3PP5A

High-resolution structure of the trimeric scar/wave complex precursor brk1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
63
structure length
63
Chain Sequence
TKTNIQKDWEQREFIEDMSINIQKIVEFLNKFELSTRNKLSDLNEKLTILDRQVDYLEATFKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Brk1
publication title High-resolution X-ray structure of the trimeric Scar/WAVE-complex precursor Brk1.
pubmed doi rcsb
source organism Dictyostelium discoideum
total genus 31
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2010-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3pp5A01
1JTHA 2YMYA 1N7SC 2N1TD 4WY4D 3RL0D 2N1TC 4JF7A 4WY4A 3HTKB 5KJ7C 1GL2A 3RL0C 1KILA 2HFED 4N78E 2H8PD 2N1TB 4WY4B 1GL2B 3P8CE 1KILB 1GL2D 2NPSD 4LGDE 1L4AD 4WY4C 1URQD 1GL2C 2PP6A 3RK2D 3B5NA 2NPSA 3TSIA 1L4AA 1KILD 1URQC 1URQA 1JTHB 5CCGD 1KILC 3VOPA 5CCGA 3B5NB 2NPSB 3RK3B 4W80A 1L4AB 1URQB 3RK2B 1SFCD 4W7ZA 1NHLA 4OH8B 1SFCC 5CCHD 1SFCA 3B5ND 3RK3D 4W7YA 5CCHC 3B5NC 5CCHA 2NPSC 3RK3C 1L4AC 3RK2C 2KOGA 3HD7D 1SFCB 5CCGC 3KYQA 3HD7A 1N7SD 2XDJA 3PP5A 1HVVA 2WZ7A 1N7SA 5KJ7D 2HG5D 2N1TA 2M8RA 5KJ7A 1XTGB 3HD7B 1N7SB 1T3JA 3M0DC 3RL0B 3HD7C
chains in the Genus database with same CATH superfamily
5KLVE 4H0LC 2FYZA 2IYOA 1MZ9A 2OQQA 2E76C 1LTAC 4DT0A 2KZIA 1EQ7A 1H0TA 1PGPA 1JY2N 2FYNB 4KHXA 1AQ5A 2P7JA 4UB8E 3L71D 1S72P 1OVRA 4A7PA 3HUSC 5B66H 3TNUB 4WB4A 3H32A 5M1BA 1G1JA 3CCVP 1PP9G 4H44D 4IFDK 3BASA 1KV4A 3RK2D 3B5NA 4DZOA 1CZQA 3TSIA 3GHGA 1J1EB 2WPVB 2IBZE 2B88A 1M8OB 3FXDA 1YI2P 3KZIE 2ZVOB 1LWUB 1Q2NA 1BE3E 1MUUA 2FY8A 1SQVE 1L0LE 3B5ND 2FKWB 2DW3A 1FZFA 1NTMK 3E1IA 2QM7A 1RE3C 3A2AA 5GTHE 1U57A 1K8AQ 1BCCG 2WITA 1NYHA 1BGYG 5AW7B 1SLQA 2Y9YA 1NVOA 1LTJC 2HODA 1JMBA 2CPSA 2E75D 1N7SA 4HYTB 3LW5H 2O01N 1NTKJ 4XFJA 3A5TA 5AW1B 3Q5SA 2FXMA 3L74E 2H88C 1AJYA 5AVQB 4OVNF 3PHLA 2E76B 2KNCB 4GDOA 1KQSO 2QJKB 2KSJA 2FXPA 2RH0A 4IOIH 3L70D 2LXBA 3H1HE 1NKZB 3CCSP 3AEFC 2W83C 3HUSB 1NTZJ 1CW5A 3E7KA 2B87B 2A45H 1RF0C 3VMZA 2E42A 3H1JE 5KAFE 3CL3D 2NPSD 1EDJA 2QM8A 1URQA 1IFDA 1JTHB 5KLVK 1IK9A 2V7QJ 3H1IG 2AEJA 3EFFK 2W8ZA 1S1CX 3HE5A 4W80A 3AE2C 1EZVG 1T2KD 1SFCD 3EFGA 4GIFA 4C7NB 1IO4A 3BRVB 3CCEP 1XTCC 1AFOA 5APSA 2OYIC 3RK3C 2Q7CA 2IX7C 3CXHE 2B89A 1J2JB 2K9JA 1GK6A 5KLVD 5KAIH 1HVVA 2BASA 2UWJE 3D6ZA 2D2CD 3H1JJ 1SQVK 3BRTB 1W2BO 2O01J 2YKOA 1L0LK 3A0HE 2V4HA 4PJ0H 3MD0A 1SQXE 1FZBA 1GZLA 2J58A 1DEBA 3HTKB 5KJ7C 4ASWA 1YQ3C 4U7JA 3CD6P 2BCCE 3CMEP 3WUTA 1EDLA 2IBZD 4L76A 1L2PA 3FXEA 1BE3D 2Q1KA 5L8RJ 4UB6E 1OVVA 1SQVD 1L0LD 2RKLA 3BATA 4U3FE 2ITAA 1PP9J 2XV5A 1KORA 4TLFA 3GHGC 1YITP 1X8YA 4NPDA 1S9KE 3H1KE 1N73B 3V2PA 2OYIB 3RK3B 4JYBA 1JY3N 2JR8A 2WSEJ 2FFDB 1SQXJ 3L74D 2Y0EA 3KXDA 3Q5PA 1H8AA 3H1LG 2R3CA 4WVZA 1BCCJ 2AEMA 2BCCJ 3H1HD 4BWNA 1WT6A 3GW6A 2W6AA 3TDKA 2ZT9C 3L75E 1P84E 1GW4A 4EYYQ 2NRGA 4U3FJ 1AV1A 3RBZA 1HJ0A 1UIIA 2OTKE 3H1JD 1RF1C 2V7QH 1SQPJ 4I2LC 2OTJP 1RQUA 4GODA 3CCMP 1USDA 1OW6A 1KD1Q 1HUCA 1RH5B 1YQ4C 1S3JA 1NTMG 1GDTA 5B66E 1NJIQ 2G8YA 1X0TA 5AW8B 3L70G 2POHA 1M90Q 1LT1A 1QVFO 2WT7B 2R44A 3MZWB 1URQC 5BVZA 2IZ0A 1HBWA 3CXHD 5BU5A 2JJLA 2QJPC 3L75J 4TT3H 1FAVA 3G4SP 3JCUH 1ZW0A 2O3JA 4PV1C 3WMM0 2KNCA 1HF9A 2O01H 1M1JC 2PFXA 4YPCA 2KB7P 3W68A 1KB9I 4YXDC 3KPEA 2KK7A 2ZT9B 2XZRA 4GKGA 1SQXD 3AE8C 2B87A 2GUSA 4PD4I 1VQ8P 3CCUP 1FZCC 2BCCD 1RF1B 1Q7YQ 1YYCA 5AVZB 3NMDA 3V5BA 1JTHA 1M7LA 2OTLP 5KLVG 3RL0D 2IFMA 4U3FD 1M1KQ 3CCLP 1VQOP 1QX8A 1IC2A 1S9KD 2YNYA 3H1KD 2WSEH 2FYUE 3CLQA 1SQPD 3NFQA 5KLIC 1ZR4A 3KQGA 4C7RA 1U7MA 2RN0A 3VMAA 3I5CA 2QJPB 2KS1B 3VMYA 4WY4C 1QVGO 1KYOI 1ZV8A 1N8RQ 4PV1B 2M3BA 3AEAC 2M5AB 2JP3A 2Y9ZA 1LTSC 1QL1A 5AVXB 1AQTA 1KC8Q 1M1JB 3AE1C 1YBKA 1KMIZ 1SQQE 1BE3G 3IAOA 4BRYA 1SQVG 3L75D 1L0LG 5CCHA 1P84D 4D6TE 1HH0A 2MJZA 3N7NA 2E5YA 3HTKA 3II6A 3AECC 5AVVB 3U59A 1FZCB 4EIJA 1OX3A 3EQ2A 4EOTA 5KAIE 5C39A 4HB1A 3H6PA 1G2CB 2VRSA 4YTPC 1XTGB 5APXA 1SQBJ 2JO1A 1JY2P 1X22A 3L74G 1PFIA 3HD7C 1OVUA 4PJ0E 