3L72G

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
b'IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
molecule tags Oxidoreductase
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
total genus 19
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l72G00
3L71G 1BE3G 1PPJG 1BGYG 1P84H 1PP9G 1NTMG 3CXHH 3BCCG 1L0LG 1SQVG 1SQBG 1EZVG 1KB9H 2IBZG 2BCCG 3H1JG 4U3FG 5KLVG 1KYOH 3H1IG 3H1HG 1SQXG 1NTZG 2A06G 1NTKG 3TGUG 3L72G 3H1KG 3L73G 4PD4H 3H1LG 1BCCG 3CWBG 3L70G 4D6TG 1L0NG 1NU1G 3L75G 2FYUG 3CX5H 1SQPG 3L74G 1SQQG
chains in the Genus database with same CATH superfamily
3B71A 1M1JC 2C9LY 1NO4A 2HODA 4KHXA 3BATA 1S2EA 3H1IE 1GL2A 3L72D 3V2PA 1HTLC 5KKZB 3RK2C 2QJYB 3H1IJ 3PHLA 1X79B 1OFCX 4JPZB 3USSA 1N7SB 3M06A 2P58A 4N78E 1RQUA 3EFGA 2FY8A 5H2FH 4PD4I 1KQFB 2K9JB 3EWKA 1L0NE 1YJ9P 2YMKA 1PP9E 3A3YB 4UB6E 1EDIA 4B86A 1SLQA 1L0NJ 2NPSD 2ZAEB 3AEDC 1GK6A 1S3JA 2JO1A 2IBZE 1IJDB 4AYCA 2N1TB 3IFMA 4LGDE 3AE9C 1URQA 2YKQA 3RL0D 5B5EE 2QA4P 1L4AA 3HE5B 2Z5IA 3FGAD 1FDOA 2QVAA 2R5DA 3JCUH 2WT7A 1KILD 2ZXXA 3AEBC 1IFPA 2FYUE 3L74G 2WPVB 3QWOC 2Y9YA 4TLFA 1CZQA 1S4XA 3IAOA 3RK3D 2J5UA 2KS1A 2W6BA 3SWFA 1SQBE 4WY4A 5M1BA 1EDJA 3H1HE 2KS1B 1NTMG 4HKZH 1VQNP 1KN7A 1MZ9A 2WSSH 4U3FD 1VQ9P 2FFDA 3RBZA 2BCCG 2N1TA 3H25A 3AE5C 1RQVA 1QGKB 2RH0A 1K8AQ 1BGYE 4GT1A 4ZKPA 3MP7B 2IPPA 3VMAA 1PV3A 4R4MA 1BGYJ 3GMAA 3L72G 2C9NY 1Q2NA 3VP9A 1NVOA 5AVTB 5AW1B 1IK7A 1BE3D 1BCCG 1E5WA 1RF0C 2P2UA 3P8CD 1D7MA 1JCDA 3L71E 4L75A 5AW7B 1LWUC 1ZXGA 3E1IA 1YHQP 1MV8A 2FBWC 1W5CE 2FYUJ 1K05A 1LTAC 2L5GB 1HH0A 1IZNB 2WITA 3GW6A 3L70E 1USEA 3ABVC 1SQPK 2ZXEB 3A7OA 5CCHD 5B66H 1KB9D 3AEFC 1L2PA 1LT9A 1KQGB 1USDA 3TGUG 1JY2P 5APSA 1BCCJ 2JWDA 3B5ND 4NPEA 3HD7A 1NHLA 3V2NA 1AQ5A 1FBMA 2M3EA 4Y28J 2ZYDA 1QL2A 3H1ID 3P32A 4K35A 1VQ5P 4H44D 2OYHB 1EZVE 2AEMA 1CI6B 3H1JJ 3HTKB 2JWAA 1URQB 1VPCA 3GF7A 3HUSC 3V4QA 5BVZA 2K9YA 2ZJSE 4C7RA 4GDOA 3B5NB 3D6YA 1SQXE 1K04A 3GLMA 2WSFH 1PFIA 2YO3A 2W83C 5AW9B 2IDBA 3CX5E 3HRNA 2Z4EA 1ZRTD 3I5CA 3CPWO 1BSNA 1NU1G 5H2FE 3VTPC 1VQOP 1LTGC 2FYUG 3MTUE 1SQVK 2XKMA 1IFJA 2I1KA 2Y0CA 2BASA 2LXCB 5GTIE 1PL5A 5B5EH 1FJKA 2K9JA 2Y9ZA 4LC1A 1AVYA 1LGHB 2D2CD 5TISH 3I55P 3H1LD 3CMEP 1QEXA 1HWTC 3KQGA 4RJTA 4GODA 2ZFCA 2FXPA 3L73D 3S9OA 2BCCE 1URQD 1NAFA 4IFFA 3Q2YA 1NTKJ 2P67A 2BCCJ 3CCLP 1ZN5A 2OARA 2CPBA 1OW6A 2O1JA 2Q9IA 5TJHA 2B9BA 2B88A 2LKMA 5AVXB 4DJGA 4JYCA 3NFQA 2FKWB 2E5TA 3KDPB 4OH8B 2QG4A 3HD7B 5CJ0A 1L0LD 1BE3J 1RF0A 1VF5C 1VF5D 3PP5A 5AVYB 3RK2D 1BGYD 2Y0EA 5AW2B 3VMXA 1LT9B 1SQQD 4GKGA 5EFWB 5BU5A 5KLVK 3L70G 3G9RA 3H1LE 2JDIH 4BWNA 5APYA 1KB9I 2D2CB 3A0BH 3CCEP 3TGUE 2V4HA 1SQQK 2QRXA 3GHGB 2FYUD 2WPSA 3G71P 2ZT9C 1NKZB 3AE8C 4CPGA 1SQQG 3CI9A 3SWKA 3U1AA 3V6IA 1NTZK 2E76D 1FZCB 1VQ7P 3D6ZA 1NTMJ 2MJZA 2Z5HA 4TT3H 4WY4C 2A06D 2BEQD 