3PP5A

High-resolution structure of the trimeric scar/wave complex precursor brk1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
63
structure length
63
Chain Sequence
TKTNIQKDWEQREFIEDMSINIQKIVEFLNKFELSTRNKLSDLNEKLTILDRQVDYLEATFKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution X-ray structure of the trimeric Scar/WAVE-complex precursor Brk1.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Structural protein
molecule keywords Brk1
total genus 31
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2010-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3pp5A01
1HVVA 3RK2B 4N78E 1NHLA 3RL0D 1L4AA 1SFCA 5CCGA 1URQB 1GL2C 4LGDE 1KILB 3KYQA 3HTKB 3B5NA 1KILA 2M8RA 5CCHC 1N7SB 1N7SA 2NPSD 3RK2C 3B5ND 2N1TB 1L4AB 2WZ7A 1SFCB 2YMYA 2N1TA 4WY4B 1XTGB 1URQA 5CCHD 4W80A 4OH8B 1GL2D 3RK2D 5CCGD 3B5NC 2XDJA 3M0DC 5CCHA 1T3JA 3HD7D 4W7ZA 4W7YA 1N7SC 2H8PD 5KJ7C 3HD7C 4WY4A 2N1TC 2NPSB 1URQC 2N1TD 4JF7A 3P8CE 2HG5D 1L4AD 4WY4D 3TSIA 5KJ7D 1JTHB 1GL2B 2HFED 3RK3C 3RK3B 5KJ7A 3HD7A 2KOGA 4WY4C 3VOPA 3RL0B 3HD7B 2PP6A 2NPSA 3RL0C 1URQD 1KILD 1L4AC 1SFCC 5CCGC 1JTHA 1GL2A 1N7SD 1KILC 3B5NB 3PP5A 1SFCD 2NPSC 3RK3D
chains in the Genus database with same CATH superfamily
5AW5B 1FDIA 1FS0E 3L73D 4JYCA 2CK3H 1LTGC 3RK2B 3SWFA 1NHLA 3I5CA 2YO2A 4GODA 1FU1A 1S2EA 1SFCA 2ZT9C 3GHGC 1BE3J 2A06D 2WSFJ 2ZT9B 3A0HH 3AECC 1DD4A 1VQ7P 1GL2C 1KILE 2WSCJ 1KILB 3KYQA 1PGJA 3H6PA 1SQXG 2FXPA 3CWBD 3HTKB 4TLFA 1L0LK 2QJPC 2FYUG 2KK7A 3CPWO 2HODB 1S5LH 1G2CA 1JCCA 3II6A 3T97A 4C7NB 1Q81Q 1EXJA 4L76A 4UB8E 1PP9G 1PIXA 2KNCA 1EDLA 1Q86Q 5AW4B 3SWKA 1P84D 1EZVD 2K88A 2NPSD 3V2QA 1BGYJ 1IFMA 1YTZT 4H13B 5KAIE 4ZKUA 4U3FD 1FZCA 2KB7P 2N1TB 3CC2P 2JDIH 4BRYA 4U3FE 3V4QA 1AV1A 1NU1K 4WY4B 5DJUB 1S5LX 4JYBA 3WMM0 1URQA 3L37A 3H1IJ 1OVVA 1TU3F 4OH8B 5CHXA 2LKMA 2B9BA 1CZQA 4PV1B 1G1IA 2KS1A 4PV1C 1S72P 1HGVA 3A0BH 4H0LD 5APYA 1JO5A 5B5EH 2K37A 3T97B 1JCDA 4C7NA 1Y9BA 1ZN5A 3CWBE 4R4LA 3M91A 5CCHA 3CCLP 3FXDA 1T3JA 3F5HA 3CCRP 1M1JA 1KB9E 2JKVA 2FY8A 3HE4A 2O1KA 3AE7C 4W7YA 1GW3A 4OGQC 2B88A 1OMIA 2QEXP 1KQSO 1NTKJ 5GTHE 1KB9D 5AVYB 2ZJSE 5C39A 4AQRD 5K5GB 1NTMJ 3Q5SA 2W6AA 4H13C 1K73Q 1NTZJ 1PL5A 4WY4A 2YNYA 3KZIE 2O3JA 3S4RA 1AVOA 2R44A 1VQ5P 2PRRA 3PH0A 4I2LC 1NTZK 2XV5A 3AE2C 3PLNA 2QA4P 1SP4A 2Y0EA 2L91A 4WY4D 1IK7A 2YIUC 1GD2E 2Q1KA 3BASA 3H1JE 1OX3A 2ZYAA 2W8ZA 3CC7P 2LXBA 1DH3A 3Q1MA 5AW7B 1Y47A 5M1BA 3MZWB 2RKLA 4HH2A 3RL0g 3GMAA 1YI2P 2FKWB 2FBWC 2IBZI 1EZVE 1P84E 2GUSA 2J59M 2L5GB 3NFQA 3V2RA 3VTPC 2OYIB 2WT7A 2OYIC 1S4XA 1SQVG 3O8ZA 4IL6X 3VMAA 3L74G 1KTMA 2QIWA 1PP9J 2ZVNB 1J2JB 5B66E 1J1DB 3VOPA 4BWNA 1PZQA 4K3AA 1VF5D 3CX5I 5E79E 1U7JA 3A0BE 1U57A 2FYUJ 3AE6C 3W68A 1T3UA 2AEFA 2XKMA 3EFFK 3L70J 2W27A 5KLVJ 2BEZF 1HGZA 1NGMB 3CCEP 1KILD 2K9JA 3D6YA 3EQ2A 3L72E 1PPJG 1L0NJ 1LT1A 1SQPJ 1GTWA 2HPCA 2A06E 2Q5UA 3LIDA 1HJBA 1L4AC 1MKMA 1NTMK 1LTAC 1W2BO 1DD3A 2CPSA 3L73E 1VDFA 1D7MA 3L70G 4PJ0H 5AVVB 2GUVA 5AVTB 3C9IA 3RBZA 1L0NK 5KLVD 2YMKA 1NH4A 2BCCD 4GKGA 3R4YA 1KC8Q 1QX8A 3VN0A 3HUSC 1KILC 1RF1C 1QEXA 1SQPD 3B5NB 3CI9A 2A45H 3GG2A 4RKUJ 3U59A 1S9KE 2IZ0A 3P8CD 1LT9A 1N7LA 1DEEG 4ZMDA 2WTYA 3G71P 1SQBE 2AXTH 3L4FA 2NPSC 3KHUA 3L71J 2JEEA 2RN0A 1YJWP 3RK3D 1N2DC 1Q2NA 1FOSE 1L0ND 1NKNA 3AE4C 1HVVA 3TF5A 3CX5D 3E1RA 1ZV8A 4YTPC 2E5YA 2WSFH 3K5BA 1QVFO 3BCCG 2QE7H 3H1HD 1LTJC 2D2CC 2I8DA 1LWUB 3O6QB 4C46A 3IF4A 3M06A 4GT1A 1FZEA 1BDCA 3PTZA 1X0TA 3TNUB 3WUTA 1SS1A 4EOTA 1BCCE 1LP1A 2ZXXA 4D6TJ 5BVZA 1WT6A 1JMMA 3B5NA 3CXHE 1EDIA 1ZRTE 3BATA 1PGOA 1ZLLA 1BDDA 3PJSK 2XNDH 4LC1A 2POHA 1N73B 3L75E 1VQOP 3L73J 1RE4A 1YIJP 1EC5A 3FX0A 1W2EA 2KXPB 1N7SA 2Z4EA 3H1KE 3Q2YA 2OYHB 2SPZA 3B5ND 2KLVA 1K04A 5AW0B 2WZ7A 1IFJA 3OW2O 1SFCB 2OGUA 2KZIA 1FZAA 1BGYE 1LNQA 1BE3E 3GLMA 1YHQP 3H1LD 3U1AA 1ZP0C 1NU1D 2BCCG 4IFMA 1VF5C 1GL2D 1AA0A 1YBKA 3JCUH 2FFDC 1NTMD 1NTZE 3RK2D 5GTIH 3CCJP 3AEEC 1RF0A 2QJKB 3CXHH 5EFWB 1J1EB 2Q3EA 2KI7B 4OGQD 1YJNP 