2RMZA

Bicelle-embedded integrin beta3 transmembrane segment
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
43
structure length
43
Chain Sequence
b'PESPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin beta-3
publication title Structure of the Integrin beta3 Transmembrane Segment in Phospholipid Bicelles and Detergent Micelles
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 14
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2007-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2rmzA00
2K9JB 3L71D 1KB9D 5KLIB 4A7PA 2FYUD 3H1ID 4PD4D 3ITKA 1BGYD 1ZRTD 2A06D 2BCCD 2RN0A 3TGUD 4RJTA 2N9YB 3FWLA 3L73D 1NU1D 2KNCB 2YIUB 1SQQD 5TJHA 2Y0CA 3TF5A 2L91A 3PHLA 2FYNB 1KYOD 1EZVD 3H1JD 1PPJD 2Y0DA 3CX5D 3KHUA 1NTKD 3BCCD 2Y0EA 1BCCD 1NTMD 3TDKA 3GG2A 3CWBD 5KKZB 4EDFA 1SQPD 2IBZD 1P84D 3L75D 3VMAA 3H1HD 2Q3EA 3PLNA 2KS1A 3CXHD 1SQBD 2O3JA 2QJYB 3GW6A 1PP9D 3PRJA 1L0LD 2RMZA 3L74D 5KLVD 2JWAA 1SQXD 1L0ND 3H1LD 3PTZA 3L72D 1NTZD 3H1KD 2QG4A 2QJPB 4U3FD 3L70D 1BE3D 4D6TD 1SQVD 2QJKB
chains in the Genus database with same CATH superfamily
1RF0C 1KYOH 3OAKA 1JNMA 1BE3E 2WPSA 2B87A 3AEBC 2BEQD 1SQQJ 1HH0A 2GUSA 2RN0A 3Q2YA 1BGYJ 5E79E 3V5BA 4PD4E 2OYIB 1QVFO 2BCCE 4TLFA 2YKOA 3B71A 1NTMK 2H8PD 3CD6P 3PP5A 1VQ9P 4C7NB 1ZR2A 1KB9H 3MIWA 1FAVA 1FBMA 1RQUA 3L70G 3WU2H 1JM0A 1NTMD 1S3JA 5EFWB 1SQPD 3MD0A 1P84D 3KZIE 2WSEH 4Y99B 4NPFX 2HPCA 2FYUG 1NH4A 3WUUA 1L0LD 1JCCA 1JY2P 3CX5I 1SQVJ 3GHGC 5CJ0A 2ZXXA 1MFTA 2N1TC 5KKZC 3NTNA 4IOIH 2IBZE 4GIFA 3NFQA 4HH2A 3BATA 3EFFK 2E74D 1AFOA 1IO4A 1T6AA 1SP4A 1AA0A 2P67A 2KSJA 1RF1C 3D6YA 2K3RA 3SWFA 4WY4A 1FZGA 4GKGA 2KLUA 2Z5HA 1AQTA 1ZXGA 1NU1E 1EC5A 2R3CA 4PD4I 1GK6A 1S9KE 1HTLC 3JC22 3CCVP 1PFIA 2W90A 4EYYQ 1T8ZA 3AEDC 1VQPP 3G9RA 2NPSD 3MUDC 1IFNA 2GM4A 3HE5B 4NPDA 3PH0A 3RBZA 1GK4A 1R5SA 1BDCA 2AXCA 4U3FJ 4R4LA 1X79B 3P8CD 3GMAA 1NTKG 3U59A 2P10A 2O01J 1EXJA 5KLVJ 2IFNA 3CWBG 3H1LD 3L74E 3SSUA 1OVVA 1HGZA 1VQ5P 1FOSF 1VF5C 2W6JH 1N73C 1HGVA 3OJAB 3CXHH 3U1CA 2K9JB 4N78D 5DJTB 5CJ4A 3L71D 4GDOA 3Q5RA 3AE5C 4C7NA 3FWNA 1PV3A 1SQXG 5H2FH 5M1BA 1KB9E 2UWJE 3RK3B 2RKLA 1HBWA 2WZ7A 3RL0D 1J1EB 3WU2E 1NTZE 1JY2O 3TGUJ 3RGUA 1PGOA 4GODA 1EDLA 2P7JA 2FKWB 1FDOA 2JDIH 1NOHA 3L73E 1MV8A 2Z4EA 3HD7B 2KZIA 5KLIC 3A3YB 2R5DA 3H1IE 2WSSH 3BCCD 1RY3A 3CLQA 1NKZB 4JPZB 3AE4C 1L4AC 1S5LH 1GU4A 2KB7P 1LTIC 1YI2P 1JCDA 1FZEA 1CI6B 4KT0J 3GW6A 1N7SD 2MJZA 3A0BH 2E75D 2WQYC 2WSCJ 3I55P 3H1JE 1PP9E 1IFIA 1OFCX 3HRNA 4OGQC 1YTZT 4H0LC 4WY4C 4ASWA 2WPRA 4L73A 5APVA 4XFJA 1H88A 2VRSA 1VQNP 2I8DA 5AW2B 4U7JA 3G71P 3HD7D 2ZT9B 3AECC 3CX5H 2WPVB 4DT0A 2MKVA 3C1LA 3H1KG 1PGQA 1KN7A 3EFGA 5AW0B 2E43A 1YQ3C 2QA4P 2A06E 2HLOA 2HODB 1URQD 2WT7A 2H89C 1LTJB 3FX0A 4L75A 3TF5A 3M9BA 2O01H 2M0BA 3HE5A 1NJIQ 4UB8E 1L0NG 3L72G 1SQQE 2IZ1A 5BVZA 1T2KD 1OVRA 2K37A 1NTKD 4D6TG 1SFCC 1BGYE 3SFEC 1BCCD 1RQVA 4WBAA 1JOCA 3CWBD 3V6IA 2OYIC 4KHXA 2IBZD 1NVOA 3B8EB 4CPGA 3L4FA 1GW4A 1KORA 1EZVG 1VDFA 1ZW0A 4HJGH 2K9JA 