1GU4A 1KYOE 4BRYA 4H0LB 4W7ZA 1EZVG 2WPRA 3H1KJ 3H1HJ 1QVGO 4MN4C 2O01J 5KJ7D 2IX7C 1H0TB 1KMIZ 1L4AC 2K3RA 4UB8H 2KK7A 3L75E 3H1IG 4K3AA 1SQXG 3MZWB 4I7ZB 2A06G 1P84E 2QE7H 1MFTA 1JO5A 3SWYA 3C1LA 4HYTB 1Q86Q 1GW4A 2C0WA 1BSHA 2SPZA 3OW2O 5AVRB 2WTYA 1L0NG 4L73A 3WU2E 3O6QB 1N73B 1LWUB 2KP8A 1ZP0C 3PLNA 1Y8AA 3TDKA 3VYIA 2GM4A 1NU1D 3PRJA 4HH2A 1PZQA 2WT7B 1YJWP 4IFDK 5APVA 1H0TA 1KORA 1HVVA 3L73J 4L74A 1NU1K 1P84H 2YKPA 1NAYA 1FC2C 1NTKD 1RY3A 2FYNC 3F5HA 1M1JA 1S9KD 1KTMA 2OTKE 1NOHA 2V7QJ 1G2CA 1NGMB 1M7LA 4GOFA 3V2RA 1JMBA 3NXSA 3CCVP 2BCCD 1J1EC 1KYOH 1OMIA 1U7MA 2HG5D 1S5LE 3H1HG 3GHGA 1S1CX 3IF4A 5APUA 5AVVB 1PP9D 3PJSK 2AXTH 2I8DA 1T8ZA 1Z56A 2E76C 2KXPB 2KI7B 2P7JA 2Q3EA 3H1JE 3H1LG 3MGNA 2A45G 1SQBK 4WWIA 1FZCA 2E75C 5KAFH 3CWBG 2Q5UA 1FDIA 1NTZJ 1DEBA 1SQQJ 3FX0A 5KJ7A 1HBWA 1KILC 1SQQE 4UB8E 3TNUA 2HPCA 1ZW0A 1PIXA 1GK4A 1SQPG 3TNUB 2HPCB 5AW3B 1GU5A 1BCCE 4DOJA 1ZV8A 3RK3E 1PGOA 2ITAA 3A2AA 4PJ0H 2IYPA 3E7KA 2KSJA 1AA0A 1Q90D 2PFXA 3H1HD 3U59A 3MIWA 5BU8B 4W80A 2P10A 3HE4B 1P84I 2MKVA 3WMM0 1NJIQ 2A06E 1H8AA 3CC2P 1VQ6P 4YTPC 3P8MC 2PAJA 2IBZD 1RE3A 3NTNA 1E79H 3H32B 2M3BA 4OWFA 2YNYA 3CMAP 4U7JA 5E79E 1L0LJ 1SQXK 5CCGC 4OGQC 3D70A 1FOSE 5CHXA 1S9KE 1NKNA 3B8EB 3FXDA 3II6A 4JQ0D 1G2CB 1BE3E 3P8CE 2E5YA 3OJAB 1M1JB 3T97A 1KV4A 3KYQA 2PGDA 3CXHD 1SQVE 3KZIE 2OYIB 1SFCD 2FFDB 3LW5H 3CX5H 2Q7CA 1GW3A 1NU1J 1KB9E 3CD6P 1N7SC 1PGJA 2H88C 3CWBD 1NU1E 3BVHA 2ZYAA 1IFDA 3I56P 4JBZA 2GA1A 1K73Q 1HF9A 5TISE 1K9MQ 1ZLLA 3L35A 4H44C 4AQRD 4EI2A 2OTJP 3H1KG 1MUUA 4RKUJ 3E1RA 4W7YA 1YYCA 3H1JG 3H1KE 1EZVD 3G3ZA 5AW0B 1AQTA 3BCCJ 3W68A 1H89A 1KILE 1GDTA 1Y47A 4IOIH 1VQ4P 1SQVD 2M0BA 3SFDC 1HJBA 1OVVA 5AVWB 1PP9J 1YQ3C 2JP3A 1RF1B 2QM8A 1OXZA 1KILB 2OYOA 2QM7A 1WMKA 3L71D 5AVSB 5KLVJ 3TGUJ 1NYHA 1ZRTE 2Y0DA 3AE7C 3CCMP 4XE5B 1YIJP 1ZR2A 3RL0B 2I1JA 1KD1Q 3CC4P 3C8VA 1OW8A 5L8RJ 3JC22 3B4SA 3KXDA 4QMAA 1J1DC 2W90A 4I6MC 2AXTE 1SP4A 3EQ2A 4WBAA 1N86A 3HUSB 1S72P 1AV1A 1CSBA 5KAIE 2CPSA 2QJYC 3CX5I 2NPSA 5K5GB 1JNMA 1JY2O 5KKZC 1RHZB 1EZVI 1GZLA 3CL3D 3RK3C 3L73E 5CMZA 1ZMEC 3BRTB 3BCCE 3CCRP 1N7LA 2WSFJ 2R5BA 1DD3A 1X22A 4IL6H 1NTMK 3JCUE 1T2KD 2CK3H 1FZGA 5CJ4A 1HJ0A 3RL0C 4OGQB 4Z1MH 1A02F 2PP6A 2IZ1A 4U3FE 4YXWH 3AE3C 3UIAA 1EDLA 1M57D 2AXCA 2HYNA 1JCCA 2RN0A 3L75G 2OYHC 1FDMA 1L0NK 2YIUB 1DIPA 4OVNF 2OTLP 3Q5PA 3RL0g 1LP1B 1SFCB 2ZYGA 3CCSP 1XTGB 2QJPC 5AW6B 2ZVNB 3T97B 1LTIC 1QL1A 4KJMA 3V4WA 3ITKA 3CC7P 2E74B 2WSCJ 1YITP 3H32A 2R3SA 4EYYQ 1N7SA 4DT0A 3HD7D 2Q1KA 3AEEC 1M90Q 3TF5A 1NTZD 4OGQD 5B66E 1IC2A 3BRVB 3C9IA 3IR9A 4H13B 5CBNA 4IL6E 3A5TA 2AEJA 4ASVA 1AJYA 5APWA 3AE2C 4R4LA 2H8PD 2H7HA 1CI6A 3HTKA 3JSVC 2JR8A 2E75D 5AVUB 3WUVA 2OYHA 2IFMA 1FZCC 2E42A 4DCKA 4PD4H 2KNCB 4BXLA 3LIDA 2BEZF 1JOCA 1KYOI 4ASWA 1YI2P 3N7NA 3PH0A 3TGUD 1M1KQ 1R5LA 1YTZT 