2RMZA

Bicelle-embedded integrin beta3 transmembrane segment
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
43
structure length
43
Chain Sequence
PESPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin beta-3
publication title Structure of the Integrin beta3 Transmembrane Segment in Phospholipid Bicelles and Detergent Micelles
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 14
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2007-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2rmzA00
2FYUD 3GW6A 1PPJD 2QJYB 5TJHA 2Y0EA 4PD4D 3L75D 3L70D 2L91A 2KS1A 1NTKD 1SQPD 1KB9D 5KKZB 3VMAA 1BGYD 5KLIB 4EDFA 2FYNB 3H1JD 3PTZA 2QJKB 3H1HD 2YIUB 3H1KD 4A7PA 3L72D 1SQXD 4D6TD 1P84D 1SQVD 2KNCB 1NTZD 3L73D 1NTMD 3TF5A 2N9YB 1PP9D 3PHLA 1EZVD 1BE3D 3CX5D 2Y0DA 1KYOD 1ZRTD 3H1ID 1SQQD 2Y0CA 3ITKA 3PLNA 1NU1D 2O3JA 3PRJA 3CXHD 2BCCD 3H1LD 2Q3EA 3FWLA 2QG4A 3TDKA 3L71D 1BCCD 2IBZD 2QJPB 2JWAA 2RMZA 1SQBD 2A06D 3GG2A 3L74D 2K9JB 5KLVD 4RJTA 1L0LD 3TGUD 3BCCD 2RN0A 4U3FD 1L0ND 3KHUA 3CWBD
chains in the Genus database with same CATH superfamily
2E75C 2E75B 2YXQB 2C9LY 2SPZA 4YXWH 1DD4A 1DH3A 3HE4A 3A0HH 2WSFH 1LTSC 2BEQD 1M56D 2R44A 1NO4A 3H1HD 3E1RA 1K8AQ 1JTHB 3A3YB 2KOGA 1S5LE 4IFFA 1E79H 1EQ7A 1KQSO 1PP9D 2G8YA 1L4AA 3F5HA 5AW0B 1N7SC 3H1HE 4YTPC 1N7SB 1OFCX 1PZQA 4H13D 2FFDB 1DX7A 2W90A 3SWYA 1PP9E 4TLFA 2Q3IA 5TISH 3NTNA 5AVTB 4DJGA 1AVYA 3NFQA 3H32A 1LP1B 1USDA 1VQ4P 1H89A 3HTKB 3CCUP 1RE4C 3HE5A 1QL1A 1OMIA 3PJSK 3I5CA 4MN4C 1ZMEC 3QH9A 1VQ9P 2HPCB 1LT1A 2JR8A 1FU1A 2DW3A 2G3AA 3CCQP 2P58A 2CPSA 2K9JA 1RY3A 2FYUG 3U1AA 2XNDH 4K35A 3GLMA 2E75D 2WT7A 1R5SA 5AW4B 1MUUA 3G3ZA 1VL2A 3TGUG 2PFXA 1L0NG 1FZGA 2JJLA 2R3CA 2HODA 4H44C 1NTZD 3L75G 2W6JH 4EOTA 1SQVJ 1BE3D 3MHVA 5DJTB 1ZP0C 4WY4A 2B89A 2LXCB 2CPBA 1KFNA 1AFOA 1NTZE 3H1JG 1PGQA 1N7SD 4PD4H 2R3SA 1BE3E 3FWLA 4BRYB 5CCHA 1GW4A 1G1JA 2WPRA 1P84I 5E79E 1ZR4A 5KLVD 2WTYA 2IBZI 2WWWA 2A06G 3PH0A 3CX5I 3B8EB 2RN0A 3AE9C 3EQ2A 1E5WA 1LT9A 3WU2E 5KLVE 2N1TC 3M0DC 1ZN5A 1CI6A 2N1TB 1NTZK 3JC22 5TJHA 4XA4A 2IX7C 3JCUE 2I1KA 1JY2P 2KP8A 4PJ0H 3CCSP 3OAKA 1NWQA 3M9BA 1VQ8P 1SS1A 1KV4A 3M06A 3CCMP 1J1EC 1J1EB 1OZHA 3BCCG 3WMM0 5APWA 2KYVA 3PTZA 2C9NY 1KQGB 1S3JA 1WT6A 2XZRA 4ZKPA 2YMKA 3D70A 2MKVA 3H1HG 2OGUA 1KZUB 3VP9A 5KLVK 1PFIA 1WMKA 1IK9A 1NTMJ 3AE1C 5B5EE 3VYIA 1PP9G 1IJDB 3GHGB 4H44D 2E74C 1VF5C 1VF5B 2MJZA 3BRTB 1PV3A 1NTZJ 4B86A 2W83C 2QM7A 5AW7B 1FZBA 5BU5A 3LIDA 3Q5SA 3AE3C 3KXDA 2XNXA 2OQQA 5KLIC 3N7NA 4HJGH 2E43A 1CW5A 2KK7A 2M8RA 5AW2B 4HYTB 3IAOA 2GUSA 2XKMA 5DJUB 2KS1A 1NTKD 2NPSC 2NPSB 4EI2A 2N1TD 1D7MA 1SQPJ 1FZAA 3A7OA 2E5YA 2OYIA 1NTKE 1FZFA 1QVGO 2QEXP 1FOSF 3FXDA 3G71P 2YO3A 4D6TD 4AUWA 5CJ4A 1R5LA 3CCRP 3OA7A 1J2JB 1GU5A 1IZNB 1EZVD 4W7YA 2RKLA 3E1IA 4RESB 1KB9I 1NTZG 1ZRTD 1BE3G 3R4YA 4D6TE 4EIJA 3D6YA 4RO0A 2JP3A 1K9MQ 1IFDA 3HD7A 1Q82Q 1EZVE 2KB7P 4W7ZA 4N6JA 1GL2A 1ZRTE 3CXHI 1SQBD 1JY3P 1NTKK 2E74D 1S5LH 5AVZB 1EDLA 5CJ0A 1VF5D 2A45I 1Q90D 4AQRD 