3MIWA 5KKZB 1SP4A 3LIDA 1N73A 3GF3A 3H1HG 2I8DA 4GOFA 5APTA 4N3YB 1AA0A 1ZR2A 1ZXGA 2FFDA 4WY4B 1LT9C 3PJSK 2ZAEB 1RY3A 5E79H 1FU1A 3BCCJ 1YHQP 1NH4A 2L5GB 2HLOA 1NTKE 5BU8B 4M3LA 5CJ4A 2FYUK 1DD3A 1X79B 2O1KA 2XDJA 1SS1A 5KJ7D 3RGUA 1NTZE 2M8RA 3AE3C 3HD7B 5APUA 3L36A 2ZXEB 1SQQK 2GA1A 1KQLA 1HWTC 2FYUD 2WT7A 2BEZF 1PGOA 3L72G 1S5LX 1A02F 4H13C 3TGUG 5TJHA 2N1TC 1GL2A 1LT9B 1BDCA 4H0LB 3PLNA 1VF5D 4EI2A 3GG2A 2XKMA 1LTBC 3P8CE 4MN4C 1SQQD 3P7KA 3WU2H 2N9YB 3MUDA 1GL2D 2NPSA 1VL2A 4WBAA 4D6TD 2OYHC 5CHXA 4EDFA 1KILC 3PH0A 2WMMA 3H1KG 2AXTH 1QL2A 1KQGB 3JCUE 1JM0A 2AEFA 1FOSF 2ZT9D 1YIJP 1SFCA 1SVFA 1CI6B 1OW7A 5CCHC 3T97B 4GOEA 1L4AC 2Q6QA 4LLHA 1LTGC 1NU1G 1T3UA 1EZVI 5CCGC 3NXSA 1GMJA 3B8EB 3SFEC 3C1LA 3L73J 4ZNCA 2XNXA 2W6JH 1LTTC 2KSEA 1NTKK 1LTJB 2SPZA 1IFNA 4H13B 4O9BA 1RE4C 1R5SA 3V2QA 3CWBG 2HYNA 4JPZB 1PP9E 2M5AA 3CC7P 1L0NJ 3NTNA 3S4RA 2HPCB 2QEXP 1FS0E 1GK4A 1W5CE 5AVUB 4YXWH 3V6IA 2O1JA 1NTZK 3EWKA 1NTKD 4I7ZC 4PV1D 2A06E 2CPBA 2OYHB 1KILB 1JY3P 3CX5I 5AVTB 1MFTA 2FBWC 4LGDE 3WUVA 4RKUJ 5AW6B 5TISH 4KT0J 1BCCE 4IL6H 3IN6A 3B71A 1KB9H 1RQVA 3Q3DA 4RJTA 1L4AB 1NTZD 4L75A 4W7ZA 1YJNP 1WRGA 1PGJA 3L4FA 2LR2A 4PD4H 1NWQA 3B5NC 3VN0A 3RBXA 1R8EA 2OGUA 1ZRTE 5DJTB 3L71G 1LP1A 3GMAA 1SQPE 1R5LA 3O6QA 5B5EH 4Z1MH 2WSCJ 4JQ0D 2E75C 1VPCA 3CMAP 2J5UA 1NGMB 3TK1A 4JYCA 1QLED 2ZJSE 3P8CD 4OGQC 1JO5A 1BGYJ 5APYA 1OXZA 1N7SC 4WY4D 3L72J 3Q1MA 4I7ZB 2WQYC 3D71A 3TGUJ 3IR9A 3TNUA 1KYOH 4HJGH 1JEKA 3JC22 3L37A 2K9YA 1H0TB 2FYUG 2YMKA 1KQFB 3MTUE 5E79E 4LC1A 1JB0J 1U7JA 3AEDC 3VP8A 3QH9A 3VTPC 1M56D 3JSVC 2MKVA 1LWUA 3H25A 3I56P 3H32B 4N6JA 1K9MQ 3OA7A 3O8ZA 1QGKB 2WPRA 3B5NB 1NOHA 1BSNA 3GHGB 1SQQG 1NHLA 1T2KC 1SFCC 4B86A 2R32A 1SQXK 3HD7D 3D6YA 3M0DA 4L73A 1J1DC 3H1IJ 1NU1J 1NKNA 4Y99C 1PP9D 5APQA 1FZGA 3P8MC 1ZOYC 3RK3E 1PPJE 1FZAA 1YTZI 4OGQB 4OWFA 2HODB 1ZN5A 3KHUA 1T8ZA 1N7SB 4AQRD 1FZEA 3HUSA 2A06D 4H0LD 2FXOA 3OJAB 2E76D 3P32A 5EFWB 4JBZA 3CC4P 1VDFA 1T6AA 1BCCD 1SQPK 2R3SA 1IZNB 1JY2O 1S4XA 4NPEA 3T97A 3WU2E 1EDKA 1Y47A 3H1LE 1H88A 5APWA 1RE3A 1LTIC 1ZRTD 1PGQA 1ZP0C 2WSCH 4C7NA 3W67A 1BSHA 2WPQA 1LTJA 2Y0CA 2AXTE 1SQBE 4RESB 1URQB 2E5TA 2HR3A 1J1DB 3MGNA 4W7YA 3HE5B 3OAKA 4DOJA 4Y99B 4XE5B 3CCQP 2QG4A 2KOGA 1OZHA 3V2NA 4XA4A 2KZJA 1Y9BA 1VQ7P 1VQ6P 5AVSB 2HPCA 1ZMEC 1GTWA 2IBZG 2H7HA 1UIXA 2QVAA 3CI9A 2K9JB 2M3EA 4R4LA 3BCCE 3SWYA 3SFDC 4K3AA 1NTME 3H1LJ 3AE4C 2QJYC 3G71P 1RF0A 4QMAA 2YMYA 2P58A 3VYIA 4ASVA 2WVRA 2XU6A 1GW3A 2Z5HA 2E74C 1VQPP 3M06A 1VQKP 2YO3A 5APVA 1USEA 1VQ4P 1VQNP 2K3RA 2B9BA 3TF5A 2OYOA 3RL0g 3CCJP 1L4AD 5KLIB 1LWUC 1JNMA 2OYIA 2W90A 5TISE 1YJ9P 4IL6E 5CCGD 1YTZT 1KB9E 3BVHA 1DEEG 1NTMJ 2C0XA 1PZQA 3H1JG 3RK3D 1PPJD 2AXCA 2YXQB 3L70J 1Q82Q 1IFIA 4PD4E 2K1AA 3TYYA 2K37A 1OMIA 2WSFJ 1FDIA 4DCKA 1KFNA 1AVYA 3D70A 3AE5C 2JDIH 2CK3H 3PP5A 1YJWP 2Q5UA 5B5EE 5KJ7A 1CSBA 2QJKC 2QJYB 3CXHI 2I1JA 1OIPA 4KJMA 3FWNA 1IFPA 1SQBK 1T3JA 2E74B 1LGHB 5KTBA 2P10A 1FDOA 4I1LA 1FBMA 3CX5H 1HGZA 4AUWA 2P2UA 3RL0C 3H1LD 5GTIH 1KYOE 1K05A 3GLMA 5AW5B 3R2PA 2WSSH 2A06G 1SQBD 3MHVA 2PAJA 2JWAA 1S5LH 1SQXG 2IFNA 2WTYA 2QA4P 5KLVJ 2H89C 1LJ2A 3L73E 2BCCG 4GT1A 2Z4EA 3IF4A 3GF7A 1W2EA 1OFCX 2R5BA 2I1KA 4OH8B 1HJBA 1N86A 3N4XA 1JY3O 1IFMA 1KTMA 2M0BA 4NPFX 3A0BH 4U3FG 1MV8A 1AVOA 3BCCD 4OGQD 1NTMD 1DH3A 1FDMA 4RO0A 1QEXA 1N7SD 1L0NE 2ZYDA 1SQPG 2WZ7A 1RF1A 3AEEC 2W27A 3F89A 1EXIA 3PRJA 4IFMA 1BE3J 3HRNA 2ZFCA 1SQVJ 2WPSA 1L0LJ 2C9LY 2XNDH 3RL0B 4AYCA 1IFJA 3Q2YA 2KYVA 1JCCA 1EDIA 2YO2A 3F5HA 1P84I 2Q3IA 3AEBC 4L74A 3L75G 3I55P 1HTLC 3USSA 1KB9D 2KS1A 2N1TB 3L74J 2K88A 1N73C 1JCDA 2WSFH 1M1JA 1URQD 3H1HJ 4PD4D 4HH2A 2BEQD 1E79H 1IK7A 3G3ZA 1N2DC 2FFDC 2Z5IA 1EXJA 3SWFA 3U1CA 2L91A 1NAYA 1M57D 1FZCA 4H44C 4ZKPA 2N9BA 3M91A 3RK2C 1VQ5P 1BGYE 2QSIA 1G2CA 4BRYB 3L72E 3MP7B 1VQLP 3HE4B 1JOCA 2IPPA 3TGUE 2PRRA 3V2RA 3M9HA 2HG5D 5H2FH 4IL6X 1G1IA 1PPJG 1KYOD 2KLUA 1Q86Q 1X9VA 1BDDA 3CCRP 5AW4B 1FJPA 1Q81Q 1LNQA 2ZVNB 4R4MA 5K5GB 