1NH4A 1R5SA 4D6TG 1A02J 1JUNA 5DJUB 1X0TA 2A45H 2WPQA 1M56D 1IFMA 2N1TD 2N1TC 1OVRA 2R44A 2J58A 2KLVA 1GMJA 2W6JH 1JY2N 3CXHI 1QX8A 3LIEA 2FFDC 1LTJA 3CWBE 1GL2C 2K1AA 4A7PA 1RH5B 3R4YA 3L37A 2OGUA 1EC5A 3RBXA 1OZHA 5KAFE 3CCQP 3BCCG 1L0LG 1JEKA 1SQPJ 1JY3O 1RE4A 2WZ7A 4M3LA 4PD4E 2KB7P 4PV1D 3D71A 1SQPE 2NRGA 2IZ0A 2O3JA 1HUCA 1KILA 2WWWA 4H44B 2WVRA 2LR2A 1N8RQ 5AVZB 3GG2A 1L4AD 4U3FG 2Q3IA 3WUTA 3NMDA 1EXJA 3BCCD 3KHUA 4Y99C 1VQLP 1LP1A 1SFCA 1SQBD 1X8YA 1LTTC 3AEAC 1VL2A 3LW5J 1NTZE 4HJGH 3B5NA 3M91A 1Q82Q 3GHGC 1BDDA 2KSEA 2O1KA 2E74D 1JMMA 1OW7A 1SFCC 2YXRB 1U57A 1WT6A 3GF3A 3L71J 3F89A 4N3YB 3VMZA 1T2KC 1Q7YQ 1IO4A 4ZMDA 3L4FA 2YMYA 4PD4D 2VRSA 4D6TD 4WY4B 2N9YB 4C46A 1SQVJ 4AUWA 2WMMA 3L75D 2LXBA 4N6JA 1J1DB 1BCCD 1BE3G 2JJLA 3TYYA 4H13C 5AVQB 1VQKP 1KQLA 2R3CA 1U7JA 2KYVA 2E75B 3AE1C 1L4AB 3CXHH 1SQVG 2G3AA 3HE5A 2ZT9D 2NPSB 4PJ0E 1LTJC 1KB9H 1FZFA 3AE4C 2W27A 1SQXD 3O8ZA 1KZUB 2IYOA 3H6PA 1VQ8P 3H1JD 1NTKK 3PTZA 4JYBA 3KZIH 4NPDA 4BRYB 1Y9BA 1LJ2A 4I2LC 3V5BA 4D6TJ 4RESB 3MUDA 2HLOA 1T3UA 2B87A 4XFJA 3S1KA 4D6TE 4UB6H 2RKLA 1KFMA 2WSEJ 4WY4D 3FWNA 2FXMA 1T6AA 2O01H 2YKOA 5AW5B 3TSIA 1SQPD 5E79H 3HE4A 4U3FJ 5CCHC 1NWQA 1RF1A 2D2CC 3W67A 2FXOA 2L91A 1P84D 1LTJB 1OWAA 2M8RA 1HGZA 1S5LH 5CBOA 2RMZA 2GUVA 2HODB 5KAIH 5KLIB 1R8EA 1FJPA 2JEEA 3L70D 3VOPA 2UWJE 1SS1A 2GUSA 2Q6QA 1EDKA 3A0HH 1DX7A 2YXQB 1PP9G 4EIJA 1Q81Q 2KNCA 4WB4A 4DZOA 2IBZG 2OYIA 2WSEH 1KFNA 3AECC 3M9QA 3OA7A 3BASA 2M5AA 1JTHB 1DEEG 2POHA 4C7NB 2E43A 5KTBA 1NTZG 1FOSF 3L75J 2A45I 2AEFA 3S4RA 4XA4A 5KLVE 3L73G 5CCGD 3VN0A 1GL2D 3P7KA 2NZ2A 2G8YA 5APTA 3CXHE 2DW3A 1X9VA 4IL6X 3Q3DA 3CCUP 1JY3P 1XTCC 3M0DA 1N73C 1DD4A 3M0AA 1FZBA 5APQA 1TU3F 2QEXP 2PRRA 3Q1MA 1YQ4C 1UIIA 1GL2B 1OX3A 1OVUA 1W2BO 1YTZI 1PPJG 2NPSC 1BGYG 1AVOA 3L72J 5APXA 1PGPA 3RK2B 2H43A 3MHVA 2IBZI 2M5AB 1IFNA 1IFIA 3H1KD 3L72E 3AEGC 2N9BA 5KLVD 3SSUA 4EDFA 3R2PA 1JB0J 2WSCH 1FU1A 5GTHE 5C39A 3OAKA 2C0XA 1W2EA 2WQYC 1NTKG 1OIPA 1ZOYC 4H0LC 4IFMA 2KOGA 3VMYA 3WU2H 3SFEC 3V2QA 1MKMA 2W8ZA 4PV1C 1IK9A 2XZRA 3CX5D 3HUSA 3L74D 2FYUK 1UIXA 3ZDMA 1LTSC 2W6AA 2XDJA 3Q5SA 1KQSO 3RK3B 4JF7A 3G4SP 2ZVOB 1SQBJ 3L70J 1DH3A 1JM0A 1VF5B 2B87B 1KC8Q 1EQ7A 1VDFA 3HD7C 1GTWA 1AFOA 1CW5A 3CWBJ 2H89C 2QJKC 1VQMP 2QIWA 1LT9C 3VP8A 4EOTA 2R32A 2YIUC 1G1IA 3IN6A 2QSIA 3L74J 3QH9A 1N2DC 4RO0A 4GIFA 3WUUA 4LLHA 1EXIA 1LWUA 2B89A 5GTIH 2O01N 5KLVG 1RF1C 1JY3N 3M0DC 3M9BA 3Q5RA 1N73A 1GD2E 3MD0A 2JKVA 1L0LE 4KT0J 4H13D 2E74C 2XNDH 2V7QH 2XU6A 1NTMD 2KLUA 3O6QA 1HGVA 3CLQA 4H0LD 1G1JA 1J1EB 1S5LX 2KUBA 1L0LK 1SQXJ 5GTHH 5CCGA 1BDCA 1FS0E 1J2JB 2HFED 1FAVA 1RE3C 2E76B 4Y99B 1ZR4A 3FXEA 4I7ZC 3TK1A 2J59M 3KPEA 2IFNA 1MFZA 2OYIC 1T3JA 1PPJE 1FZEA 1L0ND 3L71G 4YPCA 2XV5A 4WVZA 1QLED 1WRGA 2HR3A 3M9HA 3U1CA 1SVFA 3G6EP 1M8OB 3L74E 1KYOD 4HB1A 2K88A 5AW4B 1SQBG 4YXDC 3N4XA 1YJNP 3FWLA 1NTME 1PGQA 4O9BA 3A0BE 4ZKUA 1NTKE 2K37A 1URQC 1FE6A 5KJ7C 1JTHA 4NPFX 3K5BA 1FZAA 3AE6C 1LTBC 4PV1B 4ZNCA 3B5NC 3EFFK 5CCHA 3RGUA 3CCJP 1VQPP 1N7SD 1LT1A 2OQQA 4C7NA 2P1JA 1H88A 2ZT9B 4GOEA 4N78D 1PPJD 3H1LJ 2FYNB 2QJPB 1QVFO 3A0HE 3MUDC 5DJTB 2XNXA 1YBKA 2KIKA 2KZIA 2KZJA 4I1LA 5KLIC 1LNQA 3L36A 4L76A 5AW8B 1RE4C 2YO2A 2QJKB 2FYZA
