3PP5A

High-resolution structure of the trimeric scar/wave complex precursor brk1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
63
structure length
63
Chain Sequence
TKTNIQKDWEQREFIEDMSINIQKIVEFLNKFELSTRNKLSDLNEKLTILDRQVDYLEATFKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Brk1
publication title High-resolution X-ray structure of the trimeric Scar/WAVE-complex precursor Brk1.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Structural protein
total genus 31
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2010-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3pp5A01
2M8RA 4WY4A 5CCGA 2N1TD 3B5NC 5CCHC 1SFCD 1GL2B 3B5NB 2N1TC 1GL2A 3KYQA 3B5NA 5CCHA 1URQB 1N7SD 3RK2D 4N78E 4W80A 2KOGA 4W7YA 1HVVA 1URQA 1XTGB 3HD7D 5KJ7D 2PP6A 3RL0D 2H8PD 1KILD 2N1TB 3P8CE 1SFCC 3HD7C 4WY4D 3PP5A 5CCGD 1SFCB 3M0DC 3HD7B 2WZ7A 1L4AD 2N1TA 3TSIA 1KILC 1SFCA 1N7SC 3HD7A 3RK2C 1KILB 1N7SB 5CCGC 3RK2B 3HTKB 2XDJA 1GL2D 2NPSD 3B5ND 4LGDE 5CCHD 2YMYA 1L4AC 1L4AB 1KILA 1T3JA 2HG5D 1N7SA 5KJ7C 3RL0C 1URQD 1JTHB 1NHLA 3RK3D 1GL2C 3RL0B 2NPSC 1L4AA 2NPSB 1JTHA 5KJ7A 4W7ZA 4WY4C 3VOPA 1URQC 2HFED 4WY4B 3RK3C 2NPSA 4JF7A 4OH8B 3RK3B
chains in the Genus database with same CATH superfamily
1SQPG 1AQTA 1BCCJ 1YITP 5AVWB 1KTMA 1G2CA 2OYIB 5AVQB 4AYCA 3WU2E 2WSCH 1SQQE 2H88C 3E7KA 1N2DC 1AQ5A 4NPEA 3AE5C 1MZ9A 5DJTB 3EQ2A 5GTIE 5KAFH 1M56D 4PD4I 3U1CA 2D2CC 3H1IG 2H8PD 4BRYB 3WMM0 3M9QA 1EDJA 2ZYGA 1VPCA 1UIXA 3TYYA 1GU4A 1VL2A 2RMZA 1R5LA 1OW6A 2N1TA 1GK4A 2R5DA 3TSIA 2JO1A 1NYHA 3MGNA 2O1KA 2ZXEB 1LTBC 4GIFA 4GOEA 2E76D 1YJ9P 2E75C 4L76A 4A7PA 2IYPA 3O8ZA 2JP3A 2A06G 3IAOA 1LWUA 2QJKC 2YO2A 3P8MC 4L74A 3RBZA 1M7LA 1JY2N 4W7ZA 5GTHH 3L70D 2B87A 3M9BA 1OX3A 4EYYQ 1Q7YQ 2IBZI 1SQVD 5AVXB 1RE3C 1LNQA 1J1EB 1EDKA 2FBWC 1SQBD 4PJ0E 5AVUB 1L0LE 4PD4H 2W83C 1KORA 3USSA 4W80A 1HF9A 2QJYB 3G3ZA 2Q1KA 3KHUA 2D2CD 1NTMG 1M1JC 2AXTH 1IK7A 5H2FH 2FXOA 5AW5B 5KJ7D 3L71G 4B86A 3N4XA 3Q1MA 1VF5B 2KSJA 2Q3IA 1LT9C 3H1JD 1KFNA 1M57D 2KSEA 3L74E 4L73A 2K9JA 2E75D 1BE3G 1NU1J 2C9NY 3L75E 1NU1K 1MFTA 3CCSP 3A0HH 4H0LC 2D2CB 1L4AB 2ZYAA 1IK9A 3II6A 2KZJA 4YXWH 1GL2C 4WB4A 3CC2P 1BCCE 4GT1A 4PD4D 1CSBA 3GW6A 1NKZB 1AVYA 2RH0A 3VOPA 1DEEG 1AJYA 4JF7A 1SQPD 3CCRP 4UB6H 3S1KA 3TK1A 4JYCA 3FX0A 1SFCD 2N9YB 2WPQA 2IPPA 1NGMB 3H1LJ 1IJDB 3C9IA 3L72G 4XE5B 1LP1A 5KTBA 3P32A 1ZRTD 2KS1B 2HODB 2ZT9B 2PP6A 3G9RA 3HE5A 1UIIA 4GODA 1M1JA 1KYOH 4I7ZB 5APUA 3V2PA 1LTJA 1S3JA 3AE3C 1IC2A 2FYUK 1SFCB 3JCUE 3HD7B 4HB1A 3OJAB 2E43A 1IFMA 4H0LD 1D7MA 1LT9A 3SFEC 1LTAC 5APYA 4UB8H 3QH9A 2XV5A 3V4QA 2KI7B 1GL2D 4LGDE 5CBNA 2A06D 1DIPA 1RE4C 3RL0C 3CWBJ 5AVTB 3CCMP 1OWAA 1PP9G 3CXHE 5L8RJ 5BU5A 3B8EB 5KKZC 3O6QB 4KJMA 2BCCG 2WWWA 3L73G 1E5WA 1JNMA 3W68A 1RF0C 4H0LB 2IBZE 5CCGA 1L0NJ 3AE8C 1KYOD 4HKZH 2HPCA 1JY2O 1GL2B 1L2PA 3V6IA 1L0NK 2A45I 2WTYA 1YTZI 4KT0J 3M9HA 3V2RA 3P7KA 5AVVB 1SS1A 4NPDA 5AVZB 3I55P 5KLVJ 2WPRA 1NTMD 4OGQC 5E79E 2Y9ZA 2QSIA 3L71D 1NU1E 1YQ4C 2HLOA 3M06A 1LJ2A 2GUVA 3TNUB 3P8CE 3F89A 3M0DC 5K5GB 2WZ7A 2Q5UA 3HE4A 1EZVG 1BE3D 3ITKA 1Q90D 2P1JA 1T8ZA 3U1AA 1U57A 2QJPC 2OQQA 1MKMA 2FXPA 3U59A 3TF5A 5CCHD 2R32A 1MUUA 3GF7A 2V7QJ 5KAIE 2LKMA 2JJLA 2CK3H 1J2JB 3PHLA 1QGKB 1KB9E 1OW7A 1X9VA 4WY4C 2KIKA 3A0BH 2YNYA 1S9KE 3E1IA 4DOJA 3H1LE 1BDDA 1PPJE 1ZMEC 2OYIC 5AW1B 1JY2P 1VQMP 1KN7A 3T97A 5AW8B 1WMKA 1EZVI 3L72D 5APVA 3FGAD 1SVFA 1Y8AA 2FYUE 1W2BO 1NH4A 2QG4A 1JUNA 2IDBA 1NTZD 1HGZA 1SQXG 2ZAEB 1VQNP 1SQBG 4Y99C 3BRVB 1KQSO 1KFMA 1GK6A 2CPBA 2O01H 3A3YB 3CX5H 3CC7P 1QEXA 1IZNB 1WT6A 4WVZA 3H1HG 2M3BA 3Q3DA 3RK3E 4DCKA 3BRTB 2W6BA 3D70A 2OTKE 1OFCX 2Y0EA 1S1CX 3H1JG 3TGUG 2WSCJ 1PP9D 1YJWP 3KXDA 3HUSB 1FZCA 1L0NE 2BCCD 3A5TA 3L73D 3QWOC 1HUCA 4GOFA 3SFDC 2QM7A 1FDMA 1S4XA 3PJSK 3Q2YA 1SQVJ 4WY4A 1J1EC 5AW6B 1SQVK 3R4YA 4M3LA 1FC2C 3CX5D 2OYIA 3E1RA 3ABVC 1SQBK 2W6JH 2BASA 1FJKA 2QJYC 2J5UA 3B71A 1KILE 3NFQA 2E42A 5TJHA 4ZNCA 4C7RA 3S9OA 2Q7CA 1QVGO 3MHVA 