3BVHA

Crystal structure of recombinant gammad364a fibrinogen fragment d with the peptide ligand gly-pro-arg-pro-amide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
KVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Polymerization-defective fibrinogen variant gammaD364A binds knob "A" peptide mimic.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 23
structure length 62
sequence length 62
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3bvhA00
2Q9IA 1RF1A 1LT9A 2HPCB 1RF1C 1FZGA 2A45G 1LT9C 1RF1B 1JY2P 1LTJC 3GHGC 1JY3P 1FZBA 2FFDC 1LWUA 1N73C 1RE3C 2A45I 2A45H 3H32B 1JY3N 3H32A 3HUSA 2H43A 1FZCA 2HODB 2OYIC 1M1JA 1RF0C 1RE4A 2OYIA 2OYHC 2OYIB 1FZFA 2HLOA 2OYHB 1N73B 2XNXA 1LTJA 3GHGA 2FFDB 1LTJB 1T3UA 3GHGB 1FZAA 1LT9B 1JY3O 3BVHA 2Z4EA 2FFDA 1JY2N 2HPCA 1LWUB 3E1IA 3HUSB 1FZEA 1FZCB 1RF0A 2OYHA 2HODA 1FZCC 1M1JB 1JY2O 1M1JC 1RE4C 1N73A 1RE3A 3HUSC 1LWUC 1W2EA 1N86A
chains in the Genus database with same CATH superfamily
5KTBA 1OFCX 4IL6H 5AVYB 1JM0A 3HRNA 4B86A 1G2CA 1Q2NA 1ZP0C 1RF1B 2E5TA 4LGDE 4PD4E 1KYOD 5H2FH 1DD3A 2ZYGA 4D6TJ 5KKZC 1OW6A 3Q5SA 1LTIC 2A06G 1SQPD 2G8YA 4U3FJ 1R8EA 1NTKJ 2B89A 3D6ZA 3NXSA 2XKMA 4N78D 2ZT9B 1FDIA 2WPSA 1HBWA 2KP8A 1OX3A 3EQ2A 2FYNC 3L75D 4NPFX 1SP4A 2QJYC 3GHGA 1L0NK 5KLIC 4DJGA 1YI2P 1NWQA 4GDOA 1A02F 1JY3O 1YJ9P 2Z4EA 4NPEA 3TNUB 1PGOA 3E1IA 3GF3A 1M56D 3H1LE 1L0LJ 3A0HE 4PJ0E 4PV1B 2W90A 4D6TD 1VQ8P 3PH0A 3VMZA 4EI2A 1T2KD 1VQKP 3M9HA 4WY4B 3AE2C 1QL1A 2BCCG 3PP5A 5CJ0A 1FOSF 1BE3E 5KAIE 1YTZT 1KQLA 3CX5D 3LIDA 4H44D 2E74C 3I56P 3L37A 2KB7P 1NOHA 4I7ZB 1HVVA 1P84I 3CCVP 5APXA 1LT9C 1FOSE 5KLIB 1U7MA 4WBAA 1VQ6P 3BCCJ 3BCCE 2LXCB 2KSJA 3HUSA 2A45I 1HGZA 3L71J 5CCHC 2H43A 2BEQD 2HG5D 2FXPA 1FC2C 1RQUA 3A3YB 1JEKA 4HB1A 3TSIA 5BU8B 5KLVE 3CCLP 2JDIH 1L4AC 3CXHD 2YIUB 1S4XA 3M9QA 2GUSA 1KORA 1LTBC 2N1TA 3H1HJ 1T3UA 4N78E 2WMMA 1X22A 3BVHA 1EZVG 3HD7D 1SQPE 1DEBA 1NGMB 1JMBA 1L0NJ 3S4RA 3CXHH 3H1JG 1NAFA 3KHUA 4PV1D 1M1JB 1RE4C 3CI9A 1JTHA 1AV1A 2WSEJ 1RE3A 3PTZA 5B66H 4NPDA 1OVVA 1PPJG 4GIFA 1M8OB 3QH9A 2WTYA 1PFIA 1NTKE 4U3FG 3RL0B 2BEZF 3AE5C 5KLVD 1L0LD 2QJPB 2WSCJ 2H89C 2PAJA 2YIUC 2R5BA 3H1LJ 2OGUA 2FYNB 2W6AA 4UB8E 2I8DA 3FWLA 1L4AD 3RL0g 1KV4A 1KTMA 2OYHC 3OAKA 4RESB 1XTGB 1HTLC 1VQNP 1SQBG 2PFXA 2FBWC 3TYYA 1DD4A 1S5LX 1VPCA 1EDIA 1YQ3C 3U59A 4H0LC 4I1LA 1DIPA 5KAFH 5APTA 3TNUA 2Y9YA 4D6TE 1NU1D 2WSFJ 3TDKA 1YYCA 1H88A 2B87B 2HODA 4W7ZA 3OA7A 1OIPA 3O6QA 2KNCA 4UB8H 4XA4A 1NTZD 1SFCC 2AXCA 1LP1B 1EDJA 3C8VA 1J1DC 3TK1A 1NTZE 1RF1A 3ITKA 3WU2H 1K73Q 3RK2B 3ZDMA 4Y99C 4EYYQ 5CCGA 4W7YA 1LTTC 2C9LY 2YKOA 1JCCA 1EZVE 3OW2O 3M0DA 1W5CE 2E74D 2J58A 3NMDA 4XE5B 3S1KA 4WVZA 2OTLP 3RK3B 2Q1KA 3V4WA 3SWKA 2OYIA 3H1HG 5AW7B 4KHXA 2LXBA 3HE4A 4H13B 3CMEP 2W6JH 3OJAB 1P84H 1IFIA 2WPRA 1LGHB 2YNYA 3L74J 1JY2N 1KILA 2K1AA 3H1KE 4C7RA 2AXTH 4RJTA 3SWFA 1KC8Q 2UWJE 1M90Q 4BXLA 3CL3D 5AVSB 3LW5J 5M1BA 3GMAA 1SQQD 1NTKD 1SFCA 2ZYAA 1MUUA 3L70E 5AW8B 3LIEA 4R4LA 1W2EA 1LTSC 3C1LA 2XV5A 3CWBG 4JBZA 1OMIA 4L74A 4PV1C 2Q9IA 1SQBE 3FXDA 4C7NA 1HF9A 3H1HD 3T97B 3KYQA 3EWKA 1X0TA 2OYOA 1E79H 1SQQK 3WU2E 3B8EB 1VQ9P 3EFFK 2E43A 1L4AB 1DH3A 1JO5A 3V4QA 3HE5B 1EXIA 4RO0A 1RF0C 4DZOA 1G1JA 5AW4B 3VP9A 2E76D 1H0TA 2V7QJ 1FDOA 5AVWB 1CZQA 2WPVB 5APWA 5CBNA 1G2CB 2J5UA 4GT1A 1QGKB 3IAOA 2L91A 3BCCD 4BRYA 3KPEA 1KQGB 2IX7C 2R32A 3IN6A 3PHLA 3B71A 3L71E 1OZHA 2KXPB 1LT1A 2M5AA 3KXDA 1X8YA 1S1CX 4OWFA 1OW7A 1PGQA 1BE3D 2QIWA 1VF5C 1UIXA 3B4SA 3M9BA 3SFEC 2O3JA 3CC4P 1N86A 1SQVK 5AW3B 2QEXP 1NKZB 3L74D 1S9KE 2ZYDA 3AEFC 1SQVG 2IZ0A 2NPSD 3CC7P 1YJNP 1SQBK 3H1LD 4RKUJ 1FZBA 1VQ5P 3MHVA 3CCQP 3ABVC 3CX5H 1YJWP 4IOIH 1Z56A 1RHZB 1P84E 1OVUA 2G3AA 2V7QH 2QM8A 3H1LG 4H13C 2WT7B 3H25A 1ZOYC 2MJZA 1SQVD 1FU1A 1JTHB 3GG2A 3L73G 4YPCA 3I55P 3L75E 3MGNA 1S2EA 1EDKA 3L73D 3L75G 3CPWO 2JJLA 2W27A 4I7ZC 4EOTA 1USDA 1Q7YQ 1BE3G 1LT9B 3A5TA 1IZNB 1ZV8A 