2IZ1A 1ZW0A 1IK9A 1NVOA 1GW4A 4DCKA 3HE5A 4NPDA 3IAOA 1KN7A 1NU1J 3HD7D 1L2PA 3VP9A 2QRXA 2C9NY 5APSA 3VMXA 3CCUP 2Z5IA 2H8PD 3CWBJ 2OARA 1FZFA 4D6TE 2ZXEB 5BU5A 1N73C 5KKZB 3CL3D 1GK4A 4UB6E 1NU1G 3M9HA 4N6JA 3U1CA 1VPCA 1FJPA 4TT3H 1NAYA 1URQC 3H1IE 1QVGO 2RMZA 1DX7A 1L0LD 1HJ0A 1GU5A 2KS1B 1YTZI 3TGUE 2IBZE 1FZGA 1M7LA 2CPBA 4OVNF 4U3FJ 1L4AD 3IFMA 1KYOD 1KZUB 4ASWA 4CPGA 2QJYC 2ZYGA 5AVQB 2E74C 1JTHB 1OVRA 4DJGA 2HFED 3JSVC 1L0LG 2M5AA 1OIPA 5APTA 1HH0A 3H1HJ 1Y8AA 3KPEA 3OJAB 1OVUA 1YQ4C 2E75D 2KSJA 4H0LB 5APXA 2FYNC 1KYOH 2QG4A 2NZ2A 3RK3C 4AUWA 5KLVG 3B4SA 4U7JA 1X22A 3M0AA 3MTUE 1IZNB 4GDOA 1GU4A 4WY4C 3P8MC 3RL0B 3H1HG 5AW6B 2WSSH 3BCCD 3AE1C 2KLUA 2Q7CA 5GTIE 2ZT9D 1OFCX 2H43A 1MFZA 4MN4C 2YKQA 1PPJD 1RH5B 1JY3N 1KFNA 1OW8A 3RGUA 3TGUJ 2ZYDA 4NPEA 5AVZB 3VYIA 1L0NG 1VQMP 3N4XA 1AQ5A 1MFTA 5CJ4A 2FYUE 4Y28J 2JWDA 1FC2C 1EXIA 3M9BA 1KORA 2OTKE 1NTMG 2JR8A 4N78D 1LTTC 5CCGC 5AVSB 4IFDK 1N7SD 3L74D 2M5AB 2R32A 1PP9E 1NKZB 1NOHA 1SQVD 2QJYB 2E5TA 3GF7A 3H1LG 2E74B 2G3AA 2HYNA 3EWKA 3R2PA 5L8RJ 3WUVA 4C7RA 1NAFA 4EIJA 3A5TA 3LW5J 1Q7YQ 1IC2A 2WT7B 4H13D 5KLVK 1P84I 3OAKA 5CCHD 3PP5A 3FGAD 3L70D 5H2FH 1VQPP 1VQ6P 1LGHB 1SFCD 5B5EE 1CSBA 4O9BA 2PFXA 2PGDA 4YPCA 1KB9I 3AE8C 5APVA 3WU2H 1EDKA 4IL6E 2V7QJ 2Z5HA 1H8AA 1JY3P 2ITAA 4XE5B 4YXWH 2E76C 1X79B 2YKPA 2BASA 1BSHA 2QM7A 2YKOA 1YYCA 1L4AA 1JY2P 3MIWA 3H1KJ 1VF5B 3MUDA 3IN6A 4XFJA 3TNUA 1N86A 1E5WA 3CWBG 2O1JA 4LGDE 1QGKB 3S1KA 1KQGB 2WSEJ 4H44B 4PD4H 4ASVA 2HODA 3L36A 3KZIH 1GZLA 3I55P 2QM8A 1K9MQ 1A02J 1NTKE 1KILA 2R3CA 2W6BA 1R5LA 2M8RA 3L35A 1LT9B 2QJKC 2ZAEB 4I1LA 3W67A 1M1KQ 1JY2O 1RQUA 1N7SB 2J58A 1L0LJ 1SQQE 2V4HA 5KTBA 1JOCA 1OWAA 4RESB 1KB9H 2P67A 3QWOC 4ZNCA 2BCCJ 2IX7C 3B8EB 1IJDB 3MP7B 2E75C 1NTKK 2QVAA 1M90Q 2WPSA 1LTIC 1FZCB 1P84H 1L4AB 1SQPG 1ZOYC 2WSEH 2N1TA 1KV4A 1J1DC 1XTGB 4KJMA 1UIIA 2MKVA 3L71E 1FAVA 1LTJA 1LWUA 1JY2N 2W90A 3AE5C 3H1JG 4HYTB 4W80A 3SSUA 1SQQD 1AVYA 1JEKA 1LJ2A 4GOEA 1NO4A 1PGPA 2B87B 1USEA 3CXHI 5B66H 3NXSA 2HR3A 3L74J 1HWTC 3LW5H 4QMAA 3B5NC 2LR2A 3H32A 3M0DC 5CBOA 1ZR2A 1KYOI 2XZRA 4PD4D 4UB8H 2Q9IA 2RH0A 2JO1A 3AE3C 1VL2A 3RBXA 5AVWB 3WU2E 2JWAA 1SQXE 2QSIA 2W6JH 4W7ZA 1N7SC 1UIXA 1BCCJ 3CLQA 5AW2B 1M1JB 3TDKA 3VMZA 1GDTA 2OYOA 2E42A 3HE4B 1SQXD 1YQ3C 2R5DA 1ZMEC 4R4MA 3L72J 5CJ0A 5KJ7C 1VQ4P 1RHZB 2FYNB 3HD7C 1AQTA 4PD4E 5CBNA 1S1CX 2N9YB 1FDMA 1LTJB 2D2CB 2NPSB 2OTLP 3AEAC 3WUUA 1IFPA 4GIFA 1K8AQ 5E79H 2FYUK 2BEQD 2IYPA 3L73G 1HBWA 3L70E 1RE3C 2N1TD 2FFDA 4U3FG 1Q82Q 2E74D 3S9OA 4DT0A 1RF0C 1R8EA 3L71D 3SFDC 2Y9ZA 1GK6A 1SQXK 2I1JA 3Q5RA 1JUNA 2Y0CA 4IOIH 3GHGB 4ZKPA 2HLOA 3ZDMA 1DEBA 2ZVOB 4M3LA 1GL2B 4PV1D 4A7PA 2GA1A 4JPZB 1SQBG 1PGQA 3E1IA 2Y9YA 2H89C 1MUUA 4PJ0E 5AW3B 3H1JJ 1JB0J 1LTBC 2FYZA 1XTCC 3A7OA 3IR9A 3RK3B 1N73A 3CCMP 5KLIB 2E43A 4OWFA 1K05A 1JM0A 2KOGA 1T2KD 2P58A 5DJTB 5APQA 2WQYC 3HD7B 2PP6A 3RL0C 3PRJA 1NTKD 2OTJP 3P7KA 3BCCE 4GOFA 1URQD 1E79H 1H89A 2FFDB 2OYHC 2HPCB 2YIUB 3CCQP 1OXZA 1BCCG 3NMDA 1H88A 1NWQA 3GHGA 1SFCC 2R5BA 3AEGC 3JC22 4L74A 3Q5PA 1JMBA 3L75J 1JTHA 2DW3A 4HJGH 1GL2A 4PD4I 2UWJE 5GTHH 2P1JA 1S3JA 3VMYA 3CD6P 2M3EA 1R5SA 1FZBA 2A45I 1N8RQ 1SQVK 1FJKA 2H7HA 2YO3A 1G2CB 5KKZC 3QH9A 4BXLA 3MGNA 2IBZD 3PHLA 2FXOA 3TGUD 1ZR4A 4Y99C 4NPFX 1GMJA 1EZVG 2E75B 3CMEP 2WVRA 3KQGA 1HF9A 1OW6A 1U7MA 4WB4A 2KSEA 1PP9D 1SQVE 5AW8B 2A45G 1M57D 2Q3IA 1FBMA 3L74E 1FZCC 2GM4A 4N78E 1NTZG 1WMKA 2XNXA 5AVRB 3A3YB 2JJLA 2WITA 3KDPB 2P7JA 3RL0D 2FYUD 4L75A 4D6TD 1CW5A 1RY3A 3GF3A 5CCGA 3BCCJ 2IYOA 1WRGA 1URQB 2C0WA 2K3RA 2ZFCA 3V2NA 4B86A 3D6ZA 1M8OB 2J5UA 2WMMA 1SQXJ 3L72G 4HB1A 1PPJE 3JCUE 3I56P 3G4SP 3VP8A 3Q3DA 2A06G 2K9YA 1FDOA 1JY3O 2O01N 1PV3A 4I6MC 3N7NA 1IO4A 3UIAA 3CMAP 1NTZD 3HRNA 2E76D 4DZOA 2KYVA 5CCHC 4I7ZC 3CCSP 2WWWA 1EZVI 1SVFA 1M1JC 3ITKA 4EYYQ 2WPVB 3G6EP 1NU1E 1VQLP 2IFNA 1BE3D 3TK1A 1T8ZA 3H1IG 1QLED 1KMIZ 2YXRB 3MD0A 2G8YA 4H0LC 5AVXB 3RK2C 3BVHA 3H25A 1OW7A 3D71A 1A02F 1CI6B 3AEDC 3FXEA 