3BVHA

Crystal structure of recombinant gammad364a fibrinogen fragment d with the peptide ligand gly-pro-arg-pro-amide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
KVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
publication title Polymerization-defective fibrinogen variant gammaD364A binds knob "A" peptide mimic.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 62
sequence length 62
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3bvhA00
1N73C 1LTJB 1LT9A 1LTJA 1LT9B 1RE4C 1JY3P 1RF0C 3H32B 2OYHA 2OYHB 3BVHA 1FZBA 1JY3N 3H32A 1FZFA 2A45H 1RF1B 1T3UA 3GHGA 3GHGB 1M1JC 1RF1A 2HODB 2HODA 2FFDC 1LWUB 1LWUA 3HUSB 2HLOA 1JY3O 3HUSA 2OYIC 1RE3A 1N73B 1N73A 2Q9IA 1JY2P 1FZGA 1RE4A 1JY2N 1RF0A 1FZCC 1LTJC 1LT9C 2A45I 3E1IA 1M1JB 2A45G 2OYHC 2HPCB 1M1JA 1N86A 1W2EA 2HPCA 2XNXA 1JY2O 2FFDB 2FFDA 2OYIB 2OYIA 3GHGC 1RF1C 2H43A 1FZEA 2Z4EA 1FZAA 1LWUC 3HUSC 1RE3C 1FZCB 1FZCA
chains in the Genus database with same CATH superfamily
3LW5J 1EZVG 1NJIQ 1ZP0C 2I1JA 1KB9I 3TSIA 1MUUA 2JDIH 2FYUJ 1QX8A 1EXJA 2PAJA 3AE7C 3A0HH 1RHZB 1YJNP 2B87B 1SFCC 3KYQA 4EYYQ 4HJGH 1IFJA 2KNCB 3BRTB 5CBNA 4H13B 1S5LX 1SQBE 1M1KQ 3GF7A 2M3BA 2HPCB 1FU1A 1SQPK 1IK7A 3NXSA 3MD0A 4WY4D 2HG5D 1EQ7A 2K3RA 3U59A 4LC1A 1GTWA 1BGYJ 5KAIH 1VF5B 2ZFCA 4GDOA 3RK3C 4DZOA 2ZVOB 2H43A 4JQ0D 1ZR4A 1ZOYC 3HE5B 1FJKA 1NU1G 1PP9D 1NTMG 4JF7A 1QL1A 4Y28J 1SFCB 2R32A 4D6TG 2OGUA 4HYTB 2JP3A 3V6IA 1SQQG 4NPDA 3HUSC 3TGUG 2WMMA 1DD4A 2R3CA 1YIJP 4H44D 2K9JB 5AVXB 4ASVA 4U3FG 1SQVE 4DCKA 2ZT9D 1PGOA 3T97B 2OYIA 3H1HG 2E5TA 4Y99B 2L5GB 3MTUE 3RBXA 3A2AA 3M0AA 1KD1Q 2B89A 1NTZJ 3L73D 1DD3A 2JEEA 3L70D 1KQLA 4ZKPA 1JY2O 4CPGA 1DEEG 3E1RA 1QVFO 3CI9A 3M06A 1FZCA 3VMAA 2AXTH 1JB0J 2RMZA 2W8ZA 3CX5I 1LNQA 1Q90D 3BVHA 2O1KA 4PV1D 3HUSB 5KLVK 3CXHI 2FXMA 1LJ2A 5B5EE 5KJ7A 3IN6A 3CCRP 2CPBA 1VQNP 5AW8B 3ABVC 2MJZA 4OGQC 1L0NJ 2JKVA 2A06D 4R4MA 1VQMP 5AVWB 4O9BA 3HTKB 1AVYA 2N1TC 4WBAA 1GL2A 1E79H 3CWBJ 2Y9ZA 3G9RA 3TDKA 1H0TA 2HYNA 2H88C 1BCCG 3H6PA 2YO3A 3P8MC 4W80A 3MIWA 2XZRA 3VYIA 3H1KE 2WPQA 1VL2A 2WSCJ 5AW7B 1GK6A 1HJ0A 1EDJA 1SQBD 2IBZI 1MKMA 1M90Q 3VP8A 4OGQB 4GOFA 3V2QA 1BDCA 3H1ID 1SQXG 3KHUA 1NKNA 4IL6X 3M0DA 2D2CD 3AEFC 1YQ3C 2FBWC 2N1TB 3C9IA 2KYVA 1FZAA 1KZUB 2O3JA 2WWWA 5KTBA 4GT1A 3WU2E 3RBZA 1KTMA 2KNCA 3S1KA 5KLVE 1KILE 1YBKA 3FXEA 2XV5A 2AXCA 3EQ2A 1NTKE 3BRVB 1H8AA 1GD2E 2HPCA 1GL2D 4WB4A 3L71G 1DH3A 1L0ND 1HWTC 1RF0C 3BASA 1OIPA 4PD4I 3BCCG 1S5LE 1YTZT 3M9QA 1IFPA 1PPJD 1SQVD 2OYOA 4NPEA 3CC2P 3HE5A 2QA4P 3MUDC 3CCQP 3CWBD 3H32B 3KDPB 1BSHA 2ZYDA 4L75A 3FWLA 1SFCA 3N7NA 2YKQA 3A0BE 4R4LA 5AW4B 2YXQB 4YPCA 1URQC 2C0XA 2K9JA 2YKOA 1GDTA 3T97A 4GIFA 4C46A 2J59M 3N4XA 3HD7D 3L74G 1VQ6P 1BE3G 3WMM0 3L75G 1N8RQ 4HH2A 3GW6A 1PGQA 3RL0D 5E79E 3SFEC 2WPVB 1LTAC 1AJYA 5CHXA 2E76B 4Z1MH 3NFQA 2WPRA 2KSEA 5AVRB 2QM7A 1UIXA 3GMAA 2WTYA 3GG2A 5DJUB 1JEKA 1N2DC 3FX0A 3P7KA 2FFDC 1G1JA 3HUSA 4XE5B 1FZCC 5APVA 1URQB 1SS1A 3AE9C 3PH0A 1OVVA 3EFFK 1KB9H 3O6QB 4PV1B 1CW5A 1SQXK 2XU6A 1KQSO 1SQPG 3HTKA 1KYOI 2VRSA 2OTKE 2ZVNB 1KN7A 2HR3A 5AW1B 1N7SD 3CCEP 1FBMA 2PP6A 3B5NC 3V4WA 5TISE 3H1LD 3LIDA 1PP9E 3P32A 1JY3N 2Y0EA 3RK3D 2XDJA 3F5HA 5AVSB 2BCCG 1KILD 1NU1J 3R2PA 2FFDB 1J1EB 1NTKD 3OW2O 3H1JD 5AW3B 1NTMJ 2RKLA 3JCUE 4TT3H 1G2CA 3QWOC 3B4SA 1AVOA 4D6TJ 2P67A 1JMBA 1SQQJ 2OTLP 2H89C 1SQBK 3TGUJ 2O01N 2N1TA 3H1KG 3MGNA 1EDIA 2IZ0A 4U3FJ 2E75D 1S9KD 3AE5C 2Y0CA 3B5NB 1IFNA 3L70E 3M9HA 5BVZA 2Z5IA 1M56D 2C0WA 2D2CB 1WMKA 1L4AD 1OZHA 1OMIA 1N86A 4XFJA 3VP9A 5AVTB 1VQKP 3TNUB 3VN0A 3Q5SA 1NYHA 2NPSC 1L2PA 2J5UA 2YIUC 1T3UA 1BGYE 1VQ4P 5KLVG 3G3ZA 4N78D 1NAYA 3L72G 1ZR2A 1Y47A 1TU3F 5K5GB 4C7RA 1FOSF 1VF5C 1IJDB 5APSA 1ZXGA 3AE4C 2K9YA 1OVUA 2FYNB 2ZYGA 1SQVK 1OWAA 2Q6QA 1X0TA 3CX5H 1Y9BA 2CK3H 3SWYA 5GTIH 1N73C 1IZNB 1A02F 1T6AA 4N3YB 5BU5A 5CCHD 2NPSB 3WUTA 1RF0A 3PTZA 1ZRTD 2YIUB 2YNYA 1EDLA 1BCCJ 3CX5E 3A0HE 