3L72G

Chicken cytochrome bc1 complex with kresoxym-i-dimethyl bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
total genus 19
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l72G00
1SQPG 1PP9G 1NTMG 4PD4H 1SQBG 3L75G 3L74G 3TGUG 5KLVG 1PPJG 1SQXG 3H1IG 1SQVG 1NTKG 1EZVG 1L0NG 1SQQG 3L71G 1KYOH 1BCCG 1BE3G 1KB9H 3H1LG 4U3FG 3H1JG 3CXHH 3H1KG 3H1HG 3CX5H 1NU1G 2IBZG 2A06G 1BGYG 3L70G 1L0LG 4D6TG 3L72G 1NTZG 2FYUG 2BCCG 3L73G 3CWBG 1P84H 3BCCG
chains in the Genus database with same CATH superfamily
5H2FH 2K3RA 3HD7C 5AW1B 1DD4A 5H2FE 1SQBJ 2M3EA 5AVSB 1MUUA 1Y9BA 1BGYE 1L4AD 3KPEA 4JQ0D 1SQPD 1YHQP 3CX5D 1LJ2A 3UIAA 2QEXP 1P84I 3AE8C 1JCCA 2POHA 4YXWH 2JWAA 3H1IG 1J1DC 3H1KE 2WT7B 5APQA 2XNDH 2L5GB 3KXDA 1NTKJ 1L0NJ 2WMMA 1T3UA 3CX5I 3H1LJ 4C7RA 1PPJE 4H44C 2ZAEB 1NU1K 1VF5D 3H32A 1LT9C 3RL0C 2D2CC 2IBZI 1SQPK 2N9YB 2R44A 2QA4P 2CK3H 2R3SA 3L74E 3B5ND 3L72G 1VQ4P 2ZXXA 4UB6E 1OVRA 1Q2NA 2WVRA 1HJ0A 5KLVG 1X0TA 4N78E 1SFCC 5KTBA 2Q3EA 3O6QA 1S1CX 1URQB 4GKGA 3L37A 1FJKA 2HG5D 3M91A 5APTA 5KJ7C 3H1KJ 3TDKA 1SVFA 1NTZK 3T97A 2XDJA 2C0XA 1YQ3C 4JPZB 1EDIA 4CPGA 1LTIC 4M3LA 2K88A 4K3AA 3CWBG 2YKQA 2SPZA 2NPSC 5KAIH 5KAIE 2IX7C 1VQ5P 3L74J 2Q7CA 2BCCD 3VMAA 2E76D 1KB9D 1LGHB 1OVVA 3CXHD 3E1IA 5EFWB 1EC5A 1AQ5A 2ZYDA 1BE3E 1J1EC 2R5BA 5APXA 3H1HG 3MP7B 2H88C 3L70G 1GMJA 3R2PA 1AJYA 3HTKA 2QJYB 4RESB 2FKWB 2JP3A 3ABVC 1PFIA 1JY3N 1JTHB 3HE5B 3Q3DA 1TU3F 2Y9ZA 3AEFC 1KFMA 1NTMG 1LWUC 1RE4A 1R8EA 3V2NA 2IDBA 4HJGH 5M1BA 2FBWC 3NFQA 3RK3B 1SQBD 2IYPA 2XV5A 3GMAA 4H13D 1BE3J 3BASA 1NWQA 1RF1B 3S1KA 5KAFH 4IL6H 5KAFE 4IL6E 1VF5C 1FZCC 4U3FE 2O3JA 2QRXA 3O8ZA 3GHGA 5B5EH 2P10A 1KYOH 2A45G 5B5EE 2KB7P 3BCCD 3D70A 2IZ1A 1DIPA 2ZVNB 1BSNA 1GW4A 2LR2A 1XTGB 1DX7A 1L0ND 1VQNP 3B5NC 1QGKB 1LTTC 4DOJA 1P84E 1USEA 1SQBK 2KLVA 3VMXA 1NU1E 2IFNA 1JO5A 3LIDA 1M90Q 3JSVC 2OTJP 3Q1MA 3JCUH 2IYOA 3SFDC 1WRGA 2YKOA 2NPSA 3TGUE 3JCUE 4HB1A 1SQPG 1DD3A 2JDIH 2W27A 2XU6A 3L36A 2YXQB 4WWIA 3B4SA 4Y99C 1ZW0A 3E1RA 1M8OB 1BGYD 3GW6A 1NTKK 2HPCB 1L0NK 2K37A 2KSEA 2WPVB 4U3FJ 3AEEC 3U1CA 3AE5C 3AEDC 1FZFA 2H43A 1T3JA 3A3YB 4MN4C 3AE1C 3H1KD 4BRYA 4XA4A 3SSUA 2WT7A 2QJYC 2E76C 2E42A 2K9JB 1PPJD 2WPRA 1VQPP 5AVXB 3A2AA 2QM8A 4BXLA 4PV1D 1RY3A 3VMZA 2C0WA 3I55P 2OYIB 1Z56A 2N1TB 1LTSC 3SFEC 3WUVA 1EDJA 3TGUJ 3Q5PA 2O1KA 1CI6B 1BDDA 3N7NA 1MV8A 1IFMA 1GK6A 1YJNP 2ZVOB 1N73B 3G9RA 4PD4H 4N78D 5BVZA 4PD4E 3S9OA 2YNYA 1RHZB 1R5SA 1IK7A 2YMKA 1RH5B 4B86A 4GODA 2QE7H 3L75E 2R5DA 3V5BA 1AFOA 1URQA 4DCKA 2OARA 4LC1A 1BCCE 1KORA 1NAYA 2R3CA 1W5CE 1JMBA 1W2EA 2G8YA 2XZRA 4L76A 2ZFCA 1ZN5A 1N7SB 3I5CA 2BCCG 4H13C 1KILB 4RKUJ 3G6EP 4YTPC 4WB4A 1AVOA 2UWJE 5APYA 2WPSA 1K9MQ 3D6YA 4JYBA 1JY3O 4AYCA 2JO1A 3RBXA 1BE3D 1RQUA 1E5WA 3RK3E 5KKZB 2P58A 5AVZB 2KSJA 3L75J 3TF5A 3I56P 1HVVA 2LKMA 