2AEMA 2YMYA 1KYOE 1T6AA 3MUDC 3NTNA 3EFGA 2K1AA 2WPRA 2B87A 3M9QA 5KAFE 4BRYB 1KD1Q 2N9BA 1W5CE 1NYHA 1LTSC 2MJZA 5AW9B 2FXMA 3L75D 2B89A 1MV8A 1EQ7A 1L0LE 1SQQJ 2KZJA 2R3SA 3H1ID 5CCGD 2AXTE 2XDJA 3CXHD 3FWLA 5CMZA 3HE5B 4YXDC 3CCVP 1AJYA 2IPPA 3C1LA 1IFIA 2QJPB 1VQ9P 1DIPA 1KQLA 1FE6A 4KHXA 4XA4A 5APWA 1HUCA 1SQBK 2AEJA 2P2UA 3V6IA 3P32A 3H1HE 4I7ZB 4EDFA 5TISH 2W83C 3CX5H 1SLQA 2YXQB 1AFOA 1HTLC 4L73A 3HUSB 2Y0DA 4LLHA 2OYIA 1RF1B 1CI6A 1KFMA 2E76B 2H88C 3FWNA 3L75G 1L0NE 4N3YB 2C9LY 1SQPK 3AEFC 3RK3E 2N1TC 4EI2A 2O01H 3H1KG 4WBAA 1LWUC 3V2PA 1T2KC 2KIKA 1RQVA 1NTME 5H2FE 1SQBD 3BRVB 4RO0A 1YJ9P 3ABVC 2LXCB 3GW6A 3P8CE 2Q6QA 3A2AA 4JF7A 2K9JB 3H1LE 5APUA 2HG5D 3H32B 1BGYD 1VQ8P 3OA7A 1BGYG 3M0DA 1BE3G 2NRGA 2O01J 3TSIA 1Z56A 5KJ7D 2BCCE 1VQKP 3SWYA 2WPQA 3G9RA 5TISE 1SQBJ 2WSCH 4WWIA 3H1KD 1IFDA 3A0HE 3TYYA 1EDJA 4DOJA 3HUSA 1RF1A 3MHVA 4OGQB 5AW1B 4AYCA 5KAFH 2P10A 3L72D 5KLIC 2KUBA 2M3BA 1LT9C 3HD7A 3LIEA 2M0BA 5KJ7A 3CC4P 1SQQK 1ZRTD 2I1KA 1ZXGA 2NPSA 2V7QH 1QL2A 1MZ9A 4Y99B 4D6TG 1BCCD 1H0TA 2IFMA 4H44D 2XU6A 1RE3A 1SQVJ 3V5BA 3V4WA 2AXCA 3AE9C 4IL6H 1M56D 2JP3A 5TJHA 4JBZA 1USDA 4HKZH 1QL1A 1X9VA 1NTKG 4JQ0D 4K35A 4RJTA 2OQQA 2D2CD 5KAIH 1FOSF 1PFIA 3BRTB 1G1JA 3CX5E 3SFEC 3O6QA 1OZHA 3TGUG 2IBZG 1NJIQ 1SQQG 2KP8A 5BU8B 5AVUB 3HTKA 3AEBC 1LP1B 3H1JD 4H44C 4UB6H 1VQNP 4KT0J 4IFFA 1J1EC 2C0XA 3C8VA 1X8YA 3G3ZA 1S5LE 1KQFB 1JNMA 1BSNA 2PAJA 3KXDA 1YITP 2IDBA 4Z1MH 3USSA 3F89A 3E7KA 1S9KD 1RE4C 1SQPE 1IFNA 1Q90D 2KNCB 3B71A 3H1LJ 3D70A 4WVZA 3L71G 1H0TB 2VRSA 5KLVE 2OYHA
chains in the Genus database with same CATH topology
5AW5B 4JYCA 1LTGC 3RK2B 1NHLA 3I5CA 2YO2A 1FU1A 3GHGC 1SFCA 1GL2C 1KILB 3KYQA 3H6PA 3HTKB 1L0LK 2HODB 1G2CA 1JCCA 3II6A 3T97A 4C7NB 5AW4B 2NPSD 1IFMA 1YTZT 1FZCA 4ZKUA 2KB7P 2N1TB 3V4QA 1NU1K 4WY4B 4JYBA 3WMM0 1URQA 3L37A 1FZGA 4OH8B 5CHXA 1NWQA 2LKMA 1CZQA 1G1IA 1HGVA 5APYA 1JO5A 4C7NA 1JCDA 1ZN5A 3M91A 5CCHA 1T3JA 1M1JA 3HE4A 2O1KA 4W7YA 1GW3A 5AVYB 4AQRD 2W6AA 4WY4A 2YNYA 4I2LC 1NTZK 2XV5A 1GD2E 1SP4A 4WY4D 3BASA 1DH3A 5AW7B 4HH2A 2FKWB 1N73B 3V2RA 3NFQA 2GUSA 2J59M 2L5GB 3VTPC 2OYIB 2WT7A 2OYIC 3O8ZA 1J2JB 1J1DB 3VOPA 1T2KD 1T3UA 2XKMA 2W27A 1HGZA 1KILD 3EQ2A 1GTWA 2HPCA 2Q5UA 3LIDA 1HJBA 1L4AC 1NTMK 1LTAC 2CPSA 5AVVB 1VDFA 5AVTB 2GUVA 3C9IA 1L0NK 1NH4A 4GKGA 3VN0A 3HUSC 1KILC 1RF1C 3CI9A 3B5NB 2A45H 3U59A 1S9KE 3P8CD 1LT9A 1N7LA 2WTYA 3L4FA 2NPSC 2JEEA 3RK3D 1N2DC 1NKNA 1HVVA 1ZV8A 2WSFH 1LTJC 4C46A 1ZR2A 1LWUB 3M06A 4GT1A 1FZEA 3TNUB 4EOTA 5BVZA 1JMMA 1WT6A 3B5NA 3BATA 1ZLLA 4LC1A 2POHA 1RE4A 1W2EA 1N7SA 2Z4EA 2OYHB 3B5ND 2KLVA 5AW0B 2WZ7A 1IFJA 1SFCB 1FZAA 3U1AA 4IFMA 1GL2D 2FFDC 3RK2D 1RF0A 1J1EB 1IK9A 1GW4A 3HE5A 3HD7D 3VP9A 2C9NY 5APSA 3VMXA 2Z5IA 2H8PD 2OARA 2ZXEB 5BU5A 1N73C 3CL3D 1GK4A 3M9HA 4N6JA 3U1CA 1VPCA 1FJPA 1URQC 1DX7A 1GU5A 1YTZI 1M7LA 2CPBA 1L4AD 3IFMA 1KZUB 5AVQB 1JTHB 2HFED 5APTA 1HH0A 3KPEA 3OJAB 2KSJA 5APXA 3RK3C 4AUWA 3M0AA 3MTUE 1GU4A 4WY4C 3P8MC 3RL0B 5AW6B 2H43A 2Q7CA 1MFZA 2YKQA 1JY3N 1KFNA 5AVZB 3VYIA 3N4XA 1AQ5A 5CJ4A 3M9BA 4N78D 5CCGC 1LTTC 5AVSB 4IFDK 1N7SD 3V2QA 2R32A 1NKZB 1NOHA 3R2PA 2HYNA 4C7RA 1NAFA 4EIJA 3A5TA 1IC2A 2WT7B 5KLVK 3OAKA 3PP5A 1LGHB 1SFCD 1CSBA 4O9BA 5APVA 2Z5HA 1H8AA 1JY3P 4XE5B 1X79B 2YKPA 2BASA 2QM7A 2YKOA 1YYCA 1L4AA 1JY2P 3MIWA 3MUDA 3TNUA 1N86A 1E5WA 2O1JA 4LGDE 2HODA 3L36A 1GZLA 2QM8A 1A02J 1KILA 2R3CA 2W6BA 2M8RA 3L35A 1LT9B 4I1LA 1JY2O 1N7SB 2J58A 5KTBA 1JOCA 1OWAA 4RESB 2P67A 2IX7C 3B8EB 1IJDB 1NTKK 2WPSA 1LTIC 1FZCB 1L4AB 2WSEH 2N1TA 1J1DC 1XTGB 1FAVA 1LTJA 1LWUA 1JY2N 4HYTB 5CCHD 4W80A 1NO4A 3NXSA 1HWTC 3LW5H 3B5NC 3H32A 3M0DC 2XZRA 2Q9IA 5AVWB 4W7ZA 1N7SC 3CLQA 5AW2B 1M1JB 3VMZA 1GDTA 2E42A 3HE4B 2R5DA 5CJ0A 5KJ7C 3HD7C 1LTJB 2NPSB 4GIFA 2FYUK 1HBWA 2FFDA 1RE3C 2N1TD 1RF0C 1JUNA 1GK6A 1SQXK 2I1JA 3GHGB 4ZKPA 2HLOA 1DEBA 4M3LA 1GL2B 3E1IA 1MUUA 5AW3B 2FYZA 1LTBC 3A7OA 1XTCC 3IR9A 3RK3B 1N73A 2E43A 2KOGA 5APQA 3HD7B 2PP6A 3RL0C 