2J58A 3R4YA 1KQFB 1VDFA 1YJ9P 1EXIA 1RE4C 3PJSK 1VQ8P 1A02J 3H1IE 2E74C 1GW4A 3ZDMA 3MUDA 1VPCA 4Y99C 2N9YB 2BEQD 4H0LC 2QJPB 2PFXA 2Q3IA 4KHXA 3AE8C 2WT7B 3B71A 2Y0DA 1KB9D 3WUVA 3VOPA 1FE6A 1N73B 1Z56A 5KAIE 3EFGA 1L0LD 1Q2NA 3OJAB 1URQA 1JUNA 3Q3DA 1RQVA 3O6QA 1L0NE 1SVFA 1XTCC 5CJ4A 1P84I 4JYBA 4BRYA 4OVNF 2QJKC 1AFOA 1NWQA 3KQGA 3L71J 1SLQA 4EI2A 1FDIA 1PPJE 2UWJE 2WSCH 3Q1MA 4WWIA 2FYUD 2E74B 3CWBE 3UIAA 3AEDC 3BCCJ 4H0LB 3E7KA 2L91A 5CJ0A 3G71P 2IDBA 3RL0g 2BASA 2FFDA 1PGJA 2H8PD 4PD4H 1BCCD 3OA7A 2WSEJ 3HE4A 2KLUA 4YXWH 5CMZA 1ZLLA 3S9OA 1PP9G 1BGYD 1M1JB 1NTKK 2A45G 3CMAP 3MP7B 2QJKB 2QG4A 3IFMA 4GOEA 2AXTE 3A3YB 1M8OB 2KOGA 3V2NA 3B5NA 1KFNA 1JY2P 3S4RA 1PGPA 2GM4A 3L74J 1BE3J 2OYHC 2MKVA 1GZLA 3L75J 3TNUA 1JTHA 1YTZI 1QL2A 3TK1A 5AVQB 1RQUA 1HGVA 1Q86Q 1NKZB 1OXZA 3RK2D 3L71D 3L73G 1LP1B 2YXRB 3L70G 4NPFX 1WT6A 3CX5D 1USEA 4I1LA 1VQ7P 1T2KD 5KAFH 4WY4C 1FDMA 1NTZD 3CC4P 5KJ7D 1LTJC 1LT9C 2WSFH 1U7MA 3G4SP 3MZWB 2JWDA 1SQPJ 2P7JA 3H1LE 1LWUC 2B87A 3RK3E 2OYHB 4IFDK 2P58A 1GMJA 1FZFA 4M3LA 3W68A 2KSJA 1CZQA 1SP4A 2A06G 1HBWA 1KV4A 1D7MA 3USSA 2FY8A 2NPSA 1OW7A 5AVUB 1JCCA 3H1JE 4PJ0H 2QVAA 1KYOH 5AW2B 2BCCJ 2YMKA 3G6EP 1YITP 3KZIH 4H44C 1MFZA 2W90A 1EZVE 2IBZD 1PFIA 4PJ0E 2Z4EA 4WY4B 2ZT9C 1SQBG 2OARA 1LTJB 1LT9B 1S9KE 4ASWA 2E76C 4IOIH 3ITKA 1MFTA 4N6JA 1LWUB 2KK7A 2HLOA 1N73A 3K5BA 1JCDA 3CCVP 5AW9B 3H1IG 3AECC 1Q81Q 1K9MQ 4JYCA 1VQOP 4LLHA 4RO0A 2Q5UA 1L0LK 1R8EA 2WPSA 2O01H 1RE4A 2W83C 4PV1C 4N78E 2IYOA 4H13D 2WSFJ 1YJWP 2KB7P 3V2RA 1YI2P 3FWNA 4AYCA 4H44B 2DW3A 3C8VA 4PD4D 2K37A 4I6MC 3IAOA 1L0NG 4OWFA 5KLVJ 2ZT9B 1DEBA 3L72J 2FYUK 1RH5B 4K3AA 1HTLC 3KXDA 1NU1E 4BWNA 1MZ9A 2ITAA 4RESB 2NZ2A 1FJPA 1SQVG 1PPJG 3AE3C 1K05A 3I56P 3CWBG 4D6TE 2Q1KA 4UB8H 2M5AB 1J1EC 1SQQE 1ZRTE 3WUUA 2P1JA 1N7LA 3TGUE 3VMYA 1SFCD 1AQ5A 2K1AA 2WZ7A 2YMYA 2QJYC 3D6ZA 4AQRD 2KZIA 2G8YA 1JOCA 4A7PA 4U3FE 1NHLA 2ZXEB 2I1KA 3IR9A 1MV8A 2OQQA 4YXDC 2E5YA 2FXOA 1M57D 2Z5HA 1KB9E 1PZQA 4KT0J 2D2CC 1NGMB 3AEBC 4XA4A 5GTHH 1OX3A 1L0LE 2N9BA 1X9VA 2O01J 1G1IA 1LP1A 3CMEP 4I2LC 1RF1C 4GODA 3SSUA 2QIWA 2YKPA 3RK2B 5CBOA 1LTBC 2QJYB 1JY3O 1IO4A 2IYPA 2FYUE 4W7YA 1Q82Q 1IFMA 3KPEA 3SWKA 2XNXA 3U1CA 2AEMA 2R5DA 1J1DC 2FYNC 1FOSE 3CC7P 1EZVD 2OYHA 1VQPP 1KYOD 5B66H 1NTZK 3L37A 3H1HJ 4L74A 1BCCE 1P84H 3Q5PA 5APUA 1AA0A 2KXPB 3D6YA 3AE2C 4L76A 3VTPC 5CCGC 3SWFA 2JWAA 3H1LG 1RF1B 3H25A 3I55P 5B66E 5AVVB 2XNDH 3LIEA 1GL2B 3V5BA 1LTTC 3Q5RA 4WY4A 1L0NK 1S3JA 4AUWA 1LT9A 1LTJA 1NTKG 3H1JG 1PP9J 1JM0A 4L73A 3H32A 3OAKA 1HVVA 2QJPC 1E5WA 1KMIZ 1J1DB 1LWUA 1JNMA 3HD7C 1USDA 2QRXA 2R3SA 4OGQD 4ZNCA 2KP8A 1CI6B 3D71A 3RL0C 2XKMA 2WITA 1NU1D 2CPSA 2N1TD 3CXHH 1NTMD 2PGDA 4HB1A 3GLMA 2KUBA 4D6TD 1PL5A 3L71E 3L36A 2Q9IA 3U1AA 1VQ5P 2A45I 3L35A 1SQQD 2E42A 3L4FA 1S4XA 2K88A 3TGUD 3BCCE 3NTNA 4JPZB 2WSEH 5GTIE 5BU8B 3CXHE 1M7LA 4DJGA 3L73J 2M8RA 4U3FD 3L70J 2KI7B 1NTZE 1ZMEC 3VMXA 1S1CX 3H1HD 2IPPA 1LTIC 1YQ4C 3HD7B 5KLIC 2E43A 3M91A 1N7SC 1SQXJ 3RL0B 2HODB 1U7JA 1ZV8A 2M5AA 1FZGA 1K8AQ 1YHQP 1OFCX 3SFDC 1EDKA 1KILC 1FS0E 1X22A 4EOTA 1M1JC 3C1LA 2IFNA 2Y9YA 3CCMP 2IBZE 3L74E 1BE3E 1PV3A 1IFDA 2AEFA 3A5TA 4IFMA 2M0BA 3L75E 4EIJA 2W6JH 1RE3C 4OH8B 1QGKB 2P2UA 3CPWO 4MN4C 1VQLP 2YO2A 1OVRA 5KLIB 1OW8A 1JY2N 1N7SB 2E75C 1SQBJ 1W5CE 4HKZH 4C7NB 3GHGC 2E76D 1L4AC 5AW5B 3RK3B 2JJLA 3H1IJ 1J2JB 1IC2A 5B5EH 3TF5A 1WRGA 2ZJSE 1Q7YQ 1KILB 1NOHA 1FAVA 1L0LG 5APQA 1URQD 1SQPE 2V7QH 3AEGC 4PD4E 1P84D 3CL3D 3FGAD 3V2PA 1QVGO 2QE7H 3P8CE 1QEXA 1SQXD 2Q3EA 4RKUJ 3CLQA 4WVZA 2W27A 1H88A 4KJMA 1IK9A 2FYUG 4DT0A 2E75B 2BCCE 1NH4A 4UB6H 1FDOA 2IX7C 1BDDA 3GHGB 1RF1A 3NMDA 1L4AB 2JR8A 1SQVJ 3A7OA 1HH0A 1VQ9P 2QEXP 2FKWB 3F89A 2QM8A 1CSBA 1UIIA 2M3EA 2P10A 5CCHC 2KLVA 3PP5A 3BCCD 4UB6E 1HF9A 2WVRA 3CXHD 2V4HA 3FXDA 1R5LA 4I7ZC 5AVZB 4K35A 5APWA 1CI6A 2G3AA 1BGYG 2B88A 1JO5A 1G2CB 3V4QA 2QSIA 3WU2H 1LTGC 2KS1B 5KAFE 4U7JA 4EDFA 