3AE1C 3CXHE 1NU1K 1N7SA 5BU8B 1FC2C 4NPEA 1SQXD 2E5TA 3VP9A 2LKMA 2YKPA 3W68A 2YXQB 4Y99C 2QVAA 2LXBA 1Q81Q 3MZWB 2KXPB 1CZQA 3R2PA 3R4YA 2E76B 1LT1A 1FZCB 1NTMG 1S9KD 1SQVE 2W8ZA 3HD7A 4H13C 1LJ2A 1SQPG 5CCHD 2YO2A 2HPCB 1PL5A 3U1AA 2FBWC 2PRRA 2N9YB 3QWOC 3F89A 2WSCH 1KILC 2K9YA 3AE6C 3MTUE 1T3UA 3HE4B 2YKQA 3PHLA 3CCMP 1S5LE 1KYOD 1H8AA 2W6BA 1KILE 3A0BE 2L5GB 1FJKA 1RE4A 1FDIA 2Y0EA 2KP8A 2QJKC 2PP6A 1L0NJ 3VMAA 4LC1A 1NTZK 1G1JA 3IAOA 2ITAA 2P2UA 1SQBJ 3ABVC 1KFNA 2ZVOB 4N6JA 1TU3F 1LT9C 2C0XA 4JYCA 1JY3N 2R5BA 3CX5E 4AUWA 2QE7H 1FZFA 3PTZA 2D2CC 1IFMA 1NTZD 2KIKA 3EQ2A 3H1KD 1LP1B 4ZMDA 2O1JA 3LW5J 3USSA 1MKMA 2YMYA 2HODA 3CXHI 2FYNC 1LTJA 4U3FE 3L70E 2KK7A 5AW7B 1X0TA 3H1ID 5KLVE 3NMDA 3M9QA 4B86A 1LNQA 1KFMA 1OXZA 2FY8A 3MGNA 3CCQP 3CC7P 1M1JA 5CCHA 1ZRTE 3L36A 3VP8A 2HG5D 1YQ4C 3L35A 5AW3B 1FU1A 4KJMA 1SQPJ 3H1LG 2G3AA 3A7OA 1EZVD 2O01N 3H1JD 1YBKA 4IFFA 1CW5A 2W6AA 3B4SA 1L0LJ 2XU6A 2FFDB 3RK3C 2C9NY 1CSBA 3L71G 3TGUE 1LWUB 2G8YA 5BU5A 3RK3E 1DIPA 2QJYB 5AW5B 1PPJG 3M91A 2V7QJ 5AW8B 3M0DC 2PAJA 2KOGA 2E74B 1FZCA 1M90Q 1SQQK 1JEKA 3S9OA 3FGAD 1IC2A 1S4XA 1YTZI 3H1HG 1QL1A 3A0HH 3AEAC 2A45G 2LR2A 3VTPC 3BCCG 1GW3A 3HE4A 3IN6A 1BGYD 2XZRA 5AVTB 1T3JA 1Y8AA 5GTIH 5AW4B 3IR9A 2NPSB 1SFCD 2B9BA 2YO3A 3KQGA 2JO1A 1QL2A 2YIUB 1KD1Q 5TJHA 1IK9A 2QIWA 1YJNP 2E5YA 3P7KA 2ZT9C 2BCCG 2OQQA 4HB1A 1GL2D 1M56D 1SVFA 1LGHB 1SQVK 5B5EE 1JTHB 3LW5H 3TDKA 3W67A 5C39A 1LP1A 1IJDB 5APXA 3H1LJ 3WMM0 1N2DC 3Q1MA 1LTJC 1ZV8A 4JF7A 1JMMA 2WVRA 1KMIZ 2LXCB 1R8EA 2QM7A 3D70A 3TNUB 2WT7B 1ZLLA 3RL0B 2J58A 4DOJA 1GU5A 4H13D 4UB8H 3A5TA 3CPWO 5KJ7D 1DX7A 2K1AA 5AW6B 1P84H 3L70J 4DCKA 2J5UA 2YXRB 3AE3C 3ZDMA 1FE6A 4RKUJ 1KILD 1N86A 1BCCG 5CCGD 2H43A 3RL0g 1KV4A 1EDJA 2IBZG 2FYUJ 1H0TB 3KDPB 2WPQA 2BEZF 1Q2NA 2FFDA 1IFJA 1J2JB 3QH9A 2JWDA 2QM8A 2V7QH 1LWUA 1UIIA 1N7SB 2E75B 1USEA 2JJLA 3V2RA 3VYIA 4JYBA 2E76C 1PPJD 1FZCC 2KUBA 2Y0DA 3CX5D 1NAYA 5KLVK 1GL2A 3RK2C 1VQOP 3VN0A 3OA7A 4I1LA 4XA4A 1NU1G 1S72P 3L75D 3CCEP 3WUVA 2D2CD 5CMZA 1OW7A 3H1HD 3O6QB 1VQLP 1XTGB 3PRJA 3C8VA 3A0HE 2KNCA 5KLVD 2CPBA 4H44D 4I2LC 3WUTA 3B5ND 1URQB 1AV1A 1RE3A 4R4MA 1L0NE 1BE3D 3FXEA 2NPSA 5GTIE 3TSIA 3CMAP 5KJ7A 4YPCA 3L74G 1SQBE 2WITA 1QX8A 2FXMA 3VOPA 2POHA 1H89A 3HUSA 4PD4D 2B89A 2BCCD 4W7YA 5CCGA 3AEEC 1J1DB 2AEMA 1JTHA 1KQFB 3TGUD 4WWIA 1GD2E 2JR8A 1NTKJ 3FWLA 1OWAA 4UB6H 2KI7B 2PGDA 1BCCJ 2Y0CA 4RESB 3CWBJ 3CCSP 4PV1C 2NRGA 1A02J 1YJWP 1VQKP 1NTZG 1WMKA 1AVYA 1FS0E 5APSA 3TNUA 3TYYA 3L73G 5CHXA 3GF7A 1SQXJ 5AVWB 3H1IG 1SQPE 1P84E 3CC2P 1NWQA 3IFMA 1M1JB 3SWYA 2YNYA 2M5AB 1L0LE 1MUUA 2HR3A 2DW3A 1H0TA 2N1TD 4JQ0D 1LWUC 4BWNA 2N9BA 3H1JG 3CCJP 3H32B 1PP9G 2R32A 1Y9BA 5GTHH 2OYHA 3BRTB 2WMMA 1RF0A 1DEBA 3ITKA 2E74C 3Q3DA 2IYOA 1NO4A 1DH3A 1M57D 3S1KA 1IFPA 2CK3H 1NU1D 2BASA 3P8MC 1USDA 2OGUA 3O6QA 1N8RQ 1N73B 2B88A 3AE9C 1K04A 1G2CB 2A06G 2WTYA 1N7LA 1U7JA 2Q5UA 3CCLP 4ZNCA 2NZ2A 1ZOYC 1QLED 2IYPA 1JY2N 1Q90D 2NPSC 2ZYAA 1URQA 3AE2C 2Q3EA 2YIUC 1OX3A 1QEXA 5K5GB 