3PP5A

High-resolution structure of the trimeric scar/wave complex precursor brk1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
63
structure length
63
Chain Sequence
TKTNIQKDWEQREFIEDMSINIQKIVEFLNKFELSTRNKLSDLNEKLTILDRQVDYLEATFKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution X-ray structure of the trimeric Scar/WAVE-complex precursor Brk1.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Structural protein
molecule keywords Brk1
total genus 31
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2010-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3pp5A01
3RL0C 3RK2C 2NPSC 1L4AC 3HD7B 3RL0B 1N7SA 5CCGD 5KJ7D 3HD7A 1N7SD 3TSIA 5KJ7C 5CCGA 2XDJA 3RK3D 4WY4D 4WY4C 1SFCC 3B5NC 1HVVA 1XTGB 3RL0D 2N1TB 1SFCA 3B5NA 3KYQA 1L4AB 3HD7C 4JF7A 3RK2B 1L4AA 4W7YA 1N7SB 1N7SC 4W80A 2NPSB 1URQC 1SFCD 3B5ND 2N1TC 1JTHB 1URQA 2N1TD 1GL2C 4N78E 1KILA 3RK3B 3HTKB 1L4AD 4WY4B 1KILC 1NHLA 5CCHA 1KILB 1GL2B 3RK3C 1GL2A 2NPSD 1URQD 5KJ7A 1SFCB 2HG5D 3B5NB 4WY4A 3VOPA 2KOGA 4W7ZA 2PP6A 1KILD 3P8CE 1T3JA 2NPSA 4OH8B 5CCHC 5CCGC 2H8PD 5CCHD 3PP5A 3HD7D 4LGDE 2WZ7A 1GL2D 1JTHA 1URQB 2N1TA 2M8RA 3M0DC 2YMYA 2HFED 3RK2D
chains in the Genus database with same CATH superfamily
2FYNC 3NFQA 3RL0C 5K5GB 2P67A 4ASVA 1M90Q 3M9BA 1OX3A 1DEBA 1M7LA 2KNCA 3IR9A 3V2NA 4H13B 1L0LD 3H1JD 3EQ2A 3L75D 1KILE 3Q5SA 1FDIA 4QMAA 5AW1B 3H1HJ 3VMYA 1IFNA 1VQPP 1H88A 3EWKA 2HPCA 3TDKA 1NTZG 1JY3O 3FWLA 1MKMA 3R4YA 3BVHA 1L0NK 3HD7A 4JYCA 2D2CD 1QL1A 3F5HA 1N7SD 1NTZD 2N9BA 3L74D 2YKQA 1USDA 1Y9BA 1RE3C 5AVSB 2KNCB 5AW3B 2KK7A 4I7ZC 5APWA 3TGUE 2RH0A 1JNMA 3NTNA 2WVRA 4WY4D 5KLVK 3IFMA 2XNXA 1FZCB 4WY4C 1DIPA 4I2LC 1SFCC 1J1DB 1SQQE 4XE5B 1YITP 3O8ZA 1HVVA 1NAFA 1OW8A 2MKVA 1BGYG 2WWWA 3QH9A 2BCCE 4U7JA 2KXPB 3WUVA 1SFCA 4PD4I 5BU8B 1U7MA 1FE6A 1LGHB 5KAIE 3CC2P 4H0LD 2FKWB 1QVFO 4I6MC 1G1IA 2E5YA 2PRRA 2R5DA 1S72P 3RK2B 2GA1A 4DJGA 2P58A 2WT7A 1N86A 5APTA 5BU5A 3TYYA 1AQTA 1K05A 1OMIA 4W7YA 1YQ4C 1X9VA 1NU1K 3JSVC 4D6TJ 1IZNB 4NPEA 1BCCE 1YYCA 4EYYQ 2K1AA 1NTKJ 3BCCE 4PD4E 5CHXA 4O9BA 2O01H 1FJKA 1MFZA 1ZXGA 2P10A 2W6AA 2Y0CA 5KAFE 1QGKB 3U1AA 3V4QA 4B86A 2C0WA 3AE5C 5KLIB 2K9YA 3B5ND 5KLVE 3S1KA 4BWNA 2D2CB 3CCSP 2OYIA 2N1TC 1EZVD 1S9KD 5KKZC 1GL2C 1FS0E 3H1HE 1DD4A 3HTKB 3CX5H 2R44A 2JWAA 1L4AD 1NAYA 1PV3A 2M3BA 1T8ZA 1EZVG 1J1EB 2Y9YA 3EFGA 4Y99C 3CX5E 4D6TE 1N73C 1KYOE 3BRVB 1JEKA 1KILC 4DZOA 1HJ0A 3H1IE 5AW5B 2JDIH 3L70J 1AA0A 1T2KC 1LTBC 3WMM0 3CXHI 3AE9C 1R5LA 1K8AQ 1MZ9A 3BRTB 1SQXJ 2YKPA 4IFMA 2OTKE 4K3AA 1U7JA 3G4SP 2KZIA 1OVVA 1SQXK 1PPJE 2OQQA 2IZ1A 3AEGC 3L72G 2GUVA 4YPCA 1S2EA 2NPSD 3U1CA 4UB6H 2Z4EA 4EI2A 1KQLA 5GTHE 1HUCA 4H13C 3CPWO 2I1KA 1KQFB 2IYPA 3CWBE 3L35A 5KJ7A 2C9NY 3F89A 3OAKA 3TGUJ 3M91A 3FX0A 1BE3G 1Q81Q 4EIJA 2HPCB 4PJ0E 2HG5D 1KN7A 2KOGA 1YJNP 2ZYDA 2L91A 5AVRB 1P84H 2ZXEB 4GT1A 1NTKE 1OVRA 2AXTE 5GTIH 3KPEA 3HE4B 2K88A 2KP8A 3V2RA 2P2UA 4OWFA 2H88C 1PFIA 3RK3B 2YNYA 3A0BE 3A7OA 3IF4A 1J1DC 2WSEJ 1E5WA 1NTZK 5H2FE 4PV1D 1RF0C 1FZAA 1ZOYC 1SQPJ 2KUBA 3H1LE 1AVYA 4U3FG 2PFXA 1H0TA 1DX7A 1P84I 2W83C 1JTHA 1VL2A 1KFNA 3H1KG 3AE2C 4U3FD 5AVVB 1G2CB 2E75C 3M0DC 5B66H 2YMYA 2M0BA 2QE7H 2HFED 2IBZG 3N4XA 4JBZA 3CMAP 5APYA 4JQ0D 4HKZH 1KB9E 1KMIZ 4C7RA 3H1KJ 3BASA 1YTZT 3WU2H 3GHGC 2YKOA 4WVZA 1L0LG 3H1JG 3L75G 3CMEP 2ZXXA 1JCCA 1CW5A 1KTMA 2FFDC 2J58A 2ZVNB 3SSUA 2FFDB 2YXQB 1EXIA 1L4AC 2W90A 3HD7B 3FGAD 1FC2C 3L70G 1AVOA 1VPCA 4PV1B 3W68A 5CCGD 3WU2E 1FZFA 1DD3A 3MIWA 3MD0A 3NMDA 1LTTC 1N2DC 3CXHE 1FZCC 3CWBJ 4HH2A 2FXPA 2R3SA 4BXLA 3Q5RA 3Q3DA 1HBWA 3AECC 1A02J 2QM7A 1PP9E 1KYOI 1SQBJ 1FU1A 2JEEA 2N9YB 3CD6P 2O1KA 2QIWA 3H1KD 1SQVD 1NU1J 1JM0A 1SLQA 2XDJA 1L0NG 1NKZB 3RK3D 1Q90D 1BGYD 1PGQA 2JP3A 1IC2A 1LT9B 1S1CX 1S3JA 1M1JB 1SQVG 1IK9A 1NU1E 2AXCA 1Z56A 1VF5B 2A06E 1VF5C 3GG2A 4KT0J 2YO3A 1M56D 4R4MA 1PGPA 3CI9A 5DJUB 1CI6A 1PP9J 1SQBE 2P7JA 5AW4B 4K35A 3B5NA 2VRSA 1GW4A 1RQVA 4WBAA 5AVYB 3V6IA 2IFMA 4TT3H 3BATA 