2RMZA

Bicelle-embedded integrin beta3 transmembrane segment
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
43
structure length
43
Chain Sequence
PESPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Integrin beta-3
publication title Structure of the Integrin beta3 Transmembrane Segment in Phospholipid Bicelles and Detergent Micelles
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2007-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2rmzA00
2RMZA 2BCCD 2KNCB 4D6TD 2K9JB 2O3JA 3L75D 2Y0EA 3H1ID 3VMAA 3TGUD 2N9YB 5KKZB 2QJPB 2Y0CA 3TF5A 1SQQD 2YIUB 3H1KD 3GW6A 1PPJD 3ITKA 1BE3D 3L72D 1L0ND 1EZVD 3CX5D 1NTKD 3L73D 3CWBD 2RN0A 3H1JD 1KYOD 1SQVD 3GG2A 2JWAA 1P84D 1NTMD 1SQXD 1PP9D 3PRJA 2IBZD 3L71D 1SQBD 2A06D 3H1HD 1KB9D 3FWLA 4EDFA 2QJKB 5TJHA 2FYNB 3L70D 3PHLA 4PD4D 3L74D 1L0LD 3TDKA 2L91A 3BCCD 3CXHD 1NTZD 3KHUA 5KLIB 4RJTA 3PLNA 5KLVD 1SQPD 2KS1A 1ZRTD 1BCCD 2QJYB 4U3FD 2FYUD 2QG4A 1BGYD 2Y0DA 3H1LD 1NU1D 4A7PA 2Q3EA 3PTZA
chains in the Genus database with same CATH superfamily
5CCHD 1RY3A 2YKOA 3D6YA 3D6ZA 2M3BA 1FBMA 1H89A 3VOPA 3VP8A 3CCQP 2H7HA 2QIWA 1KB9E 4L74A 1NTMG 1Q82Q 1LTJC 1PP9G 2WPRA 3M06A 5CCHA 5APVA 3FXDA 2JEEA 4RESB 2E75B 3Q2YA 1JY2N 1M8OB 2W27A 3OAKA 5AW2B 2WPQA 4W80A 4IOIH 2M0BA 5E79E 1NGMB 1BCCE 1VF5C 3L37A 5GTIE 2B89A 2GA1A 2Q1KA 1FZFA 1K04A 1KB9D 1EC5A 1HWTC 3AEDC 1URQB 2N1TB 1NTKJ 2ZVNB 3JCUH 2AXTH 2KP8A 3I56P 2K37A 5AW5B 1IK9A 3S1KA 2YXRB 4CPGA 2YO3A 1S5LH 1BCCD 1GW4A 5B66E 2HODA 5BU8B 3VTPC 1JO5A 2NPSB 1Y9BA 2OYHB 1JY3P 1HF9A 3V4WA 2OYIB 2ZYAA 2LR2A 4W7ZA 1RHZB 3VMYA 4I7ZB 3JCUE 2A06E 3HUSA 3D71A 4LC1A 3R2PA 1M90Q 1GU5A 1SQBG 3A0BH 1LWUA 3CX5D 1S5LE 1KD1Q 1G1IA 4H44C 2GUSA 3L70G 5GTHE 3IF4A 3AE7C 1AA0A 2JDIH 3EWKA 4U3FE 2A06D 2E76D 2HR3A 3GLMA 1GL2C 5TJHA 2HPCA 3WUTA 2WQYC 3HD7B 3HE5A 3GHGA 2P67A 4WY4C 1ZW0A 3H1JE 3SWYA 4KHXA 4TT3H 4YPCA 1HTLC 5CJ0A 5APYA 4U3FD 1G2CA 2B9BA 4D6TG 2R44A 2Y0DA 1N73B 1PPJE 3KQGA 4L75A 1FZAA 5AVWB 1L0NE 1MFTA 4JYBA 1Q90D 1BDDA 4C7NB 4I6MC 3H1LJ 5AVSB 4N6JA 1LP1A 2W6AA 4GODA 1ZOYC 1ZLLA 2BEZF 1SQXG 1CSBA 3S4RA 2YIUB 1FDIA 3AE8C 1PPJD 3GW6A 2ZT9B 4W7YA 1VQLP 2OYHA 5KTBA 1VQPP 1L0ND 1N2DC 2ZYDA 2V4HA 1SP4A 1IFDA 1PGOA 4ZNCA 4ZMDA 4NPDA 2KZJA 2K9YA 3L71D 1K8AQ 2MJZA 3LW5J 3HTKB 1KFNA 2H43A 3W67A 3CWBJ 2E75C 1BSHA 2YO2A 3N4XA 4WWIA 4IFDK 1JMBA 1S5LX 1LT9A 2ITAA 3CXHI 2YXQB 1SS1A 3RL0D 1KN7A 1URQC 2N1TC 2QRXA 1NTME 5CCGD 1X0TA 4C7RA 1YJ9P 1KORA 3B71A 4R4LA 3HD7A 2WSEJ 1FZCA 1RE3C 1NTKE 5B5EH 5AW0B 2O1KA 3FWNA 1BE3G 4JF7A 5APSA 1L4AD 3L72G 5AW7B 1P84E 3L73G 3OA7A 4AYCA 3MP7B 2K1AA 1R5LA 2NPSC 3LIDA 1N73A 4HB1A 4H13B 2IZ1A 2Y0CA 2K88A 3A2AA 2IBZG 2OYIC 3JC22 1PZQA 2E43A 2OTLP 1VQ9P 2Q3IA 1NTKD 2VRSA 4I7ZC 1W2EA 1M57D 2I1KA 3CXHE 1FS0E 3F5HA 3H1IJ 4H0LD 1P84D 1HUCA 2Q9IA 1FZEA 3H1KJ 2IDBA 3PJSK 1TU3F 1VF5B 5KLVK 3MGNA 2KNCA 4K3AA 2QSIA 1KILB 3I5CA 2PP6A 1FU1A 1JB0J 1KV4A 1S9KE 2C0XA 3G3ZA 2CPSA 3CXHD 4N78E 1FAVA 4KT0J 2JWDA 3HD7C 1YJNP 1JY2O 3TNUB 4ASVA 