3H1KJ 1BGYG 1HJBA 1Y47A 3SFDC 3L74D 1Z56A 2WSEJ 3II6A 1R5LA 5APQA 3AE7C 3P8CE 1MFZA 4N3YB 1VF5D 3L72J 1P84I 3H1LE 3VMZA 4EIJA 5B5EH 4D6TJ 2N1TA 3M06A 1X22A 3K5BA 4UB6E 1KB9D 3E1IA 3CMEP 4N78E 3L71E 2AEFA 1PZQA 3PJSK 2WSFJ 1K05A 5KTBA 2AXTE 1WRGA 3LIDA 2JP3A 3L73D 1L0NK 4XE5B 3GF3A 1JMBA 2XNXA 3Q5SA 1EQ7A 1IFDA 1SQBK 2GA1A 2M3EA 2FYUE 2QRXA 4TT3H 2M5AA 2KYVA 3N4XA 1NTMJ 1NHLA 1L4AD 2Q6QA 1SQBD 1UIXA 1N7SC 3H32A 1PP9D 2E75C 3MUDA 4LLHA 2H88C 5AVZB 3BASA 5GTHE 1EDKA 3E1RA 2H7HA 1J1EC 5APUA 4OGQD 2QSIA 1SFCB 3I56P 2FXOA 2XDJA 2P58A 1JO5A 4H0LD 4WY4D 4LGDE 1SLQA 2Y9ZA 3HD7C 3Q5PA 1N73A 2W27A 1GL2B 1SQPK 2QEXP 2ZAEB 3HTKB 1W2BO 4PV1D 1U7MA 2ZFCA 1G2CA 4BRYA 2A06D 4YXWH 3L75G 3P32A 3FXDA 1M7LA 1L0LK 4U3FG 3V4QA 2OYOA 1URQC 2KNCB 1E5WA 1DD3A 5KLVG 5CBOA 1SQQD 4O9BA 4RO0A 4PJ0H 3D6ZA 2Q7CA 1RE4C 2OARA 1AJYA 1T2KC 4I7ZB 3GLMA 3KHUA 4GT1A 1BE3G 4H13B 3O8ZA 1J1DC 3GG2A 3G6EP 1NTKE 4JBZA 3JCUH 1BCCE 3CXHD 3CWBE 3HUSB 3CCUP 2O1KA 3D71A 2Z5IA 2IDBA 2CPSA 1KILB 1L4AA 2R3SA 3AEFC 2JWAA 3T97B 3TGUG 2WSFH 2IFMA 4ZKUA 2A45I 2M3BA 1RHZB 2Q1KA 1JB0J 2QJPB 3CI9A 3MP7B 1SQXE 1JY3P 4DJGA 5AVUB 1SQVD 2QJKB 3G3ZA 3VMYA 3H6PA 1HVVA 1DD4A 3L71J 4A7PA 2J59M 3TK1A 1M1JC 5AW1B 4YXDC 1LT9B 2JEEA 2SPZA 5CCHC 4W7ZA 2ZVNB 5B66H 5APWA 2YMKA 2D2CB 3UIAA 1K73Q 3E7KA 1GTWA 1X9VA 1QVGO 1YITP 1DEEG 1VPCA 2P1JA 2FYNB 2C9LY 3L75J 4IL6E 4H44B 4IFDK 2GUVA 2KZJA 3H1HJ 4IFMA 4DZOA 5APTA 4WB4A 3B5NB 1KYOE 1LTTC 3I5CA 3BCCJ 4BXLA 4EDFA 3V2NA 1SFCA 2OYHB 1AVOA 3M9HA 1OMIA 2OYIA 2ZYGA 5AVXB 1QGKB 3G4SP 1PGJA 1BE3J 4AYCA 4OH8B 3HTKA 1Q86Q 1BDDA 1KC8Q 2FYUK 1FJPA 5KAIH 2M8RA 3F5HA 1ZMEC 3CC4P 2IBZI 4U3FD 3L70D 1XTCC 2BCCJ 3KXDA 3CCRP 2OTLP 3H1KE 4W80A 4WVZA 2IX7C 1D7MA 4HKZH 4PJ0E 1W5CE 1ZN5A 2FYUD 3AE8C 1G1IA 4OVNF 1HWTC 1ZRTD 3VMXA 4IL6X 4AQRD 5AVVB 4HYTB 1IZNB 3C9IA 3L72E 1U57A 1S2EA 1L2PA 4D6TE 3BRVB 1VL2A 3JCUE 1HUCA 1HF9A 1KILA 2IPPA 1VQMP 3GHGB 1NYHA 1NAFA 2FYZA 2K88A 3KPEA 1JY3O 1LTBC 3T97A 5DJUB 5KAFH 1EZVE 3RK3D 2JKVA 2N1TB 5KKZB 1AQ5A 2KLVA 3L37A 2O3JA 1OVUA 1GMJA 1KYOI 2RMZA 1FOSE 3MHVA 2AXTH 1KZUB 4GOEA 3V4WA 1KTMA 1LT9A 4EI2A 1GDTA 2IZ0A 3V2PA 2QG4A 1NTME 3M0AA 1RF1B 5B66E 2KS1B 1VQ8P 1FDMA 4Z1MH 3N7NA 1NTKK 1KQSO 5TISH 1FZAA 5CBNA 3LIEA 1E79H 1OW6A 1JUNA 1KQLA 1NU1J 2A45H 1ZR4A 4Y28J 1KB9I 4L74A 2PFXA 4K35A 2FFDC 1NGMB 4M3LA 3B5NA 2WWWA 5AVSB 2I1JA 2V4HA 1SQBG 1M8OB 1SQXK 2QJYC 1VQ4P 1X8YA 1EXIA 2Y9YA 1LTGC 4OWFA 1SS1A 2B87B 1FZBA 2E42A 1GL2C 2ZT9D 1LTSC 2HYNA 5E79H 1IK7A 5AVRB 4PD4H 1KQGB 3KYQA 5AW9B 5AVYB 1BSNA 3L74J 1VF5B 1YHQP 5APYA 1WT6A 4I6MC 5H2FE 5KAIE 5L8RJ 2W83C 1VQ6P 4BRYB 2FXPA 1BSHA 2AEJA 1ZP0C 1Q7YQ 4L76A 1EZVI 1NKNA 2RH0A 4I7ZC 1S1CX 1MZ9A 1RE3C 3EWKA 3M0DA 4MN4C 1SQQG 3KZIH 1EDIA 4EOTA 3RK2B 5KJ7C 1NTZJ 2XKMA 1K8AQ 3RBXA 1VQ7P 1L0LG 4ASVA 1PIXA 3HUSC 4C7RA 4ZKPA 3H25A 3L73J 2C0WA 5KLIB 5CCGC 1CI6A 3IF4A 3GHGA 2I1KA 1RH5B 2ZXEB 3H1IJ 2XNDH 2R44A 1GZLA 4RJTA 5KAFE 2QJPC 1L4AB 3SWKA 1OW8A 3OW2O 2Q9IA 2OTJP 1M1KQ 4K3AA 2L91A 1W2EA 1OZHA 1LTAC 3CL3D 2E76D 2Q3IA 2HFED 3RL0C 3H1JJ 1HJ0A 4OGQB 1PP9J 2XV5A 4QMAA 3BVHA 1PPJE 1OIPA 3RK2D 1SQVG 3NXSA 3A2AA 4H0LB 4WY4B 4C46A 1RF1A 3AEGC 3PLNA 2KS1A 2ZJSE 2OTKE 3L75E 4PV1B 1Q82Q 3H1HE 5TISE 4H44C 1YIJP 3V2QA 4YTPC 1K9MQ 2KSEA 3B5NC 5AVQB 1L0ND 3S4RA 1A02F 3L72D 3BCCE 2ZYDA 1PGPA 1S5LX 3JSVC 4GOFA 1YJ9P 4IL6H 1YYCA 4D6TD 2OYHC
