3BVHA

Crystal structure of recombinant gammad364a fibrinogen fragment d with the peptide ligand gly-pro-arg-pro-amide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
KVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrinogen alpha chain
publication title Polymerization-defective fibrinogen variant gammaD364A binds knob "A" peptide mimic.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 23
structure length 62
sequence length 62
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3bvhA00
1LWUA 1LWUC 3HUSA 1N86A 1LT9B 2HODA 3HUSC 1M1JA 2A45I 2OYHA 1RE3A 2OYHC 3H32A 1M1JC 1RE3C 1FZBA 1JY3N 2FFDB 1N73C 1JY2N 1LT9C 1LT9A 1JY3P 1RE4A 2Q9IA 2HPCB 1JY2P 1RE4C 1T3UA 1RF1B 2OYIB 1FZFA 3BVHA 1FZEA 2FFDA 2Z4EA 3GHGB 2FFDC 1LTJB 2H43A 2HPCA 1N73B 1RF1A 2HLOA 2OYIA 1RF1C 1FZCB 2OYIC 3E1IA 1JY3O 2A45H 1LTJA 1FZGA 1LWUB 1LTJC 1JY2O 3GHGA 1N73A 2A45G 2HODB 2XNXA 3GHGC 3HUSB 1FZCA 2OYHB 1FZAA 3H32B 1FZCC 1M1JB 1W2EA 1RF0C 1RF0A
chains in the Genus database with same CATH superfamily
1BE3J 2E74D 5APTA 2GA1A 1NU1D 5AW4B 1IFMA 3VP9A 1RF1B 2ZYGA 1PFIA 3U1CA 2Z4EA 1FZCB 1HTLC 2IBZD 3LW5J 1BCCD 4D6TJ 1L0ND 1KQGB 1Q2NA 1KYOD 1SQQD 2UWJE 3E1RA 1FC2C 5CJ4A 2H43A 3SSUA 3EWKA 1NTMG 4H13B 2LR2A 4UB6E 1HWTC 4U3FJ 2D2CB 3C9IA 1FDMA 3WUVA 2M8RA 1R8EA 1LT1A 1M1JC 2V7QH 2Q7CA 2QJPB 4H44D 1SLQA 3GLMA 4I7ZB 1GZLA 3RK3B 4DOJA 1UIXA 5APVA 1S72P 4GOEA 1L0LJ 2KNCB 1YHQP 1KB9D 2K1AA 3LIDA 4GT1A 3C1LA 5KLVD 1KZUB 3NTNA 1FDOA 1NAFA 3RK3E 1NTMJ 3H1JD 3O6QB 3CCLP 1HJ0A 5GTHE 2OYIC 1VL2A 2K3RA 2NPSD 3WUTA 5CCHD 3RL0C 5KTBA 1LT9A 3L75D 1NKNA 2XZRA 3L70E 2QA4P 3HE5B 3Q5SA 3CC4P 1LGHB 1N73A 3H6PA 2O1JA 1M1JB 3L73D 3RK2D 3FXDA 2HYNA 2Q5UA 2YKPA 3H25A 3L72D 3V2RA 1URQC 3CX5D 5KLVE 1Q81Q 2ZAEB 2E75C 2K9JB 1KQFB 1JMBA 2QIWA 5H2FE 3QWOC 3I55P 3KDPB 4HH2A 1FZGA 5AW9B 1GL2C 1SQPJ 4I6MC 1FDIA 2P67A 4LC1A 1RE4A 3MTUE 1SFCC 2O3JA 3P8CD 2OYIB 3FXEA 4C7NA 2KOGA 3T97A 3BCCD 3WU2H 2E75D 3RL0B 3CWBJ 3MUDA 5KLIC 2NPSA 1PGQA 5CCHA 1Y47A 1HGZA 3IN6A 3AE5C 1SQVJ 2JWAA 3OW2O 1DIPA 3AE1C 1H0TA 1H89A 1URQB 3M0AA 1S4XA 4PJ0E 1NTMK 2W6AA 2Z5IA 1KV4A 1GL2B 2H8PD 4UB8E 3H1LG 1DX7A 3H1IE 3A7OA 3R4YA 3TGUJ 3GG2A 1BSHA 4UB6H 1SFCB 4WB4A 1G2CB 4L75A 1VQLP 1D7MA 3KXDA 1SS1A 1L4AD 3Q1MA 3B5NC 3KPEA 1MUUA 5KLIB 1QX8A 1Q7YQ 1JB0J 1S9KE 4CPGA 1LTBC 5AVYB 2N9BA 3P7KA 3G71P 3H1LJ 2JP3A 3L71D 1NO4A 5AVVB 3P32A 3KQGA 2W6BA 5GTHH 3S9OA 3D70A 1PPJD 5KJ7D 3L70G 3AEAC 4BRYA 2Q9IA 1T3UA 1CZQA 1OVUA 4DJGA 4NPDA 3M9QA 1LP1A 4KJMA 1IO4A 3V5BA 1RE3C 3F89A 3SWFA 1OMIA 3AEEC 2BEQD 1K73Q 4RJTA 1G1JA 1VQPP 1IFJA 4GIFA 2B88A 3RBXA 3B5NB 4WY4D 2POHA 1NTKJ 1NHLA 1BE3E 3PLNA 5AVXB 1L4AA 1VQNP 1FJKA 2BCCG 1AFOA 1OZHA 3TSIA 2R44A 2V4HA 4D6TE 2KP8A 2OQQA 1KMIZ 2LXCB 1LWUA 1RQVA 1NTMD 5B5EE 2ZVOB 1ZN5A 2YMYA 2Y9ZA 1OW6A 5KJ7A 2IDBA 4L73A 3CMEP 4ZMDA 5AVUB 4U3FE 2WPSA 1S1CX 2RN0A 3M0DA 3GF7A 1YQ4C 2PGDA 2BCCJ 3NMDA 2YXQB 1VF5C 1ZRTD 3U59A 1GDTA 3F5HA 5AW2B 5TJHA 1NTZJ 3H1IG 2YKQA 1FZFA 5DJUB 1L0LE 3Q5PA 3HE4A 2Y9YA 1IC2A 1XTGB 3GHGA 2OYHB 4EYYQ 4WY4A 4UB8H 1NTME 2P7JA 2AEJA 2W83C 1KILD 2O1KA 2IFNA 3GMAA 1AJYA 1W5CE 1Q82Q 3M91A 1LTJC 1AV1A 1YTZI 2LXBA 2KIKA 5AVQB 1KQSO 1FE6A 1M1KQ 3AE7C 2FYZA 3W68A 3BVHA 2FFDA 2FY8A 3S4RA 1VF5B 3FX0A 2O01J 3HUSA 1HJBA 2KLVA 4N3YB 1LTAC 5APUA 2HFED 2WPVB 1S5LE 1NH4A 2WVRA 2HPCB 5KLVK 2YNYA 4IL6X 2KB7P 2WT7A 4GDOA 4Z1MH 1NAYA 2KS1B 1JY2O 1SQPE 1YYCA 2Y0DA 2A45I 1QL1A 4NPFX 1BE3G 1AVOA 5K5GB 1LTJB 2HLOA 1KILA 4YXDC 3AE8C 2N1TD 2WWWA 3CWBE 3V2NA 4NPEA 5CCGD 5DJTB 4D6TG 1USDA 4HKZH 2OGUA 4GODA 1MKMA 1SQVE 2YIUC 3D6ZA 2B87A 2RH0A 3RBZA 1DH3A 4U7JA 4WVZA 1J1EC 5GTIE 2M3BA 4U3FG 3H1LD 3L74J 2IYOA 2KI7B 1LT9C 5B5EH 2RMZA 1YI2P 4H13D 2M0BA 5AW8B 1MZ9A 2D2CD 3TGUE 1N73C 2YMKA 1L0LG 3RL0g 1FZBA 1IFNA 2PAJA 3RK3D 3JC22 2C9NY 5C39A 3TDKA 1JM0A 1LJ2A 2WSFJ 1DD4A 1KQLA 1ZR4A 4WBAA 4OGQC 2N1TA 5KAIE 4HJGH 5AVZB 3H1LE 1QGKB 3K5BA 5CCGA 4JYBA 2YIUB 