1N73C 1N73B 5KLVG 3SWFA 2PP6A 2LKMA 2V4HA 1SQBE 2HYNA 2L5GB 2BCCG 4PJ0E 1X8YA 4U3FJ 2QJYC 4JBZA 2QJYB 1YIJP 3L71G 1ZXGA 2LR2A 2K9YA 1NKZB 1LWUC 1KORA 1LWUB 1QEXA 3GF3A 4OVNF 4ZNCA 2N9BA 2BASA 4IL6X 2NPSD 1LJ2A 2HR3A 1SQBK 4WVZA 4IFDK 5CCGA 3AE4C 2C0WA 4ASWA 3MTUE 3TNUA 1VQOP 1SQQK 3G6EP 2FFDA 1S9KD 3Q5RA 4GDOA 1VQPP 3VMYA 1JMBA 1YJ9P 5K5GB 3PLNA 1JY3O 1NU1D 1Y9BA 2Z4EA 2KI7B 1M1JC 1M1JB 3VN0A 1KTMA 2ZT9C 2YKQA 2KNCA 3H1IJ 5APXA 4C7NA 1URQC 2KSEA 1S9KE 1LP1A 1KILC 1LTIC 2GA1A 2IYPA 5APTA 1H88A 1NU1E 1RE4A 2Y9ZA 3KYQA 1BDCA 3L74J 1K73Q 2HPCA 3ABVC 2Z5HA 2IFMA 4I7ZC 4LC1A 4GODA 1N2DC 4WWIA 3RK2C 5AVWB 3RK2B 4JYCA 2AEJA 1GMJA 5AW3B 1YBKA 3MUDA 1VQ6P 1PGPA 1BSNA 1SFCC 1NOHA 2FYZA 3R2PA 5E79H 2JO1A 1NU1K 1BGYD 1NTKG 3AE5C 1T3JA 3QWOC 4BWNA 1EXJA 3CWBG 1OW6A 2K1AA 2GM4A 3WU2H 1BGYE 1P84D 1SQVD 5KAFE 2M5AA 4U7JA 3RL0C 3RL0B 2FXPA 3JCUH 4D6TG 3CX5D 5KAIE 4L73A 1OW8A 1P84E 1SQVE 4GT1A 4N3YB 4N78D 1VDFA 4BRYA 3L35A 3CX5E 3TDKA 3V4QA 1ZW0A 3B5NA 1LNQA 2ZT9D 4N78E 3KPEA 3A0BE 1HGZA 1URQD 1SQBG 4EYYQ 1G2CB 1HVVA 1IC2A 1KILD 1LTJC 3W68A 4C46A 1S72P 1LTJB 1KYOI 1SQQG 2I8DA 1NU1J 5B5EH 1MZ9A 4JQ0D 2HFED 1DIPA 2B9BA 1PPJD 5B66E 5KTBA 2IFNA 1JM0A 1KILE 1SQVK 1X79B 1X9VA 4RKUJ 2ZYDA 1FS0E 2OYHA 3CC4P 1G1IA 1M1KQ 2QE7H 3T97B 4L76A 3RK2D 1PPJE 1T2KC 2WPSA 1M8OB 3NXSA 1YTZT 2OTKE 1SFCD 4A7PA 1OXZA 1JY2N 2KSJA 2W27A 3K5BA 1NTMD 1FJKA 2E5TA 4NPEA 3P7KA 1OIPA 5KJ7A 2M0BA 1PGJA 3GHGA 1BGYJ 5AVUB 3CC2P 4BXLA 3S9OA 4HKZH 1N8RQ 1NTME 3RL0D 1FE6A 3MGNA 3G9RA 4JYBA 1NU1G 2YKPA 1ZOYC 4H44B 3H1LJ 4R4MA 4GOEA 1FZCC 2D2CC 4AYCA 1FZCB 2D2CB 1HJ0A 1RF0A 1GU4A 4RJTA 1S5LX 3EFFK 1K05A 2IPPA 1W2BO 2H43A 3MP7B 1NTMK 1YITP 2K37A 2J58A 3Q2YA 2L91A 1AA0A 3BVHA 2ZYGA 1KB9D 1SQPD 2H89C 2AXTH 2P2UA 3A2AA 1RE3A 1RF1A 1VQNP 1HH0A 4Y99C 5GTIH 4Y99B 1KB9E 1SQPE 1Y47A 3AECC 1YHQP 4R4LA 1S1CX 4QMAA 1QGKB 1T2KD 1IFMA 1SQXD 2W6BA 3HUSA 1FDMA 3V2QA 1JEKA 3H32B 1SQVG 2PAJA 2H7HA 1FDIA 1UIXA 1SQXE 3ITKA 1M7LA 2FXOA 5AW8B 3BRVB 1GTWA 2Q6QA 5BVZA 5CBNA 3CD6P 2JWAA 1SQPK 3M0AA 2V7QJ 2K9JB 5AW1B 2JEEA 1W5CE 2WQYC 3UIAA 1IFIA 1NVOA 2OYOA 2D2CD 2E74B 1OVVA 2K3RA 4U3FD 2WVRA 1EDKA 3O6QA 2M3EA 3VP8A 1SQXK 1AV1A 1MV8A 1JY3N 3D6ZA 2E42A 2OTLP 1PPJG 4U3FE 1N7LA 2KLUA 2WSSH 3II6A 1U57A 2O1JA 1JB0J 2QSIA 5KLIB 3OJAB 1HJBA 2O1KA 2FYNC 4OGQC 2FYNB 4IOIH 4OGQB 3VTPC 4UB8E 1FBMA 4WY4C 3W67A 2P10A 4WY4B 1GK4A 2J59M 1EC5A 3NMDA 2I1JA 3WUTA 3PP5A 4DCKA 1L4AD 2KLVA 2HLOA 3L72J 3TF5A 3PHLA 2IZ0A 3CL3D 3IR9A 4HB1A 2Y0DA 1NTMG 5CCHC 4WB4A 1YQ3C 1BSHA 3H1ID 1AVOA 3B71A 5AW6B 5AVQB 1HUCA 1OW7A 1L2PA 3BATA 1H8AA 1SQXJ 1LT9C 2ZVOB 3C9IA 3H1IE 3B4SA 3L74D 1FDOA 2QA4P 3MZWB 1CI6B 2K88A 2Q1KA 3AEDC 1GK6A 5KAFH 2QIWA 2Q5UA 1SVFA 1A02F 3O8ZA 1JCDA 3WUUA 5KAIH 3SFEC 4I6MC 3LW5J 2QG4A 4L75A 3L74E 1P84H 2VRSA 2P7JA 3CCEP 2KUBA 2ZAEB 2AXTE 3CX5H 2Y0EA 1KQFB 3VMZA 3SWKA 2KXPB 1NH4A 3I55P 4GIFA 4LLHA 1KQLA 5GTIE 5CBOA 5H2FE 3A0BH 1Q86Q 1GDTA 3RBXA 1MFZA 1SQPG 2J5UA 1U7JA 5C39A 1J1DC 1J1DB 5BU8B 3CCJP 1N86A 3H1KD 5M1BA 