2KIKA 2XDJA 1WT6A 1N7SD 2RMZA 1S9KD 1NKZB 5KAFH 2R32A 2E5TA 4BRYB 2M8RA 3VMAA 3TGUD 1QX8A 4HH2A 2QJPB 5AVVB 1N7SA 1RE4A 1KQFB 3G9RA 3B8EB 1JY3N 2FYUK 3GF7A 1EZVG 3FGAD 1L0LG 1AVYA 2Z5HA 3CC2P 3CCVP 2YIUC 3AE2C 1T2KD 4D6TE 2ZT9C 1NTZG 4ASWA 3HE4B 5AVTB 3RGUA 1M1JB 1LTJA 3H1LE 2ZVOB 1IFMA 3K5BA 1N86A 2HG5D 2XKMA 1JMMA 2PGDA 2FFDC 1RH5B 1KTMA 1X9VA 1IK7A 5DJTB 4YTPC 4RO0A 2HYNA 1KQLA 2ZAEB 4WBAA 1AQTA 3N7NA 1QGKB 2WWWA 4PV1D 3WU2H 2O01N 3B5ND 2AXCA 3EQ2A 3H1LD 5TISH 3KXDA 1ZXGA 2OGUA 2WT7B 5KAIE 1GK6A 1NAFA 1QVGO 4K35A 3L4FA 3CWBE 1IFIA 1GK4A 3CMEP 1KYOE 5KLVJ 4MN4C 1RF0C 1K73Q 2YNYA 4OH8B 2RKLA 2FBWC 4WVZA 1SQVG 1YTZI 2JR8A 4EYYQ 1YIJP 3RK3D 1SQBK 2IBZI 3CCUP 1H88A 3CWBD 3OJAB 1EDIA 4HJGH 1KYOD 2WSCH 2H8PD 2CK3H 4H13C 4H44D 1HJ0A 1AJYA 1CZQA 3BCCG 4IFMA 3CC4P 2P2UA 1KMIZ 1M1KQ 1VQNP 1FC2C 1FJPA 1VDFA 2FYUG 2QVAA 1GL2D 2L91A 2E5YA 5APTA 2YMKA 1AVOA 1NTMJ 1PP9J 1IC2A 4WY4D 3IAOA 3H1IE 2BCCG 1BDCA 3CCEP 1KILC 3BVHA 1AFOA 3R4YA 2RH0A 2IBZE 4WB4A 3L75G 3H1KE 1GL2A 1Q7YQ 4UB6H 3H32B 3V4QA 1SFCC 3PTZA 2OQQA 1SQQG 4PJ0H 1OW7A 4LGDE 2SPZA 3D70A 4YXDC 4WY4A 1A02F 3SSUA 2NZ2A 1K05A 2KSEA 1DH3A 2O3JA 2JJLA 1CW5A 2R3SA 3H1ID 2POHA 1FZBA 2IFNA 3RBZA 1SQXK 1YTZT 1WRGA 3H1KD 4M3LA 2GUVA 2PFXA 3E1IA 1NH4A 1EZVI 4XA4A 3MZWB 3Q1MA 3L74G 2AXTE 2QJPC 1FDMA 1WMKA 1NU1K 3CCSP 2QM7A 3T97A 2WTYA 1HVVA 3H6PA 3KZIH 4I2LC 4GKGA 1OVVA 4TLFA 1OW6A 2C9LY 3VP9A 3AE6C 4IL6H 2E75D 1J1DB 4JPZB 2XZRA 3USSA 2B87B 5H2FH 1SQBJ 1M1JC 1OX3A 2KLUA 1URQD 2N1TD 3L70J 2ZXXA 3CPWO 1H8AA 1EZVE 1KQSO 3L35A 2D2CD 1RF1C 3KZIE 3JSVC 2K9JB 1URQA 2N1TA 3A0BE 2J58A 2Y0EA 1LNQA 1EDKA 3QWOC 2NPSD 2QA4P 3H32A 3M0DC 3H1HG 4HYTB 1RE3A 1EZVD 4D6TJ 3V2RA 3CI9A 2M5AB 1HBWA 1MUUA 3H1JD 2JO1A 1VQ4P 3MUDC 4PD4I 5KLVE 2QM8A 4PD4H 2A45G 2XV5A 2I1JA 2NPSA 3A3YB 3H1HJ 2QJKC 1L4AB 2R5BA 3FWLA 2YMYA 1W5CE 3KYQA 1SQPG 2OYIA 4L73A 1J2JB 3TDKA 1BGYG 2FFDB 1SQXJ 1NU1G 5KLIC 1AQ5A 4DT0A 1NKNA 5KLVD 5CBNA 5AVZB 2QE7H 1L2PA 3WUUA 1SQVE 1YJWP 2IYOA 1SVFA 4DCKA 3HD7D 1DD4A 3C9IA 1RQVA 3AEFC 4A7PA 2KXPB 1NYHA 1JTHB 4PD4E 1LTIC 1MFZA 3CMAP 1PP9E 4Z1MH 2WPVB 2N9YB 5KKZB 1PFIA 2FYUE 3NFQA 2KYVA 4JYCA 4Y28J 1YI2P 1N8RQ 3CCJP 1Z56A 3SFDC 4XE5B 1ZN5A 5BU5A 3P8CE 1L0LK 3CCRP 2BCCE 3V2NA 1OZHA 2FY8A 1NTMD 1PP9D 1NTZK 2XNXA 2Y9YA 5AW1B 2E74B 1MZ9A 1GU4A 3TYYA 2ZT9D 1BE3J 3AEBC 3L72J 4IL6X 1JCDA 3L73J 1VQ5P 4C7NA 3PHLA 1BCCG 1SQQE 5CHXA 2R5DA 3RK2B 5KJ7A 1PV3A 2WSFH 4UB8H 3P8CD 1GMJA 3FX0A 1GZLA 1LT1A 2N9BA 3O6QB 1QEXA 1USEA 4GDOA 2WSCJ 5B5EE 3OW2O 2CPBA 1HGVA 5AW3B 1LTGC 1J1DC 4B86A 1OVUA 1R8EA 3A0HH 2FFDA 2Q3EA 3II6A 1Q2NA 1NWQA 1NJIQ 3AE1C 4BXLA 1D7MA 5AVUB 1SFCB 1ZMEC 1ZP0C 3HTKA 3LIEA 2DW3A 1SQBE 1DX7A 1KZUB 2Q6QA 1E5WA 1SQVK 3H25A 4NPFX 1IZNB 3L70E 1GD2E 3G71P 2KS1B 3B5NB 4N78D 2WVRA 1RF0A 1IFPA 2XU6A 5APUA 3B4SA 4H13D 3HRNA 2A45I 3VYIA 3PRJA 3G6EP 1SQBD 2AEMA 5CCGC 1KILE 2A45H 1UIXA 3GMAA 1MKMA 5KJ7C 2Q5UA 3L70D 4OGQB 4NPEA 5K5GB 1M56D 3NMDA 3AEGC 3IFMA 3BATA 1L4AC 3SWKA 1PGPA 3EFGA 5L8RJ 1OIPA 1VF5D 