2PP6A

Crystal structure of the atp-binding sugar transporter-like protein from salmonella typhimurium
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
88
Chain Sequence
SNAMADLFDGMKRRMDALIAERFGMKVNINGTDCIVVESDFLAGKNVVVFSGNVIPRRGDRVVLRGSEFTVTRIRRFNGKPQLTLEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gifsy-2 prophage ATP-binding sugar transporter-like protein
publication title Crystal structure of the ATP-binding sugar transporter-like protein from Salmonella typhimurium.
rcsb
source organism Salmonella typhimurium lt2
molecule tags Transport protein
total genus 18
structure length 88
sequence length 96
ec nomenclature
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13856 Gifsy-2 ATP-binding sugar transporter from pro-phage
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2pp6A01
2.40.10.210 Mainly Beta Beta Barrel Thrombin, subunit H Phage tail proteins (gpFII-like) 2pp6A02
2H8PD 1URQB 2KOGA 3RK3B 2N1TC 1SFCD 4W80A 3B5NA 2YMYA 5CCGD 1NHLA 1GL2B 3RK2C 4N78E 3B5ND 2NPSA 2XDJA 1KILC 3HD7A 1L4AA 1N7SA 2M8RA 2NPSD 5KJ7C 1T3JA 3RL0D 1XTGB 3HD7D 4WY4A 1L4AD 1N7SD 1JTHB 3RK2B 1SFCC 3HTKB 1HVVA 4LGDE 4WY4D 5CCHA 1KILB 5CCGC 4W7ZA 2N1TA 2HG5D 3B5NC 1URQA 4OH8B 5CCHD 1SFCB 2NPSC 1URQD 1KILA 3RL0C 1GL2A 3RK3D 1N7SC 5KJ7A 3B5NB 1GL2D 4WY4C 2WZ7A 5KJ7D 3P8CE 3M0DC 2NPSB 5CCHC 3RL0B 3HD7B 1JTHA 3TSIA 2N1TD 1L4AB 5CCGA 1N7SB 3KYQA 3HD7C 1URQC 1L4AC 4WY4B 3RK2D 3RK3C 3VOPA 2PP6A 1KILD 1GL2C 3PP5A 4JF7A 1SFCA 2N1TB 4W7YA 2HFED
chains in the Genus database with same CATH superfamily