3H6PA 4JQ0D 2FFDB 5EFWB 4WY4D 5E79E 3CCEP 2O1KA 1SQPG 1KYOE 1NU1J 1OXZA 1VF5B 2H8PD 3FX0A 1VQLP 1MKMA 2LKMA 1AJYA 1CW5A 2OYHA 3MP7B 1GL2B 1U57A 5GTIE 4LLHA 3I5CA 1VQOP 1VQ7P 4UB6E 2AEJA 3B5NC 3CWBJ 3VMAA 2PRRA 1YHQP 1WRGA 1GTWA 3D71A 2OARA 1SLQA 3RBZA 3T97A 3CXHI 1EC5A 2WZ7A 2E75C 3H32B 3AEBC 1MFZA 2KLUA 1BE3J 3L4FA 3HE5A 3L72D 2WVRA 1BGYG 1FZCA 1KB9I 1PV3A 2E76B 2FYZA 2HLOA 1OWAA 1NTKK 1BGYE 2IBZE 2RKLA 3JC22 2XNXA 1LNQA 1SQXJ 2QJPC 5CHXA 1RH5B 4ASVA 3CX5I 2QJKB 1NTMJ 2H88C 4K3AA 5KAIH 1OW8A 1FS0E 4N3YB 2FXOA 1AA0A 2Y0CA 1J1EC 1L0ND 2HR3A 4HYTB 2IFNA 2ZVOB 1K8AQ 2KZIA 2Q6QA 3L72J 2JWAA 1N7SC 1ZXGA 1N73A 5APQA 3A0HH 4PJ0H 1HJBA 3VMXA 1K05A 2C0WA 1SFCD 4Z1MH 2P58A 1FJKA 2GA1A 1JOCA 1VF5D 1NTKG 2Q3IA 1KYOH 1KMIZ 1PP9E 2K9JA 3KZIH 4H0LB 3E7KA 4U3FE 3H1JD 1BCCJ 1JY2P 4N6JA 1FAVA 5AVRB 5B5EE 1IK7A 2A06D 4BWNA 2C0XA 3MUDC 1RY3A 2W83C 1JY3N 1IFPA 3PRJA 2M8RA 3RK3D 3F5HA 3H1KJ 5AW1B 3V2NA 1KB9D 3M91A 2KNCB 2YO3A 2RMZA 2WT7A 1FZCC 4IFDK 3H1ID 1KFNA 2ZXXA 4CPGA 3N7NA 3AEAC 3GF7A 1WT6A 1NO4A 3L72G 2M0BA 2PP6A 1YTZI 3FGAD 2D2CB 1ZMEC 4HJGH 3PLNA 1QVGO 4DOJA 3M06A 4AYCA 2YMYA 3U1AA 2N1TD 2QVAA 3B5NB 3EFGA 2I1JA 1N7SA 3IF4A 4L73A 4QMAA 1RF0A 4WY4C 1S72P 4OGQC 2WITA 1JY2O 5KLVK 4YTPC 1YBKA 4XFJA 3CCJP 3Q5RA 1N7LA 1NTZG 3NTNA 3CCSP 2P10A 2N9YB 3H1IE 5E79H 3CWBE 4JPZB 1D7MA 5AVQB 1KILB 4O9BA 2ZVNB 1XTCC 3AE7C 2FYUD 1BCCE 1S5LH 1JY3P 5CBOA 1HJ0A 5APYA 4DCKA 1Q86Q 4D6TG 1RE3C 2A45H 2Y9ZA 3H32A 5CCHD 2ZT9C 1WMKA 3AE6C 1GW4A 4U3FD 2Q7CA 1Q82Q 3G3ZA 3L73J 1KILD 2O01N 4L76A 1IC2A 2M3BA 4W80A 2FFDA 4C7NB 3H1JJ 1FZAA 1SQQG 1VDFA 1ZRTD 2N1TC 5AW0B 4R4MA 1AQ5A 1L0NG 2I1KA 3HD7C 1Y8AA 1GU5A 1NTME 2ZFCA 1L0NE 1GL2D 1LTGC 1L0LG 3A2AA 1JMMA 5BU5A 3R4YA 1GZLA 4M3LA 4IFFA 3AE3C 2KS1A 3L35A 2WWWA 5AVVB 1R5SA 1JUNA 1H0TB 2DW3A 2KLVA 1PPJD 3MUDA 3KZIE 1ZW0A 2GM4A 2W8ZA 4IFMA 3R2PA 1HGVA 1PPJE 1RQVA 1QVFO 1N7SD 4ZKUA 1BGYD 5APSA 3PJSK 2RH0A 1N8RQ 2IBZD 5KLVJ 2K9JB 2JWDA 2NPSC 2WPQA 3GLMA 2QE7H 3H1KG 1NH4A 3A0BH 3BCCG 3G4SP 1IFDA 3D70A 3W68A 1SQVJ 2ITAA 4AQRD 3HTKB 1JB0J 3CLQA 4H13D 2OYHB 2KIKA 1SQXD 2B88A 1NAYA 4GOFA 2NPSB 1MZ9A 3G9RA 1CSBA 1S5LE 4MN4C 1QLED 3JCUE 3SWYA 3M0AA 1IFNA 1EDLA 4H0LD 1MFTA 3P8CE 3V2PA 2OTKE 1SFCB 3SSUA 2KOGA 1T2KC 2C9NY 2BCCD 3CCRP 1LWUC 3L73E 4GODA 4KT0J 1J1EB 4OGQD 1X9VA 3P32A 1VQ4P 2BCCJ 1LT9A 1DEEG 2IYPA 2O1JA 1Y9BA 3BASA 1RF1C 3Q1MA 2LR2A 3A7OA 1PL5A 1KQSO 3USSA 2JR8A 1LJ2A 2R3SA 3GHGC 1HWTC 2FFDC 4HKZH 2QG4A 1HH0A 1E5WA 5DJUB 2IYOA 2O01H 4GOEA 3L74G 1NTMK 4K35A 2FXMA 1SQQJ 1N73B 3L74E 1S9KD 1Q81Q 4GKGA 1GU4A 2H7HA 5GTHE 1KN7A 5B66E 1G1IA 4OH8B 3GHGB 4I2LC 2VRSA 1SS1A 2FKWB 1QL2A 3AEGC 5TJHA 1K04A 2A06E 3RL0D 4BRYB 2M3EA 4EDFA 2FYUK 1KQFB 1NTMD 4C46A 4OGQB 1FZCB 3O8ZA 2M5AB 3C9IA 4TLFA 1CI6A 1MV8A 2K3RA 1M1JC 2QSIA 2HFED 3HUSC 3W67A 1M1KQ 3CMAP 3Q5PA 1KILE 2R5DA 2R3CA 1JCDA 1HUCA 1KFMA 1NTZJ 1PGJA 1UIIA 2QJYB 2KYVA 2YXRB 4EIJA 3RBXA 2WQYC 1ZLLA 1URQA 3B5NA 5DJTB 1BCCD 3VTPC 2FYUE 1A02J 1PP9J 2P7JA 2J59M 3RK3C 1EZVI 1GMJA 1SQBD 1Q90D 3WUUA 1T3JA 3CWBD 3RGUA 4ASWA 4JYBA 1W2BO 1K9MQ 1EXJA 3WMM0 3CD6P 1IK9A 2WSEH 1GD2E 1FJPA 3RL0C 1DX7A 2E74B 3L72E 3L70D 2NRGA 3II6A 4UB6H 3IFMA 1SQQE 1GK4A 3RK2D 1LWUB 5C39A 2AEMA 5CMZA 1SVFA 3VMYA 1GW3A 5AW6B 1GL2A 5APUA 4ZNCA 1PZQA 2K88A 3JCUH 2BCCE 2KSEA 2FYUJ 2Z5IA 4PD4H 1M7LA 2YMKA 4PD4I 1J2JB 1NHLA 1PP9G 2D2CC 3VYIA 2R44A 2HPCB 2QJKC 3FWNA 4Y28J 4YXWH 3P8CD 3RK3E 4A7PA 2PGDA 2YO2A 2OYIC 1EZVD 2RN0A 2IPPA 1IFMA 2JEEA 1U7JA 1L0LK 2WSFH 2ZAEB 2ZT9D 1M57D 3A0BE 3F89A 3JSVC 5H2FE 5L8RJ 3V5BA 1SQXE 3TGUG 1VL2A 2ZJSE 1GK6A 3MD0A 1LTJA 1KILC 1NU1K 4TT3H 1AVYA 3RK2C 1BSHA 1P84D 2W6BA 2YKQA 3U1CA 1NU1G 3LW5H 1SQXK 2N9BA 1IFJA 1NU1E 1IO4A 4DT0A 5AVTB 1KB9H 2SPZA 3UIAA 1GL2C 1EQ7A 1QEXA 2GUVA 3AE8C 5B5EH 4AUWA 3V2QA 3Q3DA 1YITP 1URQC 2CPSA 2D2CD 1AVOA 2JP3A 2XU6A 2ZXEB 3HD7B 2BASA 1PIXA 2N1TB 3B5ND 1ZR2A 1SQPK 3CC2P 5AVUB 1AQTA 3BRTB 2A45G 2QA4P 