2QJYB 1X79B 1X8YA 1U7MA 5KAFE 1S1CX 3V2PA 1L0LJ 1GW3A 1KILD 3H1HE 4GOEA 2XNDH 1KQGB 2B88A 1NTZJ 1K9MQ 1SQQK 1W2BO 1IO4A 3O6QA 1PPJG 3Q5SA 4R4MA 1A02J 4D6TD 1L0NG 1RF1B 1Y8AA 1SQXE 1R5SA 1KILA 2WZ7A 1SQPE 1OFCX 1XTGB 3L71G 1SFCA 2KLVA 1NU1E 1J1EB 2P10A 2HODB 1DD3A 1G1JA 1KB9H 5KKZC 3TNUA 2QEXP 2ZYGA 1SQXD 1YHQP 3ZDMA 2QJKB 2FYNB 4BRYA 3HUSB 5CMZA 3WU2E 1SQVJ 5E79H 2Y9ZA 5GTIH 3TSIA 2J59M 5TISE 1Q81Q 2E74C 1PL5A 4GIFA 5KLIB 4RJTA 1LWUB 1JOCA 1QL1A 4KJMA 5AVXB 3AE4C 1EDLA 3RK2C 1FOSE 3AEEC 1LTTC 3BCCJ 1BE3E 3L72E 2KI7B 2G8YA 3M91A 3L73E 1VQKP 3Q5PA 1M7LA 2L5GB 1NOHA 1H0TB 5AVYB 2HPCB 3HE4A 3P32A 4BWNA 2WSSH 5B66H 1M1JA 2FYUJ 1NTKG 3CX5I 1S72P 3HE5B 3A5TA 1T2KC 3GHGB 3KDPB 3CX5H 4RKUJ 3TF5A 2WITA 2E76B 3P8MC 2BCCJ 1BE3D 4U7JA 1USDA 3L72D 3MIWA 1G2CB 1MV8A 3L73D 3AECC 1GTWA 2NRGA 4YXWH 1RF1A 2E42A 3L75J 1IJDB 2C0WA 2JWAA 4DOJA 1SQQJ 5CJ4A 1AV1A 2D2CB 2IBZD 2WT7A 4PV1C 3B5NC 1EXIA 2ZXEB 3E1RA 4EDFA 1SQPK 3C1LA 1FDOA 3M0DA 1JUNA 5GTHH 5APXA 1LP1B 1JNMA 1QLED 3VMXA 4HKZH 3I55P 1LTSC 3CX5E 2IX7C 1KFMA 3MUDA 4UB6E 2UWJE 3PLNA 2OYOA 3CD6P 4PJ0E 1NO4A 4OGQC 3L74J 2Z5IA 3TGUG 2KOGA 3RK3C 3AE3C 5CCHC 1EXJA 4EIJA 2KK7A 5APWA 2QJYC 2WSFJ 2KSJA 2FXPA 2AEFA 3TGUJ 2J5UA 3WMM0 3U1AA 4ZKUA 2V7QH 1LT9B 3ITKA 3UIAA 1L0LE 4I1LA 1H0TA 3TK1A 4L76A 1S4XA 2RN0A 1IFJA 3G4SP 1NTZE 2GM4A 1VL2A 1U7JA 2ZJSE 4AQRD 1FZCB 4IL6E 2YKQA 3M9BA 2O01H 3ABVC 1Y47A 3RL0B 3GF3A 4C46A 2KB7P 5H2FE 1J1EC 5AW8B 3E7KA 2R3CA 2IYPA 3BASA 3SFEC 3Q3DA 1UIIA 2Q7CA 1L0LD 3S9OA 3H1LG 1IFNA 3CLQA 1NTZD 4IFFA 3P7KA 2WPSA 2FYNC 3L36A 3V6IA 3HUSC 1VQ6P 2IFMA 3M9HA 3L71E 1ZR2A 2H88C 4Y99B 3O8ZA 5CBOA 1DIPA 4N3YB 1CI6B 5M1BA 1LWUC 1PGQA 1LTAC 2KNCB 2W6BA 1SQPJ 4EI2A 1JY3O 1JY2P 3CWBG 4AUWA 1BGYJ 1LGHB 2H89C 4H0LB 3V2QA 1NU1J 2M3EA 1FE6A 1P84I 1JCCA 2O1JA 2JP3A 2B87A 2K3RA 2LXCB 1P84H 3BRTB 1NAYA 1YBKA 3BCCE 3GHGC 4OVNF 1GDTA 1SQVD 5BVZA 1BSNA 2E76C 3AE5C 1Q86Q 1OXZA 1JEKA 5AW4B 1KC8Q 3CXHH 2FXOA 5EFWB 1S2EA 3MTUE 3RL0g 1VQ7P 4PD4D 4XFJA 5KJ7D 2K9JA 3VMZA 3BCCD 3CL3D 1HJBA 2D2CC 1N7SB 1VQ8P 5APQA 3L75E 4LLHA 1DEBA 4O9BA 1U57A 2FYUD 5CCGA 4DZOA 4DJGA 3KPEA 2M5AA 3PH0A 3H1IG 2OYHC 2YKPA 4JQ0D 3MHVA 1JM0A 1LTJB 1YYCA 3H1KG 2KZIA 2BCCD 5DJUB 3CCLP 3QH9A 1BCCJ 1L0NK 1L4AA 2I8DA 4GT1A 3WUVA 3IN6A 1FJKA 3L75D 4QMAA 1PGJA 2HFED 3Q5RA 1SQQD 1CI6A 1VQMP 3L74E 4OWFA 1N7LA 2G3AA 2W83C 5C39A 1LT9C 3CCMP 4UB8E 1ZRTE 2MKVA 3IR9A 3M0AA 2A06G 1JTHA 3TGUE 5AW6B 4PV1B 3U59A 1DEEG 1S3JA 3L74D 1VPCA 1FZCC 2JKVA 1ZV8A 1OW8A 2PAJA 1YQ4C 3EFFK 3RL0C 3FXEA 3A0HE 2WMMA 2E74D 3C8VA 2FKWB 3CC7P 1ZRTD 3U1CA 1N73C 2W6JH 4U3FG 1ZR4A 3RK2D 1NTMK 3V5BA 2W8ZA 2BEQD 3RK3B 3NXSA 2P7JA 2FXMA 2Z4EA 3F89A 1XTCC 1HGZA 1NHLA 1NTKK 4U3FJ 3AE9C 3LW5H 3H1JG 4Y99C 4H44B 1KYOI 5KAIH 3SWFA 1QL2A 3M9QA 1FOSF 1KYOH 1FZGA 3A7OA 1LTBC 2ZFCA 2IZ0A 1NVOA 4EOTA 1OMIA 1SFCD 5AW9B 3W68A 3H1JJ 2OTJP 1T3UA 1GL2B 5AVQB 4H0LC 3AEAC 2LXBA 1T3JA 1EDJA 3GG2A 3NTNA 1SLQA 2P58A 2W90A 3VN0A 4WY4B 2OTKE 2WSEH 4ZKPA 3H1HD 1OWAA 1BGYE 2IPPA 5KLVG 1LJ2A 1L0NJ 1KB9I 1HH0A 1X22A 2V7QJ 4GOFA 4JBZA 3RK3E 2AEJA 1YQ3C 3RBXA 2P1JA 2HLOA 3KHUA 2BASA 1YITP 2KUBA 3L71J 1E79H 3BRVB 5AVRB 2PRRA 3MD0A 1PIXA 1SQPD 2KS1A 1T8ZA 1T6AA 1RQUA 1VQOP 2FYZA 3B5NA 2O01J 1EQ7A 2QG4A 1BGYD 4OGQD 2C9NY 3PP5A 1QVFO 3T97B 2OARA 2LKMA 1N7SC 1NU1D 1RE4C 1OVRA