3P7KA 1URQD 1H89A 2FFDB 2OYHC 2HPCB 1OXZA 3NMDA 1H88A 3GHGA 1SFCC 2R5BA 1JTHA 1GL2A 2P1JA 3VMYA 1FZBA 2A45I 1SQVK 1FJKA 2H7HA 2YO3A 1G2CB 3MGNA 1ZR4A 4Y99C 3KQGA 4WB4A 1FZCC 5AW8B 2GM4A 2A45G 2Q3IA 1FBMA 4N78E 2XNXA 5AVRB 3A3YB 2JJLA 2WITA 3KDPB 2P7JA 3RL0D 1CW5A 1RY3A 5CCGA 4B86A 1WRGA 1URQB 2C0WA 3V2NA 2ZFCA 3VP8A 1JY3O 4I6MC 3N7NA 1IO4A 3UIAA 3HRNA 4DZOA 2KYVA 5CCHC 1FZFA 2WWWA 1SVFA 1M1JC 2IFNA 3TK1A 1T8ZA 3MD0A 3RK2C 5AVXB 3BVHA 1A02F 1CI6B 2YMYA 3NTNA 1FDMA 3EFGA 2WPRA 3M9QA 2N9BA 1LTSC 2MJZA 5AW9B 2FXMA 1MV8A 1EQ7A 5CCGD 2XDJA 5CMZA 3HE5B 2IPPA 1IFIA 1KQLA 4KHXA 4XA4A 5APWA 1HUCA 1SQBK 2P2UA 3P32A 1SLQA 1AFOA 1HTLC 4LLHA 3HUSB 1RF1B 2OYIA 1CI6A 1KFMA 4N3YB 2C9LY 1SQPK 2N1TC 2O01H 4WBAA 1LWUC 3V2PA 1T2KC 3BRVB 4JF7A 3P8CE 3A2AA 5APUA 2HG5D 3H32B 3OA7A 3SWFA 3M0DA 3TSIA 1Z56A 5KJ7D 3SWYA 2WPQA 2WSCH 1IFDA 3TYYA 4DOJA 3HUSA 1RF1A 5AW1B 4AYCA 5KJ7A 2M3BA 3HD7A 1LT9C 3LIEA 1SQQK 2I1KA 2NPSA 1QL2A 1MZ9A 4Y99B 2IFMA 2XU6A 1RE3A 3V5BA 3V4WA 1FOSE 1QL1A 1X9VA 1PFIA 1FOSF 3BRTB 1G1JA 2KP8A 5BU8B 5AVUB 3HTKA 4IFFA 1J1EC 2C0XA 3G3ZA 1X8YA 1JNMA 2PAJA 1S9KD 1RE4C 1IFNA 2VRSA 2OYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HVV A;  3RK2 B;  4N78 E;  1NHL A;  3RL0 D;  1L4A A;  1SFC A;  5CCG A;  1URQ B;  1GL2 C;  4LGD E;  1KIL B;  3KYQ A;  3HTK B;  3B5N A;  1KIL A;  2M8R A;  5CCH C;  1N7S B;  1N7S A;  2NPS D;  3RK2 C;  3B5N D;  2N1T B;  1L4A B;  2WZ7 A;  1SFC B;  2YMY A;  2N1T A;  4WY4 B;  1XTG B;  1URQ A;  5CCH D;  4W80 A;  4OH8 B;  1GL2 D;  3RK2 D;  5CCG D;  3B5N C;  2XDJ A;  3M0D C;  5CCH A;  1T3J A;  3HD7 D;  4W7Z A;  4W7Y A;  1N7S C;  2H8P D;  5KJ7 C;  3HD7 C;  4WY4 A;  2N1T C;  2NPS B;  1URQ C;  2N1T D;  4JF7 A;  3P8C E;  2HG5 D;  1L4A D;  4WY4 D;  3TSI A;  5KJ7 D;  1JTH B;  1GL2 B;  2HFE D;  3RK3 C;  3RK3 B;  5KJ7 A;  3HD7 A;  2KOG A;  4WY4 C;  3VOP A;  3RL0 B;  3HD7 B;  2PP6 A;  2NPS A;  3RL0 C;  1URQ D;  1KIL D;  1L4A C;  1SFC C;  5CCG C;  1JTH A;  1GL2 A;  1N7S D;  1KIL C;  3B5N B;  3PP5 A;  1SFC D;  2NPS C;  3RK3 D; 
#chains in the Genus database with same CATH topology
 5AW5 B;  1FDI A;  1FS0 E;  3L73 D;  4JYC A;  2CK3 H;  1LTG C;  3RK2 B;  3SWF A;  1NHL A;  3I5C A;  2YO2 A;  4GOD A;  1FU1 A;  1S2E A;  1SFC A;  2ZT9 C;  3GHG C;  1BE3 J;  2A06 D;  2WSF J;  2ZT9 B;  3A0H H;  3AEC C;  1DD4 A;  1VQ7 P;  1GL2 C;  1KIL E;  2WSC J;  1KIL B;  3KYQ A;  1PGJ A;  3H6P A;  1SQX G;  2FXP A;  3CWB D;  3HTK B;  4TLF A;  1L0L K;  2QJP C;  2FYU G;  2KK7 A;  3CPW O;  2HOD B;  1S5L H;  1G2C A;  1JCC A;  3II6 A;  3T97 A;  4C7N B;  1Q81 Q;  1EXJ A;  4L76 A;  4UB8 E;  1PP9 G;  1PIX A;  2KNC A;  1EDL A;  1Q86 Q;  5AW4 B;  3SWK A;  1P84 D;  1EZV D;  2K88 A;  2NPS D;  3V2Q A;  1BGY J;  1IFM A;  1YTZ T;  4H13 B;  5KAI E;  4ZKU A;  4U3F D;  1FZC A;  2KB7 P;  2N1T B;  3CC2 P;  2JDI H;  4BRY A;  4U3F E;  3V4Q A;  1AV1 A;  1NU1 K;  4WY4 B;  5DJU B;  1S5L X;  4JYB A;  3WMM 0;  1URQ A;  3L37 A;  3H1I J;  1OVV A;  1TU3 F;  4OH8 B;  5CHX A;  2LKM A;  2B9B A;  1CZQ A;  4PV1 B;  1G1I A;  2KS1 A;  4PV1 C;  1S72 P;  1HGV A;  3A0B H;  4H0L D;  5APY A;  1JO5 A;  5B5E H;  2K37 A;  3T97 B;  1JCD A;  4C7N A;  1Y9B A;  1ZN5 A;  3CWB E;  4R4L A;  3M91 A;  5CCH A;  3CCL P;  3FXD A;  1T3J A;  3F5H A;  3CCR P;  1M1J A;  1KB9 E;  2JKV A;  2FY8 A;  3HE4 A;  2O1K A;  3AE7 C;  4W7Y A;  1GW3 A;  4OGQ C;  2B88 A;  1OMI A;  2QEX P;  1KQS O;  1NTK J;  5GTH E;  1KB9 D;  5AVY B;  2ZJS E;  5C39 A;  4AQR D;  5K5G B;  1NTM J;  3Q5S A;  2W6A A;  4H13 C;  1K73 Q;  1NTZ J;  1PL5 A;  4WY4 A;  2YNY A;  3KZI E;  2O3J A;  3S4R A;  1AVO A;  2R44 A;  1VQ5 P;  2PRR A;  3PH0 A;  4I2L C;  1NTZ K;  2XV5 A;  3AE2 C;  3PLN A;  2QA4 P;  1SP4 A;  2Y0E A;  2L91 A;  4WY4 D;  1IK7 A;  2YIU C;  1GD2 E;  2Q1K A;  3BAS A;  3H1J E;  1OX3 A;  2ZYA A;  2W8Z A;  3CC7 P;  2LXB A;  1DH3 A;  3Q1M A;  5AW7 B;  1Y47 A;  5M1B A;  3MZW B;  2RKL A;  4HH2 A;  3RL0 g;  3GMA A;  1YI2 P;  2FKW B;  2FBW