3L70D 5APYA 1RF1A 2O01N 1J1EB 2A45G 1FZCA 1X79B 2KZJA 1U7JA 3Q5RA 1RF0A 1ZV8A 1LT9B 2R3SA 3MUDC 1YTZT 3H1HJ 1K9MQ 1KC8Q 3II6A 2W90A 1LTSC 2IZ0A 1DEEG 1N73B 1SQXJ 4N78D 3MGNA 2P10A 3OAKA 4ZKPA 2KK7A 2R5DA 2WMMA 1SQPG 5TISE 1M7LA 2E42A 2QM8A 3A0BE 2BCCD 1NTKE 1S5LH 1MFZA 3AEFC 3CLQA 3HD7C 1VDFA 3M06A 2M5AA 4OGQB 4DT0A 3PH0A 1U7MA 2KNCA 1NJIQ 1GU5A 3CWBG 1BGYJ 1K05A 4C7NB 4RKUJ 1SVFA 3AE2C 2WZ7A 3VMYA 2FXPA 2G3AA 1UIIA 2WITA 4N78E 3RL0D 1R5LA 1KYOI 1OIPA 1SQVG 2NPSB 5M1BA 3H32A 2SPZA 2KLUA 3EQ2A 3P8MC 2ZT9C 1PP9J 1YJWP 4C7RA 2BCCE 3CCUP 3H1ID 1URQD 4XA4A 1ZXGA 4HB1A 3PHLA 1M1JA 1OW7A 1J1DC 4YPCA 1JNMA 3TGUG 1JY2P 2QJYC 1GL2D 4EIJA 3HD7B 2K9JA 1VQKP 3TNUB 2DW3A 1L0LK 1KB9I 2ZFCA 1S9KD 2FYUJ 2ZXXA 1SFCD 3ITKA 2FYNC 1ZLLA 4PD4E 1CI6B 3SWYA 3AE3C 3L37A 1N7SC 2C9LY 1ZMEC 2OYIA 1X22A 1JY3O 2QE7H 2JO1A 1EXIA 2ZXEB 3C8VA 5L8RJ 1X8YA 1N86A 2AXTE 2ZT9B 2Q6QA 3V2PA 2J58A 1LTGC 2W6JH 5KAIH 4GOFA 2A06E 2E76C 3L4FA 1NU1G 5CHXA 4I2LC 1J1DB 4PD4I 3VMAA 1T2KC 4JYCA 4BRYB 2IPPA 2QJYB 1NYHA 1JY3N 2YO2A 2R3CA 1SQBJ 3BASA 3CCSP 3CPWO 1BE3D 4ZNCA 1GL2A 2FYNB 1SQPK 1HGVA 1NTKG 4LGDE 1N7SB 1ZOYC 1DEBA 1SFCA 3B5ND 1NGMB 4D6TD 1NU1J 4H0LC 1T2KD 4AQRD 3AEBC 5TISH 2Q1KA 1VQOP 4M3LA 3PP5A 2KXPB 3A0BH 3PJSK 3AE9C 5CBNA 2B9BA 1BCCJ 4MN4C 1L0NJ 3B8EB 3EFGA 1QL2A 2P2UA 2XV5A 2KYVA 2E76B 4U3FD 1SQQJ 2KZIA 1SQVK 4PV1C 4TLFA 4JPZB 2YO3A 5AW6B 5H2FH 3L74E 1OVVA 5EFWB 2OYHC 3A0HE 1HBWA 2JEEA 1MFTA 5KKZC 1L0LD 1GW3A 1BSNA 1NTZG 2WQYC 1KN7A 1SP4A 2AEFA 3G9RA 3CXHE 1H8AA 1ZP0C 2QRXA 4R4MA 3D6YA 4H0LB 4KHXA 5B66E 4XE5B 1A02J 2I8DA 3CMAP 3GHGB 1VQ5P 4OVNF 1VQ9P 3H1JJ 3BRTB 1J2JB 2NZ2A 1E79H 1S3JA 3HTKA 3S1KA 4EDFA 3VTPC 3JSVC 3OJAB 2QEXP 5BVZA 1JCDA 4PV1B 2AEMA 3MP7B 4PD4H 1OW8A 3L75J 4PJ0H 3CXHI 2IX7C 1FOSF 4HYTB 1Y9BA 3H1HE 2I1JA 2FXOA 5KKZB 2A06G 1IFIA 1EDLA 3L73J 1G1IA 1T8ZA 2GM4A 1SQXE 3M9HA 3L72J 2AXTH 1PL5A 1R5SA 1VF5D 3R2PA 1DD3A 1SQPD 3VYIA 3N7NA 1EQ7A 1MV8A 2FXMA 1VQ7P 1RE3A 3VN0A 2O01H 2WSEJ 3RGUA 2WT7B 2M3EA 3CC2P 1FBMA 4XFJA 2IFMA 1VQMP 5KAFE 1EXJA 1PZQA 1NTKK 3CWBD 4QMAA 1N8RQ 3UIAA 2L5GB 1AQTA 4W80A 5CBOA 1JCCA 3KZIE 3BCCJ 4IFDK 2CK3H 1BGYE 4W7ZA 4EI2A 2WSSH 1SQVD 1OXZA 1FOSE 1QEXA 3NFQA 1E5WA 1JMMA 3KHUA 5AW1B 1EZVE 2WSCH 5APWA 4ASVA 3SFEC 4W7YA 1PP9E 2AXCA 1VPCA 3GW6A 1HH0A 3L74G 3TGUD 2LKMA 1WRGA 3IR9A 1IFDA 1RF0C 3BATA 1PIXA 5AW5B 3GF3A 2HODA 1JO5A 1NTZK 1JTHA 1HVVA 1P84E 5CMZA 2E74C 1N2DC 2HPCA 3A0HH 4DZOA 4LLHA 3IF4A 1RY3A 2FYUE 2H89C 1EZVI 3LW5H 3WMM0 3KYQA 3JCUE 2KS1A 3CI9A 1QLED 2R32A 4ASWA 3H1KG 3CXHH 2OTKE 1FJPA 2YKOA 1EDIA 1Q90D 1LTJA 5B66H 3AECC 1CSBA 3L71J 3G4SP 1M57D 2WSFH 3O8ZA 2BEZF 1P84I 2I1KA 3Q3DA 2KSJA 4B86A 3Q2YA 1ZR2A 1M56D 2WPRA 1YBKA 2L91A 4IFMA 1ZW0A 3H1HG 3AE6C 1QVFO 4H44C 3U1AA 1OX3A 3V4WA 1SQXG 3BRVB 1Y8AA 2PP6A 2K9YA 3MIWA 3H1KJ 4K3AA 3AEDC 4DCKA 4IL6E 2E74B 3A2AA 1SQBE 1RE4C 2P1JA 1NTKD 1CW5A 2E5YA 3D71A 4AUWA 3TF5A 2N9YB 2PRRA 1FZAA 2W27A 2FKWB 1FS0E 3QH9A 1X0TA 1AVYA 5BU5A 1A02F 3CCQP 1NU1E 2NPSC 2K37A 3CCMP 5CCHC 2JR8A 2M5AB 2R5BA 1BGYG 2ZYAA 2A45H 4OGQD 2IBZE 1BCCE 5KAFH 1L0NE 1BDDA 2V7QJ 4JBZA 4JQ0D 1KYOE 2C0XA 2Y0EA 1SQQE 4I1LA 3RK2C 5AW3B 1N7LA 3KZIH 1YIJP 1S2EA 4H44B 1QVGO 1EZVG 3IAOA 2J5UA 4EOTA 2QVAA 4OH8B 1PP9G 3H32B 5BU8B 1IK7A 1NTZD 2XDJA 2IYPA 1KTMA 3PTZA 3T97B 2IBZI 1RHZB 3B4SA 3CC7P 3V6IA 5AW7B 4TT3H 3CCVP 3O6QA 1K04A 4K35A 1KB9E 1PGOA 4PD4D 1USEA 3HRNA 1PGPA 2FYUG 1TU3F 3HD7D 4IOIH 4JF7A 3ABVC 2ZVNB 3H1JE 4Y28J 2IZ1A 5E79E 1H0TB 1P84H 3HE5A 1T6AA 1AA0A 2ITAA 3CCEP 2KSEA 3RK2B 3E7KA 1NOHA 1NTZE 1IZNB 3VMZA 3I5CA 3JCUH 3L75E 5GTIH 2WPQA 2BASA 1OVRA 2A06D 2FBWC 4O9BA 1KORA 3V2QA 3L73E 2ZT9D 2Q3EA 3MZWB 2PFXA 4IFFA 3IFMA 3L72E 3A5TA 3CX5E 1JOCA 2HR3A 1SQXK 4C46A 2MJZA 2OARA 2OTJP 1SQBG 3CL3D 2ZYDA 5APQA 2E75B 1L4AC 1VQ8P 2JJLA 3B71A 1NWQA 2ZJSE 3P8CE 2XU6A 2GUSA 4IL6H 3E1IA 3HD7A 3TNUA 3BCCE 2Q3IA 1LWUC 1N7SD 4L74A 4GKGA 3CX5I 1URQA 2IBZG 1LNQA 1BCCG 1CI6A 5KJ7C 