2RMZA

Bicelle-embedded integrin beta3 transmembrane segment
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
43
structure length
43
Chain Sequence
PESPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Integrin beta3 Transmembrane Segment in Phospholipid Bicelles and Detergent Micelles
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin beta-3
total genus 14
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2007-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2rmzA00
1NU1D 3H1HD 3L75D 4A7PA 4RJTA 1L0LD 2IBZD 2KNCB 3ITKA 1SQQD 2RMZA 3H1ID 3BCCD 1PPJD 1SQBD 1KYOD 3FWLA 3L71D 2Q3EA 3GW6A 2L91A 3CXHD 4U3FD 3H1KD 3L73D 5KLIB 3H1JD 3PLNA 1NTZD 1P84D 3GG2A 1SQXD 1PP9D 3TDKA 1SQPD 4EDFA 5KKZB 1L0ND 2QJKB 3KHUA 5TJHA 1KB9D 3TF5A 1SQVD 2JWAA 1NTKD 2N9YB 2QG4A 2Y0CA 5KLVD 1BCCD 2O3JA 2Y0EA 3L72D 1BE3D 3L70D 3PHLA 1NTMD 2FYUD 3L74D 2K9JB 3PRJA 4PD4D 2RN0A 4D6TD 2QJYB 3TGUD 1ZRTD 2BCCD 3PTZA 3VMAA 2A06D 2KS1A 3CWBD 3H1LD 2Y0DA 2YIUB 1BGYD 2QJPB 1EZVD 3CX5D 2FYNB
chains in the Genus database with same CATH superfamily
2JR8A 4TLFA 4AQRD 4JPZB 4I1LA 1YJNP 1R5SA 1G2CB 2Q6QA 1P84E 3WUVA 1YBKA 2YNYA 3B4SA 4ASWA 2ZT9B 5AVWB 2L5GB 2POHA 3G6EP 5KLIB 2FYUK 4N3YB 1JOCA 3Q2YA 2PGDA 3TGUJ 4M3LA 1NGMB 3CCEP 1P84H 1N7SA 5KKZB 2YKOA 2Z4EA 5M1BA 3CWBJ 3H6PA 4OGQD 1RY3A 4EYYQ 1X8YA 2E76D 5CHXA 3GHGB 5GTHE 1NTKD 1GW4A 2PAJA 2NPSB 3HTKB 5CCHA 4LLHA 1KILE 2Z5HA 3KPEA 1L0NK 1PGPA 1EZVG 1KILB 2K9JB 3L74D 2MKVA 3P8CD 4NPDA 3S9OA 1PP9J 3L72G 1KILC 3G71P 2IFNA 1S4XA 1BCCE 1IFNA 3LW5H 1IZNB 1T3UA 4H44D 1KFNA 2KXPB 3FXEA 4HJGH 4U3FJ 2IBZD 2BCCE 4C7NB 2FFDA 2NPSD 3GMAA 3V2NA 3OW2O 1PP9G 1PL5A 3Q1MA 2QA4P 1KD1Q 4N78E 3GW6A 2IBZG 1S1CX 3NTNA 4U3FD 5KJ7D 2PFXA 1ZR4A 1M7LA 1RF1A 1T2KD 2Q3IA 3EFFK 3AEBC 1JTHA 1QL1A 2W6BA 4OWFA 2ZFCA 3G9RA 2M8RA 1J2JB 1JMMA 2I1JA 2K37A 4WY4A 4H13D 1AV1A 1LWUA 1PP9E 1VL2A 5EFWB 2FXOA 2QJKC 1NO4A 3H1LE 5AVXB 1PGOA 3TK1A 4H13C 1PFIA 1LTJA 4JQ0D 1RF1C 2XDJA 3AEGC 1ZRTD 3TYYA 5APYA 3V2QA 2QM7A 1PPJE 1JY3P 1VDFA 1VF5D 2N1TB 4L76A 4Y99C 4RJTA 1OMIA 1EQ7A 3H1KE 3L4FA 3GHGA 1N73A 5KLIC 3R4YA 1K05A 2B87B 2ZT9C 2E42A 1SQXJ 2V7QH 2H88C 2FYUG 1RF0A 2LXCB 4MN4C 4AUWA 1YQ4C 5DJUB 1SQXD 4JF7A 1JB0J 1N86A 1SQQK 1LTAC 2GUSA 2G3AA 2YIUC 2K3RA 3CXHE 3CCSP 1KC8Q 3H1KG 3WMM0 1AJYA 1GDTA 1BCCG 3GHGC 2FYUJ 3VOPA 1VQKP 4DT0A 4HH2A 3A0HH 3USSA 1H8AA 1L0NE 1PGQA 2AEMA 1P84I 1SFCC 1HGVA 1D7MA 2W8ZA 4I6MC 4YTPC 2RN0A 2B9BA 3H1KJ 4PD4I 3BRTB 5AW5B 5GTHH 1N7SC 3EQ2A 2R3CA 1GL2C 3P7KA 1XTGB 1VQ6P 1S3JA 1JTHB 1KQGB 3CX5D 4YPCA 2MJZA 3M9BA 3Q5RA 3L70G 2OARA 1SQVJ 1A02F 1VQLP 3RK3C 2K88A 3HD7C 1JO5A 1EDKA 1SQPJ 2RH0A 4EOTA 4K35A 4UB8E 1NU1G 1G1JA 2QE7H 3H1JD 2GUVA 1SLQA 1NU1K 5E79E 1H88A 1RE3C 1W5CE 3H1IE 1LP1A 1LTIC 1Q7YQ 1K73Q 1DD4A 3HTKA 1M57D 4WVZA 1QEXA 5AVVB 3KHUA 5CBOA 3CCMP 2OYIC 3L72J 3E1RA 1NU1J 1ZW0A 1JCCA 1OWAA 5AVZB 1ZMEC 3AE5C 1UIIA 5E79H 3L72D 3PHLA 1LP1B 1VQ8P 2ZYGA 1LWUB 1RF0C 3RL0B 3MIWA 2YXQB 4H0LC 1T2KC 1L0LE 2JEEA 3AE6C 5KJ7C 