1LGHB 3B5ND 3VMZA 5CCGA 1KORA 1NU1K 1W2BO 5AW6B 2LXBA 4YTPC 3CCSP 1NTMK 2V7QJ 1KFMA 2ZAEB 3AE6C 5DJTB 2RH0A 1S5LH 3MHVA 1HUCA 3L72E 1SQQK 2KIKA 1K04A 3E1IA 3II6A 3O8ZA 1BSNA 1U57A 3L74D 3HD7A 1K73Q 1BE3D 3L75D 4I7ZB 2WT7A 1KYOE 2H7HA 1KC8Q 2ZXXA 1GK4A 2POHA 3TYYA 2HODA 4B86A 3A0BH 3KZIE 3H1KJ 1ZN5A 2I8DA 1NTZG 1S2EA 2WQYC 2W6AA 2FXPA 2BEZF 4LGDE 1LTSC 1FZBA 3PLNA 2GUVA 2HFED 3QH9A 2C9NY 2R44A 5CCGD 2NPSD 5KKZC 1KQGB 3H1LJ 3CCJP 1AV1A 1NAFA 1XTGB 1SQPD 1OW6A 1HJBA 2GA1A 1ZW0A 5E79H 3IF4A 4JBZA 3P8CD 2LKMA 1N7SA 5AW0B 3CD6P 1NTKJ 3H1JJ 1VF5D 4C7NA 2IFMA 1T3JA 3AEAC 2IBZG 1NTME 1EC5A 1GU4A 4GKGA 2BCCD 4ZMDA 2OYIC 1JMMA 1S72P 4IFFA 3PRJA 1PIXA 1KILA 3HRNA 1M1JA 3RK2C 3AEEC 2LXCB 1R5SA 3I5CA 5TJHA 3GF3A 3D70A 5KKZB 1RY3A 2ZYAA 4W7ZA 2OTJP 2Q7CA 5AVYB 1RE3A 4UB8E 3H1HE 4ZKUA 1T2KC 1H89A 3H1KD 1DX7A 3Q2YA 2W6BA 1FZEA 2WSSH 2E74D 5TISH 5KJ7C 5L8RJ 1EZVI 3BATA 4BRYB 2A45H 4H0LD 3GHGA 1YYCA 1L4AA 1NO4A 2O1JA 2RN0A 1GW3A 4QMAA 2OYIB 2SPZA 2C9LY 5C39A 3JCUH 3LW5H 1HGZA 5APTA 1GL2C 3CCLP 5APYA 1X79B 5APXA 5GTHE 2AEJA 5KLVD 4DOJA 3CCUP 3RGUA 3L72D 3B8EB 1AQTA 1NVOA 3JSVC 1FZCB 4RJTA 3HE4B 1IFIA 2R5BA 1X8YA 1LT1A 4IL6H 2JO1A 2KS1A 2B9BA 5M1BA 2GUSA 2FYZA 5H2FH 3PHLA 1JY3P 1Y8AA 3W67A 1GU5A 3L73E 3M0DC 3AE1C 5CCHA 1QLED 4IL6E 4BXLA 1W2EA 1FC2C 1P84E 1JTHB 1H0TB 2NRGA 4H13C 5H2FE 1SQXE 1T8ZA 2LR2A 3EWKA 1L0LJ 4TLFA 2PRRA 3JC22 3M9BA 1DIPA 2KZJA 2A06E 5EFWB 2IZ1A
chains in the Genus database with same CATH topology
5AW5B 3RK3B 1SQXK 2XU6A 2JJLA 1J2JB 1IC2A 2I1JA 3HTKA 1WRGA 3TSIA 2VRSA 1MUUA 1KILB 1NOHA 2PAJA 1MFZA 5AW1B 1FAVA 1N7SD 5APQA 1URQD 1PFIA 1FBMA 2PP6A 4WY4B 2Z4EA 3B5NC 3V4WA 2OARA 1LTJB 1LT9B 1S9KE 1SFCC 3LIDA 3CL3D 3KYQA 3P32A 1JY3N 3V2PA 3P8CE 1IFJA 3RK3D 4N6JA 2XDJA 1LWUB 2HLOA 3CLQA 3BRTB 5AVSB 1N73A 2W27A 1JCDA 5AW9B 1KILD 2M3BA 1H88A 2HPCB 1FU1A 3R2PA 4JYCA 2FFDB 1J1EB 1SQPK 1IK9A 3NXSA 3MD0A 5AW3B 4LLHA 1G2CA 4WY4D 1NH4A 2HG5D 1EQ7A 2IX7C 2Q5UA 3GHGB 3U59A 1RF1A 2P67A 3NMDA 4LC1A 1L4AB 1L0LK 2WPSA 1GTWA 2O01H 1RE4A 3A7OA 1HH0A 1SQBK 2ZFCA 4N78E 3RK3C 2FKWB 2QM8A 4DZOA 2KB7P 2N1TA 1CSBA 2H43A 5CCHC 3V2RA 3HE5B 1ZR4A 2KLVA 3MGNA 3PP5A 4AYCA 1FJKA 4I6MC 1S9KD 3B5NB 1IFNA 3M9HA 4JF7A 5BVZA 1QL1A 2Z5IA 2C0WA 1DEBA 2FYUK 1L4AD 1SFCB 2R32A 5AVZB 1HTLC 5APWA 1CI6A 4HYTB 1N86A 1MZ9A 3VP9A 5AVTB 4RESB 3HUSC 3TNUB 1FJPA 3VN0A 1JO5A 1G2CB 3V4QA 2NPSC 2R3CA 1T3UA 1LTGC 5AVXB 1J1EC 1LGHB 3B5ND 3VMZA 5CCGA 2P1JA 1N7LA 3VMYA 1SFCD 1NU1K 3G3ZA 2OYIA 1AQ5A 4N78D 5AW6B 2WZ7A 2YMYA 1ZR2A 4AQRD 4Y99B 1NTMK 2L5GB 3MTUE 1JOCA 1KFMA 4C7RA 1FOSF 3A2AA 1IJDB 5APSA 3M0AA 1NHLA 2ZXEB 2I1KA 1HUCA 3IR9A 1MV8A 1SQQK 1SQVK 2JEEA 1OWAA 1KQLA 3E1IA 3II6A 3O8ZA 4ZKPA 1JY2O 3SWYA 3HD7A 2Z5HA 3CI9A 3M06A 1FZCA 1N73C 2WT7A 2H7HA 3BVHA 2O1KA 1GK4A 2POHA 4XA4A 3TYYA 2HODA 1A02F 3HUSB 4B86A 5KLVK 2FXMA 5BU5A 4N3YB 5KJ7A 2N9BA 5CCHD 1X9VA 2NPSB 1RF0A 1ZN5A 1G1IA 2CPBA 2YNYA 4I2LC 5AW8B 1RF1C 2J58A 2MJZA 1VDFA 2W6AA 2YKPA 1RE4C 4LGDE 1LTSC 1FZBA 3RK2B 1A02J 5AVWB 1LTBC 4O9BA 3HTKB 1GW4A 1JY3O 2N1TC 3MUDA 2GUVA 1VPCA 1IO4A 2HFED 4WBAA 4Y99C 4W7YA 2C9NY 1GL2A 1IFMA 3KPEA 5CCGD 2NPSD 2XNXA 3U1CA 2Q3IA 2R5DA 1J1DC 4KHXA 2WT7B 1NAFA 1FOSE 2HYNA 1XTGB 2OYHA 1HJBA 3H6PA 2YO3A 3P8MC 4W80A 3MIWA 1NTZK 2XZRA 3VOPA 3VYIA 1N73B 3L37A 1Z56A 3P8CD 2LKMA 2WPQA 3EFGA 1N7SA 5AW0B 3OJAB 1URQA 1JUNA 5AW7B 4C7NA 1GK6A 2IFMA 5APUA 1T3JA 1SVFA 1XTCC 3VTPC 5CJ4A 5CCGC 1GU4A 3VP8A 3SWFA 4JYBA 4GKGA 1RF1B 1AFOA 2OYIC 1JMMA 1NWQA 3KQGA 4IFFA 3V2QA 5AVVB 3LIEA 1SLQA 1KILA 3HRNA 1GL2B 1NKNA 2WSCH 3M0DA 3V5BA 1M1JA 1LTTC 3UIAA 2N1TB 3RK2C 3C9IA 2KYVA 1FZAA 4WY4A 1L0NK 3I5CA 1KZUB 4AUWA 1LT9A 1LTJA 2WWWA 5KTBA 3H32A 3OAKA 4GT1A 1HVVA 1RY3A 4W7ZA 1E5WA 1J1DB 1LWUA 1JNMA 2Q7CA 3HD7C 5AVYB 1RE3A 4ZKUA 1T2KC 1H89A 2XV5A 5CJ0A 3EQ2A 3BRVB 2KP8A 1H8AA 1CI6B 1GD2E 1DX7A 2HPCA 2BASA 3RL0C 1GL2D 2FFDA 2H8PD 2XKMA 4WB4A 2W6BA 1FZEA 3OA7A 2WITA 2CPSA 