1NTME 4AYVB 1LNQA 3GHGB 1H8HD 1DLEA 3SNBA 2CGAA 1GU5A 1P2JA 2Z4EA 1HCGA 1LQEA 3WWBA 1JIRA 1YIJP 1C9PA 1QNJA 3L75E 5DP3A 2VBCA 8GCHF 3L71D 1EATA 1F92A 4DOJA 1C1WH 1RIWB 3HATH 1GI6A 3CCVP 4A7IB 2DW3A 3JZ2B 2HPCA 4LZ1H 3LPRA 3W67A 1C5QA 2KSEA 1NU1E 1VF5D 1BCCE 1TALA 1VKYA 4YLUA 3WU2H 3F5HA 1KLIH 5EG4A 1DX5M 2BZ6H 2M5AA 4IOIH 3TH2H 1GJAB 1O5EH 1SQQE 1Q86Q 1IQIA 1SVPA 1WMKA 3E8LA 1NWQA 1ZSJA 1GZLA 3R4YA 2G4UA 2PSXA 2UWOA 4X6MA 2HRVA 5DSFA 5KGOA 3SQEE 2XV5A 1W0KD 1Y5AT 2XU6A 4HGCA 2C8ZB 1BMAA 2QF0A 2G81E 1GK4A 1WAYB 2TGTA 3O8ZA 1KLTA 1T3JA 1L2PA 1JY2N 2HYNA 1TBRH 2QXIA 2ZP0H 1RRKA 4F55A 4TWYA 3MU0A 2I1KA 1VQNP 1LPKB 1YGCH 3URCA 5GTHE 1L0NK 1KQFB 1WV7H 1GK6A 3AEDC 3Q5RA 1E0FD 3FVFB 1FJSA 1GBDA 2A31A 4WF8A 1UCYH 4BTUB 2PGDA 1LVMA 2IZ1A 2YKQA 2WPMS 1JY3N 1OKXA 3MMGA 3SJ8A 2FOAA 1EZVG 1A02J 2ZT9C 1AKSA 2AYWA 1U7JA 2LXCB 1GPZA 4KP0A 1CHOG 3V12A 1V2MT 2O8WA 3HK3B 2FYUK 2VJ1A 1P84D 2P93A 5SGAE 1JMBA 1LVOA 1Z7KA 3L74G 2W3KA 2K9JA 2FPZA 1G30B 4C7NB 1URQD 2M3EA 1KILA 1VR1H 2WPSA 1WUNH 5C1UA 3BCCG 1AIXH 3FWNA 4CBNA 2A4OA 4L75A 1T8NA 4QT8C 2ZU1A 1C5PA 1EZQA 4JZDH 1SQPJ 1AZZA 1AE8H 1QJ7B 2OD3B 1PPJE 1LVBA 1V2QT 1JOUB 2J9NA 3U9AH 3LT3A 3RXOA 3STIA 1QA7A 1ZTLA 3QUMP 5C94A 3LGIA 4ESTE 3NMDA 1ABIH 2OBOA 5EQQA 2SGDE 2PW8H 2P8OB 1FXYA 1O3GA 1SQPD 3QWOC 1HB0B 5AW6B 4YM9A 3PJSK 1QEXA 5CCGA 5KLIC 4J2YB 1L0NG 2B87A 2H9HA 1N7SB 3L72J 3OU0A 2E75C 2HPQH 2CPSA 2R9PA 1J1DC 1SQXK 1ZN5A 3AAVA 1BITA 2QXJA 4X2YA 2FYRA 3UOPA 3EYDA 4DT4A 3VMZA 3TJVA 1YPMH 1HUTH 1ZJDA 1LTBC 1C1PA 2SGQE 4HB1A 2A45B 3L72D 2BY6X 3LW5J 3EFGA 1PGJA 1A0JA 2G52A 4IGDA 3RXEA 3WWFA 5APVA 2M0BA 1GL2C 2FYUG 1T31A 1BDCA 3P8OA 3JSVC 1RE3A 2FOFA 1UO6A 2GP9B 2POHA 3CL3D 1HAVB 3R0FA 4TPYA 2UUJB 1HNEE 1Z8JB 1E1RD 3TNSA 2A7HA 2WWWA 5DKMA 4MNYA 1SFIA 2RA3A 1SQRA 1EP5A 4K1TA 3BG4C 1YPEH 1C2FA 5IDKA 1G2CA 1O3NA 4MG3A 4MLFB 1NO4A 5CJ0A 4ZUHA 5M1BA 4N78E 4ZKRU 2F91A 2ZT9D 