3CPWO 4K35A 4WY4A 3KDPB 2PGDA 2LXCB 4UB8H 2P67A 1L0NK 1VQ9P 3L73D 2HFED 4N78E 1VF5C 3QWOC 2JEEA 1GU5A 2Q3EA 4ZKUA 5AVWB 1FJKA 1GL2C 2PP6A 3H1IE 1DX7A 3VMXA 1NU1E 1MFZA 2OARA 1DIPA 1NAFA 1PV3A 2A45I 3KZIH 2WWWA 3FX0A 2ZYAA 1EZVE 1L0ND 4H44B 2KUBA 5AW9B 3RK2B 3CC2P 3UIAA 5AVYB 2A45G 3U1AA 1SQBG 3MUDC 5CBOA 3M0AA 1PIXA 5CBNA 5GTHH 2NPSC 1FE6A 1KILE 3CWBE 3KYQA 1K04A 3HD7A 1OWAA 2E74D 2YKPA 4WWIA 3H1KJ 3V4WA 1S2EA 3IFMA 3PTZA 4D6TG 3C8VA 2E75B 1WMKA 1LT9A 1Y8AA 3BCCG 1ZLLA 4Y28J 2KLVA 3L35A 2ZYGA 1VF5B 4JF7A 2GM4A 3CX5E 4C46A 5GTIE 2D2CC 2C9NY 2KP8A 1TU3F 1NO4A 1K73Q 1GL2B 3FGAD 1Z56A 5AW3B 3G9RA 5KAFH 3CWBJ 2E43A 1S5LE 1KN7A 2W6BA 1FOSE 3VP9A 2IDBA 1HGVA 5DJUB 1BGYD 3L71E 1A02J 2J59M 1EC5A 3L72D 3C9IA 3WUUA 1CI6A 4ZMDA 1JMMA 2NPSB 3TGUD 3M9QA 2R5DA 1RHZB 2Y0DA 2YIUC 2QIWA 4CPGA 2NZ2A 1JUNA 3SWKA 3A0BE 2JWDA 3SSUA 3CXHH 3ITKA 3AE9C 1SFCB 1PL5A 1NTKG 3V4QA 1IJDB 5CMZA 1NU1K 2KI7B 2N1TA 1GD2E 5KKZC 4I6MC 2IBZI 1VQMP 2ZXXA 4N78D 4HKZH 2QRXA 3A0HH 2LKMA 4BXLA 1MKMA 3K5BA 4H13D 3OW2O 3L71J 1GU4A 2D2CB 2N1TD 1Q90D 2KIKA 2QE7H 3G6EP 1NTZG 3H1ID 1NU1D 3E1RA 3LW5J 2OYHA 3AE7C 1KILA 2C0WA 3A3YB 1H89A 2H8PD 2IYPA 4IFFA 1EZVD 2FYNC 4UB6H 3A7OA 3L70E 1KZUB 1DD4A 2H43A 2GUVA 3LIEA 3HE4A 1L4AA 1KILD 5AW0B 2YXRB 2P1JA 3CWBD 3S9OA 3VOPA 3R4YA 5CCGA 1E5WA 3L73G 2YIUB 3Q5RA 1D7MA 1J1EC 1FC2C 1OW8A 2FYUJ 3FWLA 3S1KA 5CCHD 2RMZA 3AEGC 3ZDMA 5CJ0A 1N7LA 1RE4A 2G3AA 4DJGA 3B4SA 5AW2B 1KFMA 2YKQA 1L0NG 3AE6C 5H2FE 3CX5D 1SQQJ 1LP1B 3ABVC 1P84H 2KXPB 2IZ1A 3O6QB 3M0DC 3M9BA 5AVRB 2Q9IA 4D6TJ 2JKVA
chains in the Genus database with same CATH topology
1JO5A 5APYA 1JTHA 1IFJA 1M7LA 1OXZA 1N7SC 2KYVA 4WY4D 2FYZA 1JCCA 1MZ9A 3RL0D 1LTAC 2YO2A 1EQ7A 2IFMA 3IR9A 2Q3IA 1JY2N 3TNUA 4KHXA 1AQ5A 1IC2A 2P7JA 1S9KD 2YNYA 1HTLC 2WSEH 3CLQA 3L37A 2N1TB 3HUSC 3NFQA 3TNUB 1ZR4A 3KQGA 4C7RA 3MTUE 4WB4A 3H32A 4LC1A 1G1JA 1N73C 3I5CA 1JCDA 2WSFH 3VP8A 3VTPC 3VMYA 1M1JA 3BASA 4WY4C 4IFDK 1URQD 3RK2D 3B5NA 4HH2A 1LWUA 4DZOA 1CZQA 3TSIA 1ZV8A 1J1EB 3GHGA 3G3ZA 3H32B 1N2DC 2M3BA 4N6JA 2FFDC 3OA7A 1LTSC 2Z5IA 3O8ZA 1QL1A 5AVXB 3SWFA 3U1CA 1M1JB 2WPRA 3B5NB 1NOHA 1LWUB 3GHGB 1MUUA 1NHLA 1T2KC 1SFCC 3B5ND 2FKWB 1FZCA 4B86A 1FZFA 1NTMK 5CCHA 3E1IA 4ZKPA 2QM7A 1RE3C 3A2AA 1HH0A 2R32A 2MJZA 2N9BA 3M91A 3RK2C 1SQXK 3HD7D 3M0DA 3N7NA 2WITA 3HTKA 1G2CA 3II6A 5AW7B 1J1DC 1SLQA 5AVVB 3U59A 1LTJC 4EIJA 1FZCB 3HE4B 1JOCA 1NKNA 4Y99C 2HODA 2IPPA 2CPSA 5APQA 1FZGA 3EQ2A 3M9HA 1N7SA 3V2RA 4HYTB 4EOTA 3LW5H 2HG5D 3P8MC 3H6PA 1G2CB 2VRSA 3A5TA 5AW1B 1XTGB 5APXA 1FZAA 1YTZI 1G1IA 2FXMA 2HODB 1ZN5A 1JY2P 5AVQB 1T8ZA 1N7SB 4AQRD 1X9VA 1FZEA 1PFIA 3HUSA 5AW4B 1FJPA 3HD7C 2KSJA 3OJAB 3MIWA 1SP4A 1NKZB 3LIDA 1N73A 3P32A 5APTA 3HUSB 4N3YB 4WY4A 1ZR2A 3KDPB 1VDFA 1SQPK 2P67A 1L0NK 1CW5A 1JY2O 2HFED 4N78E 2FFDA 4WY4B 2JEEA 1LT9C 2A45H 3T97A 1GU5A 1RY3A 1RF0C 1FU1A 3VMZA 2E42A 4ZKUA 5AVWB 1FJKA 4AYCA 3CL3D 2NPSD 1GL2C 2PP6A 1H88A 5APWA 1RE3A 1LTIC 2QM8A 3VMXA 1MFZA 1DX7A 2OARA 1URQA 1NH4A 1IFDA 1JTHB 5KLVK 1IK9A 2L5GB 1NAFA 2WSCH 4C7NA 2HLOA 2A45I 2WPQA 2WWWA 1LTJA 5BU8B 3HE5A 4W80A 4M3LA 4RESB 1URQB 5AW9B 3RK2B 1SFCD 1T2KD 3EFGA 5AVYB 3UIAA 2A45G 3U1AA 4GIFA 4C7NB 1IO4A 3BRVB 5CJ4A 1J1DB 3M0AA 3MGNA 2FYUK 1XTCC 1AFOA 4W7YA 3HE5B 3OAKA 4DOJA 4Y99B 2NPSC 5APSA 3RK3C 2OYIC 4XE5B 1X79B 2Q7CA 2IX7C 2KOGA 3V2NA 4XA4A 2O1KA 3KYQA 3HD7A 5AVSB 1J2JB 2HPCA 1OWAA 1GK6A 2XDJA 1GTWA 2YKPA 1HVVA 2BASA 5KJ7D 2H7HA 2M8RA 3CI9A 3HD7B 5APUA 3L36A 2ZXEB 3V4WA 3IFMA 1SQQK 1KQLA 1HWTC 1SQVK 3BRTB 3SWYA 2WT7A 2YKOA 1L0LK 1LT9A 3MD0A 1ZLLA 2KLVA 3L35A 1RF0A 2YMYA 1FZBA 1GZLA 3VYIA 2J58A 1A02F 2XU6A 1GW3A 1DEBA 2Z5HA 3M06A 2N1TC 4JF7A 3HTKB 5KJ7C 2GM4A 2YO3A 1GL2A 1LT9B 4C46A 2C9NY 2KP8A 5APVA 2XKMA 1LTBC 1NO4A 1GL2B 3P8CE 1Z56A 5AW3B 3P7KA 3MUDA 2E43A 1GL2D 2W6BA 1FOSE 3BATA 1L4AD 3VP9A 1LWUC 2NPSA 2XV5A 4WBAA 1JNMA 2OYIA 3GHGC 1HGVA 2OYHC 5CCGD 5CHXA 1X8YA 1YTZT 1S9KE 1KILC 1A02J 1N73B 2J59M 3C9IA 1CI6A 3BVHA 