1SP4A 4OGQD 5B66H 2ZXXA 2WITA 4WY4D 5APYA 1M90Q 1OWAA 1SQXG 1CSBA 3H1KE 1KYOD 5CMZA 1JTHA 3KZIE 1IFPA 1NJIQ 5CCHD 1EDJA 1KYOE 1N7SA 1AJYA 4O9BA 1BCCJ 1G2CA 1AQ5A 2XV5A 3AEFC 2YXRB 3TGUD 4UB6E 1A02J 1LTAC 2FYUE 2ZT9B 3GF7A 1GZLA 1L0LJ 1URQB 1L0ND 2Q9IA 3Q5PA 1KILB 1Q81Q 2AXCA 1JMMA 1QX8A 4U3FG 3HTKA 1VQMP 2QJKC 3V6IA 3H25A 2LXBA 2V7QH 3TGUE 1SLQA 1T6AA 2OYIC 3V2RA 4TT3H 3IF4A 3L75D 1L0NE 4K3AA 3MD0A 1NYHA 2WPVB 2B87B 3AEBC 2ZYAA 1LTGC 4I7ZB 3H1JD 3L75E 2NZ2A 3FX0A 2FBWC 1Q2NA 3HD7C 1SFCB 4PD4I 3H1JE 1GL2C 1GL2B 4PV1C 4W80A 4PV1B 1ZLLA 2R5BA 2YO2A 1Q7YQ 3RBZA 3KDPB 1TU3F 1YQ4C 3H1LD 3H1IG 3FXEA 3H1KJ 1S4XA 1KB9H 2IBZD 1AQTA 2RMZA 4LGDE 1OVUA 3CI9A 3AE2C 1YJNP 3H1LE 1EZVG 2B88A 3L74G 3BCCD 4M3LA 2IBZE 5AVYB 3CXHH 1Z56A 1XTCC 3H6PA 2FYUJ 3BCCE 2A45H 1HGVA 3CPWO 3L70D 1FC2C 4GKGA 5CCGC 2PRRA 1HF9A 2ZXEB 3LW5H 4I2LC 4IFMA 3TGUJ 3TNUB 1DEBA 4DZOA 2FFDC 3L4FA 2R32A 2N1TA 3M0DA 1L0NJ 2Z5IA 3L70E 5CHXA 1EDIA 1T3UA 1H0TB 1WRGA 2KZIA 2KNCB 3H1KG 3L75J 4C7NB 2N9YB 4NPFX 1JOCA 1RHZB 3U59A 3HD7D 2QRXA 2BEZF 3AEEC 3H1JJ 1GL2D 4PV1D 4UB8H 3L36A 1EXIA 2GUVA 5AVXB 4Z1MH 3S4RA 2WSCJ 2ZFCA 3ZDMA 2E76C 2E76B 2OTJP 4CPGA 1OX3A 4KHXA 2Q7CA 3VMXA 3MUDC 1X22A 4ZMDA 2XU6A 2YKOA 2XDJA 1JNMA 4DOJA 3V2NA 4IL6H 3MIWA 3RL0g 5AVVB 4ZKUA 1RQUA 1NKNA 3VOPA 1VQ7P 5KKZC 5KKZB 2KZJA 1IK7A 3U1CA 3HE4B 1PGOA 3IFMA 3M9QA 1JO5A 1JUNA 3BCCJ 2M5AB 2KIKA 1VPCA 2R5DA 1XTGB 5CCGD 3L72D 2W6AA 3H1HJ 2NPSA 1RQVA 3L73D 3L70J 2O01J 1JCCA 1L4AC 3RK3C 3B5NC 1L4AB 3RK3B 3B5NB 1S2EA 1ZV8A 1PP9J 1KFMA 3L72E 1BGYG 4HH2A 5H2FH 2NRGA 3L73E 5APVA 3CXHD 2BCCD 2JKVA 1M57D 1KN7A 2Q3EA 2CK3H 2IYOA 3L71D 2QJPC 4DT0A 2WPQA 2QJPB 3H1LG 4JPZB 1ZR2A 4Y28J 4NPDA 3OW2O 2OARA 3P8MC 3A0HE 3CXHE 2IBZG 2BCCE 2ZJSE 2C0XA 2OYHC 3HE5B 2OYHB 3L71E 3AE7C 2FY8A 1GD2E 1NHLA 3F89A 2E76D 3KZIH 5EFWB 5APSA 1VQKP 3D71A 3AE8C 1MFTA 3C8VA 1CZQA 3AEAC 1KYOH 1N73A 1QL2A 2POHA 2WT7B 3L70G 3M91A 5GTHH 5KJ7C 2WSEJ 4UB6H 5TISE 1DEEG 3GHGC 2YIUC 2YIUB 1DD3A 4KT0J 3P8CD 1GW3A 2RH0A 1YYCA 2PGDA 2YNYA 1KMIZ 2JDIH 3V2PA 1LWUA 1HBWA 1IO4A 2HODB 2Y9YA 3FGAD 3P8CE 3RGUA 1RF0C 1BE3J 1T8ZA 3PRJA 1OVRA 1JY2O 3RK3D 3B5ND 2QVAA 4H0LC 4H0LB 2JWDA 1BCCD 1X0TA 1FOSE 3L73J 2H8PD 2IZ1A 4I1LA 3TK1A 3SFDC 1VQLP 1M1JA 4IL6E 3RK3E 3V5BA 1L0LD 3TYYA 2W8ZA 2AEMA 5KLVJ 1BCCE 1NAYA 1URQA 3C1LA 4C7RA 2WSFJ 1KILA 1PL5A 4XE5B 3CWBD 2BCCJ 2FXMA 4OH8B 3V4WA 1RE3C 4YPCA 1LT9B 3GW6A 2WSCH 1RF1C 1L0LE 1RF1B 3L71J 1MKMA 4PD4D 3CLQA 3CWBE 1UIIA 2H88C 1IFJA 2WZ7A 4JF7A 3HUSC 2B87A 3A5TA 2WMMA 3HUSB 1FAVA 1Y8AA 3G4SP 5AVRB 1R8EA 4EDFA 4PD4E 3Q1MA 2HG5D 3EFGA 1U7MA 2ZVNB 3M9HA 2FKWB 1HTLC 4KJMA 1W2EA 2AEFA 1SFCA 5KJ7D 3USSA 1IFNA 3CC7P 3L72G 1L0LK 3L37A 5L8RJ 3L73G 3FWNA 2O01N 2ITAA 1SQQD 1QLED 3CMEP 2O3JA 4ASVA 3AEGC 3TSIA 3IN6A 2QM8A 5AW9B 2UWJE 3I56P 2O01H 3CCVP 3HRNA 1SQQE 3O6QB 2M3BA 2YMYA 3GG2A 1VQ5P 3BASA 4YXDC 1RH5B 3GMAA 1YI2P 2A45G 4H0LD 5APQA 3KQGA 4XFJA 3KHUA 2FYUD 1NGMB 5APUA 1YJWP 3CMAP 1K04A 1USEA 5GTHE 1LTJA 3VMAA 2KS1B 1FJPA 1PIXA 3WUVA 1KD1Q 4OWFA 3E7KA 1NTKJ 5AW5B 3CWBJ 2QJKB 3N4XA 2OYIB 1H0TA 3JSVC 3T97A 4H13C 4H13B 3EWKA 4GOFA 1LTTC 4L74A 4D6TJ 2P67A 2IDBA 2WSEH 1HWTC 1NAFA 1YTZI 3AE6C 2Y0CA 1LTBC 2FYUK 1LGHB 1BDDA 2P1JA 4WBAA 1FZEA 3HD7B 1QVFO 3SSUA 2A06D 1KC8Q 1BCCG 3P32A 3Q3DA 1SQBJ 1L0NK 5AVSB 1EZVI 3S1KA 3LIEA 3CCLP 1SQQJ 2A06E 1L0LG 1FZCA