1L0NG 2HG5D 2NRGA 1LP1B 3ZDMA 1WT6A 2JDIH 1SQQG 1GK6A 3NXSA 3M0DC 3L74D 3VMXA 3V4QA 1JEKA 1GD2E 1OFCX 1KFNA 2Y0CA 2E76D 4WWIA 4N6JA 1KYOH 3WUUA 3AE4C 1G2CA 1M90Q 1X9VA 3GHGC 1L4AB 3CXHD 1PV3A 1NKZB 4WY4C 1YITP 5APXA 1IJDB 3AEGC 3H1KD 5KLVG 1LWUB 1U57A 2FYUK 2G8YA 2QJKC 5AVTB 1YJNP 3H1JG 4H0LD 5AVSB 1N7SA 2YXRB 1KB9H 1W2BO 2FFDC 2QSIA 2VRSA 3L71E 4RESB 3HTKB 3L70J 4L76A 2XNXA 5AVRB 3H1HD 3M9BA 3L75G 1IK9A 5AW0B 2WTYA 1JUNA 1Q86Q 5E79H 3HUSC 2XKMA 1PPJE 2CPBA 2E5TA 1SQXD 4PV1D 3VOPA 3HE4B 4AYCA 1WMKA 3L73G 2H88C 5KLVJ 2JKVA 1S5LX 3I56P 3L72G 3B5NA 1IFPA 4WY4B 3H1KE 3EFFK 1H88A 1OWAA 5APSA 4KT0J 2OTLP 3TYYA 2K88A 4BXLA 1SQBK 3FWLA 2W8ZA 2QJKB 1KILC 3CX5H 1FU1A 1FAVA 1BGYD 4Y99C 1EDKA 2FFDB 2OYOA 1M8OB 3W67A 3BCCG 2CPSA 1NU1K 3N4XA 2WSEH 4R4LA 1GMJA 3HUSB 1GTWA 1EZVD 3G3ZA 2Z5HA 1NVOA 1VQ6P 1L0NK 3SFDC 3CCRP 3A3YB 2KUBA 1PP9D 3L36A 2QG4A 2RKLA 1SQQK 1FZEA 1GU4A 4YTPC 2P58A 2J59M 2QM7A 3L35A 2JWDA 1RQUA 3SWKA 3VP8A 2OYHA 3H1IJ 2XNDH 1ZRTE 3PRJA 1K8AQ 1JY3P 1P84D 2B89A 3MD0A 1KILB 1KD1Q 2FYUD 3LIEA 1HUCA 5CJ0A 2HODB 1GW4A 1W2EA 4Y99B 2GUVA 3TK1A 1VQ4P 1JTHB 1T3JA 2N1TC 3G6EP 1HF9A 2H7HA 4BWNA 5CCGC 2MKVA 1GK4A 1BDCA 1KILE 2B87B 1RF1C 1YQ3C 4RO0A 3OA7A 1EDJA 4ZKUA 1XTCC 1FZCC 1LTIC 1LTTC 3FGAD 3L71G 1EC5A 2E43A 1Z56A 3USSA 1PPJG 5AVWB 1KFMA 4A7PA 2C0WA 1AQ5A 2WSCJ 4H13C 2D2CC 1YJ9P 1SQBD 1PGJA 3MHVA 3CCJP 1L2PA 1JY2N 4OWFA 3WU2E 4YXWH 2QJPC 3CD6P 4I7ZC 3RK3C 1RH5B 3FWNA 2N1TB
chains in the Genus database with same CATH topology
1SQPK 4WY4A 1HGVA 4LGDE 5APTA 1N7SB 3HRNA 5AW4B 2P7JA 1DEBA 1IFMA 1SFCA 1KILD 3VP9A 1RF1B 3B5ND 2O1KA 3HD7D 1PFIA 2IFNA 3U1CA 2Z4EA 1T2KD 4JF7A 4AQRD 1FZCB 1HTLC 3M91A 1LTJC 1YTZI 4M3LA 3PP5A 5AVQB 3HE5A 3RK2B 1NOHA 3B8EB 3VMZA 2FYZA 3I5CA 3EFGA 1QL2A 2P2UA 2XV5A 2KYVA 5CJ4A 3BVHA 2WPQA 2FFDA 2BASA 2H43A 1SQVK 4O9BA 1HWTC 3C9IA 2YO3A 5AW6B 1FDMA 3V2QA 3HUSA 2M8RA 1HJBA 2KLVA 4N3YB 2OYHC 1M1JC 1LTAC 4IFFA 1HBWA 5APUA 2JEEA 2HFED 3IFMA 2Q7CA 3A5TA 1NH4A 2HPCB 1SLQA 1JOCA 1GZLA 3RK3B 5KLVK 1GW3A 4DOJA 2YNYA 1SQXK 5APVA 2KB7P 2WT7A 4C46A 2MJZA 1SP4A 2OARA 1JY2O 3CL3D 1YYCA 3LIDA 5APQA 1H8AA 1L4AC 4GT1A 2A45I 1KZUB 2JJLA 3NTNA 4KHXA 1NAFA 1QL1A 4XE5B 1A02J 1NWQA 3P8CE 2XU6A 3GHGB 1LTJB 2GUSA 2HLOA 2OYIC 1KILA 3E1IA 3HD7A 2N1TD 2WWWA 3TNUA 3BRTB 1J2JB 3V2NA 2Q3IA 2NPSD 1LWUC 1N7SD 3HTKA 5CCGD 3VTPC 4GKGA 5CCHD 3RL0C 3OJAB 1URQA 5KTBA 1LT9A 5BVZA 1CI6A 5KJ7C 1NKNA 1JCDA 2HG5D 2XZRA 1WT6A 3HE5B 1LGHB 2IX7C 1GK6A 1N73A 1FOSF 3H6PA 2O1JA 3NXSA 3M0DC 1DH3A 3VMXA 1M1JB 1J1EC 4HYTB 3RK2D 3V4QA 2HYNA 2Q5UA 2YKPA 2M3BA 2I1JA 1GD2E 3V2RA 1IFIA 1KFNA 1URQC 1G1IA 1T8ZA 1LT9C 2GM4A 4N6JA 3M9HA 1G2CA 3R2PA 5AW8B 1MZ9A 3KDPB 4HH2A 1FZGA 1N73C 1X9VA 3VYIA 5AW9B 3GHGC 1L4AB 1GL2C 3N7NA 1EQ7A 1MV8A 2FXMA 1NKZB 4WY4C 1RE3A 3VN0A 2O01H 1FZBA 4I6MC 1IFNA 2PAJA 2P67A 4LC1A 3RK3D 1RE4A 3MTUE 1SFCC 3P8CD 5APXA 2WT7B 2C9NY 1IJDB 1FBMA 2OYIB 2IFMA 4C7NA 2KOGA 3T97A 1NTKK 1LWUB 3UIAA 2L5GB 2FYUK 4W80A 1KQLA 3RL0B 1JCCA 5AVTB 1ZR4A 4WBAA 2N1TA 3MUDA 4IFDK 5AVSB 4W7ZA 5AVZB 2NPSA 1N7SA 5CCGA 4JYBA 5CCHA 2FFDC 2VRSA 5APYA 1RF1A 1HGZA 4RESB 1OXZA 1J1EB 1FOSE 3HTKB 2A45G 3NFQA 2XNXA 1E5WA 1FZCA 5AVRB 1JMMA 1X79B 1RF0A 3M9BA 1IK9A 5AW0B 2WTYA 1URQB 1H89A 1JUNA 5AW1B 1ZV8A 1LT9B 2WSCH 2XKMA 3HUSC 5APWA 3M0AA 1YTZT 2CPBA 4W7YA 1NTMK 3VOPA 2W6AA 2Z5IA 3II6A 3HE4B 1VPCA 4AYCA 1HH0A 1LTSC 1N73B 1GL2B 4N78D 2H8PD 2LKMA 3B5NA 1DX7A 1WRGA 3IR9A 4WY4B 1IFDA 3A7OA 1OWAA 1RF0C 3MGNA 3BATA 5APSA 1H88A 5AW5B 2HODA 3TYYA 1SFCB 3OAKA 1JO5A 4ZKPA 2R5DA 1NTZK 1JTHA 4WB4A 1G2CB 1SQBK 1HVVA 1M7LA 5CMZA 2E42A 2QM8A 1N2DC 2HPCA 4DZOA 4LLHA 1MFZA 1RY3A 1L4AD 1KILC 3CLQA 3B5NC 3HD7C 1VDFA 3KPEA 3M06A 1FU1A 1MUUA 3LW5H 3WMM0 1FAVA 3KYQA 3CI9A 1S9KE 2R32A 1LTBC 4Y99C 1GU5A 5AVYB 2FFDB 2N9BA 3P7KA 2CPSA 4C7NB 1NU1K 3N4XA 1FJPA 2WSEH 2YKOA 1NO4A 1SVFA 2WZ7A 5AVVB 3VMYA 3P32A 3KQGA 2WITA 1LTJA 4N78E 1CSBA 3HUSB 3RL0D 