4KJMA 4GCHF 3H32A 4EDFA 1BMLA 3A7WA 4CRAA 5B6LA 2ZPRA 3Q3YA 1LT1A 4AYYB 1OW6A 1MUUA 3AVZA 1FS0E 4UD9H 1MKMA 2BDCA 5HIZA 1CT2E 3AE5C 1Y3UA 5K7RA 1IFPA 4JBZA 3MI4A 3P7KA 1AVXA 1KIGH 1KMHB 4MQAA 3HGNA 5EJLA 1GCDA 2QAAA 1IHTH 2I8DA 2ODPA 1DT2A 4NGAH 4YTAA 1JTHB 3H1HJ 3E3TA 4DIHH 2JKVA 2PKAA 3SZNA 1GJ4H 3PWBA 1FJKA 3TITA 5HM9A 4ZCNA 4B6FA 1P02A 3M36A 1YHQP 2K37A 2RN0A 4I86A 1ZRTE 1QL9A 1V3XA 3VP8A 1O3OA 3SUGA 4AFSA 3UY9A 3Q5PA 3H1HD 1FJPA 1T4UH 1AQ7A 1CBWB 1O3IA 1O2VA 1V2TT 3DCLA 3VGCC 3MU1A 1SLXB 2BD2A 1EKBB 2OK5A 4FUBA 1H89A 5APXA 3I78A 4WMDA 2MJZA 1HWTC 2E75D 3B8EB 2IBZD 1PIXA 4RN6A 1TPAE 1KN7A 2E5YA 3QH9A 1DWCH 1C5SA 3CI9A 2KCOA 5DO4H 1S85A 1EJAA 2ZFTA 1E79D 1EAUA 2ZYAA 2XBWA 3LC5A 3MUDC 1KYNA 1G3BA 3AAUA 3ESTA 5FPSA 1E36B 1O33A 1VF5B 5H2FH 2GDDA 3KQEA 2NU2E 5EODA 3ATMA 3N7EA 4D6TE 1GL2D 3FXEA 3D71A 2VIPA 1GL0E 3HRNA 3OW2O 1KV4A 1ZHMA 2AS9A 4TY6A 1KDQB 1VQ5P 1COWD 5BRRE 1TNIA 4BXWA 4Y10E 4KTCA 2QV1A 1NGMB 4A7PA 3SO3A 3SSUA 4AOQA 3A0BH 1L1GA 2R5DA 3SFEC 5BU5A 9ESTA 1KB9D 2HOBA 4UFEH 1W11U 4KTSA 1C5ZB 3GG2A 2RMZA 2Z9JA 5EW1H 3EA7A 2VU8E 1L4AC 1FY8E 1K1OA 1QJ1B 2BX3A 4YT6H 3U8RH 1P2IA 2HODA 1UK2A 4HG6A 3MGNA 1FZBA 1NTMK 1FOSE 2Y82A 3P8NA 1ZOMA 3QZQA 1NN6A 3KYFA 5ESTE 1VGCC 2VWOA 1ZTJA 2E76C 1HV7A 1GMCG 1Z71A 5A09A 6LPRA 1UVSH 4AFUA 3OEED 2G00A 4CRFA 4W7YA 1QCPA 2V35A 5HXFA 1RE4C 2YO3A 3VMAA 1Z56A 2OQ5A 2VGCC 4O03A 1RF1A 1ZHRA 3QK1A 1O3MA 3TGJE 1URQB 2FX4A 3USSA 4I6MC 4BNRA 3II6A 1HFDA 2G51A 4EI2A 1ELTA 1MBQA 1QY6A 3BTDE 4ZXYH 4AORA 5FAHA 2G4TA 2YMYA 3GMAA 4ZKSU 1NBME 4MNWA 3SV7A 3RBXA 1X7AC 2HR3A 1PQ8A 2R0KA 5DJUB 1AU8A 4K3JA 3MO9A 1H1BA 1C2LA 2ANMH 1Z8IB 3VB7A 1AE5A 2Q3EA 3FFGA 1XUFA 2A06E 1D3TB 4I8JA 2FFDC 4K2YA 1TPOA 3F9FA 1ZPCA 1GI0A 4XSKU 