chains in the Genus database with same CATH topology
3L71G 1BE3G 1PPJG 1BGYG 1P84H 1PP9G 1NTMG 3CXHH 3BCCG 1L0LG 1SQVG 1SQBG 1EZVG 1KB9H 2IBZG 2BCCG 3H1JG 4U3FG 5KLVG 1KYOH 3H1IG 3H1HG 1SQXG 1NTZG 2A06G 1NTKG 3TGUG 3L72G 3H1KG 3L73G 4PD4H 3H1LG 1BCCG 3CWBG 3L70G 4D6TG 1L0NG 1NU1G 3L75G 2FYUG 3CX5H 1SQPG 3L74G 1SQQG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L71 G;  1BE3 G;  1PPJ G;  1BGY G;  1P84 H;  1PP9 G;  1NTM G;  3CXH H;  3BCC G;  1L0L G;  1SQV G;  1SQB G;  1EZV G;  1KB9 H;  2IBZ G;  2BCC G;  3H1J G;  4U3F G;  5KLV G;  1KYO H;  3H1I G;  3H1H G;  1SQX G;  1NTZ G;  2A06 G;  1NTK G;  3TGU G;  3L72 G;  3H1K G;  3L73 G;  4PD4 H;  3H1L G;  1BCC G;  3CWB G;  3L70 G;  4D6T G;  1L0N G;  1NU1 G;  3L75 G;  2FYU G;  3CX5 H;  1SQP G;  3L74 G;  1SQQ G; 
#chains in the Genus database with same CATH topology
 3B71 A;  1M1J C;  2C9L Y;  1NO4 A;  2HOD A;  4KHX A;  3BAT A;  1S2E A;  3H1I E;  1GL2 A;  3L72 D;  3V2P A;  1HTL C;  5KKZ B;  3RK2 C;  2QJY B;  3H1I J;  3PHL A;  1X79 B;  1OFC X;  4JPZ B;  3USS A;  1N7S B;  3M06 A;  2P58 A;  4N78 E;  1RQU A;  3EFG A;  2FY8 A;  5H2F H;  4PD4 I;  1KQF B;  2K9J B;  3EWK A;  1L0N E;  1YJ9 P;  2YMK A;  1PP9 E;  3A3Y B;  4UB6 E;  1EDI A;  4B86 A;  1SLQ A;  1L0N J;  2NPS D;  2ZAE B;  3AED C;  1GK6 A;  1S3J A;  2JO1 A;  2IBZ E;  1IJD B;  4AYC A;  2N1T B;  3IFM A;  4LGD E;  3AE9 C;  1URQ A;  2YKQ A;  3RL0 D;  5B5E E;  2QA4 P;  1L4A A;  3HE5 B;  2Z5I A;  3FGA D;  1FDO A;  2QVA A;  2R5D A;  3JCU H;  2WT7 A;  1KIL D;  2ZXX A;  3AEB C;  1IFP A;  2FYU E;  3L74 G;  2WPV B;  3QWO C;  2Y9Y A;  4TLF A;  1CZQ A;  1S4X A;  3IAO A;  3RK3 D;  2J5U A;  2KS1 A;  2W6B A;  3SWF A;  1SQB E;  4WY4 A;  5M1B A;  1EDJ A;  3H1H E;  2KS1 B;  1NTM G;  4HKZ H;  1VQN P;  1KN7 A;  1MZ9 A;  2WSS H;  4U3F D;  1VQ9 P;  2FFD A;  3RBZ A;  2BCC G;  2N1T A;  3H25 A;  3AE5 C;  1RQV A;  1QGK B;  2RH0 A;  1K8A Q;  1BGY E;  4GT1 A;  4ZKP A;  3MP7 B;  2IPP A;  3VMA A;  1PV3 A;  4R4M A;  1BGY J;  3GMA A;  3L72 G;  2C9N Y;  1Q2N A;  3VP9 A;  1NVO A;  5AVT B;  5AW1 B;  1IK7 A;  1BE3 D;  1BCC G;  1E5W A;  1RF0 C;  2P2U A;  3P8C D;  1D7M A;  1JCD A;  3L71 E;  4L75 A;  5AW7 B;  1LWU C;  1ZXG A;  3E1I A;  1YHQ P;  1MV8 A;  2FBW C;  1W5C E;  2FYU J;  1K05 A;  1LTA C;  2L5G B;  1HH0 A;  1IZN B;  2WIT A;  3GW6 A;  3L70 E;  1USE A;  3ABV C;  1SQP K;  2ZXE B;  3A7O A;  5CCH D;  5B66 H;  1KB9 D;  3AEF C;  1L2P A;  