chains in the Genus database with same CATH topology
2FYUD 3GW6A 1PPJD 2QJYB 5TJHA 2Y0EA 4PD4D 3L75D 3L70D 2L91A 2KS1A 1NTKD 1SQPD 1KB9D 5KKZB 3VMAA 1BGYD 5KLIB 4EDFA 2FYNB 3H1JD 3PTZA 2QJKB 3H1HD 2YIUB 3H1KD 4A7PA 3L72D 1SQXD 4D6TD 1P84D 1SQVD 2KNCB 1NTZD 3L73D 1NTMD 3TF5A 2N9YB 1PP9D 3PHLA 1EZVD 1BE3D 3CX5D 2Y0DA 1KYOD 1ZRTD 3H1ID 1SQQD 2Y0CA 3ITKA 3PLNA 1NU1D 2O3JA 3PRJA 3CXHD 2BCCD 3H1LD 2Q3EA 3FWLA 2QG4A 3TDKA 3L71D 1BCCD 2IBZD 2QJPB 2JWAA 2RMZA 1SQBD 2A06D 3GG2A 3L74D 2K9JB 5KLVD 4RJTA 1L0LD 3TGUD 3BCCD 2RN0A 4U3FD 1L0ND 3KHUA 3CWBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU D;  3GW6 A;  1PPJ D;  2QJY B;  5TJH A;  2Y0E A;  4PD4 D;  3L75 D;  3L70 D;  2L91 A;  2KS1 A;  1NTK D;  1SQP D;  1KB9 D;  5KKZ B;  3VMA A;  1BGY D;  5KLI B;  4EDF A;  2FYN B;  3H1J D;  3PTZ A;  2QJK B;  3H1H D;  2YIU B;  3H1K D;  4A7P A;  3L72 D;  1SQX D;  4D6T D;  1P84 D;  1SQV D;  2KNC B;  1NTZ D;  3L73 D;  1NTM D;  3TF5 A;  2N9Y B;  1PP9 D;  3PHL A;  1EZV D;  1BE3 D;  3CX5 D;  2Y0D A;  1KYO D;  1ZRT D;  3H1I D;  1SQQ D;  2Y0C A;  3ITK A;  3PLN A;  1NU1 D;  2O3J A;  3PRJ A;  3CXH D;  2BCC D;  3H1L D;  2Q3E A;  3FWL A;  2QG4 A;  3TDK A;  3L71 D;  1BCC D;  2IBZ D;  2QJP B;  2JWA A;  2RMZ A;  1SQB D;  2A06 D;  3GG2 A;  3L74 D;  2K9J B;  5KLV D;  4RJT A;  1L0L D;  3TGU D;  3BCC D;  2RN0 A;  4U3F D;  1L0N D;  3KHU A;  3CWB D; 
#chains in the Genus database with same CATH topology
 2E75 C;  2E75 B;  2YXQ B;  2C9L Y;  2SPZ A;  4YXW H;  1DD4 A;  1DH3 A;  3HE4 A;  3A0H H;  2WSF H;  1LTS C;  2BEQ D;  1M56 D;  2R44 A;  1NO4 A;  3H1H D;  3E1R A;  1K8A Q;  1JTH B;  3A3Y B;  2KOG A;  1S5L E;  4IFF A;  1E79 H;  1EQ7 A;  1KQS O;  1PP9 D;  2G8Y A;  1L4A A;  3F5H A;  5AW0 B;  1N7S C;  3H1H E;  4YTP C;  1N7S B;  1OFC X;  1PZQ A;  4H13 D;  2FFD B;  1DX7 A;  2W90 A;  3SWY A;  1PP9 E;  4TLF A;  2Q3I A;  5TIS H;  3NTN A;  5AVT B;  4DJG A;  1AVY A;  3NFQ A;  3H32 A;  1LP1 B;  1USD A;  1VQ4 P;  1H89 A;  3HTK B;  3CCU P;  1RE4 C;  3HE5 A;  1QL1 A;  1OMI A;  3PJS K;  3I5C A;  4MN4 C;  1ZME C;  3QH9 A;  1VQ9 P;  2HPC B;  1LT1 A;  2JR8 A;  1FU1 A;  2DW3 A;  2G3A A;  3CCQ P;  2P58 A;  2CPS A;  2K9J A;  1RY3 A;  2FYU G;  3U1A A;  2XND H;  4K35 A;  3GLM A;  2E75 D;  2WT7 A;  1R5S A;  5AW4 B;  1MUU A;  3G3Z A;  1VL2 A;  3TGU G;  2PFX A;  1L0N G;  1FZG A;  2JJL A;  2R3C A;  2HOD A;  4H44 C;  1NTZ D;  3L75 G;  2W6J H;  4EOT A;  1SQV J;  1BE3 D;  3MHV A;  5DJT B;  1ZP0 C;  4WY4 A;  2B89 A;  2LXC B;  2CPB A;  1KFN A;  1AFO A;  1NTZ E;  3H1J G;  1PGQ A;  1N7S D;  4PD4 H;  2R3S A;  1BE3 E;  3FWL A;  4BRY B;  5CCH A;  1GW4 A;  1G1J A;  2WPR A;  1P84 I;  5E79 