1VF5C 4IFFA 2WT7B 1JB0J 4YPCA 4DZOA 1VQ5P 4BRYA 1EZVD 4U3FJ 1BSNA 2FXMA 1N73C 5KLIB 2YKPA 4ZMDA 3H25A 3HTKB 4D6TG 3VMAA 1IFDA 4Y99B 2UWJE 1L4AC 1LT1A 1P84E 1TU3F 5KJ7C 2W6AA 4C7NB 3CCJP 1GZLA 2KXPB 1CZQA 3NMDA 4EOTA 3VP8A 3MUDC 5AW2B 1H0TB 2M5AA 1USDA 1SQPK 3CPWO 1JO5A 3F5HA 2M5AB 3JC22 1BGYJ 2IFMA 1YIJP 1IFJA 3VN0A 2AEJA 3L35A 2KOGA 1VF5D 3CMAP 1G1IA 1SQXD 2ZT9C 2W27A 1S5LH 1HBWA 3H1IJ 4I7ZC 1N7LA 4L75A 5DJUB 2ZJSE 4C46A 1HJBA 2BEQD 4EIJA 1SFCC 3HD7C 2GA1A 3SSUA 1Q86Q 3H1HD 3PLNA 1L4AD 3A7OA 1N8RQ 2JDIH 2R3CA 1YI2P 1KD1Q 3AE6C 1FBMA 2KYVA 1RF1C 1M8OB 1NO4A 3TGUD 5KAFE 2B9BA 1FZAA 1L4AA 3H1KG 3UIAA 1SQVE 2NPSB 2WSEH 2P7JA 1N73B 5KJ7A 1VQKP 1KYOI 2IX7C 3V2QA 3NXSA 3PRJA 1NTKG 1U7MA 1JM0A 3MUDA 2L5GB 5AW3B 3WUUA 2W8ZA 2MJZA 3CC4P 3AE7C 1KQLA 2K1AA 3I56P 3MZWB 2O1JA 4H44D 2ZT9D 1N7SD 1VQ9P 3IF4A 1RQUA 1PL5A 3GHGB 1XTGB 5GTHE 3L71J 1NTMK 2KNCB 1OVRA 3HD7D 2QIWA 4U3FE 2OARA 1ZP0C 2PFXA 1CI6B 1R5SA 2KS1A 1JCDA 2HODA 1RE3A 2I1JA 2FY8A 2O01N 2IZ0A 4EDFA 1LGHB 3CCEP 1BE3J 3LW5H 3CWBG 4H44B 1NTZG 1LTIC 2Z4EA 4PD4E 1HGVA 1SFCA 3HD7A 2BEZF 4R4LA 1N7SB 4D6TD 5CMZA 1ZV8A 2FYUJ 2K3RA 3BCCG 3GF3A 2AXTE 1EXJA 5CHXA 2L91A 5H2FE 1SQPE 3IR9A 2Y0DA 1IFPA 1XTCC 2AEFA 1FZFA 3LIDA 3CCUP 3KQGA 3I5CA 5AVYB 4IL6X 2WVRA 2QA4P 1Q2NA 1URQC 2HFED 1U7JA 1BGYE 1OMIA 1X79B 3O6QA 3IN6A 1RF1B 1BSHA 3G6EP 3MIWA 5KLVG 5CCHC 4XFJA 3KZIH 1ZRTE 3A0HE 1KQGB 2OGUA 1KB9H 1GL2A 3VMZA 4AQRD 5C39A 3H1IE 3Q5SA 3FXDA 1DD3A 2NZ2A 3D6ZA 1NTZK 2ZXXA 1SQQG 4UB6E 3P8CD 4N78D 1QLED 1VQ4P 1QVFO 2Z5IA 2A06E 3TNUA 3L4FA 5B66E 3CD6P 5BU8B 4ZKPA 4ASWA 2WSSH 1NVOA 2R44A 2VRSA 1IFNA 3B5ND 5B5EH 3RBXA 1ZW0A 5CJ0A 1VQPP 1DH3A 2H7HA 1NKNA 1PP9J 1VQ8P 1URQD 1KB9D 2G8YA 3H1KD 4O9BA 3AE9C 1PFIA 3HUSC 2LR2A 1KYOE 2H89C 3EWKA 4IOIH 2P67A 3L73J 2JR8A 3GLMA 5AW9B 3TDKA 4NPFX 3CX5I 1NTKD 1ZR2A 1VQ6P 1K8AQ 3FXEA 2I1KA 2O3JA 4UB8E 1NTME 1LTTC 2O01J 5TISH 2ZVOB 3B5NB 3G71P 1AVOA 3L71E 1RE4A 1MFZA 3PH0A 1PGOA 5CCHA 1URQB 4HJGH 2V4HA 3AEFC 1HTLC 2IZ1A 2KUBA 3C1LA 1QL2A 2K37A 2Q9IA 1BE3E 2YIUC 1L0LG 1RF0A 4RKUJ 2KZIA 4TLFA 1K73Q 3CCLP 2C0XA 1VQ7P 5KLIC 3CWBD 4N3YB 3KDPB 2W90A 1G1JA 1M1KQ 4I6MC 4KHXA 2PGDA 1OIPA 3WU2H 3BCCD 2YMYA 3RL0g 1H89A 4QMAA 1T3JA 1CW5A 1H88A 3L74G 2WSFH 3RGUA 1JTHB 1Y47A 1NHLA 2FYZA 3BASA 4HYTB 3WUTA 1KV4A 3L75G 5AW7B 3VP9A 5GTIH 3M0DA 3V4WA 2J59M 3BVHA 3HUSA 3RK3B 1P84H 2J58A 5KLVD 1BCCG 1KQFB 1PIXA 3L70J 5AW0B 2N1TC 1W2EA 2YKQA 3RK2D 4H13C 1SQXJ 4RO0A 1S5LX 1X22A 2IFNA 2P2UA 3MTUE 2C9LY 1SQBJ 3MP7B 4DJGA 1SQXK 1VQLP 3A0BE 1T2KD 1SQQD 4IL6E 1X0TA 2KB7P 1E79H 2AEMA 1R8EA 2WT7A 3CCQP 3A2AA 5AW4B 1GU5A 3AE2C 1YYCA 1N86A 3D71A 1PP9E 4ZKUA 1Q82Q 4LC1A 1KILB 1LTGC 1OXZA 2YIUB 3RK2B 3VTPC 1USEA 1P84D 1BDCA 2BCCE 3H1JJ 1EQ7A 4PJ0H 3L73E 4YTPC 2FFDB 3HTKA 3H32B 2FYNC 2NPSC 3AEBC 3L37A 4C7NA 3H6PA 3CX5E 1BGYG 3WUVA 1G2CB 3GMAA 4TT3H 4RESB 1ZXGA 1PGPA 2M8RA 1H0TA 3M91A 3V2NA 1DX7A 2N1TD 3SWYA 2P10A 1Q81Q 4U7JA 4H13D 3SWKA 2OYOA 2C0WA 1EDIA 1NOHA 1SQPJ 1NWQA 1RHZB 2IBZG 4CPGA 2ITAA 1PZQA 3GHGC 3V5BA 1HWTC 3FWNA 1Z56A 1S2EA 2QVAA 1KC8Q 4IFDK 1EZVE 1L0LD 2GM4A 1FDOA 4Z1MH 1J1DB 2JEEA 1VDFA 2WSEJ 1FS0E 3S4RA 2ZVNB 2N1TB 3KPEA 2WQYC 2OTLP 1RH5B 2JKVA 4H13B 3W67A 4H44C 1IFIA 5APTA 3NTNA 2YXRB 1FE6A 3CXHI 4D6TJ 1AV1A 1N7SC 1NU1G 2Y0CA 3AE1C 2FKWB 2KLVA 2NPSD 1LWUB 4WWIA 3L74D 2POHA 1T6AA 5APXA 2B87B 2E76B 3L75D 2NPSA 1ZLLA 1N73A 2IYOA 3L70E 2YXQB 3D6YA 1BCCD 1NAFA 2FYNB 1JY3N 1LTJC 1FZGA 3L36A 1SQXE 3JCUH 2XNDH 4PV1C 3LW5J 1SQBE 3OA7A 4I2LC 3H1LG 1RQVA 1PPJG 2LXCB 1OW8A 1HVVA 1MV8A 2E74C 4Y28J 4U3FD 3H1HE 1FJPA 4IFMA 2HYNA 3GHGA 2ZFCA 2YKOA 3CXHH 2B89A 5APQA 4OWFA 2KNCA 1GW4A 2K9JB 2FYUG 2M0BA 1CI6A 3H1JE 4K35A 1NTMJ 3TGUE 2Y9YA 1WRGA 3CCVP 1ZOYC 3Q5RA 2NRGA 1W5CE 1KB9I 2JWAA 2Q6QA 2DW3A 5CCGC 3HRNA 2JWDA 4BXLA 1VQOP 4AUWA 2E75B 1N7SA 3H1KJ 1S5LE 1AFOA 1AA0A 2K88A 1OVVA 1YJNP 2QJKB 1GDTA 5CJ4A 1JEKA 5BVZA 2Z5HA 5E79H 5B66H 1BGYD 1NTKJ 2B88A 3FWLA 2QE7H 1GD2E 3VMXA 2N9BA 4PV1D 1NTKK 2XZRA 