chains in the Genus database with same CATH topology
2RMZA 2BCCD 2KNCB 4D6TD 2K9JB 2O3JA 3L75D 2Y0EA 3H1ID 3VMAA 3TGUD 2N9YB 5KKZB 2QJPB 2Y0CA 3TF5A 1SQQD 2YIUB 3H1KD 3GW6A 1PPJD 3ITKA 1BE3D 3L72D 1L0ND 1EZVD 3CX5D 1NTKD 3L73D 3CWBD 2RN0A 3H1JD 1KYOD 1SQVD 3GG2A 2JWAA 1P84D 1NTMD 1SQXD 1PP9D 3PRJA 2IBZD 3L71D 1SQBD 2A06D 3H1HD 1KB9D 3FWLA 4EDFA 2QJKB 5TJHA 2FYNB 3L70D 3PHLA 4PD4D 3L74D 1L0LD 3TDKA 2L91A 3BCCD 3CXHD 1NTZD 3KHUA 5KLIB 4RJTA 3PLNA 5KLVD 1SQPD 2KS1A 1ZRTD 1BCCD 2QJYB 4U3FD 2FYUD 2QG4A 1BGYD 2Y0DA 3H1LD 1NU1D 4A7PA 2Q3EA 3PTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RMZ A;  2BCC D;  2KNC B;  4D6T D;  2K9J B;  2O3J A;  3L75 D;  2Y0E A;  3H1I D;  3VMA A;  3TGU D;  2N9Y B;  5KKZ B;  2QJP B;  2Y0C A;  3TF5 A;  1SQQ D;  2YIU B;  3H1K D;  3GW6 A;  1PPJ D;  3ITK A;  1BE3 D;  3L72 D;  1L0N D;  1EZV D;  3CX5 D;  1NTK D;  3L73 D;  3CWB D;  2RN0 A;  3H1J D;  1KYO D;  1SQV D;  3GG2 A;  2JWA A;  1P84 D;  1NTM D;  1SQX D;  1PP9 D;  3PRJ A;  2IBZ D;  3L71 D;  1SQB D;  2A06 D;  3H1H D;  1KB9 D;  3FWL A;  4EDF A;  2QJK B;  5TJH A;  2FYN B;  3L70 D;  3PHL A;  4PD4 D;  3L74 D;  1L0L D;  3TDK A;  2L91 A;  3BCC D;  3CXH D;  1NTZ D;  3KHU A;  5KLI B;  4RJT A;  3PLN A;  5KLV D;  1SQP D;  2KS1 A;  1ZRT D;  1BCC D;  2QJY B;  4U3F D;  2FYU D;  2QG4 A;  1BGY D;  2Y0D A;  3H1L D;  1NU1 D;  4A7P A;  2Q3E A;  3PTZ A; 
#chains in the Genus database with same CATH topology
 5CCH D;  1RY3 A;  2YKO A;  3D6Y A;  3D6Z A;  2M3B A;  1FBM A;  1H89 A;  3VOP A;  3VP8 A;  3CCQ P;  2H7H A;  2QIW A;  1KB9 E;  4L74 A;  1NTM G;  1Q82 Q;  1LTJ C;  1PP9 G;  2WPR A;  3M06 A;  5CCH A;  5APV A;  3FXD A;  2JEE A;  4RES B;  2E75 B;  3Q2Y A;  1JY2 N;  1M8O B;  2W27 A;  3OAK A;  5AW2 B;  2WPQ A;  4W80 A;  4IOI H;  2M0B A;  5E79 E;  1NGM B;  1BCC E;  1VF5 C;  3L37 A;  5GTI E;  2B89 A;  2GA1 A;  2Q1K A;  1FZF A;  1K04 A;  1KB9 D;  1EC5 A;  1HWT C;  3AED C;  1URQ B;  2N1T B;  1NTK J;  2ZVN B;  3JCU H;  2AXT H;  2KP8 A;  3I56 P;  2K37 A;  5AW5 B;  1IK9 A;  3S1K A;  2YXR B;  4CPG A;  2YO3 A;  1S5L H;  1BCC D;  1GW4 A;  5B66 E;  2HOD A;  5BU8 B;  3VTP C;  1JO5 A;  2NPS B;  1Y9B A;  2OYH B;  1JY3 P;  1HF9 A;  3V4W A;  2OYI B;  2ZYA A;  2LR2 A;  4W7Z A;  1RHZ B;  3VMY A;  4I7Z B;  3JCU E;  2A06 E;  3HUS A;  3D71 A;  4LC1 A;  3R2P A;  1M90 Q;  1GU5 A;  1SQB G;  3A0B H;  1LWU A;  3CX5 D;  1S5L E;  1KD1 Q;  1G1I A;  4H44 C;  2GUS A;  3L70 G;  5GTH E;  3IF4 A;  3AE7 C;  1AA0 A;  2JDI H;  3EWK A;  4U3F E;  2A06 D;  2E76 D;  2HR3 A;  3GLM A;  1GL2 C;  5TJH A;  2HPC A;  3WUT A;  2WQY C;  3HD7 B;  3HE5 A;  3GHG A;  2P67 A;  4WY4 C;  1ZW0 A;  3H1J E;  3SWY A;  4KHX A;  4TT3 H;  4YPC