E;  1ZR4 A;  5KLV D;  2WTY A;  2IBZ I;  2WWW A;  2A06 G;  3PH0 A;  3CX5 I;  3B8E B;  2RN0 A;  3AE9 C;  3EQ2 A;  1E5W A;  1LT9 A;  3WU2 E;  5KLV E;  2N1T C;  3M0D C;  1ZN5 A;  1CI6 A;  2N1T B;  1NTZ K;  3JC2 2;  5TJH A;  4XA4 A;  2IX7 C;  3JCU E;  2I1K A;  1JY2 P;  2KP8 A;  4PJ0 H;  3CCS P;  3OAK A;  1NWQ A;  3M9B A;  1VQ8 P;  1SS1 A;  1KV4 A;  3M06 A;  3CCM P;  1J1E C;  1J1E B;  1OZH A;  3BCC G;  3WMM 0;  5APW A;  2KYV A;  3PTZ A;  2C9N Y;  1KQG B;  1S3J A;  1WT6 A;  2XZR A;  4ZKP A;  2YMK A;  3D70 A;  2MKV A;  3H1H G;  2OGU A;  1KZU B;  3VP9 A;  5KLV K;  1PFI A;  1WMK A;  1IK9 A;  1NTM J;  3AE1 C;  5B5E E;  3VYI A;  1PP9 G;  1IJD B;  3GHG B;  4H44 D;  2E74 C;  1VF5 C;  1VF5 B;  2MJZ A;  3BRT B;  1PV3 A;  1NTZ J;  4B86 A;  2W83 C;  2QM7 A;  5AW7 B;  1FZB A;  5BU5 A;  3LID A;  3Q5S A;  3AE3 C;  3KXD A;  2XNX A;  2OQQ A;  5KLI C;  3N7N A;  4HJG H;  2E43 A;  1CW5 A;  2KK7 A;  2M8R A;  5AW2 B;  4HYT B;  3IAO A;  2GUS A;  2XKM A;  5DJU B;  2KS1 A;  1NTK D;  2NPS C;  2NPS B;  4EI2 A;  2N1T D;  1D7M A;  1SQP J;  1FZA A;  3A7O A;  2E5Y A;  2OYI A;  1NTK E;  1FZF A;  1QVG O;  2QEX P;  1FOS F;  3FXD A;  3G71 P;  2YO3 A;  4D6T D;  4AUW A;  5CJ4 A;  1R5L A;  3CCR P;  3OA7 A;  1J2J B;  1GU5 A;  1IZN B;  1EZV D;  4W7Y A;  2RKL A;  3E1I A;  4RES B;  1KB9 I;  1NTZ G;  1ZRT D;  1BE3 G;  3R4Y A;  4D6T E;  4EIJ A;  3D6Y A;  4RO0 A;  2JP3 A;  1K9M Q;  1IFD A;  3HD7 A;  1Q82 Q;  1EZV E;  2KB7 P;  4W7Z A;  4N6J A;  1GL2 A;  1ZRT E;  3CXH I;  1SQB D;  1JY3 P;  1NTK K;  2E74 D;  1S5L H;  5AVZ B;  1EDL A;  5CJ0 A;  1VF5 D;  2A45 I;  1Q90 D;  4AQR D;  1N73 C;  1N73 B;  5KLV G;  3SWF A;  2PP6 A;  2LKM A;  2V4H A;  1SQB E;  2HYN A;  2L5G B;  2BCC G;  4PJ0 E;  1X8Y A;  4U3F J;  2QJY C;  4JBZ A;  2QJY B;  1YIJ P;  3L71 G;  1ZXG A;  2LR2 A;  2K9Y A;  1NKZ B;  1LWU C;  1KOR A;  1LWU B;  1QEX A;  3GF3 A;  4OVN F;  4ZNC A;  2N9B A;  2BAS A;  4IL6 X;  2NPS D;  1LJ2 A;  2HR3 A;  1SQB K;  4WVZ A;  4IFD K;  5CCG A;  3AE4 C;  2C0W A;  4ASW A;  3MTU E;  3TNU A;  1VQO P;  1SQQ K;  3G6E P;  2FFD A;  1S9K D;  3Q5R A;  4GDO A;  1VQP P;  3VMY A;  1JMB A;  1YJ9 P;  5K5G B;  3PLN A;  1JY3 O;  1NU1 D;  1Y9B A;  2Z4E A;  2KI7 B;  1M1J C;  1M1J B;  3VN0 A;  1KTM A;  2ZT9 C;  2YKQ A;  2KNC A;  3H1I J;  5APX A;  4C7N A;  1URQ C;  2KSE A;  1S9K E;  1LP1 A;  1KIL C;  1LTI C;  2GA1 A;  2IYP A;  5APT A;  1H88 A;  1NU1 E;  1RE4 A;  2Y9Z A;  3KYQ A;  1BDC A;  3L74 J;  1K73 Q;  2HPC A;  3ABV C;  2Z5H A;  2IFM A;  4I7Z C;  4LC1 A;  4GOD A;  1N2D C;  4WWI A;  3RK2 C;  5AVW B;  3RK2 B;  4JYC A;  2AEJ A;  1GMJ A;  5AW3 B;  1YBK A;  3MUD A;  1VQ6 P;  1PGP A;  1BSN A;  1SFC C;  1NOH A;  2FYZ A;  3R2P A;  5E79 H;  2JO1 A;  1NU1 K;  1BGY D;  1NTK G;  3AE5 C;  1T3J A;  3QWO C;  4BWN A;  1EXJ A;  3CWB G;  1OW6 A;  2K1A A;  2GM4 A;  3WU2 H;  1BGY E;  1P84 D;  1SQV D;  5KAF E;  2M5A A;  4U7J A;  3RL0 C;  3RL0 B;  2FXP A;  3JCU H;  4D6T G;  3CX5 D;  5KAI E;  4L73 A;  1OW8 A;  1P84 E;  1SQV E;  