3PP5A

High-resolution structure of the trimeric scar/wave complex precursor brk1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
63
structure length
63
Chain Sequence
TKTNIQKDWEQREFIEDMSINIQKIVEFLNKFELSTRNKLSDLNEKLTILDRQVDYLEATFKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Brk1
publication title High-resolution X-ray structure of the trimeric Scar/WAVE-complex precursor Brk1.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Structural protein
total genus 31
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2010-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3pp5A01
1SFCD 4W7ZA 3KYQA 3VOPA 3HD7B 2NPSD 1GL2A 1N7SD 3HD7C 1URQA 1URQD 1KILB 2N1TB 4JF7A 2KOGA 2PP6A 3B5NA 3B5ND 4WY4D 3RL0B 1L4AA 3HTKB 3RK2D 2H8PD 1L4AC 4W7YA 4W80A 4N78E 5CCHA 2YMYA 3HD7A 1GL2D 3HD7D 5CCHC 1SFCB 3RK3D 4LGDE 5CCGC 1SFCC 2NPSB 1KILA 1KILC 3PP5A 1L4AD 1N7SB 5KJ7C 2N1TC 1T3JA 2NPSC 3RL0C 1HVVA 1N7SC 5CCHD 4WY4B 3M0DC 3P8CE 1JTHB 3TSIA 3RK2B 2WZ7A 4WY4C 1SFCA 4OH8B 5CCGA 5CCGD 3RK2C 5KJ7A 1KILD 5KJ7D 2N1TA 1GL2B 1XTGB 2N1TD 1JTHA 3RK3B 2NPSA 1URQB 3RL0D 2HFED 2XDJA 1N7SA 1GL2C 1NHLA 3B5NB 3RK3C 1URQC 1L4AB 2M8RA 4WY4A 2HG5D 3B5NC
chains in the Genus database with same CATH superfamily
1HTLC 3GHGA 2ZVNB 1NVOA 1NTZD 3CD6P 2W6JH 1A02J 2FYNB 1IJDB 1IC2A 3M06A 1VQ5P 1DEBA 3I56P 5AW9B 4I6MC 1QL1A 5CMZA 5AW8B 3FXDA 1LWUB 1NTMJ 1LJ2A 2G8YA 3T97B 3B5ND 4L75A 2OYIA 2H8PD 1LTBC 2ZYAA 3CCLP 3HUSA 1YBKA 3H1LD 3VMZA 1JO5A 1BE3J 1N73A 2R44A 4N78E 3EFGA 1RF1B 1FDIA 5E79H 4PV1C 3L36A 2QM8A 1HBWA 3L73D 2GM4A 2ZYDA 1LTTC 4K35A 3A0BE 2A45H 1BCCJ 3L70G 1KYOI 1RF0A 2OARA 3GHGB 1Y9BA 5TJHA 1ZV8A 3AE3C 4GDOA 1AQ5A 5GTIH 2V7QJ 3VP8A 1FZBA 2IYPA 1EZVI 5EFWB 1G2CA 2OYIB 1SVFA 1AVYA 2FYUG 3HUSB 2WPVB 3O6QA 2WPRA 5AW7B 1N73B 5AVUB 2AXTE 1JMBA 3ZDMA 4PJ0E 2W27A 3CCVP 2WWWA 3VP9A 2N9YB 1FJKA 2Z4EA 1NGMB 1G1JA 1JY2N 2KOGA 5KLVK 1BDDA 1L0LD 3A0HH 5AVYB 3RGUA 2AXCA 5AVSB 1BGYJ 1H88A 2BCCG 4GOEA 5CCHC 1PP9G 3C8VA 1T8ZA 3L70J 2RKLA 2WTYA 2M3EA 2PAJA 4YTPC 1HJ0A 3L72G 5BU8B 3BRVB 2K9YA 1NAYA 1G2CB 4BWNA 3G4SP 1SQVD 1VF5D 4BXLA 1NTMK 1KB9H 2J58A 2QSIA 3Q1MA 1CSBA 3L75D 5CCGD 2WSCH 2J5UA 5L8RJ 4N3YB 4C46A 2JKVA 5B5EH 1GK6A 2WT7B 2A45G 1GL2C 3MGNA 3PJSK 2OGUA 1JY2P 2JDIH 2M8RA 2Q9IA 2KZJA 2Z5IA 1N2DC 1NYHA 4O9BA 3CWBJ 2YXQB 1P84H 2XZRA 2FYZA 1VF5B 2VRSA 4IL6E 5C39A 2BCCJ 3HD7C 1SQVE 2FXOA 3NXSA 2OTJP 4JF7A 3L75E 1K05A 1EDKA 1FAVA 2IBZD 3SWYA 3L73G 1L4AC 3L72J 4PV1B 4XE5B 2JP3A 4H13C 2P2UA 3TGUE 1SQXJ 1S3JA 4U3FD 4Y28J 1KN7A 3AE5C 1KQGB 1T3JA 2H7HA 3WUUA 1GDTA 1YI2P 4D6TE 2JWDA 3M0DC 4N6JA 5KLVD 1FU1A 1Z56A 1SQQD 2B9BA 2QA4P 4CPGA 1NWQA 1VQNP 3SFEC 1IFJA 5CHXA 3RL0D 1IZNB 5DJTB 2V4HA 3RK3C 1E79H 3ITKA 5AW1B 2JEEA 1JY3N 2Y9YA 2LXBA 3H1HJ 1QLED 1CW5A 3U59A 1RQVA 3KYQA 1X22A 2WSFJ 1D7MA 1GL2A 3B8EB 1NTMD 2JWAA 4HB1A 3R2PA 5KLVE 3OA7A 1ZR2A 1KYOD 3JC22 4BRYA 1GMJA 3RL0B 1SQPJ 5KAIE 4YXWH 4WVZA 4W7YA 5BU5A 1K04A 2OYOA 3PH0A 3HD7A 1GL2D 1PIXA 1EZVD 1JUNA 4EOTA 5H2FE 4OVNF 1KORA 3TDKA 3NMDA 4KHXA 3MZWB 3SWKA 1ZR4A 2N9BA 4U7JA 1HJBA 1OIPA 3AE1C 1NTME 1FZEA 2O1JA 1JY3P 3JSVC 1KYOE 1BDCA 2FXPA 5AW0B 4OH8B 3A7OA 1BE3E 1GL2B 2N1TD 1EDIA 3OW2O 1CZQA 3L35A 2KLUA 3TYYA 1RE3C 2HYNA 3M0DA 4BRYB 1YTZI 1EZVE 1SQXK 2ZT9C 2MJZA 2DW3A 3V2RA 5AVZB 4I1LA 3B5NC 4AQRD 1IK7A 2Q1KA 3L71D 3HD7B 3H32A 3G3ZA 2W83C 3RBXA 1BCCE 1QGKB 2H89C 1H8AA 4EDFA 3VTPC 5M1BA 4JPZB 2N1TB 2ZYGA 3GMAA 1BGYD 2NZ2A 2R5BA 5AVXB 4U3FG 3V4QA 2HR3A 2A06D 4H13B 1M90Q 2K88A 2FFDB 1PPJG 3RK3D 2KLVA 3CX5I 1LP1A 4L73A 3CCSP 3UIAA 2IZ1A 1SQQG 3VMYA 1MZ9A 3M9QA 3HE4B 2Q3EA 2BEZF 1DD4A 1N7SC 3Q5PA 3M91A 2E76D 1BGYE 1SQPK 3H1JG 3KXDA 1J2JB 1SQBG 3H32B 1AQTA 3N7NA 3T97A 3RK3B 4GIFA 3L70E 2XDJA 2QEXP 3AEGC 3Q5SA 3CWBD 2BASA 1X8YA 3CMEP 3CXHH 2QIWA 3VOPA 2CK3H 2E76B 3VMXA 4RO0A 3CL3D 1Q86Q 1RE3A 4OGQC 1Q90D 2E74D 1LP1B 1GD2E 2CPBA 3H6PA 3B5NA 1FZCC 5AW5B 2ITAA 1HGZA 3GF7A 1SS1A 4PD4I 1NU1J 2YIUB 1PGQA 3H1IJ 1YQ4C 1SQXD 1VF5C 