1GTWA 2W6BA 3G3ZA 2WSFH 2Z5HA 2NPSB 3O8ZA 5KJ7D 1L0NK 3H32A 3A3YB 2I1KA 2KSJA 4B86A 3L36A 3EQ2A 1ZR2A 2Q9IA 3P8MC 1T3UA 2WPRA 1SQQK 4IFMA 1FZEA 1GU4A 1CZQA 4C7RA 3M9QA 3U1AA 2J59M 2QM7A 1URQD 4XA4A 3V4WA 3L35A 3BRVB 2PP6A 3MIWA 3VP8A 2OYHA 1M1JA 1J1DC 1IO4A 3V5BA 1RE3C 1JNMA 3SWFA 3A2AA 1JY3P 1G1JA 1JY2P 1RE4C 2P1JA 3MD0A 1IFJA 1KILB 4GIFA 1CW5A 1GL2D 4EIJA 3B5NB 3HD7B 3TNUB 3LIEA 1HUCA 4WY4D 4AUWA 1L0LK 5CJ0A 2POHA 1NHLA 2HODB 1FZAA 1GW4A 2W27A 1W2EA 2ZFCA 1S9KD 4Y99B 5AVXB 1SFCD 2GUVA 1L4AA 3TK1A 2FKWB 1FJKA 1JTHB 1T3JA 1ZLLA 2N1TC 1CI6B 5BU5A 1A02F 2H7HA 1AFOA 3SWYA 2NPSC 3L37A 1N7SC 5CCGC 1GK4A 3TSIA 5CCHC 2C9LY 2KP8A 2OYIA 1RF1C 2R5BA 1JY3O 2A45H 3OA7A 2ZXEB 4ZKUA 1X8YA 1XTCC 1FZCC 1LTIC 1LWUA 1LTTC 1N86A 2C0XA 1ZN5A 2YMYA 2E43A 3V2PA 4I1LA 3RK2C 1Z56A 5AW3B 1N7LA 5KJ7A 2J58A 5AVUB 1LTGC 2WPSA 5AVWB 4EOTA 3L4FA 1KFMA 5CHXA 3M0DA 2C0WA 4I2LC 1AQ5A 4OH8B 1J1DB 3H32B 5BU8B 1T2KC 3NMDA 4JYCA 2IPPA 3U59A 1GDTA 5AW2B 2XDJA 1JY3N 1JY2N 2YO2A 2R3CA 2YKQA 1FZFA 3BASA 3HE4A 3RK3C 5AW7B 1IC2A 1XTGB 3GHGA 1GL2A 2OYHB 2N1TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LWU A;  1LWU C;  3HUS A;  1N86 A;  1LT9 B;  2HOD A;  3HUS C;  1M1J A;  2A45 I;  2OYH A;  1RE3 A;  2OYH C;  3H32 A;  1M1J C;  1RE3 C;  1FZB A;  1JY3 N;  2FFD B;  1N73 C;  1JY2 N;  1LT9 C;  1LT9 A;  1JY3 P;  1RE4 A;  2Q9I A;  2HPC B;  1JY2 P;  1RE4 C;  1T3U A;  1RF1 B;  2OYI B;  1FZF A;  3BVH A;  1FZE A;  2FFD A;  2Z4E A;  3GHG B;  2FFD C;  1LTJ B;  2H43 A;  2HPC A;  1N73 B;  1RF1 A;  2HLO A;  2OYI A;  1RF1 C;  1FZC B;  2OYI C;  3E1I A;  1JY3 O;  2A45 H;  1LTJ A;  1FZG A;  1LWU B;  1LTJ C;  1JY2 O;  3GHG A;  1N73 A;  2A45 G;  2HOD B;  2XNX A;  3GHG C;  3HUS B;  1FZC A;  2OYH B;  1FZA A;  3H32 B;  1FZC C;  1M1J B;  1W2E A;  1RF0 C;  1RF0 A; 
#chains in the Genus database with same CATH topology
 1BE3 J;  2E74 D;  5APT A;  2GA1 A;  1NU1 D;  5AW4 B;  1IFM A;  3VP9 A;  1RF1 B;  2ZYG A;  1PFI A;  3U1C A;  2Z4E A;  1FZC B;  1HTL C;  2IBZ D;  3LW5 J;  1BCC D;  4D6T J;  1L0N D;  1KQG B;  1Q2N A;  1KYO D;  1SQQ D;  2UWJ E;  3E1R A;  1FC2 C;  5CJ4 A;  2H43 A;  3SSU A;  3EWK A;  1NTM G;  4H13 B;  2LR2 A;  4UB6 E;  1HWT C;  4U3F J;  2D2C B;  3C9I A;  1FDM A;  3WUV A;  2M8R A;  1R8E A;  1LT1 A;  1M1J C;  2V7Q H;  2Q7C A;  2QJP B;  4H44 D;  1SLQ A;  3GLM A;  4I7Z B;  1GZL A;  3RK3 B;  4DOJ A;  1UIX A;  5APV A;  1S72 P;  4GOE A;  1L0L J;  2KNC B;  1YHQ P;  1KB9 D;  2K1A A;  3LID A;  4GT1 A;  3C1L A;  5KLV D;  1KZU B;  3NTN A;  1FDO A;  1NAF A;  3RK3 E;  1NTM J;  3H1J D;  3O6Q B;  3CCL P;  1HJ0 A;  5GTH E;  2OYI C;  1VL2 A;  2K3R A;  2NPS D;  3WUT A;  5CCH D;  3RL0 C;  5KTB A;  1LT9 A;  3L75 D;  1NKN A;  2XZR A;  3L70 E;  2QA4 P;  3HE5 B;  3Q5S A;  3CC4 P;  1LGH B;  1N73 A;  3H6P A;  2O1J A;  1M1J B;  3L73 D;  3RK2 D;  3FXD A;  2HYN A;  2Q5U A;  2YKP A;  3H25 A;  3L72 D;  3V2R A;  1URQ C;  3CX5 D;  5KLV E;  1Q81 Q;  2ZAE B;  2E75 C;  2K9J B;  1KQF B;  1JMB A;  2QIW A;  5H2F E;  3QWO C;  3I55 P;  3KDP B;  4HH2 A;  1FZG A;  5AW9 B;  1GL2 C;  1SQP J;  4I6M C;  1FDI A;  2P67 A;  4LC1 A;  1RE4 A;  3MTU E;  1SFC C;  2O3J A;  3P8C D;  2OYI B;  3FXE A;  4C7N A;  2KOG A;  3T97 A;  3BCC D;  3WU2 H;  2E75 D;  3RL0 B;  3CWB J;  3MUD A;  5KLI C;  2NPS A;  1PGQ A;  5CCH A;  1Y47 A;  1HGZ A;  3IN6 A;  3AE5 C;  1SQV J;  2JWA A;  3OW2 O;  1DIP A;  3AE1 C;  1H0T A;  1H89 A;  1URQ B;  3M0A A;  1S4X A;  4PJ0 E;  1NTM K;  2W6A A;  2Z5I A;  1KV4 A;  1GL2 B;  2H8P D;  4UB8 E;  3H1L G;  1DX7 A;  3H1I E;  3A7O A;  3R4Y A;  3TGU J;  3GG2 A;  1BSH A;  4UB6 H;  1SFC B;  4WB4 A;  1G2C B;  4L75 A;  1VQL P;  1D7M A;  3KXD A;  1SS1 A;  1L4A D;  3Q1M A;  3B5N C;  3KPE A;  1MUU A;  5KLI B;  1QX8 A;  1Q7Y Q;  1JB0 J;  1S9K E;  4CPG A;  1LTB C;  5AVY B;  2N9B A;  3P7K A;  3G71 P;  3H1L J;  2JP3 A;  3L71 D;  1NO4 A;  5AVV B;  3P32 A;  3KQG A;  2W6B A;  5GTH H;  