4GT1 A;  4N3Y B;  4N78 D;  1VDF A;  4BRY A;  3L35 A;  3CX5 E;  3TDK A;  3V4Q A;  1ZW0 A;  3B5N A;  1LNQ A;  2ZT9 D;  4N78 E;  3KPE A;  3A0B E;  1HGZ A;  1URQ D;  1SQB G;  4EYY Q;  1G2C B;  1HVV A;  1IC2 A;  1KIL D;  1LTJ C;  3W68 A;  4C46 A;  1S72 P;  1LTJ B;  1KYO I;  1SQQ G;  2I8D A;  1NU1 J;  5B5E H;  1MZ9 A;  4JQ0 D;  2HFE D;  1DIP A;  2B9B A;  1PPJ D;  5B66 E;  5KTB A;  2IFN A;  1JM0 A;  1KIL E;  1SQV K;  1X79 B;  1X9V A;  4RKU J;  2ZYD A;  1FS0 E;  2OYH A;  3CC4 P;  1G1I A;  1M1K Q;  2QE7 H;  3T97 B;  4L76 A;  3RK2 D;  1PPJ E;  1T2K C;  2WPS A;  1M8O B;  3NXS A;  1YTZ T;  2OTK E;  1SFC D;  4A7P A;  1OXZ A;  1JY2 N;  2KSJ A;  2W27 A;  3K5B A;  1NTM D;  1FJK A;  2E5T A;  4NPE A;  3P7K A;  1OIP A;  5KJ7 A;  2M0B A;  1PGJ A;  3GHG A;  1BGY J;  5AVU B;  3CC2 P;  4BXL A;  3S9O A;  4HKZ H;  1N8R Q;  1NTM E;  3RL0 D;  1FE6 A;  3MGN A;  3G9R A;  4JYB A;  1NU1 G;  2YKP A;  1ZOY C;  4H44 B;  3H1L J;  4R4M A;  4GOE A;  1FZC C;  2D2C C;  4AYC A;  1FZC B;  2D2C B;  1HJ0 A;  1RF0 A;  1GU4 A;  4RJT A;  1S5L X;  3EFF K;  1K05 A;  2IPP A;  1W2B O;  2H43 A;  3MP7 B;  1NTM K;  1YIT P;  2K37 A;  2J58 A;  3Q2Y A;  2L91 A;  1AA0 A;  3BVH A;  2ZYG A;  1KB9 D;  1SQP D;  2H89 C;  2AXT H;  2P2U A;  3A2A A;  1RE3 A;  1RF1 A;  1VQN P;  1HH0 A;  4Y99 C;  5GTI H;  4Y99 B;  1KB9 E;  1SQP E;  1Y47 A;  3AEC C;  1YHQ P;  4R4L A;  1S1C X;  4QMA A;  1QGK B;  1T2K D;  1IFM A;  1SQX D;  2W6B A;  3HUS A;  1FDM A;  3V2Q A;  1JEK A;  3H32 B;  1SQV G;  2PAJ A;  2H7H A;  1FDI A;  1UIX A;  1SQX E;  3ITK A;  1M7L A;  2FXO A;  5AW8 B;  3BRV B;  1GTW A;  2Q6Q A;  5BVZ A;  5CBN A;  3CD6 P;  2JWA A;  1SQP K;  3M0A A;  2V7Q J;  2K9J B;  5AW1 B;  2JEE A;  1W5C E;  2WQY C;  3UIA A;  1IFI A;  1NVO A;  2OYO A;  2D2C D;  2E74 B;  1OVV A;  2K3R A;  4U3F D;  2WVR A;  1EDK A;  3O6Q A;  2M3E A;  3VP8 A;  1SQX K;  1AV1 A;  1MV8 A;  1JY3 N;  3D6Z A;  2E42 A;  2OTL P;  1PPJ G;  4U3F E;  1N7L A;  2KLU A;  2WSS H;  3II6 A;  1U57 A;  2O1J A;  1JB0 J;  2QSI A;  5KLI B;  3OJA B;  1HJB A;  2O1K A;  2FYN C;  4OGQ C;  2FYN B;  4IOI H;  4OGQ B;  3VTP C;  4UB8 E;  1FBM A;  4WY4 C;  3W67 A;  2P10 A;  4WY4 B;  1GK4 A;  2J59 M;  1EC5 A;  3NMD A;  2I1J A;  3WUT A;  3PP5 A;  4DCK A;  1L4A D;  2KLV A;  2HLO A;  3L72 J;  3TF5 A;  3PHL A;  2IZ0 A;  3CL3 D;  3IR9 A;  4HB1 A;  2Y0D A;  1NTM G;  5CCH C;  4WB4 A;  1YQ3 C;  1BSH A;  3H1I D;  1AVO A;  3B71 A;  5AW6 B;  5AVQ B;  1HUC A;  1OW7 A;  1L2P A;  3BAT A;  1H8A A;  1SQX J;  1LT9 C;  2ZVO B;  3C9I A;  3H1I E;  3B4S A;  3L74 D;  1FDO A;  2QA4 P;  3MZW B;  1CI6 B;  2K88 A;  2Q1K A;  3AED C;  1GK6 A;  5KAF H;  2QIW A;  2Q5U A;  1SVF A;  1A02 F;  3O8Z A;  1JCD A;  3WUU A;  5KAI H;  3SFE C;  4I6M C;  3LW5 J;  2QG4 A;  4L75 A;  3L74 E;  1P84 H;  2VRS A;  2P7J A;  3CCE P;  2KUB A;  2ZAE B;  2AXT E;  3CX5 H;  2Y0E A;  1KQF B;  3VMZ A;  3SWK A;  2KXP B;  1NH4 A;  3I55 P;  4GIF A;  4LLH A;  1KQL A;  5GTI E;  5CBO A;  5H2F E;  3A0B H;  1Q86 Q;  1GDT A;  