2B89A 1SQXD 2CPSA 3Q1MA 3D6ZA 3E1IA 3GHGB 1NTME 2CPBA 4RKUJ 3SWFA 1HWTC 3P8MC 1RF1C 1SQXG 5AW0B 2AEJA 2K3RA 3Q5PA 2W8ZA 3OW2O 1SS1A 1L0NJ 1A02F 3KDPB 1JO5A 1QLED 2NPSB 1OWAA 3JCUH 4EDFA 5AVZB 1GU5A 2K9JB 1FAVA 3C8VA 5AVUB 5KTBA 3USSA 1L0LK 1URQA 1NTZE 2N1TD 1ZRTE 3M0DA 3HUSC 4N78E 3HUSB 3MUDA 4H44B 1HH0A 5B66E 3L75J 2QG4A 4WY4B 2WT7B 2A45I 1EDLA 3R2PA 5APQA 1VQMP 1USEA 3RBXA 3HUSA 2LR2A 4LC1A 1HGZA 1P84D 2PAJA 3L37A 1NOHA 1LJ2A 2M3EA 3MHVA 2W27A 3CCRP 3U59A 3OA7A 4HJGH 2ZYGA 1KD1Q 4GIFA 1OW6A 1IK7A 1JUNA 4L73A 1VQ7P 1JOCA 1GMJA 1SQPD 2O3JA 5KLIC 1LTGC 1NKNA 2JJLA 2E43A 3I5CA 5CJ0A 3CCLP 2FYZA 3VMAA 1H0TB 1JCDA 1SQVJ 2FY8A 4PJ0H 3P7KA 1CZQA 3IAOA 3VYIA 1BCCG 3B5NB 1JY2P 2WSSH 3AE4C 1FBMA 1S5LH 3I56P 3G6EP 4EOTA 1M1KQ 2Q9IA 1GK6A 5H2FH 1GD2E 5AVXB 1S4XA 1GW3A 3P8CE 1S9KE 2GM4A 2V7QH 2Q3EA 4H44D 5GTHH 4XFJA 3CC7P 1Q82Q 4UB6E 2AEMA 2KI7B 5TISH 3CCUP 2HYNA 3KQGA 2G3AA 2WSCJ 1KYOD 1SQBK 2AXTH 2WPVB 2XU6A 3L74E 3PHLA 4JYBA 5CCGC 5B5EE 4DT0A 4GDOA 3PP5A 4H0LC 5BVZA 3CCJP 2HR3A 4H13D 4BRYB 2E42A 1X0TA 3LIDA 2QVAA 1N73A 2H7HA 3L73G 1H89A 2H89C 2A45G 1GL2D 5E79E 5AW6B 3TGUG 1JY2N 2OYHC 1URQB 1YBKA 3L73J 2N1TA 1UIIA 2BEZF 3L73D 3N7NA 2KLUA 4A7PA 3O6QA 4ZMDA 3D6YA 2FFDA 1SQQG 3AEFC 4GOEA 1BGYJ 3L72E 3VMZA 3AEBC 1HTLC 1T2KD 1EDIA 1RF1B 1ZV8A 2QRXA 3G3ZA 1JY2O 1FZGA 2E76D 4GOFA 3T97A 1WT6A 1IFPA 3MTUE 2WMMA 3L70D 2Q3IA 1VF5D 2NRGA 2Y0DA 1LP1A 4PD4H 4AQRD 4ZKUA 2KIKA 1HF9A 2WSFJ 1GDTA 1LT1A 1NTKK 2NPSC 1BE3E 2IBZI 3B71A 3L71G 3LW5J 2OYHA 3HE5B 1VQ9P 2LXCB 3MZWB 3ABVC 3I55P 3D71A 1ZLLA 3L71D 3AE1C 5AW2B 5KLVD 3A5TA 3H1LJ 3BCCG 3OJAB 1YTZI 3MP7B 2FYUE 1L0ND 2IX7C 5AW7B 4TLFA 5KJ7D 2YO2A 2RMZA 2JR8A 3SWYA 5CCGA 5KLVG 2W6JH 4Y28J 3V4WA 2PGDA 1SQQJ 4D6TD 2NZ2A 5GTIE 2I8DA 2I1JA 3GW6A 5KAFH 1KFMA 4JPZB 3TNUA 1NWQA 1NVOA 3AE7C 3RBZA 1RF1A 4DOJA 1QEXA 4U3FE 1NTMK 1VQOP 4GKGA 1FZEA 2N1TB 2QJPC 3H1IG 3CCEP 3KYQA 1BDCA 4IL6X 1FZBA 1L4AB 1KYOH 1LTAC 1NYHA 1PPJD 3HD7C 2IYOA 4HYTB 5CBOA 3TK1A 1M8OB 1G1JA 3VTPC 1L4AA 2JWDA 3K5BA 2QJKC 1VQKP 5KAIH 1OZHA 2HODB 5KKZB 1N7SB 3CWBD 1N7SC 5AW9B 1NGMB 3S9OA 2B9BA 1L0LE 3H1JE 5APSA 1SVFA 2QJKB 2JO1A 1ZMEC 3VMXA 3MUDC 3CC4P 3CWBG 2KSEA 3G71P 1KC8Q 2E5TA 2IFNA 1GK4A 2M5AA 3AE6C 1CSBA 2HLOA 3RL0g 3AEAC 1LTJB 3AEEC 4RO0A 5TJHA 4YXWH 1JTHB 2WSCH 1WRGA 2J59M 2ZJSE 3L4FA 4IOIH 1KILA 5CMZA 5AVTB 5CBNA 4IFFA 3H1IJ 2B87B 2WPSA 1LT9C 4H0LB 3WUUA 1M1JC 2WPQA 1AJYA 1LTJC 2OYOA 1ZR4A 3HTKA 2BCCG 5E79H 1EZVI 2KYVA 2QJYB 2QJYC 2A06D 4L74A 3H32A 1VQNP 2OYHB 1JMBA 2ZT9C 5CCHA 1IFMA 1VQLP 2K9JA 2BCCD 1SQBD 1R8EA 1BSHA 4MN4C 2A06G 2CK3H 4WB4A 5B5EH 5KJ7C 4I1LA 1X79B 1OXZA 1GL2B 1SQPG 4U3FJ 3RGUA 1GL2A 1SQBG 1WMKA 2YIUC 4WWIA 3RK3C 4PV1C 3KXDA 4ASWA 1BSNA 1MUUA 3O6QB 4ZKPA 1SP4A 3QWOC 3M9QA 1KQSO 1BCCD 2WITA 3B4SA 5APUA 1LWUA 1NTMG 2IBZE 1RHZB 2RKLA 5AVWB 2XV5A 1BDDA 1LNQA 4ZNCA 2OTLP 2Q5UA 3FXDA 1KZUB 3L74J 1SFCB 1LWUB 1RE4A 1LWUC 4WY4A 1YHQP 1Q86Q 1EDJA 2LKMA 2ZFCA 3M0AA 5APVA 3L75E 3VOPA 2V7QJ 1KILD 1YIJP 3PRJA 1T3JA 1X8YA 1ZRTD 2NPSA 1IFIA 3G9RA 4KHXA 4N78D 2C9LY 1L0LJ 3CXHD 3H1JJ 3T97B 5TISE 1Q2NA 3CCQP 1FDMA 1OW7A 4OH8B 3CX5D 1EQ7A 2XKMA 3V5BA 1PGOA 3M06A 2H8PD 2HODA 2KZJA 1RQUA 5CCHD 3HE4A 4LGDE 3TGUD 3GHGA 3RK3E 1RE3A 1S5LE 4NPFX 4OVNF 3VP8A 1EC5A 1BGYE 3L72J 3SWKA 2D2CC 1AV1A 2WZ7A 1HJBA 1NTMJ 1R5SA 1SQQD 4KJMA 2Z5HA 3D70A 2E75D 1EXJA 3CCVP 3AE3C 1DEEG 1IFDA 1M57D 1NU1G 3MGNA 4RESB 5AW8B 3UIAA 2OARA 1ZW0A 1YJ9P 1QVGO 2OTJP 2ZT9D 2Z5IA 1LTSC 4C46A 1JY3P 1RH5B 2KS1B 2GUSA 3VP9A 5CJ4A 3JCUE 4Z1MH 1Q7YQ 2JKVA 2WTYA 3PTZA 3RK2C 4OGQB 1YJWP 2KS1A 1ZP0C 2E74C 3NXSA 2E74B 3L36A 4C7NA 2FYNB 3RL0B 1N7SA 4IL6H 2KB7P 3LW5H 1FOSE 4RJTA 2WQYC 3P8CD 3BCCD 4PD4D 1VDFA 3B8EB 4N3YB 1ZR2A 1W5CE 1GU4A 1FJPA 4AYCA 3V2PA 1RY3A 2ZYAA 1IO4A 3H1HG 1KV4A 1IFJA 2BASA 2FXOA 4M3LA 4UB8E 2E75B 3Q2YA 1GTWA 1VQ8P 1EZVE 3A2AA 3FWNA 4D6TG 1E79H 1JY3N 1ZN5A 3H1LG 3TSIA 3PLNA 2OYIC 3H1HD 1K04A 2A45H 5L8RJ 2K37A 2ZVOB 1PL5A 3L74G 5KLVJ 1W2BO 3H1LD 2QM8A 