1BCCJ 5KJ7D 1KC8Q 3M0DA 1Q81Q 1JB0J 4H0LB 1X22A 1G2CB 3K5BA 3MUDA 2Z5HA 1FZAA 1YTZT 4IOIH 1LTJB 1SQVJ 1HGZA 2GUSA 1M56D 5AW8B 1JTHA 2N1TC 3BRVB 3HE5A 3IR9A 2NPSD 2ZYAA 3GHGB 4UB8E 5KLIC 1LP1B 2J5UA 1ZLLA 1XTCC 2OTLP 2RH0A 5AW0B 3CCVP 1FDMA 4TT3H 1YTZI 3RBZA 1QLED 3P8MC 1AV1A 3BCCG 1NTKE 1GU4A 1RF1A 1CSBA 3VP9A 3H1LE 5AVTB 1L0NG 4JF7A 2HLOA 2V4HA 2FYUE 1Q82Q 1RF0A 5AVYB 2OQQA 1CZQA 1LTAC 1P84D 5AW3B 2AEJA 1GL2B 3ITKA 2P67A 1NU1D 1KYOI 4KT0J 4I6MC 3B71A 1UIXA 2E74B 3W67A 3TGUD 1BGYG 1LTGC 1RE3A 4BRYB 4GOEA 3H1JE 2WQYC 5GTIH 2IBZD 3CC7P 2A06E 2ZT9B 5GTIE 1K05A 2MJZA 1SLQA 3H1KG 3A0BH 1OIPA 5CCGA 5KKZC 3BVHA 4K35A 1EZVI 2HPCA 3A0BE 4ZKPA 1URQD 3M0AA 3L71E 5APSA 2FYUJ 3MTUE 1PPJG 2RN0A 1IFDA 5DJUB 2IPPA 1RE4C 2PRRA 1NTZD 1K04A 3OAKA 1VQMP 4OGQB 2B87B 1ZR2A 3F89A 2K9JA 1L0LJ 2WWWA 1Y8AA 3MD0A 1KILE 3NTNA 3GHGC 2OYIA 2N1TA 3OJAB 2WTYA 1CI6A 2YKPA 2H8PD 3H1JJ 3SWYA 2P7JA 2KZIA 2FYNC 1N73A 2WPQA 2KI7B 2BASA 5E79H 5E79E 1ZOYC 3L75D 3L71J 4PJ0H 3PJSK 4I1LA 4I7ZC 2O01H 4PJ0E 1BCCD 4PD4I 2I8DA 4NPFX 4GT1A 1GZLA 3AE4C 3MIWA 2NRGA 4D6TE 4HKZH 1GL2C 3GF3A 1SQXE 3A5TA 1N7SA 2B88A 1PGJA 1IC2A 4N6JA 3L72J 2E74C 1MKMA 4EYYQ 4DZOA 1KILA 1YJWP 3V2QA 3Q2YA 1BE3G 3CD6P 1PGQA 2BEZF 3CC4P 1SP4A 1NGMB 3AE7C 3RK3D 3VYIA 4WBAA 1MZ9A 2OGUA 3JC22 2JJLA 3HUSB 1MFZA 1D7MA 1SQVK 1JY2N 2HR3A 3V4WA 4EOTA 2NZ2A 3TNUB 2O01J 2KIKA 2WSFH 4Z1MH 1JCDA 4ASVA 3MGNA 4D6TJ 1JM0A 3CCJP 2PP6A 3IN6A 1H8AA 1VQ7P 1SQXJ 1G2CA 2QIWA 1LTJA 3CI9A 1MFTA 2GA1A 2OYHB 2QJKB 1URQC 4AQRD 1HF9A 1WMKA 1GK4A 1N2DC 5B66H 1LP1A 3KQGA 5B66E 1KYOE 1SQQK 4IL6X 3G3ZA 4ZKUA 2K9YA 5CCGD 1HBWA 1NTKD 2A45H 4XE5B 3H1HJ 4WVZA 5CBNA 3H1LD 1T6AA 2HFED 1N7LA 1LTBC 1HUCA 2J58A 2Q3IA 3KZIH 1PGPA 1RQVA 3KZIE 1NU1G 2KOGA 2WSFJ 1EXJA 1M1JB 2WITA 5CJ4A 1EZVE 1NAFA 2FXPA 3TGUG 3CCQP 3FWNA 3U59A 5APVA 1FC2C 1GL2A 1N86A 2E75B 2FY8A 3GLMA 1Y47A 3L4FA 1FAVA 1OW7A 1Q7YQ 2IBZG 3IF4A 2N1TD 2W6BA 1OFCX 1HJBA 4C7NB 2FYUK 3VN0A 3CCLP 3H1JD 2JWDA 1YQ4C 3M0DC 3V4QA 2A06D 3OA7A 4Y28J 3E7KA 1LNQA 3MUDC 2KYVA 5BU8B 4RO0A 5DJTB 1NTZG 3CC2P 1JY2P 4KHXA 3L71D 3BRTB 1L0LK 1USDA 3IAOA 3CCUP 1U57A 2KS1B 4W80A 1DH3A 3L74D 3KYQA 2BEQD 1N7SD 2M3BA 2B87A 3RK3C 2OYOA 3OW2O 2PGDA 1RF1C 1KILD 1JNMA 3CLQA 2QSIA 1KQSO 1RF0C 1HTLC 4OWFA 3B8EB 2AXCA 1BCCG 1S3JA 1R5LA 2Y9YA 4WY4B 3PLNA 1SQVE 2QJPB 1IFPA 2E5YA 2WSSH 4GDOA 2W6JH 2Q9IA 1RE3C 3P7KA 2QM7A 4D6TD 1M1JC 2E5TA 1KB9H 3PRJA 4H0LD 1VQOP 3HD7B 1PZQA 3CXHH 5TISH 1FBMA 1SQXD 2QVAA 5TISE 1JY2O 3P8CE 4BWNA 3RL0g 2E75C 3NMDA 5CCGC 3RK2B 1HWTC 4JYCA 1EXIA 3CL3D 2YO3A 3PH0A 4L75A 1JUNA 1YYCA 5AW5B 3A0HH 4C46A 3A0HE 1GTWA 5L8RJ 1J1DB 4IFMA 4W7ZA 1SQQE 1FZGA 1FDOA 1ZR4A 2JR8A 5K5GB 4H44B 3FX0A 1SQXK 1LT9B 2OTKE 1OVUA 3RL0B 3L73E 3HUSA 1H0TB 4ASWA 4LLHA 2D2CB 2FXMA 1EDKA 2ZXEB 1GU5A 1JEKA 1NO4A 4DJGA 1G1JA 3TNUA 2OYIC 