1JMMA 3V2PA 2NPSB 2OYIB 3RK3B 1QL2A 4JYBA 3M9QA 1JY3N 1FOSF 2R5DA 2C0XA 1SFCA 1SVFA 2FFDB 3RK3D 1CI6B 5CCHC 1IFIA 1JUNA 1L4AC 1H8AA 4LLHA 3TYYA 1LTGC 1T3UA 2R3CA 1SFCB 1KFNA 5CCGC 3NXSA 3PP5A 3B8EB 3V4QA 1WT6A 1IJDB 2Q5UA 1NU1K 5CMZA 2W6AA 2XNXA 2N1TA 1GD2E 1LTTC 5KJ7A 1CSBA 1NTKK 1LTJB 1IFNA 4I6MC 2I1JA 4O9BA 1SQBK 4N78D 1GW4A 1T3JA 2LKMA 1RE4C 3V2QA 1LGHB 2HYNA 5KTBA 1GU4A 4I1LA 2N1TD 1RF1C 1FBMA 1HGZA 4AUWA 2P2UA 3RL0C 3NTNA 4I2LC 2HPCB 2OYHA 1GK4A 5AVUB 1KILA 2C0WA 2O1JA 1NTZK 3A3YB 1H89A 5AW5B 3R2PA 2H8PD 4IFFA 1HUCA 2CPBA 3A7OA 1GDTA 1KZUB 2OYHB 2PAJA 5AW8B 2POHA 1KILB 2H43A 1JY3P 5AVTB 2IFNA 2GUVA 4LGDE 2WTYA 3LIEA 2WT7B 3HE4A 5AW6B 1L4AA 1KILD 1URQC 5AW0B 5BVZA 1HBWA 2P1JA 2JJLA 4GT1A 5BU5A 3VOPA 2Z4EA 5CCGA 1E5WA 1FAVA 1L4AB 1J1EC 3WMM0 1W2EA 2R5BA 4W7ZA 2I1KA 1WRGA 4OH8B 1HJBA 1N86A 3N4XA 3L4FA 5CCHD 1JY3O 1IFMA 2O01H 1M1JC 1NWQA 2KB7P 3B5NC 3VN0A 5CJ0A 1MV8A 1N7LA 1RE4A 1DH3A 3KPEA 1FDMA 1N7SD 5AW2B 2XZRA 1KFMA 4GKGA 2YKQA 2WZ7A 1RF1A 2W27A 1VPCA 2GUSA 4IFMA 1FZCC 3HRNA 2ZFCA 2WPSA 2C9LY 1RF1B 3TK1A 1YYCA 3M0DC 3M9BA 4JYCA 5AVRB 2Q9IA 5AVZB 3P8CD 3RL0B 3NMDA 3V5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTH A;  2YMY A;  1N7S C;  2N1T D;  4WY4 D;  3RL0 D;  2N1T C;  4JF7 A;  4WY4 A;  3HTK B;  5KJ7 C;  1GL2 A;  3RL0 C;  1KIL A;  2HFE D;  4N78 E;  2H8P D;  2N1T B;  4WY4 B;  1GL2 B;  3P8C E;  1KIL B;  1GL2 D;  2NPS D;  4LGD E;  1L4A D;  4WY4 C;  1URQ D;  1GL2 C;  2PP6 A;  3RK2 D;  3B5N A;  2NPS A;  3TSI A;  1L4A A;  1KIL D;  1URQ C;  1URQ A;  1JTH B;  5CCG D;  1KIL C;  3VOP A;  5CCG A;  3B5N B;  2NPS B;  3RK3 B;  4W80 A;  1L4A B;  1URQ B;  3RK2 B;  1SFC D;  4W7Z A;  1NHL A;  4OH8 B;  1SFC C;  5CCH D;  1SFC A;  3B5N D;  3RK3 D;  4W7Y A;  5CCH C;  3B5N C;  5CCH A;  2NPS C;  3RK3 C;  1L4A C;  3RK2 C;  2KOG A;  3HD7 D;  1SFC B;  5CCG C;  3KYQ A;  3HD7 A;  1N7S D;  2XDJ A;  3PP5 A;  1HVV A;  2WZ7 A;  1N7S A;  5KJ7 D;  2HG5 D;  2N1T A;  2M8R A;  5KJ7 A;  1XTG B;  3HD7 B;  1N7S B;  1T3J A;  3M0D C;  3RL0 B;  3HD7 C; 
#chains in the Genus database with same CATH topology
 5KLV E;  4H0L C;  2FYZ A;  2IYO A;  1MZ9 A;  2OQQ A;  2E76 C;  1LTA C;  4DT0 A;  2KZI A;  1EQ7 A;  1H0T A;  1PGP A;  1JY2 N;  2FYN B;  4KHX A;  1AQ5 A;  2P7J A;  4UB8 E;  3L71 D;  1S72 P;  1OVR A;  4A7P A;  3HUS C;  5B66 H;  3TNU B;  4WB4 A;  3H32 A;  5M1B A;  1G1J A;  3CCV P;  1PP9 G;  4H44 D;  4IFD K;  3BAS A;  1KV4 A;  3RK2 D;  3B5N A;  4DZO A;  1CZQ A;  3TSI A;  3GHG A;  1J1E B;  2WPV B;  2IBZ E;  2B88 A;  1M8O B;  3FXD A;  1YI2 P;  3KZI E;  2ZVO B;  1LWU B;  1Q2N A;  1BE3 E;  1MUU A;  2FY8 A;  1SQV E;  1L0L E;  3B5N D;  2FKW B;  2DW3 A;  1FZF A;  1NTM K;  3E1I A;  2QM7 A;  1RE3 C;  3A2A A;  5GTH E;  1U57 A;  1K8A Q;  1BCC G;  2WIT A;  1NYH A;  1BGY G;  5AW7 B;  1SLQ A;  2Y9Y A;  1NVO A;  1LTJ C;  2HOD A;  1JMB A;  2CPS A;  2E75 D;  1N7S A;  4HYT B;  3LW5 H;  2O01 N;  1NTK J;  4XFJ A;  3A5T A;  5AW1 B;  3Q5S A;  2FXM A;  3L74 E;  2H88 C;  1AJY A;  5AVQ B;  4OVN F;  3PHL A;  2E76 B;  2KNC B;  4GDO A;  1KQS O;  2QJK B;  2KSJ A;  2FXP A;  2RH0 A;  4IOI H;  3L70 D;  2LXB A;  3H1H E;  1NKZ B;  3CCS P;  3AEF C;  2W83 C;  3HUS B;  1NTZ J;  1CW5 A;  3E7K A;  2B87 B;  2A45 H;  1RF0 C;  3VMZ A;  2E42 A;  3H1J E;  5KAF E;  3CL3 D;  2NPS D;  1EDJ A;  2QM8 A;  1URQ A;  1IFD A;  1JTH B;  5KLV K;  1IK9 A;  2V7Q J;  3H1I G;  2AEJ A;  3EFF K;  2W8Z A;  1S1C X;  3HE5 A;  4W80 A;  3AE2 C;  1EZV G;  1T2K D;  1SFC D;  3EFG A;  4GIF A;  4C7N B;  1IO4 A;  3BRV B;  3CCE P;  1XTC C;  1AFO A;  5APS A;  2OYI C;  3RK3 C;  2Q7C A;  2IX7 C;  3CXH E;  2B89 A;  1J2J B;  2K9J A;  1GK6 A;  5KLV D;  5KAI H;  1HVV A;  2BAS A;  2UWJ E;  3D6Z A;  2D2C D;  3H1J J;  1SQV K;  3BRT B;  1W2B O;  2O01 J;  2YKO A;  1L0L K;  3A0H E;  2V4H A;  4PJ0 H;  3MD0 A;  1SQX E;  1FZB A;  1GZL A;  2J58 A;  1DEB A;  3HTK B;  5KJ7 C;  4ASW A;  1YQ3 C;  4U7J A;  3CD6 P;  2BCC E;  3CME P;  3WUT A;  