1K73Q 4AUWA 1K9MQ 4GODA 3H1ID 3B5NC 1PZQA 2O01J 3P32A 5M1BA 3W67A 1PGJA 4OGQD 4YXDC 1PPJG 3CX5I 2E74D 1NO4A 3L73E 1T3UA 3PJSK 1BCCJ 1XTGB 3RL0D 1AQ5A 3HRNA 1S5LX 3TF5A 1VQ5P 1X22A 1Y47A 5APXA 1Y8AA 3A0HH 2Y9ZA 4XA4A 3CCMP 4JF7A 1W2EA 2RN0A 2V4HA 3KZIE 4UB8H 3A0HE 2B87A 1DH3A 2IZ0A 1OFCX 2J5UA 1HGVA 2IPPA 1SQQK 2Q1KA 4IL6E 4BRYA 1SQPK 3AEDC 1NTZJ 4NPDA 3GF7A 1D7MA 1OIPA 4W80A 1URQC 1U57A 3L71E 1NTKG 2UWJE 2WSEH 1SFCD 1TU3F 1KB9H 2XNDH 3JC22 1L0NE 3CL3D 2Y0EA 3WUTA 1NTKD 2SPZA 1EDKA 1SQVE 1NJIQ 3KZIH 1YQ3C 2BEQD 3CXHH 2Q7CA 1YI2P 1NHLA 2YXRB 3CLQA 2KLVA 1FOSF 1AFOA 4R4LA 5DJTB 1XTCC 3ITKA 5C39A 1KILB 1QL2A 3EFFK 1MV8A 2MJZA 2Q6QA 3A3YB 1FDOA 1LTJA 1QX8A 4Y99B 1J1EC 5EFWB 3L71J 1LT9A 1N73B 3ZDMA 2FBWC 3S4RA 1L2PA 1NH4A 2AEFA 1URQD 1VQ4P 3PH0A 1GZLA 5AVQB 1J2JB 1NTMD 2B88A 1IJDB 1RE4C 2FYUJ 3AE8C 3L72D 2POHA 4YTPC 3H25A 2QSIA 4N6JA 4OGQC 1KB9D 1KB9I 2ZAEB 1N8RQ 3IN6A 1JMMA 2YMKA 1MFTA 2FYUK 3SFEC 2E76B 3L70E 4CPGA 1LTIC 2DW3A 3E1RA 3KHUA 4L76A 1BE3J 3HE5A 1BE3D 3GMAA 2H43A 2E76C 4W7ZA 2PP6A 2O01N 4C7NB 1LP1B 3VN0A 2ZT9B 1PP9G 2OYIB 1T6AA 2KSJA 1JB0J 2LXBA 2R3CA 2QJPB 1KORA 3C1LA 3E7KA 3M9HA 2FYUD 4LLHA 3TNUB 3V2QA 5CCHC 1PP9D 2XZRA 3FXEA 2ITAA 1P84E 1N7LA 3H32B 1SQVK 2YIUB 3BCCJ 3HD7D 3H1KE 4DCKA 1G2CA 3II6A 4IFDK 3GLMA 3LIEA 2FYUG 3H6PA 1FZCA 2OGUA 2QA4P 1OVUA 4I7ZB 4HB1A 2R32A 1NU1D 2C0XA 2WPRA 3GF3A 3SFDC 3C9IA 2L5GB 2M8RA 2QEXP 2R5BA 1RF0A 2W6BA 2M5AB 3A0BH 2FXMA 1CI6B 1SQPE 2P1JA 1H8AA 1VQ6P 1M1JA 2IDBA 1PIXA 1KQGB 1UIXA 2BCCJ 4H44C 1SQXE 2O1JA 2G8YA 2WSFH 4L75A 2IBZD 3RK2D
chains in the Genus database with same CATH topology
3RL0C 3NFQA 2P67A 3M9BA 1DEBA 1M7LA 3IR9A 3V2NA 3EQ2A 5AW1B 3VMYA 2HPCA 1IFNA 1H88A 1JY3O 3BVHA 1L0NK 3HD7A 4JYCA 1QL1A 5AVSB 1N7SD 5KLVK 2N9BA 5KJ7C 2YKQA 5AW3B 1RE3C 5APWA 1JNMA 3NTNA 4WY4D 3IFMA 2XNXA 1FZCB 4WY4C 4I2LC 1SFCC 1J1DB 4XE5B 3O8ZA 1HVVA 1NAFA 2WWWA 1SFCA 5BU8B 1LGHB 2FKWB 4I6MC 1G1IA 2R5DA 3RK2B 2WT7A 1N86A 5APTA 5BU5A 3TYYA 4W7YA 1X9VA 1NU1K 1YYCA 5CHXA 4O9BA 2O01H 1FJKA 1MFZA 3V4QA 2W6AA 3U1AA 4B86A 2C0WA 2OYIA 3B5ND 2N1TC 1S9KD 1GL2C 3RK3B 3HTKB 1L4AD 2M3BA 1T8ZA 3EFGA 1J1EB 4Y99C 1N73C 3BRVB 1KILC 4DZOA 5AW5B 1T2KC 1LTBC 3WMM0 1MZ9A 3BRTB 2YKPA 4IFMA 1SQXK 3U1CA 2GUVA 2NPSD 2Z4EA 1KQLA 1HUCA 2I1KA 3L35A 5KJ7A 2C9NY 3OAKA 3M91A 4EIJA 2HPCB 2HG5D 2KOGA 5AVRB 2ZXEB 4GT1A 3KPEA 3HE4B 2KP8A 3V2RA 2P2UA 1PFIA 2YNYA 3A7OA 1J1DC 1E5WA 1NTZK 1RF0C 1FZAA 1DX7A 1JTHA 1KFNA 5AVVB 1G2CB 3M0DC 2YMYA 3N4XA 2HFED 5APYA 4C7RA 3BASA 1YTZT 3GHGC 2YKOA 1JCCA 1CW5A 2FFDC 2J58A 2FFDB 1L4AC 3HD7B 1VPCA 5CCGD 1FZFA 3MIWA 3MD0A 3NMDA 1LTTC 1N2DC 1FZCC 4HH2A 1HBWA 1A02J 2QM7A 2JEEA 1FU1A 2O1KA 1SLQA 2XDJA 3RK3D 1NKZB 1IC2A 1LT9B 1M1JB 1IK9A 1Z56A 2YO3A 3CI9A 1CI6A 2P7JA 5AW4B 3B5NA 2VRSA 1GW4A 4WBAA 5AVYB 2IFMA 3BATA 2CPSA 3E1IA 3GHGB 1HWTC 2CPBA 3SWFA 3P8MC 1RF1C 5AW0B 1A02F 3KDPB 1JO5A 2NPSB 1OWAA 5AVZB 1GU5A 1FAVA 5AVUB 5KTBA 1L0LK 1URQA 2N1TD 3M0DA 3HUSC 4N78E 3HUSB 3MUDA 1HH0A 2WT7B 4WY4B 2A45I 3R2PA 5APQA 3HUSA 4LC1A 1HGZA 2PAJA 3L37A 1NOHA 2W27A 3U59A 3OA7A 4GIFA 1JUNA 1JOCA 1LTGC 1NKNA 2JJLA 2E43A 3I5CA 5CJ0A 2FYZA 1JCDA 3P7KA 1CZQA 3VYIA 3B5NB 4EOTA 1JY2P 1FBMA 2Q9IA 1GK6A 1GD2E 5AVXB 1GW3A 3P8CE 1S9KE 2GM4A 2HYNA 3KQGA 4JYBA 2XU6A 1FZCA 1SQBK 5CCGC 1FJPA 5BVZA 2E42A 3PP5A 3LIDA 2H7HA 1H89A 2A45G 1GL2D 5AW6B 1JY2N 2OYHC 1URQB 2N1TA 3N7NA 2FFDA 3VMZA 1T2KD 1HTLC 1RF1B 1ZV8A 3G3ZA 1JY2O 1FZGA 3T97A 1WT6A 3MTUE 2Q3IA 4AQRD 4ZKUA 1GDTA 1NTKK 2NPSC 2OYHA 3HE5B 1ZLLA 5AW2B 3A5TA 3OJAB 1YTZI 5KJ7D 2IX7C 5AW7B 2YO2A 3SWYA 5CCGA 3V4WA 2I1JA 1KFMA 3TNUA 1NWQA 1RF1A 4DOJA 1NTMK 4GKGA 1FZEA 2N1TB 3KYQA 1FZBA 1L4AB 1LTAC 3HD7C 4HYTB 3TK1A 1G1JA 3VTPC 1L4AA 2HODB 1N7SB 5AW9B 1N7SC 5APSA 1SVFA 3VMXA 2IFNA 1GK4A 1CSBA 2HLOA 1LTJB 1N73A 1JTHB 2WSCH 1WRGA 2J59M 3L4FA 5CMZA 5AVTB 1KILA 4IFFA 2WPSA 1LT9C 1M1JC 2WPQA 1LTJC 1ZR4A 3HTKA 2KYVA 3H32A 2OYHB 5CCHA 1IFMA 4WB4A 4I1LA 1X79B 1OXZA 1GL2B 4C7NA 3RK3C 1GL2A 