2K9YA 3CWBD 4Z1MH 2Y0DA 2ZYDA 3C9IA 1ZXGA 4PJ0E 1MFTA 1NTME 2J58A 3CXHH 4W80A 3CCRP 1QVFO 2ZXEB 3L75D 4PV1B 3HUSA 4D6TE 5AVYB 3ITKA 5KAIE 2WQYC 1MFZA 1OVVA 4ZNCA 1HF9A 1SQXE 4WWIA 3FWLA 5BVZA 2AEFA 5AVRB 1GK6A 3N7NA 3ZDMA 4NPFX 3KXDA 2ZYAA 3FX0A 3OJAB 1K8AQ 5B66H 3CD6P 4GDOA 2Q9IA 4PJ0H 3AE7C 1S9KD 2HR3A 5APXA 5KLVE 2W6JH 3HE5B 3SWKA 1FZCB 1HWTC 1FJPA 4C7NA 1KTMA 1BE3J 1S5LX 3L70J 4U7JA 2JWAA 2N9YB 1FZCC 1KYOH 5AVTB 2P2UA 3GLMA 2NPSA 1YYCA 1BE3D 2Y0EA 3L70D 3OAKA 1Q81Q 1A02J 1H0TA 3LIDA 3CL3D 1SQVE 3KZIE 3CXHI 2XNXA 1Y9BA 2A06D 3JSVC 4DZOA 1HVVA 1OVRA 4K3AA 3A5TA 2WITA 4HYTB 4QMAA 3BCCJ 5DJTB 1NTMG 1NAYA 3TGUG 3P8CE 5KLVK 1GU5A 3CWBG 3EFGA 3A3YB 1KB9I 1OZHA 1DEBA 3H1JE 1VQ9P 1DIPA 1H0TB 3FWNA 1OW8A 2XU6A 3BCCD 1NTZG 1IC2A 4I7ZB 1BGYE 3G3ZA 1IFMA 1X9VA 3H1HJ 3SFDC 3V2RA 1NU1E 3KZIH 1LTJC 1LT9B 1GD2E 2OYIB 2IDBA 1URQC 2VRSA 1IFIA 1FDOA 1N7SD 4N78D 1NTZJ 2OGUA 1J1DC 3A7OA 3MZWB 5AW3B 2Q5UA 2BEQD 2PP6A 2P1JA 2WPVB 4L73A 5AW8B 1J1DB 3CMAP 2LXBA 1JUNA 1S5LE 2A06G 2JKVA 4BRYB 3GF3A 3HE4A 4GIFA 2WWWA 2D2CC 1NTMD 1PIXA 1QL2A 2XV5A 2HG5D 2V4HA 1LJ2A 3H1LG 2IBZI 1LT9C 2IPPA 3PH0A 4JYCA 3RL0C 3B8EB 1FDIA 1HTLC 1L2PA 2WSFH 3H1LD 3PP5A 2OQQA 4HB1A 4KHXA 4PD4E 1S5LH 1YJWP 1AQTA 2KNCB 3U59A 1FOSF 1E5WA 5CCHC 2R5DA 1ZP0C 2AEJA 1FZGA 3V4WA 1U7JA 1W2EA 4H0LD 2OYOA 2G8YA 3GG2A 5AW9B 3RK2D 2KK7A 3IF4A 1FJKA 1GL2D 3M0DA 3I5CA 1H89A 1ZLLA 2A45H 4EI2A 4GOFA 3BVHA 2K1AA 1BE3E 1AVYA 1J1EC 3L70E 3TF5A 3SSUA 4H0LB 5K5GB 3CCJP 3P32A 2CK3H 2P7JA 4JBZA 2HFED 2P10A 1EXJA 1BDCA 2QVAA 1BCCD 1NTKK 1OXZA 2B87A 4UB6E 3T97A 3AE4C 2E76C 4WY4B 1URQA 2C0XA 1SQVK 3SWYA 1MUUA 3F89A 3CCUP 1VQ5P 3KDPB 1BDDA 1AQ5A 4OH8B 3RK3D 1OVUA 1ZV8A 3KYQA 1NU1D 4CPGA 1JNMA 1CSBA 4OVNF 3V6IA 1FBMA 5GTIE 2QEXP 1M8OB 4BXLA 1EC5A 1NYHA 3HE4B 3RK3B 1IFDA 3E1IA 4B86A 4C46A 2H8PD 3B5ND 4LC1A 2YXRB 5APQA 1KZUB 2O01H 1IK7A 2WPSA 1L4AD 1SQQG 3AEFC 2WPRA 2WSFJ 3L73G 3VTPC 3W67A 1U57A 2FYZA 1QLED 2WSCJ 4PD4H 1YTZI 3L37A 1BSHA 1LGHB 1YHQP 3C1LA 1MZ9A 2FXMA 5AW6B 4WBAA 2C0WA 1SQVG 2I8DA 5BU8B 3VN0A 4WB4A 1EZVE 2NRGA 1VPCA 2WTYA 1NAFA 3TGUD 1X0TA 2XKMA 1KN7A 4PV1C 3VMAA 1VQMP 2AXCA 3H1HG 1EDIA 3WUTA 2QM8A 1VQNP 2YIUB 1GZLA 1OFCX 1USEA 1M56D 2Z5IA 3L71G 4XA4A 1JY2O 1T3JA 2E75C 4IL6E 1LWUC 1QVGO 1K04A 3HD7D 5AW1B 3TNUB 4KJMA 1VF5C 2FY8A 4IOIH 3CXHD 3U1CA 1RHZB 3L75E 4UB6H 3C8VA 3I56P 1YIJP 2GM4A 4W7YA 2OTJP 3EWKA 1NTKE 3A0HE 3B5NA 3L71J 4GOEA 2N1TC 4H44C 4YXDC 1FZCA 4BRYA 4Y28J 3JC22 3S4RA 1FS0E 1KILD 2KLUA 3IN6A 3RL0D 3Q5PA 1VQPP 3L74E 2OTLP 1KV4A 1GMJA 3K5BA 4GT1A 2FFDC 1ZOYC 4XE5B 1SQXK 5KLVD 3BRVB 2V7QJ 1PV3A 1GK4A 2WSEH 3MUDA 1VQOP 1S72P 1NKNA 1URQD 2BCCD 3MTUE 3RBZA 3WU2E 3D70A 1FZFA 1YITP 1GL2B 3F5HA 1QX8A 4W7ZA 3RK2C 4ZMDA 1WT6A 2XZRA 1AA0A 2BCCJ 3H1HD 3KQGA 2WSEJ 5AVQB 1Q82Q 2K9JA 2FYNC 2A06E 4DCKA 1Z56A 2M0BA 3H1ID 3QWOC 1NTKJ 1HJBA 1SQBD 2OTKE 2R3SA 3IFMA 4I2LC 1SFCA 1WRGA 4DJGA 1JY3O 4GODA 1CI6A 2YKQA 1NTZD 3AEEC 3L74J 2CPSA 2KLVA 3LIEA 3MHVA 1OIPA 2HPCA 3BCCE 1PP9D 2YO2A 5GTIH 2C9NY 