chains in the Genus database with same CATH topology
2K9JB 3L71D 1KB9D 5KLIB 4A7PA 2FYUD 3H1ID 4PD4D 3ITKA 1BGYD 1ZRTD 2A06D 2BCCD 2RN0A 3TGUD 4RJTA 2N9YB 3FWLA 3L73D 1NU1D 2KNCB 2YIUB 1SQQD 5TJHA 2Y0CA 3TF5A 2L91A 3PHLA 2FYNB 1KYOD 1EZVD 3H1JD 1PPJD 2Y0DA 3CX5D 3KHUA 1NTKD 3BCCD 2Y0EA 1BCCD 1NTMD 3TDKA 3GG2A 3CWBD 5KKZB 4EDFA 1SQPD 2IBZD 1P84D 3L75D 3VMAA 3H1HD 2Q3EA 3PLNA 2KS1A 3CXHD 1SQBD 2O3JA 2QJYB 3GW6A 1PP9D 3PRJA 1L0LD 2RMZA 3L74D 5KLVD 2JWAA 1SQXD 1L0ND 3H1LD 3PTZA 3L72D 1NTZD 3H1KD 2QG4A 2QJPB 4U3FD 3L70D 1BE3D 4D6TD 1SQVD 2QJKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9J B;  3L71 D;  1KB9 D;  5KLI B;  4A7P A;  2FYU D;  3H1I D;  4PD4 D;  3ITK A;  1BGY D;  1ZRT D;  2A06 D;  2BCC D;  2RN0 A;  3TGU D;  4RJT A;  2N9Y B;  3FWL A;  3L73 D;  1NU1 D;  2KNC B;  2YIU B;  1SQQ D;  5TJH A;  2Y0C A;  3TF5 A;  2L91 A;  3PHL A;  2FYN B;  1KYO D;  1EZV D;  3H1J D;  1PPJ D;  2Y0D A;  3CX5 D;  3KHU A;  1NTK D;  3BCC D;  2Y0E A;  1BCC D;  1NTM D;  3TDK A;  3GG2 A;  3CWB D;  5KKZ B;  4EDF A;  1SQP D;  2IBZ D;  1P84 D;  3L75 D;  3VMA A;  3H1H D;  2Q3E A;  3PLN A;  2KS1 A;  3CXH D;  1SQB D;  2O3J A;  2QJY B;  3GW6 A;  1PP9 D;  3PRJ A;  1L0L D;  2RMZ A;  3L74 D;  5KLV D;  2JWA A;  1SQX D;  1L0N D;  3H1L D;  3PTZ A;  3L72 D;  1NTZ D;  3H1K D;  2QG4 A;  2QJP B;  4U3F D;  3L70 D;  1BE3 D;  4D6T D;  1SQV D;  2QJK B; 
#chains in the Genus database with same CATH topology
 1RF0 C;  1KYO H;  3OAK A;  1JNM A;  1BE3 E;  2WPS A;  2B87 A;  3AEB C;  2BEQ D;  1SQQ J;  1HH0 A;  2GUS A;  2RN0 A;  3Q2Y A;  1BGY J;  5E79 E;  3V5B A;  4PD4 E;  2OYI B;  1QVF O;  2BCC E;  4TLF A;  2YKO A;  3B71 A;  1NTM K;  2H8P D;  3CD6 P;  3PP5 A;  1VQ9 P;  4C7N B;  1ZR2 A;  1KB9 H;  3MIW A;  1FAV A;  1FBM A;  1RQU A;  3L70 G;  3WU2 H;  1JM0 A;  1NTM D;  1S3J A;  5EFW B;  1SQP D;  3MD0 A;  1P84 D;  3KZI E;  2WSE H;  4Y99 B;  4NPF X;  2HPC A;  2FYU G;  1NH4 A;  3WUU A;  1L0L D;  1JCC A;  1JY2 P;  3CX5 I;  1SQV J;  3GHG C;  5CJ0 A;  2ZXX A;  1MFT A;  2N1T C;  5KKZ C;  3NTN A;  4IOI H;  2IBZ E;  4GIF A;  3NFQ A;  4HH2 A;  3BAT A;  3EFF K;  2E74 D;  1AFO A;  1IO4 A;  1T6A A;  1SP4 A;  1AA0 A;  2P67 A;  2KSJ A;  1RF1 C;  3D6Y A;  2K3R A;  3SWF A;  4WY4 A;  1FZG A;  4GKG A;  2KLU A;  2Z5H A;  1AQT A;  1ZXG A;  1NU1 E;  1EC5 A;  2R3C A;  4PD4 I;  1GK6 A;  1S9K E;  1HTL C;  3JC2 2;  3CCV P;  1PFI A;  2W90 A;  4EYY Q;  1T8Z A;  3AED C;  1VQP P;  3G9R A;  2NPS D;  3MUD C;  1IFN A;  2GM4 A;  3HE5 B;  4NPD A;  3PH0 A;  3RBZ A;  1GK4 A;  1R5S A;  1BDC A;  2AXC A;  4U3F J;  4R4L A;  1X79 B;  3P8C D;  3GMA A;  1NTK G;  3U59 A;  2P10 A;  2O01 J;  1EXJ A;  5KLV