5KJ7C 2N1TD 1DH3A 3HE4A 1HWTC 1RF0C 3BATA 3BASA 2A45H 3GHGA 1YYCA 5CMZA 1L4AA 1ZLLA 1NO4A 2O1JA 1GW3A 3L36A 2Q9IA 1YTZT 3U1AA 2A45I 1M1JB 1NTKK 2A45G 3L35A 2E42A 3L4FA 3M9QA 2OYIB 2C9LY 3NTNA 3HE5A 3IFMA 2WSEH 3LW5H 5BU8B 1HGZA 3H32B 3A3YB 1M7LA 3KDPB 5APTA 1GL2C 5APYA 1X79B 2KOGA 2M8RA 3V2NA 3B5NA 5APXA 1KFNA 1JY2P 1SFCA 3N7NA 2YKQA 2GM4A 4DOJA 3VMXA 2OYHC 3B8EB 2IPPA 1LTIC 1GZLA 3HD7B 5AW4B 3TNUA 1JTHA 1YTZI 1FZCB 2E43A 1QL2A 1IFIA 3HE4B 3TK1A 5AVQB 2R5BA 3M91A 1N7SC 1HGVA 1X8YA 1URQC 3RL0B 1NKZB 1OXZA 2C0XA 2HODB 1ZV8A 2YKOA 3RK2D 1FZGA 1GDTA 2GUSA 3T97A 4GIFA 1WT6A 2FYZA 4C46A 2J59M 3N4XA 4I1LA 3HD7D 1KILC 1JY3P 1T2KD 3WMM0 1GU5A 3M0DC 4HH2A 4EOTA 1M1JC 5CCHA 3RL0D 4WY4C 2IFNA 1FDMA 1LTAC 1LTJC 1LT9C 2WSFH 5CHXA 5KJ7D 1IFDA 1W2EA 3A5TA 4IFMA 3NFQA 4EIJA 2WPRA 2P7JA 5AVRB 1JTHB 1LWUC 2QM7A 1RE3C 4OH8B 2WTYA 2P2UA 1T8ZA 2OYHB 4IFDK 2KSJA 4M3LA 1CZQA 1SP4A 2YO2A 1N2DC 3P7KA 1FZFA 1HBWA 2FFDC 1G1JA 3HUSA 4XE5B 1JY2N 1N7SB 2NPSA 1FZCC 5APVA 1URQB 5AVUB 1JCCA 4C7NB 3M9BA 3GHGC 1L4AC 5AW2B 1CW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N73 C;  1LTJ B;  1LT9 A;  1LTJ A;  1LT9 B;  1RE4 C;  1JY3 P;  1RF0 C;  3H32 B;  2OYH A;  2OYH B;  3BVH A;  1FZB A;  1JY3 N;  3H32 A;  1FZF A;  2A45 H;  1RF1 B;  1T3U A;  3GHG A;  3GHG B;  1M1J C;  1RF1 A;  2HOD B;  2HOD A;  2FFD C;  1LWU B;  1LWU A;  3HUS B;  2HLO A;  1JY3 O;  3HUS A;  2OYI C;  1RE3 A;  1N73 B;  1N73 A;  2Q9I A;  1JY2 P;  1FZG A;  1RE4 A;  1JY2 N;  1RF0 A;  1FZC C;  1LTJ C;  1LT9 C;  2A45 I;  3E1I A;  1M1J B;  2A45 G;  2OYH C;  2HPC B;  1M1J A;  1N86 A;  1W2E A;  2HPC A;  2XNX A;  1JY2 O;  2FFD B;  2FFD A;  2OYI B;  2OYI A;  3GHG C;  1RF1 C;  2H43 A;  1FZE A;  2Z4E A;  1FZA A;  1LWU C;  3HUS C;  1RE3 C;  1FZC B;  1FZC A; 
#chains in the Genus database with same CATH topology
 3LW5 J;  1EZV G;  1NJI Q;  1ZP0 C;  2I1J A;  1KB9 I;  3TSI A;  1MUU A;  2JDI H;  2FYU J;  1QX8 A;  1EXJ A;  2PAJ A;  3AE7 C;  3A0H H;  1RHZ B;  1YJN P;  2B87 B;  1SFC C;  3KYQ A;  4EYY Q;  4HJG H;  1IFJ A;  2KNC B;  3BRT B;  5CBN A;  4H13 B;  1S5L X;  1SQB E;  1M1K Q;  3GF7 A;  2M3B A;  2HPC B;  1FU1 A;  1SQP K;  1IK7 A;  3NXS A;  3MD0 A;  4WY4 D;  2HG5 D;  1EQ7 A;  2K3R A;  3U59 A;  4LC1 A;  1GTW A;  1BGY J;  5KAI H;  1VF5 B;  2ZFC A;  4GDO A;  3RK3 C;  4DZO A;  2ZVO B;  2H43 A;  4JQ0 D;  1ZR4 A;  1ZOY C;  3HE5 B;  1FJK A;  1NU1 G;  1PP9 D;  1NTM G;  4JF7 A;  1QL1 A;  4Y28 J;  1SFC B;  2R32 A;  4D6T G;  2OGU A;  4HYT B;  2JP3 A;  3V6I A;  1SQQ G;  4NPD A;  3HUS C;  3TGU G;  2WMM A;  1DD4 A;  2R3C A;  1YIJ P;  4H44 D;  2K9J B;  5AVX B;  4ASV A;  4U3F G;  1SQV E;  4DCK A;  2ZT9 D;  1PGO A;  3T97 B;  2OYI A;  3H1H G;  2E5T A;  4Y99 B;  2L5G B;  3MTU E;  3RBX A;  3A2A A;  3M0A A;  1KD1 Q;  2B89 A;  1NTZ J;  3L73 D;  1DD3 A;  2JEE A;  3L70 D;  1KQL A;  4ZKP A;  1JY2 O;  4CPG A;  1DEE G;  3E1R A;  1QVF O;  3CI9 A;  3M06 A;  1FZC A;  3VMA A;  2AXT H;  1JB0 J;  2RMZ A;  2W8Z A;  3CX5 I;  1LNQ A;  1Q90 D;  3BVH A;  2O1K A;  4PV1 D;  3HUS B;  5KLV K;  3CXH I;  2FXM A;  1LJ2 A;  5B5E E;  5KJ7 A;  3IN6 A;  3CCR P;  2CPB A;  1VQN P;  5AW8 B;  3ABV C;  2MJZ A;  4OGQ C;  1L0N J;  2JKV A;  2A06 D;  4R4M A;  1VQM P;  5AVW B;  4O9B A;  3HTK B;  1AVY A;  2N1T C;  4WBA A;  1GL2 A;  1E79 H;  3CWB J;  2Y9Z A;  3G9R A;  3TDK A;  1H0T A;  2HYN A;  2H88 C;  1BCC G;  3H6P A;  2YO3 A;  3P8M C;  4W80 A;  3MIW A;  2XZR A;  3VYI A;  3H1K E;  2WPQ A;  1VL2 A;  2WSC J;  5AW7 B;  1GK6 A;  1HJ0 A;  1EDJ A;  1SQB D;  2IBZ I;  1MKM A;  1M90 Q;  3VP8 A;  4OGQ B;  4GOF A;  3V2Q A;  1BDC A;  3H1I D;  1SQX G;  3KHU A;  1NKN A;  4IL6 X;  3M0D A;  2D2C D;  3AEF C;  1YQ3 C;  2FBW C;  2N1T B;  3C9I A;  2KYV A;  1FZA A;  1KZU B;  2O3J A;  2WWW A;  5KTB A;  4GT1 A;  3WU2 E;  3RBZ A;  1KTM A;  2KNC A;  3S1K A;  5KLV E;  1KIL E;  1YBK A;  3FXE A;  2XV5 A;  2AXC A;  3EQ2 A;  1NTK E;  