3GW6A 1NVOA 5TISE 1N73C 2QRXA 5KLVG 4JF7A 3VOPA 1T6AA 1L0LE 2KZJA 1FDMA 2KS1B 3BRVB 1RE4A 1ZRTE 3MIWA 2E76C 3N4XA 1FE6A 3AE4C 3HE4B 2O01J 3CCMP 4ZMDA 5KJ7C 3L75J 1BSNA 5CCGD 1KYOI 2OYIB 1AFOA 1VQMP 2FY8A 4Y99B 2CK3H 2AEFA 2E42A 1SQPJ 5AW2B 3HUSB 1JNMA 1N7SB 3CCUP 3HTKA 2KUBA 1URQD 3H1HE 4OVNF 3BATA 3SFDC 1NJIQ 2FYUG 1N2DC 1KD1Q 3AE9C 3WUVA 1H89A 2IZ1A 3M0DC 5AW5B 4WWIA 3Q2YA 3KQGA 5AVXB 2IDBA 3CXHE 2AXTE 1SQVE 2Q5UA 1BDDA 1FZGA 4LC1A 3IR9A 5BVZA 1VQPP 1LTJC 2P1JA 1USEA 1YQ4C 4WB4A 2Q3EA 3S9OA 1BDCA 5CJ4A 5K5GB 4KJMA 1M1JA 1SQBJ 1CI6B 3K5BA 1FZFA 2IBZG 2L5GB 1R5LA 3CX5E 3O6QB 4IL6X 1IJDB 2K37A 3MZWB 3TGUJ 2Y0DA 1FBMA 5CCHA 3FXEA 1LTJB 1KB9E 2IBZI 2KK7A 3H1IG 3L70J 2QM7A 4I6MC 1KZUB 1NKNA 1J1DB 3L71D 5GTHH 4HH2A 2P2UA 2E5YA 3H1JE 1NYHA 3MTUE 4YXDC 1URQB 2OQQA 1PP9D 2Y0EA 4JYCA 3AE1C 3V6IA 5KAFE 2CPBA 2XDJA 2POHA 4IL6E 4WY4A 5AW9B 4H44C 1OVRA 3TF5A 3L36A 2YXQB 3HD7A 2B9BA 2IFMA 2MKVA 2WSCH 3AECC 2K9YA 5KJ7A 1S3JA 1YIJP 1BCCG 2V4HA 1Y47A 5AVZB 2E75D 1LWUA 3L71G 4L75A 2JKVA 2KI7B 3VN0A 4PD4D 5GTIH 1LTAC 3H1IJ 3L70G 3NFQA 1NTZK 2B87A 2HODB 2JO1A 1ZR4A 1X79B 3VP8A 1QX8A 2E75B 3WUTA 3AEEC 2XZRA 2OTJP 1LP1A 1TU3F 3P7KA 2P67A 1ZN5A 2NPSA 3QWOC 1GDTA 5KKZB 5APVA 1SQXG 3TGUE 1PGPA 2NZ2A 2WSSH 5TISH 2XNDH 1BGYJ 3E1RA 5KJ7D 5CCGC 3G6EP 2HPCA 1L2PA 4ZKPA 3G71P 1NTMG 2Z5HA 4H44B 4U7JA 1FZEA 1H8AA 3AEDC 1L4AA 3V2RA 2YKPA 1T8ZA 3H1KD 3P8MC 3KDPB 3D6YA 3TGUD 2HYNA
chains in the Genus database with same CATH topology
5KTBA 5AVYB 3HRNA 4B86A 1G2CA 4LGDE 1LTIC 3NXSA 2XKMA 4N78D 2WPSA 1HBWA 2KP8A 3EQ2A 1SP4A 1A02F 3GHGA 1L0NK 2E42A 1NWQA 1JY3O 2Z4EA 3TNUB 3E1IA 3VMZA 1T2KD 3M9HA 4WY4B 1QL1A 3PP5A 5CJ0A 1FOSF 1YTZT 1KQLA 3LIDA 3L37A 2KB7P 1NOHA 1FOSE 1HVVA 5APXA 1LT9C 4WBAA 5CCHC 2KSJA 3HUSA 2A45I 1HGZA 2H43A 3A3YB 2HG5D 3TSIA 5BU8B 1L4AC 3M9QA 2GUSA 1LTBC 2N1TA 4N78E 1T3UA 3BVHA 3HD7D 1DEBA 1NAFA 1FDMA 1M1JB 1RE4C 3CI9A 1JTHA 1RE3A 4GIFA 2WTYA 1PFIA 3RL0B 2PAJA 2R5BA 2W6AA 1L4AD 2OYHC 3OAKA 4RESB 1XTGB 1HTLC 3TYYA 1VPCA 3U59A 4I1LA 5APTA 3TNUA 1YYCA 1H88A 2HODA 4W7ZA 4XA4A 3OA7A 1FZCC 1SFCC 1J1DC 3TK1A 1RF1A 3RK2B 2C9LY 4Y99C 5CCGA 4W7YA 1LTTC 2YKOA 1JCCA 3M0DA 3NMDA 4XE5B 2J58A 3RK3B 3V4WA 2OYIA 5AW7B 4KHXA 3HE4A 3OJAB 1IFIA 2WPRA 1LGHB 2YNYA 1JY2N 1KILA 4C7RA 3SWFA 3CL3D 5AVSB 1SFCA 1MUUA 5AW8B 3LIEA 1W2EA 1LTSC 2XV5A 2Q9IA 4C7NA 3KYQA 1SQQK 3B8EB 2E43A 1L4AB 1DH3A 1JO5A 3V4QA 3HE5B 1RF0C 4DZOA 1G1JA 5AW4B 3VP9A 5AVWB 1CZQA 5APWA 1G2CB 4GT1A 3KPEA 2IX7C 2R32A 1X8YA 3M9BA 1N86A 1SQVK 5AW3B 1NKZB 1S9KE 2NPSD 1SQBK 1FZBA 1Z56A 2WT7B 2QM8A 2MJZA 2OYIB 1FU1A 1JTHB 3MGNA 4EOTA 2JJLA 2W27A 1LT9B 3A5TA 3H6PA 1ZV8A 4WY4D 2O1KA 1OXZA 2H8PD 2LKMA 2OYHA 1GL2B 4LLHA 3I5CA 3B5NC 1GTWA 1WRGA 2OARA 1SLQA 3T97A 2WZ7A 3H32B 1MFZA 3L4FA 1FZCA 3HE5A 2FYZA 2HLOA 1OWAA 1NTKK 2XNXA 5CHXA 4N3YB 1J1EC 4HYTB 2IFNA 1N7SC 1N73A 5APQA 1HJBA 3VMXA 2C0WA 1SFCD 1FJKA 1JOCA 2Q3IA 1JY2P 4N6JA 1FAVA 5AVRB 2C0XA 1RY3A 1JY3N 3RK3D 2M8RA 3V2NA 5AW1B 2WT7A 4IFDK 3M91A 2YO3A 1KFNA 3N7NA 1WT6A 1NO4A 2PP6A 1YTZI 4DOJA 3M06A 4AYCA 2YMYA 3U1AA 2N1TD 3B5NB 3EFGA 2I1JA 1N7SA 4WY4C 1RF0A 2WITA 1JY2O 5KLVK 1N7LA 3NTNA 5AVQB 1KILB 4O9BA 1XTCC 1JY3P 5APYA 1RE3C 2A45H 3H32A 5CCHD 1GW4A 2Q7CA 3G3ZA 1KILD 1IC2A 2M3BA 4W80A 2FFDA 4C7NB 1FZAA 1VDFA 5AW0B 1AQ5A 2N1TC 2I1KA 3HD7C 1GU5A 2ZFCA 1GL2D 1LTGC 3A2AA 1JMMA 5BU5A 1GZLA 4M3LA 4IFFA 5AVVB 3L35A 2WWWA 1JUNA 2KLVA 3MUDA 2GM4A 4IFMA 3R2PA 1HGVA 1N7SD 4ZKUA 5APSA 2NPSC 2WPQA 1NH4A 1IFDA 4AQRD 3HTKB 3CLQA 2OYHB 2NPSB 1MZ9A 1CSBA 3SWYA 3M0AA 1IFNA 3P8CE 3V2PA 1SFCB 2KOGA 1T2KC 2C9NY 1LWUC 1J1EB 1X9VA 3P32A 1LT9A 2O1JA 3BASA 1RF1C 3A7OA 1HWTC 3GHGC 2FFDC 1HH0A 1E5WA 2O01H 1NTMK 2FXMA 1N73B 1S9KD 4GKGA 1GU4A 2H7HA 1G1IA 4OH8B 3GHGB 4I2LC 2VRSA 2FKWB 1QL2A 3RL0D 2FYUK 4C46A 1FZCB 3O8ZA 3C9IA 1CI6A 1MV8A 1M1JC 2HFED 3HUSC 2R5DA 2R3CA 1JCDA 1HUCA 1KFMA 2KYVA 4EIJA 1ZLLA 1URQA 3B5NA 3VTPC 1A02J 2P7JA 