3S9O A;  3D70 A;  1PPJ D;  5KJ7 D;  3L70 G;  3AEA C;  4BRY A;  2Q9I A;  1T3U A;  1CZQ A;  1OVU A;  4DJG A;  4NPD A;  3M9Q A;  1LP1 A;  4KJM A;  1IO4 A;  3V5B A;  1RE3 C;  3F89 A;  3SWF A;  1OMI A;  3AEE C;  2BEQ D;  1K73 Q;  4RJT A;  1G1J A;  1VQP P;  1IFJ A;  4GIF A;  2B88 A;  3RBX A;  3B5N B;  4WY4 D;  2POH A;  1NTK J;  1NHL A;  1BE3 E;  3PLN A;  5AVX B;  1L4A A;  1VQN P;  1FJK A;  2BCC G;  1AFO A;  1OZH A;  3TSI A;  2R44 A;  2V4H A;  4D6T E;  2KP8 A;  2OQQ A;  1KMI Z;  2LXC B;  1LWU A;  1RQV A;  1NTM D;  5B5E E;  2ZVO B;  1ZN5 A;  2YMY A;  2Y9Z A;  1OW6 A;  5KJ7 A;  2IDB A;  4L73 A;  3CME P;  4ZMD A;  5AVU B;  4U3F E;  2WPS A;  1S1C X;  2RN0 A;  3M0D A;  3GF7 A;  1YQ4 C;  2PGD A;  2BCC J;  3NMD A;  2YXQ B;  1VF5 C;  1ZRT D;  3U59 A;  1GDT A;  3F5H A;  5AW2 B;  5TJH A;  1NTZ J;  3H1I G;  2YKQ A;  1FZF A;  5DJU B;  1L0L E;  3Q5P A;  3HE4 A;  2Y9Y A;  1IC2 A;  1XTG B;  3GHG A;  2OYH B;  4EYY Q;  4WY4 A;  4UB8 H;  1NTM E;  2P7J A;  2AEJ A;  2W83 C;  1KIL D;  2O1K A;  2IFN A;  3GMA A;  1AJY A;  1W5C E;  1Q82 Q;  3M91 A;  1LTJ C;  1AV1 A;  1YTZ I;  2LXB A;  2KIK A;  5AVQ B;  1KQS O;  1FE6 A;  1M1K Q;  3AE7 C;  2FYZ A;  3W68 A;  3BVH A;  2FFD A;  2FY8 A;  3S4R A;  1VF5 B;  3FX0 A;  2O01 J;  3HUS A;  1HJB A;  2KLV A;  4N3Y B;  1LTA C;  5APU A;  2HFE D;  2WPV B;  1S5L E;  1NH4 A;  2WVR A;  2HPC B;  5KLV K;  2YNY A;  4IL6 X;  2KB7 P;  2WT7 A;  4GDO A;  4Z1M H;  1NAY A;  2KS1 B;  1JY2 O;  1SQP E;  1YYC A;  2Y0D A;  2A45 I;  1QL1 A;  4NPF X;  1BE3 G;  1AVO A;  5K5G B;  1LTJ B;  2HLO A;  1KIL A;  4YXD C;  3AE8 C;  2N1T D;  2WWW A;  3CWB E;  3V2N A;  4NPE A;  5CCG D;  5DJT B;  4D6T G;  1USD A;  4HKZ H;  2OGU A;  4GOD A;  1MKM A;  1SQV E;  2YIU C;  3D6Z A;  2B87 A;  2RH0 A;  3RBZ A;  1DH3 A;  4U7J A;  4WVZ A;  1J1E C;  5GTI E;  2M3B A;  4U3F G;  3H1L D;  3L74 J;  2IYO A;  2KI7 B;  1LT9 C;  5B5E H;  2RMZ A;  1YI2 P;  4H13 D;  2M0B A;  5AW8 B;  1MZ9 A;  2D2C D;  3TGU E;  1N73 C;  2YMK A;  1L0L G;  3RL0 g;  1FZB A;  1IFN A;  2PAJ A;  3RK3 D;  3JC2 2;  2C9N Y;  5C39 A;  3TDK A;  1JM0 A;  1LJ2 A;  2WSF J;  1DD4 A;  1KQL A;  1ZR4 A;  4WBA A;  4OGQ C;  2N1T A;  5KAI E;  4HJG H;  5AVZ B;  3H1L E;  1QGK B;  3K5B A;  5CCG A;  4JYB A;  2YIU B;  3L70 D;  5APY A;  1RF1 A;  2O01 N;  1J1E B;  2A45 G;  1FZC A;  1X79 B;  2KZJ A;  1U7J A;  3Q5R A;  1RF0 A;  1ZV8 A;  1LT9 B;  2R3S A;  3MUD C;  1YTZ T;  3H1H J;  1K9M Q;  1KC8 Q;  3II6 A;  2W90 A;  1LTS C;  2IZ0 A;  1DEE G;  1N73 B;  1SQX J;  4N78 D;  3MGN A;  2P10 A;  3OAK A;  4ZKP A;  2KK7 A;  2R5D A;  2WMM A;  1SQP G;  5TIS E;  1M7L A;  2E42 A;  2QM8 A;  3A0B E;  2BCC D;  1NTK E;  1S5L H;  1MFZ A;  3AEF C;  3CLQ A;  3HD7 C;  1VDF A;  3M06 A;  2M5A A;  4OGQ B;  4DT0 A;  3PH0 A;  1U7M A;  2KNC A;  1NJI Q;  1GU5 A;  3CWB G;  1BGY J;  1K05 A;  4C7N B;  4RKU J;  1SVF A;  3AE2 C;  2WZ7 A;  3VMY A;  2FXP A;  2G3A A;  1UII A;  2WIT A;  4N78 E;  3RL0 D;  1R5L A;  1KYO I;  1OIP A;  1SQV G;  2NPS B;  5M1B A;  3H32 A;  2SPZ A;  2KLU A;  3EQ2 A;  3P8M C;  2ZT9 C;  1PP9 J;  1YJW P;  4C7R A;  2BCC E;  3CCU P;  3H1I D;  1URQ D;  4XA4 A;  1ZXG A;  4HB1 A;  3PHL A;  1M1J A;  1OW7 A;  1J1D C;  4YPC A;  1JNM A;  3TGU G;  1JY2 P;  2QJY C;  1GL2 D;  4EIJ A;  3HD7 B;  2K9J A;  1VQK P;  3TNU B;  2DW3 A;  1L0L K;  1KB9 I;  2ZFC A;  1S9K D;  2FYU J;  2ZXX A;  1SFC D;  3ITK A;  2FYN C;  1ZLL A;  4PD4 E;  1CI6 B;  3SWY A;  3AE3 C;  3L37 A;  1N7S C;  2C9L Y;  1ZME C;  2OYI A;  1X22 A;  1JY3 O;  2QE7 H;  2JO1 A;  1EXI A;  2ZXE B;  3C8V A;  5L8R J;  1X8Y A;  1N86 A;  2AXT E;  2ZT9 B;  2Q6Q A;  3V2P A;  2J58 A;  1LTG C;  2W6J H;  5KAI H;  4GOF A;  2A06 E;  2E76 C;  3L4F A;  1NU1 G;  5CHX A;  4I2L C;  1J1D B;  4PD4 I;  3VMA A;  1T2K C;  4JYC A;  4BRY B;  2IPP A;  2QJY B;  1NYH A;  1JY3 N;  2YO2 A;  2R3C A;  1SQB J;  3BAS A;  3CCS P;  3CPW O;  1BE3 D;  4ZNC A;  1GL2 A;  2FYN B;  1SQP