3BRV B;  1H8A A;  1GD2 E;  2HPC A;  1GL2 D;  4WB4 A;  3L71 G;  1DH3 A;  1L0N D;  1HWT C;  1RF0 C;  3BAS A;  1OIP A;  4PD4 I;  3BCC G;  1S5L E;  1YTZ T;  3M9Q A;  1IFP A;  1PPJ D;  1SQV D;  2OYO A;  4NPE A;  3CC2 P;  3HE5 A;  2QA4 P;  3MUD C;  3CCQ P;  3CWB D;  3H32 B;  3KDP B;  1BSH A;  2ZYD A;  4L75 A;  3FWL A;  1SFC A;  3N7N A;  2YKQ A;  3A0B E;  4R4L A;  5AW4 B;  2YXQ B;  4YPC A;  1URQ C;  2C0X A;  2K9J A;  2YKO A;  1GDT A;  3T97 A;  4GIF A;  4C46 A;  2J59 M;  3N4X A;  3HD7 D;  3L74 G;  1VQ6 P;  1BE3 G;  3WMM 0;  3L75 G;  1N8R Q;  4HH2 A;  3GW6 A;  1PGQ A;  3RL0 D;  5E79 E;  3SFE C;  2WPV B;  1LTA C;  1AJY A;  5CHX A;  2E76 B;  4Z1M H;  3NFQ A;  2WPR A;  2KSE A;  5AVR B;  2QM7 A;  1UIX A;  3GMA A;  2WTY A;  3GG2 A;  5DJU B;  1JEK A;  1N2D C;  3FX0 A;  3P7K A;  2FFD C;  1G1J A;  3HUS A;  4XE5 B;  1FZC C;  5APV A;  1URQ B;  1SS1 A;  3AE9 C;  3PH0 A;  1OVV A;  3EFF K;  1KB9 H;  3O6Q B;  4PV1 B;  1CW5 A;  1SQX K;  2XU6 A;  1KQS O;  1SQP G;  3HTK A;  1KYO I;  2VRS A;  2OTK E;  2ZVN B;  1KN7 A;  2HR3 A;  5AW1 B;  1N7S D;  3CCE P;  1FBM A;  2PP6 A;  3B5N C;  3V4W A;  5TIS E;  3H1L D;  3LID A;  1PP9 E;  3P32 A;  1JY3 N;  2Y0E A;  3RK3 D;  2XDJ A;  3F5H A;  5AVS B;  2BCC G;  1KIL D;  1NU1 J;  3R2P A;  2FFD B;  1J1E B;  1NTK D;  3OW2 O;  3H1J D;  5AW3 B;  1NTM J;  2RKL A;  3JCU E;  4TT3 H;  1G2C A;  3QWO C;  3B4S A;  1AVO A;  4D6T J;  2P67 A;  1JMB A;  1SQQ J;  2OTL P;  2H89 C;  1SQB K;  3TGU J;  2O01 N;  2N1T A;  3H1K G;  3MGN A;  1EDI A;  2IZ0 A;  4U3F J;  2E75 D;  1S9K D;  3AE5 C;  2Y0C A;  3B5N B;  1IFN A;  3L70 E;  3M9H A;  5BVZ A;  2Z5I A;  1M56 D;  2C0W A;  2D2C B;  1WMK A;  1L4A D;  1OZH A;  1OMI A;  1N86 A;  4XFJ A;  3VP9 A;  5AVT B;  1VQK P;  3TNU B;  3VN0 A;  3Q5S A;  1NYH A;  2NPS C;  1L2P A;  2J5U A;  2YIU C;  1T3U A;  1BGY E;  1VQ4 P;  5KLV G;  3G3Z A;  4N78 D;  1NAY A;  3L72 G;  1ZR2 A;  1Y47 A;  1TU3 F;  5K5G B;  4C7R A;  1FOS F;  1VF5 C;  1IJD B;  5APS A;  1ZXG A;  3AE4 C;  2K9Y A;  1OVU A;  2FYN B;  2ZYG A;  1SQV K;  1OWA A;  2Q6Q A;  1X0T A;  3CX5 H;  1Y9B A;  2CK3 H;  3SWY A;  5GTI H;  1N73 C;  1IZN B;  1A02 F;  1T6A A;  4N3Y B;  5BU5 A;  5CCH D;  2NPS B;  3WUT A;  1RF0 A;  3PTZ A;  1ZRT D;  2YIU B;  2YNY A;  1EDL A;  1BCC J;  3CX5 E;  3A0H E;  2J58 A;  3R4Y A;  1KQF B;  1VDF A;  1YJ9 P;  1EXI A;  1RE4 C;  3PJS K;  1VQ8 P;  1A02 J;  3H1I E;  2E74 C;  1GW4 A;  3ZDM A;  3MUD A;  1VPC A;  4Y99 C;  2N9Y B;  2BEQ D;  4H0L C;  2QJP B;  2PFX A;  2Q3I A;  4KHX A;  3AE8 C;  2WT7 B;  3B71 A;  2Y0D A;  1KB9 D;  3WUV A;  3VOP A;  1FE6 A;  1N73 B;  1Z56 A;  5KAI E;  3EFG A;  1L0L D;  1Q2N A;  3OJA B;  1URQ A;  1JUN A;  3Q3D A;  1RQV A;  3O6Q A;  1L0N E;  1SVF A;  1XTC C;  5CJ4 A;  1P84 I;  4JYB A;  4BRY A;  4OVN F;  2QJK C;  1AFO A;  1NWQ A;  3KQG A;  3L71 J;  1SLQ A;  4EI2 A;  1FDI A;  1PPJ E;  2UWJ E;  2WSC H;  3Q1M A;  4WWI A;  2FYU D;  2E74 B;  3CWB E;  3UIA A;  3AED C;  3BCC J;  4H0L B;  3E7K A;  2L91 A;  5CJ0 A;  3G71 P;  2IDB A;  3RL0 g;  2BAS A;  2FFD A;  1PGJ A;  2H8P D;  4PD4 H;  1BCC D;  3OA7 A;  2WSE J;  3HE4 A;  2KLU A;  4YXW H;  5CMZ A;  1ZLL A;  3S9O A;  1PP9 G;  1BGY D;  1M1J B;  1NTK K;  2A45 G;  3CMA P;  3MP7 B;  2QJK B;  2QG4 A;  3IFM A;  4GOE A;  2AXT E;  3A3Y B;  1M8O B;  2KOG A;  3V2N A;  3B5N A;  1KFN A;  1JY2 P;  3S4R A;  1PGP A;  2GM4 A;  3L74 J;  1BE3 J;  2OYH C;  2MKV A;  1GZL A;  3L75 J;  3TNU A;  1JTH A;  1YTZ I;  1QL2 A;  3TK1 A;  5AVQ B;  1RQU A;  1HGV A;  1Q86 Q;  1NKZ B;  1OXZ A;  3RK2 D;  3L71 D;  3L73 G;  1LP1 B;  2YXR B;  3L70 G;  4NPF X;  1WT6 A;  3CX5 D;  1USE A;  4I1L A;  1VQ7 P;  1T2K D;  5KAF H;  4WY4 C;  1FDM A;  1NTZ D;  3CC4 P;  5KJ7 D;  1LTJ C;  1LT9 C;  2WSF H;  1U7M A;  3G4S P;  3MZW B;  2JWD A;  1SQP J;  2P7J A;  3H1L E;  1LWU C;  2B87 A;  3RK3 E;  2OYH B;  4IFD K;  2P58 A;  1GMJ A;  1FZF A;  4M3L A;  3W68 A;  2KSJ A;  