3CWBE 4L76A 2ZT9D 3GF3A 3TNUA 2XNDH 3H1JJ 5CCGC 2L91A 3BCCG 1SQBJ 1NTKG 2E74B 2R5DA 2BCCE 2OTLP 3CMAP 1KD1Q 2Q5UA 3QWOC 4UB8H 3KZIH 1E5WA 1J1DC 1GK4A 1HGVA 3L72E 1FDMA 2WQYC 2ZT9B 1N7SA 1RE4C 1SQXE 2YO3A 1L0NG 3B5NB 5AW3B 3H1KG 1G1IA 2HG5D 3CCUP 2QJYB 3A0BH 1DH3A 5KKZB 4W7ZA 1KILE 1S4XA 5AVQB 1DEEG 1N7SD 3TNUB 5KTBA 1QL2A 3VMAA 3S9OA 4NPDA 1YTZT 1JNMA 3D6YA 5GTIE 4AUWA 3P32A 2K3RA 3V5BA 1NTKJ 3EQ2A 1IFPA 2YO2A 1HWTC 2M5AA 4NPFX 3H1HE 4PJ0H 3L74G 2AEJA 2WT7A 4AYCA 1FZCA 2L5GB 2OQQA 1X79B 1N7SB 1YJ9P 4EIJA 2WPQA 3R4YA 3RL0C 3I55P 4YPCA 1HVVA 3AE4C 3A0HE 4OGQD 1IFNA 1SQPE 1L0NJ 1DX7A 2E5YA 1T3UA 5CCGA 3H1KJ 1ZN5A 3MIWA 3RK2C 1Q82Q 1NU1K 1FZAA 1JOCA 4DJGA 4HJGH 3W68A 3KHUA 3W67A 5AVRB 2WSEH 4I7ZB 5AVVB 1GU4A 2ZJSE 2GUVA 1VQ7P 2JR8A 1SQBK 2FYUJ 2Q7CA 1NKZB 4KT0J 4OGQB 2M5AB 1NTZG 1RE4A 1IFDA 2W6BA 5GTHE 1FZCB 1PGPA 3TK1A 2E42A 3M9BA 3HRNA 3L74J 4JYCA 2R32A 3TGUD 1VQMP 3K5BA 5AW4B 3PLNA 2H88C 2FBWC 4D6TD 3H1LG 4LLHA 2YKQA 2E75D 3CXHI 4IL6H 5K5GB 1PP9J 2O01H 2E43A 2KSEA 4GODA 3CX5E 1OX3A 3CCEP 3JCUE 2QM7A 3CCJP 1WRGA 1S1CX 2N1TC 1J1DB 3USSA 3HTKA 2QVAA 1U7JA 2MKVA 2P58A 2P10A 2KSJA 1RY3A 1IFMA 2FFDC 2OTKE 1NTKK 1Q7YQ 1Q2NA 2HFED 1NTZJ 5B66H 3V6IA 3KPEA 1HH0A 1WT6A 1SP4A 1WMKA 1RHZB 1USEA 2JO1A 1NAFA 1N7LA 1QVFO 1H0TA 2PFXA 1EXIA 4WWIA 1L0NK 3WMM0 2B87B 3H1LJ 2J59M 4C7RA 3WU2E 5APYA 3IN6A 2FY8A 1KFMA 1NU1D 3HTKB 1ZLLA 1L0LG 3RK2D 1Q81Q 2A45I 3II6A 3L73J 4PD4E 4GT1A 3FWNA 1KZUB 1FOSE 2YMYA 4EYYQ 4ZNCA 3GLMA 2E76C 2FYUK 1ZRTE 1FS0E 1LTJC 1BE3D 5KAIH 1UIIA 1LTIC 2YIUC 3C9IA 3RK2B 1SQVG 1NU1E 3L4FA 3H1IE 1H0TB 3L75G 2N1TA 1OW6A 1M57D 5H2FH 1BCCD 2C9NY 2E74C 3H1JE 1OFCX 1SQBE 1YJNP 2FFDA 2W90A 1T2KC 1IK9A 1VQ9P 2WSCJ 1PGOA 1KYOH 4ZKPA 1FOSF 1L0LJ 2QE7H 4DCKA 1J1EC 4JQ0D 3AE2C 1RH5B 1URQD 3HE4A 1M7LA 1DIPA 4M3LA 3CC2P 3KDPB 3AEFC 2GUSA 2IBZG 1EQ7A 1KB9I 3GW6A 2QJYC 1NTZK 5KKZC 3AE8C 2O01J 3G71P 1A02F 2ZXEB 1MFZA 1LNQA 4IFFA 1K8AQ 3PP5A 5KLIC 2KIKA 2RN0A 2Y0EA 2IFMA 2V7QH 4ASVA 3M9HA 3L70D 4HKZH 3VYIA 5TISH 1NH4A 1OZHA 3AE9C 1P84I 2IDBA 5KLVG 1JCDA 1NTKE 4H44D 2K9JA 1LTJA 2OYHA 1LT1A 1OWAA 1KQFB 2FYUD 4WBAA 1LGHB 1M56D 3U1CA 3LIEA 3NFQA 5AVTB 4RJTA 5APSA 3FX0A 1L0NE 2KUBA 5KAFE 1KQLA 4WB4A 3H1KE 1NTMG 1TU3F 4UB6H 1LT9C 2PP6A 3SWFA 3AE6C 1W5CE 1PL5A 5APWA 4I7ZC 4R4LA 4U3FJ 3F89A 2BCCD 1VQOP 1PP9D 1H89A 2B89A 2R3SA 4XA4A 2K9JB 2C0XA 1EXJA 2FYUE 3CXHE 2QJKC 1LTJB 1KQSO 2OYHB 1NJIQ 2IBZI 1Y47A 1EZVG 2KB7P 1T2KD 3L72D 1KILA 1L0LK 3CI9A 2CPSA 1NO4A 1SQQJ 3D6ZA 1LTAC 3OAKA 1S5LE 2IZ0A 3N4XA 5AVWB 2WPSA 3L74E 1U7MA 1AV1A 1BCCG 2IYOA 2KS1A 2FXMA 1W2BO 1UIXA 2WSSH 3E7KA 1S9KE 1IO4A 3Q5RA 1JEKA 3PTZA 1KILD 5KJ7D 2JJLA 1PP9E 2RMZA 1GZLA 3D70A 1SQVK 5AW6B 5BVZA 1JTHA 3FWLA 4ZKUA 4UB8E 1J1EB 2YKOA 3KZIE 5DJUB 3L71G 5E79E 4DT0A 1BSNA 1GW4A 2E75C 1KILB 3H1HD 2KZIA 2M3BA 1BGYG 3S4RA 1OVRA 2D2CD 1NTZE 2BEQD 3H25A 3F5HA 1S2EA 4IL6X 2ZFCA 1FZFA 2KS1B 4R4MA 2A06G 1QVGO 1EDLA 3O8ZA 2B88A 3QH9A 1SQPD 1LT9A 5KLIB 1SFCC 1FDOA 2YMKA 1MUUA 3BCCJ 1N8RQ 1R5LA 3H1LE 3IAOA 1GU5A 5CJ4A 2ZVOB 2NPSC 2POHA 1JB0J 1ZOYC 2AXTH 4JBZA 3Q2YA 1JTHB 2D2CB 2C0WA 3P7KA 2M0BA 3L73E 2WZ7A 1S72P 3TF5A 2LKMA 2IPPA 1XTGB 1PV3A 2KP8A 1KB9D 2WSFH 3L71J 2KXPB 2PGDA 2ZAEB 2P1JA 3BVHA 3CWBG 3L37A 3IFMA 4YXDC 1MFTA 3CC4P 1SQQK 4Y99C 1KTMA 1LT9B 4QMAA 2YNYA 2FKWB 1DD3A 3FGAD 3P8CD 2I1JA 3V4WA 1P84D 2C9LY 3CX5D 3FXEA 4C7NA 2AEMA 3B71A 1KB9E 1JM0A 1QEXA 2QJKB 1JY2O 3CCMP 1M8OB 3V2PA 1M1KQ 1CI6A 3O6QB 3A3YB 1SQXG 5APQA 5GTHH 2AEFA 3BATA 1L0LE 1SLQA 5B5EE 2XU6A 3G6EP 1HUCA 3A5TA 2XV5A 1AA0A 1VQKP 3P8CE 1ZW0A 4TLFA 1FJPA 2IX7C 1P84E 2Y9ZA 1AJYA 4PV1D 1VDFA 1SFCA 2B87A 3B4SA 2GA1A 4ZMDA 2R3CA 1L2PA 3RBZA 5AW2B 3CX5H 1EC5A 3JCUH 2NPSA 3AEBC 3AEAC 1YITP 1X0TA 2HPCA 1URQC 4B86A 4Z1MH 3CPWO 3H1HG 3LW5H 4C7NB 1SFCD 1KFNA 3MUDC 2Q3IA 2O01N 5APVA 1LTGC 3M0AA 3BRTB 1U57A 2E75B 3MP7B 3P8MC 1CI6B 2LR2A 4PD4D 2NPSD 2I1KA 1OVVA 4IFDK 4TT3H 2SPZA 1IFIA 3MHVA 1JMMA 2LXCB 4HH2A 3AE7C 1YYCA 1SQPG 2K1AA 4LC1A 