3CCMP 1DEBA 1SQBG 1N8RQ 2BCCJ 5AW4B 3EWKA 3SWKA 3FXEA 1A02J 3GF7A 1DEEG 3FWLA 2JEEA 1OMIA 1N73C 1QVGO 1FDIA 1GL2D 4XFJA 2B89A 1VQKP 3FGAD 1A02F 1SFCB 2H89C 1NHLA 3AEBC 1KQGB 1VQ6P 2E74D 2I1JA 2ZJSE 4U3FD 1JOCA 4L73A 2OYHA 1NTKG 1KYOD 3H1LG 1Q86Q 2VRSA 1SQQJ 1PP9E 3FXDA 4A7PA 2HODB 2ZT9D 1S9KE 2IFMA 3AE9C 3PHLA 3L73J 1N7SC 4WY4C 1KZUB 1NTMK 2ITAA 1OW6A 2G3AA 1L0LE 1S72P 1KILC 1NH4A 2W90A 4GIFA 1EZVD 2A45I 2PFXA 3CMEP 3G4SP 1NYHA 1M1JA 4OGQD 1NKNA 3RK2C 1J1EB 5C39A 3H1JG 3HE4B 1X8YA 2A06G 1VQLP 2KXPB 3H1IE 4ZNCA 1OW8A 1QL1A 2GUVA 3BCCJ 4C7NA 1PP9J 3L71G 1ZMEC 1YBKA 1U7JA 1M57D 4H0LC 1S4XA 1EQ7A 4YPCA 1IK9A 1VDFA 1LTJC 2W83C 1L4AB 3L74G 1KQLA 2KNCB 1M1KQ 4OH8B 2C9NY 3W68A 1S5LH 1LWUB 2MKVA 3L72E 2KS1A 3V6IA 1KMIZ 3M06A 5CCHA 1S5LE 4UB6H 5KLVE 5AW7B 2L91A 2AEMA 1BGYJ 4EI2A 1S5LX 5APUA 4HYTB 4PD4D 1QL2A 1UIIA 2K1AA 2LXCB 3TK1A 2Q5UA 3H1IJ 1VF5B 3QWOC 1IZNB 1FU1A 1FZCB 4O9BA 2FXOA 3AEAC 1K73Q 2PAJA 2Q6QA 3VMYA 1ZXGA 1NVOA 4AUWA 3L35A 2LXBA 2H7HA 1BDCA 3H25A 3USSA 3D71A 2I1KA 3B5NB 3CWBE 1VQ9P 2YMYA 3NXSA 4D6TG 5CBOA 1SQVD 1HGVA 4WY4A 4HH2A 3WUUA 4KJMA 1SS1A 2O1JA 1SQXG 3V2PA 5KLVJ 3M9BA 2J59M 3AE6C 4Y99B 3P8CD 3HD7A 4GOFA 2KZJA 2ZT9C 3MZWB 1ZRTE 5APWA 1OX3A 2W6AA 2FFDB 1KFNA 1WT6A 2KUBA 3H1HE 2KP8A 3L70E 4YXDC 1KB9I 2CPBA 1AQTA 3CXHI 4RJTA 3CCSP 3C9IA 5AVRB 3U1AA 4ZMDA 2WZ7A 1SQQD 1PV3A 2E76B 3CWBJ 3EFFK 1KD1Q 1X9VA 4OGQC 3L73D 1L4AC 2C9LY 2XKMA 1NTME 1LT9A 4LGDE 1H0TA 1EDLA 1GW3A 3ZDMA 3CCRP 2M5AB 1GDTA 1ZV8A 3WUTA 3VOPA 5AVQB 1IFIA 4L74A 1FJPA 3TYYA 3GG2A 5CJ0A 4U3FG 5CHXA 1FZEA 1QX8A 2E75D 3M9HA 1IJDB 1SFCA 3L70J 3AECC 2AEFA 3AE3C 2WSCH 1K8AQ 1J2JB 2FYUD 4IFDK 1QEXA 1PP9D 5KJ7A 1LT1A 2Y0DA 4DT0A 1S9KD 1P84H 2HODA 2M0BA 1VPCA 1EZVG 3A7OA 1QVFO 1FOSE 4H13B 1NTMJ 3P32A 1L0LD 2YO2A 3S4RA 1GD2E 1W2BO 3R4YA 1SQPE 3CX5H 5CCHD 1OZHA 2Y0CA 3CX5E 5CMZA 2CPSA 3TSIA 3VTPC 3WU2H 1E79H 1IO4A 2GM4A 3WU2E 4OVNF 2IBZE 2KK7A 2DW3A 3Q5SA 1X79B 3M9QA 3H32B 2FFDC 3H1ID 3HUSC 1ZP0C 3HE4A 2WSCJ 4NPEA 3F5HA 1NTZE 2M8RA 2JKVA 1JY3P 3RGUA 2V7QH 1NU1J 1KN7A 4WY4D 2WSEH 3O6QB 1SQPJ 2Z5IA 1L4AA 1FOSF 3L72D 1H88A 2KNCA 2O01N 1T2KD 2OYHC 5KLIB 3PP5A 2E43A 2QJKC 1VQ8P 5KLVD 1LWUA 3T97B 1CW5A 1NKZB 3HRNA 1T8ZA 3HD7D 3D6ZA 3L75G 4I2LC 1IFJA 3WMM0 3LW5H 3Q5RA 5GTHH 2Q1KA 2IZ0A 3RK2D 3CPWO 5GTHE 5BU5A 2P1JA 4QMAA 4PV1B 1H89A 2YIUB 4R4MA 1FZCA 1PL5A 3PTZA 3SWFA 3LIEA 1FZBA 1U7MA 4N3YB 1NTZJ 1NOHA 1AA0A 4R4LA 1SQVG 4TLFA 3VP8A 2W8ZA 3H6PA 5AVVB 2RKLA 1KQFB 1JMMA 5KLVK 3IFMA 3CWBD 2Y0EA 2BCCE 2YXRB 3QH9A 2V7QJ 3B5NA 1KB9E 4H44D 3CXHE 1KV4A 3RL0D 2WSEJ 2D2CD 1Q90D 3BATA 5AW6B 2QG4A 1BSHA 1YJ9P 5AVUB 4EIJA 2RMZA 3II6A 1G1IA 3HTKB 1VL2A 1FS0E 1S2EA 1ZRTD 1M7LA 3LW5J 2KLUA 1SFCD 3H1HD 4EDFA 4W7YA 1SQQG 3L70D 2FFDA 1L2PA 3L73G 5TJHA 1FE6A 1HH0A 5CCHC 3V2RA 3CMAP 3MHVA 2Z4EA 2B9BA 1YITP 3G71P 1YI2P 1OXZA 1NTMD 3KDPB 1SQBE 2FYZA 4UB8H 3AE2C 3EFGA 1OWAA 3CCEP 1IFNA 2M5AA 1AVYA 2P2UA 3N4XA 2ZYGA 5AW9B 2FYNB 3BCCE 3EQ2A 3AEGC 2FYUG 4JBZA 1L0NE 1PP9G 1YIJP 4U7JA 4PV1C 5AW2B 4IFFA 2XNXA 1PGOA 2YIUC 4NPDA 3KHUA 3C8VA 5AVWB 4I7ZB 1KTMA 3C1LA 2AXTH 2QJPC 2NPSB 2HYNA 2AXTE 1T2KC 2R32A 1NJIQ 2N9BA 1L0LG 1PIXA