1GW3A 4L74A 3CMEP 2QJKB 3QH9A 4U3FG 1RE4C 1KB9D 1NTMJ 3M9QA 1K9MQ 2WSCH 3G4SP 3CWBE 4RESB 3D6ZA 2QRXA 1M90Q 2WMMA 4ZKPA 3L35A 2HODA 1DD3A 1R5LA 3HRNA 2QJYB 5B5EH 5CBNA 1GU4A 1YI2P 1LNQA 2WPQA 4Y99B 2H7HA 3H1IG 1OX3A 1SS1A 2FYNB 2FYUD 2W6AA 2KNCA 3VMYA 5CCGD 3I55P 5B66E 2Y9ZA 3CC7P 3CX5I 3L73J 2M3EA 1BCCJ 3AE8C 4H13B 5AW0B 4NPEA 1S9KE 3CCLP 3H1KD 2E75B 1SVFA 2O1KA 1ZN5A 3IR9A 2JO1A 1SQBG 3L73D 2OYHA 1CW5A 1IJDB 1P84D 2J5UA 2KUBA 3TDKA 2WT7A 1FE6A 1ZR2A 1AFOA 1IFPA 1KYOI 3M9HA 1L0ND 1NOHA 5KTBA 2KIKA 2H89C 2J59M 3O8ZA 1PGJA 1HH0A 1RH5B 1YTZT 1SQVD 3FXDA 3JCUH 3Q3DA 1VQ7P 1SQXG 3P8MC 2Y0CA 1HBWA 1Q86Q 2R44A 5KKZC 3L36A 1DH3A 1N7LA 4H44B 3D6YA 1T6AA 2O01N 1KMIZ 4UB8H 2HPCB 3H1HE 1KB9H 4EIJA 1RE3A 1PZQA 1JMBA 1EDJA 3CC2P 3RK2B 1KQSO 1EZVI 2E74D 1Q2NA 1L0LG 1VF5B 1UIXA 2N1TA 2N1TD 2IFMA 2R5BA 3CCVP 2KYVA 1RE4A 2RKLA 3VMXA 1EXIA 1N73B 2B89A 4XFJA 2A45I 3WU2H 2KSEA 1W2BO 3RK3E 2NPSC 3FGAD 3R2PA 1KB9E 2IBZE 4PV1D 5H2FH 2QIWA 3A2AA 1M1KQ 2DW3A 4N6JA 2ZXXA 2Q7CA 2KS1B 3AEAC 4RO0A 4U3FE 1T8ZA 3HUSC 3D71A 2JDIH 1S2EA 1JY3N 1SQPG 3M0AA 2ZAEB 3UIAA 1SQPK 1NHLA 1Y47A 1YQ3C 2P67A 1XTCC 1WMKA 3IAOA 3NFQA 4OGQB 4PD4D 2FYUE 4D6TD 5CCGA 4TT3H 1NTKG 1NTMK 1X79B 3WUUA 2HODB 3AEDC 3M0DC 5AW2B 1SQQJ 5APWA 1L0LK 2QJPB 1EZVD 1NVOA 2B88A 2ZT9D 2KOGA 3L74G 4A7PA 3L73E 1LTTC 3V4QA 1CI6B 1FU1A 1KORA 1L0LD 5B5EE 4JYBA 5CJ0A 3H25A 1SQQD 2AXTE 4RKUJ 1PPJD 1FDMA 1KYOE 1IK9A 3L71D 4GKGA 2L91A 1X22A 1FZBA 3L75G 2M5AA 1BSNA 1FZAA 1CZQA 2YO3A 2CPBA 3PLNA 1LT9A 2E76B 2JWDA 1JCDA 5CCGC 3RL0g 2O1JA 2AXTH 4L75A 3BASA 5TJHA 5KLVJ 5APVA 3E7KA 2ZJSE 2A45G 5AVUB 2WT7B 2ITAA 2M3BA 1IO4A 3H1IJ 2M5AB 1SFCD 1J1EB 1U7MA 2FKWB 2D2CB 2HLOA 2ZVNB 1LT1A 3L75J 2UWJE 3MGNA 5C39A 3U1AA 5CCHD 3PTZA 1M1JC 3LW5J 1OW6A 4R4MA 5APUA 2KSJA 3PRJA 2OYHC 2IYOA 5KLVG 1BGYG 3JCUE 3VP9A 5AVSB 3VP8A 1L4AB 3CCQP 3O6QA 2N9BA 3A0BH 1NWQA 2E5YA 4D6TG 4R4LA 1BE3G 1BGYD 3B5NB 1LTSC 1FZEA 1JM0A 1SQBJ 2KP8A 1MKMA 1NTZK 2Y9YA 2YMYA 2E75D 1KFMA 3II6A 4WY4C 2C9LY 3T97B 1BGYJ 2P58A 3MD0A 4IL6X 2KZIA 2Q3EA 1AVOA 2JJLA 2W27A 3A0BE 3CX5E 3O6QB 3OA7A 4O9BA 1DX7A 1KILA 3H1LJ 4YXWH 2R32A 3BCCG 4EDFA 2Q1KA 2E74C 2WSSH 2IYPA 1NTZE 2I1KA 1FC2C 4AYCA 2H43A 3AE2C 5H2FE 5TISE 1ZRTE 1M1JB 1SQPE 1NKZB 2BCCG 1KQLA 2IZ0A 4BWNA 3HD7A 2E74B 2WVRA 1HGZA 1EDLA 3SFEC 3NMDA 1E79H 4IL6H 1LTJB 2KB7P 2O01J 1IFJA 1OW7A 3ABVC 2KI7B 2IX7C 4OGQC 1SQQE 3RGUA 1RQUA 3L72E 3CC4P 1KYOD 3L71E 5CMZA 1N8RQ 3PJSK 4WY4D 1VQ4P 1RQVA 2ZVOB 2FXPA 4KT0J 3W68A 2SPZA 3SWFA 1LTBC 1L0NJ 1G1IA 1QGKB 3CLQA 5CJ4A 2FBWC 2OYHB 3AECC 1N2DC 5KJ7A 2JP3A 1TU3F 5KAIH 4IFDK 1Q90D 1MV8A 2GA1A 1L4AA 2PRRA 3AE3C 1G2CA 4HKZH 1URQB 3MP7B 1KQFB 2E43A 1N73C 1L0NG 5KAFE 3Q5SA 3TSIA 3TNUA 3VMZA 2O3JA 2QSIA 3H32B 3NXSA 4I7ZC 4IFMA 3CX5H 3HUSB 4ZKUA 2NZ2A 4DOJA 2KS1A 3B5NC 1USDA 1HJ0A 4C7RA 4ASVA 1NJIQ 2OYIA 1SQBE 1L4AC 2KZJA 1PPJG 2LR2A 5AW4B 5BU5A 2HYNA 2RMZA 3H1JG 3HD7B 4IFFA 3VYIA 1M1JA 5APSA 3MUDC 2FFDB 2E5TA 3V5BA 2W90A 1R8EA 3AE9C 1SQPD 1JY2P 1GL2A 1N7SB 1SQBK 5AW7B 3H1JJ 5L8RJ 2YKPA 3M06A 1L0LJ 5APTA 1DEEG 3RBXA 3CPWO 1NH4A 3TGUE 2D2CD 2W83C 1LTGC 3M91A 1SFCB 2QG4A 4D6TJ 1SP4A 3H32A 3N4XA 2BASA 3S1KA 1YJ9P 1GTWA 1FOSE 1JY2N 1JEKA 1HUCA 2IZ1A 1FAVA 3V2PA 2QJYC 3GF7A 2WZ7A 3BATA 5KAFH 1RF1B 2YMKA 2QJPC 3B71A 3HE5A 2XNDH 2BEZF 4LGDE 5TISH 2LKMA 3CI9A 3AE1C 1Y8AA