1LT9 A;  1KQG B;  1USD A;  3TGU G;  1JY2 P;  5APS A;  1BCC J;  2JWD A;  3B5N D;  4NPE A;  3HD7 A;  1NHL A;  3V2N A;  1AQ5 A;  1FBM A;  2M3E A;  4Y28 J;  2ZYD A;  1QL2 A;  3H1I D;  3P32 A;  4K35 A;  1VQ5 P;  4H44 D;  2OYH B;  1EZV E;  2AEM A;  1CI6 B;  3H1J J;  3HTK B;  2JWA A;  1URQ B;  1VPC A;  3GF7 A;  3HUS C;  3V4Q A;  5BVZ A;  2K9Y A;  2ZJS E;  4C7R A;  4GDO A;  3B5N B;  3D6Y A;  1SQX E;  1K04 A;  3GLM A;  2WSF H;  1PFI A;  2YO3 A;  2W83 C;  5AW9 B;  2IDB A;  3CX5 E;  3HRN A;  2Z4E A;  1ZRT D;  3I5C A;  3CPW O;  1BSN A;  1NU1 G;  5H2F E;  3VTP C;  1VQO P;  1LTG C;  2FYU G;  3MTU E;  1SQV K;  2XKM A;  1IFJ A;  2I1K A;  2Y0C A;  2BAS A;  2LXC B;  5GTI E;  1PL5 A;  5B5E H;  1FJK A;  2K9J A;  2Y9Z A;  4LC1 A;  1AVY A;  1LGH B;  2D2C D;  5TIS H;  3I55 P;  3H1L D;  3CME P;  1QEX A;  1HWT C;  3KQG A;  4RJT A;  4GOD A;  2ZFC A;  2FXP A;  3L73 D;  3S9O A;  2BCC E;  1URQ D;  1NAF A;  4IFF A;  3Q2Y A;  1NTK J;  2P67 A;  2BCC J;  3CCL P;  1ZN5 A;  2OAR A;  2CPB A;  1OW6 A;  2O1J A;  2Q9I A;  5TJH A;  2B9B A;  2B88 A;  2LKM A;  5AVX B;  4DJG A;  4JYC A;  3NFQ A;  2FKW B;  2E5T A;  3KDP B;  4OH8 B;  2QG4 A;  3HD7 B;  5CJ0 A;  1L0L D;  1BE3 J;  1RF0 A;  1VF5 C;  1VF5 D;  3PP5 A;  5AVY B;  3RK2 D;  1BGY D;  2Y0E A;  5AW2 B;  3VMX A;  1LT9 B;  1SQQ D;  4GKG A;  5EFW B;  5BU5 A;  5KLV K;  3L70 G;  3G9R A;  3H1L E;  2JDI H;  4BWN A;  5APY A;  1KB9 I;  2D2C B;  3A0B H;  3CCE P;  3TGU E;  2V4H A;  1SQQ K;  2QRX A;  3GHG B;  2FYU D;  2WPS A;  3G71 P;  2ZT9 C;  1NKZ B;  3AE8 C;  4CPG A;  1SQQ G;  3CI9 A;  3SWK A;  3U1A A;  3V6I A;  1NTZ K;  2E76 D;  1FZC B;  1VQ7 P;  3D6Z A;  1NTM J;  2MJZ A;  2Z5H A;  4TT3 H;  4WY4 C;  2A06 D;  2BEQ D;  1GU4 A;  1KYO E;  4BRY A;  4H0L B;  4W7Z A;  1EZV G;  2WPR A;  3H1K J;  3H1H J;  1QVG O;  4MN4 C;  2O01 J;  5KJ7 D;  2IX7 C;  1H0T B;  1KMI Z;  1L4A C;  2K3R A;  4UB8 H;  2KK7 A;  3L75 E;  3H1I G;  4K3A A;  1SQX G;  3MZW B;  4I7Z B;  2A06 G;  1P84 E;  2QE7 H;  1MFT A;  1JO5 A;  3SWY A;  3C1L A;  4HYT B;  1Q86 Q;  1GW4 A;  2C0W A;  1BSH A;  2SPZ A;  3OW2 O;  5AVR B;  2WTY A;  1L0N G;  4L73 A;  3WU2 E;  3O6Q B;  1N73 B;  1LWU B;  2KP8 A;  1ZP0 C;  3PLN A;  1Y8A A;  3TDK A;  3VYI A;  2GM4 A;  1NU1 D;  3PRJ A;  4HH2 A;  1PZQ A;  2WT7 B;  1YJW P;  4IFD K;  5APV A;  1H0T A;  1KOR A;  1HVV A;  3L73 J;  4L74 A;  1NU1 K;  1P84 H;  2YKP A;  1NAY A;  1FC2 C;  1NTK D;  1RY3 A;  2FYN C;  3F5H A;  1M1J A;  1S9K D;  1KTM A;  2OTK E;  1NOH A;  2V7Q J;  1G2C A;  1NGM B;  1M7L A;  4GOF A;  3V2R A;  1JMB A;  3NXS A;  3CCV P;  2BCC D;  1J1E C;  1KYO H;  1OMI A;  1U7M A;  2HG5 D;  1S5L E;  3H1H G;  3GHG A;  1S1C X;  3IF4 A;  5APU A;  5AVV B;  1PP9 D;  3PJS K;  2AXT H;  2I8D A;  1T8Z A;  1Z56 A;  2E76 C;  2KXP B;  2KI7 B;  2P7J A;  2Q3E A;  3H1J E;  3H1L G;  