J;  2IFN A;  3CWB G;  3H1L D;  3L74 E;  3SSU A;  1OVV A;  1HGZ A;  1VQ5 P;  1FOS F;  1VF5 C;  2W6J H;  1N73 C;  1HGV A;  3OJA B;  3CXH H;  3U1C A;  2K9J B;  4N78 D;  5DJT B;  5CJ4 A;  3L71 D;  4GDO A;  3Q5R A;  3AE5 C;  4C7N A;  3FWN A;  1PV3 A;  1SQX G;  5H2F H;  5M1B A;  1KB9 E;  2UWJ E;  3RK3 B;  2RKL A;  1HBW A;  2WZ7 A;  3RL0 D;  1J1E B;  3WU2 E;  1NTZ E;  1JY2 O;  3TGU J;  3RGU A;  1PGO A;  4GOD A;  1EDL A;  2P7J A;  2FKW B;  1FDO A;  2JDI H;  1NOH A;  3L73 E;  1MV8 A;  2Z4E A;  3HD7 B;  2KZI A;  5KLI C;  3A3Y B;  2R5D A;  3H1I E;  2WSS H;  3BCC D;  1RY3 A;  3CLQ A;  1NKZ B;  4JPZ B;  3AE4 C;  1L4A C;  1S5L H;  1GU4 A;  2KB7 P;  1LTI C;  1YI2 P;  1JCD A;  1FZE A;  1CI6 B;  4KT0 J;  3GW6 A;  1N7S D;  2MJZ A;  3A0B H;  2E75 D;  2WQY C;  2WSC J;  3I55 P;  3H1J E;  1PP9 E;  1IFI A;  1OFC X;  3HRN A;  4OGQ C;  1YTZ T;  4H0L C;  4WY4 C;  4ASW A;  2WPR A;  4L73 A;  5APV A;  4XFJ A;  1H88 A;  2VRS A;  1VQN P;  2I8D A;  5AW2 B;  4U7J A;  3G71 P;  3HD7 D;  2ZT9 B;  3AEC C;  3CX5 H;  2WPV B;  4DT0 A;  2MKV A;  3C1L A;  3H1K G;  1PGQ A;  1KN7 A;  3EFG A;  5AW0 B;  2E43 A;  1YQ3 C;  2QA4 P;  2A06 E;  2HLO A;  2HOD B;  1URQ D;  2WT7 A;  2H89 C;  1LTJ B;  3FX0 A;  4L75 A;  3TF5 A;  3M9B A;  2O01 H;  2M0B A;  3HE5 A;  1NJI Q;  4UB8 E;  1L0N G;  3L72 G;  1SQQ E;  2IZ1 A;  5BVZ A;  1T2K D;  1OVR A;  2K37 A;  1NTK D;  4D6T G;  1SFC C;  1BGY E;  3SFE C;  1BCC D;  1RQV A;  4WBA A;  1JOC A;  3CWB D;  3V6I A;  2OYI C;  4KHX A;  2IBZ D;  1NVO A;  3B8E B;  4CPG A;  3L4F A;  1GW4 A;  1KOR A;  1EZV G;  1VDF A;  1ZW0 A;  4HJG H;  2K9J A;  3AE1 C;  3CXH E;  1NU1 K;  1N7S A;  5BU8 B;  1FC2 C;  4NPE A;  1SQX D;  2E5T A;  3VP9 A;  2LKM A;  2YKP A;  3W68 A;  2YXQ B;  4Y99 C;  2QVA A;  2LXB A;  1Q81 Q;  3MZW B;  2KXP B;  1CZQ A;  3R2P A;  3R4Y A;  2E76 B;  1LT1 A;  1FZC B;  1NTM G;  1S9K D;  1SQV E;  2W8Z A;  3HD7 A;  4H13 C;  1LJ2 A;  1SQP G;  5CCH D;  2YO2 A;  2HPC B;  1PL5 A;  3U1A A;  2FBW C;  2PRR A;  2N9Y B;  3QWO C;  3F89 A;  2WSC H;  1KIL C;  2K9Y A;  3AE6 C;  3MTU E;  1T3U A;  3HE4 B;  2YKQ A;  3PHL A;  3CCM P;  1S5L E;  1KYO D;  1H8A A;  2W6B A;  1KIL E;  3A0B E;  2L5G B;  1FJK A;  1RE4 A;  1FDI A;  2Y0E A;  2KP8 A;  2QJK C;  2PP6 A;  1L0N J;  3VMA A;  4LC1 A;  1NTZ K;  1G1J A;  3IAO A;  2ITA A;  2P2U A;  1SQB J;  3ABV C;  1KFN A;  2ZVO B;  4N6J A;  1TU3 F;  1LT9 C;  2C0X A;  4JYC A;  1JY3 N;  2R5B A;  3CX5 E;  4AUW A;  2QE7 H;  1FZF A;  3PTZ A;  2D2C C;  1IFM A;  1NTZ D;  2KIK A;  3EQ2 A;  3H1K D;  1LP1 B;  4ZMD A;  2O1J A;  3LW5 J;  3USS A;  1MKM A;  2YMY A;  2HOD A;  3CXH I;  2FYN C;  1LTJ A;  4U3F E;  3L70 E;  2KK7 A;  5AW7 B;  1X0T A;  3H1I D;  5KLV E;  3NMD A;  3M9Q A;  4B86 A;  1LNQ A;  1KFM A;  1OXZ A;  2FY8 A;  3MGN A;  3CCQ P;  3CC7 P;  1M1J A;  5CCH A;  1ZRT E;  3L36 A;  3VP8 A;  2HG5 D;  1YQ4 C;  3L35 A;  5AW3 B;  1FU1 A;  4KJM A;  1SQP J;  3H1L G;  2G3A A;  3A7O A;  1EZV D;  2O01 N;  3H1J D;  1YBK A;  4IFF A;  1CW5 A;  2W6A