2OTJP 3CXHD 1A02F 3B5NC 1EC5A 1RF1A 3AEAC 1L0NG 2KLUA 3PTZA 1LP1B 2E5YA 1OVUA 3H1ID 1GW3A 2E74D 4I1LA 3K5BA 1K9MQ 2IBZD 2QRXA 1X8YA 5APWA 1ZN5A 2WMMA 1EXIA 1S72P 4W7YA 1FU1A 3HE5B 2R5BA 5KAIH 2R3SA 1M1JB 2A45G 1K04A 1LTJB 3CL3D 1FOSE 4R4MA 4GKGA 3L72J 1HH0A 4PV1B 2AXCA 4DT0A 4D6TE 2MKVA 2QM8A 1LT9B 2G3AA 2XKMA 3SWFA 5CCGD 1RY3A 1NTZJ 1LTSC 3BATA 3N7NA 2WPVB 1FAVA 4GDOA 2E74B 1NU1D 3AEDC 3OW2O 3BCCJ 3CLQA 2XDJA 1ZR4A 4N6JA 4ASVA 4XA4A 4WBAA 1T3UA 1FDIA 3B4SA 2PRRA 4EI2A 2ZYDA 4HH2A 1PGQA 2OYHC 2KP8A 2SPZA 4JQ0D 4K3AA 1HJ0A 3RK3C 5M1BA 2HPCB 2E5TA 1PV3A 3C8VA 3EFFK 2XNXA 5KLVK 1FOSF 2BCCJ 4YXDC 1QX8A 1JOCA 1S9KD 3H1LD 2KK7A 5EFWB 3KYQA 3B5NA 1FZEA 1PPJD 2WITA 4RJTA 4MN4C 4N78E 1EDLA 2Q3EA 1GMJA 1JY3O 2WPSA 1URQA 3M0AA 3LIEA 1SQQJ 2WSFJ 1YQ3C 3RL0D 1JMMA 4JPZB 1SQQK 3HE4B 2FYUD 1FZCC 1P84I 1FZBA 3PP5A 3KZIE 1NAYA 3H1KE 1KILC 2LXBA 2M3EA 3RK2C 2GUSA 3JSVC 2I8DA 2P58A 2A45H 2FFDC 5APSA 4IL6H 3CI9A 3IFMA 4JBZA 1NTKE 1Y9BA 3G4SP 1DEBA 1T2KC 3RK3D 3RL0B 1PGJA 3Q5PA 1K05A 1JTHA 4OGQD 5KKZB 3L70G 3T97B 2YMKA 1KMIZ 2RKLA 2OYHA 3MD0A 1SQVG 1SLQA 1L0ND 4LLHA 2V7QH 5B5EE 1YHQP 1JCCA 5AVRB 4JYBA 2K9YA 5AVSB 2OYHB 1JY3P 3L72E 3CMEP 3OAKA 5CBOA 1L0LJ 4OGQB 1DD4A 2RN0A 3CWBE 2QEXP 1NTZE 3VMYA 1GTWA 1J1DC 1IO4A 3AECC 1L0LK 2CPSA 1SP4A 1KILD 3BCCE 3EFGA 1M90Q 4WY4D 1H8AA 3AEEC 5TISE 2H43A 3AE4C 3ZDMA 3GG2A 2YO3A 4U3FG 1YBKA 3AEGC 1NJIQ 1OZHA 4BWNA 4OVNF 1JMBA 1KZUB 2QJPB 1LWUC 2PAJA 3VYIA 1YTZT 2HR3A 3L74J 1KILA 2HG5D 1A02J 3H1HJ 1FZCB 3L75J 2E76C 3R2PA 2FFDA 5KLVE 3H32A 2XU6A 1QL1A 4WY4B 3TGUJ 4OH8B
chains in the Genus database with same CATH topology
1X79B 1RF1B 2OYIC 5AW1B 1JY2P 5AVWB 1G2CA 2OYIB 1NAFA 3MIWA 5AVQB 3T97A 1JY3N 1LTJC 4AYCA 5AW8B 1FZGA 5CCHC 3L36A 2WSCH 3OA7A 4I2LC 5APVA 1GL2A 3VMZA 4AQRD 1N2DC 1AQ5A 1SVFA 1NH4A 1JUNA 1HVVA 1MZ9A 1MV8A 3EQ2A 1HGZA 1FJPA 1NTZK 4IFMA 2HYNA 3GHGA 2ZFCA 2YKOA 4Y99C 3BRVB 5APQA 3U1CA 3P8CD 4N78D 2H8PD 1KFMA 3WMM0 1GW4A 3M9QA 1VPCA 1GK6A 2CPBA 2O01H 3A3YB 1CI6A 3TYYA 2Z5IA 1WT6A 1GU4A 1WRGA 2M3BA 2N1TA 2R5DA 1GK4A 3L4FA 3TNUA 3TSIA 5BU8B 3BRTB 3MGNA 4ZKPA 2O1KA 2W6BA 2ZXEB 2VRSA 5CCGC 3HRNA 1IFNA 1LTBC 4GIFA 3B5ND 5CJ0A 4AUWA 3O8ZA 1N7SA 1DH3A 2H7HA 1NKNA 1LWUA 1URQD 1AFOA 4O9BA 2YO2A 3P8MC 1PFIA 3HUSC 1GDTA 5CJ4A 1M7LA 5BVZA 3HUSB 1JY2N 1FZCA 2Z5HA 2P67A 4W7ZA 5AW9B 3A5TA 3M9BA 1HUCA 1GD2E 2QM7A 3VMXA 2N9BA 1FDMA 1ZR2A 1NTKK 2XZRA 4WY4A 2I1KA 1J1EC 1A02F 5AVXB 1RE3C 1J1EB 3B5NC 5AW6B 1LTTC 1RF1A 1SQVK 3B5NB 4M3LA 5AVUB 2OYIA 1RE4A 1SQBK 1MFZA 1GW3A 4I1LA 2BASA 1FJKA 5CCHA 1URQB 1X8YA 5APWA 4W80A 1ZN5A 1HTLC 3NFQA 3G3ZA 4W7YA 2E42A 1FU1A 3HE5B 1M1JC 4C7RA 2R5BA 1QL2A 1M1JB 2Q9IA 5AW5B 2A45G 5KJ7D 2Q7CA 1LTJB 3CL3D 1RF0A 1FOSE 4B86A 4GKGA 4IFFA 3N4XA 2WT7B 1HH0A 2KSJA 2Q3IA 1LT9C 1KFNA 2QM8A 1LT9B 4DZOA 2C0XA 2XKMA 3SWFA 5CCGD 1RY3A 1LTSC 3BATA 3N7NA 2FXMA 1N73C 4N3YB 2YKPA 3KDPB 1FAVA 2C9NY 1G1JA 4I6MC 4KHXA 3HTKB 2XDJA 3CLQA 1ZR4A 1NU1K 1IFDA 4Y99B 2YMYA 1H89A 1L4AC 4N6JA 1L4AB 1T3JA 1IK9A 1CW5A 4XA4A 1H88A 4WBAA 1T3UA 3II6A 2WSFH 5KJ7C 2W6AA 4C7NB 1JTHB 1NHLA 1GZLA 1GL2C 4WB4A 4HH2A 4GT1A 1CSBA 1CZQA 3NMDA 2FYZA 1NKZB 3BASA 4EOTA 4HYTB 5AW7B 3VP8A 5AW2B 3VP9A 2OYHC 3M0DA 3VOPA 2KP8A 3V4WA 2J59M 3BVHA 3RK3C 4JF7A 3HUSA 3RK3B 2HPCB 3TK1A 1SQPK 4JYCA 1JO5A 2J58A 2XNXA 1SFCD 5KLVK 1FOSF 2WPQA 2IPPA 1JOCA 5AW0B 1IJDB 2IFMA 1S9KD 3C9IA 2N1TC 1IFJA 3KYQA 3B5NA 1FZEA 1W2EA 3VN0A 4XE5B 2WITA 2YKQA 3RK2D 4N78E 3L35A 2KOGA 5KTBA 2IFNA 1JY3O 1G1IA 2P2UA 2WPSA 1URQA 3MTUE 3P32A 2C9LY 3M0AA 3LIEA 2HODB 2W27A 1HBWA 1SQXK 2PP6A 3RL0D 1T2KD 3HE5A 1N7LA 2KB7P 1JMMA 1M1JA 5APUA 1SQQK 3V2PA 3HE4B 1LTJA 4C46A 1HJBA 4EIJA 1FZCC 1IC2A 1SFCC 3HD7C 2WT7A 1FZBA 3PP5A 3A2AA 2FYUK 1SFCB 5AW4B 3HD7B 1GU5A 1YYCA 1N86A 3OJAB 2E43A 1IFMA 1L4AD 1LT9A 4ZKUA 1LTAC 3A7OA 4LC1A 5APYA 1KILC 2R3CA 2XV5A 3RK2C 2GUSA 3V4QA 1KILB 1LTGC 1OXZA 3RK2B 3VTPC 1FBMA 1GL2D 2KYVA 4LGDE 1EQ7A 2A45H 2FFDC 5APSA 1RF1C 3CI9A 2FFDB 3IFMA 1NO4A 