2J59M 3RK3C 1T3JA 4JYBA 3WMM0 1IK9A 2WSEH 1GD2E 1FJPA 3RL0C 1DX7A 3II6A 3IFMA 1GK4A 3RK2D 1LWUB 5CMZA 1SVFA 3VMYA 1GW3A 5AW6B 1GL2A 5APUA 2Z5IA 1M7LA 1J2JB 1NHLA 3VYIA 2HPCB 3P8CD 2YO2A 2OYIC 2IPPA 1IFMA 2JEEA 1L0LK 2WSFH 3V5BA 4AUWA 1CW5A 1GK6A 3MD0A 1LTJA 1KILC 1NU1K 3RK2C 2W6BA 2YKQA 3U1CA 3LW5H 1SQXK 2N9BA 1IFJA 1IO4A 5AVTB 3UIAA 1GL2C 1EQ7A 2GUVA 3V2QA 1URQC 2CPSA 2XU6A 2ZXEB 3HD7B 2BASA 2N1TB 3B5ND 1ZR2A 1SQPK 5AVUB 3BRTB 2A45G 1N73C 4JF7A 3VOPA 3MIWA 3BRVB 1RE4A 3N4XA 3HE4B 5KJ7C 5CCGD 1AFOA 4Y99B 5AW2B 3HUSB 1JNMA 1N7SB 3HTKA 1URQD 3BATA 1N2DC 1H89A 3M0DC 5AW5B 3KQGA 5AVXB 2Q5UA 1FZGA 4LC1A 3IR9A 5BVZA 1LTJC 2P1JA 4WB4A 5CJ4A 1M1JA 1CI6B 1FZFA 2L5GB 1IJDB 5CCHA 1FBMA 2FFDB 1RF1B 1LTJB 4I6MC 2QM7A 1KZUB 1NKNA 1J1DB 4HH2A 2P2UA 3MTUE 1URQB 4JYCA 2CPBA 2XDJA 2POHA 5AW9B 4WY4A 3L36A 3HD7A 2IFMA 2WSCH 5KJ7A 5AVZB 1LWUA 3VN0A 1LTAC 3NFQA 1NTZK 2HODB 1ZR4A 1X79B 3VP8A 2XZRA 3P7KA 2P67A 1ZN5A 2NPSA 1GDTA 5APVA 5KJ7D 2HPCA 5CCGC 4ZKPA 2Z5HA 1FZEA 1H8AA 3V2RA 1L4AA 2YKPA 1T8ZA 3P8MC 3KDPB 2HYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9I A;  1RF1 A;  1LT9 A;  2HPC B;  1RF1 C;  1FZG A;  2A45 G;  1LT9 C;  1RF1 B;  1JY2 P;  1LTJ C;  3GHG C;  1JY3 P;  1FZB A;  2FFD C;  1LWU A;  1N73 C;  1RE3 C;  2A45 I;  2A45 H;  3H32 B;  1JY3 N;  3H32 A;  3HUS A;  2H43 A;  1FZC A;  2HOD B;  2OYI C;  1M1J A;  1RF0 C;  1RE4 A;  2OYI A;  2OYH C;  2OYI B;  1FZF A;  2HLO A;  2OYH B;  1N73 B;  2XNX A;  1LTJ A;  3GHG A;  2FFD B;  1LTJ B;  1T3U A;  3GHG B;  1FZA A;  1LT9 B;  1JY3 O;  3BVH A;  2Z4E A;  2FFD A;  1JY2 N;  2HPC A;  1LWU B;  3E1I A;  3HUS B;  1FZE A;  1FZC B;  1RF0 A;  2OYH A;  2HOD A;  1FZC C;  1M1J B;  1JY2 O;  1M1J C;  1RE4 C;  1N73 A;  1RE3 A;  3HUS C;  1LWU C;  1W2E A;  1N86 A; 
#chains in the Genus database with same CATH topology
 5KTB A;  1OFC X;  4IL6 H;  5AVY B;  1JM0 A;  3HRN A;  4B86 A;  1G2C A;  1Q2N A;  1ZP0 C;  1RF1 B;  2E5T A;  4LGD E;  4PD4 E;  1KYO D;  5H2F H;  1DD3 A;  2ZYG A;  4D6T J;  5KKZ C;  1OW6 A;  3Q5S A;  1LTI C;  2A06 G;  1SQP D;  2G8Y A;  4U3F J;  1R8E A;  1NTK J;  2B89 A;  3D6Z A;  3NXS A;  2XKM A;  4N78 D;  2ZT9 B;  1FDI A;  2WPS A;  1HBW A;  2KP8 A;  1OX3 A;  3EQ2 A;  2FYN C;  3L75 D;  4NPF X;  1SP4 A;  2QJY C;  3GHG A;  1L0N K;  5KLI C;  4DJG A;  1YI2 P;  1NWQ A;  4GDO A;  1A02 F;  1JY3 O;  1YJ9 P;  2Z4E A;  4NPE A;  3TNU B;  1PGO A;  3E1I A;  3GF3 A;  1M56 D;  3H1L E;  1L0L J;  3A0H E;  4PJ0 E;  4PV1 B;  2W90 A;  4D6T D;  1VQ8 P;  3PH0 A;  3VMZ A;  4EI2 A;  1T2K D;  1VQK P;  3M9H A;  4WY4 B;  3AE2 C;  1QL1 A;  2BCC G;  3PP5 A;  5CJ0 A;  1FOS F;  1BE3 E;  5KAI E;  1YTZ T;  1KQL A;  3CX5 D;  3LID A;  4H44 D;  2E74 C;  3I56 P;  3L37 A;  2KB7 P;  1NOH A;  4I7Z B;  1HVV A;  1P84 I;  3CCV P;  5APX A;  1LT9 C;  1FOS E;  5KLI B;  1U7M A;  4WBA A;  1VQ6 P;  3BCC J;  3BCC E;  2LXC B;  2KSJ A;  3HUS A;  2A45 I;  1HGZ A;  3L71 J;  5CCH C;  2H43 A;  2BEQ D;  2HG5 D;  2FXP A;  1FC2 C;  1RQU A;  3A3Y B;  1JEK A;  4HB1 A;  3TSI A;  5BU8 B;  5KLV E;  3CCL P;  2JDI H;  1L4A C;  3CXH D;  2YIU B;  1S4X A;  3M9Q A;  2GUS A;  1KOR A;  1LTB C;  2N1T A;  3H1H J;  1T3U A;  4N78 E;  2WMM A;  1X22 A;  3BVH A;  1EZV G;  3HD7 D;  1SQP E;  1DEB A;  1NGM B;  1JMB A;  1L0N J;  3S4R A;  3CXH H;  3H1J G;  1NAF A;  3KHU A;  4PV1 D;  1M1J B;  1RE4 C;  3CI9 A;  1JTH A;  1AV1 A;  2WSE J;  1RE3 A;  3PTZ A;  5B66 H;  4NPD A;  1OVV A;  1PPJ G;  4GIF A;  1M8O B;  3QH9 A;  2WTY A;  1PFI A;  1NTK E;  4U3F G;  3RL0 B;  2BEZ F;  3AE5 C;  5KLV D;  1L0L D;  2QJP B;  2WSC J;  2H89 C;  2PAJ A;  2YIU C;  2R5B A;  3H1L J;  2OGU A;  2FYN B;  2W6A A;  4UB8 E;  2I8D A;  3FWL A;  1L4A D;  3RL0 g;  1KV4 A;  1KTM A;  2OYH C;  3OAK A;  4RES B;  1XTG B;  1HTL C;  1VQN P;  1SQB G;  2PFX A;  2FBW C;  3TYY A;  1DD4 A;  1S5L X;  1VPC A;  1EDI A;  1YQ3 C;  3U59 A;  4H0L C;  4I1L A;  1DIP A;  5KAF H;  