1ZRTD 5APUA 1YHQP 3Q3DA 3CLQA 2K37A 2NRGA 5B66E 1K9MQ 3E1IA 1PFIA 1PPJD 5CCHA 2PRRA 3BASA 1SFCB 2KYVA 3A2AA 4H44C 2IBZE 1ZP0C 3MTUE 3V2NA 2NPSB 3WU2H 3H1ID 1MKMA 3NTNA 1M1JC 2HPCB 2E5TA 2I8DA 3EFFK 2KNCA 5CCHD 4PD4H 3H1JD 4H0LC 4DOJA 4OWFA 1SQBD 4U3FE 5APTA 1K73Q 3OJAB 2ZXXA 4WY4C 1YJWP 2YXRB 2OYHC 5APXA 1Y8AA 4IFMA 3U1AA 1X9VA 1R5SA 3PHLA 1PPJE 3VN0A 4Y99B 2QJPC 1SQQE 3G9RA 2RH0A 3MD0A 1YQ3C 1VQPP 1OVUA 3HE5A 2WITA 1T6AA 3IF4A 1JY3O 3PRJA 1URQA 3AEDC 2WSEJ 2FYNC 1GW3A 2WVRA 1VL2A 4XFJA 4L74A 3MUDA 1L4AA 1VQLP 3TGUG 3E1RA 1LWUC 2Q6QA 3EWKA 1OMIA 2KNCB 1W2EA 3RL0g 2KK7A 1EDJA 1FZGA 3HD7D 4HYTB 4A7PA 4GOFA 4D6TG 2Z5HA 3BCCD 1RF1C 4I2LC 4LGDE 1XTCC 1NTKD 2YKPA 4GKGA 1PGJA 1KILC 1L4AD 5KJ7C 3CC7P 1S5LX 3CCRP 3WUTA 2HODA 3IR9A 3CCQP 1FC2C 1AFOA 4H13D 3AECC 1QX8A 2XNXA 3HE5B 3LIDA 1SQVJ 3ABVC 1KMIZ 1OW7A 1RQUA 3GHGC 1M1JA 3V2QA 3L75J 1URQB 1L0ND 1MV8A 4NPEA 4MN4C 2O1KA 3I5CA 1NHLA 4KJMA 3H1KD 2P7JA 2QRXA 1L4AB 2KI7B 3BCCE 3LW5J 3AEEC 4WY4A 3C1LA 2IFNA 5TISE 2D2CC 2OYIC 3TGUJ 2Y0DA 3HUSC 2W6AA 4K3AA 1N73C 1HF9A 1USDA 1GTWA 2W8ZA 1N86A 1LTSC 4H0LD 3CXHD 1OW8A 4D6TJ 4IOIH 4WY4D 1VQ4P 4DZOA 4RKUJ 1NU1G 3L71E 2HODB 3H1IG 1OXZA 4W80A 1NOHA 2Y0CA 2HLOA 1KV4A 3L74D 3D71A 1FE6A 1PZQA 4H44B 4RESB 1RF0C 2H43A 2O3JA 3WUVA 5KAFH 1M1JB 1S9KD 4JYBA 1LWUA 1ZXGA 2P67A 2A06E 1BE3G 4UB6E 4ASWA 1FBMA 4H0LB 4WY4B 3RK3E 5CJ0A 3SFDC 3TSIA 2XKMA 1RF1A 2G3AA 1KC8Q 2WMMA 3SSUA 5KLVJ 1JCCA 5KJ7A 1ZMEC 3S1KA 5CBOA 1NKNA 2QG4A 4EI2A 4N78D 1VPCA 1VQ8P 1AVOA 2QJPB 5CBNA 1YIJP 2UWJE 1S5LH 1R8EA 3KQGA 3GG2A 1BSHA 1VQ6P
chains in the Genus database with same CATH topology
4AQRD 1HTLC 1SQQK 3GHGA 4Y99C 1NAFA 1N7LA 3HD7B 3H32A 3G3ZA 1A02J 1IJDB 1IC2A 3M06A 1LT9B 1DEBA 1H8AA 2YNYA 2FKWB 5AW9B 1L0NK 3WMM0 4I6MC 1QL1A 2J59M 3P8CD 3VTPC 4C7RA 2I1JA 5CMZA 5AW8B 5APYA 2N1TB 1LWUB 3V4WA 1KFMA 2C9LY 3B5ND 2R5BA 5AVXB 3HTKB 3V4QA 2OYIA 1ZLLA 3RK2D 2H8PD 1LTBC 2A45I 3II6A 4C7NA 3HUSA 3VMZA 1JO5A 4GT1A 1N73A 1KZUB 4N78E 3EFGA 1FOSE 1JY2O 1RF1B 2FFDB 2YMYA 3V2PA 1CI6A 3RK3D 3A3YB 2KLVA 5APQA 3BATA 1SLQA 3L36A 2FYUK 2QM8A 1HBWA 2XU6A 2GM4A 3UIAA 1HUCA 1LTJC 3VMYA 3A5TA 1MZ9A 3M9QA 3HE4B 1LTTC 2XV5A 1N7SC 2A45H 3P8CE 1LTIC 3M91A 1RF0A 3C9IA 3RK2B 1FJPA 2IX7C 2OARA 3GHGB 1SQPK 1VDFA 1SFCA 1J2JB 3H32B 3L4FA 2R3CA 1ZV8A 2N1TA 3N7NA 5AW2B 1AQ5A 3T97A 3RK3B 2NPSA 4GIFA 3VP8A 2XDJA 2C9NY 1FZBA 2HPCA 1URQC 4B86A 2BASA 1X8YA 1G2CA 2OYIB 1SVFA 2FFDA 3LW5H 4C7NB 1T2KC 3HUSB 1IK9A 1KFNA 1SFCD 2WPRA 5AW7B 2Q3IA 1N73B 5AVUB 4ZKPA 5APVA 1LTGC 3M0AA 3BRTB 1FOSF 3VOPA 3P8MC 1CI6B 3VMXA 2NPSD 3CL3D 2I1KA 1RE3A 1J1EC 2W27A 4IFDK 1GD2E 2WWWA 1URQD 3HE4A 2CPBA 1IFIA 3VP9A 1JMMA 1FJKA 3H6PA 4HH2A 2Z4EA 1G1JA 1M7LA 1JY2N 1YYCA 2KOGA 5KLVK 3B5NA 1FZCC 4M3LA 5AVYB 5AW5B 1HGZA 3KDPB 4LC1A 5APUA 2GUSA 3CLQA 5AVSB 1EQ7A 1NTZK 3E1IA 1H88A 1PFIA 5CCHA 3BASA 5CCHC 1SFCB 1T8ZA 1A02F 2KYVA 3A2AA 2ZXEB 3TNUA 1MFZA 5CCGC 3MTUE 3V2NA 2NPSB 4IFFA 2WTYA 3PP5A 2PAJA 3NTNA 2R5DA 5BU8B 1M1JC 2IFMA 3BRVB 2HPCB 3M9HA 2Q5UA 1G2CB 3VYIA 1NH4A 5CCHD 1E5WA 1J1DC 1GK4A 1NTMK 4DOJA 1HGVA 2J58A 5APTA 1JCDA 3OJAB 1CSBA 4WY4C 5CCGD 1LTJA 2OYHA 2WSCH 4N3YB 1OWAA 2OYHC 4C46A 1FDMA 5APXA 4IFMA 3U1AA 1X9VA 1GK6A 2WT7B 1N7SA 1RE4C 2A45G 1GL2C 2YO3A 3VN0A 3MGNA 3B5NB 4WBAA 1LGHB 5AW3B 1JY2P 2M8RA 2Q9IA 2Z5IA 4Y99B 1N2DC 1G1IA 2HG5D 3U1CA 3LIEA 1DH3A 3NFQA 4O9BA 5AVTB 3MD0A 4W7ZA 2XZRA 2WITA 2FYZA 3HE5A 5APSA 2VRSA 5AVQB 1JY3O 1KQLA 1N7SD 3TNUB 4WB4A 3HD7C 5KTBA 1URQA 1QL2A 1GW3A 3NXSA 1LT9C 1YTZT 1JNMA 4JF7A 2PP6A 3SWFA 4AUWA 1FAVA 3MUDA 3P32A 3SWYA 1L4AA 5APWA 3V5BA 1L4AC 1LWUC 3EQ2A 1W2EA 3L37A 2YO2A 1H89A 1HWTC 4XA4A 1FZGA 3HD7D 4XE5B 2C0XA 4HYTB 2P2UA 1LTJB 2WT7A 2Z5HA 2OYHB 4AYCA 1RF1C 4I2LC 1FZCA 4LGDE 1XTCC 2KB7P 2YKPA 4GKGA 1T2KD 1KILA 2L5GB 1L0LK 3CI9A 1KILC 1X79B 1L4AD 1N7SB 2CPSA 5KJ7C 1NO4A 1T3JA 2H7HA 1LTAC 4EIJA 2WPQA 3OAKA 3N4XA 3RL0C 1GDTA 5AVWB 1HVVA 2WPSA 2HODA 3IR9A 3M0DC 1IFNA 4N6JA 1AFOA 1DX7A 2FXMA 2XNXA 