A;  3B4S A;  1L0L J;  2XU6 A;  2FFD B;  3RK3 C;  2C9N Y;  1CSB A;  3L71 G;  3TGU E;  1LWU B;  2G8Y A;  5BU5 A;  3RK3 E;  1DIP A;  2QJY B;  5AW5 B;  1PPJ G;  3M91 A;  2V7Q J;  5AW8 B;  3M0D C;  2PAJ A;  2KOG A;  2E74 B;  1FZC A;  1M90 Q;  1SQQ K;  1JEK A;  3S9O A;  3FGA D;  1IC2 A;  1S4X A;  1YTZ I;  3H1H G;  1QL1 A;  3A0H H;  3AEA C;  2A45 G;  2LR2 A;  3VTP C;  3BCC G;  1GW3 A;  3HE4 A;  3IN6 A;  1BGY D;  2XZR A;  5AVT B;  1T3J A;  1Y8A A;  5GTI H;  5AW4 B;  3IR9 A;  2NPS B;  1SFC D;  2B9B A;  2YO3 A;  3KQG A;  2JO1 A;  1QL2 A;  2YIU B;  1KD1 Q;  5TJH A;  1IK9 A;  2QIW A;  1YJN P;  2E5Y A;  3P7K A;  2ZT9 C;  2BCC G;  2OQQ A;  4HB1 A;  1GL2 D;  1M56 D;  1SVF A;  1LGH B;  1SQV K;  5B5E E;  1JTH B;  3LW5 H;  3TDK A;  3W67 A;  5C39 A;  1LP1 A;  1IJD B;  5APX A;  3H1L J;  3WMM 0;  1N2D C;  3Q1M A;  1LTJ C;  1ZV8 A;  4JF7 A;  1JMM A;  2WVR A;  1KMI Z;  2LXC B;  1R8E A;  2QM7 A;  3D70 A;  3TNU B;  2WT7 B;  1ZLL A;  3RL0 B;  2J58 A;  4DOJ A;  1GU5 A;  4H13 D;  4UB8 H;  3A5T A;  3CPW O;  5KJ7 D;  1DX7 A;  2K1A A;  5AW6 B;  1P84 H;  3L70 J;  4DCK A;  2J5U A;  2YXR B;  3AE3 C;  3ZDM A;  1FE6 A;  4RKU J;  1KIL D;  1N86 A;  1BCC G;  5CCG D;  2H43 A;  3RL0 g;  1KV4 A;  1EDJ A;  2IBZ G;  2FYU J;  1H0T B;  3KDP B;  2WPQ A;  2BEZ F;  1Q2N A;  2FFD A;  1IFJ A;  1J2J B;  3QH9 A;  2JWD A;  2QM8 A;  2V7Q H;  1LWU A;  1UII A;  1N7S B;  2E75 B;  1USE A;  2JJL A;  3V2R A;  3VYI A;  4JYB A;  2E76 C;  1PPJ D;  1FZC C;  2KUB A;  2Y0D A;  3CX5 D;  1NAY A;  5KLV K;  1GL2 A;  3RK2 C;  1VQO P;  3VN0 A;  3OA7 A;  4I1L A;  4XA4 A;  1NU1 G;  1S72 P;  3L75 D;  3CCE P;  3WUV A;  2D2C D;  5CMZ A;  1OW7 A;  3H1H D;  3O6Q B;  1VQL P;  1XTG B;  3PRJ A;  3C8V A;  3A0H E;  2KNC A;  5KLV D;  2CPB A;  4H44 D;  4I2L C;  3WUT A;  3B5N D;  1URQ B;  1AV1 A;  1RE3 A;  4R4M A;  1L0N E;  1BE3 D;  3FXE A;  2NPS A;  5GTI E;  3TSI A;  3CMA P;  5KJ7 A;  4YPC A;  3L74 G;  1SQB E;  2WIT A;  1QX8 A;  2FXM A;  3VOP A;  2POH A;  1H89 A;  3HUS A;  4PD4 D;  2B89 A;  2BCC D;  4W7Y A;  5CCG A;  3AEE C;  1J1D B;  2AEM A;  1JTH A;  1KQF B;  3TGU D;  4WWI A;  1GD2 E;  2JR8 A;  1NTK J;  3FWL A;  1OWA A;  4UB6 H;  2KI7 B;  2PGD A;  1BCC J;  2Y0C A;  4RES B;  3CWB J;  3CCS P;  4PV1 C;  2NRG A;  1A02 J;  1YJW P;  1VQK P;  1NTZ G;  1WMK A;  1AVY A;  1FS0 E;  5APS A;  3TNU A;  3TYY A;  3L73 G;  5CHX A;  3GF7 A;  1SQX J;  5AVW B;  3H1I G;  1SQP E;  1P84 E;  3CC2 P;  1NWQ A;  3IFM A;  1M1J B;  3SWY A;  2YNY A;  2M5A B;  1L0L E;  1MUU A;  2HR3 A;  2DW3 A;  1H0T A;  2N1T D;  4JQ0 D;  1LWU C;  4BWN A;  2N9B A;  3H1J G;  3CCJ P;  3H32 B;  1PP9 G;  2R32 A;  1Y9B A;  5GTH H;  2OYH A;  3BRT B;  2WMM A;  1RF0 A;  1DEB A;  3ITK A;  2E74 C;  3Q3D A;  2IYO A;  1NO4 A;  1DH3 A;  1M57 D;  3S1K A;  1IFP A;  2CK3 H;  1NU1 D;  2BAS A;  3P8M C;  1USD A;  2OGU A;  3O6Q A;  1N8R Q;  1N73 B;  2B88 A;  3AE9 C;  1K04 A;  1G2C B;  2A06 G;  2WTY A;  1N7L A;  1U7J A;  2Q5U A;  3CCL P;  4ZNC A;  2NZ2 A;  1ZOY C;  1QLE D;  