chains in the Genus database with same CATH topology
1SQPG 1PP9G 1NTMG 4PD4H 1SQBG 3L75G 3L74G 3TGUG 5KLVG 1PPJG 1SQXG 3H1IG 1SQVG 1NTKG 1EZVG 1L0NG 1SQQG 3L71G 1KYOH 1BCCG 1BE3G 1KB9H 3H1LG 4U3FG 3H1JG 3CXHH 3H1KG 3H1HG 3CX5H 1NU1G 2IBZG 2A06G 1BGYG 3L70G 1L0LG 4D6TG 3L72G 1NTZG 2FYUG 2BCCG 3L73G 3CWBG 1P84H 3BCCG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQP G;  1PP9 G;  1NTM G;  4PD4 H;  1SQB G;  3L75 G;  3L74 G;  3TGU G;  5KLV G;  1PPJ G;  1SQX G;  3H1I G;  1SQV G;  1NTK G;  1EZV G;  1L0N G;  1SQQ G;  3L71 G;  1KYO H;  1BCC G;  1BE3 G;  1KB9 H;  3H1L G;  4U3F G;  3H1J G;  3CXH H;  3H1K G;  3H1H G;  3CX5 H;  1NU1 G;  2IBZ G;  2A06 G;  1BGY G;  3L70 G;  1L0L G;  4D6T G;  3L72 G;  1NTZ G;  2FYU G;  2BCC G;  3L73 G;  3CWB G;  1P84 H;  3BCC G; 
#chains in the Genus database with same CATH topology
 5H2F H;  2K3R A;  3HD7 C;  5AW1 B;  1DD4 A;  5H2F E;  1SQB J;  2M3E A;  5AVS B;  1MUU A;  1Y9B A;  1BGY E;  1L4A D;  3KPE A;  4JQ0 D;  1SQP D;  1YHQ P;  3CX5 D;  1LJ2 A;  3UIA A;  2QEX P;  1P84 I;  3AE8 C;  1JCC A;  2POH A;  4YXW H;  2JWA A;  3H1I G;  1J1D C;  3H1K E;  2WT7 B;  5APQ A;  2XND H;  2L5G B;  3KXD A;  1NTK J;  1L0N J;  2WMM A;  1T3U A;  3CX5 I;  3H1L J;  4C7R A;  1PPJ E;  4H44 C;  2ZAE B;  1NU1 K;  1VF5 D;  3H32 A;  1LT9 C;  3RL0 C;  2D2C C;  2IBZ I;  1SQP K;  2N9Y B;  2R44 A;  2QA4 P;  2CK3 H;  2R3S A;  3L74 E;  3B5N D;  3L72 G;  1VQ4 P;  2ZXX A;  4UB6 E;  1OVR A;  1Q2N A;  2WVR A;  1HJ0 A;  5KLV G;  1X0T A;  4N78 E;  1SFC C;  5KTB A;  2Q3E A;  3O6Q A;  1S1C X;  1URQ B;  4GKG A;  3L37 A;  1FJK A;  2HG5 D;  3M91 A;  5APT A;  5KJ7 C;  3H1K J;  3TDK A;  1SVF A;  1NTZ K;  3T97 A;  2XDJ A;  2C0X A;  1YQ3 C;  4JPZ B;  1EDI A;  4CPG A;  1LTI C;  4M3L A;  2K88 A;  4K3A A;  3CWB G;  2YKQ A;  2SPZ A;  2NPS C;  5KAI H;  5KAI E;  2IX7 C;  1VQ5 P;  3L74 J;  2Q7C A;  2BCC D;  3VMA A;  2E76 D;  1KB9 D;  1LGH B;  1OVV A;  3CXH D;  3E1I A;  5EFW B;  1EC5 A;  1AQ5 A;  2ZYD A;  1BE3 E;  1J1E C;  2R5B A;  5APX A;  3H1H G;  3MP7 B;  2H88 C;  3L70 G;  1GMJ A;  3R2P A;  1AJY A;  3HTK A;  2QJY B;  4RES B;  2FKW B;  2JP3 A;  3ABV C;  1PFI A;  1JY3 N;  1JTH B;  3HE5 B;  3Q3D A;  1TU3 F;  2Y9Z A;  3AEF C;  1KFM A;  1NTM G;  1LWU C;  1RE4 A;  1R8E A;  3V2N A;  2IDB A;  4HJG H;  5M1B A;  2FBW C;  3NFQ A;  3RK3 B;  1SQB D;  2IYP A;  2XV5 A;  3GMA A;  4H13 D;  1BE3 J;  3BAS A;  1NWQ A;  1RF1 B;  3S1K A;  5KAF H;  4IL6 H;  5KAF E;  4IL6 E;  1VF5 C;  