A;  1HTL C;  5CJ0 A;  5APY A;  4U3F D;  1G2C A;  2B9B A;  4D6T G;  2R44 A;  2Y0D A;  1N73 B;  1PPJ E;  3KQG A;  4L75 A;  1FZA A;  5AVW B;  1L0N E;  1MFT A;  4JYB A;  1Q90 D;  1BDD A;  4C7N B;  4I6M C;  3H1L J;  5AVS B;  4N6J A;  1LP1 A;  2W6A A;  4GOD A;  1ZOY C;  1ZLL A;  2BEZ F;  1SQX G;  1CSB A;  3S4R A;  2YIU B;  1FDI A;  3AE8 C;  1PPJ D;  3GW6 A;  2ZT9 B;  4W7Y A;  1VQL P;  2OYH A;  5KTB A;  1VQP P;  1L0N D;  1N2D C;  2ZYD A;  2V4H A;  1SP4 A;  1IFD A;  1PGO A;  4ZNC A;  4ZMD A;  4NPD A;  2KZJ A;  2K9Y A;  3L71 D;  1K8A Q;  2MJZ A;  3LW5 J;  3HTK B;  1KFN A;  2H43 A;  3W67 A;  3CWB J;  2E75 C;  1BSH A;  2YO2 A;  3N4X A;  4WWI A;  4IFD K;  1JMB A;  1S5L X;  1LT9 A;  2ITA A;  3CXH I;  2YXQ B;  1SS1 A;  3RL0 D;  1KN7 A;  1URQ C;  2N1T C;  2QRX A;  1NTM E;  5CCG D;  1X0T A;  4C7R A;  1YJ9 P;  1KOR A;  3B71 A;  4R4L A;  3HD7 A;  2WSE J;  1FZC A;  1RE3 C;  1NTK E;  5B5E H;  5AW0 B;  2O1K A;  3FWN A;  1BE3 G;  4JF7 A;  5APS A;  1L4A D;  3L72 G;  5AW7 B;  1P84 E;  3L73 G;  3OA7 A;  4AYC A;  3MP7 B;  2K1A A;  1R5L A;  2NPS C;  3LID A;  1N73 A;  4HB1 A;  4H13 B;  2IZ1 A;  2Y0C A;  2K88 A;  3A2A A;  2IBZ G;  2OYI C;  3JC2 2;  1PZQ A;  2E43 A;  2OTL P;  1VQ9 P;  2Q3I A;  1NTK D;  2VRS A;  4I7Z C;  1W2E A;  1M57 D;  2I1K A;  3CXH E;  1FS0 E;  3F5H A;  3H1I J;  4H0L D;  1P84 D;  1HUC A;  2Q9I A;  1FZE A;  3H1K J;  2IDB A;  3PJS K;  1TU3 F;  1VF5 B;  5KLV K;  3MGN A;  2KNC A;  4K3A A;  2QSI A;  1KIL B;  3I5C A;  2PP6 A;  1FU1 A;  1JB0 J;  1KV4 A;  1S9K E;  2C0X A;  3G3Z A;  2CPS A;  3CXH D;  4N78 E;  1FAV A;  4KT0 J;  2JWD A;  3HD7 C;  1YJN P;  1JY2 O;  3TNU B;  4ASV A;  2KIK A;  2XDJ A;  1WT6 A;  1N7S D;  2RMZ A;  1S9K D;  1NKZ B;  5KAF H;  2R32 A;  2E5T A;  4BRY B;  2M8R A;  3VMA A;  3TGU D;  1QX8 A;  4HH2 A;  2QJP B;  5AVV B;  1N7S A;  1RE4 A;  1KQF B;  3G9R A;  3B8E B;  1JY3 N;  2FYU K;  3GF7 A;  1EZV G;  3FGA D;  1L0L G;  1AVY A;  2Z5H A;  3CC2 P;  3CCV P;  2YIU C;  3AE2 C;  1T2K D;  4D6T E;  2ZT9 C;  1NTZ G;  4ASW A;  3HE4 B;  5AVT B;  3RGU A;  1M1J B;  1LTJ A;  3H1L E;  2ZVO B;  1IFM A;  3K5B A;  1N86 A;  2HG5 D;  2XKM A;  1JMM A;  2PGD A;  2FFD C;  1RH5 B;  1KTM A;  1X9V A;  1IK7 A;  5DJT B;  4YTP C;  4RO0 A;  2HYN A;  1KQL A;  2ZAE B;  4WBA A;  1AQT A;  3N7N A;  1QGK B;  2WWW A;  4PV1 D;  3WU2 H;  2O01 N;  3B5N D;  2AXC A;  3EQ2 A;  3H1L D;  5TIS H;  3KXD A;  1ZXG A;  2OGU A;  2WT7 B;  5KAI E;  1GK6 A;  1NAF A;  1QVG O;  4K35 A;  3L4F A;  3CWB E;  1IFI A;  1GK4 A;  3CME P;  1KYO E;  5KLV J;  4MN4 C;  1RF0 C;  1K73 Q;  2YNY A;  4OH8 B;  2RKL A;  2FBW C;  4WVZ A;  1SQV G;  1YTZ I;  2JR8 A;  4EYY Q;  1YIJ P;  3RK3 D;  1SQB K;  2IBZ I;  3CCU P;  1H88 A;  3CWB D;  3OJA B;  1EDI A;  4HJG H;  1KYO D;  2WSC H;  2H8P D;  2CK3 H;  4H13 C;  4H44 D;  1HJ0 A;  1AJY A;  1CZQ A;  3BCC G;  4IFM A;  3CC4 P;  2P2U A;  1KMI Z;  1M1K Q;  1VQN P;  1FC2 C;  1FJP A;  1VDF A;  2FYU G;  2QVA A;  1GL2 D;  2L91 A;  2E5Y A;  5APT A;  2YMK A;  