3HTKA 3H32B 1DEBA 1RE4C 3RL0C 1T2KC 5AVTB 3RK3D 1OWAA 1FZAA 2NPSC 3RL0B 1L4AA 3UIAA 2NPSB 5BU5A 2WSEH 2P7JA 3B8EB 3L37A 1N73B 4C7NA 1JTHA 5KJ7A 3H6PA 2WWWA 1G2CB 2IX7C 1E5WA 3V2QA 1JNMA 3NXSA 4RESB 1RF0C 2M8RA 3MUDA 2L5GB 3M91A 3V2NA 2OYHA 5CCGA 1DX7A 5AW3B 2N1TD 3MD0A 2MJZA 3SWYA 2HPCA 1SLQA 1JY2O 1GL2B 4LLHA 1KQLA 2C0WA 1L0NK 1JCCA 1NOHA 5AVRB 2A45I 2O1JA 4JYBA 2WTYA 1YTZI 5AVSB 1NWQA 3M9HA 2OYHB 1JY3P 1N7SD 3V2RA 3P7KA 5AVVB 3V5BA 3GHGC 5AVZB 1HWTC 3OAKA 1Z56A 2WPRA 3GHGB 1XTGB 4IFDK 1NTMK 2GM4A 3HD7D 3VMYA 1GTWA 1J1DC 1IO4A 2OARA 1J1DB 1CI6B 1L0LK 2HLOA 2JEEA 3M06A 1JCDA 2CPSA 2GUVA 2HODA 1RE3A 1VDFA 2I1JA 1SP4A 1KILD 2N1TB 3EFGA 3P8CE 3TNUB 4WY4D 1H8AA 3KPEA 1LGHB 3M0DC 2WZ7A 3LW5H 2Q5UA 2H43A 3HE4A 1IFIA 5APTA 3NTNA 2YO3A 2P1JA 1T8ZA 1LTIC 3U1AA 2Z4EA 1HGVA 1N7SC 1SFCA 3HD7A 1KZUB 3U59A 1N7SB 1LWUC 2FKWB 2PAJA 3VYIA 2KLVA 2NPSD 2R32A 5CMZA 1ZV8A 1LWUB 5CCHD 1YTZT 1MUUA 1KILA 2HG5D 2LKMA 2POHA 5CHXA 1A02J 2JJLA 1FZCB 3IR9A 1N73A 1J2JB 1XTCC 3R2PA 2FFDA 5APXA 1FZFA 3LIDA 3H32A 2XU6A 3KQGA 3I5CA 5AVYB 1QL1A 1X9VA 4WY4C 1URQC 2HFED 4WY4B 2NPSA 1ZLLA 2YNYA 1S9KE 3E1IA 4DOJA 4OH8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8R A;  4WY4 A;  5CCG A;  2N1T D;  3B5N C;  5CCH C;  1SFC D;  1GL2 B;  3B5N B;  2N1T C;  1GL2 A;  3KYQ A;  3B5N A;  5CCH A;  1URQ B;  1N7S D;  3RK2 D;  4N78 E;  4W80 A;  2KOG A;  4W7Y A;  1HVV A;  1URQ A;  1XTG B;  3HD7 D;  5KJ7 D;  2PP6 A;  3RL0 D;  2H8P D;  1KIL D;  2N1T B;  3P8C E;  1SFC C;  3HD7 C;  4WY4 D;  3PP5 A;  5CCG D;  1SFC B;  3M0D C;  3HD7 B;  2WZ7 A;  1L4A D;  2N1T A;  3TSI A;  1KIL C;  1SFC A;  1N7S C;  3HD7 A;  3RK2 C;  1KIL B;  1N7S B;  5CCG C;  3RK2 B;  3HTK B;  2XDJ A;  1GL2 D;  2NPS D;  3B5N D;  4LGD E;  5CCH D;  2YMY A;  1L4A C;  1L4A B;  1KIL A;  1T3J A;  2HG5 D;  1N7S A;  5KJ7 C;  3RL0 C;  1URQ D;  1JTH B;  1NHL A;  3RK3 D;  1GL2 C;  3RL0 B;  2NPS C;  1L4A A;  2NPS B;  1JTH A;  5KJ7 A;  4W7Z A;  4WY4 C;  3VOP A;  1URQ C;  2HFE D;  4WY4 B;  3RK3 C;  2NPS A;  4JF7 A;  4OH8 B;  3RK3 B; 
#chains in the Genus database with same CATH topology
 1SQP G;  1AQT A;  1BCC J;  1YIT P;  5AVW B;  1KTM A;  1G2C A;  2OYI B;  5AVQ B;  4AYC A;  3WU2 E;  2WSC H;  1SQQ E;  2H88 C;  3E7K A;  1N2D C;  1AQ5 A;  4NPE A;  3AE5 C;  1MZ9 A;  5DJT B;  3EQ2 A;  5GTI E;  5KAF H;  1M56 D;  4PD4 I;  3U1C A;  2D2C C;  3H1I G;  2H8P D;  4BRY B;  3WMM 0;  3M9Q A;  1EDJ A;  2ZYG A;  1VPC A;  1UIX A;  3TYY A;  1GU4 A;  1VL2 A;  2RMZ A;  1R5L A;  1OW6 A;  2N1T A;  1GK4 A;  2R5D A;  3TSI A;  2JO1 A;  1NYH A;  3MGN A;  2O1K A;  2ZXE B;  1LTB C;  4GIF A;  4GOE A;  2E76 D;  1YJ9 P;  2E75 C;  4L76 A;  4A7P A;  2IYP A;  3O8Z A;  2JP3 A;  2A06 G;  3IAO A;  1LWU A;  2QJK C;  2YO2 A;  3P8M C;  4L74 A;  3RBZ A;  1M7L A;  1JY2 N;  4W7Z A;  5GTH H;  3L70 D;  2B87 A;  3M9B A;  1OX3 A;  4EYY Q;  1Q7Y Q;  2IBZ I;  1SQV D;  5AVX B;  1RE3 C;  1LNQ A;  1J1E B;  1EDK A;  2FBW C;  1SQB D;  4PJ0 E;  5AVU B;  1L0L E;  4PD4 H;  2W83 C;  1KOR A;  3USS A;  4W80 A;  1HF9 A;  2QJY B;  3G3Z A;  2Q1K A;  3KHU A;  2D2C D;  1NTM G;  1M1J C;  2AXT H;  1IK7 A;  5H2F H;  2FXO A;  5AW5 B;  5KJ7 D;  3L71 G;  4B86 A;  3N4X A;  3Q1M A;  1VF5 B;  2KSJ A;  2Q3I A;  1LT9 C;  3H1J D;  1KFN A;  1M57 D;  2KSE A;  3L74 E;  4L73 A;  2K9J A;  2E75 D;  1BE3 G;  1NU1 J;  2C9N Y;  3L75 E;  1NU1 K;  1MFT A;  3CCS P;  3A0H H;  4H0L C;  2D2C B;  1L4A B;  2ZYA A;  1IK9 A;  3II6 A;  2KZJ A;  4YXW H;  1GL2 C;  4WB4 A;  3CC2 P;  1BCC E;  4GT1 A;  4PD4 D;  1CSB A;  3GW6 A;  1NKZ B;  1AVY A;  2RH0 A;  3VOP A;  1DEE G;  1AJY A;  4JF7 A;  1SQP D;  3CCR P;  4UB6 H;  3S1K A;  3TK1 A;  4JYC A;  3FX0 A;  1SFC D;  2N9Y B;  2WPQ A;  2IPP A;  1NGM B;  3H1L J;  1IJD B;  3C9I A;  3L72 G;  4XE5 B;  1LP1 A;  5KTB A;  3P32 A;  1ZRT D;  2KS1 B;  2HOD B;  2ZT9 B;  2PP6 A;  3G9R A;  3HE5 A;  1UII A;  4GOD A;  1M1J A;  1KYO H;  4I7Z B;  5APU A;  3V2P A;  1LTJ A;  1S3J A;  3AE3 C;  1IC2 A;  2FYU K;  1SFC B;  3JCU E;  3HD7 B;  4HB1 A;  3OJA B;  2E43 A;  1IFM A;  4H0L D;  1D7M A;  1LT9 A;  3SFE C;  1LTA C;  5APY A;  4UB8 H;  3QH9 A;  2XV5 A;  3V4Q A;  2KI7 B;  1GL2 D;  4LGD E;  5CBN A;  2A06 D;  1DIP A;  1RE4 C;  3RL0 C;  3CWB J;  5AVT B;  3CCM P;  1OWA A;  1PP9 G;  3CXH E;  5L8R J;  5BU5 A;  3B8E B;  5KKZ C;  3O6Q B;  4KJM A;  2BCC G;  2WWW A;  3L73 G;  1E5W A;  1JNM A;  3W68 A;  1RF0 C;  4H0L B;  2IBZ E;  5CCG A;  1L0N J;  3AE8 C;  1KYO D;  4HKZ H;  2HPC A;  1JY2 O;  1GL2 B;  1L2P A;  3V6I A;  1L0N K;  2A45 I;  2WTY A;  1YTZ I;  4KT0 J;  3M9H A;  3V2R A;  3P7K A;  5AVV B;  1SS1 A;  4NPD A;  5AVZ B;  3I55 P;  5KLV J;  2WPR A;  1NTM D;  4OGQ C;  5E79 E;  2Y9Z A;  2QSI A;  3L71 D;  1NU1 E;  1YQ4 C;  2HLO A;  3M06 A;  1LJ2 A;  2GUV A;  3TNU B;  3P8C E;  3F89 A;  3M0D C;  5K5G B;  2WZ7 A;  2Q5U A;  3HE4 A;  1EZV G;  1BE3 D;  3ITK A;  1Q90 D;  2P1J A;  1T8Z A;  3U1A A;  1U57 A;  2QJP C;  2OQQ A;  1MKM A;  2FXP A;  3U59 A;  3TF5 A;  5CCH D;  2R32 A;  1MUU A;  3GF7 A;  2V7Q J;  5KAI E;  2LKM A;  2JJL A;  2CK3 H;  1J2J B;  3PHL A;  1QGK B;  1KB9 E;  1OW7 A;  1X9V A;  4WY4 C;  2KIK A;  3A0B H;  2YNY A;  1S9K E;  3E1I A;  4DOJ A;  3H1L E;  1BDD A;  1PPJ E;  1ZME C;  2OYI C;  5AW1 B;  1JY2 P;  1VQM P;  1KN7 A;  3T97 A;  5AW8 B;  1WMK A;  1EZV I;  3L72 D;  5APV A;  3FGA D;  1SVF A;  1Y8A A;  2FYU E;  1W2B O;  1NH4 A;  2QG4 A;  1JUN A;  2IDB A;  1NTZ D;  1HGZ A;  1SQX G;  2ZAE B;  1VQN P;  1SQB G;  4Y99 C;  3BRV B;  1KQS O;  1KFM A;  1GK6 A;  2CPB A;  2O01 H;  3A3Y B;  3CX5 H;  3CC7 P;  1QEX A;  1IZN B;  1WT6 A;  4WVZ A;  3H1H G;  2M3B A;  3Q3D A;  3RK3 E;  4DCK A;  3BRT B;  2W6B A;  3D70 A;  2OTK E;  1OFC X;  2Y0E A;  1S1C X;  3H1J G;  3TGU G;  2WSC J;  1PP9 D;  1YJW P;  3KXD A;  3HUS B;  1FZC A;  1L0N E;  2BCC D;  3A5T A;  3L73 D;  3QWO C;  1HUC A;  4GOF A;  3SFD C;  2QM7 A;  1FDM A;  1S4X A;  3PJS K;  3Q2Y A;  1SQV J;  4WY4 A;  1J1E C;  5AW6 B;  1SQV K;  3R4Y A;  4M3L A;  1FC2 C;  3CX5 D;  2OYI A;  3E1R A;  3ABV C;  1SQB K;  2W6J H;  2BAS A;  1FJK A;  2QJY C;  2J5U A;  3B71 A;  1KIL E;  3NFQ A;  2E42 A;  5TJH A;  4ZNC A;  4C7R A;  3S9O A;  2Q7C A;  1QVG O;  3MHV A;  1VF5 C;  4IFF A;  2WT7 B;  1JB0 J;  4YPC A;  4DZO A;  1VQ5 P;  4BRY A;  1EZV D;  4U3F J;  1BSN A;  2FXM A;  1N73 C;  5KLI B;  2YKP A;  4ZMD A;  3H25 A;  3HTK B;  4D6T G;  3VMA A;  1IFD A;  4Y99 B;  2UWJ E;  1L4A C;  1LT1 A;  1P84 E;  1TU3 F;  5KJ7 C;  2W6A A;  4C7N B;  3CCJ P;  1GZL A;  2KXP B;  1CZQ A;  3NMD A;  4EOT A;  3VP8 A;  3MUD C;  5AW2 B;  1H0T B;  2M5A A;  1USD A;  1SQP K;  3CPW O;  1JO5 A;  3F5H A;  2M5A B;  3JC2 2;  1BGY J;  2IFM A;  1YIJ P;  1IFJ A;  3VN0 A;  2AEJ A;  3L35 A;  2KOG A;  1VF5 D;  3CMA P;  1G1I A;  1SQX D;  2ZT9 C;  2W27 A;  1S5L H;  1HBW A;  3H1I J;  4I7Z C;  1N7L A;  4L75 A;  5DJU B;  2ZJS E;  4C46 A;  1HJB A;  2BEQ D;  4EIJ A;  1SFC C;  3HD7 C;  2GA1 A;  3SSU A;  1Q86 Q;  3H1H D;  3PLN A;  1L4A D;  3A7O A;  1N8R Q;  2JDI H;  2R3C A;  1YI2 P;  1KD1 Q;  3AE6 C;  1FBM A;  2KYV A;  1RF1 C;  1M8O B;  1NO4 A;  3TGU D;  5KAF E;  2B9B A;  1FZA A;  1L4A A;  3H1K G;  3UIA A;  1SQV E;  2NPS B;  2WSE H;  2P7J A;  1N73 B;  5KJ7 A;  1VQK P;  1KYO I;  2IX7 C;  3V2Q A;  3NXS A;  3PRJ A;  1NTK G;  1U7M A;  1JM0 A;  3MUD A;  2L5G B;  5AW3 B;  3WUU A;  2W8Z A;  2MJZ A;  3CC4 P;  3AE7 C;  1KQL A;  2K1A A;  3I56 P;  3MZW B;  2O1J A;  4H44 D;  2ZT9 D;  1N7S D;  1VQ9 P;  3IF4 A;  1RQU A;  1PL5 A;  3GHG B;  1XTG B;  5GTH E;  3L71 J;  1NTM K;  2KNC B;  1OVR A;  3HD7 D;  2QIW A;  4U3F E;  2OAR A;  1ZP0 C;  2PFX A;  1CI6 B;  1R5S A;  2KS1 A;  1JCD A;  2HOD A;  1RE3 A;  2I1J A;  2FY8 A;  2O01 N;  2IZ0 A;  4EDF A;  1LGH B;  3CCE P;  1BE3 J;  3LW5 H;  3CWB G;  4H44 B;  1NTZ G;  1LTI C;  2Z4E A;  4PD4 E;  1HGV A;  1SFC A;  3HD7 A;  2BEZ F;  4R4L A;  1N7S B;  4D6T D;  5CMZ A;  1ZV8 A;  2FYU J;  2K3R A;  3BCC G;  3GF3 A;  2AXT E;  1EXJ A;  5CHX A;  