1MUUA 4ZKPA 1SP4A 3M9QA 2WITA 5APUA 1LWUA 5AVWB 2XV5A 2Q5UA 1KZUB 1SFCB 1LWUB 1RE4A 1LWUC 4WY4A 2LKMA 2ZFCA 3M0AA 5APVA 3VOPA 1KILD 1T3JA 1X8YA 2NPSA 4KHXA 1IFIA 4N78D 2C9LY 1FDMA 4OH8B 3V5BA 1EQ7A 2XKMA 3M06A 2H8PD 2HODA 5CCHD 4LGDE 3GHGA 1RE3A 3VP8A 2WZ7A 1HJBA 2Z5HA 1IFDA 3MGNA 4RESB 5AW8B 3UIAA 2OARA 4C46A 2Z5IA 1LTSC 5CJ4A 1JY3P 2GUSA 3VP9A 2WTYA 3RK2C 3NXSA 3L36A 3RL0B 1N7SA 1FOSE 2KB7P 3LW5H 3P8CD 1VDFA 3B8EB 4N3YB 1ZR2A 1GU4A 4AYCA 3V2PA 1RY3A 1IO4A 1IFJA 2BASA 4M3LA 1GTWA 3A2AA 1JY3N 1ZN5A 3TSIA 2OYIC 2A45H 2QM8A 4AUWA 3B5NC 3P32A 1NO4A 1T3UA 1AQ5A 1XTGB 3RL0D 3HRNA 5APXA 4XA4A 4JF7A 1W2EA 1DH3A 1HGVA 2IPPA 1SQQK 1SQPK 4W80A 1URQC 2WSEH 1SFCD 3CL3D 2Q7CA 1NHLA 3CLQA 1FOSF 2KLVA 1AFOA 1XTCC 1KILB 1QL2A 1MV8A 2MJZA 3A3YB 1LTJA 4Y99B 1N73B 1J1EC 1LT9A 1NH4A 1URQD 5AVQB 1GZLA 1J2JB 1IJDB 1RE4C 2POHA 4N6JA 1JMMA 2FYUK 1LTIC 3HE5A 2H43A 4W7ZA 2PP6A 4C7NB 3VN0A 2OYIB 2KSJA 2R3CA 3M9HA 3TNUB 4LLHA 3V2QA 5CCHC 2XZRA 3H32B 1N7LA 1SQVK 3HD7D 4IFDK 1G2CA 3II6A 3LIEA 3H6PA 2R32A 2C0XA 2WPRA 3C9IA 2L5GB 2M8RA 2R5BA 1RF0A 2W6BA 1H8AA 2FXMA 1CI6B 2P1JA 1M1JA 2WSFH 2O1JA 3HE4A 3RK2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RL0 C;  3RK2 C;  2NPS C;  1L4A C;  3HD7 B;  3RL0 B;  1N7S A;  5CCG D;  5KJ7 D;  3HD7 A;  1N7S D;  3TSI A;  5KJ7 C;  5CCG A;  2XDJ A;  3RK3 D;  4WY4 D;  4WY4 C;  1SFC C;  3B5N C;  1HVV A;  1XTG B;  3RL0 D;  2N1T B;  1SFC A;  3B5N A;  3KYQ A;  1L4A B;  3HD7 C;  4JF7 A;  3RK2 B;  1L4A A;  4W7Y A;  1N7S B;  1N7S C;  4W80 A;  2NPS B;  1URQ C;  1SFC D;  3B5N D;  2N1T C;  1JTH B;  1URQ A;  2N1T D;  1GL2 C;  4N78 E;  1KIL A;  3RK3 B;  3HTK B;  1L4A D;  4WY4 B;  1KIL C;  1NHL A;  5CCH A;  1KIL B;  1GL2 B;  3RK3 C;  1GL2 A;  2NPS D;  1URQ D;  5KJ7 A;  1SFC B;  2HG5 D;  3B5N B;  4WY4 A;  3VOP A;  2KOG A;  4W7Z A;  2PP6 A;  1KIL D;  3P8C E;  1T3J A;  2NPS A;  4OH8 B;  5CCH C;  5CCG C;  2H8P D;  5CCH D;  3PP5 A;  3HD7 D;  4LGD E;  2WZ7 A;  1GL2 D;  1JTH A;  1URQ B;  2N1T A;  2M8R A;  3M0D C;  2YMY A;  2HFE D;  3RK2 D; 
#chains in the Genus database with same CATH topology
 2FYN C;  3NFQ A;  3RL0 C;  5K5G B;  2P67 A;  4ASV A;  1M90 Q;  3M9B A;  1OX3 A;  1DEB A;  1M7L A;  2KNC A;  3IR9 A;  3V2N A;  4H13 B;  1L0L D;  3H1J D;  3EQ2 A;  3L75 D;  1KIL E;  3Q5S A;  1FDI A;  4QMA A;  5AW1 B;  3H1H J;  3VMY A;  1IFN A;  1VQP P;  1H88 A;  3EWK A;  2HPC A;  3TDK A;  1NTZ G;  1JY3 O;  3FWL A;  1MKM A;  3R4Y A;  3BVH A;  1L0N K;  3HD7 A;  4JYC A;  2D2C D;  1QL1 A;  3F5H A;  1N7S D;  1NTZ D;  2N9B A;  3L74 D;  2YKQ A;  1USD A;  1Y9B A;  1RE3 C;  5AVS B;  2KNC B;  5AW3 B;  2KK7 A;  4I7Z C;  5APW A;  3TGU E;  2RH0 A;  1JNM A;  3NTN A;  2WVR A;  4WY4 D;  5KLV K;  3IFM A;  2XNX A;  1FZC B;  4WY4 C;  1DIP A;  4I2L C;  1SFC C;  1J1D B;  1SQQ E;  4XE5 B;  1YIT P;  3O8Z A;  1HVV A;  1NAF A;  1OW8 A;  2MKV A;  1BGY G;  2WWW A;  3QH9 A;  2BCC E;  4U7J A;  2KXP B;  3WUV A;  1SFC A;  4PD4 I;  5BU8 B;  1U7M A;  1FE6 A;  1LGH B;  5KAI E;  3CC2 P;  4H0L D;  2FKW B;  1QVF O;  4I6M C;  1G1I A;  2E5Y A;  2PRR A;  2R5D A;  1S72 P;  3RK2 B;  2GA1 A;  4DJG A;  2P58 A;  2WT7 A;  1N86 A;  5APT A;  5BU5 A;  3TYY A;  1AQT A;  1K05 A;  1OMI A;  4W7Y A;  1YQ4 C;  1X9V A;  1NU1 K;  3JSV C;  4D6T J;  1IZN B;  4NPE A;  1BCC E;  1YYC A;  4EYY Q;  2K1A A;  1NTK J;  3BCC E;  4PD4 E;  5CHX A;  4O9B A;  2O01 H;  1FJK A;  1MFZ A;  1ZXG A;  2P10 A;  2W6A A;  2Y0C A;  5KAF E;  1QGK B;  3U1A A;  3V4Q A;  4B86 A;  2C0W A;  3AE5 C;  5KLI B;  2K9Y A;  3B5N D;  5KLV E;  3S1K A;  4BWN A;  2D2C B;  3CCS P;  2OYI A;  2N1T C;  1EZV D;  1S9K D;  5KKZ C;  1GL2 C;  1FS0 E;  3H1H E;  1DD4 A;  3HTK B;  3CX5 H;  2R44 A;  2JWA A;  1L4A D;  1NAY A;  1PV3 A;  2M3B A;  1T8Z A;  1EZV G;  1J1E B;  2Y9Y A;  3EFG A;  4Y99 C;  3CX5 E;  4D6T E;  1N73 C;  1KYO E;  3BRV B;  1JEK A;  1KIL C;  4DZO A;  1HJ0 A;  3H1I E;  5AW5 B;  2JDI H;  3L70 J;  1AA0 A;  1T2K C;  1LTB C;  3WMM 0;  3CXH