1FU1A 3HE5B 1T3UA 3LIDA 5CCGA 1S9KE 1Z56A 1IO4A 1ZN5A 1NWQA 3MIWA 3RK2C 1KILD 1NU1K 1FZAA 5KJ7D 1JOCA 3GHGC 1IFJA 1M1JA 3V2QA 2JJLA 5CHXA 1URQB 3RL0D 1MV8A 2O1KA 3I5CA 1NHLA 1GZLA 3RK3C 5AVRB 2WSEH 2P7JA 5AVVB 5AW1B 1GU4A 1SQVK 5AW6B 1L4AB 2JEEA 2GUVA 1JY3N 4WY4A 1SQBK 5BVZA 1JTHA 2IFNA 4ZKUA 2Q7CA 1CW5A 1NKZB 3U59A 2OYIC 3KYQA 1J1EB 2YKOA 3HUSC 2W6AA 1RE4A 1N73C 1GL2A 1IFDA 2W6BA 3B8EB 3R2PA 1GW4A 1GTWA 1FZCB 1N86A 3OA7A 1LTSC 3TK1A 2E42A 1KILB 3M9BA 1ZR2A 3HRNA 4JYCA 2R32A 4WY4D 3RL0B 4DZOA 2M3BA 2HODB 4W7YA 1OXZA 4W80A 5BU5A 5AW4B 1NOHA 2HLOA 2ZFCA 1FZFA 3HD7A 4LLHA 1GL2D 2YKQA 3O8ZA 4RESB 1LT9A 2O01H 1RF0C 2H43A 2E43A 1M1JB 1SFCC 2QM7A 4EOTA 1S9KD 1JUNA 1WRGA 1MUUA 4JYBA 1LWUA 3NMDA 4KHXA 2N1TC 1ZR4A 2P67A 2N9BA 1GU5A 1HJBA 1J1DB 5CJ4A 1FBMA 2NPSC 2POHA 3HTKA 1FZEA 4WY4B 2KSJA 1JTHB 5CJ0A 2O1JA 1RY3A 3TSIA 2C0WA 1JY3P 2XKMA 1RF1A 1IFMA 3P7KA 5AW0B 2FFDC 2WZ7A 4OH8B 3A7OA 2LKMA 1JCCA 1NTKK 5KJ7A 3BVHA 2IPPA 1GL2B 1XTGB 2N1TD 1NKNA 2KP8A 2HFED 2WSFH 4N78D 1CZQA 1VPCA 3L35A 3TYYA 1RE3C 2HYNA 3M0DA 1YTZI 1SQXK 2MJZA 3KPEA 2P1JA 1HH0A 3KQGA 3V2RA 1WT6A 1SP4A 5AVZB 3IFMA 4I1LA 3B5NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFC D;  4W7Z A;  3KYQ A;  3VOP A;  3HD7 B;  2NPS D;  1GL2 A;  1N7S D;  3HD7 C;  1URQ A;  1URQ D;  1KIL B;  2N1T B;  4JF7 A;  2KOG A;  2PP6 A;  3B5N A;  3B5N D;  4WY4 D;  3RL0 B;  1L4A A;  3HTK B;  3RK2 D;  2H8P D;  1L4A C;  4W7Y A;  4W80 A;  4N78 E;  5CCH A;  2YMY A;  3HD7 A;  1GL2 D;  3HD7 D;  5CCH C;  1SFC B;  3RK3 D;  4LGD E;  5CCG C;  1SFC C;  2NPS B;  1KIL A;  1KIL C;  3PP5 A;  1L4A D;  1N7S B;  5KJ7 C;  2N1T C;  1T3J A;  2NPS C;  3RL0 C;  1HVV A;  1N7S C;  5CCH D;  4WY4 B;  3M0D C;  3P8C E;  1JTH B;  3TSI A;  3RK2 B;  2WZ7 A;  4WY4 C;  1SFC A;  4OH8 B;  5CCG A;  5CCG D;  3RK2 C;  5KJ7 A;  1KIL D;  5KJ7 D;  2N1T A;  1GL2 B;  1XTG B;  2N1T D;  1JTH A;  3RK3 B;  2NPS A;  1URQ B;  3RL0 D;  2HFE D;  2XDJ A;  1N7S A;  1GL2 C;  1NHL A;  3B5N B;  3RK3 C;  1URQ C;  1L4A B;  2M8R A;  4WY4 A;  2HG5 D;  3B5N C; 
#chains in the Genus database with same CATH topology
 1HTL C;  3GHG A;  2ZVN B;  1NVO A;  1NTZ D;  3CD6 P;  2W6J H;  1A02 J;  2FYN B;  1IJD B;  1IC2 A;  3M06 A;  1VQ5 P;  1DEB A;  3I56 P;  5AW9 B;  4I6M C;  1QL1 A;  5CMZ A;  5AW8 B;  3FXD A;  1LWU B;  1NTM J;  1LJ2 A;  2G8Y A;  3T97 B;  3B5N D;  4L75 A;  2OYI A;  2H8P D;  1LTB C;  2ZYA A;  3CCL P;  3HUS A;  1YBK A;  3H1L D;  3VMZ A;  1JO5 A;  1BE3 J;  1N73 A;  2R44 A;  4N78 E;  3EFG A;  1RF1 B;  1FDI A;  5E79 H;  4PV1 C;  3L36 A;  2QM8 A;  1HBW A;  3L73 D;  2GM4 A;  2ZYD A;  1LTT C;  4K35 A;  3A0B E;  2A45 H;  1BCC J;  3L70 G;  1KYO I;  1RF0 A;  2OAR A;  3GHG B;  1Y9B A;  5TJH A;  1ZV8 A;  3AE3 C;  4GDO A;  1AQ5 A;  5GTI H;  2V7Q J;  3VP8 A;  1FZB A;  2IYP A;  1EZV I;  5EFW B;  1G2C A;  2OYI B;  1SVF A;  1AVY A;  2FYU G;  3HUS B;  2WPV B;  3O6Q A;  2WPR A;  5AW7 B;  1N73 B;  5AVU B;  2AXT E;  1JMB A;  3ZDM A;  4PJ0 E;  2W27 A;  3CCV P;  2WWW A;  3VP9 A;  2N9Y B;  1FJK A;  2Z4E A;  1NGM B;  1G1J A;  1JY2 N;  2KOG A;  5KLV K;  1BDD A;  1L0L D;  3A0H H;  5AVY B;  3RGU A;  2AXC A;  5AVS B;  1BGY J;  1H88 A;  2BCC G;  4GOE A;  5CCH C;  1PP9 G;  3C8V A;  1T8Z A;  3L70 J;  2RKL A;  2WTY A;  2M3E A;  2PAJ A;  4YTP C;  1HJ0 A;  3L72 G;  5BU8 B;  3BRV B;  2K9Y A;  1NAY A;  1G2C B;  4BWN A;  3G4S P;  1SQV D;  1VF5 D;  4BXL A;  1NTM K;  1KB9 H;  2J58 A;  2QSI A;  3Q1M A;  1CSB A;  3L75 D;  5CCG D;  2WSC H;  2J5U A;  5L8R J;  4N3Y B;  4C46 A;  2JKV A;  5B5E H;  1GK6 A;  2WT7 B;  2A45 G;  1GL2 C;  3MGN A;  3PJS K;  2OGU A;  1JY2 P;  2JDI H;  2M8R A;  2Q9I A;  2KZJ A;  2Z5I A;  1N2D C;  1NYH A;  4O9B A;  3CWB J;  2YXQ B;  1P84 H;  2XZR A;  2FYZ A;  1VF5 B;  2VRS A;  4IL6 E;  5C39 A;  2BCC J;  3HD7 C;  1SQV E;  2FXO A;  3NXS A;  2OTJ P;  4JF7 A;  3L75 E;  1K05 A;  1EDK A;  1FAV A;  2IBZ D;  3SWY A;  3L73 G;  1L4A C;  3L72 J;  4PV1 B;  4XE5 B;  2JP3 A;  