1CZQ A;  1SP4 A;  2A06 G;  1HBW A;  1KV4 A;  1D7M A;  3USS A;  2FY8 A;  2NPS A;  1OW7 A;  5AVU B;  1JCC A;  3H1J E;  4PJ0 H;  2QVA A;  1KYO H;  5AW2 B;  2BCC J;  2YMK A;  3G6E P;  1YIT P;  3KZI H;  4H44 C;  1MFZ A;  2W90 A;  1EZV E;  2IBZ D;  1PFI A;  4PJ0 E;  2Z4E A;  4WY4 B;  2ZT9 C;  1SQB G;  2OAR A;  1LTJ B;  1LT9 B;  1S9K E;  4ASW A;  2E76 C;  4IOI H;  3ITK A;  1MFT A;  4N6J A;  1LWU B;  2KK7 A;  2HLO A;  1N73 A;  3K5B A;  1JCD A;  3CCV P;  5AW9 B;  3H1I G;  3AEC C;  1Q81 Q;  1K9M Q;  4JYC A;  1VQO P;  4LLH A;  4RO0 A;  2Q5U A;  1L0L K;  1R8E A;  2WPS A;  2O01 H;  1RE4 A;  2W83 C;  4PV1 C;  4N78 E;  2IYO A;  4H13 D;  2WSF J;  1YJW P;  2KB7 P;  3V2R A;  1YI2 P;  3FWN A;  4AYC A;  4H44 B;  2DW3 A;  3C8V A;  4PD4 D;  2K37 A;  4I6M C;  3IAO A;  1L0N G;  4OWF A;  5KLV J;  2ZT9 B;  1DEB A;  3L72 J;  2FYU K;  1RH5 B;  4K3A A;  1HTL C;  3KXD A;  1NU1 E;  4BWN A;  1MZ9 A;  2ITA A;  4RES B;  2NZ2 A;  1FJP A;  1SQV G;  1PPJ G;  3AE3 C;  1K05 A;  3I56 P;  3CWB G;  4D6T E;  2Q1K A;  4UB8 H;  2M5A B;  1J1E C;  1SQQ E;  1ZRT E;  3WUU A;  2P1J A;  1N7L A;  3TGU E;  3VMY A;  1SFC D;  1AQ5 A;  2K1A A;  2WZ7 A;  2YMY A;  2QJY C;  3D6Z A;  4AQR D;  2KZI A;  2G8Y A;  1JOC A;  4A7P A;  4U3F E;  1NHL A;  2ZXE B;  2I1K A;  3IR9 A;  1MV8 A;  2OQQ A;  4YXD C;  2E5Y A;  2FXO A;  1M57 D;  2Z5H A;  1KB9 E;  1PZQ A;  4KT0 J;  2D2C C;  1NGM B;  3AEB C;  4XA4 A;  5GTH H;  1OX3 A;  1L0L E;  2N9B A;  1X9V A;  2O01 J;  1G1I A;  1LP1 A;  3CME P;  4I2L C;  1RF1 C;  4GOD A;  3SSU A;  2QIW A;  2YKP A;  3RK2 B;  5CBO A;  1LTB C;  2QJY B;  1JY3 O;  1IO4 A;  2IYP A;  2FYU E;  4W7Y A;  1Q82 Q;  1IFM A;  3KPE A;  3SWK A;  2XNX A;  3U1C A;  2AEM A;  2R5D A;  1J1D C;  2FYN C;  1FOS E;  3CC7 P;  1EZV D;  2OYH A;  1VQP P;  1KYO D;  5B66 H;  1NTZ K;  3L37 A;  3H1H J;  4L74 A;  1BCC E;  1P84 H;  3Q5P A;  5APU A;  1AA0 A;  2KXP B;  3D6Y A;  3AE2 C;  4L76 A;  3VTP C;  5CCG C;  3SWF A;  2JWA A;  3H1L G;  1RF1 B;  3H25 A;  3I55 P;  5B66 E;  5AVV B;  2XND H;  3LIE A;  1GL2 B;  3V5B A;  1LTT C;  3Q5R A;  4WY4 A;  1L0N K;  1S3J A;  4AUW A;  1LT9 A;  1LTJ A;  1NTK G;  3H1J G;  1PP9 J;  1JM0 A;  4L73 A;  3H32 A;  3OAK A;  1HVV A;  2QJP C;  1E5W A;  1KMI Z;  1J1D B;  1LWU A;  1JNM A;  3HD7 C;  1USD A;  2QRX A;  2R3S A;  4OGQ D;  4ZNC A;  2KP8 A;  1CI6 B;  3D71 A;  3RL0 C;  2XKM A;  2WIT A;  1NU1 D;  2CPS A;  2N1T D;  3CXH H;  1NTM D;  2PGD A;  4HB1 A;  3GLM A;  2KUB A;  4D6T D;  1PL5 A;  3L71 E;  3L36 A;  2Q9I A;  3U1A A;  1VQ5 P;  2A45 I;  3L35 A;  1SQQ D;  2E42 A;  3L4F A;  1S4X A;  2K88 A;  3TGU D;  3BCC E;  3NTN A;  4JPZ B;  2WSE H;  5GTI E;  5BU8 B;  3CXH E;  1M7L A;  4DJG A;  3L73 J;  2M8R A;  4U3F D;  3L70 J;  2KI7 B;  1NTZ E;  1ZME C;  3VMX A;  1S1C X;  3H1H D;  2IPP A;  1LTI C;  1YQ4 C;  3HD7 B;  5KLI C;  2E43 A;  3M91 A;  1N7S C;  1SQX J;  3RL0 B;  2HOD B;  1U7J A;  1ZV8 A;  2M5A A;  1FZG A;  1K8A Q;  1YHQ P;  1OFC X;  3SFD C;  1EDK A;  1KIL C;  1FS0 E;  1X22 A;  4EOT A;  1M1J C;  3C1L A;  2IFN A;  2Y9Y A;  3CCM P;  2IBZ E;  3L74 E;  1BE3 E;  1PV3 A;  1IFD A;  2AEF A;  3A5T A;  4IFM A;  2M0B A;  3L75 E;  4EIJ A;  2W6J H;  1RE3 C;  4OH8 B;  1QGK B;  2P2U A;  3CPW O;  4MN4 C;  1VQL P;  2YO2 A;  1OVR A;  5KLI B;  1OW8 A;  1JY2 N;  1N7S B;  2E75 C;  1SQB J;  1W5C E;  4HKZ H;  4C7N B;  3GHG C;  2E76 D;  1L4A C;  5AW5 B;  3RK3 B;  2JJL A;  3H1I J;  1J2J B;  1IC2 A;  5B5E H;  3TF5 A;  1WRG A;  2ZJS E;  1Q7Y Q;  1KIL B;  1NOH A;  1FAV A;  1L0L G;  5APQ A;  1URQ D;  1SQP E;  2V7Q H;  3AEG C;  4PD4 E;  1P84 D;  3CL3 D;  3FGA D;  3V2P A;  1QVG O;  2QE7 H;  3P8C E;  1QEX A;  1SQX D;  2Q3E A;  4RKU J;  3CLQ A;  4WVZ A;  2W27 A;  1H88 A;  4KJM A;  1IK9 A;  2FYU G;  4DT0 A;  2E75 B;  2BCC E;  1NH4 A;  4UB6 H;  1FDO A;  2IX7 C;  1BDD A;  3GHG B;  1RF1 A;  3NMD A;  1L4A B;  2JR8 A;  1SQV J;  3A7O A;  1HH0 A;  1VQ9 P;  2QEX P;  