2IYP A;  1JY2 N;  1Q90 D;  2NPS C;  2ZYA A;  1URQ A;  3AE2 C;  2Q3E A;  2YIU C;  1OX3 A;  1QEX A;  5K5G B;  3H1K J;  1BGY G;  1HJB A;  1Y47 A;  3SFD C;  3L74 D;  1Z56 A;  2WSE J;  3II6 A;  1R5L A;  5APQ A;  3AE7 C;  3P8C E;  1MFZ A;  4N3Y B;  1VF5 D;  3L72 J;  1P84 I;  3H1L E;  3VMZ A;  4EIJ A;  5B5E H;  4D6T J;  2N1T A;  3M06 A;  1X22 A;  3K5B A;  4UB6 E;  1KB9 D;  3E1I A;  3CME P;  4N78 E;  3L71 E;  2AEF A;  1PZQ A;  3PJS K;  2WSF J;  1K05 A;  5KTB A;  2AXT E;  1WRG A;  3LID A;  2JP3 A;  3L73 D;  1L0N K;  4XE5 B;  3GF3 A;  1JMB A;  2XNX A;  3Q5S A;  1EQ7 A;  1IFD A;  1SQB K;  2GA1 A;  2M3E A;  2FYU E;  2QRX A;  4TT3 H;  2M5A A;  2KYV A;  3N4X A;  1NTM J;  1NHL A;  1L4A D;  2Q6Q A;  1SQB D;  1UIX A;  1N7S C;  3H32 A;  1PP9 D;  2E75 C;  3MUD A;  4LLH A;  2H88 C;  5AVZ B;  3BAS A;  5GTH E;  1EDK A;  3E1R A;  2H7H A;  1J1E C;  5APU A;  4OGQ D;  2QSI A;  1SFC B;  3I56 P;  2FXO A;  2XDJ A;  2P58 A;  1JO5 A;  4H0L D;  4WY4 D;  4LGD E;  1SLQ A;  2Y9Z A;  3HD7 C;  3Q5P A;  1N73 A;  2W27 A;  1GL2 B;  1SQP K;  2QEX P;  2ZAE B;  3HTK B;  1W2B O;  4PV1 D;  1U7M A;  2ZFC A;  1G2C A;  4BRY A;  2A06 D;  4YXW H;  3L75 G;  3P32 A;  3FXD A;  1M7L A;  1L0L K;  4U3F G;  3V4Q A;  2OYO A;  1URQ C;  2KNC B;  1E5W A;  1DD3 A;  5KLV G;  5CBO A;  1SQQ D;  4O9B A;  4RO0 A;  4PJ0 H;  3D6Z A;  2Q7C A;  1RE4 C;  2OAR A;  1AJY A;  1T2K C;  4I7Z B;  3GLM A;  3KHU A;  4GT1 A;  1BE3 G;  4H13 B;  3O8Z A;  1J1D C;  3GG2 A;  3G6E P;  1NTK E;  4JBZ A;  3JCU H;  1BCC E;  3CXH D;  3CWB E;  3HUS B;  3CCU P;  2O1K A;  3D71 A;  2Z5I A;  2IDB A;  2CPS A;  1KIL B;  1L4A A;  2R3S A;  3AEF C;  2JWA A;  3T97 B;  3TGU G;  2WSF H;  2IFM A;  4ZKU A;  2A45 I;  2M3B A;  1RHZ B;  2Q1K A;  1JB0 J;  2QJP B;  3CI9 A;  3MP7 B;  1SQX E;  1JY3 P;  4DJG A;  5AVU B;  1SQV D;  2QJK B;  3G3Z A;  3VMY A;  3H6P A;  1HVV A;  1DD4 A;  3L71 J;  4A7P A;  2J59 M;  3TK1 A;  1M1J C;  5AW1 B;  4YXD C;  1LT9 B;  2JEE A;  2SPZ A;  5CCH C;  4W7Z A;  2ZVN B;  5B66 H;  5APW A;  2YMK A;  2D2C B;  3UIA A;  1K73 Q;  3E7K A;  1GTW A;  1X9V A;  1QVG O;  1YIT P;  1DEE G;  1VPC A;  2P1J A;  2FYN B;  2C9L Y;  3L75 J;  4IL6 E;  4H44 B;  4IFD K;  2GUV A;  2KZJ A;  3H1H J;  4IFM A;  4DZO A;  5APT A;  4WB4 A;  3B5N B;  1KYO E;  1LTT C;  3I5C A;  3BCC J;  4BXL A;  4EDF A;  3V2N A;  1SFC A;  2OYH B;  1AVO A;  3M9H A;  1OMI A;  2OYI A;  2ZYG A;  5AVX B;  1QGK B;  3G4S P;  1PGJ A;  1BE3 J;  4AYC A;  4OH8 B;  3HTK A;  1Q86 Q;  1BDD A;  1KC8 Q;  2FYU K;  1FJP A;  5KAI H;  2M8R A;  3F5H A;  1ZME C;  3CC4 P;  2IBZ I;  4U3F D;  3L70 D;  1XTC C;  2BCC J;  3KXD A;  3CCR P;  2OTL P;  3H1K E;  4W80 A;  4WVZ A;  2IX7 C;  1D7M A;  4HKZ H;  4PJ0 E;  1W5C E;  1ZN5 A;  2FYU D;  3AE8 C;  1G1I A;  4OVN F;  1HWT C;  1ZRT D;  3VMX A;  4IL6 X;  4AQR D;  5AVV B;  4HYT B;  1IZN B;  3C9I A;  3L72 E;  1U57 A;  1S2E A;  1L2P A;  4D6T E;  3BRV B;  1VL2 A;  3JCU E;  1HUC A;  1HF9 A;  1KIL A;  2IPP A;  1VQM P;  3GHG B;  1NYH A;  1NAF A;  2FYZ A;  2K88 A;  3KPE A;  1JY3 O;  1LTB C;  3T97 A;  5DJU B;  5KAF H;  1EZV E;  3RK3 D;  2JKV A;  2N1T B;  5KKZ B;  1AQ5 A;  2KLV A;  3L37 A;  2O3J A;  1OVU A;  1GMJ A;  1KYO I;  2RMZ A;  1FOS E;  3MHV A;  2AXT H;  1KZU B;  4GOE A;  3V4W A;  1KTM A;  1LT9 A;  4EI2 A;  1GDT A;  2IZ0 A;  3V2P A;  2QG4 A;  1NTM E;  3M0A A;  1RF1 B;  5B66 E;  2KS1 B;  1VQ8 P;  1FDM A;  4Z1M H;  3N7N A;  1NTK K;  1KQS O;  5TIS H;  1FZA A;  5CBN A;  3LIE A;  1E79 H;  1OW6 A;  1JUN A;  1KQL A;  1NU1 J;  2A45 H;  1ZR4 A;  4Y28 J;  1KB9 I;  4L74 A;  2PFX A;  4K35 A;  2FFD C;  1NGM B;  4M3L A;  3B5N A;  2WWW A;  5AVS B;  2I1J A;  2V4H A;  1SQB G;  1M8O B;  1SQX K;  2QJY C;  1VQ4 P;  1X8Y A;  1EXI A;  2Y9Y A;  1LTG C;  4OWF A;  1SS1 A;  2B87 B;  1FZB A;  2E42 A;  1GL2 C;  2ZT9 D;  1LTS C;  2HYN A;  5E79 H;  1IK7 A;  5AVR B;  4PD4 H;  1KQG B;  3KYQ A;  5AW9 B;  5AVY B;  1BSN A;  3L74 J;  1VF5 B;  1YHQ P;  5APY A;  1WT6 A;  4I6M C;  5H2F E;  5KAI E;  5L8R J;  2W83 C;  1VQ6 P;  4BRY B;  2FXP A;  1BSH A;  2AEJ A;  1ZP0 C;  1Q7Y Q;  4L76 A;  1EZV I;  1NKN A;  2RH0 A;  4I7Z C;  1S1C X;  1MZ9 A;  1RE3 C;  3EWK A;  3M0D A;  4MN4 C;  1SQQ G;  3KZI H;  1EDI A;  4EOT A;  3RK2 B;  5KJ7 C;  1NTZ J;  2XKM A;  1K8A Q;  3RBX A;  1VQ7 P;  1L0L G;  4ASV A;  1PIX A;  3HUS C;  4C7R A;  4ZKP A;  3H25 A;  3L73 J;  2C0W A;  5KLI B;  5CCG C;  1CI6 A;  3IF4 A;  3GHG A;  2I1K A;  1RH5 B;  2ZXE B;  3H1I J;  2XND H;  2R44 A;  1GZL A;  4RJT A;  5KAF E;  2QJP C;  1L4A B;  3SWK A;  1OW8 A;  3OW2 O;  2Q9I A;  2OTJ P;  1M1K Q;  4K3A A;  2L91 A;  1W2E A;  1OZH A;  1LTA C;  3CL3 D;  2E76 D;  2Q3I A;  2HFE D;  3RL0 C;  3H1J J;  1HJ0 A;  4OGQ B;  1PP9 J;  2XV5 A;  4QMA A;  3BVH A;  1PPJ E;  1OIP A;  3RK2 D;  1SQV G;  3NXS A;  3A2A A;  4H0L B;  4WY4 B;  4C46 A;  1RF1 A;  3AEG C;  3PLN A;  2KS1 A;  2ZJS E;  2OTK E;  3L75 E;  4PV1 B;  1Q82 Q;  3H1H E;  5TIS E;  4H44 C;  1YIJ P;  3V2Q A;  4YTP C;  1K9M Q;  2KSE A;  3B5N C;  5AVQ B;  1L0N D;  3S4R A;  1A02 F;  3L72 D;  3BCC E;  2ZYD A;  1PGP A;  1S5L X;  3JSV C;  4GOF A;  1YJ9 P;  4IL6 H;  1YYC A;  4D6T D;  2OYH C; 
#chains in the Genus database with same CATH homology
 2K9J B;  3L71 D;  1KB9 D;  5KLI B;  4A7P A;  2FYU D;  3H1I D;  4PD4 D;  3ITK A;  1BGY D;  1ZRT D;  2A06 D;  2BCC D;  2RN0 A;  3TGU D;  4RJT A;  2N9Y B;  3FWL A;  3L73 D;  1NU1 D;  2KNC B;  2YIU B;  1SQQ D;  5TJH A;  2Y0C A;  3TF5 A;  2L91 A;  3PHL A;  2FYN B;  1KYO D;  1EZV D;  3H1J D;  1PPJ D;  2Y0D A;  3CX5 D;  3KHU A;  1NTK D;  3BCC D;  2Y0E A;  1BCC D;  1NTM D;  3TDK A;  3GG2 A;  3CWB D;  5KKZ B;  4EDF A;  1SQP D;  2IBZ D;  1P84 D;  3L75 D;  3VMA A;  3H1H D;  2Q3E A;  3PLN A;  2KS1 A;  3CXH D;  1SQB D;  2O3J A;  2QJY B;  3GW6 A;  1PP9 D;  3PRJ A;  1L0L D;  2RMZ A;  3L74 D;  5KLV D;  2JWA A;  1SQX D;  1L0N D;  3H1L D;  3PTZ A;  3L72 D;  1NTZ D;  3H1K D;  2QG4 A;  2QJP B;  4U3F D;  3L70 D;  1BE3 D;  4D6T D;  1SQV D;  2QJK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...