K;  1HGV A;  1NTK G;  4LGD E;  1N7S B;  1ZOY C;  1DEB A;  1SFC A;  3B5N D;  1NGM B;  4D6T D;  1NU1 J;  4H0L C;  1T2K D;  4AQR D;  3AEB C;  5TIS H;  2Q1K A;  1VQO P;  4M3L A;  3PP5 A;  2KXP B;  3A0B H;  3PJS K;  3AE9 C;  5CBN A;  2B9B A;  1BCC J;  4MN4 C;  1L0N J;  3B8E B;  3EFG A;  1QL2 A;  2P2U A;  2XV5 A;  2KYV A;  2E76 B;  4U3F D;  1SQQ J;  2KZI A;  1SQV K;  4PV1 C;  4TLF A;  4JPZ B;  2YO3 A;  5AW6 B;  5H2F H;  3L74 E;  1OVV A;  5EFW B;  2OYH C;  3A0H E;  1HBW A;  2JEE A;  1MFT A;  5KKZ C;  1L0L D;  1GW3 A;  1BSN A;  1NTZ G;  2WQY C;  1KN7 A;  1SP4 A;  2AEF A;  3G9R A;  3CXH E;  1H8A A;  1ZP0 C;  2QRX A;  4R4M A;  3D6Y A;  4H0L B;  4KHX A;  5B66 E;  4XE5 B;  1A02 J;  2I8D A;  3CMA P;  3GHG B;  1VQ5 P;  4OVN F;  1VQ9 P;  3H1J J;  3BRT B;  1J2J B;  2NZ2 A;  1E79 H;  1S3J A;  3HTK A;  3S1K A;  4EDF A;  3VTP C;  3JSV C;  3OJA B;  2QEX P;  5BVZ A;  1JCD A;  4PV1 B;  2AEM A;  3MP7 B;  4PD4 H;  1OW8 A;  3L75 J;  4PJ0 H;  3CXH I;  2IX7 C;  1FOS F;  4HYT B;  1Y9B A;  3H1H E;  2I1J A;  2FXO A;  5KKZ B;  2A06 G;  1IFI A;  1EDL A;  3L73 J;  1G1I A;  1T8Z A;  2GM4 A;  1SQX E;  3M9H A;  3L72 J;  2AXT H;  1PL5 A;  1R5S A;  1VF5 D;  3R2P A;  1DD3 A;  1SQP D;  3VYI A;  3N7N A;  1EQ7 A;  1MV8 A;  2FXM A;  1VQ7 P;  1RE3 A;  3VN0 A;  2O01 H;  2WSE J;  3RGU A;  2WT7 B;  2M3E A;  3CC2 P;  1FBM A;  4XFJ A;  2IFM A;  1VQM P;  5KAF E;  1EXJ A;  1PZQ A;  1NTK K;  3CWB D;  4QMA A;  1N8R Q;  3UIA A;  2L5G B;  1AQT A;  4W80 A;  5CBO A;  1JCC A;  3KZI E;  3BCC J;  4IFD K;  2CK3 H;  1BGY E;  4W7Z A;  4EI2 A;  2WSS H;  1SQV D;  1OXZ A;  1FOS E;  1QEX A;  3NFQ A;  1E5W A;  1JMM A;  3KHU A;  5AW1 B;  1EZV E;  2WSC H;  5APW A;  4ASV A;  3SFE C;  4W7Y A;  1PP9 E;  2AXC A;  1VPC A;  3GW6 A;  1HH0 A;  3L74 G;  3TGU D;  2LKM A;  1WRG A;  3IR9 A;  1IFD A;  1RF0 C;  3BAT A;  1PIX A;  5AW5 B;  3GF3 A;  2HOD A;  1JO5 A;  1NTZ K;  1JTH A;  1HVV A;  1P84 E;  5CMZ A;  2E74 C;  1N2D C;  2HPC A;  3A0H H;  4DZO A;  4LLH A;  3IF4 A;  1RY3 A;  2FYU E;  2H89 C;  1EZV I;  3LW5 H;  3WMM 0;  3KYQ A;  3JCU E;  2KS1 A;  3CI9 A;  1QLE D;  2R32 A;  4ASW A;  3H1K G;  3CXH H;  2OTK E;  1FJP A;  2YKO A;  1EDI A;  1Q90 D;  1LTJ A;  5B66 H;  3AEC C;  1CSB A;  3L71 J;  3G4S P;  1M57 D;  2WSF H;  3O8Z A;  2BEZ F;  1P84 I;  2I1K A;  3Q3D A;  2KSJ A;  4B86 A;  3Q2Y A;  1ZR2 A;  1M56 D;  2WPR A;  1YBK A;  2L91 A;  4IFM A;  1ZW0 A;  3H1H G;  3AE6 C;  1QVF O;  4H44 C;  3U1A A;  1OX3 A;  3V4W A;  1SQX G;  3BRV B;  1Y8A A;  2PP6 A;  2K9Y A;  3MIW A;  3H1K J;  4K3A A;  3AED C;  4DCK A;  4IL6 E;  2E74 B;  3A2A A;  1SQB E;  1RE4 C;  2P1J A;  1NTK D;  1CW5 A;  2E5Y A;  3D71 A;  4AUW A;  3TF5 A;  2N9Y B;  2PRR A;  1FZA A;  2W27 A;  2FKW B;  1FS0 E;  3QH9 A;  1X0T A;  1AVY A;  5BU5 A;  1A02 F;  3CCQ P;  1NU1 E;  2NPS C;  2K37 A;  3CCM P;  5CCH C;  2JR8 A;  2M5A B;  2R5B A;  1BGY G;  2ZYA A;  2A45 H;  4OGQ D;  2IBZ E;  1BCC E;  5KAF H;  1L0N E;  1BDD A;  2V7Q J;  4JBZ A;  4JQ0 D;  1KYO E;  2C0X A;  2Y0E A;  1SQQ E;  4I1L A;  3RK2 C;  5AW3 B;  1N7L A;  3KZI H;  1YIJ P;  1S2E A;  4H44 B;  1QVG O;  1EZV G;  3IAO A;  2J5U A;  4EOT A;  2QVA A;  4OH8 B;  1PP9 G;  3H32 B;  5BU8 B;  1IK7 A;  1NTZ D;  2XDJ A;  2IYP A;  1KTM A;  3PTZ A;  3T97 B;  2IBZ I;  1RHZ B;  3B4S A;  3CC7 P;  3V6I A;  5AW7 B;  4TT3 H;  3CCV P;  3O6Q A;  1K04 A;  4K35 A;  1KB9 E;  1PGO A;  4PD4 D;  1USE A;  3HRN A;  1PGP A;  2FYU G;  1TU3 F;  3HD7 D;  4IOI H;  4JF7 A;  3ABV C;  2ZVN B;  3H1J E;  4Y28 J;  2IZ1 A;  5E79 E;  1H0T B;  1P84 H;  3HE5 A;  1T6A A;  1AA0 A;  2ITA A;  3CCE P;  2KSE A;  3RK2 B;  3E7K A;  1NOH A;  1NTZ E;  1IZN B;  3VMZ A;  3I5C A;  3JCU H;  3L75 E;  5GTI H;  2WPQ A;  2BAS A;  1OVR A;  2A06 D;  2FBW C;  4O9B A;  1KOR A;  3V2Q A;  3L73 E;  2ZT9 D;  2Q3E A;  3MZW B;  2PFX A;  4IFF A;  3IFM A;  3L72 E;  3A5T A;  3CX5 E;  1JOC A;  2HR3 A;  1SQX K;  4C46 A;  2MJZ A;  