chains in the Genus database with same CATH topology
1NU1D 3H1HD 3L75D 4A7PA 4RJTA 1L0LD 2IBZD 2KNCB 3ITKA 1SQQD 2RMZA 3H1ID 3BCCD 1PPJD 1SQBD 1KYOD 3FWLA 3L71D 2Q3EA 3GW6A 2L91A 3CXHD 4U3FD 3H1KD 3L73D 5KLIB 3H1JD 3PLNA 1NTZD 1P84D 3GG2A 1SQXD 1PP9D 3TDKA 1SQPD 4EDFA 5KKZB 1L0ND 2QJKB 3KHUA 5TJHA 1KB9D 3TF5A 1SQVD 2JWAA 1NTKD 2N9YB 2QG4A 2Y0CA 5KLVD 1BCCD 2O3JA 2Y0EA 3L72D 1BE3D 3L70D 3PHLA 1NTMD 2FYUD 3L74D 2K9JB 3PRJA 4PD4D 2RN0A 4D6TD 2QJYB 3TGUD 1ZRTD 2BCCD 3PTZA 3VMAA 2A06D 2KS1A 3CWBD 3H1LD 2Y0DA 2YIUB 1BGYD 2QJPB 1EZVD 3CX5D 2FYNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NU1 D;  3H1H D;  3L75 D;  4A7P A;  4RJT A;  1L0L D;  2IBZ D;  2KNC B;  3ITK A;  1SQQ D;  2RMZ A;  3H1I D;  3BCC D;  1PPJ D;  1SQB D;  1KYO D;  3FWL A;  3L71 D;  2Q3E A;  3GW6 A;  2L91 A;  3CXH D;  4U3F D;  3H1K D;  3L73 D;  5KLI B;  3H1J D;  3PLN A;  1NTZ D;  1P84 D;  3GG2 A;  1SQX D;  1PP9 D;  3TDK A;  1SQP D;  4EDF A;  5KKZ B;  1L0N D;  2QJK B;  3KHU A;  5TJH A;  1KB9 D;  3TF5 A;  1SQV D;  2JWA A;  1NTK D;  2N9Y B;  2QG4 A;  2Y0C A;  5KLV D;  1BCC D;  2O3J A;  2Y0E A;  3L72 D;  1BE3 D;  3L70 D;  3PHL A;  1NTM D;  2FYU D;  3L74 D;  2K9J B;  3PRJ A;  4PD4 D;  2RN0 A;  4D6T D;  2QJY B;  3TGU D;  1ZRT D;  2BCC D;  3PTZ A;  3VMA A;  2A06 D;  2KS1 A;  3CWB D;  3H1L D;  2Y0D A;  2YIU B;  1BGY D;  2QJP B;  1EZV D;  3CX5 D;  2FYN B; 
#chains in the Genus database with same CATH topology
 2JR8 A;  4TLF A;  4AQR D;  4JPZ B;  4I1L A;  1YJN P;  1R5S A;  1G2C B;  2Q6Q A;  1P84 E;  3WUV A;  1YBK A;  2YNY A;  3B4S A;  4ASW A;  2ZT9 B;  5AVW B;  2L5G B;  2POH A;  3G6E P;  5KLI B;  2FYU K;  4N3Y B;  1JOC A;  3Q2Y A;  2PGD A;  3TGU J;  4M3L A;  1NGM B;  3CCE P;  1P84 H;  1N7S A;  5KKZ B;  2YKO A;  2Z4E A;  5M1B A;  3CWB J;  3H6P A;  4OGQ D;  1RY3 A;  4EYY Q;  1X8Y A;  2E76 D;  5CHX A;  3GHG B;  5GTH E;  1NTK D;  1GW4 A;  2PAJ A;  2NPS B;  3HTK B;  5CCH A;  4LLH A;  1KIL E;  2Z5H A;  3KPE A;  1L0N K;  1PGP A;  1EZV G;  1KIL B;  2K9J B;  3L74 D;  2MKV A;  3P8C D;  4NPD A;  3S9O A;  1PP9 J;  3L72 G;  1KIL C;  3G71 P;  2IFN A;  1S4X A;  1BCC E;  1IFN A;  3LW5 H;  1IZN B;  1T3U A;  4H44 D;  1KFN A;  2KXP B;  3FXE A;  4HJG H;  4U3F J;  2IBZ D;  2BCC E;  4C7N B;  2FFD A;  2NPS D;  3GMA A;  3V2N A;  3OW2 O;  1PP9 G;  1PL5 A;  3Q1M A;  2QA4 P;  1KD1 Q;  4N78 E;  3GW6 A;  2IBZ G;  1S1C X;  3NTN A;  4U3F D;  5KJ7 D;  2PFX A;  1ZR4 A;  1M7L A;  1RF1 A;  1T2K D;  2Q3I A;  3EFF K;  3AEB C;  1JTH A;  1QL1 A;  2W6B A;  4OWF A;  2ZFC A;  3G9R A;  2M8R A;  1J2J B;  1JMM A;  2I1J A;  2K37 A;  4WY4 A;  4H13 D;  1AV1 A;  1LWU A;  1PP9 E;  1VL2 A;  5EFW B;  2FXO A;  2QJK C;  