3MGN A;  2A45 G;  1SQB K;  4WWI A;  1FZC A;  2E75 C;  5KAF H;  3CWB G;  2Q5U A;  1FDI A;  1NTZ J;  1DEB A;  1SQQ J;  3FX0 A;  5KJ7 A;  1HBW A;  1KIL C;  1SQQ E;  4UB8 E;  3TNU A;  2HPC A;  1ZW0 A;  1PIX A;  1GK4 A;  1SQP G;  3TNU B;  2HPC B;  5AW3 B;  1GU5 A;  1BCC E;  4DOJ A;  1ZV8 A;  3RK3 E;  1PGO A;  2ITA A;  3A2A A;  4PJ0 H;  2IYP A;  3E7K A;  2KSJ A;  1AA0 A;  1Q90 D;  2PFX A;  3H1H D;  3U59 A;  3MIW A;  5BU8 B;  4W80 A;  2P10 A;  3HE4 B;  1P84 I;  2MKV A;  3WMM 0;  1NJI Q;  2A06 E;  1H8A A;  3CC2 P;  1VQ6 P;  4YTP C;  3P8M C;  2PAJ A;  2IBZ D;  1RE3 A;  3NTN A;  1E79 H;  3H32 B;  2M3B A;  4OWF A;  2YNY A;  3CMA P;  4U7J A;  5E79 E;  1L0L J;  1SQX K;  5CCG C;  4OGQ C;  3D70 A;  1FOS E;  5CHX A;  1S9K E;  1NKN A;  3B8E B;  3FXD A;  3II6 A;  4JQ0 D;  1G2C B;  1BE3 E;  3P8C E;  2E5Y A;  3OJA B;  1M1J B;  3T97 A;  1KV4 A;  3KYQ A;  2PGD A;  3CXH D;  1SQV E;  3KZI E;  2OYI B;  1SFC D;  2FFD B;  3LW5 H;  3CX5 H;  2Q7C A;  1GW3 A;  1NU1 J;  1KB9 E;  3CD6 P;  1N7S C;  1PGJ A;  2H88 C;  3CWB D;  1NU1 E;  3BVH A;  2ZYA A;  1IFD A;  3I56 P;  4JBZ A;  2GA1 A;  1K73 Q;  1HF9 A;  5TIS E;  1K9M Q;  1ZLL A;  3L35 A;  4H44 C;  4AQR D;  4EI2 A;  2OTJ P;  3H1K G;  1MUU A;  4RKU J;  3E1R A;  4W7Y A;  1YYC A;  3H1J G;  3H1K E;  1EZV D;  3G3Z A;  5AW0 B;  1AQT A;  3BCC J;  3W68 A;  1H89 A;  1KIL E;  1GDT A;  1Y47 A;  4IOI H;  1VQ4 P;  1SQV D;  2M0B A;  3SFD C;  1HJB A;  1OVV A;  5AVW B;  1PP9 J;  1YQ3 C;  2JP3 A;  1RF1 B;  2QM8 A;  1OXZ A;  1KIL B;  2OYO A;  2QM7 A;  1WMK A;  3L71 D;  5AVS B;  5KLV J;  3TGU J;  1NYH A;  1ZRT E;  2Y0D A;  3AE7 C;  3CCM P;  4XE5 B;  1YIJ P;  1ZR2 A;  3RL0 B;  2I1J A;  1KD1 Q;  3CC4 P;  3C8V A;  1OW8 A;  5L8R J;  3JC2 2;  3B4S A;  3KXD A;  4QMA A;  1J1D C;  2W90 A;  4I6M C;  2AXT E;  1SP4 A;  3EQ2 A;  4WBA A;  1N86 A;  3HUS B;  1S72 P;  1AV1 A;  1CSB A;  5KAI E;  2CPS A;  2QJY C;  3CX5 I;  2NPS A;  5K5G B;  1JNM A;  1JY2 O;  5KKZ C;  1RHZ B;  1EZV I;  1GZL A;  3CL3 D;  3RK3 C;  3L73 E;  5CMZ A;  1ZME C;  3BRT B;  3BCC E;  3CCR P;  1N7L A;  2WSF J;  2R5B A;  1DD3 A;  1X22 A;  4IL6 H;  1NTM K;  3JCU E;  1T2K D;  2CK3 H;  1FZG A;  5CJ4 A;  1HJ0 A;  3RL0 C;  4OGQ B;  4Z1M H;  1A02 F;  2PP6 A;  2IZ1 A;  4U3F E;  4YXW H;  3AE3 C;  3UIA A;  1EDL A;  1M57 D;  2AXC A;  2HYN A;  1JCC A;  2RN0 A;  3L75 G;  2OYH C;  1FDM A;  1L0N K;  2YIU B;  1DIP A;  4OVN F;  2OTL P;  3Q5P A;  3RL0 g;  1LP1 B;  1SFC B;  2ZYG A;  3CCS P;  1XTG B;  2QJP C;  5AW6 B;  2ZVN B;  3T97 B;  1LTI C;  1QL1 A;  4KJM A;  3V4W A;  3ITK A;  3CC7 P;  2E74 B;  2WSC J;  1YIT P;  3H32 A;  2R3S A;  4EYY Q;  1N7S A;  4DT0 A;  3HD7 D;  2Q1K A;  3AEE C;  1M90 Q;  3TF5 A;  1NTZ D;  4OGQ D;  5B66 E;  1IC2 A;  3BRV B;  3C9I A;  3IR9 A;  4H13 B;  5CBN A;  4IL6 E;  3A5T A;  2AEJ A;  4ASV A;  1AJY