2L91 A;  5H2F E;  1SQP E;  3IR9 A;  2Y0D A;  1IFP A;  1XTC C;  2AEF A;  1FZF A;  3LID A;  3CCU P;  3KQG A;  3I5C A;  5AVY B;  4IL6 X;  2WVR A;  2QA4 P;  1Q2N A;  1URQ C;  2HFE D;  1U7J A;  1BGY E;  1OMI A;  1X79 B;  3O6Q A;  3IN6 A;  1RF1 B;  1BSH A;  3G6E P;  3MIW A;  5KLV G;  5CCH C;  4XFJ A;  3KZI H;  1ZRT E;  3A0H E;  1KQG B;  2OGU A;  1KB9 H;  1GL2 A;  3VMZ A;  4AQR D;  5C39 A;  3H1I E;  3Q5S A;  3FXD A;  1DD3 A;  2NZ2 A;  3D6Z A;  1NTZ K;  2ZXX A;  1SQQ G;  4UB6 E;  3P8C D;  4N78 D;  1QLE D;  1VQ4 P;  1QVF O;  2Z5I A;  2A06 E;  3TNU A;  3L4F A;  5B66 E;  3CD6 P;  5BU8 B;  4ZKP A;  4ASW A;  2WSS H;  1NVO A;  2R44 A;  2VRS A;  1IFN A;  3B5N D;  5B5E H;  3RBX A;  1ZW0 A;  5CJ0 A;  1VQP P;  1DH3 A;  2H7H A;  1NKN A;  1PP9 J;  1VQ8 P;  1URQ D;  1KB9 D;  2G8Y A;  3H1K D;  4O9B A;  3AE9 C;  1PFI A;  3HUS C;  2LR2 A;  1KYO E;  2H89 C;  3EWK A;  4IOI H;  2P67 A;  3L73 J;  2JR8 A;  3GLM A;  5AW9 B;  3TDK A;  4NPF X;  3CX5 I;  1NTK D;  1ZR2 A;  1VQ6 P;  1K8A Q;  3FXE A;  2I1K A;  2O3J A;  4UB8 E;  1NTM E;  1LTT C;  2O01 J;  5TIS H;  2ZVO B;  3B5N B;  3G71 P;  1AVO A;  3L71 E;  1RE4 A;  1MFZ A;  3PH0 A;  1PGO A;  5CCH A;  1URQ B;  4HJG H;  2V4H A;  3AEF C;  1HTL C;  2IZ1 A;  2KUB A;  3C1L A;  1QL2 A;  2K37 A;  2Q9I A;  1BE3 E;  2YIU C;  1L0L G;  1RF0 A;  4RKU J;  2KZI A;  4TLF A;  1K73 Q;  3CCL P;  2C0X A;  1VQ7 P;  5KLI C;  3CWB D;  4N3Y B;  3KDP B;  2W90 A;  1G1J A;  1M1K Q;  4I6M C;  4KHX A;  2PGD A;  1OIP A;  3WU2 H;  3BCC D;  2YMY A;  3RL0 g;  1H89 A;  4QMA A;  1T3J A;  1CW5 A;  1H88 A;  3L74 G;  2WSF H;  3RGU A;  1JTH B;  1Y47 A;  1NHL A;  2FYZ A;  3BAS A;  4HYT B;  3WUT A;  1KV4 A;  3L75 G;  5AW7 B;  3VP9 A;  5GTI H;  3M0D A;  3V4W A;  2J59 M;  3BVH A;  3HUS A;  3RK3 B;  1P84 H;  2J58 A;  5KLV D;  1BCC G;  1KQF B;  1PIX A;  3L70 J;  5AW0 B;  2N1T C;  1W2E A;  2YKQ A;  3RK2 D;  4H13 C;  1SQX J;  4RO0 A;  1S5L X;  1X22 A;  2IFN A;  2P2U A;  3MTU E;  2C9L Y;  1SQB J;  3MP7 B;  4DJG A;  1SQX K;  1VQL P;  3A0B E;  1T2K D;  1SQQ D;  4IL6 E;  1X0T A;  2KB7 P;  1E79 H;  2AEM A;  1R8E A;  2WT7 A;  3CCQ P;  3A2A A;  5AW4 B;  1GU5 A;  3AE2 C;  1YYC A;  1N86 A;  3D71 A;  1PP9 E;  4ZKU A;  1Q82 Q;  4LC1 A;  1KIL B;  1LTG C;  1OXZ A;  2YIU B;  3RK2 B;  3VTP C;  1USE A;  1P84 D;  1BDC A;  2BCC E;  3H1J J;  1EQ7 A;  4PJ0 H;  3L73 E;  4YTP C;  2FFD B;  3HTK A;  3H32 B;  2FYN C;  2NPS C;  3AEB C;  3L37 A;  4C7N A;  3H6P A;  3CX5 E;  1BGY G;  3WUV A;  1G2C B;  3GMA A;  4TT3 H;  4RES B;  1ZXG A;  1PGP A;  2M8R A;  1H0T A;  3M91 A;  3V2N A;  1DX7 A;  2N1T D;  3SWY A;  2P10 A;  1Q81 Q;  4U7J A;  4H13 D;  3SWK A;  2OYO A;  2C0W A;  1EDI A;  1NOH A;  1SQP J;  1NWQ A;  1RHZ B;  2IBZ G;  4CPG A;  2ITA A;  1PZQ A;  3GHG C;  3V5B A;  1HWT C;  3FWN A;  1Z56 A;  1S2E A;  2QVA A;  1KC8 Q;  4IFD K;  1EZV E;  1L0L D;  2GM4 A;  1FDO A;  4Z1M H;  1J1D B;  2JEE A;  1VDF A;  2WSE J;  1FS0 E;  3S4R A;  2ZVN B;  2N1T B;  3KPE A;  2WQY C;  2OTL P;  1RH5 B;  2JKV A;  4H13 B;  3W67 A;  4H44 C;  1IFI A;  5APT A;  3NTN A;  2YXR B;  1FE6 A;  3CXH I;  4D6T J;  1AV1 A;  1N7S C;  1NU1 G;  2Y0C A;  3AE1 C;  2FKW B;  2KLV A;  2NPS D;  1LWU B;  4WWI A;  3L74 D;  2POH A;  1T6A A;  5APX A;  2B87 B;  2E76 B;  3L75 D;  2NPS A;  1ZLL A;  1N73 A;  2IYO A;  3L70 E;  2YXQ B;  3D6Y A;  1BCC D;  1NAF A;  2FYN B;  1JY3 N;  1LTJ C;  1FZG A;  3L36 A;  1SQX E;  3JCU H;  2XND H;  4PV1 C;  3LW5 J;  1SQB E;  3OA7 A;  4I2L C;  3H1L G;  1RQV A;  1PPJ G;  2LXC B;  1OW8 A;  1HVV A;  1MV8 A;  2E74 C;  4Y28 J;  4U3F D;  3H1H E;  1FJP A;  4IFM A;  2HYN A;  3GHG A;  2ZFC A;  2YKO A;  3CXH H;  2B89 A;  5APQ A;  4OWF A;  2KNC A;  1GW4 A;  2K9J B;  2FYU G;  2M0B A;  1CI6 A;  3H1J E;  4K35 A;  1NTM J;  3TGU E;  2Y9Y A;  1WRG A;  3CCV P;  1ZOY C;  3Q5R A;  2NRG A;  1W5C E;  1KB9 I;  2JWA A;  2Q6Q A;  2DW3 A;  5CCG C;  3HRN A;  2JWD A;  4BXL A;  1VQO P;  4AUW A;  2E75 B;  1N7S A;  3H1K J;  1S5L