I;  3AE9 C;  1R5L A;  1K8A Q;  1MZ9 A;  3BRT B;  1SQX J;  2YKP A;  4IFM A;  2OTK E;  4K3A A;  1U7J A;  3G4S P;  2KZI A;  1OVV A;  1SQX K;  1PPJ E;  2OQQ A;  2IZ1 A;  3AEG C;  3L72 G;  2GUV A;  4YPC A;  1S2E A;  2NPS D;  3U1C A;  4UB6 H;  2Z4E A;  4EI2 A;  1KQL A;  5GTH E;  1HUC A;  4H13 C;  3CPW O;  2I1K A;  1KQF B;  2IYP A;  3CWB E;  3L35 A;  5KJ7 A;  2C9N Y;  3F89 A;  3OAK A;  3TGU J;  3M91 A;  3FX0 A;  1BE3 G;  1Q81 Q;  4EIJ A;  2HPC B;  4PJ0 E;  2HG5 D;  1KN7 A;  2KOG A;  1YJN P;  2ZYD A;  2L91 A;  5AVR B;  1P84 H;  2ZXE B;  4GT1 A;  1NTK E;  1OVR A;  2AXT E;  5GTI H;  3KPE A;  3HE4 B;  2K88 A;  2KP8 A;  3V2R A;  2P2U A;  4OWF A;  2H88 C;  1PFI A;  3RK3 B;  2YNY A;  3A0B E;  3A7O A;  3IF4 A;  1J1D C;  2WSE J;  1E5W A;  1NTZ K;  5H2F E;  4PV1 D;  1RF0 C;  1FZA A;  1ZOY C;  1SQP J;  2KUB A;  3H1L E;  1AVY A;  4U3F G;  2PFX A;  1H0T A;  1DX7 A;  1P84 I;  2W83 C;  1JTH A;  1VL2 A;  1KFN A;  3H1K G;  3AE2 C;  4U3F D;  5AVV B;  1G2C B;  2E75 C;  3M0D C;  5B66 H;  2YMY A;  2M0B A;  2QE7 H;  2HFE D;  2IBZ G;  3N4X A;  4JBZ A;  3CMA P;  5APY A;  4JQ0 D;  4HKZ H;  1KB9 E;  1KMI Z;  4C7R A;  3H1K J;  3BAS A;  1YTZ T;  3WU2 H;  3GHG C;  2YKO A;  4WVZ A;  1L0L G;  3H1J G;  3L75 G;  3CME P;  2ZXX A;  1JCC A;  1CW5 A;  1KTM A;  2FFD C;  2J58 A;  2ZVN B;  3SSU A;  2FFD B;  2YXQ B;  1EXI A;  1L4A C;  2W90 A;  3HD7 B;  3FGA D;  1FC2 C;  3L70 G;  1AVO A;  1VPC A;  4PV1 B;  3W68 A;  5CCG D;  3WU2 E;  1FZF A;  1DD3 A;  3MIW A;  3MD0 A;  3NMD A;  1LTT C;  1N2D C;  3CXH E;  1FZC C;  3CWB J;  4HH2 A;  2FXP A;  2R3S A;  4BXL A;  3Q5R A;  3Q3D A;  1HBW A;  3AEC C;  1A02 J;  2QM7 A;  1PP9 E;  1KYO I;  1SQB J;  1FU1 A;  2JEE A;  2N9Y B;  3CD6 P;  2O1K A;  2QIW A;  3H1K D;  1SQV D;  1NU1 J;  1JM0 A;  1SLQ A;  2XDJ A;  1L0N G;  1NKZ B;  3RK3 D;  1Q90 D;  1BGY D;  1PGQ A;  2JP3 A;  1IC2 A;  1LT9 B;  1S1C X;  1S3J A;  1M1J B;  1SQV G;  1IK9 A;  1NU1 E;  2AXC A;  1Z56 A;  1VF5 B;  2A06 E;  1VF5 C;  3GG2 A;  4KT0 J;  2YO3 A;  1M56 D;  4R4M A;  1PGP A;  3CI9 A;  5DJU B;  1CI6 A;  1PP9 J;  1SQB E;  2P7J A;  5AW4 B;  4K35 A;  3B5N A;  2VRS A;  1GW4 A;  1RQV A;  4WBA A;  5AVY B;  3V6I A;  2IFM A;  4TT3 H;  3BAT A;  2B89 A;  1SQX D;  2CPS A;  3Q1M A;  3D6Z A;  3E1I A;  3GHG B;  1NTM E;  2CPB A;  4RKU J;  3SWF A;  1HWT C;  3P8M C;  1RF1 C;  1SQX G;  5AW0 B;  2AEJ A;  2K3R A;  3Q5P A;  2W8Z A;  3OW2 O;  1SS1 A;  1L0N J;  1A02 F;  3KDP B;  1JO5 A;  1QLE D;  2NPS B;  1OWA A;  3JCU H;  4EDF A;  5AVZ B;  1GU5 A;  2K9J B;  1FAV A;  3C8V A;  5AVU B;  5KTB A;  3USS A;  1L0L K;  1URQ A;  1NTZ E;  2N1T D;  1ZRT E;  3M0D A;  3HUS C;  4N78 E;  3HUS B;  3MUD A;  4H44 B;  1HH0 A;  5B66 E;  3L75 J;  2QG4 A;  4WY4 B;  2WT7 B;  2A45 I;  1EDL A;  3R2P A;  5APQ A;  1VQM P;  1USE A;  3RBX A;  3HUS A;  2LR2 A;  4LC1 A;  1HGZ A;  1P84 D;  2PAJ A;  3L37 A;  1NOH A;  1LJ2 A;  2M3E A;  3MHV A;  2W27 A;  3CCR P;  3U59 A;  3OA7 A;  4HJG H;  2ZYG A;  1KD1 Q;  4GIF A;  1OW6 A;  1IK7 A;  1JUN A;  4L73 A;  1VQ7 P;  1JOC A;  1GMJ A;  1SQP D;  2O3J A;  5KLI C;  1LTG C;  1NKN A;  2JJL A;  2E43 A;  3I5C A;  5CJ0 A;  3CCL P;  2FYZ A;  3VMA A;  1H0T B;  1JCD A;  1SQV J;  2FY8 A;  4PJ0 H;  3P7K A;  1CZQ A;  3IAO A;  3VYI A;  1BCC G;  3B5N B;  1JY2 P;  2WSS H;  3AE4 C;  1FBM A;  1S5L H;  3I56 P;  3G6E P;  4EOT A;  1M1K Q;  2Q9I A;  1GK6 A;  5H2F H;  1GD2 E;  5AVX B;  1S4X A;  1GW3 A;  3P8C E;  1S9K E;  2GM4 A;  2V7Q H;  2Q3E A;  4H44 D;  5GTH H;  4XFJ A;  3CC7 P;  1Q82 Q;  4UB6 E;  2AEM A;  2KI7 B;  5TIS H;  3CCU P;  2HYN A;  3KQG A;  2G3A A;  2WSC J;  1KYO D;  1SQB K;  2AXT H;  2WPV B;  2XU6 A;  3L74 E;  3PHL A;  4JYB A;  5CCG C;  5B5E E;  4DT0 A;  4GDO A;  3PP5 A;  4H0L C;  5BVZ A;  3CCJ P;  2HR3 A;  4H13 D;  4BRY B;  2E42 A;  1X0T A;  3LID A;  2QVA A;  1N73 A;  2H7H A;  3L73 G;  1H89 A;  2H89 C;  2A45 G;  1GL2 D;  5E79 E;  5AW6 B;  3TGU G;  1JY2 N;  2OYH C;  1URQ B;  1YBK A;  3L73 J;  