1EDL A;  2IBZ D;  4L76 A;  1L2P A;  3FXE A;  1BE3 D;  2Q1K A;  5L8R J;  4UB6 E;  1OVV A;  1SQV D;  1L0L D;  2RKL A;  3BAT A;  4U3F E;  2ITA A;  1PP9 J;  2XV5 A;  1KOR A;  4TLF A;  3GHG C;  1YIT P;  1X8Y A;  4NPD A;  1S9K E;  3H1K E;  1N73 B;  3V2P A;  2OYI B;  3RK3 B;  4JYB A;  1JY3 N;  2JR8 A;  2WSE J;  2FFD B;  1SQX J;  3L74 D;  2Y0E A;  3KXD A;  3Q5P A;  1H8A A;  3H1L G;  2R3C A;  4WVZ A;  1BCC J;  2AEM A;  2BCC J;  3H1H D;  4BWN A;  1WT6 A;  3GW6 A;  2W6A A;  3TDK A;  2ZT9 C;  3L75 E;  1P84 E;  1GW4 A;  4EYY Q;  2NRG A;  4U3F J;  1AV1 A;  3RBZ A;  1HJ0 A;  1UII A;  2OTK E;  3H1J D;  1RF1 C;  2V7Q H;  1SQP J;  4I2L C;  2OTJ P;  1RQU A;  4GOD A;  3CCM P;  1USD A;  1OW6 A;  1KD1 Q;  1HUC A;  1RH5 B;  1YQ4 C;  1S3J A;  1NTM G;  1GDT A;  5B66 E;  1NJI Q;  2G8Y A;  1X0T A;  5AW8 B;  3L70 G;  2POH A;  1M90 Q;  1LT1 A;  1QVF O;  2WT7 B;  2R44 A;  3MZW B;  1URQ C;  5BVZ A;  2IZ0 A;  1HBW A;  3CXH D;  5BU5 A;  2JJL A;  2QJP C;  3L75 J;  4TT3 H;  1FAV A;  3G4S P;  3JCU H;  1ZW0 A;  2O3J A;  4PV1 C;  3WMM 0;  2KNC A;  1HF9 A;  2O01 H;  1M1J C;  2PFX A;  4YPC A;  2KB7 P;  3W68 A;  1KB9 I;  4YXD C;  3KPE A;  2KK7 A;  2ZT9 B;  2XZR A;  4GKG A;  1SQX D;  3AE8 C;  2B87 A;  2GUS A;  4PD4 I;  1VQ8 P;  3CCU P;  1FZC C;  2BCC D;  1RF1 B;  1Q7Y Q;  1YYC A;  5AVZ B;  3NMD A;  3V5B A;  1JTH A;  1M7L A;  2OTL P;  5KLV G;  3RL0 D;  2IFM A;  4U3F D;  1M1K Q;  3CCL P;  1VQO P;  1QX8 A;  1IC2 A;  1S9K D;  2YNY A;  3H1K D;  2WSE H;  2FYU E;  3CLQ A;  1SQP D;  3NFQ A;  5KLI C;  1ZR4 A;  3KQG A;  4C7R A;  1U7M A;  2RN0 A;  3VMA A;  3I5C A;  2QJP B;  2KS1 B;  3VMY A;  4WY4 C;  1QVG O;  1KYO I;  1ZV8 A;  1N8R Q;  4PV1 B;  2M3B A;  3AEA C;  2M5A B;  2JP3 A;  2Y9Z A;  1LTS C;  1QL1 A;  5AVX B;  1AQT A;  1KC8 Q;  1M1J B;  3AE1 C;  1YBK A;  1KMI Z;  1SQQ E;  1BE3 G;  3IAO A;  4BRY A;  1SQV G;  3L75 D;  1L0L G;  5CCH A;  1P84 D;  4D6T E;  1HH0 A;  2MJZ A;  3N7N A;  2E5Y A;  3HTK A;  3II6 A;  3AEC C;  5AVV B;  3U59 A;  1FZC B;  4EIJ A;  1OX3 A;  3EQ2 A;  4EOT A;  5KAI E;  5C39 A;  4HB1 A;  3H6P A;  1G2C B;  2VRS A;  4YTP C;  1XTG B;  5APX A;  1SQB J;  2JO1 A;  1JY2 P;  1X22 A;  3L74 G;  1PFI A;  3HD7 C;  1OVU A;  4PJ0 E;  3MIW A;  5KKZ B;  1SP4 A;  3LID A;  1N73 A;  3GF3 A;  3H1H G;  2I8D A;  4GOF A;  5APT A;  4N3Y B;  1AA0 A;  1ZR2 A;  1ZXG A;  2FFD A;  4WY4 B;  1LT9 C;  3PJS K;  2ZAE B;  1RY3 A;  5E79 H;  1FU1 A;  3BCC J;  1YHQ P;  1NH4 A;  2L5G B;  2HLO A;  1NTK E;  5BU8 B;  4M3L A;  5CJ4 A;  2FYU K;  1DD3 A;  1X79 B;  2O1K A;  2XDJ A;  1SS1 A;  5KJ7 D;  3RGU A;  1NTZ E;  2M8R A;  3AE3 C;  3HD7 B;  5APU A;  3L36 A;  2ZXE B;  1SQQ K;  2GA1 A;  1KQL A;  1HWT C;  2FYU D;  2WT7 A;  2BEZ F;  1PGO A;  3L72 G;  1S5L X;  1A02 F;  4H13 C;  3TGU G;  5TJH A;  2N1T C;  1GL2 A;  1LT9 B;  1BDC A;  4H0L B;  3PLN A;  1VF5 D;  4EI2 A;  3GG2 A;  2XKM A;  1LTB C;  3P8C E;  4MN4 C;  1SQQ D;  3P7K A;  3WU2 H;  2N9Y B;  3MUD A;  1GL2 D;  2NPS A;  1VL2 A;  4WBA A;  4D6T D;  2OYH C;  5CHX A;  4EDF A;  1KIL C;  3PH0 A;  2WMM A;  3H1K G;  2AXT H;  1QL2 A;  1KQG B;  3JCU E;  1JM0 A;  2AEF A;  1FOS F;  2ZT9 D;  1YIJ P;  1SFC A;  1SVF A;  1CI6 B;  1OW7 A;  5CCH C;  3T97 B;  4GOE A;  1L4A C;  2Q6Q A;  4LLH A;  1LTG C;  1NU1 G;  1T3U A;  1EZV I;  5CCG C;  3NXS A;  1GMJ A;  3B8E B;  3SFE C;  3C1L A;  3L73 J;  4ZNC A;  2XNX A;  2W6J H;  1LTT C;  2KSE A;  1NTK K;  1LTJ B;  2SPZ A;  1IFN A;  4H13 B;  4O9B A;  1RE4 C;  1R5S A;  3V2Q A;  3CWB G;  2HYN A;  4JPZ B;  1PP9 E;  2M5A A;  3CC7 P;  1L0N J;  3NTN A;  3S4R A;  2HPC B;  2QEX P;  1FS0 E;  1GK4 A;  1W5C E;  5AVU B;  4YXW H;  3V6I A;  2O1J A;  1NTZ K;  3EWK A;  1NTK D;  4I7Z C;  4PV1 D;  2A06 E;  2CPB A;  2OYH B;  1KIL B;  1JY3 P;  3CX5 I;  5AVT B;  1MFT A;  2FBW C;  4LGD E;  3WUV A;  4RKU J;  5AW6 B;  5TIS H;  4KT0 J;  1BCC E;  4IL6 H;  3IN6 A;  3B71 A;  1KB9 H;  1RQV A;  3Q3D A;  4RJT A;  1L4A B;  1NTZ D;  4L75 A;  4W7Z A;  1YJN