5APT A;  3TNU A;  2Y9Y A;  4D6T E;  1NU1 D;  2WSF J;  3TDK A;  1YYC A;  1H88 A;  2B87 B;  2HOD A;  4W7Z A;  3OA7 A;  1OIP A;  3O6Q A;  2KNC A;  4UB8 H;  4XA4 A;  1NTZ D;  1SFC C;  2AXC A;  1LP1 B;  1EDJ A;  3C8V A;  1J1D C;  3TK1 A;  1NTZ E;  1RF1 A;  3ITK A;  3WU2 H;  1K73 Q;  3RK2 B;  3ZDM A;  4Y99 C;  4EYY Q;  5CCG A;  4W7Y A;  1LTT C;  2C9L Y;  2YKO A;  1JCC A;  1EZV E;  3OW2 O;  3M0D A;  1W5C E;  2E74 D;  2J58 A;  3NMD A;  4XE5 B;  3S1K A;  4WVZ A;  2OTL P;  3RK3 B;  2Q1K A;  3V4W A;  3SWK A;  2OYI A;  3H1H G;  5AW7 B;  4KHX A;  2LXB A;  3HE4 A;  4H13 B;  3CME P;  2W6J H;  3OJA B;  1P84 H;  1IFI A;  2WPR A;  1LGH B;  2YNY A;  3L74 J;  1JY2 N;  1KIL A;  2K1A A;  3H1K E;  4C7R A;  2AXT H;  4RJT A;  3SWF A;  1KC8 Q;  2UWJ E;  1M90 Q;  4BXL A;  3CL3 D;  5AVS B;  3LW5 J;  5M1B A;  3GMA A;  1SQQ D;  1NTK D;  1SFC A;  2ZYA A;  1MUU A;  3L70 E;  5AW8 B;  3LIE A;  4R4L A;  1W2E A;  1LTS C;  3C1L A;  2XV5 A;  3CWB G;  4JBZ A;  1OMI A;  4L74 A;  4PV1 C;  2Q9I A;  1SQB E;  3FXD A;  4C7N A;  1HF9 A;  3H1H D;  3T97 B;  3KYQ A;  3EWK A;  1X0T A;  2OYO A;  1E79 H;  1SQQ K;  3WU2 E;  3B8E B;  1VQ9 P;  3EFF K;  2E43 A;  1L4A B;  1DH3 A;  1JO5 A;  3V4Q A;  3HE5 B;  1EXI A;  4RO0 A;  1RF0 C;  4DZO A;  1G1J A;  5AW4 B;  3VP9 A;  2E76 D;  1H0T A;  2V7Q J;  1FDO A;  5AVW B;  1CZQ A;  2WPV B;  5APW A;  5CBN A;  1G2C B;  2J5U A;  4GT1 A;  1QGK B;  3IAO A;  2L91 A;  3BCC D;  4BRY A;  3KPE A;  1KQG B;  2IX7 C;  2R32 A;  3IN6 A;  3PHL A;  3B71 A;  3L71 E;  1OZH A;  2KXP B;  1LT1 A;  2M5A A;  3KXD A;  1X8Y A;  1S1C X;  4OWF A;  1OW7 A;  1PGQ A;  1BE3 D;  2QIW A;  1VF5 C;  1UIX A;  3B4S A;  3M9B A;  3SFE C;  2O3J A;  3CC4 P;  1N86 A;  1SQV K;  5AW3 B;  2QEX P;  1NKZ B;  3L74 D;  1S9K E;  2ZYD A;  3AEF C;  1SQV G;  2IZ0 A;  2NPS D;  3CC7 P;  1YJN P;  1SQB K;  3H1L D;  4RKU J;  1FZB A;  1VQ5 P;  3MHV A;  3CCQ P;  3ABV C;  3CX5 H;  1YJW P;  4IOI H;  1Z56 A;  1RHZ B;  1P84 E;  1OVU A;  2G3A A;  2V7Q H;  2QM8 A;  3H1L G;  4H13 C;  2WT7 B;  3H25 A;  1ZOY C;  2MJZ A;  1SQV D;  1FU1 A;  1JTH B;  3GG2 A;  3L73 G;  4YPC A;  3I55 P;  3L75 E;  3MGN A;  1S2E A;  1EDK A;  3L73 D;  3L75 G;  3CPW O;  2JJL A;  2W27 A;  4I7Z C;  4EOT A;  1USD A;  1Q7Y Q;  1BE3 G;  1LT9 B;  3A5T A;  1IZN B;  1ZV8 A;  3H6P A;  4JQ0 D;  2FFD B;  5EFW B;  4WY4 D;  5E79 E;  3CCE P;  2O1K A;  1SQP G;  1KYO E;  1NU1 J;  1OXZ A;  1VF5 B;  2H8P D;  3FX0 A;  1VQL P;  1MKM A;  2LKM A;  1AJY A;  1CW5 A;  2OYH A;  3MP7 B;  1GL2 B;  1U57 A;  5GTI E;  4LLH A;  3I5C A;  1VQO P;  1VQ7 P;  4UB6 E;  2AEJ A;  3B5N C;  3CWB J;  3VMA A;  2PRR A;  1YHQ P;  1WRG A;  1GTW A;  3D71 A;  2OAR A;  1SLQ A;  3RBZ A;  3T97 A;  3CXH I;  1EC5 A;  2WZ7 A;  2E75 C;  3H32 B;  3AEB C;  1MFZ A;  2KLU A;  1BE3 J;  3L4F A;  3HE5 A;  3L72 D;  2WVR A;  1BGY G;  1FZC A;  1KB9 I;  1PV3 A;  2E76 B;  2FYZ A;  2HLO A;  1OWA A;  1NTK K;  1BGY E;  2IBZ E;  2RKL A;  3JC2 2;  2XNX A;  1LNQ A;  1SQX J;  2QJP C;  5CHX A;  1RH5 B;  4ASV A;  3CX5 I;  2QJK B;  1NTM J;  2H88 C;  4K3A A;  5KAI H;  1OW8 A;  1FS0 E;  4N3Y B;  2FXO A;  1AA0 A;  2Y0C A;  1J1E C;  1L0N D;  2HR3 A;  4HYT B;  2IFN A;  2ZVO B;  1K8A Q;  2KZI A;  2Q6Q A;  3L72 J;  2JWA A;  1N7S C;  1ZXG A;  1N73 A;  5APQ A;  3A0H H;  4PJ0 H;  1HJB A;  3VMX A;  1K05 A;  2C0W A;  1SFC D;  4Z1M H;  2P58 A;  1FJK A;  2GA1 A;  1JOC A;  1VF5 D;  1NTK G;  2Q3I A;  1KYO H;  1KMI Z;  1PP9 E;  2K9J A;  3KZI H;  4H0L B;  3E7K A;  4U3F E;  3H1J D;  1BCC J;  1JY2 P;  4N6J A;  1FAV A;  5AVR B;  5B5E E;  1IK7 A;  2A06 D;  4BWN A;  2C0X A;  3MUD C;  1RY3 A;  2W83 C;  1JY3 N;  1IFP A;  3PRJ A;  2M8R A;  3RK3 D;  3F5H A;  3H1K J;  5AW1 B;  3V2N A;  1KB9 D;  3M91 A;  2KNC B;  2YO3 A;  2RMZ A;  2WT7 A;  1FZC C;  4IFD K;  3H1I D;  1KFN A;  2ZXX A;  4CPG A;  3N7N A;  3AEA C;  3GF7 A;  1WT6 A;  1NO4 A;  3L72 G;  2M0B A;  2PP6 A;  1YTZ I;  3FGA D;  