4H13 C;  2P2U A;  3TGU E;  1SQX J;  1S3J A;  4U3F D;  4Y28 J;  1KN7 A;  3AE5 C;  1KQG B;  1T3J A;  2H7H A;  3WUU A;  1GDT A;  1YI2 P;  4D6T E;  2JWD A;  3M0D C;  4N6J A;  5KLV D;  1FU1 A;  1Z56 A;  1SQQ D;  2B9B A;  2QA4 P;  4CPG A;  1NWQ A;  1VQN P;  3SFE C;  1IFJ A;  5CHX A;  3RL0 D;  1IZN B;  5DJT B;  2V4H A;  3RK3 C;  1E79 H;  3ITK A;  5AW1 B;  2JEE A;  1JY3 N;  2Y9Y A;  2LXB A;  3H1H J;  1QLE D;  1CW5 A;  3U59 A;  1RQV A;  3KYQ A;  1X22 A;  2WSF J;  1D7M A;  1GL2 A;  3B8E B;  1NTM D;  2JWA A;  4HB1 A;  3R2P A;  5KLV E;  3OA7 A;  1ZR2 A;  1KYO D;  3JC2 2;  4BRY A;  1GMJ A;  3RL0 B;  1SQP J;  5KAI E;  4YXW H;  4WVZ A;  4W7Y A;  5BU5 A;  1K04 A;  2OYO A;  3PH0 A;  3HD7 A;  1GL2 D;  1PIX A;  1EZV D;  1JUN A;  4EOT A;  5H2F E;  4OVN F;  1KOR A;  3TDK A;  3NMD A;  4KHX A;  3MZW B;  3SWK A;  1ZR4 A;  2N9B A;  4U7J A;  1HJB A;  1OIP A;  3AE1 C;  1NTM E;  1FZE A;  2O1J A;  1JY3 P;  3JSV C;  1KYO E;  1BDC A;  2FXP A;  5AW0 B;  4OH8 B;  3A7O A;  1BE3 E;  1GL2 B;  2N1T D;  1EDI A;  3OW2 O;  1CZQ A;  3L35 A;  2KLU A;  3TYY A;  1RE3 C;  2HYN A;  3M0D A;  4BRY B;  1YTZ I;  1EZV E;  1SQX K;  2ZT9 C;  2MJZ A;  2DW3 A;  3V2R A;  5AVZ B;  4I1L A;  3B5N C;  4AQR D;  1IK7 A;  2Q1K A;  3L71 D;  3HD7 B;  3H32 A;  3G3Z A;  2W83 C;  3RBX A;  1BCC E;  1QGK B;  2H89 C;  1H8A A;  4EDF A;  3VTP C;  5M1B A;  4JPZ B;  2N1T B;  2ZYG A;  3GMA A;  1BGY D;  2NZ2 A;  2R5B A;  5AVX B;  4U3F G;  3V4Q A;  2HR3 A;  2A06 D;  4H13 B;  1M90 Q;  2K88 A;  2FFD B;  1PPJ G;  3RK3 D;  2KLV A;  3CX5 I;  1LP1 A;  4L73 A;  3CCS P;  3UIA A;  2IZ1 A;  1SQQ G;  3VMY A;  1MZ9 A;  3M9Q A;  3HE4 B;  2Q3E A;  2BEZ F;  1DD4 A;  1N7S C;  3Q5P A;  3M91 A;  2E76 D;  1BGY E;  1SQP K;  3H1J G;  3KXD A;  1J2J B;  1SQB G;  3H32 B;  1AQT A;  3N7N A;  3T97 A;  3RK3 B;  4GIF A;  3L70 E;  2XDJ A;  2QEX P;  3AEG C;  3Q5S A;  3CWB D;  2BAS A;  1X8Y A;  3CME P;  3CXH H;  2QIW A;  3VOP A;  2CK3 H;  2E76 B;  3VMX A;  4RO0 A;  3CL3 D;  1Q86 Q;  1RE3 A;  4OGQ C;  1Q90 D;  2E74 D;  1LP1 B;  1GD2 E;  2CPB A;  3H6P A;  3B5N A;  1FZC C;  5AW5 B;  2ITA A;  1HGZ A;  3GF7 A;  1SS1 A;  4PD4 I;  1NU1 J;  2YIU B;  1PGQ A;  3H1I J;  1YQ4 C;  1SQX D;  1VF5 C;  3CWB E;  4L76 A;  2ZT9 D;  3GF3 A;  3TNU A;  2XND H;  3H1J J;  5CCG C;  2L91 A;  3BCC G;  1SQB J;  1NTK G;  2E74 B;  2R5D A;  2BCC E;  2OTL P;  3CMA P;  1KD1 Q;  2Q5U A;  3QWO C;  4UB8 H;  3KZI H;  1E5W A;  1J1D C;  1GK4 A;  1HGV A;  3L72 E;  1FDM A;  2WQY C;  2ZT9 B;  1N7S A;  1RE4 C;  1SQX E;  2YO3 A;  1L0N G;  3B5N B;  5AW3 B;  3H1K G;  1G1I A;  2HG5 D;  3CCU P;  2QJY B;  3A0B H;  1DH3 A;  5KKZ B;  4W7Z A;  1KIL E;  1S4X A;  5AVQ B;  1DEE G;  1N7S D;  3TNU B;  5KTB A;  1QL2 A;  3VMA A;  3S9O A;  4NPD A;  1YTZ T;  1JNM A;  3D6Y A;  5GTI E;  4AUW A;  3P32 A;  2K3R A;  3V5B A;  1NTK J;  3EQ2 A;  1IFP A;  2YO2 A;  1HWT C;  2M5A A;  4NPF X;  3H1H E;  4PJ0 H;  3L74 G;  2AEJ A;  2WT7 A;  4AYC A;  1FZC A;  2L5G B;  2OQQ A;  1X79 B;  1N7S B;  1YJ9 P;  4EIJ A;  2WPQ A;  3R4Y A;  3RL0 C;  3I55 P;  4YPC A;  1HVV A;  3AE4 C;  3A0H E;  4OGQ D;  1IFN A;  1SQP E;  1L0N J;  1DX7 A;  2E5Y A;  1T3U A;  5CCG A;  3H1K J;  1ZN5 A;  3MIW A;  3RK2 C;  1Q82 Q;  1NU1 K;  1FZA A;  1JOC A;  4DJG A;  4HJG H;  3W68 A;  3KHU A;  3W67 A;  5AVR B;  2WSE H;  4I7Z B;  5AVV B;  1GU4 A;  2ZJS E;  2GUV A;  1VQ7 P;  2JR8 A;  1SQB K;  2FYU J;  2Q7C A;  1NKZ B;  4KT0 J;  4OGQ B;  2M5A B;  1NTZ G;  1RE4 A;  1IFD A;  2W6B A;  5GTH E;  1FZC B;  1PGP A;  3TK1 A;  2E42 A;  3M9B A;  3HRN A;  3L74 J;  4JYC A;  2R32 A;  3TGU D;  1VQM P;  3K5B A;  5AW4 B;  3PLN A;  2H88 C;  2FBW C;  4D6T D;  3H1L G;  4LLH A;  2YKQ A;  2E75 D;  3CXH I;  4IL6 H;  5K5G B;  1PP9 J;  2O01 H;  2E43 A;  2KSE A;  4GOD A;  3CX5 E;  1OX3 A;  3CCE P;  3JCU E;  2QM7 A;  3CCJ P;  1WRG A;  1S1C X;  2N1T C;  1J1D B;  3USS A;  3HTK A;  2QVA A;  1U7J A;  2MKV A;  2P58 A;  2P10 A;  2KSJ A;  1RY3 A;  1IFM A;  2FFD C;  2OTK E;  