1FZC C;  4U3F E;  2O3J A;  2QRX A;  3O8Z A;  3GHG A;  5B5E H;  2P10 A;  1KYO H;  2A45 G;  5B5E E;  2KB7 P;  3BCC D;  3D70 A;  2IZ1 A;  1DIP A;  2ZVN B;  1BSN A;  1GW4 A;  2LR2 A;  1XTG B;  1DX7 A;  1L0N D;  1VQN P;  3B5N C;  1QGK B;  1LTT C;  4DOJ A;  1P84 E;  1USE A;  1SQB K;  2KLV A;  3VMX A;  1NU1 E;  2IFN A;  1JO5 A;  3LID A;  1M90 Q;  3JSV C;  2OTJ P;  3Q1M A;  3JCU H;  2IYO A;  3SFD C;  1WRG A;  2YKO A;  2NPS A;  3TGU E;  3JCU E;  4HB1 A;  1SQP G;  1DD3 A;  2JDI H;  2W27 A;  2XU6 A;  3L36 A;  2YXQ B;  4WWI A;  3B4S A;  4Y99 C;  1ZW0 A;  3E1R A;  1M8O B;  1BGY D;  3GW6 A;  1NTK K;  2HPC B;  1L0N K;  2K37 A;  2KSE A;  2WPV B;  4U3F J;  3AEE C;  3U1C A;  3AE5 C;  3AED C;  1FZF A;  2H43 A;  1T3J A;  3A3Y B;  4MN4 C;  3AE1 C;  3H1K D;  4BRY A;  4XA4 A;  3SSU A;  2WT7 A;  2QJY C;  2E76 C;  2E42 A;  2K9J B;  1PPJ D;  2WPR A;  1VQP P;  5AVX B;  3A2A A;  2QM8 A;  4BXL A;  4PV1 D;  1RY3 A;  3VMZ A;  2C0W A;  3I55 P;  2OYI B;  1Z56 A;  2N1T B;  1LTS C;  3SFE C;  3WUV A;  1EDJ A;  3TGU J;  3Q5P A;  2O1K A;  1CI6 B;  1BDD A;  3N7N A;  1MV8 A;  1IFM A;  1GK6 A;  1YJN P;  2ZVO B;  1N73 B;  3G9R A;  4PD4 H;  4N78 D;  5BVZ A;  4PD4 E;  3S9O A;  2YNY A;  1RHZ B;  1R5S A;  1IK7 A;  2YMK A;  1RH5 B;  4B86 A;  4GOD A;  2QE7 H;  3L75 E;  2R5D A;  3V5B A;  1AFO A;  1URQ A;  4DCK A;  2OAR A;  4LC1 A;  1BCC E;  1KOR A;  1NAY A;  2R3C A;  1W5C E;  1JMB A;  1W2E A;  2G8Y A;  2XZR A;  4L76 A;  2ZFC A;  1ZN5 A;  1N7S B;  3I5C A;  2BCC G;  4H13 C;  1KIL B;  4RKU J;  3G6E P;  4YTP C;  4WB4 A;  1AVO A;  2UWJ E;  5APY A;  2WPS A;  1K9M Q;  3D6Y A;  4JYB A;  1JY3 O;  4AYC A;  2JO1 A;  3RBX A;  1BE3 D;  1RQU A;  1E5W A;  3RK3 E;  5KKZ B;  2P58 A;  5AVZ B;  2KSJ A;  3L75 J;  3TF5 A;  3I56 P;  1HVV A;  2LKM A;  1BCC J;  5KJ7 D;  1KC8 Q;  3M0D A;  1Q81 Q;  1JB0 J;  4H0L B;  1X22 A;  1G2C B;  3K5B A;  3MUD A;  2Z5H A;  1FZA A;  1YTZ T;  4IOI H;  1LTJ B;  1SQV J;  1HGZ A;  2GUS A;  1M56 D;  5AW8 B;  1JTH A;  2N1T C;  3BRV B;  3HE5 A;  3IR9 A;  2NPS D;  2ZYA A;  3GHG B;  4UB8 E;  5KLI C;  1LP1 B;  2J5U A;  1ZLL A;  1XTC C;  2OTL P;  2RH0 A;  5AW0 B;  3CCV P;  1FDM A;  4TT3 H;  1YTZ I;  3RBZ A;  1QLE D;  3P8M C;  1AV1 A;  3BCC G;  1NTK E;  1GU4 A;  1RF1 A;  1CSB A;  3VP9 A;  3H1L E;  5AVT B;  1L0N G;  4JF7 A;  2HLO A;  2V4H A;  2FYU E;  1Q82 Q;  1RF0 A;  5AVY B;  2OQQ A;  1CZQ A;  1LTA C;  1P84 D;  5AW3 B;  2AEJ A;  1GL2 B;  3ITK A;  2P67 A;  1NU1 D;  1KYO I;  4KT0 J;  4I6M C;  3B71 A;  1UIX A;  2E74 B;  3W67 A;  3TGU D;  1BGY G;  1LTG C;  1RE3 A;  4BRY B;  4GOE A;  3H1J E;  2WQY C;  5GTI H;  2IBZ D;  3CC7 P;  2A06 E;  2ZT9 B;  5GTI E;  1K05 A;  2MJZ A;  1SLQ A;  3H1K G;  3A0B H;  1OIP A;  5CCG A;  5KKZ C;  3BVH A;  4K35 A;  1EZV I;  2HPC A;  3A0B E;  4ZKP A;  1URQ D;  3M0A A;  