P;  1WRG A;  1PGJ A;  3L4F A;  2LR2 A;  4PD4 H;  1NWQ A;  3B5N C;  3VN0 A;  3RBX A;  1R8E A;  2OGU A;  1ZRT E;  5DJT B;  3L71 G;  1LP1 A;  3GMA A;  1SQP E;  1R5L A;  3O6Q A;  5B5E H;  4Z1M H;  2WSC J;  4JQ0 D;  2E75 C;  1VPC A;  3CMA P;  2J5U A;  1NGM B;  3TK1 A;  4JYC A;  1QLE D;  2ZJS E;  3P8C D;  4OGQ C;  1JO5 A;  1BGY J;  5APY A;  1OXZ A;  1N7S C;  4WY4 D;  3L72 J;  3Q1M A;  4I7Z B;  2WQY C;  3D71 A;  3TGU J;  3IR9 A;  3TNU A;  1KYO H;  4HJG H;  1JEK A;  3JC2 2;  3L37 A;  2K9Y A;  1H0T B;  2FYU G;  2YMK A;  1KQF B;  3MTU E;  5E79 E;  4LC1 A;  1JB0 J;  1U7J A;  3AED C;  3VP8 A;  3QH9 A;  3VTP C;  1M56 D;  3JSV C;  2MKV A;  1LWU A;  3H25 A;  3I56 P;  3H32 B;  4N6J A;  1K9M Q;  3OA7 A;  3O8Z A;  1QGK B;  2WPR A;  3B5N B;  1NOH A;  1BSN A;  3GHG B;  1SQQ G;  1NHL A;  1T2K C;  1SFC C;  4B86 A;  2R32 A;  1SQX K;  3HD7 D;  3D6Y A;  3M0D A;  4L73 A;  1J1D C;  3H1I J;  1NU1 J;  1NKN A;  4Y99 C;  1PP9 D;  5APQ A;  1FZG A;  3P8M C;  1ZOY C;  3RK3 E;  1PPJ E;  1FZA A;  1YTZ I;  4OGQ B;  4OWF A;  2HOD B;  1ZN5 A;  3KHU A;  1T8Z A;  1N7S B;  4AQR D;  1FZE A;  3HUS A;  2A06 D;  4H0L D;  2FXO A;  3OJA B;  2E76 D;  3P32 A;  5EFW B;  4JBZ A;  3CC4 P;  1VDF A;  1T6A A;  1BCC D;  1SQP K;  2R3S A;  1IZN B;  1JY2 O;  1S4X A;  4NPE A;  3T97 A;  3WU2 E;  1EDK A;  1Y47 A;  3H1L E;  1H88 A;  5APW A;  1RE3 A;  1LTI C;  1ZRT D;  1PGQ A;  1ZP0 C;  2WSC H;  4C7N A;  3W67 A;  1BSH A;  2WPQ A;  1LTJ A;  2Y0C A;  2AXT E;  1SQB E;  4RES B;  1URQ B;  2E5T A;  2HR3 A;  1J1D B;  3MGN A;  4W7Y A;  3HE5 B;  3OAK A;  4DOJ A;  4Y99 B;  4XE5 B;  3CCQ P;  2QG4 A;  2KOG A;  1OZH A;  3V2N A;  4XA4 A;  2KZJ A;  1Y9B A;  1VQ7 P;  1VQ6 P;  5AVS B;  2HPC A;  1ZME C;  1GTW A;  2IBZ G;  2H7H A;  1UIX A;  2QVA A;  3CI9 A;  2K9J B;  2M3E A;  4R4L A;  3BCC E;  3SWY A;  3SFD C;  4K3A A;  1NTM E;  3H1L J;  3AE4 C;  2QJY C;  3G71 P;  1RF0 A;  4QMA A;  2YMY A;  2P58 A;  3VYI A;  4ASV A;  2WVR A;  2XU6 A;  1GW3 A;  2Z5H A;  2E74 C;  1VQP P;  3M06 A;  1VQK P;  2YO3 A;  5APV A;  1USE A;  1VQ4 P;  1VQN P;  2K3R A;  2B9B A;  3TF5 A;  2OYO A;  3RL0 g;  3CCJ P;  1L4A D;  5KLI B;  1LWU C;  1JNM A;  2OYI A;  2W90 A;  5TIS E;  1YJ9 P;  4IL6 E;  5CCG D;  1YTZ T;  1KB9 E;  3BVH A;  1DEE G;  1NTM J;  2C0X A;  1PZQ A;  3H1J G;  3RK3 D;  1PPJ D;  2AXC A;  2YXQ B;  3L70 J;  1Q82 Q;  1IFI A;  4PD4 E;  2K1A A;  3TYY A;  2K37 A;  1OMI A;  2WSF J;  1FDI A;  4DCK A;  1KFN A;  1AVY A;  3D70 A;  3AE5 C;  2JDI H;  2CK3 H;  3PP5 A;  1YJW P;  2Q5U A;  5B5E E;  5KJ7 A;  1CSB A;  2QJK C;  2QJY B;  3CXH I;  2I1J A;  1OIP A;  4KJM A;  3FWN A;  1IFP A;  1SQB K;  1T3J A;  2E74 B;  1LGH B;  5KTB A;  2P10 A;  1FDO A;  4I1L A;  1FBM A;  3CX5 H;  1HGZ A;  4AUW A;  2P2U A;  3RL0 C;  3H1L D;  5GTI H;  1KYO E;  1K05 A;  3GLM A;  5AW5 B;  3R2P A;  2WSS H;  2A06 G;  1SQB D;  3MHV A;  2PAJ A;  2JWA A;  1S5L H;  1SQX G;  2IFN A;  2WTY A;  2QA4 P;  5KLV J;  2H89 C;  1LJ2 A;  3L73 E;  2BCC G;  4GT1 A;  2Z4E A;  3IF4 A;  3GF7 A;  1W2E A;  1OFC X;  2R5B A;  2I1K A;  4OH8 B;  1HJB A;  1N86 A;  3N4X A;  1JY3 O;  1IFM A;  1KTM A;  2M0B A;  4NPF X;  3A0B H;  4U3F G;  1MV8 A;  1AVO A;  3BCC D;  4OGQ D;  1NTM D;  1DH3 A;  1FDM A;  4RO0 A;  1QEX A;  1N7S D;  1L0N E;  2ZYD A;  1SQP G;  2WZ7 A;  1RF1 A;  3AEE C;  2W27 A;  3F89 A;  1EXI A;  3PRJ A;  4IFM A;  1BE3 J;  3HRN A;  2ZFC A;  1SQV J;  2WPS A;  1L0L J;  2C9L Y;  2XND H;  3RL0 B;  4AYC A;  1IFJ A;  3Q2Y A;  2KYV A;  1JCC A;  1EDI A;  2YO2 A;  3F5H A;  1P84 I;  2Q3I A;  3AEB C;  4L74 A;  3L75 G;  3I55 P;  1HTL C;  3USS A;  1KB9 D;  2KS1 A;  2N1T B;  3L74 J;  2K88 A;  1N73 C;  1JCD A;  2WSF H;  1M1J A;  1URQ D;  3H1H J;  4PD4 D;  4HH2 A;  2BEQ D;  1E79 H;  1IK7 A;  3G3Z A;  1N2D C;  2FFD C;  2Z5I A;  1EXJ A;  3SWF A;  3U1C A;  2L91 A;  1NAY A;  1M57 D;  1FZC A;  4H44 C;  4ZKP A;  2N9B A;  3M91 A;  3RK2 C;  1VQ5 P;  1BGY E;  2QSI A;  1G2C A;  4BRY B;  3L72 E;  3MP7 B;  