2OAR A;  2OTJ P;  1SQB G;  3CL3 D;  2ZYD A;  5APQ A;  2E75 B;  1L4A C;  1VQ8 P;  2JJL A;  3B71 A;  1NWQ A;  2ZJS E;  3P8C E;  2XU6 A;  2GUS A;  4IL6 H;  3E1I A;  3HD7 A;  3TNU A;  3BCC E;  2Q3I A;  1LWU C;  1N7S D;  4L74 A;  4GKG A;  3CX5 I;  1URQ A;  2IBZ G;  1LNQ A;  1BCC G;  1CI6 A;  5KJ7 C;  1L0N G;  2HG5 D;  2NRG A;  1LP1 B;  3ZDM A;  1WT6 A;  2JDI H;  1SQQ G;  1GK6 A;  3NXS A;  3M0D C;  3L74 D;  3VMX A;  3V4Q A;  1JEK A;  1GD2 E;  1OFC X;  1KFN A;  2Y0C A;  2E76 D;  4WWI A;  4N6J A;  1KYO H;  3WUU A;  3AE4 C;  1G2C A;  1M90 Q;  1X9V A;  3GHG C;  1L4A B;  3CXH D;  1PV3 A;  1NKZ B;  4WY4 C;  1YIT P;  5APX A;  1IJD B;  3AEG C;  3H1K D;  5KLV G;  1LWU B;  1U57 A;  2FYU K;  2G8Y A;  2QJK C;  5AVT B;  1YJN P;  3H1J G;  4H0L D;  5AVS B;  1N7S A;  2YXR B;  1KB9 H;  1W2B O;  2FFD C;  2QSI A;  2VRS A;  3L71 E;  4RES B;  3HTK B;  3L70 J;  4L76 A;  2XNX A;  5AVR B;  3H1H D;  3M9B A;  3L75 G;  1IK9 A;  5AW0 B;  2WTY A;  1JUN A;  1Q86 Q;  5E79 H;  3HUS C;  2XKM A;  1PPJ E;  2CPB A;  2E5T A;  1SQX D;  4PV1 D;  3VOP A;  3HE4 B;  4AYC A;  1WMK A;  3L73 G;  2H88 C;  5KLV J;  2JKV A;  1S5L X;  3I56 P;  3L72 G;  3B5N A;  1IFP A;  4WY4 B;  3H1K E;  3EFF K;  1H88 A;  1OWA A;  5APS A;  4KT0 J;  2OTL P;  3TYY A;  2K88 A;  4BXL A;  1SQB K;  3FWL A;  2W8Z A;  2QJK B;  1KIL C;  3CX5 H;  1FU1 A;  1FAV A;  1BGY D;  4Y99 C;  1EDK A;  2FFD B;  2OYO A;  1M8O B;  3W67 A;  3BCC G;  2CPS A;  1NU1 K;  3N4X A;  2WSE H;  4R4L A;  1GMJ A;  3HUS B;  1GTW A;  1EZV D;  3G3Z A;  2Z5H A;  1NVO A;  1VQ6 P;  1L0N K;  3SFD C;  3CCR P;  3A3Y B;  2KUB A;  1PP9 D;  3L36 A;  2QG4 A;  2RKL A;  1SQQ K;  1FZE A;  1GU4 A;  4YTP C;  2P58 A;  2J59 M;  2QM7 A;  3L35 A;  2JWD A;  1RQU A;  3SWK A;  3VP8 A;  2OYH A;  3H1I J;  2XND H;  1ZRT E;  3PRJ A;  1K8A Q;  1JY3 P;  1P84 D;  2B89 A;  3MD0 A;  1KIL B;  1KD1 Q;  2FYU D;  3LIE A;  1HUC A;  5CJ0 A;  2HOD B;  1GW4 A;  1W2E A;  4Y99 B;  2GUV A;  3TK1 A;  1VQ4 P;  1JTH B;  1T3J A;  2N1T C;  3G6E P;  1HF9 A;  2H7H A;  4BWN A;  5CCG C;  2MKV A;  1GK4 A;  1BDC A;  1KIL E;  2B87 B;  1RF1 C;  1YQ3 C;  4RO0 A;  3OA7 A;  1EDJ A;  4ZKU A;  1XTC C;  1FZC C;  1LTI C;  1LTT C;  3FGA D;  3L71 G;  1EC5 A;  2E43 A;  1Z56 A;  3USS A;  1PPJ G;  5AVW B;  1KFM A;  4A7P A;  2C0W A;  1AQ5 A;  2WSC J;  4H13 C;  2D2C C;  1YJ9 P;  1SQB D;  1PGJ A;  3MHV A;  3CCJ P;  1L2P A;  1JY2 N;  4OWF A;  3WU2 E;  4YXW H;  2QJP C;  3CD6 P;  4I7Z C;  3RK3 C;  1RH5 B;  3FWN A;  2N1T B; 
#chains in the Genus database with same CATH homology
 1SQP K;  4WY4 A;  1HGV A;  4LGD E;  5APT A;  1N7S B;  3HRN A;  5AW4 B;  2P7J A;  1DEB A;  1IFM A;  1SFC A;  1KIL D;  3VP9 A;  1RF1 B;  3B5N D;  2O1K A;  3HD7 D;  1PFI A;  2IFN A;  3U1C A;  2Z4E A;  1T2K D;  4JF7 A;  4AQR D;  1FZC B;  1HTL C;  3M91 A;  1LTJ C;  1YTZ I;  4M3L A;  3PP5 A;  5AVQ B;  3HE5 A;  3RK2 B;  1NOH A;  3B8E B;  3VMZ A;  2FYZ A;  3I5C A;  3EFG A;  1QL2 A;  2P2U A;  2XV5 A;  2KYV A;  5CJ4 A;  3BVH A;  2WPQ A;  2FFD A;  2BAS A;  2H43 A;  1SQV K;  4O9B A;  1HWT C;  3C9I A;  2YO3 A;  5AW6 B;  1FDM A;  3V2Q A;  3HUS A;  2M8R A;  1HJB A;  2KLV A;  4N3Y B;  2OYH C;  1M1J C;  1LTA C;  4IFF A;  1HBW A;  5APU A;  2JEE A;  2HFE D;  3IFM A;  2Q7C A;  3A5T A;  1NH4 A;  2HPC B;  1SLQ A;  1JOC A;  1GZL A;  3RK3 B;  5KLV K;  1GW3 A;  4DOJ A;  2YNY A;  1SQX K;  5APV A;  2KB7 P;  2WT7 A;  4C46 A;  2MJZ A;  1SP4 A;  2OAR A;  1JY2 O;  3CL3 D;  1YYC A;  3LID A;  5APQ A;  1H8A A;  1L4A C;  4GT1 A;  2A45 I;  1KZU B;  2JJL A;  3NTN A;  4KHX A;  1NAF A;  1QL1 A;  4XE5 B;  1A02 J;  1NWQ A;  3P8C E;  2XU6 A;  3GHG B;  1LTJ B;  2GUS A;  2HLO A;  2OYI C;  1KIL A;  3E1I A;  3HD7 A;  2N1T D;  2WWW A;  3TNU A;  3BRT B;  1J2J B;  3V2N A;  2Q3I A;  2NPS D;  1LWU C;  1N7S D;  3HTK A;  5CCG D;  3VTP C;  4GKG A;  5CCH D;  3RL0 C;  3OJA B;  1URQ A;  5KTB A;  1LT9 A;  5BVZ A;  1CI6 A;  5KJ7 C;  