1NO4 A;  3H1L E;  5AVX B;  1PGO A;  3TK1 A;  4H13 C;  1PFI A;  1LTJ A;  4JQ0 D;  1RF1 C;  2XDJ A;  3AEG C;  1ZRT D;  3TYY A;  5APY A;  3V2Q A;  2QM7 A;  1PPJ E;  1JY3 P;  1VDF A;  1VF5 D;  2N1T B;  4L76 A;  4Y99 C;  4RJT A;  1OMI A;  1EQ7 A;  3H1K E;  3L4F A;  3GHG A;  1N73 A;  5KLI C;  3R4Y A;  1K05 A;  2B87 B;  2ZT9 C;  2E42 A;  1SQX J;  2V7Q H;  2H88 C;  2FYU G;  1RF0 A;  2LXC B;  4MN4 C;  4AUW A;  1YQ4 C;  5DJU B;  1SQX D;  4JF7 A;  1JB0 J;  1N86 A;  1SQQ K;  1LTA C;  2GUS A;  2G3A A;  2YIU C;  2K3R A;  3CXH E;  3CCS P;  1KC8 Q;  3H1K G;  3WMM 0;  1AJY A;  1GDT A;  1BCC G;  3GHG C;  2FYU J;  3VOP A;  1VQK P;  4DT0 A;  4HH2 A;  3A0H H;  3USS A;  1H8A A;  1L0N E;  1PGQ A;  2AEM A;  1P84 I;  1SFC C;  1HGV A;  1D7M A;  2W8Z A;  4I6M C;  4YTP C;  2RN0 A;  2B9B A;  3H1K J;  4PD4 I;  3BRT B;  5AW5 B;  5GTH H;  1N7S C;  3EQ2 A;  2R3C A;  1GL2 C;  3P7K A;  1XTG B;  1VQ6 P;  1S3J A;  1JTH B;  1KQG B;  3CX5 D;  4YPC A;  2MJZ A;  3M9B A;  3Q5R A;  3L70 G;  2OAR A;  1SQV J;  1A02 F;  1VQL P;  3RK3 C;  2K88 A;  3HD7 C;  1JO5 A;  1EDK A;  1SQP J;  2RH0 A;  4EOT A;  4K35 A;  4UB8 E;  1NU1 G;  1G1J A;  2QE7 H;  3H1J D;  2GUV A;  1SLQ A;  1NU1 K;  5E79 E;  1H88 A;  1RE3 C;  1W5C E;  3H1I E;  1LP1 A;  1LTI C;  1Q7Y Q;  1K73 Q;  1DD4 A;  3HTK A;  1M57 D;  4WVZ A;  1QEX A;  5AVV B;  3KHU A;  5CBO A;  3CCM P;  2OYI C;  3L72 J;  3E1R A;  1NU1 J;  1ZW0 A;  1JCC A;  1OWA A;  5AVZ B;  1ZME C;  3AE5 C;  1UII A;  5E79 H;  3L72 D;  3PHL A;  1LP1 B;  1VQ8 P;  2ZYG A;  1LWU B;  1RF0 C;  3RL0 B;  3MIW A;  2YXQ B;  4H0L C;  1T2K C;  1L0L E;  2JEE A;  3AE6 C;  5KJ7 C;  2K9Y A;  3CWB D;  4Z1M H;  2Y0D A;  2ZYD A;  3C9I A;  1ZXG A;  4PJ0 E;  1MFT A;  1NTM E;  2J58 A;  3CXH H;  4W80 A;  3CCR P;  1QVF O;  2ZXE B;  3L75 D;  4PV1 B;  3HUS A;  4D6T E;  5AVY B;  3ITK A;  5KAI E;  2WQY C;  1MFZ A;  1OVV A;  4ZNC A;  1HF9 A;  1SQX E;  4WWI A;  3FWL A;  5BVZ A;  2AEF A;  5AVR B;  1GK6 A;  3N7N A;  3ZDM A;  4NPF X;  3KXD A;  2ZYA A;  3FX0 A;  3OJA B;  1K8A Q;  5B66 H;  3CD6 P;  4GDO A;  2Q9I A;  4PJ0 H;  3AE7 C;  1S9K D;  2HR3 A;  5APX A;  5KLV E;  2W6J H;  3HE5 B;  3SWK A;  1FZC B;  1HWT C;  1FJP A;  4C7N A;  1KTM A;  1BE3 J;  1S5L X;  3L70 J;  4U7J A;  2JWA A;  2N9Y B;  1FZC C;  1KYO H;  5AVT B;  2P2U A;  3GLM A;  2NPS A;  1YYC A;  1BE3 D;  2Y0E A;  3L70 D;  3OAK A;  1Q81 Q;  1A02 J;  1H0T A;  3LID A;  3CL3 D;  1SQV E;  3KZI E;  3CXH I;  2XNX A;  1Y9B A;  2A06 D;  3JSV C;  4DZO A;  1HVV A;  1OVR A;  4K3A A;  3A5T A;  2WIT A;  4HYT B;  4QMA A;  3BCC J;  5DJT B;  1NTM G;  1NAY A;  3TGU G;  3P8C E;  5KLV K;  1GU5 A;  3CWB G;  3EFG A;  3A3Y B;  1KB9 I;  1OZH A;  1DEB A;  3H1J E;  1VQ9 P;  1DIP A;  1H0T B;  3FWN A;  1OW8 A;  2XU6 A;  3BCC D;  1NTZ G;  1IC2 A;  4I7Z B;  1BGY E;  3G3Z A;  1IFM A;  1X9V A;  3H1H J;  3SFD C;  3V2R A;  1NU1 E;  3KZI H;  1LTJ C;  1LT9 B;  1GD2 E;  2OYI B;  2IDB A;  1URQ C;  2VRS A;  1IFI A;  1FDO A;  1N7S D;  4N78 D;  1NTZ J;  2OGU A;  