2D2C B;  1ZME C;  4HJG H;  3PLN A;  1QVG O;  4DOJ A;  3M06 A;  4AYC A;  2YMY A;  3U1A A;  2N1T D;  2QVA A;  3B5N B;  3EFG A;  2I1J A;  1N7S A;  3IF4 A;  4L73 A;  4QMA A;  1RF0 A;  4WY4 C;  1S72 P;  4OGQ C;  2WIT A;  1JY2 O;  5KLV K;  4YTP C;  1YBK A;  4XFJ A;  3CCJ P;  3Q5R A;  1N7L A;  1NTZ G;  3NTN A;  3CCS P;  2P10 A;  2N9Y B;  3H1I E;  5E79 H;  3CWB E;  4JPZ B;  1D7M A;  5AVQ B;  1KIL B;  4O9B A;  2ZVN B;  1XTC C;  3AE7 C;  2FYU D;  1BCC E;  1S5L H;  1JY3 P;  5CBO A;  1HJ0 A;  5APY A;  4DCK A;  1Q86 Q;  4D6T G;  1RE3 C;  2A45 H;  2Y9Z A;  3H32 A;  5CCH D;  2ZT9 C;  1WMK A;  3AE6 C;  1GW4 A;  4U3F D;  2Q7C A;  1Q82 Q;  3G3Z A;  3L73 J;  1KIL D;  2O01 N;  4L76 A;  1IC2 A;  2M3B A;  4W80 A;  2FFD A;  4C7N B;  3H1J J;  1FZA A;  1SQQ G;  1VDF A;  1ZRT D;  2N1T C;  5AW0 B;  4R4M A;  1AQ5 A;  1L0N G;  2I1K A;  3HD7 C;  1Y8A A;  1GU5 A;  1NTM E;  2ZFC A;  1L0N E;  1GL2 D;  1LTG C;  1L0L G;  3A2A A;  1JMM A;  5BU5 A;  3R4Y A;  1GZL A;  4M3L A;  4IFF A;  3AE3 C;  2KS1 A;  3L35 A;  2WWW A;  5AVV B;  1R5S A;  1JUN A;  1H0T B;  2DW3 A;  2KLV A;  1PPJ D;  3MUD A;  3KZI E;  1ZW0 A;  2GM4 A;  2W8Z A;  4IFM A;  3R2P A;  1HGV A;  1PPJ E;  1RQV A;  1QVF O;  1N7S D;  4ZKU A;  1BGY D;  5APS A;  3PJS K;  2RH0 A;  1N8R Q;  2IBZ D;  5KLV J;  2K9J B;  2JWD A;  2NPS C;  2WPQ A;  3GLM A;  2QE7 H;  3H1K G;  1NH4 A;  3A0B H;  3BCC G;  3G4S P;  1IFD A;  3D70 A;  3W68 A;  1SQV J;  2ITA A;  4AQR D;  3HTK B;  1JB0 J;  3CLQ A;  4H13 D;  2OYH B;  2KIK A;  1SQX D;  2B88 A;  1NAY A;  4GOF A;  2NPS B;  1MZ9 A;  3G9R A;  1CSB A;  1S5L E;  4MN4 C;  1QLE D;  3JCU E;  3SWY A;  3M0A A;  1IFN A;  1EDL A;  4H0L D;  1MFT A;  3P8C E;  3V2P A;  2OTK E;  1SFC B;  3SSU A;  2KOG A;  1T2K C;  2C9N Y;  2BCC D;  3CCR P;  1LWU C;  3L73 E;  4GOD A;  4KT0 J;  1J1E B;  4OGQ D;  1X9V A;  3P32 A;  1VQ4 P;  2BCC J;  1LT9 A;  1DEE G;  2IYP A;  2O1J A;  1Y9B A;  3BAS A;  1RF1 C;  3Q1M A;  2LR2 A;  3A7O A;  1PL5 A;  1KQS O;  3USS A;  2JR8 A;  1LJ2 A;  2R3S A;  3GHG C;  1HWT C;  2FFD C;  4HKZ H;  2QG4 A;  1HH0 A;  1E5W A;  5DJU B;  2IYO A;  2O01 H;  4GOE A;  3L74 G;  1NTM K;  4K35 A;  2FXM A;  1SQQ J;  1N73 B;  3L74 E;  1S9K D;  1Q81 Q;  4GKG A;  1GU4 A;  2H7H A;  5GTH E;  1KN7 A;  5B66 E;  1G1I A;  4OH8 B;  3GHG B;  4I2L C;  2VRS A;  1SS1 A;  2FKW B;  1QL2 A;  3AEG C;  5TJH A;  1K04 A;  2A06 E;  3RL0 D;  4BRY B;  2M3E A;  4EDF A;  2FYU K;  1KQF B;  1NTM D;  4C46 A;  4OGQ B;  1FZC B;  3O8Z A;  2M5A B;  3C9I A;  4TLF A;  1CI6 A;  1MV8 A;  2K3R A;  1M1J C;  2QSI A;  2HFE D;  3HUS C;  3W67 A;  1M1K Q;  3CMA P;  3Q5P A;  1KIL E;  2R5D A;  2R3C A;  1JCD A;  1HUC A;  1KFM A;  1NTZ J;  1PGJ A;  1UII A;  2QJY B;  2KYV A;  2YXR B;  4EIJ A;  3RBX A;  2WQY C;  1ZLL A;  1URQ A;  3B5N A;  5DJT B;  1BCC D;  3VTP C;  2FYU E;  1A02 J;  1PP9 J;  2P7J A;  2J59 M;  3RK3 C;  1EZV I;  1GMJ A;  1SQB D;  1Q90 D;  3WUU A;  1T3J A;  3CWB D;  3RGU A;  4ASW A;  4JYB A;  1W2B O;  1K9M Q;  1EXJ A;  3WMM 0;  3CD6 P;  1IK9 A;  2WSE H;  1GD2 E;  1FJP A;  3RL0 C;  1DX7 A;  2E74 B;  3L72 E;  3L70 D;  2NRG A;  3II6 A;  4UB6 H;  3IFM A;  1SQQ E;  1GK4 A;  3RK2 D;  1LWU B;  5C39 A;  2AEM A;  5CMZ A;  1SVF A;  3VMY A;  1GW3 A;  5AW6 B;  1GL2 A;  5APU A;  4ZNC A;  1PZQ A;  2K88 A;  3JCU H;  2BCC E;  2KSE A;  2FYU J;  2Z5I A;  4PD4 H;  1M7L A;  2YMK A;  4PD4 I;  1J2J B;  1NHL A;  1PP9 G;  2D2C C;  3VYI A;  2R44 A;  2HPC B;  2QJK C;  3FWN A;  4Y28 J;  4YXW H;  3P8C D;  3RK3 E;  4A7P A;  2PGD A;  2YO2 A;  2OYI C;  1EZV D;  2RN0 A;  2IPP A;  1IFM A;  2JEE A;  1U7J A;  1L0L K;  2WSF H;  2ZAE B;  2ZT9 D;  1M57 D;  3A0B E;  3F89 A;  3JSV C;  5H2F E;  5L8R J;  3V5B A;  1SQX E;  3TGU G;  1VL2 A;  2ZJS E;  1GK6 A;  3MD0 A;  1LTJ A;  1KIL C;  1NU1 K;  4TT3 H;  1AVY A;  3RK2 C;  1BSH A;  1P84 D;  2W6B A;  2YKQ A;  3U1C A;  1NU1 G;  3LW5 H;  1SQX K;  2N9B A;  1IFJ A;  1NU1 E;  