2N1T A;  1UII A;  2BEZ F;  3L73 D;  3N7N A;  2KLU A;  4A7P A;  3O6Q A;  4ZMD A;  3D6Y A;  2FFD A;  1SQQ G;  3AEF C;  4GOE A;  1BGY J;  3L72 E;  3VMZ A;  3AEB C;  1HTL C;  1T2K D;  1EDI A;  1RF1 B;  1ZV8 A;  2QRX A;  3G3Z A;  1JY2 O;  1FZG A;  2E76 D;  4GOF A;  3T97 A;  1WT6 A;  1IFP A;  3MTU E;  2WMM A;  3L70 D;  2Q3I A;  1VF5 D;  2NRG A;  2Y0D A;  1LP1 A;  4PD4 H;  4AQR D;  4ZKU A;  2KIK A;  1HF9 A;  2WSF J;  1GDT A;  1LT1 A;  1NTK K;  2NPS C;  1BE3 E;  2IBZ I;  3B71 A;  3L71 G;  3LW5 J;  2OYH A;  3HE5 B;  1VQ9 P;  2LXC B;  3MZW B;  3ABV C;  3I55 P;  3D71 A;  1ZLL A;  3L71 D;  3AE1 C;  5AW2 B;  5KLV D;  3A5T A;  3H1L J;  3BCC G;  3OJA B;  1YTZ I;  3MP7 B;  2FYU E;  1L0N D;  2IX7 C;  5AW7 B;  4TLF A;  5KJ7 D;  2YO2 A;  2RMZ A;  2JR8 A;  3SWY A;  5CCG A;  5KLV G;  2W6J H;  4Y28 J;  3V4W A;  2PGD A;  1SQQ J;  4D6T D;  2NZ2 A;  5GTI E;  2I8D A;  2I1J A;  3GW6 A;  5KAF H;  1KFM A;  4JPZ B;  3TNU A;  1NWQ A;  1NVO A;  3AE7 C;  3RBZ A;  1RF1 A;  4DOJ A;  1QEX A;  4U3F E;  1NTM K;  1VQO P;  4GKG A;  1FZE A;  2N1T B;  2QJP C;  3H1I G;  3CCE P;  3KYQ A;  1BDC A;  4IL6 X;  1FZB A;  1L4A B;  1KYO H;  1LTA C;  1NYH A;  1PPJ D;  3HD7 C;  2IYO A;  4HYT B;  5CBO A;  3TK1 A;  1M8O B;  1G1J A;  3VTP C;  1L4A A;  2JWD A;  3K5B A;  2QJK C;  1VQK P;  5KAI H;  1OZH A;  2HOD B;  5KKZ B;  1N7S B;  3CWB D;  1N7S C;  5AW9 B;  1NGM B;  3S9O A;  2B9B A;  1L0L E;  3H1J E;  5APS A;  1SVF A;  2QJK B;  2JO1 A;  1ZME C;  3VMX A;  3MUD C;  3CC4 P;  3CWB G;  2KSE A;  3G71 P;  1KC8 Q;  2E5T A;  2IFN A;  1GK4 A;  2M5A A;  3AE6 C;  1CSB A;  2HLO A;  3RL0 g;  3AEA C;  1LTJ B;  3AEE C;  4RO0 A;  5TJH A;  4YXW H;  1JTH B;  2WSC H;  1WRG A;  2J59 M;  2ZJS E;  3L4F A;  4IOI H;  1KIL A;  5CMZ A;  5AVT B;  5CBN A;  4IFF A;  3H1I J;  2B87 B;  2WPS A;  1LT9 C;  4H0L B;  3WUU A;  1M1J C;  2WPQ A;  1AJY A;  1LTJ C;  2OYO A;  1ZR4 A;  3HTK A;  2BCC G;  5E79 H;  1EZV I;  2KYV A;  2QJY B;  2QJY C;  2A06 D;  4L74 A;  3H32 A;  1VQN P;  2OYH B;  1JMB A;  2ZT9 C;  5CCH A;  1IFM A;  1VQL P;  2K9J A;  2BCC D;  1SQB D;  1R8E A;  1BSH A;  4MN4 C;  2A06 G;  2CK3 H;  4WB4 A;  5B5E H;  5KJ7 C;  4I1L A;  1X79 B;  1OXZ A;  1GL2 B;  1SQP G;  4U3F J;  3RGU A;  1GL2 A;  1SQB G;  1WMK A;  2YIU C;  4WWI A;  3RK3 C;  4PV1 C;  3KXD A;  4ASW A;  1BSN A;  1MUU A;  3O6Q B;  4ZKP A;  1SP4 A;  3QWO C;  3M9Q A;  1KQS O;  1BCC D;  2WIT A;  3B4S A;  5APU A;  1LWU A;  1NTM G;  2IBZ E;  1RHZ B;  2RKL A;  5AVW B;  2XV5 A;  1BDD A;  1LNQ A;  4ZNC A;  2OTL P;  2Q5U A;  3FXD A;  1KZU B;  3L74 J;  1SFC B;  1LWU B;  1RE4 A;  1LWU C;  4WY4 A;  1YHQ P;  1Q86 Q;  1EDJ A;  2LKM A;  2ZFC A;  3M0A A;  5APV A;  3L75 E;  3VOP A;  2V7Q J;  1KIL D;  1YIJ P;  3PRJ A;  1T3J A;  1X8Y A;  1ZRT D;  2NPS A;  1IFI A;  3G9R A;  4KHX A;  4N78 D;  2C9L Y;  1L0L J;  3CXH D;  3H1J J;  3T97 B;  5TIS E;  1Q2N A;  3CCQ P;  1FDM A;  1OW7 A;  4OH8 B;  3CX5 D;  1EQ7 A;  2XKM A;  3V5B A;  1PGO A;  3M06 A;  2H8P D;  2HOD A;  2KZJ A;  1RQU A;  5CCH D;  3HE4 A;  4LGD E;  3TGU D;  3GHG A;  3RK3 E;  1RE3 A;  1S5L E;  4NPF X;  4OVN F;  3VP8 A;  1EC5 A;  1BGY E;  3L72 J;  3SWK A;  2D2C C;  1AV1 A;  2WZ7 A;  1HJB A;  1NTM J;  1R5S A;  1SQQ D;  4KJM A;  2Z5H A;  3D70 A;  2E75 D;  1EXJ A;  3CCV P;  3AE3 C;  1DEE G;  1IFD A;  1M57 D;  1NU1 G;  3MGN A;  4RES B;  5AW8 B;  3UIA A;  2OAR A;  1ZW0 A;  1YJ9 P;  1QVG O;  2OTJ P;  2ZT9 D;  2Z5I A;  1LTS C;  4C46 A;  1JY3 P;  1RH5 B;  2KS1 B;  2GUS A;  3VP9 A;  5CJ4 A;  3JCU E;  4Z1M H;  1Q7Y Q;  2JKV A;  2WTY A;  3PTZ A;  3RK2 C;  4OGQ B;  1YJW P;  2KS1 A;  1ZP0 C;  2E74 C;  3NXS A;  2E74 B;  3L36 A;  4C7N A;  2FYN B;  3RL0 B;  1N7S A;  4IL6 H;  2KB7 P;  3LW5 H;  1FOS E;  4RJT A;  2WQY C;  3P8C D;  3BCC D;  4PD4 D;  1VDF A;  3B8E B;  4N3Y B;  1ZR2 A;  1W5C E;  1GU4 A;  1FJP A;  4AYC A;  3V2P A;  1RY3 A;  2ZYA A;  1IO4 A;  3H1H G;  1KV4 A;  1IFJ A;  2BAS A;  2FXO A;  4M3L A;  4UB8 E;  2E75 B;  3Q2Y