1VQL P;  3HE4 B;  1JOC A;  2IPP A;  3TGU E;  2PRR A;  3V2R A;  3M9H A;  2HG5 D;  5H2F H;  4IL6 X;  1G1I A;  1PPJ G;  1KYO D;  2KLU A;  1Q86 Q;  1X9V A;  1BDD A;  3CCR P;  5AW4 B;  1FJP A;  1Q81 Q;  1LNQ A;  2ZVN B;  4R4M A;  5K5G B;  3CPW O;  4K35 A;  4WY4 A;  3KDP B;  2PGD A;  2LXC B;  4UB8 H;  2P67 A;  1L0N K;  1VQ9 P;  3L73 D;  2HFE D;  4N78 E;  1VF5 C;  3QWO C;  2JEE A;  1GU5 A;  2Q3E A;  4ZKU A;  5AVW B;  1FJK A;  1GL2 C;  2PP6 A;  3H1I E;  1DX7 A;  3VMX A;  1NU1 E;  1MFZ A;  2OAR A;  1DIP A;  1NAF A;  1PV3 A;  2A45 I;  3KZI H;  2WWW A;  3FX0 A;  2ZYA A;  1EZV E;  1L0N D;  4H44 B;  2KUB A;  5AW9 B;  3RK2 B;  3CC2 P;  3UIA A;  5AVY B;  2A45 G;  3U1A A;  1SQB G;  3MUD C;  5CBO A;  3M0A A;  1PIX A;  5CBN A;  5GTH H;  2NPS C;  1FE6 A;  1KIL E;  3CWB E;  3KYQ A;  1K04 A;  3HD7 A;  1OWA A;  2E74 D;  2YKP A;  4WWI A;  3H1K J;  3V4W A;  1S2E A;  3IFM A;  3PTZ A;  4D6T G;  3C8V A;  2E75 B;  1WMK A;  1LT9 A;  1Y8A A;  3BCC G;  1ZLL A;  4Y28 J;  2KLV A;  3L35 A;  2ZYG A;  1VF5 B;  4JF7 A;  2GM4 A;  3CX5 E;  4C46 A;  5GTI E;  2D2C C;  2C9N Y;  2KP8 A;  1TU3 F;  1NO4 A;  1K73 Q;  1GL2 B;  3FGA D;  1Z56 A;  5AW3 B;  3G9R A;  5KAF H;  3CWB J;  2E43 A;  1S5L E;  1KN7 A;  2W6B A;  1FOS E;  3VP9 A;  2IDB A;  1HGV A;  5DJU B;  1BGY D;  3L71 E;  1A02 J;  2J59 M;  1EC5 A;  3L72 D;  3C9I A;  3WUU A;  1CI6 A;  4ZMD A;  1JMM A;  2NPS B;  3TGU D;  3M9Q A;  2R5D A;  1RHZ B;  2Y0D A;  2YIU C;  2QIW A;  4CPG A;  2NZ2 A;  1JUN A;  3SWK A;  3A0B E;  2JWD A;  3SSU A;  3CXH H;  3ITK A;  3AE9 C;  1SFC B;  1PL5 A;  1NTK G;  3V4Q A;  1IJD B;  5CMZ A;  1NU1 K;  2KI7 B;  2N1T A;  1GD2 E;  5KKZ C;  4I6M C;  2IBZ I;  1VQM P;  2ZXX A;  4N78 D;  4HKZ H;  2QRX A;  3A0H H;  2LKM A;  4BXL A;  1MKM A;  3K5B A;  4H13 D;  3OW2 O;  3L71 J;  1GU4 A;  2D2C B;  2N1T D;  1Q90 D;  2KIK A;  2QE7 H;  3G6E P;  1NTZ G;  3H1I D;  1NU1 D;  3E1R A;  3LW5 J;  2OYH A;  3AE7 C;  1KIL A;  2C0W A;  3A3Y B;  1H89 A;  2H8P D;  2IYP A;  4IFF A;  1EZV D;  2FYN C;  4UB6 H;  3A7O A;  3L70 E;  1KZU B;  1DD4 A;  2H43 A;  2GUV A;  3LIE A;  3HE4 A;  1L4A A;  1KIL D;  5AW0 B;  2YXR B;  2P1J A;  3CWB D;  3S9O A;  3VOP A;  3R4Y A;  5CCG A;  1E5W A;  3L73 G;  2YIU B;  3Q5R A;  1D7M A;  1J1E C;  1FC2 C;  1OW8 A;  2FYU J;  3FWL A;  3S1K A;  5CCH D;  2RMZ A;  3AEG C;  3ZDM A;  5CJ0 A;  1N7L A;  1RE4 A;  2G3A A;  4DJG A;  3B4S A;  5AW2 B;  1KFM A;  2YKQ A;  1L0N G;  3AE6 C;  5H2F E;  3CX5 D;  1SQQ J;  1LP1 B;  3ABV C;  1P84 H;  2KXP B;  2IZ1 A;  3O6Q B;  3M0D C;  3M9B A;  5AVR B;  2Q9I A;  4D6T J;  2JKV A; 
#chains in the Genus database with same CATH homology
 1JO5 A;  5APY A;  1JTH A;  1IFJ A;  1M7L A;  1OXZ A;  1N7S C;  2KYV A;  4WY4 D;  2FYZ A;  1JCC A;  1MZ9 A;  3RL0 D;  1LTA C;  2YO2 A;  1EQ7 A;  2IFM A;  3IR9 A;  2Q3I A;  1JY2 N;  3TNU A;  4KHX A;  1AQ5 A;  1IC2 A;  2P7J A;  1S9K D;  2YNY A;  1HTL C;  2WSE H;  3CLQ A;  3L37 A;  2N1T B;  3HUS C;  3NFQ A;  3TNU B;  1ZR4 A;  3KQG A;  4C7R A;  3MTU E;  4WB4 A;  3H32 A;  4LC1 A;  1G1J A;  1N73 C;  3I5C A;  1JCD A;  2WSF H;  3VP8 A;  3VTP C;  3VMY A;  1M1J A;  3BAS A;  4WY4 C;  4IFD K;  1URQ D;  3RK2 D;  3B5N A;  4HH2 A;  1LWU A;  4DZO A;  1CZQ A;  3TSI A;  1ZV8 A;  1J1E B;  3GHG A;  3G3Z A;  3H32 B;  1N2D C;  2M3B A;  4N6J A;  2FFD C;  3OA7 A;  1LTS C;  2Z5I A;  3O8Z A;  1QL1 A;  5AVX B;  3SWF A;  3U1C A;  1M1J B;  2WPR A;  3B5N B;  1NOH A;  1LWU B;  3GHG B;  1MUU A;  1NHL A;  1T2K C;  1SFC C;  3B5N D;  2FKW B;  1FZC A;  4B86 A;  1FZF A;  1NTM K;  5CCH A;  3E1I A;  4ZKP A;  2QM7 A;  1RE3 C;  3A2A A;  1HH0 A;  2R32 A;  2MJZ A;  2N9B A;  3M91 A;  3RK2 C;  1SQX K;  3HD7 D;  3M0D A;  3N7N A;  2WIT A;  3HTK A;  1G2C A;  3II6 A;  5AW7 B;  1J1D C;  1SLQ A;  5AVV B;  3U59 A;  1LTJ C;  4EIJ A;  1FZC B;  3HE4 B;  1JOC A;  1NKN A;  4Y99 C;  2HOD A;  2IPP A;  2CPS A;  5APQ A;  1FZG A;  3EQ2 A;  3M9H A;  1N7S A;  3V2R A;  4HYT B;  4EOT A;  3LW5 H;  