1J1D C;  3A7O A;  3MZW B;  5AW3 B;  2Q5U A;  2BEQ D;  2PP6 A;  2P1J A;  2WPV B;  4L73 A;  5AW8 B;  1J1D B;  3CMA P;  2LXB A;  1JUN A;  1S5L E;  2A06 G;  2JKV A;  4BRY B;  3GF3 A;  3HE4 A;  4GIF A;  2WWW A;  2D2C C;  1NTM D;  1PIX A;  1QL2 A;  2XV5 A;  2HG5 D;  2V4H A;  1LJ2 A;  3H1L G;  2IBZ I;  1LT9 C;  2IPP A;  3PH0 A;  4JYC A;  3RL0 C;  3B8E B;  1FDI A;  1HTL C;  1L2P A;  2WSF H;  3H1L D;  3PP5 A;  2OQQ A;  4HB1 A;  4KHX A;  4PD4 E;  1S5L H;  1YJW P;  1AQT A;  2KNC B;  3U59 A;  1FOS F;  1E5W A;  5CCH C;  2R5D A;  1ZP0 C;  2AEJ A;  1FZG A;  3V4W A;  1U7J A;  1W2E A;  4H0L D;  2OYO A;  2G8Y A;  3GG2 A;  5AW9 B;  3RK2 D;  2KK7 A;  3IF4 A;  1FJK A;  1GL2 D;  3M0D A;  3I5C A;  1H89 A;  1ZLL A;  2A45 H;  4EI2 A;  4GOF A;  3BVH A;  2K1A A;  1BE3 E;  1AVY A;  1J1E C;  3L70 E;  3TF5 A;  3SSU A;  4H0L B;  5K5G B;  3CCJ P;  3P32 A;  2CK3 H;  2P7J A;  4JBZ A;  2HFE D;  2P10 A;  1EXJ A;  1BDC A;  2QVA A;  1BCC D;  1NTK K;  1OXZ A;  2B87 A;  4UB6 E;  3T97 A;  3AE4 C;  2E76 C;  4WY4 B;  1URQ A;  2C0X A;  1SQV K;  3SWY A;  1MUU A;  3F89 A;  3CCU P;  1VQ5 P;  3KDP B;  1BDD A;  1AQ5 A;  4OH8 B;  3RK3 D;  1OVU A;  1ZV8 A;  3KYQ A;  1NU1 D;  4CPG A;  1JNM A;  1CSB A;  4OVN F;  3V6I A;  1FBM A;  5GTI E;  2QEX P;  1M8O B;  4BXL A;  1EC5 A;  1NYH A;  3HE4 B;  3RK3 B;  1IFD A;  3E1I A;  4B86 A;  4C46 A;  2H8P D;  3B5N D;  4LC1 A;  2YXR B;  5APQ A;  1KZU B;  2O01 H;  1IK7 A;  2WPS A;  1L4A D;  1SQQ G;  3AEF C;  2WPR A;  2WSF J;  3L73 G;  3VTP C;  3W67 A;  1U57 A;  2FYZ A;  1QLE D;  2WSC J;  4PD4 H;  1YTZ I;  3L37 A;  1BSH A;  1LGH B;  1YHQ P;  3C1L A;  1MZ9 A;  2FXM A;  5AW6 B;  4WBA A;  2C0W A;  1SQV G;  2I8D A;  5BU8 B;  3VN0 A;  4WB4 A;  1EZV E;  2NRG A;  1VPC A;  2WTY A;  1NAF A;  3TGU D;  1X0T A;  2XKM A;  1KN7 A;  4PV1 C;  3VMA A;  1VQM P;  2AXC A;  3H1H G;  1EDI A;  3WUT A;  2QM8 A;  1VQN P;  2YIU B;  1GZL A;  1OFC X;  1USE A;  1M56 D;  2Z5I A;  3L71 G;  4XA4 A;  1JY2 O;  1T3J A;  2E75 C;  4IL6 E;  1LWU C;  1QVG O;  1K04 A;  3HD7 D;  5AW1 B;  3TNU B;  4KJM A;  1VF5 C;  2FY8 A;  4IOI H;  3CXH D;  3U1C A;  1RHZ B;  3L75 E;  4UB6 H;  3C8V A;  3I56 P;  1YIJ P;  2GM4 A;  4W7Y A;  2OTJ P;  3EWK A;  1NTK E;  3A0H E;  3B5N A;  3L71 J;  4GOE A;  2N1T C;  4H44 C;  4YXD C;  1FZC A;  4BRY A;  4Y28 J;  3JC2 2;  3S4R A;  1FS0 E;  1KIL D;  2KLU A;  3IN6 A;  3RL0 D;  3Q5P A;  1VQP P;  3L74 E;  2OTL P;  1KV4 A;  1GMJ A;  3K5B A;  4GT1 A;  2FFD C;  1ZOY C;  4XE5 B;  1SQX K;  5KLV D;  3BRV B;  2V7Q J;  1PV3 A;  1GK4 A;  2WSE H;  3MUD A;  1VQO P;  1S72 P;  1NKN A;  1URQ D;  2BCC D;  3MTU E;  3RBZ A;  3WU2 E;  3D70 A;  1FZF A;  1YIT P;  1GL2 B;  3F5H A;  1QX8 A;  4W7Z A;  3RK2 C;  4ZMD A;  1WT6 A;  2XZR A;  1AA0 A;  2BCC J;  3H1H D;  3KQG A;  2WSE J;  5AVQ B;  1Q82 Q;  2K9J A;  2FYN C;  2A06 E;  4DCK A;  1Z56 A;  2M0B A;  3H1I D;  3QWO C;  1NTK J;  1HJB A;  1SQB D;  2OTK E;  2R3S A;  3IFM A;  4I2L C;  1SFC A;  1WRG A;  4DJG A;  1JY3 O;  4GOD A;  1CI6 A;  