C;  2IBZ I;  1EZV E;  1P84 E;  2GUS A;  2J59 M;  2L5G B;  3NFQ A;  3V2R A;  3VTP C;  2OYI B;  2WT7 A;  2OYI C;  1S4X A;  1SQV G;  3O8Z A;  4IL6 X;  3VMA A;  3L74 G;  1KTM A;  2QIW A;  1PP9 J;  2ZVN B;  1J2J B;  5B66 E;  1J1D B;  3VOP A;  4BWN A;  1PZQ A;  4K3A A;  1VF5 D;  3CX5 I;  5E79 E;  1U7J A;  3A0B E;  1U57 A;  2FYU J;  3AE6 C;  3W68 A;  1T3U A;  2AEF A;  2XKM A;  3EFF K;  3L70 J;  2W27 A;  5KLV J;  2BEZ F;  1HGZ A;  1NGM B;  3CCE P;  1KIL D;  2K9J A;  3D6Y A;  3EQ2 A;  3L72 E;  1PPJ G;  1L0N J;  1LT1 A;  1SQP J;  1GTW A;  2HPC A;  2A06 E;  2Q5U A;  3LID A;  1HJB A;  1L4A C;  1MKM A;  1NTM K;  1LTA C;  1W2B O;  1DD3 A;  2CPS A;  3L73 E;  1VDF A;  1D7M A;  3L70 G;  4PJ0 H;  5AVV B;  2GUV A;  5AVT B;  3C9I A;  3RBZ A;  1L0N K;  5KLV D;  2YMK A;  1NH4 A;  2BCC D;  4GKG A;  3R4Y A;  1KC8 Q;  1QX8 A;  3VN0 A;  3HUS C;  1KIL C;  1RF1 C;  1QEX A;  1SQP D;  3B5N B;  3CI9 A;  2A45 H;  3GG2 A;  4RKU J;  3U59 A;  1S9K E;  2IZ0 A;  3P8C D;  1LT9 A;  1N7L A;  1DEE G;  4ZMD A;  2WTY A;  3G71 P;  1SQB E;  2AXT H;  3L4F A;  2NPS C;  3KHU A;  3L71 J;  2JEE A;  2RN0 A;  1YJW P;  3RK3 D;  1N2D C;  1Q2N A;  1FOS E;  1L0N D;  1NKN A;  3AE4 C;  1HVV A;  3TF5 A;  3CX5 D;  3E1R A;  1ZV8 A;  4YTP C;  2E5Y A;  2WSF H;  3K5B A;  1QVF O;  3BCC G;  2QE7 H;  3H1H D;  1LTJ C;  2D2C C;  2I8D A;  1LWU B;  3O6Q B;  4C46 A;  3IF4 A;  3M06 A;  4GT1 A;  1FZE A;  1BDC A;  3PTZ A;  1X0T A;  3TNU B;  3WUT A;  1SS1 A;  4EOT A;  1BCC E;  1LP1 A;  2ZXX A;  4D6T J;  5BVZ A;  1WT6 A;  1JMM A;  3B5N A;  3CXH E;  1EDI A;  1ZRT E;  3BAT A;  1PGO A;  1ZLL A;  1BDD A;  3PJS K;  2XND H;  4LC1 A;  2POH A;  1N73 B;  3L75 E;  1VQO P;  3L73 J;  1RE4 A;  1YIJ P;  1EC5 A;  3FX0 A;  1W2E A;  2KXP B;  1N7S A;  2Z4E A;  3H1K E;  3Q2Y A;  2OYH B;  2SPZ A;  3B5N D;  2KLV A;  1K04 A;  5AW0 B;  2WZ7 A;  1IFJ A;  3OW2 O;  1SFC B;  2OGU A;  2KZI A;  1FZA A;  1BGY E;  1LNQ A;  1BE3 E;  3GLM A;  1YHQ P;  3H1L D;  3U1A A;  1ZP0 C;  1NU1 D;  2BCC G;  4IFM A;  1VF5 C;  1GL2 D;  1AA0 A;  1YBK A;  3JCU H;  2FFD C;  1NTM D;  1NTZ E;  3RK2 D;  5GTI H;  3CCJ P;  3AEE C;  1RF0 A;  2QJK B;  3CXH H;  5EFW B;  1J1E B;  2Q3E A;  2KI7 B;  4OGQ D;  1YJN P;  2IZ1 A;  1ZW0 A;  1IK9 A;  1NVO A;  1GW4 A;  4DCK A;  3HE5 A;  4NPD A;  3IAO A;  1KN7 A;  1NU1 J;  3HD7 D;  1L2P A;  3VP9 A;  2QRX A;  2C9N Y;  5APS A;  3VMX A;  3CCU P;  2Z5I A;  2H8P D;  3CWB J;  2OAR A;  1FZF A;  4D6T E;  2ZXE B;  5BU5 A;  1N73 C;  5KKZ B;  3CL3 D;  1GK4 A;  4UB6 E;  1NU1 G;  3M9H A;  4N6J A;  3U1C A;  1VPC A;  1FJP A;  4TT3 H;  1NAY A;  1URQ C;  3H1I E;  1QVG O;  2RMZ A;  1DX7 A;  1L0L D;  1HJ0 A;  1GU5 A;  2KS1 B;  1YTZ I;  3TGU E;  2IBZ E;  1FZG A;  1M7L A;  2CPB A;  4OVN F;  4U3F J;  1L4A D;  3IFM A;  1KYO D;  1KZU B;  4ASW A;  4CPG A;  2QJY C;  2ZYG A;  5AVQ B;  2E74 C;  1JTH B;  1OVR A;  4DJG A;  2HFE D;  3JSV C;  1L0L G;  2M5A A;  1OIP A;  5APT A;  1HH0 A;  3H1H J;  1Y8A A;  3KPE A;  3OJA B;  1OVU A;  1YQ4 C;  2E75 D;  2KSJ A;  4H0L B;  5APX A;  2FYN C;  1KYO H;  2QG4 A;  2NZ2 A;  3RK3 C;  4AUW A;  5KLV G;  3B4S A;  4U7J A;  1X22 A;  3M0A A;  3MTU E;  1IZN B;  4GDO A;  1GU4 A;  4WY4 C;  3P8M C;  3RL0 B;  3H1H G;  5AW6 B;  2WSS H;  3BCC D;  3AE1 C;  2KLU A;  2Q7C A;  5GTI E;  2ZT9 D;  1OFC X;  2H43 A;  1MFZ A;  4MN4 C;  2YKQ A;  1PPJ D;  1RH5 B;  1JY3 N;  1KFN A;  1OW8 A;  3RGU A;  3TGU J;  2ZYD A;  4NPE A;  5AVZ B;  3VYI A;  1L0N G;  1VQM P;  3N4X A;  1AQ5 A;  1MFT A;  5CJ4 A;  2FYU E;  4Y28 J;  2JWD A;  1FC2 C;  1EXI A;  3M9B A;  1KOR A;  2OTK E;  1NTM G;  2JR8 A;  4N78 D;  1LTT C;  5CCG C;  5AVS B;  4IFD K;  1N7S D;  3L74 D;  2M5A B;  2R32 A;  1PP9 E;  1NKZ B;  1NOH A;  1SQV D;  2QJY B;  2E5T A;  3GF7 A;  3H1L G;  2E74 B;  2G3A A;  2HYN A;  3EWK A;  3R2P A;  5L8R J;  3WUV A;  4C7R A;  1NAF A;  4EIJ A;  3A5T A;  3LW5 J;  1Q7Y Q;  1IC2 A;  2WT7 B;  4H13 D;  5KLV K;  1P84 I;  3OAK A;  5CCH D;  3PP5 A;  3FGA D;  