1AVO A;  1NTM J;  1PP9 J;  1IC2 A;  4WY4 D;  3IAO A;  3H1I E;  2BCC G;  1BDC A;  3CCE P;  1KIL C;  3BVH A;  1AFO A;  3R4Y A;  2RH0 A;  2IBZ E;  4WB4 A;  3L75 G;  3H1K E;  1GL2 A;  1Q7Y Q;  4UB6 H;  3H32 B;  3V4Q A;  1SFC C;  3PTZ A;  2OQQ A;  1SQQ G;  4PJ0 H;  1OW7 A;  4LGD E;  2SPZ A;  3D70 A;  4YXD C;  4WY4 A;  1A02 F;  3SSU A;  2NZ2 A;  1K05 A;  2KSE A;  1DH3 A;  2O3J A;  2JJL A;  1CW5 A;  2R3S A;  3H1I D;  2POH A;  1FZB A;  2IFN A;  3RBZ A;  1SQX K;  1YTZ T;  1WRG A;  3H1K D;  4M3L A;  2GUV A;  2PFX A;  3E1I A;  1NH4 A;  1EZV I;  4XA4 A;  3MZW B;  3Q1M A;  3L74 G;  2AXT E;  2QJP C;  1FDM A;  1WMK A;  1NU1 K;  3CCS P;  2QM7 A;  3T97 A;  2WTY A;  1HVV A;  3H6P A;  3KZI H;  4I2L C;  4GKG A;  1OVV A;  4TLF A;  1OW6 A;  2C9L Y;  3VP9 A;  3AE6 C;  4IL6 H;  2E75 D;  1J1D B;  4JPZ B;  2XZR A;  3USS A;  2B87 B;  5H2F H;  1SQB J;  1M1J C;  1OX3 A;  2KLU A;  1URQ D;  2N1T D;  3L70 J;  2ZXX A;  3CPW O;  1H8A A;  1EZV E;  1KQS O;  3L35 A;  2D2C D;  1RF1 C;  3KZI E;  3JSV C;  2K9J B;  1URQ A;  2N1T A;  3A0B E;  2J58 A;  2Y0E A;  1LNQ A;  1EDK A;  3QWO C;  2NPS D;  2QA4 P;  3H32 A;  3M0D C;  3H1H G;  4HYT B;  1RE3 A;  1EZV D;  4D6T J;  3V2R A;  3CI9 A;  2M5A B;  1HBW A;  1MUU A;  3H1J D;  2JO1 A;  1VQ4 P;  3MUD C;  4PD4 I;  5KLV E;  2QM8 A;  4PD4 H;  2A45 G;  2XV5 A;  2I1J A;  2NPS A;  3A3Y B;  3H1H J;  2QJK C;  1L4A B;  2R5B A;  3FWL A;  2YMY A;  1W5C E;  3KYQ A;  1SQP G;  2OYI A;  4L73 A;  1J2J B;  3TDK A;  1BGY G;  2FFD B;  1SQX J;  1NU1 G;  5KLI C;  1AQ5 A;  4DT0 A;  1NKN A;  5KLV D;  5CBN A;  5AVZ B;  2QE7 H;  1L2P A;  3WUU A;  1SQV E;  1YJW P;  2IYO A;  1SVF A;  4DCK A;  3HD7 D;  1DD4 A;  3C9I A;  1RQV A;  3AEF C;  4A7P A;  2KXP B;  1NYH A;  1JTH B;  4PD4 E;  1LTI C;  1MFZ A;  3CMA P;  1PP9 E;  4Z1M H;  2WPV B;  2N9Y B;  5KKZ B;  1PFI A;  2FYU E;  3NFQ A;  2KYV A;  4JYC A;  4Y28 J;  1YI2 P;  1N8R Q;  3CCJ P;  1Z56 A;  3SFD C;  4XE5 B;  1ZN5 A;  5BU5 A;  3P8C E;  1L0L K;  3CCR P;  2BCC E;  3V2N A;  1OZH A;  2FY8 A;  1NTM D;  1PP9 D;  1NTZ K;  2XNX A;  2Y9Y A;  5AW1 B;  2E74 B;  1MZ9 A;  1GU4 A;  3TYY A;  2ZT9 D;  1BE3 J;  3AEB C;  3L72 J;  4IL6 X;  1JCD A;  3L73 J;  1VQ5 P;  4C7N A;  3PHL A;  1BCC G;  1SQQ E;  5CHX A;  2R5D A;  3RK2 B;  5KJ7 A;  1PV3 A;  2WSF H;  4UB8 H;  3P8C D;  1GMJ A;  3FX0 A;  1GZL A;  1LT1 A;  2N9B A;  3O6Q B;  1QEX A;  1USE A;  4GDO A;  2WSC J;  5B5E E;  3OW2 O;  2CPB A;  1HGV A;  5AW3 B;  1LTG C;  1J1D C;  4B86 A;  1OVU A;  1R8E A;  3A0H H;  2FFD A;  2Q3E A;  3II6 A;  1Q2N A;  1NWQ A;  1NJI Q;  3AE1 C;  4BXL A;  1D7M A;  5AVU B;  1SFC B;  1ZME C;  1ZP0 C;  3HTK A;  3LIE A;  2DW3 A;  1SQB E;  1DX7 A;  1KZU B;  2Q6Q A;  1E5W A;  1SQV K;  3H25 A;  4NPF X;  1IZN B;  3L70 E;  1GD2 E;  3G71 P;  2KS1 B;  3B5N B;  4N78 D;  2WVR A;  1RF0 A;  1IFP A;  2XU6 A;  5APU A;  3B4S A;  4H13 D;  3HRN A;  2A45 I;  3VYI A;  3PRJ A;  3G6E P;  1SQB D;  2AEM A;  5CCG C;  1KIL E;  2A45 H;  1UIX A;  3GMA A;  1MKM A;  5KJ7 