E;  1AFO A;  1AA0 A;  2K88 A;  1OVV A;  1YJN P;  2QJK B;  1GDT A;  5CJ4 A;  1JEK A;  5BVZ A;  2Z5H A;  5E79 H;  5B66 H;  1BGY D;  1NTK J;  2B88 A;  3FWL A;  2QE7 H;  1GD2 E;  3VMX A;  2N9B A;  4PV1 D;  1NTK K;  2XZR A;  2OTJ P;  3CXH D;  1A02 F;  3B5N C;  1EC5 A;  1RF1 A;  3AEA C;  1L0N G;  2KLU A;  3PTZ A;  1LP1 B;  2E5Y A;  1OVU A;  3H1I D;  1GW3 A;  2E74 D;  4I1L A;  3K5B A;  1K9M Q;  2IBZ D;  2QRX A;  1X8Y A;  5APW A;  1ZN5 A;  2WMM A;  1EXI A;  1S72 P;  4W7Y A;  1FU1 A;  3HE5 B;  2R5B A;  5KAI H;  2R3S A;  1M1J B;  2A45 G;  1K04 A;  1LTJ B;  3CL3 D;  1FOS E;  4R4M A;  4GKG A;  3L72 J;  1HH0 A;  4PV1 B;  2AXC A;  4DT0 A;  4D6T E;  2MKV A;  2QM8 A;  1LT9 B;  2G3A A;  2XKM A;  3SWF A;  5CCG D;  1RY3 A;  1NTZ J;  1LTS C;  3BAT A;  3N7N A;  2WPV B;  1FAV A;  4GDO A;  2E74 B;  1NU1 D;  3AED C;  3OW2 O;  3BCC J;  3CLQ A;  2XDJ A;  1ZR4 A;  4N6J A;  4ASV A;  4XA4 A;  4WBA A;  1T3U A;  1FDI A;  3B4S A;  2PRR A;  4EI2 A;  2ZYD A;  4HH2 A;  1PGQ A;  2OYH C;  2KP8 A;  2SPZ A;  4JQ0 D;  4K3A A;  1HJ0 A;  3RK3 C;  5M1B A;  2HPC B;  2E5T A;  1PV3 A;  3C8V A;  3EFF K;  2XNX A;  5KLV K;  1FOS F;  2BCC J;  4YXD C;  1QX8 A;  1JOC A;  1S9K D;  3H1L D;  2KK7 A;  5EFW B;  3KYQ A;  3B5N A;  1FZE A;  1PPJ D;  2WIT A;  4RJT A;  4MN4 C;  4N78 E;  1EDL A;  2Q3E A;  1GMJ A;  1JY3 O;  2WPS A;  1URQ A;  3M0A A;  3LIE A;  1SQQ J;  2WSF J;  1YQ3 C;  3RL0 D;  1JMM A;  4JPZ B;  1SQQ K;  3HE4 B;  2FYU D;  1FZC C;  1P84 I;  1FZB A;  3PP5 A;  3KZI E;  1NAY A;  3H1K E;  1KIL C;  2LXB A;  2M3E A;  3RK2 C;  2GUS A;  3JSV C;  2I8D A;  2P58 A;  2A45 H;  2FFD C;  5APS A;  4IL6 H;  3CI9 A;  3IFM A;  4JBZ A;  1NTK E;  1Y9B A;  3G4S P;  1DEB A;  1T2K C;  3RK3 D;  3RL0 B;  1PGJ A;  3Q5P A;  1K05 A;  1JTH A;  4OGQ D;  5KKZ B;  3L70 G;  3T97 B;  2YMK A;  1KMI Z;  2RKL A;  2OYH A;  3MD0 A;  1SQV G;  1SLQ A;  1L0N D;  4LLH A;  2V7Q H;  5B5E E;  1YHQ P;  1JCC A;  5AVR B;  4JYB A;  2K9Y A;  5AVS B;  2OYH B;  1JY3 P;  3L72 E;  3CME P;  3OAK A;  5CBO A;  1L0L J;  4OGQ B;  1DD4 A;  2RN0 A;  3CWB E;  2QEX P;  1NTZ E;  3VMY A;  1GTW A;  1J1D C;  1IO4 A;  3AEC C;  1L0L K;  2CPS A;  1SP4 A;  1KIL D;  3BCC E;  3EFG A;  1M90 Q;  4WY4 D;  1H8A A;  3AEE C;  5TIS E;  2H43 A;  3AE4 C;  3ZDM A;  3GG2 A;  2YO3 A;  4U3F G;  1YBK A;  3AEG C;  1NJI Q;  1OZH A;  4BWN A;  4OVN F;  1JMB A;  1KZU B;  2QJP B;  1LWU C;  2PAJ A;  3VYI A;  1YTZ T;  2HR3 A;  3L74 J;  1KIL A;  2HG5 D;  1A02 J;  3H1H J;  1FZC B;  3L75 J;  2E76 C;  3R2P A;  2FFD A;  5KLV E;  3H32 A;  2XU6 A;  1QL1 A;  4WY4 B;  3TGU J;  4OH8 B; 
#chains in the Genus database with same CATH homology
 1X79 B;  1RF1 B;  2OYI C;  5AW1 B;  1JY2 P;  5AVW B;  1G2C A;  2OYI B;  1NAF A;  3MIW A;  5AVQ B;  3T97 A;  1JY3 N;  1LTJ C;  4AYC A;  5AW8 B;  1FZG A;  5CCH C;  3L36 A;  2WSC H;  3OA7 A;  4I2L C;  5APV A;  1GL2 A;  3VMZ A;  4AQR D;  1N2D C;  1AQ5 A;  1SVF A;  1NH4 A;  1JUN A;  1HVV A;  1MZ9 A;  1MV8 A;  3EQ2 A;  1HGZ A;  1FJP A;  1NTZ K;  4IFM A;  2HYN A;  3GHG A;  2ZFC A;  2YKO A;  4Y99 C;  3BRV B;  5APQ A;  3U1C A;  3P8C D;  4N78 D;  2H8P D;  1KFM A;  3WMM 0;  1GW4 A;  3M9Q A;  1VPC A;  1GK6 A;  2CPB A;  2O01 H;  3A3Y B;  1CI6 A;  3TYY A;  2Z5I A;  1WT6 A;  1GU4 A;  1WRG A;  2M3B A;  2N1T A;  2R5D A;  1GK4 A;  3L4F A;  3TNU A;  3TSI A;  5BU8 B;  3BRT B;  3MGN A;  4ZKP A;  2O1K A;  2W6B A;  2ZXE B;  2VRS A;  5CCG C;  3HRN A;  1IFN A;  1LTB C;  4GIF A;  3B5N D;  5CJ0 A;  4AUW A;  3O8Z A;  1N7S A;  1DH3 A;  2H7H A;  1NKN A;  1LWU A;  1URQ D;  1AFO A;  4O9B A;  2YO2 A;  3P8M C;  1PFI A;  3HUS C;  1GDT A;  5CJ4 A;  1M7L A;  5BVZ A;  3HUS B;  1JY2 N;  1FZC A;  2Z5H A;  2P67 A;  4W7Z A;  5AW9 B;  3A5T A;  3M9B A;  1HUC A;  1GD2 E;  2QM7 A;  3VMX A;  2N9B A;  1FDM A;  1ZR2 A;  1NTK K;  2XZR A;  4WY4 A;  2I1K A;  1J1E C;  1A02 F;  5AVX B;  1RE3 C;  1J1E B;  3B5N C;  5AW6 B;  1LTT C;  1RF1 A;  1SQV K;  3B5N B;  4M3L A;  5AVU B;  2OYI A;  