1IO4 A;  4DT0 A;  5AVT B;  1KB9 H;  2SPZ A;  3UIA A;  1GL2 C;  1EQ7 A;  1QEX A;  2GUV A;  3AE8 C;  5B5E H;  4AUW A;  3V2Q A;  3Q3D A;  1YIT P;  1URQ C;  2CPS A;  2D2C D;  1AVO A;  2JP3 A;  2XU6 A;  2ZXE B;  3HD7 B;  2BAS A;  1PIX A;  2N1T B;  3B5N D;  1ZR2 A;  1SQP K;  3CC2 P;  5AVU B;  1AQT A;  3BRT B;  2A45 G;  2QA4 P;  3GW6 A;  1NVO A;  5TIS E;  1N73 C;  2QRX A;  5KLV G;  4JF7 A;  3VOP A;  1T6A A;  1L0L E;  2KZJ A;  1FDM A;  2KS1 B;  3BRV B;  1RE4 A;  1ZRT E;  3MIW A;  2E76 C;  3N4X A;  1FE6 A;  3AE4 C;  3HE4 B;  2O01 J;  3CCM P;  4ZMD A;  5KJ7 C;  3L75 J;  1BSN A;  5CCG D;  1KYO I;  2OYI B;  1AFO A;  1VQM P;  2FY8 A;  4Y99 B;  2CK3 H;  2AEF A;  2E42 A;  1SQP J;  5AW2 B;  3HUS B;  1JNM A;  1N7S B;  3CCU P;  3HTK A;  2KUB A;  1URQ D;  3H1H E;  4OVN F;  3BAT A;  3SFD C;  1NJI Q;  2FYU G;  1N2D C;  1KD1 Q;  3AE9 C;  3WUV A;  1H89 A;  2IZ1 A;  3M0D C;  5AW5 B;  4WWI A;  3Q2Y A;  3KQG A;  5AVX B;  2IDB A;  3CXH E;  2AXT E;  1SQV E;  2Q5U A;  1BDD A;  1FZG A;  4LC1 A;  3IR9 A;  5BVZ A;  1VQP P;  1LTJ C;  2P1J A;  1USE A;  1YQ4 C;  4WB4 A;  2Q3E A;  3S9O A;  1BDC A;  5CJ4 A;  5K5G B;  4KJM A;  1M1J A;  1SQB J;  1CI6 B;  3K5B A;  1FZF A;  2IBZ G;  2L5G B;  1R5L A;  3CX5 E;  3O6Q B;  4IL6 X;  1IJD B;  2K37 A;  3MZW B;  3TGU J;  2Y0D A;  1FBM A;  5CCH A;  3FXE A;  1LTJ B;  1KB9 E;  2IBZ I;  2KK7 A;  3H1I G;  3L70 J;  2QM7 A;  4I6M C;  1KZU B;  1NKN A;  1J1D B;  3L71 D;  5GTH H;  4HH2 A;  2P2U A;  2E5Y A;  3H1J E;  1NYH A;  3MTU E;  4YXD C;  1URQ B;  2OQQ A;  1PP9 D;  2Y0E A;  4JYC A;  3AE1 C;  3V6I A;  5KAF E;  2CPB A;  2XDJ A;  2POH A;  4IL6 E;  4WY4 A;  5AW9 B;  4H44 C;  1OVR A;  3TF5 A;  3L36 A;  2YXQ B;  3HD7 A;  2B9B A;  2IFM A;  2MKV A;  2WSC H;  3AEC C;  2K9Y A;  5KJ7 A;  1S3J A;  1YIJ P;  1BCC G;  2V4H A;  1Y47 A;  5AVZ B;  2E75 D;  1LWU A;  3L71 G;  4L75 A;  2JKV A;  2KI7 B;  3VN0 A;  4PD4 D;  5GTI H;  1LTA C;  3H1I J;  3L70 G;  3NFQ A;  1NTZ K;  2B87 A;  2HOD B;  2JO1 A;  1ZR4 A;  1X79 B;  3VP8 A;  1QX8 A;  2E75 B;  3WUT A;  3AEE C;  2XZR A;  2OTJ P;  1LP1 A;  1TU3 F;  3P7K A;  2P67 A;  1ZN5 A;  2NPS A;  3QWO C;  1GDT A;  5KKZ B;  5APV A;  1SQX G;  3TGU E;  1PGP A;  2NZ2 A;  2WSS H;  5TIS H;  2XND H;  1BGY J;  3E1R A;  5KJ7 D;  5CCG C;  3G6E P;  2HPC A;  1L2P A;  4ZKP A;  3G71 P;  1NTM G;  2Z5H A;  4H44 B;  4U7J A;  1FZE A;  1H8A A;  3AED C;  1L4A A;  3V2R A;  2YKP A;  1T8Z A;  3H1K D;  3P8M C;  3KDP B;  3D6Y A;  3TGU D;  2HYN A; 
#chains in the Genus database with same CATH homology
 5KTB A;  5AVY B;  3HRN A;  4B86 A;  1G2C A;  4LGD E;  1LTI C;  3NXS A;  2XKM A;  4N78 D;  2WPS A;  1HBW A;  2KP8 A;  3EQ2 A;  1SP4 A;  1A02 F;  3GHG A;  1L0N K;  2E42 A;  1NWQ A;  1JY3 O;  2Z4E A;  3TNU B;  3E1I A;  3VMZ A;  1T2K D;  3M9H A;  4WY4 B;  1QL1 A;  3PP5 A;  5CJ0 A;  1FOS F;  1YTZ T;  1KQL A;  3LID A;  3L37 A;  2KB7 P;  1NOH A;  1FOS E;  1HVV A;  5APX A;  1LT9 C;  4WBA A;  5CCH C;  2KSJ A;  3HUS A;  2A45 I;  1HGZ A;  2H43 A;  3A3Y B;  2HG5 D;  3TSI A;  5BU8 B;  1L4A C;  3M9Q A;  2GUS A;  1LTB C;  2N1T A;  4N78 E;  1T3U A;  3BVH A;  3HD7 D;  1DEB A;  1NAF A;  1FDM A;  1M1J B;  1RE4 C;  3CI9 A;  1JTH A;  1RE3 A;  4GIF A;  2WTY A;  1PFI A;  3RL0 B;  2PAJ A;  2R5B A;  2W6A A;  1L4A D;  2OYH C;  3OAK A;  4RES B;  1XTG B;  1HTL C;  3TYY A;  1VPC A;  3U59 A;  4I1L A;  5APT A;  3TNU A;  1YYC A;  1H88 A;  2HOD A;  4W7Z A;  4XA4 A;  3OA7 A;  1FZC C;  1SFC C;  1J1D C;  3TK1 A;  1RF1 A;  3RK2 B;  2C9L Y;  4Y99 C;  5CCG A;  4W7Y A;  1LTT C;  2YKO A;  1JCC A;  3M0D A;  3NMD A;  4XE5 B;  2J58 A;  3RK3 B;  3V4W A;  2OYI A;  5AW7 B;  4KHX A;  3HE4 A;  3OJA B;  1IFI A;  2WPR A;  1LGH B;  2YNY A;  1JY2 N;  1KIL A;  4C7R A;  3SWF A;  3CL3 D;  5AVS B;  1SFC A;  1MUU A;  5AW8 B;  3LIE A;  1W2E A;  1LTS C;  2XV5 A;  2Q9I A;  4C7N A;  3KYQ A;  1SQQ K;  3B8E B;  2E43 A;  1L4A B;  1DH3 A;  1JO5 