C;  2Q5U A;  3L70 D;  4OGQ B;  4NPE A;  5K5G B;  1M56 D;  3NMD A;  3AEG C;  3IFM A;  3BAT A;  1L4A C;  3SWK A;  1PGP A;  3EFG A;  5L8R J;  1OIP A;  1VF5 D;  2QJY B;  1X79 B;  1X8Y A;  1U7M A;  5KAF E;  1S1C X;  3V2P A;  1L0L J;  1GW3 A;  1KIL D;  3H1H E;  4GOE A;  2XND H;  1KQG B;  2B88 A;  1NTZ J;  1K9M Q;  1SQQ K;  1W2B O;  1IO4 A;  3O6Q A;  1PPJ G;  3Q5S A;  4R4M A;  1A02 J;  4D6T D;  1L0N G;  1RF1 B;  1Y8A A;  1SQX E;  1R5S A;  1KIL A;  2WZ7 A;  1SQP E;  1OFC X;  1XTG B;  3L71 G;  1SFC A;  2KLV A;  1NU1 E;  1J1E B;  2P10 A;  2HOD B;  1DD3 A;  1G1J A;  1KB9 H;  5KKZ C;  3TNU A;  2QEX P;  2ZYG A;  1SQX D;  1YHQ P;  3ZDM A;  2QJK B;  2FYN B;  4BRY A;  3HUS B;  5CMZ A;  3WU2 E;  1SQV J;  5E79 H;  2Y9Z A;  5GTI H;  3TSI A;  2J59 M;  5TIS E;  1Q81 Q;  2E74 C;  1PL5 A;  4GIF A;  5KLI B;  4RJT A;  1LWU B;  1JOC A;  1QL1 A;  4KJM A;  5AVX B;  3AE4 C;  1EDL A;  3RK2 C;  1FOS E;  3AEE C;  1LTT C;  3BCC J;  1BE3 E;  3L72 E;  2KI7 B;  2G8Y A;  3M91 A;  3L73 E;  1VQK P;  3Q5P A;  1M7L A;  2L5G B;  1NOH A;  1H0T B;  5AVY B;  2HPC B;  3HE4 A;  3P32 A;  4BWN A;  2WSS H;  5B66 H;  1M1J A;  2FYU J;  1NTK G;  3CX5 I;  1S72 P;  3HE5 B;  3A5T A;  1T2K C;  3GHG B;  3KDP B;  3CX5 H;  4RKU J;  3TF5 A;  2WIT A;  2E76 B;  3P8M C;  2BCC J;  1BE3 D;  4U7J A;  1USD A;  3L72 D;  3MIW A;  1G2C B;  1MV8 A;  3L73 D;  3AEC C;  1GTW A;  2NRG A;  4YXW H;  1RF1 A;  2E42 A;  3L75 J;  1IJD B;  2C0W A;  2JWA A;  4DOJ A;  1SQQ J;  5CJ4 A;  1AV1 A;  2D2C B;  2IBZ D;  2WT7 A;  4PV1 C;  3B5N C;  1EXI A;  2ZXE B;  3E1R A;  4EDF A;  1SQP K;  3C1L A;  1FDO A;  3M0D A;  1JUN A;  5GTH H;  5APX A;  1LP1 B;  1JNM A;  1QLE D;  3VMX A;  4HKZ H;  3I55 P;  1LTS C;  3CX5 E;  2IX7 C;  1KFM A;  3MUD A;  4UB6 E;  2UWJ E;  3PLN A;  2OYO A;  3CD6 P;  4PJ0 E;  1NO4 A;  4OGQ C;  3L74 J;  2Z5I A;  3TGU G;  2KOG A;  3RK3 C;  3AE3 C;  5CCH C;  1EXJ A;  4EIJ A;  2KK7 A;  5APW A;  2QJY C;  2WSF J;  2KSJ A;  2FXP A;  2AEF A;  3TGU J;  2J5U A;  3WMM 0;  3U1A A;  4ZKU A;  2V7Q H;  1LT9 B;  3ITK A;  3UIA A;  1L0L E;  4I1L A;  1H0T A;  3TK1 A;  4L76 A;  1S4X A;  2RN0 A;  1IFJ A;  3G4S P;  1NTZ E;  2GM4 A;  1VL2 A;  1U7J A;  2ZJS E;  4AQR D;  1FZC B;  4IL6 E;  2YKQ A;  3M9B A;  2O01 H;  3ABV C;  1Y47 A;  3RL0 B;  3GF3 A;  4C46 A;  2KB7 P;  5H2F E;  1J1E C;  5AW8 B;  3E7K A;  2R3C A;  2IYP A;  3BAS A;  3SFE C;  3Q3D A;  1UII A;  2Q7C A;  1L0L D;  3S9O A;  3H1L G;  1IFN A;  3CLQ A;  1NTZ D;  4IFF A;  3P7K A;  2WPS A;  2FYN C;  3L36 A;  3V6I A;  3HUS C;  1VQ6 P;  2IFM A;  3M9H A;  3L71 E;  1ZR2 A;  2H88 C;  4Y99 B;  3O8Z A;  5CBO A;  1DIP A;  4N3Y B;  1CI6 B;  5M1B A;  1LWU C;  1PGQ A;  1LTA C;  2KNC B;  2W6B A;  1SQP J;  4EI2 A;  1JY3 O;  1JY2 P;  3CWB G;  4AUW A;  1BGY J;  1LGH B;  2H89 C;  4H0L B;  3V2Q A;  1NU1 J;  2M3E A;  1FE6 A;  1P84 I;  1JCC A;  2O1J A;  2JP3 A;  2B87 A;  2K3R A;  2LXC B;  1P84 H;  3BRT B;  1NAY A;  1YBK A;  3BCC E;  3GHG C;  4OVN F;  1GDT A;  1SQV D;  5BVZ A;  