A;  5APW A;  3AE2 C;  4R4L A;  2H8P D;  2H7H A;  1CI6 A;  3HTK A;  3JSV C;  2JR8 A;  2E75 D;  5AVU B;  3WUV A;  2OYH A;  2IFM A;  1FZC C;  2E42 A;  4DCK A;  4PD4 H;  2KNC B;  4BXL A;  3LID A;  2BEZ F;  1JOC A;  1KYO I;  4ASW A;  1YI2 P;  3N7N A;  3PH0 A;  3TGU D;  1M1K Q;  1R5L A;  1YTZ T;  1NH4 A;  1R5S A;  4D6T G;  1A02 J;  1JUN A;  5DJU B;  1X0T A;  2A45 H;  2WPQ A;  1M56 D;  1IFM A;  2N1T D;  2N1T C;  1OVR A;  2R44 A;  2J58 A;  2KLV A;  1GMJ A;  2W6J H;  1JY2 N;  3CXH I;  1QX8 A;  3LIE A;  2FFD C;  1LTJ A;  3CWB E;  1GL2 C;  2K1A A;  4A7P A;  1RH5 B;  3R4Y A;  3L37 A;  2OGU A;  1EC5 A;  3RBX A;  1OZH A;  5KAF E;  3CCQ P;  3BCC G;  1L0L G;  1JEK A;  1SQP J;  1JY3 O;  1RE4 A;  2WZ7 A;  4M3L A;  4PD4 E;  2KB7 P;  4PV1 D;  3D71 A;  1SQP E;  2NRG A;  2IZ0 A;  2O3J A;  1HUC A;  1KIL A;  2WWW A;  4H44 B;  2WVR A;  2LR2 A;  1N8R Q;  5AVZ B;  3GG2 A;  1L4A D;  4U3F G;  2Q3I A;  3WUT A;  3NMD A;  1EXJ A;  3BCC D;  3KHU A;  4Y99 C;  1VQL P;  1LP1 A;  1SFC A;  1SQB D;  1X8Y A;  1LTT C;  3AEA C;  1VL2 A;  3LW5 J;  1NTZ E;  4HJG H;  3B5N A;  3M91 A;  1Q82 Q;  3GHG C;  1BDD A;  2KSE A;  2O1K A;  2E74 D;  1JMM A;  1OW7 A;  1SFC C;  2YXR B;  1U57 A;  1WT6 A;  3GF3 A;  3L71 J;  3F89 A;  4N3Y B;  3VMZ A;  1T2K C;  1Q7Y Q;  1IO4 A;  4ZMD A;  3L4F A;  2YMY A;  4PD4 D;  2VRS A;  4D6T D;  4WY4 B;  2N9Y B;  4C46 A;  1SQV J;  4AUW A;  2WMM A;  3L75 D;  2LXB A;  4N6J A;  1J1D B;  1BCC D;  1BE3 G;  2JJL A;  3TYY A;  4H13 C;  5AVQ B;  1VQK P;  1KQL A;  2R3C A;  1U7J A;  2KYV A;  2E75 B;  3AE1 C;  1L4A B;  3CXH H;  1SQV G;  2G3A A;  3HE5 A;  2ZT9 D;  2NPS B;  4PJ0 E;  1LTJ C;  1KB9 H;  1FZF A;  3AE4 C;  2W27 A;  1SQX D;  3O8Z A;  1KZU B;  2IYO A;  3H6P A;  1VQ8 P;  3H1J D;  1NTK K;  3PTZ A;  4JYB A;  3KZI H;  4NPD A;  4BRY B;  1Y9B A;  1LJ2 A;  4I2L C;  3V5B A;  4D6T J;  4RES B;  3MUD A;  2HLO A;  1T3U A;  2B87 A;  4XFJ A;  3S1K A;  4D6T E;  4UB6 H;  2RKL A;  1KFM A;  2WSE J;  4WY4 D;  3FWN A;  2FXM A;  1T6A A;  2O01 H;  2YKO A;  5AW5 B;  3TSI A;  1SQP D;  5E79 H;  3HE4 A;  4U3F J;  5CCH C;  1NWQ A;  1RF1 A;  2D2C C;  3W67 A;  2FXO A;  2L91 A;  1P84 D;  1LTJ B;  1OWA A;  2M8R A;  1HGZ A;  1S5L H;  5CBO A;  2RMZ A;  2GUV A;  2HOD B;  5KAI H;  5KLI B;  1R8E A;  1FJP A;  2JEE A;  3L70 D;  3VOP A;  2UWJ E;  1SS1 A;  2GUS A;  2Q6Q A;  1EDK A;  3A0H H;  1DX7 A;  2YXQ B;  1PP9 G;  4EIJ A;  1Q81 Q;  2KNC A;  4WB4 A;  4DZO A;  2IBZ G;  2OYI A;  2WSE H;  1KFN A;  3AEC C;  3M9Q A;  3OA7 A;  3BAS A;  2M5A A;  1JTH B;  1DEE G;  2POH A;  4C7N B;  2E43 A;  5KTB A;  1NTZ G;  1FOS F;  3L75 J;  2A45 I;  2AEF A;  3S4R A;  4XA4 A;  5KLV E;  3L73 G;  5CCG D;  3VN0 A;  1GL2 D;  3P7K A;  2NZ2 A;  2G8Y A;  5APT A;  3CXH E;  2DW3 A;  1X9V A;  4IL6 X;  3Q3D A;  3CCU P;  1JY3 P;  1XTC C;  3M0D A;  1N73 