A;  3V4Q A;  3HE5 B;  1RF0 C;  4DZO A;  1G1J A;  5AW4 B;  3VP9 A;  5AVW B;  1CZQ A;  5APW A;  1G2C B;  4GT1 A;  3KPE A;  2IX7 C;  2R32 A;  1X8Y A;  3M9B A;  1N86 A;  1SQV K;  5AW3 B;  1NKZ B;  1S9K E;  2NPS D;  1SQB K;  1FZB A;  1Z56 A;  2WT7 B;  2QM8 A;  2MJZ A;  2OYI B;  1FU1 A;  1JTH B;  3MGN A;  4EOT A;  2JJL A;  2W27 A;  1LT9 B;  3A5T A;  3H6P A;  1ZV8 A;  4WY4 D;  2O1K A;  1OXZ A;  2H8P D;  2LKM A;  2OYH A;  1GL2 B;  4LLH A;  3I5C A;  3B5N C;  1GTW A;  1WRG A;  2OAR A;  1SLQ A;  3T97 A;  2WZ7 A;  3H32 B;  1MFZ A;  3L4F A;  1FZC A;  3HE5 A;  2FYZ A;  2HLO A;  1OWA A;  1NTK K;  2XNX A;  5CHX A;  4N3Y B;  1J1E C;  4HYT B;  2IFN A;  1N7S C;  1N73 A;  5APQ A;  1HJB A;  3VMX A;  2C0W A;  1SFC D;  1FJK A;  1JOC A;  2Q3I A;  1JY2 P;  4N6J A;  1FAV A;  5AVR B;  2C0X A;  1RY3 A;  1JY3 N;  3RK3 D;  2M8R A;  3V2N A;  5AW1 B;  2WT7 A;  4IFD K;  3M91 A;  2YO3 A;  1KFN A;  3N7N A;  1WT6 A;  1NO4 A;  2PP6 A;  1YTZ I;  4DOJ A;  3M06 A;  4AYC A;  2YMY A;  3U1A A;  2N1T D;  3B5N B;  3EFG A;  2I1J A;  1N7S A;  4WY4 C;  1RF0 A;  2WIT A;  1JY2 O;  5KLV K;  1N7L A;  3NTN A;  5AVQ B;  1KIL B;  4O9B A;  1XTC C;  1JY3 P;  5APY A;  1RE3 C;  2A45 H;  3H32 A;  5CCH D;  1GW4 A;  2Q7C A;  3G3Z A;  1KIL D;  1IC2 A;  2M3B A;  4W80 A;  2FFD A;  4C7N B;  1FZA A;  1VDF A;  5AW0 B;  1AQ5 A;  2N1T C;  2I1K A;  3HD7 C;  1GU5 A;  2ZFC A;  1GL2 D;  1LTG C;  3A2A A;  1JMM A;  5BU5 A;  1GZL A;  4M3L A;  4IFF A;  5AVV B;  3L35 A;  2WWW A;  1JUN A;  2KLV A;  3MUD A;  2GM4 A;  4IFM A;  3R2P A;  1HGV A;  1N7S D;  4ZKU A;  5APS A;  2NPS C;  2WPQ A;  1NH4 A;  1IFD A;  4AQR D;  3HTK B;  3CLQ A;  2OYH B;  2NPS B;  1MZ9 A;  1CSB A;  3SWY A;  3M0A A;  1IFN A;  3P8C E;  3V2P A;  1SFC B;  2KOG A;  1T2K C;  2C9N Y;  1LWU C;  1J1E B;  1X9V A;  3P32 A;  1LT9 A;  2O1J A;  3BAS A;  1RF1 C;  3A7O A;  1HWT C;  3GHG C;  2FFD C;  1HH0 A;  1E5W A;  2O01 H;  1NTM K;  2FXM A;  1N73 B;  1S9K D;  4GKG A;  1GU4 A;  2H7H A;  1G1I A;  4OH8 B;  3GHG B;  4I2L C;  2VRS A;  2FKW B;  1QL2 A;  3RL0 D;  2FYU K;  4C46 A;  1FZC B;  3O8Z A;  3C9I A;  1CI6 A;  1MV8 A;  1M1J C;  2HFE D;  3HUS C;  2R5D A;  2R3C A;  1JCD A;  1HUC A;  1KFM A;  2KYV A;  4EIJ A;  1ZLL A;  1URQ A;  3B5N A;  3VTP C;  1A02 J;  2P7J A;  2J59 M;  3RK3 C;  1T3J A;  4JYB A;  3WMM 0;  1IK9 A;  2WSE H;  1GD2 E;  1FJP A;  3RL0 C;  1DX7 A;  3II6 A;  3IFM A;  1GK4 A;  3RK2 D;  1LWU B;  5CMZ A;  1SVF A;  3VMY A;  1GW3 A;  5AW6 B;  1GL2 A;  5APU A;  2Z5I A;  1M7L A;  1J2J B;  1NHL A;  3VYI A;  2HPC B;  3P8C D;  2YO2 A;  2OYI C;  2IPP A;  1IFM A;  2JEE A;  1L0L K;  2WSF H;  3V5B A;  4AUW A;  1CW5 A;  1GK6 A;  3MD0 A;  1LTJ A;  1KIL C;  1NU1 K;  3RK2 C;  2W6B A;  2YKQ A;  3U1C A;  3LW5 H;  1SQX K;  2N9B A;  1IFJ A;  1IO4 A;  5AVT B;  3UIA A;  1GL2 C;  1EQ7 A;  2GUV A;  3V2Q A;  1URQ C;  2CPS A;  2XU6 A;  2ZXE B;  3HD7 B;  2BAS A;  2N1T B;  3B5N D;  1ZR2 A;  1SQP K;  5AVU B;  3BRT B;  2A45 G;  1N73 C;  4JF7 A;  3VOP A;  3MIW A;  3BRV B;  1RE4 A;  3N4X A;  3HE4 B;  5KJ7 C;  5CCG D;  1AFO A;  4Y99 B;  5AW2 B;  3HUS B;  1JNM A;  1N7S B;  3HTK A;  1URQ D;  3BAT A;  1N2D C;  1H89 A;  3M0D C;  5AW5 B;  3KQG A;  5AVX B;  2Q5U A;  1FZG A;  4LC1 A;  3IR9 A;  5BVZ A;  1LTJ C;  2P1J A;  4WB4 A;  5CJ4 A;  1M1J A;  1CI6 B;  1FZF A;  2L5G B;  1IJD B;  5CCH A;  1FBM A;  2FFD B;  1RF1 B;  1LTJ B;  4I6M C;  2QM7 A;  1KZU B;  1NKN A;  1J1D B;  4HH2 A;  2P2U A;  3MTU E;  1URQ B;  4JYC A;  2CPB A;  2XDJ A;  2POH A;  5AW9 B;  4WY4 A;  3L36 A;  3HD7 A;  2IFM A;  2WSC H;  5KJ7 A;  5AVZ B;  1LWU A;  3VN0 A;  1LTA C;  3NFQ A;  1NTZ K;  2HOD B;  1ZR4 A;  1X79 B;  3VP8 A;  2XZR A;  3P7K A;  2P67 A;  1ZN5 A;  2NPS A;  1GDT A;  5APV A;  5KJ7 D;  2HPC A;  5CCG C;  4ZKP A;  2Z5H A;  1FZE A;  1H8A A;  3V2R A;  1L4A A;  2YKP A;  1T8Z A;  3P8M C;  3KDP B;  2HYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...