1BSN A;  2E76 C;  3AE5 C;  1Q86 Q;  1OXZ A;  1JEK A;  5AW4 B;  1KC8 Q;  3CXH H;  2FXO A;  5EFW B;  1S2E A;  3MTU E;  3RL0 g;  1VQ7 P;  4PD4 D;  4XFJ A;  5KJ7 D;  2K9J A;  3VMZ A;  3BCC D;  3CL3 D;  1HJB A;  2D2C C;  1N7S B;  1VQ8 P;  5APQ A;  3L75 E;  4LLH A;  1DEB A;  4O9B A;  1U57 A;  2FYU D;  5CCG A;  4DZO A;  4DJG A;  3KPE A;  2M5A A;  3PH0 A;  3H1I G;  2OYH C;  2YKP A;  4JQ0 D;  3MHV A;  1JM0 A;  1LTJ B;  1YYC A;  3H1K G;  2KZI A;  2BCC D;  5DJU B;  3CCL P;  3QH9 A;  1BCC J;  1L0N K;  1L4A A;  2I8D A;  4GT1 A;  3WUV A;  3IN6 A;  1FJK A;  3L75 D;  4QMA A;  1PGJ A;  2HFE D;  3Q5R A;  1SQQ D;  1CI6 A;  1VQM P;  3L74 E;  4OWF A;  1N7L A;  2G3A A;  2W83 C;  5C39 A;  1LT9 C;  3CCM P;  4UB8 E;  1ZRT E;  2MKV A;  3IR9 A;  3M0A A;  2A06 G;  1JTH A;  3TGU E;  5AW6 B;  4PV1 B;  3U59 A;  1DEE G;  1S3J A;  3L74 D;  1VPC A;  1FZC C;  2JKV A;  1ZV8 A;  1OW8 A;  2PAJ A;  1YQ4 C;  3EFF K;  3RL0 C;  3FXE A;  3A0H E;  2WMM A;  2E74 D;  3C8V A;  2FKW B;  3CC7 P;  1ZRT D;  3U1C A;  1N73 C;  2W6J H;  4U3F G;  1ZR4 A;  3RK2 D;  1NTM K;  3V5B A;  2W8Z A;  2BEQ D;  3RK3 B;  3NXS A;  2P7J A;  2FXM A;  2Z4E A;  3F89 A;  1XTC C;  1HGZ A;  1NHL A;  1NTK K;  4U3F J;  3AE9 C;  3LW5 H;  3H1J G;  4Y99 C;  4H44 B;  1KYO I;  5KAI H;  3SWF A;  1QL2 A;  3M9Q A;  1FOS F;  1KYO H;  1FZG A;  3A7O A;  1LTB C;  2ZFC A;  2IZ0 A;  1NVO A;  4EOT A;  1OMI A;  1SFC D;  5AW9 B;  3W68 A;  3H1J J;  2OTJ P;  1T3U A;  1GL2 B;  5AVQ B;  4H0L C;  3AEA C;  2LXB A;  1T3J A;  1EDJ A;  3GG2 A;  3NTN A;  1SLQ A;  2P58 A;  2W90 A;  3VN0 A;  4WY4 B;  2OTK E;  2WSE H;  4ZKP A;  3H1H D;  1OWA A;  1BGY E;  2IPP A;  5KLV G;  1LJ2 A;  1L0N J;  1KB9 I;  1HH0 A;  1X22 A;  2V7Q J;  4GOF A;  4JBZ A;  3RK3 E;  2AEJ A;  1YQ3 C;  3RBX A;  2P1J A;  2HLO A;  3KHU A;  2BAS A;  1YIT P;  2KUB A;  3L71 J;  1E79 H;  3BRV B;  5AVR B;  2PRR A;  3MD0 A;  1PIX A;  1SQP D;  2KS1 A;  1T8Z A;  1T6A A;  1RQU A;  1VQO P;  2FYZ A;  3B5N A;  2O01 J;  1EQ7 A;  2QG4 A;  1BGY D;  4OGQ D;  2C9N Y;  3PP5 A;  1QVF O;  3T97 B;  2OAR A;  2LKM A;  1N7S C;  1NU1 D;  1RE4 C;  1OVR A; 
#chains in the Genus database with same CATH homology
 2RMZ A;  2BCC D;  2KNC B;  4D6T D;  2K9J B;  2O3J A;  3L75 D;  2Y0E A;  3H1I D;  3VMA A;  3TGU D;  2N9Y B;  5KKZ B;  2QJP B;  2Y0C A;  3TF5 A;  1SQQ D;  2YIU B;  3H1K D;  3GW6 A;  1PPJ D;  3ITK A;  1BE3 D;  3L72 D;  1L0N D;  1EZV D;  3CX5 D;  1NTK D;  3L73 D;  3CWB D;  2RN0 A;  3H1J D;  1KYO D;  1SQV D;  3GG2 A;  2JWA A;  1P84 D;  1NTM D;  1SQX D;  1PP9 D;  3PRJ A;  2IBZ D;  3L71 D;  1SQB D;  2A06 D;  3H1H D;  1KB9 D;  3FWL A;  4EDF A;  2QJK B;  5TJH A;  2FYN B;  3L70 D;  3PHL A;  4PD4 D;  3L74 D;  1L0L D;  3TDK A;  2L91 A;  3BCC D;  3CXH D;  1NTZ D;  3KHU A;  5KLI B;  4RJT A;  3PLN A;  5KLV D;  1SQP D;  2KS1 A;  1ZRT D;  1BCC D;  2QJY B;  4U3F D;  2FYU D;  2QG4 A;  1BGY D;  2Y0D A;  3H1L D;  1NU1 D;  4A7P A;  2Q3E A;  3PTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...