2HG5 D;  3P8M C;  3H6P A;  1G2C B;  2VRS A;  3A5T A;  5AW1 B;  1XTG B;  5APX A;  1FZA A;  1YTZ I;  1G1I A;  2FXM A;  2HOD B;  1ZN5 A;  1JY2 P;  5AVQ B;  1T8Z A;  1N7S B;  4AQR D;  1X9V A;  1FZE A;  1PFI A;  3HUS A;  5AW4 B;  1FJP A;  3HD7 C;  2KSJ A;  3OJA B;  3MIW A;  1SP4 A;  1NKZ B;  3LID A;  1N73 A;  3P32 A;  5APT A;  3HUS B;  4N3Y B;  4WY4 A;  1ZR2 A;  3KDP B;  1VDF A;  1SQP K;  2P67 A;  1L0N K;  1CW5 A;  1JY2 O;  2HFE D;  4N78 E;  2FFD A;  4WY4 B;  2JEE A;  1LT9 C;  2A45 H;  3T97 A;  1GU5 A;  1RY3 A;  1RF0 C;  1FU1 A;  3VMZ A;  2E42 A;  4ZKU A;  5AVW B;  1FJK A;  4AYC A;  3CL3 D;  2NPS D;  1GL2 C;  2PP6 A;  1H88 A;  5APW A;  1RE3 A;  1LTI C;  2QM8 A;  3VMX A;  1MFZ A;  1DX7 A;  2OAR A;  1URQ A;  1NH4 A;  1IFD A;  1JTH B;  5KLV K;  1IK9 A;  2L5G B;  1NAF A;  2WSC H;  4C7N A;  2HLO A;  2A45 I;  2WPQ A;  2WWW A;  1LTJ A;  5BU8 B;  3HE5 A;  4W80 A;  4M3L A;  4RES B;  1URQ B;  5AW9 B;  3RK2 B;  1SFC D;  1T2K D;  3EFG A;  5AVY B;  3UIA A;  2A45 G;  3U1A A;  4GIF A;  4C7N B;  1IO4 A;  3BRV B;  5CJ4 A;  1J1D B;  3M0A A;  3MGN A;  2FYU K;  1XTC C;  1AFO A;  4W7Y A;  3HE5 B;  3OAK A;  4DOJ A;  4Y99 B;  2NPS C;  5APS A;  3RK3 C;  2OYI C;  4XE5 B;  1X79 B;  2Q7C A;  2IX7 C;  2KOG A;  3V2N A;  4XA4 A;  2O1K A;  3KYQ A;  3HD7 A;  5AVS B;  1J2J B;  2HPC A;  1OWA A;  1GK6 A;  2XDJ A;  1GTW A;  2YKP A;  1HVV A;  2BAS A;  5KJ7 D;  2H7H A;  2M8R A;  3CI9 A;  3HD7 B;  5APU A;  3L36 A;  2ZXE B;  3V4W A;  3IFM A;  1SQQ K;  1KQL A;  1HWT C;  1SQV K;  3BRT B;  3SWY A;  2WT7 A;  2YKO A;  1L0L K;  1LT9 A;  3MD0 A;  1ZLL A;  2KLV A;  3L35 A;  1RF0 A;  2YMY A;  1FZB A;  1GZL A;  3VYI A;  2J58 A;  1A02 F;  2XU6 A;  1GW3 A;  1DEB A;  2Z5H A;  3M06 A;  2N1T C;  4JF7 A;  3HTK B;  5KJ7 C;  2GM4 A;  2YO3 A;  1GL2 A;  1LT9 B;  4C46 A;  2C9N Y;  2KP8 A;  5APV A;  2XKM A;  1LTB C;  1NO4 A;  1GL2 B;  3P8C E;  1Z56 A;  5AW3 B;  3P7K A;  3MUD A;  2E43 A;  1GL2 D;  2W6B A;  1FOS E;  3BAT A;  1L4A D;  3VP9 A;  1LWU C;  2NPS A;  2XV5 A;  4WBA A;  1JNM A;  2OYI A;  3GHG C;  1HGV A;  2OYH C;  5CCG D;  5CHX A;  1X8Y A;  1YTZ T;  1S9K E;  1KIL C;  1A02 J;  1N73 B;  2J59 M;  3C9I A;  1CI6 A;  3BVH A;  1JMM A;  3V2P A;  2NPS B;  2OYI B;  3RK3 B;  1QL2 A;  4JYB A;  3M9Q A;  1JY3 N;  1FOS F;  2R5D A;  2C0X A;  1SFC A;  1SVF A;  2FFD B;  3RK3 D;  1CI6 B;  5CCH C;  1IFI A;  1JUN A;  1L4A C;  1H8A A;  4LLH A;  3TYY A;  1LTG C;  1T3U A;  2R3C A;  1SFC B;  1KFN A;  5CCG C;  3NXS A;  3PP5 A;  3B8E B;  3V4Q A;  1WT6 A;  1IJD B;  2Q5U A;  1NU1 K;  5CMZ A;  2W6A A;  2XNX A;  2N1T A;  1GD2 E;  1LTT C;  5KJ7 A;  1CSB A;  1NTK K;  1LTJ B;  1IFN A;  4I6M C;  2I1J A;  4O9B A;  1SQB K;  4N78 D;  1GW4 A;  1T3J A;  2LKM A;  1RE4 C;  3V2Q A;  1LGH B;  2HYN A;  5KTB A;  1GU4 A;  4I1L A;  2N1T D;  1RF1 C;  1FBM A;  1HGZ A;  4AUW A;  2P2U A;  3RL0 C;  3NTN A;  4I2L C;  2HPC B;  2OYH A;  1GK4 A;  5AVU B;  1KIL A;  2C0W A;  2O1J A;  1NTZ K;  3A3Y B;  1H89 A;  5AW5 B;  3R2P A;  2H8P D;  4IFF A;  1HUC A;  2CPB A;  3A7O A;  1GDT A;  1KZU B;  2OYH B;  2PAJ A;  5AW8 B;  2POH A;  1KIL B;  2H43 A;  1JY3 P;  5AVT B;  2IFN A;  2GUV A;  4LGD E;  2WTY A;  3LIE A;  2WT7 B;  3HE4 A;  5AW6 B;  1L4A A;  1KIL D;  1URQ C;  5AW0 B;  5BVZ A;  1HBW A;  2P1J A;  2JJL A;  4GT1 A;  5BU5 A;  3VOP A;  2Z4E A;  5CCG A;  1E5W A;  1FAV A;  1L4A B;  1J1E C;  3WMM 0;  1W2E A;  2R5B A;  4W7Z A;  2I1K A;  1WRG A;  4OH8 B;  1HJB A;  1N86 A;  3N4X A;  3L4F A;  5CCH D;  1JY3 O;  1IFM A;  2O01 H;  1M1J C;  1NWQ A;  2KB7 P;  3B5N C;  3VN0 A;  5CJ0 A;  1MV8 A;  1N7L A;  1RE4 A;  1DH3 A;  3KPE A;  1FDM A;  1N7S D;  5AW2 B;  2XZR A;  1KFM A;  4GKG A;  2YKQ A;  2WZ7 A;  1RF1 A;  2W27 A;  1VPC A;  2GUS A;  4IFM A;  1FZC C;  3HRN A;  2ZFC A;  2WPS A;  2C9L Y;  1RF1 B;  3TK1 A;  1YYC A;  3M0D C;  3M9B A;  4JYC A;  5AVR B;  2Q9I A;  5AVZ B;  3P8C D;  3RL0 B;  3NMD A;  3V5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...