1NTK K;  1Q7Y Q;  1Q2N A;  2HFE D;  1NTZ J;  5B66 H;  3V6I A;  3KPE A;  1HH0 A;  1WT6 A;  1SP4 A;  1WMK A;  1RHZ B;  1USE A;  2JO1 A;  1NAF A;  1N7L A;  1QVF O;  1H0T A;  2PFX A;  1EXI A;  4WWI A;  1L0N K;  3WMM 0;  2B87 B;  3H1L J;  2J59 M;  4C7R A;  3WU2 E;  5APY A;  3IN6 A;  2FY8 A;  1KFM A;  1NU1 D;  3HTK B;  1ZLL A;  1L0L G;  3RK2 D;  1Q81 Q;  2A45 I;  3II6 A;  3L73 J;  4PD4 E;  4GT1 A;  3FWN A;  1KZU B;  1FOS E;  2YMY A;  4EYY Q;  4ZNC A;  3GLM A;  2E76 C;  2FYU K;  1ZRT E;  1FS0 E;  1LTJ C;  1BE3 D;  5KAI H;  1UII A;  1LTI C;  2YIU C;  3C9I A;  3RK2 B;  1SQV G;  1NU1 E;  3L4F A;  3H1I E;  1H0T B;  3L75 G;  2N1T A;  1OW6 A;  1M57 D;  5H2F H;  1BCC D;  2C9N Y;  2E74 C;  3H1J E;  1OFC X;  1SQB E;  1YJN P;  2FFD A;  2W90 A;  1T2K C;  1IK9 A;  1VQ9 P;  2WSC J;  1PGO A;  1KYO H;  4ZKP A;  1FOS F;  1L0L J;  2QE7 H;  4DCK A;  1J1E C;  4JQ0 D;  3AE2 C;  1RH5 B;  1URQ D;  3HE4 A;  1M7L A;  1DIP A;  4M3L A;  3CC2 P;  3KDP B;  3AEF C;  2GUS A;  2IBZ G;  1EQ7 A;  1KB9 I;  3GW6 A;  2QJY C;  1NTZ K;  5KKZ C;  3AE8 C;  2O01 J;  3G71 P;  1A02 F;  2ZXE B;  1MFZ A;  1LNQ A;  4IFF A;  1K8A Q;  3PP5 A;  5KLI C;  2KIK A;  2RN0 A;  2Y0E A;  2IFM A;  2V7Q H;  4ASV A;  3M9H A;  3L70 D;  4HKZ H;  3VYI A;  5TIS H;  1NH4 A;  1OZH A;  3AE9 C;  1P84 I;  2IDB A;  5KLV G;  1JCD A;  1NTK E;  4H44 D;  2K9J A;  1LTJ A;  2OYH A;  1LT1 A;  1OWA A;  1KQF B;  2FYU D;  4WBA A;  1LGH B;  1M56 D;  3U1C A;  3LIE A;  3NFQ A;  5AVT B;  4RJT A;  5APS A;  3FX0 A;  1L0N E;  2KUB A;  5KAF E;  1KQL A;  4WB4 A;  3H1K E;  1NTM G;  1TU3 F;  4UB6 H;  1LT9 C;  2PP6 A;  3SWF A;  3AE6 C;  1W5C E;  1PL5 A;  5APW A;  4I7Z C;  4R4L A;  4U3F J;  3F89 A;  2BCC D;  1VQO P;  1PP9 D;  1H89 A;  2B89 A;  2R3S A;  4XA4 A;  2K9J B;  2C0X A;  1EXJ A;  2FYU E;  3CXH E;  2QJK C;  1LTJ B;  1KQS O;  2OYH B;  1NJI Q;  2IBZ I;  1Y47 A;  1EZV G;  2KB7 P;  1T2K D;  3L72 D;  1KIL A;  1L0L K;  3CI9 A;  2CPS A;  1NO4 A;  1SQQ J;  3D6Z A;  1LTA C;  3OAK A;  1S5L E;  2IZ0 A;  3N4X A;  5AVW B;  2WPS A;  3L74 E;  1U7M A;  1AV1 A;  1BCC G;  2IYO A;  2KS1 A;  2FXM A;  1W2B O;  1UIX A;  2WSS H;  3E7K A;  1S9K E;  1IO4 A;  3Q5R A;  1JEK A;  3PTZ A;  1KIL D;  5KJ7 D;  2JJL A;  1PP9 E;  2RMZ A;  1GZL A;  3D70 A;  1SQV K;  5AW6 B;  5BVZ A;  1JTH A;  3FWL A;  4ZKU A;  4UB8 E;  1J1E B;  2YKO A;  3KZI E;  5DJU B;  3L71 G;  5E79 E;  4DT0 A;  1BSN A;  1GW4 A;  2E75 C;  1KIL B;  3H1H D;  2KZI A;  2M3B A;  1BGY G;  3S4R A;  1OVR A;  2D2C D;  1NTZ E;  2BEQ D;  3H25 A;  3F5H A;  1S2E A;  4IL6 X;  2ZFC A;  1FZF A;  2KS1 B;  4R4M A;  2A06 G;  1QVG O;  1EDL A;  3O8Z A;  2B88 A;  3QH9 A;  1SQP D;  1LT9 A;  5KLI B;  1SFC C;  1FDO A;  2YMK A;  1MUU A;  3BCC J;  1N8R Q;  1R5L A;  3H1L E;  3IAO A;  1GU5 A;  5CJ4 A;  2ZVO B;  2NPS C;  2POH A;  1JB0 J;  1ZOY C;  2AXT H;  4JBZ A;  3Q2Y A;  1JTH B;  2D2C B;  2C0W A;  3P7K A;  2M0B A;  3L73 E;  2WZ7 A;  1S72 P;  3TF5 A;  2LKM A;  2IPP A;  1XTG B;  1PV3 A;  2KP8 A;  1KB9 D;  2WSF H;  3L71 J;  2KXP B;  2PGD A;  2ZAE B;  2P1J A;  3BVH A;  3CWB G;  3L37 A;  3IFM A;  4YXD C;  1MFT A;  3CC4 P;  1SQQ K;  4Y99 C;  1KTM A;  1LT9 B;  4QMA A;  2YNY A;  2FKW B;  1DD3 A;  3FGA D;  3P8C D;  2I1J A;  3V4W A;  1P84 D;  2C9L Y;  3CX5 D;  3FXE A;  4C7N A;  2AEM A;  3B71 A;  1KB9 E;  1JM0 A;  1QEX A;  2QJK B;  1JY2 O;  3CCM P;  1M8O B;  3V2P A;  1M1K Q;  1CI6 A;  3O6Q B;  3A3Y B;  1SQX G;  5APQ A;  5GTH H;  2AEF A;  3BAT A;  1L0L E;  1SLQ A;  5B5E E;  2XU6 A;  3G6E P;  1HUC A;  3A5T A;  2XV5 A;  1AA0 A;  1VQK P;  3P8C E;  1ZW0 A;  4TLF A;  1FJP A;  2IX7 C;  1P84 E;  2Y9Z A;  1AJY A;  4PV1 D;  1VDF A;  1SFC A;  2B87 A;  3B4S A;  2GA1 A;  4ZMD A;  2R3C A;  1L2P A;  3RBZ A;  5AW2 B;  3CX5 H;  1EC5 A;  3JCU H;  2NPS A;  3AEB C;  3AEA C;  1YIT P;  1X0T A;  2HPC A;  1URQ C;  4B86 A;  4Z1M H;  3CPW O;  3H1H G;  3LW5 H;  4C7N B;  1SFC D;  1KFN A;  3MUD C;  2Q3I A;  2O01 N;  5APV A;  1LTG C;  3M0A