3L71 E;  5APS A;  2FYU J;  3MTU E;  1PPJ G;  2RN0 A;  1IFD A;  5DJU B;  2IPP A;  1RE4 C;  2PRR A;  1NTZ D;  1K04 A;  3OAK A;  1VQM P;  4OGQ B;  2B87 B;  1ZR2 A;  3F89 A;  2K9J A;  1L0L J;  2WWW A;  1Y8A A;  3MD0 A;  1KIL E;  3NTN A;  3GHG C;  2OYI A;  2N1T A;  3OJA B;  2WTY A;  1CI6 A;  2YKP A;  2H8P D;  3H1J J;  3SWY A;  2P7J A;  2KZI A;  2FYN C;  1N73 A;  2WPQ A;  2KI7 B;  2BAS A;  5E79 H;  5E79 E;  1ZOY C;  3L75 D;  3L71 J;  4PJ0 H;  3PJS K;  4I1L A;  4I7Z C;  2O01 H;  4PJ0 E;  1BCC D;  4PD4 I;  2I8D A;  4NPF X;  4GT1 A;  1GZL A;  3AE4 C;  3MIW A;  2NRG A;  4D6T E;  4HKZ H;  1GL2 C;  3GF3 A;  1SQX E;  3A5T A;  1N7S A;  2B88 A;  1PGJ A;  1IC2 A;  4N6J A;  3L72 J;  2E74 C;  1MKM A;  4EYY Q;  4DZO A;  1KIL A;  1YJW P;  3V2Q A;  3Q2Y A;  1BE3 G;  3CD6 P;  1PGQ A;  2BEZ F;  3CC4 P;  1SP4 A;  1NGM B;  3AE7 C;  3RK3 D;  3VYI A;  4WBA A;  1MZ9 A;  2OGU A;  3JC2 2;  2JJL A;  3HUS B;  1MFZ A;  1D7M A;  1SQV K;  1JY2 N;  2HR3 A;  3V4W A;  4EOT A;  2NZ2 A;  3TNU B;  2O01 J;  2KIK A;  2WSF H;  4Z1M H;  1JCD A;  4ASV A;  3MGN A;  4D6T J;  1JM0 A;  3CCJ P;  2PP6 A;  3IN6 A;  1H8A A;  1VQ7 P;  1SQX J;  1G2C A;  2QIW A;  1LTJ A;  3CI9 A;  1MFT A;  2GA1 A;  2OYH B;  2QJK B;  1URQ C;  4AQR D;  1HF9 A;  1WMK A;  1GK4 A;  1N2D C;  5B66 H;  1LP1 A;  3KQG A;  5B66 E;  1KYO E;  1SQQ K;  4IL6 X;  3G3Z A;  4ZKU A;  2K9Y A;  5CCG D;  1HBW A;  1NTK D;  2A45 H;  4XE5 B;  3H1H J;  4WVZ A;  5CBN A;  3H1L D;  1T6A A;  2HFE D;  1N7L A;  1LTB C;  1HUC A;  2J58 A;  2Q3I A;  3KZI H;  1PGP A;  1RQV A;  3KZI E;  1NU1 G;  2KOG A;  2WSF J;  1EXJ A;  1M1J B;  2WIT A;  5CJ4 A;  1EZV E;  1NAF A;  2FXP A;  3TGU G;  3CCQ P;  3FWN A;  3U59 A;  5APV A;  1FC2 C;  1GL2 A;  1N86 A;  2E75 B;  2FY8 A;  3GLM A;  1Y47 A;  3L4F A;  1FAV A;  1OW7 A;  1Q7Y Q;  2IBZ G;  3IF4 A;  2N1T D;  2W6B A;  1OFC X;  1HJB A;  4C7N B;  2FYU K;  3VN0 A;  3CCL P;  3H1J D;  2JWD A;  1YQ4 C;  3M0D C;  3V4Q A;  2A06 D;  3OA7 A;  4Y28 J;  3E7K A;  1LNQ A;  3MUD C;  2KYV A;  5BU8 B;  4RO0 A;  5DJT B;  1NTZ G;  3CC2 P;  1JY2 P;  4KHX A;  3L71 D;  3BRT B;  1L0L K;  1USD A;  3IAO A;  3CCU P;  1U57 A;  2KS1 B;  4W80 A;  1DH3 A;  3L74 D;  3KYQ A;  2BEQ D;  1N7S D;  2M3B A;  2B87 A;  3RK3 C;  2OYO A;  3OW2 O;  2PGD A;  1RF1 C;  1KIL D;  1JNM A;  3CLQ A;  2QSI A;  1KQS O;  1RF0 C;  1HTL C;  4OWF A;  3B8E B;  2AXC A;  1BCC G;  1S3J A;  1R5L A;  2Y9Y A;  4WY4 B;  3PLN A;  1SQV E;  2QJP B;  1IFP A;  2E5Y A;  2WSS H;  4GDO A;  2W6J H;  2Q9I A;  1RE3 C;  3P7K A;  2QM7 A;  4D6T D;  1M1J C;  2E5T A;  1KB9 H;  3PRJ A;  4H0L D;  1VQO P;  3HD7 B;  1PZQ A;  3CXH H;  5TIS H;  1FBM A;  1SQX D;  2QVA A;  5TIS E;  1JY2 O;  3P8C E;  4BWN A;  3RL0 g;  2E75 C;  3NMD A;  5CCG C;  3RK2 B;  1HWT C;  4JYC A;  1EXI A;  3CL3 D;  2YO3 A;  3PH0 A;  