2YKQ A;  1NTZ D;  3AEE C;  3L74 J;  2CPS A;  2KLV A;  3LIE A;  3MHV A;  1OIP A;  2HPC A;  3BCC E;  1PP9 D;  2YO2 A;  5GTI H;  2C9N Y;  1GW3 A;  4L74 A;  3CME P;  2QJK B;  3QH9 A;  4U3F G;  1RE4 C;  1KB9 D;  1NTM J;  3M9Q A;  1K9M Q;  2WSC H;  3G4S P;  3CWB E;  4RES B;  3D6Z A;  2QRX A;  1M90 Q;  2WMM A;  4ZKP A;  3L35 A;  2HOD A;  1DD3 A;  1R5L A;  3HRN A;  2QJY B;  5B5E H;  5CBN A;  1GU4 A;  1YI2 P;  1LNQ A;  2WPQ A;  4Y99 B;  2H7H A;  3H1I G;  1OX3 A;  1SS1 A;  2FYN B;  2FYU D;  2W6A A;  2KNC A;  3VMY A;  5CCG D;  3I55 P;  5B66 E;  2Y9Z A;  3CC7 P;  3CX5 I;  3L73 J;  2M3E A;  1BCC J;  3AE8 C;  4H13 B;  5AW0 B;  4NPE A;  1S9K E;  3CCL P;  3H1K D;  2E75 B;  1SVF A;  2O1K A;  1ZN5 A;  3IR9 A;  2JO1 A;  1SQB G;  3L73 D;  2OYH A;  1CW5 A;  1IJD B;  1P84 D;  2J5U A;  2KUB A;  3TDK A;  2WT7 A;  1FE6 A;  1ZR2 A;  1AFO A;  1IFP A;  1KYO I;  3M9H A;  1L0N D;  1NOH A;  5KTB A;  2KIK A;  2H89 C;  2J59 M;  3O8Z A;  1PGJ A;  1HH0 A;  1RH5 B;  1YTZ T;  1SQV D;  3FXD A;  3JCU H;  3Q3D A;  1VQ7 P;  1SQX G;  3P8M C;  2Y0C A;  1HBW A;  1Q86 Q;  2R44 A;  5KKZ C;  3L36 A;  1DH3 A;  1N7L A;  4H44 B;  3D6Y A;  1T6A A;  2O01 N;  1KMI Z;  4UB8 H;  2HPC B;  3H1H E;  1KB9 H;  4EIJ A;  1RE3 A;  1PZQ A;  1JMB A;  1EDJ A;  3CC2 P;  3RK2 B;  1KQS O;  1EZV I;  2E74 D;  1Q2N A;  1L0L G;  1VF5 B;  1UIX A;  2N1T A;  2N1T D;  2IFM A;  2R5B A;  3CCV P;  2KYV A;  1RE4 A;  2RKL A;  3VMX A;  1EXI A;  1N73 B;  2B89 A;  4XFJ A;  2A45 I;  3WU2 H;  2KSE A;  1W2B O;  3RK3 E;  2NPS C;  3FGA D;  3R2P A;  1KB9 E;  2IBZ E;  4PV1 D;  5H2F H;  2QIW A;  3A2A A;  1M1K Q;  2DW3 A;  4N6J A;  2ZXX A;  2Q7C A;  2KS1 B;  3AEA C;  4RO0 A;  4U3F E;  1T8Z A;  3HUS C;  3D71 A;  2JDI H;  1S2E A;  1JY3 N;  1SQP G;  3M0A A;  2ZAE B;  3UIA A;  1SQP K;  1NHL A;  1Y47 A;  1YQ3 C;  2P67 A;  1XTC C;  1WMK A;  3IAO A;  3NFQ A;  4OGQ B;  4PD4 D;  2FYU E;  4D6T D;  5CCG A;  4TT3 H;  1NTK G;  1NTM K;  1X79 B;  3WUU A;  2HOD B;  3AED C;  3M0D C;  5AW2 B;  1SQQ J;  5APW A;  1L0L K;  2QJP B;  1EZV D;  1NVO A;  2B88 A;  2ZT9 D;  2KOG A;  3L74 G;  4A7P A;  3L73 E;  1LTT C;  3V4Q A;  1CI6 B;  1FU1 A;  1KOR A;  1L0L D;  5B5E E;  4JYB A;  5CJ0 A;  3H25 A;  1SQQ D;  2AXT E;  4RKU J;  1PPJ D;  1FDM A;  1KYO E;  1IK9 A;  3L71 D;  4GKG A;  2L91 A;  1X22 A;  1FZB A;  3L75 G;  2M5A A;  1BSN A;  1FZA A;  1CZQ A;  2YO3 A;  2CPB A;  3PLN A;  1LT9 A;  2E76 B;  2JWD A;  1JCD A;  5CCG C;  3RL0 g;  2O1J A;  2AXT H;  4L75 A;  3BAS A;  5TJH A;  5KLV J;  5APV A;  3E7K A;  2ZJS E;  2A45 G;  5AVU B;  2WT7 B;  2ITA A;  2M3B A;  1IO4 A;  3H1I J;  2M5A B;  1SFC D;  1J1E B;  1U7M A;  2FKW B;  2D2C B;  2HLO A;  2ZVN B;  1LT1 A;  3L75 J;  2UWJ E;  3MGN A;  5C39 A;  3U1A A;  5CCH D;  3PTZ A;  1M1J C;  3LW5 J;  1OW6 A;  4R4M A;  5APU A;  2KSJ A;  3PRJ A;  2OYH C;  2IYO A;  5KLV G;  1BGY G;  3JCU E;  3VP9 A;  5AVS B;  3VP8 A;  1L4A B;  3CCQ P;  3O6Q A;  2N9B A;  3A0B H;  1NWQ A;  2E5Y A;  4D6T G;  4R4L A;  1BE3 G;  1BGY D;  