2FKW B;  3F89 A;  2QM8 A;  1CSB A;  1UII A;  2M3E A;  2P10 A;  5CCH C;  2KLV A;  3PP5 A;  3BCC D;  4UB6 E;  1HF9 A;  2WVR A;  3CXH D;  2V4H A;  3FXD A;  1R5L A;  4I7Z C;  5AVZ B;  4K35 A;  5APW A;  1CI6 A;  2G3A A;  1BGY G;  2B88 A;  1JO5 A;  1G2C B;  3V4Q A;  2QSI A;  3WU2 H;  1LTG C;  2KS1 B;  5KAF E;  4U7J A;  4EDF A;  1LGH B;  3B5N D;  3VMZ A;  5CCG A;  1KOR A;  1NU1 K;  1W2B O;  5AW6 B;  2LXB A;  4YTP C;  3CCS P;  1NTM K;  2V7Q J;  1KFM A;  2ZAE B;  3AE6 C;  5DJT B;  2RH0 A;  1S5L H;  3MHV A;  1HUC A;  3L72 E;  1SQQ K;  2KIK A;  1K04 A;  3E1I A;  3II6 A;  3O8Z A;  1BSN A;  1U57 A;  3L74 D;  3HD7 A;  1K73 Q;  1BE3 D;  3L75 D;  4I7Z B;  2WT7 A;  1KYO E;  2H7H A;  1KC8 Q;  2ZXX A;  1GK4 A;  2POH A;  3TYY A;  2HOD A;  4B86 A;  3A0B H;  3KZI E;  3H1K J;  1ZN5 A;  2I8D A;  1NTZ G;  1S2E A;  2WQY C;  2W6A A;  2FXP A;  2BEZ F;  4LGD E;  1LTS C;  1FZB A;  3PLN A;  2GUV A;  2HFE D;  3QH9 A;  2C9N Y;  2R44 A;  5CCG D;  2NPS D;  5KKZ C;  1KQG B;  3H1L J;  3CCJ P;  1AV1 A;  1NAF A;  1XTG B;  1SQP D;  1OW6 A;  1HJB A;  2GA1 A;  1ZW0 A;  5E79 H;  3IF4 A;  4JBZ A;  3P8C D;  2LKM A;  1N7S A;  5AW0 B;  3CD6 P;  1NTK J;  3H1J J;  1VF5 D;  4C7N A;  2IFM A;  1T3J A;  3AEA C;  2IBZ G;  1NTM E;  1EC5 A;  1GU4 A;  4GKG A;  2BCC D;  4ZMD A;  2OYI C;  1JMM A;  1S72 P;  4IFF A;  3PRJ A;  1PIX A;  1KIL A;  3HRN A;  1M1J A;  3RK2 C;  3AEE C;  2LXC B;  1R5S A;  3I5C A;  5TJH A;  3GF3 A;  3D70 A;  5KKZ B;  1RY3 A;  2ZYA A;  4W7Z A;  2OTJ P;  2Q7C A;  5AVY B;  1RE3 A;  4UB8 E;  3H1H E;  4ZKU A;  1T2K C;  1H89 A;  3H1K D;  1DX7 A;  3Q2Y A;  2W6B A;  1FZE A;  2WSS H;  2E74 D;  5TIS H;  5KJ7 C;  5L8R J;  1EZV I;  3BAT A;  4BRY B;  2A45 H;  4H0L D;  3GHG A;  1YYC A;  1L4A A;  1NO4 A;  2O1J A;  2RN0 A;  1GW3 A;  4QMA A;  2OYI B;  2SPZ A;  2C9L Y;  5C39 A;  3JCU H;  3LW5 H;  1HGZ A;  5APT A;  1GL2 C;  3CCL P;  5APY A;  1X79 B;  5APX A;  5GTH E;  2AEJ A;  5KLV D;  4DOJ A;  3CCU P;  3RGU A;  3L72 D;  3B8E B;  1AQT A;  1NVO A;  3JSV C;  1FZC B;  4RJT A;  3HE4 B;  1IFI A;  2R5B A;  1X8Y A;  1LT1 A;  4IL6 H;  2JO1 A;  2KS1 A;  2B9B A;  5M1B A;  2GUS A;  2FYZ A;  5H2F H;  3PHL A;  1JY3 P;  1Y8A A;  3W67 A;  1GU5 A;  3L73 E;  3M0D C;  3AE1 C;  5CCH A;  1QLE D;  4IL6 E;  4BXL A;  1W2E A;  1FC2 C;  1P84 E;  1JTH B;  1H0T B;  2NRG A;  4H13 C;  5H2F E;  1SQX E;  1T8Z A;  2LR2 A;  3EWK A;  1L0L J;  4TLF A;  2PRR A;  3JC2 2;  3M9B A;  1DIP A;  2KZJ A;  2A06 E;  5EFW B;  2IZ1 A; 
#chains in the Genus database with same CATH homology
 5AW5 B;  3RK3 B;  1SQX K;  2XU6 A;  2JJL A;  1J2J B;  1IC2 A;  2I1J A;  3HTK A;  1WRG A;  3TSI A;  2VRS A;  1MUU A;  1KIL B;  1NOH A;  2PAJ A;  1MFZ A;  5AW1 B;  1FAV A;  1N7S D;  5APQ A;  1URQ D;  1PFI A;  1FBM A;  2PP6 A;  4WY4 B;  2Z4E A;  3B5N C;  3V4W A;  2OAR A;  1LTJ B;  1LT9 B;  1S9K E;  1SFC C;  3LID A;  3CL3 D;  3KYQ A;  3P32 A;  1JY3 N;  3V2P A;  3P8C E;  1IFJ A;  3RK3 D;  4N6J A;  2XDJ A;  1LWU B;  2HLO A;  3CLQ A;  3BRT B;  5AVS B;  1N73 A;  2W27 A;  1JCD A;  5AW9 B;  1KIL D;  2M3B A;  1H88 A;  2HPC B;  1FU1 A;  3R2P A;  4JYC A;  2FFD B;  1J1E B;  1SQP K;  1IK9 A;  3NXS A;  3MD0 A;  5AW3 B;  4LLH A;  1G2C A;  4WY4 D;  1NH4 A;  2HG5 D;  1EQ7 A;  2IX7 C;  2Q5U A;  3GHG B;  3U59 A;  1RF1 A;  2P67 A;  3NMD A;  4LC1 A;  1L4A B;  1L0L K;  2WPS A;  1GTW A;  2O01 H;  1RE4 A;  3A7O A;  1HH0 A;  1SQB K;  2ZFC A;  4N78 E;  3RK3 C;  2FKW B;  2QM8 A;  4DZO A;  2KB7 P;  2N1T A;  1CSB A;  2H43 A;  5CCH C;  3V2R A;  3HE5 B;  1ZR4 A;  2KLV A;  3MGN A;  3PP5 A;  4AYC A;  1FJK A;  4I6M C;  1S9K D;  3B5N B;  1IFN A;  3M9H A;  4JF7 A;  5BVZ A;  1QL1 A;  2Z5I A;  2C0W A;  1DEB A;  2FYU K;  1L4A D;  1SFC B;  2R32 A;  5AVZ B;  1HTL C;  5APW A;  1CI6 A;  4HYT B;  1N86 A;  1MZ9 A;  3VP9 A;  5AVT B;  4RES B;  3HUS C;  3TNU B;  1FJP A;  3VN0 A;  1JO5 A;  1G2C B;  3V4Q A;  2NPS C;  2R3C A;  1T3U