3L70 D;  5H2F H;  1VQP P;  1VQ6 P;  1LGH B;  1SFC D;  5B5E E;  1CSB A;  4O9B A;  2PFX A;  2PGD A;  4YPC A;  1KB9 I;  3AE8 C;  5APV A;  3WU2 H;  1EDK A;  4IL6 E;  2V7Q J;  2Z5H A;  1H8A A;  1JY3 P;  2ITA A;  4XE5 B;  4YXW H;  2E76 C;  1X79 B;  2YKP A;  2BAS A;  1BSH A;  2QM7 A;  2YKO A;  1YYC A;  1L4A A;  1JY2 P;  3MIW A;  3H1K J;  1VF5 B;  3MUD A;  3IN6 A;  4XFJ A;  3TNU A;  1N86 A;  1E5W A;  3CWB G;  2O1J A;  4LGD E;  1QGK B;  3S1K A;  1KQG B;  2WSE J;  4H44 B;  4PD4 H;  4ASV A;  2HOD A;  3L36 A;  3KZI H;  1GZL A;  3I55 P;  2QM8 A;  1K9M Q;  1A02 J;  1NTK E;  1KIL A;  2R3C A;  2W6B A;  1R5L A;  2M8R A;  3L35 A;  1LT9 B;  2QJK C;  2ZAE B;  4I1L A;  3W67 A;  1M1K Q;  1JY2 O;  1RQU A;  1N7S B;  2J58 A;  1L0L J;  1SQQ E;  2V4H A;  5KTB A;  1JOC A;  1OWA A;  4RES B;  1KB9 H;  2P67 A;  3QWO C;  4ZNC A;  2BCC J;  2IX7 C;  3B8E B;  1IJD B;  3MP7 B;  2E75 C;  1NTK K;  2QVA A;  1M90 Q;  2WPS A;  1LTI C;  1FZC B;  1P84 H;  1L4A B;  1SQP G;  1ZOY C;  2WSE H;  2N1T A;  1KV4 A;  1J1D C;  1XTG B;  4KJM A;  1UII A;  2MKV A;  3L71 E;  1FAV A;  1LTJ A;  1LWU A;  1JY2 N;  2W90 A;  3AE5 C;  3H1J G;  4HYT B;  4W80 A;  3SSU A;  1SQQ D;  1AVY A;  1JEK A;  1LJ2 A;  4GOE A;  1NO4 A;  1PGP A;  2B87 B;  1USE A;  3CXH I;  5B66 H;  3NXS A;  2HR3 A;  3L74 J;  1HWT C;  3LW5 H;  4QMA A;  3B5N C;  2LR2 A;  3H32 A;  3M0D C;  5CBO A;  1ZR2 A;  1KYO I;  2XZR A;  4PD4 D;  4UB8 H;  2Q9I A;  2RH0 A;  2JO1 A;  3AE3 C;  1VL2 A;  3RBX A;  5AVW B;  3WU2 E;  2JWA A;  1SQX E;  2QSI A;  2W6J H;  4W7Z A;  1N7S C;  1UIX A;  1BCC J;  3CLQ A;  5AW2 B;  1M1J B;  3TDK A;  3VMZ A;  1GDT A;  2OYO A;  2E42 A;  3HE4 B;  1SQX D;  1YQ3 C;  2R5D A;  1ZME C;  4R4M A;  3L72 J;  5CJ0 A;  5KJ7 C;  1VQ4 P;  1RHZ B;  2FYN B;  3HD7 C;  1AQT A;  4PD4 E;  5CBN A;  1S1C X;  2N9Y B;  1FDM A;  1LTJ B;  2D2C B;  2NPS B;  2OTL P;  3AEA C;  3WUU A;  1IFP A;  4GIF A;  1K8A Q;  5E79 H;  2FYU K;  2BEQ D;  2IYP A;  3L73 G;  1HBW A;  3L70 E;  1RE3 C;  2N1T D;  2FFD A;  4U3F G;  1Q82 Q;  2E74 D;  3S9O A;  4DT0 A;  1RF0 C;  1R8E A;  3L71 D;  3SFD C;  2Y9Z A;  1GK6 A;  1SQX K;  2I1J A;  3Q5R A;  1JUN A;  2Y0C A;  4IOI H;  3GHG B;  4ZKP A;  2HLO A;  3ZDM A;  1DEB A;  2ZVO B;  4M3L A;  1GL2 B;  4PV1 D;  4A7P A;  2GA1 A;  4JPZ B;  1SQB G;  1PGQ A;  3E1I A;  2Y9Y A;  2H89 C;  1MUU A;  4PJ0 E;  5AW3 B;  3H1J J;  1JB0 J;  1LTB C;  2FYZ A;  1XTC C;  3A7O A;  3IR9 A;  3RK3 B;  1N73 A;  3CCM P;  5KLI B;  2E43 A;  4OWF A;  1K05 A;  1JM0 A;  2KOG A;  1T2K D;  2P58 A;  5DJT B;  5APQ A;  2WQY C;  3HD7 B;  2PP6 A;  3RL0 C;  3PRJ A;  1NTK D;  2OTJ P;  3P7K A;  3BCC E;  4GOF A;  1URQ D;  1E79 H;  1H89 A;  2FFD B;  2OYH C;  2HPC B;  2YIU B;  3CCQ P;  1OXZ A;  1BCC G;  3NMD A;  1H88 A;  1NWQ A;  3GHG A;  1SFC C;  2R5B A;  3AEG C;  3JC2 2;  4L74 A;  3Q5P A;  1JMB A;  3L75 J;  1JTH A;  2DW3 A;  4HJG H;  1GL2 A;  4PD4 I;  2UWJ E;  5GTH H;  2P1J A;  1S3J A;  3VMY A;  3CD6 P;  2M3E A;  1R5S A;  1FZB A;  2A45 I;  1N8R Q;  1SQV K;  1FJK A;  2H7H A;  2YO3 A;  1G2C B;  5KKZ C;  3QH9 A;  4BXL A;  3MGN A;  2IBZ D;  3PHL A;  2FXO A;  3TGU D;  1ZR4 A;  4Y99 C;  4NPF X;  1GMJ A;  1EZV G;  2E75 B;  3CME P;  2WVR A;  3KQG A;  1HF9 A;  1OW6 A;  1U7M A;  4WB4 A;  2KSE A;  1PP9 D;  1SQV E;  5AW8 B;  2A45 G;  1M57 D;  2Q3I A;  1FBM A;  3L74 E;  1FZC C;  2GM4 A;  4N78 E;  1NTZ G;  1WMK A;  2XNX A;  5AVR B;  3A3Y B;  2JJL A;  2WIT A;  3KDP B;  2P7J A;  3RL0 D;  2FYU D;  4L75 A;  4D6T D;  1CW5 A;  1RY3 A;  3GF3 A;  5CCG A;  3BCC J;  2IYO A;  1WRG A;  1URQ B;  2C0W A;  2K3R A;  2ZFC A;  3V2N A;  4B86 A;  3D6Z A;  1M8O B;  2J5U A;  2WMM A;  1SQX J;  3L72 G;  4HB1 A;  1PPJ E;  3JCU E;  3I56 P;  3G4S P;  3VP8 A;  3Q3D A;  2A06 G;  2K9Y A;  1FDO A;  1JY3 O;  2O01 N;  1PV3 A;  4I6M C;  3N7N A;  1IO4 A;  3UIA A;  3CMA P;  1NTZ D;  3HRN A;  2E76 D;  4DZO A;  2KYV A;  5CCH C;  4I7Z C;  3CCS P;  2WWW A;  1EZV I;  1SVF A;  1M1J C;  3ITK A;  4EYY