A;  3BRT B;  1U57 A;  2E75 B;  3MP7 B;  3P8M C;  1CI6 B;  2LR2 A;  4PD4 D;  2NPS D;  2I1K A;  1OVV A;  4IFD K;  4TT3 H;  2SPZ A;  1IFI A;  3MHV A;  1JMM A;  2LXC B;  4HH2 A;  3AE7 C;  1YYC A;  1SQP G;  2K1A A;  4LC1 A;  1ZRT D;  5APU A;  1YHQ P;  3Q3D A;  3CLQ A;  2K37 A;  2NRG A;  5B66 E;  1K9M Q;  3E1I A;  1PFI A;  1PPJ D;  5CCH A;  2PRR A;  3BAS A;  1SFC B;  2KYV A;  3A2A A;  4H44 C;  2IBZ E;  1ZP0 C;  3MTU E;  3V2N A;  2NPS B;  3WU2 H;  3H1I D;  1MKM A;  3NTN A;  1M1J C;  2HPC B;  2E5T A;  2I8D A;  3EFF K;  2KNC A;  5CCH D;  4PD4 H;  3H1J D;  4H0L C;  4DOJ A;  4OWF A;  1SQB D;  4U3F E;  5APT A;  1K73 Q;  3OJA B;  2ZXX A;  4WY4 C;  1YJW P;  2YXR B;  2OYH C;  5APX A;  1Y8A A;  4IFM A;  3U1A A;  1X9V A;  1R5S A;  3PHL A;  1PPJ E;  3VN0 A;  4Y99 B;  2QJP C;  1SQQ E;  3G9R A;  2RH0 A;  3MD0 A;  1YQ3 C;  1VQP P;  1OVU A;  3HE5 A;  2WIT A;  1T6A A;  3IF4 A;  1JY3 O;  3PRJ A;  1URQ A;  3AED C;  2WSE J;  2FYN C;  1GW3 A;  2WVR A;  1VL2 A;  4XFJ A;  4L74 A;  3MUD A;  1L4A A;  1VQL P;  3TGU G;  3E1R A;  1LWU C;  2Q6Q A;  3EWK A;  1OMI A;  2KNC B;  1W2E A;  3RL0 g;  2KK7 A;  1EDJ A;  1FZG A;  3HD7 D;  4HYT B;  4A7P A;  4GOF A;  4D6T G;  2Z5H A;  3BCC D;  1RF1 C;  4I2L C;  4LGD E;  1XTC C;  1NTK D;  2YKP A;  4GKG A;  1PGJ A;  1KIL C;  1L4A D;  5KJ7 C;  3CC7 P;  1S5L X;  3CCR P;  3WUT A;  2HOD A;  3IR9 A;  3CCQ P;  1FC2 C;  1AFO A;  4H13 D;  3AEC C;  1QX8 A;  2XNX A;  3HE5 B;  3LID A;  1SQV J;  3ABV C;  1KMI Z;  1OW7 A;  1RQU A;  3GHG C;  1M1J A;  3V2Q A;  3L75 J;  1URQ B;  1L0N D;  1MV8 A;  4NPE A;  4MN4 C;  2O1K A;  3I5C A;  1NHL A;  4KJM A;  3H1K D;  2P7J A;  2QRX A;  1L4A B;  2KI7 B;  3BCC E;  3LW5 J;  3AEE C;  4WY4 A;  3C1L A;  2IFN A;  5TIS E;  2D2C C;  2OYI C;  3TGU J;  2Y0D A;  3HUS C;  2W6A A;  4K3A A;  1N73 C;  1HF9 A;  1USD A;  1GTW A;  2W8Z A;  1N86 A;  1LTS C;  4H0L D;  3CXH D;  1OW8 A;  4D6T J;  4IOI H;  4WY4 D;  1VQ4 P;  4DZO A;  4RKU J;  1NU1 G;  3L71 E;  2HOD B;  3H1I G;  1OXZ A;  4W80 A;  1NOH A;  2Y0C A;  2HLO A;  1KV4 A;  3L74 D;  3D71 A;  1FE6 A;  1PZQ A;  4H44 B;  4RES B;  1RF0 C;  2H43 A;  2O3J A;  3WUV A;  5KAF H;  1M1J B;  1S9K D;  4JYB A;  1LWU A;  1ZXG A;  2P67 A;  2A06 E;  1BE3 G;  4UB6 E;  4ASW A;  1FBM A;  4H0L B;  4WY4 B;  3RK3 E;  5CJ0 A;  3SFD C;  3TSI A;  2XKM A;  1RF1 A;  2G3A A;  1KC8 Q;  2WMM A;  3SSU A;  5KLV J;  1JCC A;  5KJ7 A;  1ZME C;  3S1K A;  5CBO A;  1NKN A;  2QG4 A;  4EI2 A;  4N78 D;  1VPC A;  1VQ8 P;  1AVO A;  2QJP B;  5CBN A;  1YIJ P;  2UWJ E;  1S5L H;  1R8E A;  3KQG A;  3GG2 A;  1BSH A;  1VQ6 P; 
#chains in the Genus database with same CATH homology
 4AQR D;  1HTL C;  1SQQ K;  3GHG A;  4Y99 C;  1NAF A;  1N7L A;  3HD7 B;  3H32 A;  3G3Z A;  1A02 J;  1IJD B;  1IC2 A;  3M06 A;  1LT9 B;  1DEB A;  1H8A A;  2YNY A;  2FKW B;  5AW9 B;  1L0N K;  3WMM 0;  4I6M C;  1QL1 A;  2J59 M;  3P8C D;  3VTP C;  4C7R A;  2I1J A;  5CMZ A;  5AW8 B;  5APY A;  2N1T B;  1LWU B;  3V4W A;  1KFM A;  2C9L Y;  3B5N D;  2R5B A;  5AVX B;  3HTK B;  3V4Q A;  2OYI A;  1ZLL A;  3RK2 D;  2H8P D;  1LTB C;  2A45 I;  3II6 A;  4C7N A;  3HUS A;  3VMZ A;  1JO5 A;  4GT1 A;  1N73 A;  1KZU B;  4N78 E;  3EFG A;  1FOS E;  1JY2 O;  1RF1 B;  2FFD B;  2YMY A;  3V2P A;  1CI6 A;  3RK3 D;  3A3Y B;  2KLV A;  5APQ A;  3BAT A;  1SLQ A;  3L36 A;  2FYU K;  2QM8 A;  1HBW A;  2XU6 A;  2GM4 A;  3UIA A;  1HUC A;  1LTJ C;  3VMY A;  3A5T A;  1MZ9 A;  3M9Q A;  3HE4 B;  1LTT C;  2XV5 A;  1N7S C;  2A45 H;  3P8C E;  1LTI C;  3M91 A;  1RF0 A;  3C9I A;  3RK2 B;  1FJP A;  2IX7 C;  2OAR A;  3GHG B;  1SQP K;  1VDF A;  1SFC A;  1J2J B;  3H32 B;  3L4F A;  2R3C A;  1ZV8 A;  2N1T A;  3N7N A;  5AW2 B;  1AQ5 A;  3T97 A;  3RK3 B;  2NPS A;  4GIF A;  3VP8 A;  2XDJ A;  2C9N Y;  1FZB A;  2HPC A;  1URQ C;  4B86 A;  2BAS A;  1X8Y A;  1G2C A;  2OYI B;  1SVF A;  2FFD A;  3LW5 H;  4C7N B;  1T2K C;  3HUS B;  1IK9 A;  1KFN A;  1SFC D;  2WPR A;  5AW7 B;  2Q3I A;  1N73 B;  