3B5N B;  1LTS C;  1FZE A;  1JM0 A;  1SQB J;  2KP8 A;  1MKM A;  1NTZ K;  2Y9Y A;  2YMY A;  2E75 D;  1KFM A;  3II6 A;  4WY4 C;  2C9L Y;  3T97 B;  1BGY J;  2P58 A;  3MD0 A;  4IL6 X;  2KZI A;  2Q3E A;  1AVO A;  2JJL A;  2W27 A;  3A0B E;  3CX5 E;  3O6Q B;  3OA7 A;  4O9B A;  1DX7 A;  1KIL A;  3H1L J;  4YXW H;  2R32 A;  3BCC G;  4EDF A;  2Q1K A;  2E74 C;  2WSS H;  2IYP A;  1NTZ E;  2I1K A;  1FC2 C;  4AYC A;  2H43 A;  3AE2 C;  5H2F E;  5TIS E;  1ZRT E;  1M1J B;  1SQP E;  1NKZ B;  2BCC G;  1KQL A;  2IZ0 A;  4BWN A;  3HD7 A;  2E74 B;  2WVR A;  1HGZ A;  1EDL A;  3SFE C;  3NMD A;  1E79 H;  4IL6 H;  1LTJ B;  2KB7 P;  2O01 J;  1IFJ A;  1OW7 A;  3ABV C;  2KI7 B;  2IX7 C;  4OGQ C;  1SQQ E;  3RGU A;  1RQU A;  3L72 E;  3CC4 P;  1KYO D;  3L71 E;  5CMZ A;  1N8R Q;  3PJS K;  4WY4 D;  1VQ4 P;  1RQV A;  2ZVO B;  2FXP A;  4KT0 J;  3W68 A;  2SPZ A;  3SWF A;  1LTB C;  1L0N J;  1G1I A;  1QGK B;  3CLQ A;  5CJ4 A;  2FBW C;  2OYH B;  3AEC C;  1N2D C;  5KJ7 A;  2JP3 A;  1TU3 F;  5KAI H;  4IFD K;  1Q90 D;  1MV8 A;  2GA1 A;  1L4A A;  2PRR A;  3AE3 C;  1G2C A;  4HKZ H;  1URQ B;  3MP7 B;  1KQF B;  2E43 A;  1N73 C;  1L0N G;  5KAF E;  3Q5S A;  3TSI A;  3TNU A;  3VMZ A;  2O3J A;  2QSI A;  3H32 B;  3NXS A;  4I7Z C;  4IFM A;  3CX5 H;  3HUS B;  4ZKU A;  2NZ2 A;  4DOJ A;  2KS1 A;  3B5N C;  1USD A;  1HJ0 A;  4C7R A;  4ASV A;  1NJI Q;  2OYI A;  1SQB E;  1L4A C;  2KZJ A;  1PPJ G;  2LR2 A;  5AW4 B;  5BU5 A;  2HYN A;  2RMZ A;  3H1J G;  3HD7 B;  4IFF A;  3VYI A;  1M1J A;  5APS A;  3MUD C;  2FFD B;  2E5T A;  3V5B A;  2W90 A;  1R8E A;  3AE9 C;  1SQP D;  1JY2 P;  1GL2 A;  1N7S B;  1SQB K;  5AW7 B;  3H1J J;  5L8R J;  2YKP A;  3M06 A;  1L0L J;  5APT A;  1DEE G;  3RBX A;  3CPW O;  1NH4 A;  3TGU E;  2D2C D;  2W83 C;  1LTG C;  3M91 A;  1SFC B;  2QG4 A;  4D6T J;  1SP4 A;  3H32 A;  3N4X A;  2BAS A;  3S1K A;  1YJ9 P;  1GTW A;  1FOS E;  1JY2 N;  1JEK A;  1HUC A;  2IZ1 A;  1FAV A;  3V2P A;  2QJY C;  3GF7 A;  2WZ7 A;  3BAT A;  5KAF H;  1RF1 B;  2YMK A;  2QJP C;  3B71 A;  3HE5 A;  2XND H;  2BEZ F;  4LGD E;  5TIS H;  2LKM A;  3CI9 A;  3AE1 C;  1Y8A A; 
#chains in the Genus database with same CATH homology
 1NU1 D;  3H1H D;  3L75 D;  4A7P A;  4RJT A;  1L0L D;  2IBZ D;  2KNC B;  3ITK A;  1SQQ D;  2RMZ A;  3H1I D;  3BCC D;  1PPJ D;  1SQB D;  1KYO D;  3FWL A;  3L71 D;  2Q3E A;  3GW6 A;  2L91 A;  3CXH D;  4U3F D;  3H1K D;  3L73 D;  5KLI B;  3H1J D;  3PLN A;  1NTZ D;  1P84 D;  3GG2 A;  1SQX D;  1PP9 D;  3TDK A;  1SQP D;  4EDF A;  5KKZ B;  1L0N D;  2QJK B;  3KHU A;  5TJH A;  1KB9 D;  3TF5 A;  1SQV D;  2JWA A;  1NTK D;  2N9Y B;  2QG4 A;  2Y0C A;  5KLV D;  1BCC D;  2O3J A;  2Y0E A;  3L72 D;  1BE3 D;  3L70 D;  3PHL A;  1NTM D;  2FYU D;  3L74 D;  2K9J B;  3PRJ A;  4PD4 D;  2RN0 A;  4D6T D;  2QJY B;  3TGU D;  1ZRT D;  2BCC D;  3PTZ A;  3VMA A;  2A06 D;  2KS1 A;  3CWB D;  3H1L D;  2Y0D A;  2YIU B;  1BGY D;  2QJP B;  1EZV D;  3CX5 D;  2FYN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...