1NKN A;  1JCD A;  2HG5 D;  2XZR A;  1WT6 A;  3HE5 B;  1LGH B;  2IX7 C;  1GK6 A;  1N73 A;  1FOS F;  3H6P A;  2O1J A;  3NXS A;  3M0D C;  1DH3 A;  3VMX A;  1M1J B;  1J1E C;  4HYT B;  3RK2 D;  3V4Q A;  2HYN A;  2Q5U A;  2YKP A;  2M3B A;  2I1J A;  1GD2 E;  3V2R A;  1IFI A;  1KFN A;  1URQ C;  1G1I A;  1T8Z A;  1LT9 C;  2GM4 A;  4N6J A;  3M9H A;  1G2C A;  3R2P A;  5AW8 B;  1MZ9 A;  3KDP B;  4HH2 A;  1FZG A;  1N73 C;  1X9V A;  3VYI A;  5AW9 B;  3GHG C;  1L4A B;  1GL2 C;  3N7N A;  1EQ7 A;  1MV8 A;  2FXM A;  1NKZ B;  4WY4 C;  1RE3 A;  3VN0 A;  2O01 H;  1FZB A;  4I6M C;  1IFN A;  2PAJ A;  2P67 A;  4LC1 A;  3RK3 D;  1RE4 A;  3MTU E;  1SFC C;  3P8C D;  5APX A;  2WT7 B;  2C9N Y;  1IJD B;  1FBM A;  2OYI B;  2IFM A;  4C7N A;  2KOG A;  3T97 A;  1NTK K;  1LWU B;  3UIA A;  2L5G B;  2FYU K;  4W80 A;  1KQL A;  3RL0 B;  1JCC A;  5AVT B;  1ZR4 A;  4WBA A;  2N1T A;  3MUD A;  4IFD K;  5AVS B;  4W7Z A;  5AVZ B;  2NPS A;  1N7S A;  5CCG A;  4JYB A;  5CCH A;  2FFD C;  2VRS A;  5APY A;  1RF1 A;  1HGZ A;  4RES B;  1OXZ A;  1J1E B;  1FOS E;  3HTK B;  2A45 G;  3NFQ A;  2XNX A;  1E5W A;  1FZC A;  5AVR B;  1JMM A;  1X79 B;  1RF0 A;  3M9B A;  1IK9 A;  5AW0 B;  2WTY A;  1URQ B;  1H89 A;  1JUN A;  5AW1 B;  1ZV8 A;  1LT9 B;  2WSC H;  2XKM A;  3HUS C;  5APW A;  3M0A A;  1YTZ T;  2CPB A;  4W7Y A;  1NTM K;  3VOP A;  2W6A A;  2Z5I A;  3II6 A;  3HE4 B;  1VPC A;  4AYC A;  1HH0 A;  1LTS C;  1N73 B;  1GL2 B;  4N78 D;  2H8P D;  2LKM A;  3B5N A;  1DX7 A;  1WRG A;  3IR9 A;  4WY4 B;  1IFD A;  3A7O A;  1OWA A;  1RF0 C;  3MGN A;  3BAT A;  5APS A;  1H88 A;  5AW5 B;  2HOD A;  3TYY A;  1SFC B;  3OAK A;  1JO5 A;  4ZKP A;  2R5D A;  1NTZ K;  1JTH A;  4WB4 A;  1G2C B;  1SQB K;  1HVV A;  1M7L A;  5CMZ A;  2E42 A;  2QM8 A;  1N2D C;  2HPC A;  4DZO A;  4LLH A;  1MFZ A;  1RY3 A;  1L4A D;  1KIL C;  3CLQ A;  3B5N C;  3HD7 C;  1VDF A;  3KPE A;  3M06 A;  1FU1 A;  1MUU A;  3LW5 H;  3WMM 0;  1FAV A;  3KYQ A;  3CI9 A;  1S9K E;  2R32 A;  1LTB C;  4Y99 C;  1GU5 A;  5AVY B;  2FFD B;  2N9B A;  3P7K A;  2CPS A;  4C7N B;  1NU1 K;  3N4X A;  1FJP A;  2WSE H;  2YKO A;  1NO4 A;  1SVF A;  2WZ7 A;  5AVV B;  3VMY A;  3P32 A;  3KQG A;  2WIT A;  1LTJ A;  4N78 E;  1CSB A;  3HUS B;  3RL0 D;  1GTW A;  2W6B A;  3G3Z A;  2WSF H;  2Z5H A;  2NPS B;  3O8Z A;  5KJ7 D;  1L0N K;  3H32 A;  3A3Y B;  2I1K A;  2KSJ A;  4B86 A;  3L36 A;  3EQ2 A;  1ZR2 A;  2Q9I A;  3P8M C;  1T3U A;  2WPR A;  1SQQ K;  4IFM A;  1FZE A;  1GU4 A;  1CZQ A;  4C7R A;  3M9Q A;  3U1A A;  2J59 M;  2QM7 A;  1URQ D;  4XA4 A;  3V4W A;  3L35 A;  3BRV B;  2PP6 A;  3MIW A;  3VP8 A;  2OYH A;  1M1J A;  1J1D C;  1IO4 A;  3V5B A;  1RE3 C;  1JNM A;  3SWF A;  3A2A A;  1JY3 P;  1G1J A;  1JY2 P;  1RE4 C;  2P1J A;  3MD0 A;  1IFJ A;  1KIL B;  4GIF A;  1CW5 A;  1GL2 D;  4EIJ A;  3B5N B;  3HD7 B;  3TNU B;  3LIE A;  1HUC A;  4WY4 D;  4AUW A;  1L0L K;  5CJ0 A;  2POH A;  1NHL A;  2HOD B;  1FZA A;  1GW4 A;  2W27 A;  1W2E A;  2ZFC A;  1S9K D;  4Y99 B;  5AVX B;  1SFC D;  2GUV A;  1L4A A;  3TK1 A;  2FKW B;  1FJK A;  1JTH B;  1T3J A;  1ZLL A;  2N1T C;  1CI6 B;  5BU5 A;  1A02 F;  2H7H A;  1AFO A;  3SWY A;  2NPS C;  3L37 A;  1N7S C;  5CCG C;  1GK4 A;  3TSI A;  5CCH C;  2C9L Y;  2KP8 A;  2OYI A;  1RF1 C;  2R5B A;  1JY3 O;  2A45 H;  3OA7 A;  2ZXE B;  4ZKU A;  1X8Y A;  1XTC C;  1FZC C;  1LTI C;  1LWU A;  1LTT C;  1N86 A;  2C0X A;  1ZN5 A;  2YMY A;  2E43 A;  3V2P A;  4I1L A;  3RK2 C;  1Z56 A;  5AW3 B;  1N7L A;  5KJ7 A;  2J58 A;  5AVU B;  1LTG C;  2WPS A;  5AVW B;  4EOT A;  3L4F A;  1KFM A;  5CHX A;  3M0D A;  2C0W A;  4I2L C;  1AQ5 A;  4OH8 B;  1J1D B;  3H32 B;  5BU8 B;  1T2K C;  3NMD A;  4JYC A;  2IPP A;  3U59 A;  1GDT A;  5AW2 B;  2XDJ A;  1JY3 N;  1JY2 N;  2YO2 A;  2R3C A;  2YKQ A;  1FZF A;  3BAS A;  3HE4 A;  3RK3 C;  5AW7 B;  1IC2 A;  1XTG B;  3GHG A;  1GL2 A;  2OYH B;  2N1T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...