C;  1DD4 A;  3M0A A;  1FZB A;  5APQ A;  1TU3 F;  2QEX P;  2PRR A;  3Q1M A;  1YQ4 C;  1UII A;  1GL2 B;  1OX3 A;  1OVU A;  1W2B O;  1YTZ I;  1PPJ G;  2NPS C;  1BGY G;  1AVO A;  3L72 J;  5APX A;  1PGP A;  3RK2 B;  2H43 A;  3MHV A;  2IBZ I;  2M5A B;  1IFN A;  1IFI A;  3H1K D;  3L72 E;  3AEG C;  2N9B A;  5KLV D;  3SSU A;  4EDF A;  3R2P A;  1JB0 J;  2WSC H;  1FU1 A;  5GTH E;  5C39 A;  3OAK A;  2C0X A;  1W2E A;  2WQY C;  1NTK G;  1OIP A;  1ZOY C;  4H0L C;  4IFM A;  2KOG A;  3VMY A;  3WU2 H;  3SFE C;  3V2Q A;  1MKM A;  2W8Z A;  4PV1 C;  1IK9 A;  2XZR A;  3CX5 D;  3HUS A;  3L74 D;  2FYU K;  1UIX A;  3ZDM A;  1LTS C;  2W6A A;  2XDJ A;  3Q5S A;  1KQS O;  3RK3 B;  4JF7 A;  3G4S P;  2ZVO B;  1SQB J;  3L70 J;  1DH3 A;  1JM0 A;  1VF5 B;  2B87 B;  1KC8 Q;  1EQ7 A;  1VDF A;  3HD7 C;  1GTW A;  1AFO A;  1CW5 A;  3CWB J;  2H89 C;  2QJK C;  1VQM P;  2QIW A;  1LT9 C;  3VP8 A;  4EOT A;  2R32 A;  2YIU C;  1G1I A;  3IN6 A;  2QSI A;  3L74 J;  3QH9 A;  1N2D C;  4RO0 A;  4GIF A;  3WUU A;  4LLH A;  1EXI A;  1LWU A;  2B89 A;  5GTI H;  2O01 N;  5KLV G;  1RF1 C;  1JY3 N;  3M0D C;  3M9B A;  3Q5R A;  1N73 A;  1GD2 E;  3MD0 A;  2JKV A;  1L0L E;  4KT0 J;  4H13 D;  2E74 C;  2XND H;  2V7Q H;  2XU6 A;  1NTM D;  2KLU A;  3O6Q A;  1HGV A;  3CLQ A;  4H0L D;  1G1J A;  1J1E B;  1S5L X;  2KUB A;  1L0L K;  1SQX J;  5GTH H;  5CCG A;  1BDC A;  1FS0 E;  1J2J B;  2HFE D;  1FAV A;  1RE3 C;  2E76 B;  4Y99 B;  1ZR4 A;  3FXE A;  4I7Z C;  3TK1 A;  2J59 M;  3KPE A;  2IFN A;  1MFZ A;  2OYI C;  1T3J A;  1PPJ E;  1FZE A;  1L0N D;  3L71 G;  4YPC A;  2XV5 A;  4WVZ A;  1QLE D;  1WRG A;  2HR3 A;  3M9H A;  3U1C A;  1SVF A;  3G6E P;  1M8O B;  3L74 E;  1KYO D;  4HB1 A;  2K88 A;  5AW4 B;  1SQB G;  4YXD C;  3N4X A;  1YJN P;  3FWL A;  1NTM E;  1PGQ A;  4O9B A;  3A0B E;  4ZKU A;  1NTK E;  2K37 A;  1URQ C;  1FE6 A;  5KJ7 C;  1JTH A;  4NPF X;  3K5B A;  1FZA A;  3AE6 C;  1LTB C;  4PV1 B;  4ZNC A;  3B5N C;  3EFF K;  5CCH A;  3RGU A;  3CCJ P;  1VQP P;  1N7S D;  1LT1 A;  2OQQ A;  4C7N A;  2P1J A;  1H88 A;  2ZT9 B;  4GOE A;  4N78 D;  1PPJ D;  3H1L J;  2FYN B;  2QJP B;  1QVF O;  3A0H E;  3MUD C;  5DJT B;  2XNX A;  1YBK A;  2KIK A;  2KZI A;  2KZJ A;  4I1L A;  5KLI C;  1LNQ A;  3L36 A;  4L76 A;  5AW8 B;  1RE4 C;  2YO2 A;  2QJK B;  2FYZ A; 
#chains in the Genus database with same CATH homology
 3L71 G;  1BE3 G;  1PPJ G;  1BGY G;  1P84 H;  1PP9 G;  1NTM G;  3CXH H;  3BCC G;  1L0L G;  1SQV G;  1SQB G;  1EZV G;  1KB9 H;  2IBZ G;  2BCC G;  3H1J G;  4U3F G;  5KLV G;  1KYO H;  3H1I G;  3H1H G;  1SQX G;  1NTZ G;  2A06 G;  1NTK G;  3TGU G;  3L72 G;  3H1K G;  3L73 G;  4PD4 H;  3H1L G;  1BCC G;  3CWB G;  3L70 G;  4D6T G;  1L0N G;  1NU1 G;  3L75 G;  2FYU G;  3CX5 H;  1SQP G;  3L74 G;  1SQQ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...