4L75 A;  1JUN A;  1YYC A;  5AW5 B;  3A0H H;  4C46 A;  3A0H E;  1GTW A;  5L8R J;  1J1D B;  4IFM A;  4W7Z A;  1SQQ E;  1FZG A;  1FDO A;  1ZR4 A;  2JR8 A;  5K5G B;  4H44 B;  3FX0 A;  1SQX K;  1LT9 B;  2OTK E;  1OVU A;  3RL0 B;  3L73 E;  3HUS A;  1H0T B;  4ASW A;  4LLH A;  2D2C B;  2FXM A;  1EDK A;  2ZXE B;  1GU5 A;  1JEK A;  1NO4 A;  4DJG A;  1G1J A;  3TNU A;  2OYI C;  3CCM P;  1DEB A;  1SQB G;  1N8R Q;  2BCC J;  5AW4 B;  3EWK A;  3SWK A;  3FXE A;  1A02 J;  3GF7 A;  1DEE G;  3FWL A;  2JEE A;  1OMI A;  1N73 C;  1QVG O;  1FDI A;  1GL2 D;  4XFJ A;  2B89 A;  1VQK P;  3FGA D;  1A02 F;  1SFC B;  2H89 C;  1NHL A;  3AEB C;  1KQG B;  1VQ6 P;  2E74 D;  2I1J A;  2ZJS E;  4U3F D;  1JOC A;  4L73 A;  2OYH A;  1NTK G;  1KYO D;  3H1L G;  1Q86 Q;  2VRS A;  1SQQ J;  1PP9 E;  3FXD A;  4A7P A;  2HOD B;  2ZT9 D;  1S9K E;  2IFM A;  3AE9 C;  3PHL A;  3L73 J;  1N7S C;  4WY4 C;  1KZU B;  1NTM K;  2ITA A;  1OW6 A;  2G3A A;  1L0L E;  1S72 P;  1KIL C;  1NH4 A;  2W90 A;  4GIF A;  1EZV D;  2A45 I;  2PFX A;  3CME P;  3G4S P;  1NYH A;  1M1J A;  4OGQ D;  1NKN A;  3RK2 C;  1J1E B;  5C39 A;  3H1J G;  3HE4 B;  1X8Y A;  2A06 G;  1VQL P;  2KXP B;  3H1I E;  4ZNC A;  1OW8 A;  1QL1 A;  2GUV A;  3BCC J;  4C7N A;  1PP9 J;  3L71 G;  1ZME C;  1YBK A;  1U7J A;  1M57 D;  4H0L C;  1S4X A;  1EQ7 A;  4YPC A;  1IK9 A;  1VDF A;  1LTJ C;  2W83 C;  1L4A B;  3L74 G;  1KQL A;  2KNC B;  1M1K Q;  4OH8 B;  2C9N Y;  3W68 A;  1S5L H;  1LWU B;  2MKV A;  3L72 E;  2KS1 A;  3V6I A;  1KMI Z;  3M06 A;  5CCH A;  1S5L E;  4UB6 H;  5KLV E;  5AW7 B;  2L91 A;  2AEM A;  1BGY J;  4EI2 A;  1S5L X;  5APU A;  4HYT B;  4PD4 D;  1QL2 A;  1UII A;  2K1A A;  2LXC B;  3TK1 A;  2Q5U A;  3H1I J;  1VF5 B;  3QWO C;  1IZN B;  1FU1 A;  1FZC B;  4O9B A;  2FXO A;  3AEA C;  1K73 Q;  2PAJ A;  2Q6Q A;  3VMY A;  1ZXG A;  1NVO A;  4AUW A;  3L35 A;  2LXB A;  2H7H A;  1BDC A;  3H25 A;  3USS A;  3D71 A;  2I1K A;  3B5N B;  3CWB E;  1VQ9 P;  2YMY A;  3NXS A;  4D6T G;  5CBO A;  1SQV D;  1HGV A;  4WY4 A;  4HH2 A;  3WUU A;  4KJM A;  1SS1 A;  2O1J A;  1SQX G;  3V2P A;  5KLV J;  3M9B A;  2J59 M;  3AE6 C;  4Y99 B;  3P8C D;  3HD7 A;  4GOF A;  2KZJ A;  2ZT9 C;  3MZW B;  1ZRT E;  5APW A;  1OX3 A;  2W6A A;  2FFD B;  1KFN A;  1WT6 A;  2KUB A;  3H1H E;  2KP8 A;  3L70 E;  4YXD C;  1KB9 I;  2CPB A;  1AQT A;  3CXH I;  4RJT A;  3CCS P;  3C9I A;  5AVR B;  3U1A A;  4ZMD A;  2WZ7 A;  1SQQ D;  1PV3 A;  2E76 B;  3CWB J;  3EFF K;  1KD1 Q;  1X9V A;  4OGQ C;  3L73 D;  1L4A C;  2C9L Y;  2XKM A;  1NTM E;  1LT9 A;  4LGD E;  1H0T A;  1EDL A;  1GW3 A;  3ZDM A;  3CCR P;  2M5A B;  1GDT A;  1ZV8 A;  3WUT A;  3VOP A;  5AVQ B;  1IFI A;  4L74 A;  1FJP A;  3TYY A;  3GG2 A;  5CJ0 A;  4U3F G;  5CHX A;  1FZE A;  1QX8 A;  2E75 D;  3M9H A;  1IJD B;  1SFC A;  3L70 J;  3AEC C;  2AEF A;  