5AVU B;  4ZKP A;  5APV A;  1LTG C;  3M0A A;  3BRT B;  1FOS F;  3VOP A;  3P8M C;  1CI6 B;  3VMX A;  2NPS D;  3CL3 D;  2I1K A;  1RE3 A;  1J1E C;  2W27 A;  4IFD K;  1GD2 E;  2WWW A;  1URQ D;  3HE4 A;  2CPB A;  1IFI A;  3VP9 A;  1JMM A;  1FJK A;  3H6P A;  4HH2 A;  2Z4E A;  1G1J A;  1M7L A;  1JY2 N;  1YYC A;  2KOG A;  5KLV K;  3B5N A;  1FZC C;  4M3L A;  5AVY B;  5AW5 B;  1HGZ A;  3KDP B;  4LC1 A;  5APU A;  2GUS A;  3CLQ A;  5AVS B;  1EQ7 A;  1NTZ K;  3E1I A;  1H88 A;  1PFI A;  5CCH A;  3BAS A;  5CCH C;  1SFC B;  1T8Z A;  1A02 F;  2KYV A;  3A2A A;  2ZXE B;  3TNU A;  1MFZ A;  5CCG C;  3MTU E;  3V2N A;  2NPS B;  4IFF A;  2WTY A;  3PP5 A;  2PAJ A;  3NTN A;  2R5D A;  5BU8 B;  1M1J C;  2IFM A;  3BRV B;  2HPC B;  3M9H A;  2Q5U A;  1G2C B;  3VYI A;  1NH4 A;  5CCH D;  1E5W A;  1J1D C;  1GK4 A;  1NTM K;  4DOJ A;  1HGV A;  2J58 A;  5APT A;  1JCD A;  3OJA B;  1CSB A;  4WY4 C;  5CCG D;  1LTJ A;  2OYH A;  2WSC H;  4N3Y B;  1OWA A;  2OYH C;  4C46 A;  1FDM A;  5APX A;  4IFM A;  3U1A A;  1X9V A;  1GK6 A;  2WT7 B;  1N7S A;  1RE4 C;  2A45 G;  1GL2 C;  2YO3 A;  3VN0 A;  3MGN A;  3B5N B;  4WBA A;  1LGH B;  5AW3 B;  1JY2 P;  2M8R A;  2Q9I A;  2Z5I A;  4Y99 B;  1N2D C;  1G1I A;  2HG5 D;  3U1C A;  3LIE A;  1DH3 A;  3NFQ A;  4O9B A;  5AVT B;  3MD0 A;  4W7Z A;  2XZR A;  2WIT A;  2FYZ A;  3HE5 A;  5APS A;  2VRS A;  5AVQ B;  1JY3 O;  1KQL A;  1N7S D;  3TNU B;  4WB4 A;  3HD7 C;  5KTB A;  1URQ A;  1QL2 A;  1GW3 A;  3NXS A;  1LT9 C;  1YTZ T;  1JNM A;  4JF7 A;  2PP6 A;  3SWF A;  4AUW A;  1FAV A;  3MUD A;  3P32 A;  3SWY A;  1L4A A;  5APW A;  3V5B A;  1L4A C;  1LWU C;  3EQ2 A;  1W2E A;  3L37 A;  2YO2 A;  1H89 A;  1HWT C;  4XA4 A;  1FZG A;  3HD7 D;  4XE5 B;  2C0X A;  4HYT B;  2P2U A;  1LTJ B;  2WT7 A;  2Z5H A;  2OYH B;  4AYC A;  1RF1 C;  4I2L C;  1FZC A;  4LGD E;  1XTC C;  2KB7 P;  2YKP A;  4GKG A;  1T2K D;  1KIL A;  2L5G B;  1L0L K;  3CI9 A;  1KIL C;  1X79 B;  1L4A D;  1N7S B;  2CPS A;  5KJ7 C;  1NO4 A;  1T3J A;  2H7H A;  1LTA C;  4EIJ A;  2WPQ A;  3OAK A;  3N4X A;  3RL0 C;  1GDT A;  5AVW B;  1HVV A;  2WPS A;  2HOD A;  3IR9 A;  3M0D C;  1IFN A;  4N6J A;  1AFO A;  1DX7 A;  2FXM A;  2XNX A;  1FU1 A;  3HE5 B;  1T3U A;  3LID A;  5CCG A;  1S9K E;  1Z56 A;  1IO4 A;  1ZN5 A;  1NWQ A;  3MIW A;  3RK2 C;  1KIL D;  1NU1 K;  1FZA A;  5KJ7 D;  1JOC A;  3GHG C;  1IFJ A;  1M1J A;  3V2Q A;  2JJL A;  5CHX A;  1URQ B;  3RL0 D;  1MV8 A;  2O1K A;  3I5C A;  1NHL A;  1GZL A;  3RK3 C;  5AVR B;  2WSE H;  2P7J A;  5AVV B;  5AW1 B;  1GU4 A;  1SQV K;  5AW6 B;  1L4A B;  2JEE A;  2GUV A;  1JY3 N;  4WY4 A;  1SQB K;  5BVZ A;  1JTH A;  2IFN A;  4ZKU A;  2Q7C A;  1CW5 A;  1NKZ B;  3U59 A;  2OYI C;  3KYQ A;  1J1E B;  2YKO A;  3HUS C;  2W6A A;  1RE4 A;  1N73 C;  1GL2 A;  1IFD A;  2W6B A;  3B8E B;  3R2P A;  1GW4 A;  1GTW A;  1FZC B;  1N86 A;  3OA7 A;  1LTS C;  3TK1 A;  2E42 A;  1KIL B;  3M9B A;  1ZR2 A;  3HRN A;  4JYC A;  2R32 A;  4WY4 D;  3RL0 B;  4DZO A;  2M3B A;  2HOD B;  4W7Y A;  1OXZ A;  4W80 A;  5BU5 A;  5AW4 B;  1NOH A;  2HLO A;  2ZFC A;  1FZF A;  3HD7 A;  4LLH A;  1GL2 D;  2YKQ A;  3O8Z A;  4RES B;  1LT9 A;  2O01 H;  1RF0 C;  2H43 A;  2E43 A;  1M1J B;  1SFC C;  2QM7 A;  4EOT A;  1S9K D;  1JUN A;  1WRG A;  1MUU A;  4JYB A;  1LWU A;  3NMD A;  4KHX A;  2N1T C;  1ZR4 A;  2P67 A;  2N9B A;  1GU5 A;  1HJB A;  1J1D B;  5CJ4 A;  1FBM A;  2NPS C;  2POH A;  3HTK A;  1FZE A;  4WY4 B;  2KSJ A;  1JTH B;  5CJ0 A;  2O1J A;  1RY3 A;  3TSI A;  2C0W A;  1JY3 P;  2XKM A;  1RF1 A;  1IFM A;  3P7K A;  5AW0 B;  2FFD C;  2WZ7 A;  4OH8 B;  3A7O A;  2LKM A;  1JCC A;  1NTK K;  5KJ7 A;  3BVH A;  2IPP A;  1GL2 B;  1XTG B;  2N1T D;  1NKN A;  2KP8 A;  2HFE D;  2WSF H;  4N78 D;  1CZQ A;  1VPC A;  3L35 A;  3TYY A;  1RE3 C;  2HYN A;  3M0D A;  1YTZ I;  1SQX K;  2MJZ A;  3KPE A;  2P1J A;  1HH0 A;  3KQG A;  3V2R A;  1WT6 A;  1SP4 A;  5AVZ B;  3IFM A;  4I1L A;  3B5N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...