A;  1GTW A;  1VQ8 P;  1EZV E;  3A2A A;  3FWN A;  4D6T G;  1E79 H;  1JY3 N;  1ZN5 A;  3H1L G;  3TSI A;  3PLN A;  2OYI C;  3H1H D;  1K04 A;  2A45 H;  5L8R J;  2K37 A;  2ZVO B;  1PL5 A;  3L74 G;  5KLV J;  1W2B O;  3H1L D;  2QM8 A;  1K73 Q;  4AUW A;  1K9M Q;  4GOD A;  3H1I D;  3B5N C;  1PZQ A;  2O01 J;  3P32 A;  5M1B A;  3W67 A;  1PGJ A;  4OGQ D;  4YXD C;  1PPJ G;  3CX5 I;  2E74 D;  1NO4 A;  3L73 E;  1T3U A;  3PJS K;  1BCC J;  1XTG B;  3RL0 D;  1AQ5 A;  3HRN A;  1S5L X;  3TF5 A;  1VQ5 P;  1X22 A;  1Y47 A;  5APX A;  1Y8A A;  3A0H H;  2Y9Z A;  4XA4 A;  3CCM P;  4JF7 A;  1W2E A;  2RN0 A;  2V4H A;  3KZI E;  4UB8 H;  3A0H E;  2B87 A;  1DH3 A;  2IZ0 A;  1OFC X;  2J5U A;  1HGV A;  2IPP A;  1SQQ K;  2Q1K A;  4IL6 E;  4BRY A;  1SQP K;  3AED C;  1NTZ J;  4NPD A;  3GF7 A;  1D7M A;  1OIP A;  4W80 A;  1URQ C;  1U57 A;  3L71 E;  1NTK G;  2UWJ E;  2WSE H;  1SFC D;  1TU3 F;  1KB9 H;  2XND H;  3JC2 2;  1L0N E;  3CL3 D;  2Y0E A;  3WUT A;  1NTK D;  2SPZ A;  1EDK A;  1SQV E;  1NJI Q;  3KZI H;  1YQ3 C;  2BEQ D;  3CXH H;  2Q7C A;  1YI2 P;  1NHL A;  2YXR B;  3CLQ A;  2KLV A;  1FOS F;  1AFO A;  4R4L A;  5DJT B;  1XTC C;  3ITK A;  5C39 A;  1KIL B;  1QL2 A;  3EFF K;  1MV8 A;  2MJZ A;  2Q6Q A;  3A3Y B;  1FDO A;  1LTJ A;  1QX8 A;  4Y99 B;  1J1E C;  5EFW B;  3L71 J;  1LT9 A;  1N73 B;  3ZDM A;  2FBW C;  3S4R A;  1L2P A;  1NH4 A;  2AEF A;  1URQ D;  1VQ4 P;  3PH0 A;  1GZL A;  5AVQ B;  1J2J B;  1NTM D;  2B88 A;  1IJD B;  1RE4 C;  2FYU J;  3AE8 C;  3L72 D;  2POH A;  4YTP C;  3H25 A;  2QSI A;  4N6J A;  4OGQ C;  1KB9 D;  1KB9 I;  2ZAE B;  1N8R Q;  3IN6 A;  1JMM A;  2YMK A;  1MFT A;  2FYU K;  3SFE C;  2E76 B;  3L70 E;  4CPG A;  1LTI C;  2DW3 A;  3E1R A;  3KHU A;  4L76 A;  1BE3 J;  3HE5 A;  1BE3 D;  3GMA A;  2H43 A;  2E76 C;  4W7Z A;  2PP6 A;  2O01 N;  4C7N B;  1LP1 B;  3VN0 A;  2ZT9 B;  1PP9 G;  2OYI B;  1T6A A;  2KSJ A;  1JB0 J;  2LXB A;  2R3C A;  2QJP B;  1KOR A;  3C1L A;  3E7K A;  3M9H A;  2FYU D;  4LLH A;  3TNU B;  3V2Q A;  5CCH C;  1PP9 D;  2XZR A;  3FXE A;  2ITA A;  1P84 E;  1N7L A;  3H32 B;  1SQV K;  2YIU B;  3BCC J;  3HD7 D;  3H1K E;  4DCK A;  1G2C A;  3II6 A;  4IFD K;  3GLM A;  3LIE A;  2FYU G;  3H6P A;  1FZC A;  2OGU A;  2QA4 P;  1OVU A;  4I7Z B;  4HB1 A;  2R32 A;  1NU1 D;  2C0X A;  2WPR A;  3GF3 A;  3SFD C;  3C9I A;  2L5G B;  2M8R A;  2QEX P;  2R5B A;  1RF0 A;  2W6B A;  2M5A B;  3A0B H;  2FXM A;  1CI6 B;  1SQP E;  2P1J A;  1H8A A;  1VQ6 P;  1M1J A;  2IDB A;  1PIX A;  1KQG B;  1UIX A;  2BCC J;  4H44 C;  1SQX E;  2O1J A;  2G8Y A;  2WSF H;  4L75 A;  2IBZ D;  3RK2 D; 
#chains in the Genus database with same CATH homology
 3RL0 C;  3NFQ A;  2P67 A;  3M9B A;  1DEB A;  1M7L A;  3IR9 A;  3V2N A;  3EQ2 A;  5AW1 B;  3VMY A;  2HPC A;  1IFN A;  1H88 A;  1JY3 O;  3BVH A;  1L0N K;  3HD7 A;  4JYC A;  1QL1 A;  5AVS B;  1N7S D;  5KLV K;  2N9B A;  5KJ7 C;  2YKQ A;  5AW3 B;  1RE3 C;  5APW A;  1JNM A;  3NTN A;  4WY4 D;  3IFM A;  2XNX A;  1FZC B;  4WY4 C;  4I2L C;  1SFC C;  1J1D B;  4XE5 B;  3O8Z A;  1HVV A;  1NAF A;  2WWW A;  1SFC A;  5BU8 B;  1LGH B;  2FKW B;  4I6M C;  1G1I A;  2R5D A;  3RK2 B;  2WT7 A;  1N86 A;  5APT A;  5BU5 A;  3TYY A;  4W7Y A;  1X9V A;  1NU1 K;  1YYC A;  5CHX A;  4O9B A;  2O01 H;  1FJK A;  1MFZ A;  3V4Q A;  2W6A A;  3U1A A;  4B86 A;  2C0W A;  2OYI A;  3B5N D;  2N1T C;  1S9K D;  1GL2 C;  3RK3 B;  3HTK B;  1L4A D;  2M3B A;  1T8Z A;  3EFG A;  1J1E B;  4Y99 C;  1N73 C;  3BRV B;  1KIL C;  4DZO A;  5AW5 B;  1T2K C;  1LTB C;  3WMM 0;  1MZ9 A;  3BRT B;  2YKP A;  4IFM A;  1SQX K;  3U1C A;  2GUV A;  2NPS D;  2Z4E A;  1KQL A;  1HUC A;  2I1K A;  3L35 A;  5KJ7 A;  2C9N Y;  3OAK A;  3M91 A;  4EIJ A;  2HPC B;  2HG5 D;  2KOG A;  5AVR B;  2ZXE B;  4GT1 A;  3KPE A;  3HE4 B;  2KP8 A;  3V2R A;  2P2U A;  1PFI A;  2YNY A;  3A7O A;  1J1D C;  1E5W A;  1NTZ K;  1RF0 C;  1FZA A;  1DX7 A;  1JTH A;  1KFN A;  5AVV B;  1G2C B;  3M0D C;  2YMY A;  3N4X A;  2HFE D;  5APY A;  