2ZZUH 2BCCG 1H9LB 2H89C 2THFB 4FU7A 2EI7A 2VRSA 4B71A 5L30H 3ZVBA 1LPZB 2FOGA 4KGAA 1QB9A 1NO9H 3VN0A 2EY4C 1KZUB 3TYYA 2SGAA 1FZEA 1ZXGA 2KZ4A 2K1AA 1YPKH 1BBRH 1MTWA 1THRH 2WVRA 5PTPA 3TPIZ 1N6YA 4FETA 2ZDAH 3PO1B 1VQ6P 1DFPA 2WTYA 5AVUB 2FXMA 4MPWA 5FCRA 1VQMP 2HGTH 1XVOA 3L70E 1HYLA 4ABGA 1BHXF 1DXPA 2WV9A 1GMHG 4B73A 1M1JC 1ZP0C 3L73J 3ZZ9A 1GG6C 2ZXEB 1PFIA 4GODA 4ACAA 3GLMA 1C1OA 1CT0E 1AMHA 2A1DB 4YZUA 4Z0KA 1WCZA 1O2GH 2BDIA 3PM3A 3E1IA 5EQSA 1JIMA 1T4VH 2QM7A 2ZT9B 1KTMA 1SGRE 2TRMA 3RXSA 2FESH 2SGPE 1O5DH 1QRXA 4WY4C 2QJYB 3L73D 1DANH 2G8TA 2E76D 4JZIA 2JR8A 1DSUA 2OQQA 1DD4A 4OM9A 4THNH 1S5LE 5BVZA 3P8CE 4IBLH 3ATWA 3M0DC 5CBOA 1GJCB 1KYOE 4OS6A 1SQXJ 2Q1KA 2BX4A 5FX5A 3OY5U 1OMIA 1YTZI 1ZMLA 5AW2B 3MNSA 1SHYA 1GI4A 3PHLA 4WVZA 2OINA 1T8MA 5TCAA 3L4FA 2LPRA 2EI6A 5B5EH 3RC4A 3TNUA 4AX9H 2Q6GA 1ZPBA 2RCEA 3SHAH 4FU8A 1D7MA 1G9IE 2L6OA 2XCFA 1SQXD 1CSBA 1CZQA 4Q7YA 1BGYJ 4X2VA 2SNWA 2FYNC 3CXHD 3W1EA 2FBWC 1ZTKA 3M37A 2OC7A 3P6ZB 4ZKNU 1KD1Q 1IAUA 3CLQA 1LP1B 2XNXA 1FUJA 2J97A 2SPZA 5KLIB 2HNTE 2ULLA 3FZDA 5F8TA 4IL6X 1TGTA 4JK5A 1J1EC 3NTNA 3G71P 1TRMA 2ZFQH 3V2PA 2H7HA 2BY5X 2VH6A 3BTEE 1BT7A 3Q77A 1J1DB 1DITH 5AFYH 4OGYA 5EXLA 2KOGA 3GY8A 2IFMA 1RHZB 1H8ED 1C5WB 3Q5SA 3OAKA 3GHGC 1AVWA 2ZPSA 2A45G 5E79H 3QTOH 3VMYA 2H43A 2QF4A 3DHKH 3FZZA 5GJ4B 5C0TA 1GL2B 3SJOA 1O2LA 1SQOA 1HAVA 1GMDG 5JB9S 5FCKA 5APUA 3ZVFA 3M5NA 1MTVA 4YTPC 2Z94A 1O31A 1E1QD 3F2FA 1J15A 5C0UA 2AXCA 2KS1B 1SVFA 1TONA 2KNCA 1K1MA 2OYHA 1GBMA 3AEBC 4O3UA 1UK4A 3M5LA 3RU4T 2C0XA 3RXUA 3MWIU 3VYIA 3RMLH 1C1QA 3KQGA 3BG4B 5C1XA 2QIQA 1PP9J 2O1JA 1S84A 2XC5A 5C1YA 2FYQA 1EOJA 1WOFA 3R3GB 3HPTB 1TPPA 1DY9A 1UTMA 5CHBA 1V2KT 4CH8B 4FUCA 4YXWD 2HLCA 2GZ8A 2QJPC 3DSPA 