A;  1LTG C;  5AVX B;  1J1E C;  1LGH B;  3B5N D;  3VMZ A;  5CCG A;  2P1J A;  1N7L A;  3VMY A;  1SFC D;  1NU1 K;  3G3Z A;  2OYI A;  1AQ5 A;  4N78 D;  5AW6 B;  2WZ7 A;  2YMY A;  1ZR2 A;  4AQR D;  4Y99 B;  1NTM K;  2L5G B;  3MTU E;  1JOC A;  1KFM A;  4C7R A;  1FOS F;  3A2A A;  1IJD B;  5APS A;  3M0A A;  1NHL A;  2ZXE B;  2I1K A;  1HUC A;  3IR9 A;  1MV8 A;  1SQQ K;  1SQV K;  2JEE A;  1OWA A;  1KQL A;  3E1I A;  3II6 A;  3O8Z A;  4ZKP A;  1JY2 O;  3SWY A;  3HD7 A;  2Z5H A;  3CI9 A;  3M06 A;  1FZC A;  1N73 C;  2WT7 A;  2H7H A;  3BVH A;  2O1K A;  1GK4 A;  2POH A;  4XA4 A;  3TYY A;  2HOD A;  1A02 F;  3HUS B;  4B86 A;  5KLV K;  2FXM A;  5BU5 A;  4N3Y B;  5KJ7 A;  2N9B A;  5CCH D;  1X9V A;  2NPS B;  1RF0 A;  1ZN5 A;  1G1I A;  2CPB A;  2YNY A;  4I2L C;  5AW8 B;  1RF1 C;  2J58 A;  2MJZ A;  1VDF A;  2W6A A;  2YKP A;  1RE4 C;  4LGD E;  1LTS C;  1FZB A;  3RK2 B;  1A02 J;  5AVW B;  1LTB C;  4O9B A;  3HTK B;  1GW4 A;  1JY3 O;  2N1T C;  3MUD A;  2GUV A;  1VPC A;  1IO4 A;  2HFE D;  4WBA A;  4Y99 C;  4W7Y A;  2C9N Y;  1GL2 A;  1IFM A;  3KPE A;  5CCG D;  2NPS D;  2XNX A;  3U1C A;  2Q3I A;  2R5D A;  1J1D C;  4KHX A;  2WT7 B;  1NAF A;  1FOS E;  2HYN A;  1XTG B;  2OYH A;  1HJB A;  3H6P A;  2YO3 A;  3P8M C;  4W80 A;  3MIW A;  1NTZ K;  2XZR A;  3VOP A;  3VYI A;  1N73 B;  3L37 A;  1Z56 A;  3P8C D;  2LKM A;  2WPQ A;  3EFG A;  1N7S A;  5AW0 B;  3OJA B;  1URQ A;  1JUN A;  5AW7 B;  4C7N A;  1GK6 A;  2IFM A;  5APU A;  1T3J A;  1SVF A;  1XTC C;  3VTP C;  5CJ4 A;  5CCG C;  1GU4 A;  3VP8 A;  3SWF A;  4JYB A;  4GKG A;  1RF1 B;  1AFO A;  2OYI C;  1JMM A;  1NWQ A;  3KQG A;  4IFF A;  3V2Q A;  5AVV B;  3LIE A;  1SLQ A;  1KIL A;  3HRN A;  1GL2 B;  1NKN A;  2WSC H;  3M0D A;  3V5B A;  1M1J A;  1LTT C;  3UIA A;  2N1T B;  3RK2 C;  3C9I A;  2KYV A;  1FZA A;  4WY4 A;  1L0N K;  3I5C A;  1KZU B;  4AUW A;  1LT9 A;  1LTJ A;  2WWW A;  5KTB A;  3H32 A;  3OAK A;  4GT1 A;  1HVV A;  1RY3 A;  4W7Z A;  1E5W A;  1J1D B;  1LWU A;  1JNM A;  2Q7C A;  3HD7 C;  5AVY B;  1RE3 A;  4ZKU A;  1T2K C;  1H89 A;  2XV5 A;  5CJ0 A;  3EQ2 A;  3BRV B;  2KP8 A;  1H8A A;  1CI6 B;  1GD2 E;  1DX7 A;  2HPC A;  2BAS A;  3RL0 C;  1GL2 D;  2FFD A;  2H8P D;  2XKM A;  4WB4 A;  2W6B A;  1FZE A;  3OA7 A;  2WIT A;  2CPS A;  5KJ7 C;  2N1T D;  1DH3 A;  3HE4 A;  1HWT C;  1RF0 C;  3BAT A;  3BAS A;  2A45 H;  3GHG A;  1YYC A;  5CMZ A;  1L4A A;  1ZLL A;  1NO4 A;  2O1J A;  1GW3 A;  3L36 A;  2Q9I A;  1YTZ T;  3U1A A;  2A45 I;  1M1J B;  1NTK K;  2A45 G;  3L35 A;  2E42 A;  3L4F A;  3M9Q A;  2OYI B;  2C9L Y;  3NTN A;  3HE5 A;  3IFM A;  2WSE H;  3LW5 H;  5BU8 B;  1HGZ A;  3H32 B;  3A3Y B;  1M7L A;  3KDP B;  5APT A;  1GL2 C;  5APY A;  1X79 B;  2KOG A;  2M8R A;  3V2N A;  3B5N A;  5APX A;  1KFN A;  1JY2 P;  1SFC A;  3N7N A;  2YKQ A;  2GM4 A;  4DOJ A;  3VMX A;  2OYH C;  3B8E B;  2IPP A;  1LTI C;  1GZL A;  3HD7 B;  5AW4 B;  3TNU A;  1JTH A;  1YTZ I;  1FZC B;  2E43 A;  1QL2 A;  1IFI A;  3HE4 B;  3TK1 A;  5AVQ B;  2R5B A;  3M91 A;  1N7S C;  1HGV A;  1X8Y A;  1URQ C;  3RL0 B;  1NKZ B;  1OXZ A;  2C0X A;  2HOD B;  1ZV8 A;  2YKO A;  3RK2 D;  1FZG A;  1GDT A;  2GUS A;  3T97 A;  4GIF A;  1WT6 A;  2FYZ A;  4C46 A;  2J59 M;  3N4X A;  4I1L A;  3HD7 D;  1KIL C;  1JY3 P;  1T2K D;  3WMM 0;  1GU5 A;  3M0D C;  4HH2 A;  4EOT A;  1M1J C;  5CCH A;  3RL0 D;  4WY4 C;  2IFN A;  1FDM A;  1LTA C;  1LTJ C;  1LT9 C;  2WSF H;  5CHX A;  5KJ7 D;  1IFD A;  1W2E A;  3A5T A;  4IFM A;  3NFQ A;  4EIJ A;  2WPR A;  2P7J A;  5AVR B;  1JTH B;  1LWU C;  2QM7 A;  1RE3 C;  4OH8 B;  2WTY A;  2P2U A;  1T8Z A;  2OYH B;  4IFD K;  2KSJ A;  4M3L A;  1CZQ A;  1SP4 A;  2YO2 A;  1N2D C;  3P7K A;  1FZF A;  1HBW A;  2FFD C;  1G1J A;  3HUS A;  4XE5 B;  1JY2 N;  1N7S B;  2NPS A;  1FZC C;  5APV A;  1URQ B;  5AVU B;  1JCC A;  4C7N B;  3M9B A;  3GHG C;  1L4A C;  5AW2 B;  1CW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...