4C7R A;  3BAS A;  1YTZ T;  3GHG C;  2YKO A;  1JCC A;  1CW5 A;  2FFD C;  2J58 A;  2FFD B;  1L4A C;  3HD7 B;  1VPC A;  5CCG D;  1FZF A;  3MIW A;  3MD0 A;  3NMD A;  1LTT C;  1N2D C;  1FZC C;  4HH2 A;  1HBW A;  1A02 J;  2QM7 A;  2JEE A;  1FU1 A;  2O1K A;  1SLQ A;  2XDJ A;  3RK3 D;  1NKZ B;  1IC2 A;  1LT9 B;  1M1J B;  1IK9 A;  1Z56 A;  2YO3 A;  3CI9 A;  1CI6 A;  2P7J A;  5AW4 B;  3B5N A;  2VRS A;  1GW4 A;  4WBA A;  5AVY B;  2IFM A;  3BAT A;  2CPS A;  3E1I A;  3GHG B;  1HWT C;  2CPB A;  3SWF A;  3P8M C;  1RF1 C;  5AW0 B;  1A02 F;  3KDP B;  1JO5 A;  2NPS B;  1OWA A;  5AVZ B;  1GU5 A;  1FAV A;  5AVU B;  5KTB A;  1L0L K;  1URQ A;  2N1T D;  3M0D A;  3HUS C;  4N78 E;  3HUS B;  3MUD A;  1HH0 A;  2WT7 B;  4WY4 B;  2A45 I;  3R2P A;  5APQ A;  3HUS A;  4LC1 A;  1HGZ A;  2PAJ A;  3L37 A;  1NOH A;  2W27 A;  3U59 A;  3OA7 A;  4GIF A;  1JUN A;  1JOC A;  1LTG C;  1NKN A;  2JJL A;  2E43 A;  3I5C A;  5CJ0 A;  2FYZ A;  1JCD A;  3P7K A;  1CZQ A;  3VYI A;  3B5N B;  4EOT A;  1JY2 P;  1FBM A;  2Q9I A;  1GK6 A;  1GD2 E;  5AVX B;  1GW3 A;  3P8C E;  1S9K E;  2GM4 A;  2HYN A;  3KQG A;  4JYB A;  2XU6 A;  1FZC A;  1SQB K;  5CCG C;  1FJP A;  5BVZ A;  2E42 A;  3PP5 A;  3LID A;  2H7H A;  1H89 A;  2A45 G;  1GL2 D;  5AW6 B;  1JY2 N;  2OYH C;  1URQ B;  2N1T A;  3N7N A;  2FFD A;  3VMZ A;  1T2K D;  1HTL C;  1RF1 B;  1ZV8 A;  3G3Z A;  1JY2 O;  1FZG A;  3T97 A;  1WT6 A;  3MTU E;  2Q3I A;  4AQR D;  4ZKU A;  1GDT A;  1NTK K;  2NPS C;  2OYH A;  3HE5 B;  1ZLL A;  5AW2 B;  3A5T A;  3OJA B;  1YTZ I;  5KJ7 D;  2IX7 C;  5AW7 B;  2YO2 A;  3SWY A;  5CCG A;  3V4W A;  2I1J A;  1KFM A;  3TNU A;  1NWQ A;  1RF1 A;  4DOJ A;  1NTM K;  4GKG A;  1FZE A;  2N1T B;  3KYQ A;  1FZB A;  1L4A B;  1LTA C;  3HD7 C;  4HYT B;  3TK1 A;  1G1J A;  3VTP C;  1L4A A;  2HOD B;  1N7S B;  5AW9 B;  1N7S C;  5APS A;  1SVF A;  3VMX A;  2IFN A;  1GK4 A;  1CSB A;  2HLO A;  1LTJ B;  1N73 A;  1JTH B;  2WSC H;  1WRG A;  2J59 M;  3L4F A;  5CMZ A;  5AVT B;  1KIL A;  4IFF A;  2WPS A;  1LT9 C;  1M1J C;  2WPQ A;  1LTJ C;  1ZR4 A;  3HTK A;  2KYV A;  3H32 A;  2OYH B;  5CCH A;  1IFM A;  4WB4 A;  4I1L A;  1X79 B;  1OXZ A;  1GL2 B;  4C7N A;  3RK3 C;  1GL2 A;  1MUU A;  4ZKP A;  1SP4 A;  3M9Q A;  2WIT A;  5APU A;  1LWU A;  5AVW B;  2XV5 A;  2Q5U A;  1KZU B;  1SFC B;  1LWU B;  1RE4 A;  1LWU C;  4WY4 A;  2LKM A;  2ZFC A;  3M0A A;  5APV A;  3VOP A;  1KIL D;  1T3J A;  1X8Y A;  2NPS A;  4KHX A;  1IFI A;  4N78 D;  2C9L Y;  1FDM A;  4OH8 B;  3V5B A;  1EQ7 A;  2XKM A;  3M06 A;  2H8P D;  2HOD A;  5CCH D;  4LGD E;  3GHG A;  1RE3 A;  3VP8 A;  2WZ7 A;  1HJB A;  2Z5H A;  1IFD A;  3MGN A;  4RES B;  5AW8 B;  3UIA A;  2OAR A;  4C46 A;  2Z5I A;  1LTS C;  5CJ4 A;  1JY3 P;  2GUS A;  3VP9 A;  2WTY A;  3RK2 C;  3NXS A;  3L36 A;  3RL0 B;  1N7S A;  1FOS E;  2KB7 P;  3LW5 H;  3P8C D;  1VDF A;  3B8E B;  4N3Y B;  1ZR2 A;  1GU4 A;  4AYC A;  3V2P A;  1RY3 A;  1IO4 A;  1IFJ A;  2BAS A;  4M3L A;  1GTW A;  3A2A A;  1JY3 N;  1ZN5 A;  3TSI A;  2OYI C;  2A45 H;  2QM8 A;  4AUW A;  3B5N C;  3P32 A;  1NO4 A;  1T3U A;  1AQ5 A;  1XTG B;  3RL0 D;  3HRN A;  5APX A;  4XA4 A;  4JF7 A;  1W2E A;  1DH3 A;  1HGV A;  2IPP A;  1SQQ K;  1SQP K;  4W80 A;  1URQ C;  2WSE H;  1SFC D;  3CL3 D;  2Q7C A;  1NHL A;  3CLQ A;  1FOS F;  2KLV A;  1AFO A;  1XTC C;  1KIL B;  1QL2 A;  1MV8 A;  2MJZ A;  3A3Y B;  1LTJ A;  4Y99 B;  1N73 B;  1J1E C;  1LT9 A;  1NH4 A;  1URQ D;  5AVQ B;  1GZL A;  1J2J B;  1IJD B;  1RE4 C;  2POH A;  4N6J A;  1JMM A;  2FYU K;  1LTI C;  3HE5 A;  2H43 A;  4W7Z A;  2PP6 A;  4C7N B;  3VN0 A;  2OYI B;  2KSJ A;  2R3C A;  3M9H A;  3TNU B;  4LLH A;  3V2Q A;  5CCH C;  2XZR A;  3H32 B;  1N7L A;  1SQV K;  3HD7 D;  4IFD K;  1G2C A;  3II6 A;  3LIE A;  3H6P A;  2R32 A;  2C0X A;  2WPR A;  3C9I A;  2L5G B;  2M8R A;  2R5B A;  1RF0 A;  2W6B A;  1H8A A;  2FXM A;  1CI6 B;  2P1J A;  1M1J A;  2WSF H;  2O1J A;  3HE4 A;  3RK2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...