2BVXH 2D26C 2F43B 1YF4A 3IG6B 3H1LG 2R3SA 4WY4D 3UB0A 1MQ5A 2PAJA 1W2EA 1PP9D 1JCCA 1W7XH 2CN0H 2N1TA 3AW0A 3E7KA 3CNRA 3S9AA 1MKWH 1SGFA 4OS2A 3NXPA 4NWKA 1IQKA 2FX6A 2CK3H 4JYTA 1EPTC 1TFXA 3SU1A 1C5OH 2WPRA 1V2NT 3BN9A 4JYVH 3A7VA 3RM0H 4DIIH 4NZQA 1BE3E 2WUCA 2J98A 5H4IB 2GZ9A 3SV6A 1EZVE 2QXHA 2W5EA 3MQKC 1OPHB 4KTUA 2ZHWH 3RXBA 1VQ8P 2WPKS 1SLQA 1A7SA 1JBUH 1ZLLA 1UTQA 1GBLA 1E35B 2Y9YA 1DICA 1UVPA 1V2OT 2ZCLP 3KYGA 3WUTA 5G4BA 3H1JE 5A0AE 2WPLS 3MH7A 3K6YA 4U3FG 3VGCB 1V6DA 1LTGC 2GMTC 1G3EA 1PGPA 4TWWA 3LDXH 4D8NA 5DP6A 1YBWA 1YCPK 3MNCA 2EA3A 2A45H 3SJIA 3BEUA 4OWFA 1SQBG 3T62A 2IYOA 1ELCA 1PQ5A 4WJG2 3L71G 1ACBE 2FOHA 1MV8A 4K60A 5B66E 1O38A 1LDTT 2ANWA 1K1IA 1T7CA 4MTBA 1OWDA 3P8MC 2NU3E 1GBAA 2P8OC 5TCCA 1XUJA 3F68H 4A1XA 1O35A 1KTTB 4IN1A 2XNDD 2KM0A 1LWUA 1NTMJ 2H5CA 4PD4D 1CHGA 1DDJA 1EXJA 1TX8A 3MO3A 3IR9A 1S5LX 2C93B 3P92A 3L75J 4BRYB 2J92A 1K2I1 2ZGJA 3DFJA 5FBEA 2SFAA 3AE7C 4BAOB 5AVVB 2KR7A 4D7GA 2J59M 1K9OE 1NTMD 1FY1A 1SQPK 1GDUA 1NU1J 3AE6C 1BCCJ 1G32B 3CS0A 1UIIA 2ZO3H 1LHDH 2Z7FE 3OE7D 1SQVE 1SQQJ 2GVFA 2OARA 3L75D 2XC0A 3AE9C 2FEQH 1O2OA 2QE7H 3S9OA 1OWJA 3JCUE 1HH0A 2JJLA 4GOEA 5CHXA 1LHFH 4TSFD 4FUJA 1NU1D 1F5RA 1BCCD 1A46H 3V7TA 2F83A 2OQUA 2V3OH 3SBKA 1SQQD 1C5UA 4QMAA 1O2IA 1UHBB 2ALVA 2KX4A 3UQVA 2E76B 3JZ1B 2F9BH 2KP8A 3HE4B 3F9HA 2ZAEB 2F9UA 2PUQH 3LIDA 4Y6DA 3UAIC 1KXCA 1DX7A 4H6TA 3A89A 1GBCA 4NPEA 3NWUA 3AE1C 1A5GH 1FV9A 1N2DC 1G3DA 2A5IA 1C5MD 3CPWO 3FAOA 3Q00A 1GI3A 2B8OH 5KAFE 1QBOA 5KJ7C 1NH4A 1IK9A 1XX9A 1BUIA 2EI8A 3NUMA 1HAOH 1DWBH 2YNBA 1YY3A 1Y59T 4NWLA 4PD4I 2F4LA 4ZAEA 1SGPE 1C1VH 1IJDB 4BAMB 2WSFH 2P3UB 3P95A 3QDZB 3SGBE 1GMJA 3BATA 1YLDA 3DSGA 4WMFA 3G3ZA 5AW3B 3PMBB 5EJZA 2P94A 1FZZA 1O5GH 