Q;  2WPV B;  3G6E P;  1NU1 E;  1VQL P;  2IFN A;  1BE3 D;  3TK1 A;  1T8Z A;  3H1I G;  1QLE D;  1KMI Z;  2YXR B;  3MD0 A;  2G8Y A;  4H0L C;  5AVX B;  3RK2 C;  3BVH A;  3H25 A;  1OW7 A;  3D71 A;  1A02 F;  1CI6 B;  3AED C;  3FXE A;  2AEM A;  2YMY A;  1KYO E;  1T6A A;  3MUD C;  3NTN A;  3EFG A;  2K1A A;  2WPR A;  2B87 A;  3M9Q A;  5KAF E;  4BRY B;  1KD1 Q;  2N9B A;  1W5C E;  1NYH A;  1LTS C;  2MJZ A;  5AW9 B;  2FXM A;  3L75 D;  2B89 A;  1MV8 A;  1EQ7 A;  1L0L E;  1SQQ J;  2KZJ A;  2R3S A;  3H1I D;  5CCG D;  2AXT E;  2XDJ A;  3CXH D;  3FWL A;  5CMZ A;  3HE5 B;  4YXD C;  3CCV P;  1AJY A;  2IPP A;  3C1L A;  1IFI A;  2QJP B;  1VQ9 P;  1DIP A;  1KQL A;  1FE6 A;  4KHX A;  4XA4 A;  5APW A;  1HUC A;  1SQB K;  2AEJ A;  2P2U A;  3V6I A;  3P32 A;  3H1H E;  4I7Z B;  4EDF A;  5TIS H;  2W83 C;  3CX5 H;  1SLQ A;  2YXQ B;  1AFO A;  1HTL C;  4L73 A;  3HUS B;  2Y0D A;  4LLH A;  2OYI A;  1RF1 B;  1CI6 A;  1KFM A;  2E76 B;  2H88 C;  3FWN A;  3L75 G;  1L0N E;  4N3Y B;  2C9L Y;  1SQP K;  3AEF C;  3RK3 E;  2N1T C;  4EI2 A;  2O01 H;  3H1K G;  4WBA A;  1LWU C;  3V2P A;  1T2K C;  2KIK A;  1RQV A;  1NTM E;  5H2F E;  1SQB D;  3BRV B;  4RO0 A;  1YJ9 P;  3ABV C;  2LXC B;  3GW6 A;  3P8C E;  2Q6Q A;  3A2A A;  4JF7 A;  2K9J B;  3H1L E;  5APU A;  2HG5 D;  3H32 B;  1BGY D;  1VQ8 P;  3OA7 A;  1BGY G;  3M0D A;  1BE3 G;  2NRG A;  2O01 J;  3TSI A;  1Z56 A;  5KJ7 D;  2BCC E;  1VQK P;  3SWY A;  2WPQ A;  3G9R A;  5TIS E;  1SQB J;  2WSC H;  4WWI A;  3H1K D;  1IFD A;  3A0H E;  3TYY A;  1EDJ A;  4DOJ A;  3HUS A;  1RF1 A;  3MHV A;  4OGQ B;  5AW1 B;  4AYC A;  5KAF H;  2P10 A;  3L72 D;  5KLI C;  2KUB A;  2M3B A;  1LT9 C;  3HD7 A;  3LIE A;  2M0B A;  5KJ7 A;  3CC4 P;  1SQQ K;  1ZRT D;  2I1K A;  1ZXG A;  2NPS A;  2V7Q H;  1QL2 A;  1MZ9 A;  4Y99 B;  4D6T G;  1BCC D;  1H0T A;  2IFM A;  4H44 D;  2XU6 A;  1RE3 A;  1SQV J;  3V5B A;  3V4W A;  2AXC A;  3AE9 C;  4IL6 H;  1M56 D;  2JP3 A;  5TJH A;  4JBZ A;  1USD A;  4HKZ H;  1QL1 A;  1X9V A;  1NTK G;  4JQ0 D;  4K35 A;  4RJT A;  2OQQ A;  2D2C D;  5KAI H;  1FOS F;  1PFI A;  3BRT B;  1G1J A;  3CX5 E;  3SFE C;  3O6Q A;  1OZH A;  3TGU G;  2IBZ G;  1NJI Q;  1SQQ G;  2KP8 A;  5BU8 B;  5AVU B;  3HTK A;  3AEB C;  1LP1 B;  3H1J D;  4H44 C;  4UB6 H;  1VQN P;  4KT0 J;  4IFF A;  1J1E C;  2C0X A;  3C8V A;  1X8Y A;  3G3Z A;  1S5L E;  1KQF B;  1JNM A;  1BSN A;  2PAJ A;  3KXD A;  1YIT P;  2IDB A;  4Z1M H;  3USS A;  3F89 A;  3E7K A;  1S9K D;  1RE4 C;  1SQP E;  1IFN A;  1Q90 D;  2KNC B;  3B71 A;  3H1L J;  3D70 A;  4WVZ A;  3L71 G;  1H0T B;  2VRS A;  5KLV E;  2OYH A; 
#chains in the Genus database with same CATH homology
 5AW5 B;  4JYC A;  1LTG C;  3RK2 B;  1NHL A;  3I5C A;  2YO2 A;  1FU1 A;  3GHG C;  1SFC A;  1GL2 C;  1KIL B;  3KYQ A;  3H6P A;  3HTK B;  1L0L K;  2HOD B;  1G2C A;  1JCC A;  3II6 A;  3T97 A;  4C7N B;  5AW4 B;  2NPS D;  1IFM A;  1YTZ T;  1FZC A;  4ZKU A;  2KB7 P;  2N1T B;  3V4Q A;  1NU1 K;  4WY4 B;  4JYB A;  3WMM 0;  1URQ A;  3L37 A;  1FZG A;  4OH8 B;  5CHX A;  1NWQ A;  2LKM A;  1CZQ A;  1G1I A;  1HGV A;  5APY A;  1JO5 A;  4C7N A;  1JCD A;  1ZN5 A;  3M91 A;  5CCH A;  1T3J A;  1M1J A;  3HE4 A;  2O1K A;  4W7Y A;  1GW3 A;  5AVY B;  4AQR D;  2W6A A;  4WY4 A;  2YNY A;  4I2L C;  1NTZ K;  2XV5 A;  1GD2 E;  1SP4 A;  4WY4 D;  3BAS A;  1DH3 A;  5AW7 B;  4HH2 A;  2FKW B;  1N73 B;  3V2R A;  3NFQ A;  2GUS A;  2J59 M;  2L5G B;  3VTP C;  2OYI B;  2WT7 A;  2OYI C;  3O8Z A;  1J2J B;  1J1D B;  3VOP A;  1T2K D;  1T3U A;  2XKM A;  2W27 A;  1HGZ A;  1KIL D;  3EQ2 A;  1GTW A;  2HPC A;  2Q5U A;  3LID A;  1HJB A;  1L4A C;  1NTM K;  1LTA C;  2CPS A;  5AVV B;  1VDF A;  5AVT B;  2GUV A;  3C9I A;  1L0N K;  1NH4 A;  4GKG A;  3VN0 A;  3HUS C;  1KIL C;  1RF1 C;  3CI9 A;  3B5N B;  2A45 H;  3U59 A;  1S9K E;  3P8C D;  1LT9 A;  1N7L A;  2WTY A;  3L4F A;  2NPS C;  2JEE A;  3RK3 D;  1N2D C;  1NKN A;  1HVV A;  1ZV8 A;  2WSF H;  1LTJ C;  4C46 A;  1ZR2 A;  1LWU B;  3M06 A;  