3RBX A;  1MFZ A;  1SQP G;  2J5U A;  1U7J A;  5C39 A;  1J1D C;  1J1D B;  5BU8 B;  3CCJ P;  1N86 A;  3H1K D;  5M1B A;  1SP4 A;  4OGQ D;  5B66 H;  2ZXX A;  2WIT A;  4WY4 D;  5APY A;  1M90 Q;  1OWA A;  1SQX G;  1CSB A;  3H1K E;  1KYO D;  5CMZ A;  1JTH A;  3KZI E;  1IFP A;  1NJI Q;  5CCH D;  1EDJ A;  1KYO E;  1N7S A;  1AJY A;  4O9B A;  1BCC J;  1G2C A;  1AQ5 A;  2XV5 A;  3AEF C;  2YXR B;  3TGU D;  4UB6 E;  1A02 J;  1LTA C;  2FYU E;  2ZT9 B;  3GF7 A;  1GZL A;  1L0L J;  1URQ B;  1L0N D;  2Q9I A;  3Q5P A;  1KIL B;  1Q81 Q;  2AXC A;  1JMM A;  1QX8 A;  4U3F G;  3HTK A;  1VQM P;  2QJK C;  3V6I A;  3H25 A;  2LXB A;  2V7Q H;  3TGU E;  1SLQ A;  1T6A A;  2OYI C;  3V2R A;  4TT3 H;  3IF4 A;  3L75 D;  1L0N E;  4K3A A;  3MD0 A;  1NYH A;  2WPV B;  2B87 B;  3AEB C;  2ZYA A;  1LTG C;  4I7Z B;  3H1J D;  3L75 E;  2NZ2 A;  3FX0 A;  2FBW C;  1Q2N A;  3HD7 C;  1SFC B;  4PD4 I;  3H1J E;  1GL2 C;  1GL2 B;  4PV1 C;  4W80 A;  4PV1 B;  1ZLL A;  2R5B A;  2YO2 A;  1Q7Y Q;  3RBZ A;  3KDP B;  1TU3 F;  1YQ4 C;  3H1L D;  3H1I G;  3FXE A;  3H1K J;  1S4X A;  1KB9 H;  2IBZ D;  1AQT A;  2RMZ A;  4LGD E;  1OVU A;  3CI9 A;  3AE2 C;  1YJN P;  3H1L E;  1EZV G;  2B88 A;  3L74 G;  3BCC D;  4M3L A;  2IBZ E;  5AVY B;  3CXH H;  1Z56 A;  1XTC C;  3H6P A;  2FYU J;  3BCC E;  2A45 H;  1HGV A;  3CPW O;  3L70 D;  1FC2 C;  4GKG A;  5CCG C;  2PRR A;  1HF9 A;  2ZXE B;  3LW5 H;  4I2L C;  4IFM A;  3TGU J;  3TNU B;  1DEB A;  4DZO A;  2FFD C;  3L4F A;  2R32 A;  2N1T A;  3M0D A;  1L0N J;  2Z5I A;  3L70 E;  5CHX A;  1EDI A;  1T3U A;  1H0T B;  1WRG A;  2KZI A;  2KNC B;  3H1K G;  3L75 J;  4C7N B;  2N9Y B;  4NPF X;  1JOC A;  1RHZ B;  3U59 A;  3HD7 D;  2QRX A;  2BEZ F;  3AEE C;  3H1J J;  1GL2 D;  4PV1 D;  4UB8 H;  3L36 A;  1EXI A;  2GUV A;  5AVX B;  4Z1M H;  3S4R A;  2WSC J;  2ZFC A;  3ZDM A;  2E76 C;  2E76 B;  2OTJ P;  4CPG A;  1OX3 A;  4KHX A;  2Q7C A;  3VMX A;  3MUD C;  1X22 A;  4ZMD A;  2XU6 A;  2YKO A;  2XDJ A;  1JNM A;  4DOJ A;  3V2N A;  4IL6 H;  3MIW A;  3RL0 g;  5AVV B;  4ZKU A;  1RQU A;  1NKN A;  3VOP A;  1VQ7 P;  5KKZ C;  5KKZ B;  2KZJ A;  1IK7 A;  3U1C A;  3HE4 B;  1PGO A;  3IFM A;  3M9Q A;  1JO5 A;  1JUN A;  3BCC J;  2M5A B;  2KIK A;  1VPC A;  2R5D A;  1XTG B;  5CCG D;  3L72 D;  2W6A A;  3H1H J;  2NPS A;  1RQV A;  3L73 D;  3L70 J;  2O01 J;  1JCC A;  1L4A C;  3RK3 C;  3B5N C;  1L4A B;  3RK3 B;  3B5N B;  1S2E A;  1ZV8 A;  1PP9 J;  1KFM A;  3L72 E;  1BGY G;  4HH2 A;  5H2F H;  2NRG A;  3L73 E;  5APV A;  3CXH D;  2BCC D;  2JKV A;  1M57 D;  1KN7 A;  2Q3E A;  2CK3 H;  2IYO A;  3L71 D;  2QJP C;  4DT0 A;  2WPQ A;  2QJP B;  3H1L G;  4JPZ B;  1ZR2 A;  4Y28 J;  4NPD A;  3OW2 O;  2OAR A;  3P8M C;  3A0H E;  3CXH E;  2IBZ G;  2BCC E;  2ZJS E;  2C0X A;  2OYH C;  3HE5 B;  2OYH B;  3L71 E;  3AE7 C;  2FY8 A;  1GD2 E;  1NHL A;  3F89 A;  2E76 D;  3KZI H;  5EFW B;  5APS A;  1VQK P;  3D71 A;  3AE8 C;  1MFT A;  3C8V A;  1CZQ A;  3AEA C;  1KYO H;  1N73 A;  1QL2 A;  2POH A;  2WT7 B;  3L70 G;  3M91 A;  5GTH