1RE4 A;  1SQB K;  1MFZ A;  1GW3 A;  4I1L A;  2BAS A;  1FJK A;  5CCH A;  1URQ B;  1X8Y A;  5APW A;  4W80 A;  1ZN5 A;  1HTL C;  3NFQ A;  3G3Z A;  4W7Y A;  2E42 A;  1FU1 A;  3HE5 B;  1M1J C;  4C7R A;  2R5B A;  1QL2 A;  1M1J B;  2Q9I A;  5AW5 B;  2A45 G;  5KJ7 D;  2Q7C A;  1LTJ B;  3CL3 D;  1RF0 A;  1FOS E;  4B86 A;  4GKG A;  4IFF A;  3N4X A;  2WT7 B;  1HH0 A;  2KSJ A;  2Q3I A;  1LT9 C;  1KFN A;  2QM8 A;  1LT9 B;  4DZO A;  2C0X A;  2XKM A;  3SWF A;  5CCG D;  1RY3 A;  1LTS C;  3BAT A;  3N7N A;  2FXM A;  1N73 C;  4N3Y B;  2YKP A;  3KDP B;  1FAV A;  2C9N Y;  1G1J A;  4I6M C;  4KHX A;  3HTK B;  2XDJ A;  3CLQ A;  1ZR4 A;  1NU1 K;  1IFD A;  4Y99 B;  2YMY A;  1H89 A;  1L4A C;  4N6J A;  1L4A B;  1T3J A;  1IK9 A;  1CW5 A;  4XA4 A;  1H88 A;  4WBA A;  1T3U A;  3II6 A;  2WSF H;  5KJ7 C;  2W6A A;  4C7N B;  1JTH B;  1NHL A;  1GZL A;  1GL2 C;  4WB4 A;  4HH2 A;  4GT1 A;  1CSB A;  1CZQ A;  3NMD A;  2FYZ A;  1NKZ B;  3BAS A;  4EOT A;  4HYT B;  5AW7 B;  3VP8 A;  5AW2 B;  3VP9 A;  2OYH C;  3M0D A;  3VOP A;  2KP8 A;  3V4W A;  2J59 M;  3BVH A;  3RK3 C;  4JF7 A;  3HUS A;  3RK3 B;  2HPC B;  3TK1 A;  1SQP K;  4JYC A;  1JO5 A;  2J58 A;  2XNX A;  1SFC D;  5KLV K;  1FOS F;  2WPQ A;  2IPP A;  1JOC A;  5AW0 B;  1IJD B;  2IFM A;  1S9K D;  3C9I A;  2N1T C;  1IFJ A;  3KYQ A;  3B5N A;  1FZE A;  1W2E A;  3VN0 A;  4XE5 B;  2WIT A;  2YKQ A;  3RK2 D;  4N78 E;  3L35 A;  2KOG A;  5KTB A;  2IFN A;  1JY3 O;  1G1I A;  2P2U A;  2WPS A;  1URQ A;  3MTU E;  3P32 A;  2C9L Y;  3M0A A;  3LIE A;  2HOD B;  2W27 A;  1HBW A;  1SQX K;  2PP6 A;  3RL0 D;  1T2K D;  3HE5 A;  1N7L A;  2KB7 P;  1JMM A;  1M1J A;  5APU A;  1SQQ K;  3V2P A;  3HE4 B;  1LTJ A;  4C46 A;  1HJB A;  4EIJ A;  1FZC C;  1IC2 A;  1SFC C;  3HD7 C;  2WT7 A;  1FZB A;  3PP5 A;  3A2A A;  2FYU K;  1SFC B;  5AW4 B;  3HD7 B;  1GU5 A;  1YYC A;  1N86 A;  3OJA B;  2E43 A;  1IFM A;  1L4A D;  1LT9 A;  4ZKU A;  1LTA C;  3A7O A;  4LC1 A;  5APY A;  1KIL C;  2R3C A;  2XV5 A;  3RK2 C;  2GUS A;  3V4Q A;  1KIL B;  1LTG C;  1OXZ A;  3RK2 B;  3VTP C;  1FBM A;  1GL2 D;  2KYV A;  4LGD E;  1EQ7 A;  2A45 H;  2FFD C;  5APS A;  1RF1 C;  3CI9 A;  2FFD B;  3IFM A;  1NO4 A;  3HTK A;  3H32 B;  1DEB A;  1RE4 C;  3RL0 C;  1T2K C;  5AVT B;  3RK3 D;  1OWA A;  1FZA A;  2NPS C;  3RL0 B;  1L4A A;  3UIA A;  2NPS B;  5BU5 A;  2WSE H;  2P7J A;  3B8E B;  3L37 A;  1N73 B;  4C7N A;  1JTH A;  5KJ7 A;  3H6P A;  2WWW A;  1G2C B;  2IX7 C;  1E5W A;  3V2Q A;  1JNM A;  3NXS A;  4RES B;  1RF0 C;  2M8R A;  3MUD A;  2L5G B;  3M91 A;  3V2N A;  2OYH A;  5CCG A;  1DX7 A;  5AW3 B;  2N1T D;  3MD0 A;  2MJZ A;  3SWY A;  2HPC A;  1SLQ A;  1JY2 O;  1GL2 B;  4LLH A;  1KQL A;  2C0W A;  1L0N K;  1JCC A;  1NOH A;  5AVR B;  2A45 I;  2O1J A;  4JYB A;  2WTY A;  1YTZ I;  5AVS B;  1NWQ A;  3M9H A;  2OYH B;  1JY3 P;  1N7S D;  3V2R A;  3P7K A;  5AVV B;  3V5B A;  3GHG C;  5AVZ B;  1HWT C;  3OAK A;  1Z56 A;  2WPR A;  3GHG B;  1XTG B;  4IFD K;  1NTM K;  2GM4 A;  3HD7 D;  3VMY A;  1GTW A;  1J1D C;  1IO4 A;  2OAR A;  1J1D B;  1CI6 B;  1L0L K;  2HLO A;  2JEE A;  3M06 A;  1JCD A;  2CPS A;  2GUV A;  2HOD A;  1RE3 A;  1VDF A;  2I1J A;  1SP4 A;  1KIL D;  2N1T B;  3EFG A;  3P8C E;  3TNU B;  4WY4 D;  1H8A A;  3KPE A;  1LGH B;  3M0D C;  2WZ7 A;  3LW5 H;  2Q5U A;  2H43 A;  3HE4 A;  1IFI A;  5APT A;  3NTN A;  2YO3 A;  2P1J A;  1T8Z A;  1LTI C;  3U1A A;  2Z4E A;  1HGV A;  1N7S C;  1SFC A;  3HD7 A;  1KZU B;  3U59 A;  1N7S B;  1LWU C;  2FKW B;  2PAJ A;  3VYI A;  2KLV A;  2NPS D;  2R32 A;  5CMZ A;  1ZV8 A;  1LWU B;  5CCH D;  1YTZ T;  1MUU A;  1KIL A;  2HG5 D;  2LKM A;  2POH A;  5CHX A;  1A02 J;  2JJL A;  1FZC B;  3IR9 A;  1N73 A;  1J2J B;  1XTC C;  3R2P A;  2FFD A;  5APX A;  1FZF A;  3LID A;  3H32 A;  2XU6 A;  3KQG A;  3I5C A;  5AVY B;  1QL1 A;  1X9V A;  4WY4 C;  1URQ C;  2HFE D;  4WY4 B;  2NPS A;  1ZLL A;  2YNY A;  1S9K E;  3E1I A;  4DOJ A;  4OH8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...