4GT1 A;  1FZE A;  3TNU B;  4EOT A;  5BVZ A;  1JMM A;  1WT6 A;  3B5N A;  3BAT A;  1ZLL A;  4LC1 A;  2POH A;  1RE4 A;  1W2E A;  1N7S A;  2Z4E A;  2OYH B;  3B5N D;  2KLV A;  5AW0 B;  2WZ7 A;  1IFJ A;  1SFC B;  1FZA A;  3U1A A;  4IFM A;  1GL2 D;  2FFD C;  3RK2 D;  1RF0 A;  1J1E B;  1IK9 A;  1GW4 A;  3HE5 A;  3HD7 D;  3VP9 A;  2C9N Y;  5APS A;  3VMX A;  2Z5I A;  2H8P D;  2OAR A;  2ZXE B;  5BU5 A;  1N73 C;  3CL3 D;  1GK4 A;  3M9H A;  4N6J A;  3U1C A;  1VPC A;  1FJP A;  1URQ C;  1DX7 A;  1GU5 A;  1YTZ I;  1M7L A;  2CPB A;  1L4A D;  3IFM A;  1KZU B;  5AVQ B;  1JTH B;  2HFE D;  5APT A;  1HH0 A;  3KPE A;  3OJA B;  2KSJ A;  5APX A;  3RK3 C;  4AUW A;  3M0A A;  3MTU E;  1GU4 A;  4WY4 C;  3P8M C;  3RL0 B;  5AW6 B;  2H43 A;  2Q7C A;  1MFZ A;  2YKQ A;  1JY3 N;  1KFN A;  5AVZ B;  3VYI A;  3N4X A;  1AQ5 A;  5CJ4 A;  3M9B A;  4N78 D;  5CCG C;  1LTT C;  5AVS B;  4IFD K;  1N7S D;  3V2Q A;  2R32 A;  1NKZ B;  1NOH A;  3R2P A;  2HYN A;  4C7R A;  1NAF A;  4EIJ A;  3A5T A;  1IC2 A;  2WT7 B;  5KLV K;  3OAK A;  3PP5 A;  1LGH B;  1SFC D;  1CSB A;  4O9B A;  5APV A;  2Z5H A;  1H8A A;  1JY3 P;  4XE5 B;  1X79 B;  2YKP A;  2BAS A;  2QM7 A;  2YKO A;  1YYC A;  1L4A A;  1JY2 P;  3MIW A;  3MUD A;  3TNU A;  1N86 A;  1E5W A;  2O1J A;  4LGD E;  2HOD A;  3L36 A;  1GZL A;  2QM8 A;  1A02 J;  1KIL A;  2R3C A;  2W6B A;  2M8R A;  3L35 A;  1LT9 B;  4I1L A;  1JY2 O;  1N7S B;  2J58 A;  5KTB A;  1JOC A;  1OWA A;  4RES B;  2P67 A;  2IX7 C;  3B8E B;  1IJD B;  1NTK K;  2WPS A;  1LTI C;  1FZC B;  1L4A B;  2WSE H;  2N1T A;  1J1D C;  1XTG B;  1FAV A;  1LTJ A;  1LWU A;  1JY2 N;  4HYT B;  5CCH D;  4W80 A;  1NO4 A;  3NXS A;  1HWT C;  3LW5 H;  3B5N C;  3H32 A;  3M0D C;  2XZR A;  2Q9I A;  5AVW B;  4W7Z A;  1N7S C;  3CLQ A;  5AW2 B;  1M1J B;  3VMZ A;  1GDT A;  2E42 A;  3HE4 B;  2R5D A;  5CJ0 A;  5KJ7 C;  3HD7 C;  1LTJ B;  2NPS B;  4GIF A;  2FYU K;  1HBW A;  2FFD A;  1RE3 C;  2N1T D;  1RF0 C;  1JUN A;  1GK6 A;  1SQX K;  2I1J A;  3GHG B;  4ZKP A;  2HLO A;  1DEB A;  4M3L A;  1GL2 B;  3E1I A;  1MUU A;  5AW3 B;  2FYZ A;  1LTB C;  3A7O A;  1XTC C;  3IR9 A;  3RK3 B;  1N73 A;  2E43 A;  2KOG A;  5APQ A;  3HD7 B;  2PP6 A;  3RL0 C;  3P7K A;  1URQ D;  1H89 A;  2FFD B;  2OYH C;  2HPC B;  1OXZ A;  3NMD A;  1H88 A;  3GHG A;  1SFC C;  2R5B A;  1JTH A;  1GL2 A;  2P1J A;  3VMY A;  1FZB A;  2A45 I;  1SQV K;  1FJK A;  2H7H A;  2YO3 A;  1G2C B;  3MGN A;  1ZR4 A;  4Y99 C;  3KQG A;  4WB4 A;  1FZC C;  5AW8 B;  2GM4 A;  2A45 G;  2Q3I A;  1FBM A;  4N78 E;  2XNX A;  5AVR B;  3A3Y B;  2JJL A;  2WIT A;  3KDP B;  2P7J A;  3RL0 D;  1CW5 A;  1RY3 A;  5CCG A;  4B86 A;  1WRG A;  1URQ B;  2C0W A;  3V2N A;  2ZFC A;  3VP8 A;  1JY3 O;  4I6M C;  3N7N A;  1IO4 A;  3UIA A;  3HRN A;  4DZO A;  2KYV A;  5CCH C;  1FZF A;  2WWW A;  1SVF A;  1M1J C;  2IFN A;  3TK1 A;  1T8Z A;  3MD0 A;  3RK2 C;  5AVX B;  3BVH A;  1A02 F;  1CI6 B;  2YMY A;  3NTN A;  1FDM A;  3EFG A;  2WPR A;  3M9Q A;  2N9B A;  1LTS C;  2MJZ A;  5AW9 B;  2FXM A;  1MV8 A;  1EQ7 A;  5CCG D;  2XDJ A;  5CMZ A;  3HE5 B;  2IPP A;  1IFI A;  1KQL A;  4KHX A;  4XA4 A;  5APW A;  1HUC A;  1SQB K;  2P2U A;  3P32 A;  1SLQ A;  1AFO A;  1HTL C;  4LLH A;  3HUS B;  1RF1 B;  2OYI A;  1CI6 A;  1KFM A;  4N3Y B;  2C9L Y;  1SQP K;  2N1T C;  2O01 H;  4WBA A;  1LWU C;  3V2P A;  1T2K C;  3BRV B;  4JF7 A;  3P8C E;  3A2A A;  5APU A;  2HG5 D;  3H32 B;  3OA7 A;  3SWF A;  3M0D A;  3TSI A;  1Z56 A;  5KJ7 D;  3SWY A;  2WPQ A;  2WSC H;  1IFD A;  3TYY A;  4DOJ A;  3HUS A;  1RF1 A;  5AW1 B;  4AYC A;  5KJ7 A;  2M3B A;  3HD7 A;  1LT9 C;  3LIE A;  1SQQ K;  2I1K A;  2NPS A;  1QL2 A;  1MZ9 A;  4Y99 B;  2IFM A;  2XU6 A;  1RE3 A;  3V5B A;  3V4W A;  1FOS E;  1QL1 A;  1X9V A;  1PFI A;  1FOS F;  3BRT B;  1G1J A;  2KP8 A;  5BU8 B;  5AVU B;  3HTK A;  4IFF A;  1J1E C;  2C0X A;  3G3Z A;  1X8Y A;  1JNM A;  2PAJ A;  1S9K D;  1RE4 C;  1IFN A;  2VRS A;  2OYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...