H;  5KJ7 C;  2WSE J;  4UB6 H;  5TIS E;  1DEE G;  3GHG C;  2YIU C;  2YIU B;  1DD3 A;  4KT0 J;  3P8C D;  1GW3 A;  2RH0 A;  1YYC A;  2PGD A;  2YNY A;  1KMI Z;  2JDI H;  3V2P A;  1LWU A;  1HBW A;  1IO4 A;  2HOD B;  2Y9Y A;  3FGA D;  3P8C E;  3RGU A;  1RF0 C;  1BE3 J;  1T8Z A;  3PRJ A;  1OVR A;  1JY2 O;  3RK3 D;  3B5N D;  2QVA A;  4H0L C;  4H0L B;  2JWD A;  1BCC D;  1X0T A;  1FOS E;  3L73 J;  2H8P D;  2IZ1 A;  4I1L A;  3TK1 A;  3SFD C;  1VQL P;  1M1J A;  4IL6 E;  3RK3 E;  3V5B A;  1L0L D;  3TYY A;  2W8Z A;  2AEM A;  5KLV J;  1BCC E;  1NAY A;  1URQ A;  3C1L A;  4C7R A;  2WSF J;  1KIL A;  1PL5 A;  4XE5 B;  3CWB D;  2BCC J;  2FXM A;  4OH8 B;  3V4W A;  1RE3 C;  4YPC A;  1LT9 B;  3GW6 A;  2WSC H;  1RF1 C;  1L0L E;  1RF1 B;  3L71 J;  1MKM A;  4PD4 D;  3CLQ A;  3CWB E;  1UII A;  2H88 C;  1IFJ A;  2WZ7 A;  4JF7 A;  3HUS C;  2B87 A;  3A5T A;  2WMM A;  3HUS B;  1FAV A;  1Y8A A;  3G4S P;  5AVR B;  1R8E A;  4EDF A;  4PD4 E;  3Q1M A;  2HG5 D;  3EFG A;  1U7M A;  2ZVN B;  3M9H A;  2FKW B;  1HTL C;  4KJM A;  1W2E A;  2AEF A;  1SFC A;  5KJ7 D;  3USS A;  1IFN A;  3CC7 P;  3L72 G;  1L0L K;  3L37 A;  5L8R J;  3L73 G;  3FWN A;  2O01 N;  2ITA A;  1SQQ D;  1QLE D;  3CME P;  2O3J A;  4ASV A;  3AEG C;  3TSI A;  3IN6 A;  2QM8 A;  5AW9 B;  2UWJ E;  3I56 P;  2O01 H;  3CCV P;  3HRN A;  1SQQ E;  3O6Q B;  2M3B A;  2YMY A;  3GG2 A;  1VQ5 P;  3BAS A;  4YXD C;  1RH5 B;  3GMA A;  1YI2 P;  2A45 G;  4H0L D;  5APQ A;  3KQG A;  4XFJ A;  3KHU A;  2FYU D;  1NGM B;  5APU A;  1YJW P;  3CMA P;  1K04 A;  1USE A;  5GTH E;  1LTJ A;  3VMA A;  2KS1 B;  1FJP A;  1PIX A;  3WUV A;  1KD1 Q;  4OWF A;  3E7K A;  1NTK J;  5AW5 B;  3CWB J;  2QJK B;  3N4X A;  2OYI B;  1H0T A;  3JSV C;  3T97 A;  4H13 C;  4H13 B;  3EWK A;  4GOF A;  1LTT C;  4L74 A;  4D6T J;  2P67 A;  2IDB A;  2WSE H;  1HWT C;  1NAF A;  1YTZ I;  3AE6 C;  2Y0C A;  1LTB C;  2FYU K;  1LGH B;  1BDD A;  2P1J A;  4WBA A;  1FZE A;  3HD7 B;  1QVF O;  3SSU A;  2A06 D;  1KC8 Q;  1BCC G;  3P32 A;  3Q3D A;  1SQB J;  1L0N K;  5AVS B;  1EZV I;  3S1K A;  3LIE A;  3CCL P;  1SQQ J;  2A06 E;  1L0L G;  1FZC A; 
#chains in the Genus database with same CATH homology
 2FYU D;  3GW6 A;  1PPJ D;  2QJY B;  5TJH A;  2Y0E A;  4PD4 D;  3L75 D;  3L70 D;  2L91 A;  2KS1 A;  1NTK D;  1SQP D;  1KB9 D;  5KKZ B;  3VMA A;  1BGY D;  5KLI B;  4EDF A;  2FYN B;  3H1J D;  3PTZ A;  2QJK B;  3H1H D;  2YIU B;  3H1K D;  4A7P A;  3L72 D;  1SQX D;  4D6T D;  1P84 D;  1SQV D;  2KNC B;  1NTZ D;  3L73 D;  1NTM D;  3TF5 A;  2N9Y B;  1PP9 D;  3PHL A;  1EZV D;  1BE3 D;  3CX5 D;  2Y0D A;  1KYO D;  1ZRT D;  3H1I D;  1SQQ D;  2Y0C A;  3ITK A;  3PLN A;  1NU1 D;  2O3J A;  3PRJ A;  3CXH D;  2BCC D;  3H1L D;  2Q3E A;  3FWL A;  2QG4 A;  3TDK A;  3L71 D;  1BCC D;  2IBZ D;  2QJP B;  2JWA A;  2RMZ A;  1SQB D;  2A06 D;  3GG2 A;  3L74 D;  2K9J B;  5KLV D;  4RJT A;  1L0L D;  3TGU D;  3BCC D;  2RN0 A;  4U3F D;  1L0N D;  3KHU A;  3CWB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...