3AE3 C;  2WSC H;  1K8A Q;  1J2J B;  2FYU D;  4IFD K;  1QEX A;  1PP9 D;  5KJ7 A;  1LT1 A;  2Y0D A;  4DT0 A;  1S9K D;  1P84 H;  2HOD A;  2M0B A;  1VPC A;  1EZV G;  3A7O A;  1QVF O;  1FOS E;  4H13 B;  1NTM J;  3P32 A;  1L0L D;  2YO2 A;  3S4R A;  1GD2 E;  1W2B O;  3R4Y A;  1SQP E;  3CX5 H;  5CCH D;  1OZH A;  2Y0C A;  3CX5 E;  5CMZ A;  2CPS A;  3TSI A;  3VTP C;  3WU2 H;  1E79 H;  1IO4 A;  2GM4 A;  3WU2 E;  4OVN F;  2IBZ E;  2KK7 A;  2DW3 A;  3Q5S A;  1X79 B;  3M9Q A;  3H32 B;  2FFD C;  3H1I D;  3HUS C;  1ZP0 C;  3HE4 A;  2WSC J;  4NPE A;  3F5H A;  1NTZ E;  2M8R A;  2JKV A;  1JY3 P;  3RGU A;  2V7Q H;  1NU1 J;  1KN7 A;  4WY4 D;  2WSE H;  3O6Q B;  1SQP J;  2Z5I A;  1L4A A;  1FOS F;  3L72 D;  1H88 A;  2KNC A;  2O01 N;  1T2K D;  2OYH C;  5KLI B;  3PP5 A;  2E43 A;  2QJK C;  1VQ8 P;  5KLV D;  1LWU A;  3T97 B;  1CW5 A;  1NKZ B;  3HRN A;  1T8Z A;  3HD7 D;  3D6Z A;  3L75 G;  4I2L C;  1IFJ A;  3WMM 0;  3LW5 H;  3Q5R A;  5GTH H;  2Q1K A;  2IZ0 A;  3RK2 D;  3CPW O;  5GTH E;  5BU5 A;  2P1J A;  4QMA A;  4PV1 B;  1H89 A;  2YIU B;  4R4M A;  1FZC A;  1PL5 A;  3PTZ A;  3SWF A;  3LIE A;  1FZB A;  1U7M A;  4N3Y B;  1NTZ J;  1NOH A;  1AA0 A;  4R4L A;  1SQV G;  4TLF A;  3VP8 A;  2W8Z A;  3H6P A;  5AVV B;  2RKL A;  1KQF B;  1JMM A;  5KLV K;  3IFM A;  3CWB D;  2Y0E A;  2BCC E;  2YXR B;  3QH9 A;  2V7Q J;  3B5N A;  1KB9 E;  4H44 D;  3CXH E;  1KV4 A;  3RL0 D;  2WSE J;  2D2C D;  1Q90 D;  3BAT A;  5AW6 B;  2QG4 A;  1BSH A;  1YJ9 P;  5AVU B;  4EIJ A;  2RMZ A;  3II6 A;  1G1I A;  3HTK B;  1VL2 A;  1FS0 E;  1S2E A;  1ZRT D;  1M7L A;  3LW5 J;  2KLU A;  1SFC D;  3H1H D;  4EDF A;  4W7Y A;  1SQQ G;  3L70 D;  2FFD A;  1L2P A;  3L73 G;  5TJH A;  1FE6 A;  1HH0 A;  5CCH C;  3V2R A;  3CMA P;  3MHV A;  2Z4E A;  2B9B A;  1YIT P;  3G71 P;  1YI2 P;  1OXZ A;  1NTM D;  3KDP B;  1SQB E;  2FYZ A;  4UB8 H;  3AE2 C;  3EFG A;  1OWA A;  3CCE P;  1IFN A;  2M5A A;  1AVY A;  2P2U A;  3N4X A;  2ZYG A;  5AW9 B;  2FYN B;  3BCC E;  3EQ2 A;  3AEG C;  2FYU G;  4JBZ A;  1L0N E;  1PP9 G;  1YIJ P;  4U7J A;  4PV1 C;  5AW2 B;  4IFF A;  2XNX A;  1PGO A;  2YIU C;  4NPD A;  3KHU A;  3C8V A;  5AVW B;  4I7Z B;  1KTM A;  3C1L A;  2AXT H;  2QJP C;  2NPS B;  2HYN A;  2AXT E;  1T2K C;  2R32 A;  1NJI Q;  2N9B A;  1L0L G;  1PIX A; 
#chains in the Genus database with same CATH homology
 1SQP G;  1PP9 G;  1NTM G;  4PD4 H;  1SQB G;  3L75 G;  3L74 G;  3TGU G;  5KLV G;  1PPJ G;  1SQX G;  3H1I G;  1SQV G;  1NTK G;  1EZV G;  1L0N G;  1SQQ G;  3L71 G;  1KYO H;  1BCC G;  1BE3 G;  1KB9 H;  3H1L G;  4U3F G;  3H1J G;  3CXH H;  3H1K G;  3H1H G;  3CX5 H;  1NU1 G;  2IBZ G;  2A06 G;  1BGY G;  3L70 G;  1L0L G;  4D6T G;  3L72 G;  1NTZ G;  2FYU G;  2BCC G;  3L73 G;  3CWB G;  1P84 H;  3BCC G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...