1RTLA 1OVVA 2W6JH 1XUHA 1ZYOA 4ABDA 5C3NA 2FFDB 3N7NA 2BDBA 3RXAA 1O5AB 1QRZA 3MTYA 1JY2O 3CX5I 1W10U 3WY8A 1BRCE 1HIAB 4JPZB 1O2TA 1OP8A 1QBNA 4TT3D 1DS2E 1BTHH 1GMCF 4UFDH 3OY6U 1NAYA 3ATKA 3SJ9A 3TJNA 5GTIE 2GT8A 3BG8A 4E05H 1LHCH 1BQYA 5BPEA 5I46H 1YITP 1TIOA 1V2ST 1SQAA 3SWKA 1B7XB 3RXKA 3I56P 1O3AA 1JY3O 1PPJD 3A85A 2N9BA 1T8LA 3L72G 1SLVB 4YOIA 1S1CX 1BSHA 1CA0B 1DXWA 3UR9A 1FBMA 5DG6A 2VVUA 3BF6H 1FAKH 3DT0H 3TK9A 5ABWA 3BEIB 4X8UH 5I25A 1GTWA 3CCQP 3HUSC 1YKTA 1C4Y2 1VITF 1P01A 3CMEP 4ACBA 1M1JB 3RXCA 2R3UA 1GG6B 2FS8A 4DG4A 2QIWA 2YKPA 4A6LA 1O2RA 5A8XA 1OHHD 1YYCA 3ZZ4A 1ZR0A 5EPYA 4GIFA 1V2WT 3BVHA 2QRXA 2HVXA 3T27A 1F0SA 4WY4B 4X8VH 3FP6E 3QZRA 2YOLA 1Z8GA 1H88A 1M9UA 1EOLA 3VP9A 1UVOA 1HXEH 1W14U 3PLBA 2QSIA 3N7OA 5TJXA 1RF0C 1YPLH 3O8BA 4A1VA 1GW4A 1AV1A 1BBRE 1FNIA 3AE4C 1NM6A 1SSXA 2AIPA 3O6QB 1JB0J 3KZIH 2ZPQA 3SHCH 4XFJA 1UVTH 1MKXH 4MVNA 3PTZA 1LJ2A 4ISOA 1AGJA 3RXGA 4HYTB 2UUYA 1YJWP 3AEFC 1C5YB 1EASA 4R4MA 1P3EA 1HAHH 1GMHF 1IK7A 3PRJA 1GL1A 2G5NA 4AGKA 1TNKA 1F0RA 2ODYB 1TX6A 2FYNB 4N78D 3E6PH 3IAOA 5CBNA 1M1KQ 2JKHA 4DCDA 3V2RA 1TOCB 3H1HG 1LP1A 2ZVOB 2OYIC 1FLEE 2ZVNB 2QCYA 1TGCA 5EJ1A 1EDLA 1F2SE 2P95A 1HXFH 2ZTZA 5DJ7A 3T28A 1J1EB 1X22A 3RU4E 3GYLB 2J58A 1IQJA 3SQHE 2IBZG 1SFQB 1GBEA 4CR5A 1YLNA 5FPYA 2D2DA 1JRSA 1P12E 3RMNH 3LGUA 3H1IE 1HPGA 1Q82Q 1SB1H 2BLQA 2ZC9H 1S6HA 1O2XA 4L74A 2GKVE 4WH8A 1MU6B 3OX7U 4CBOA 1XTGB 3HD7D 1NTKE 3PLNA 1MTNC 3LH3A 2A7CA 2Q6DA 5AVXB 3RXHA 3LW5H 1C5LH 2Z3DA 1MU8B 1ZMJA 3F89A 1IC2A 5B5EE 1FDPA 4K69A 4CR9A 1ZRTD 3HTKB 1W8BH 3SU6A 4H42U 1S0QA 1CW5A 1M90Q 4Z1MH 1AO5A 2BCCE 1YPJH 1P10A 1GU4A 3BRVB 3A84A 4XBCA 2R44A 1LTIC 4EOTA 2SNVA 5F8XA 1OVRA 1QURH 1SLUB 3B5NC 2FS9A 4XBBA 3NCLA 6GCHG 4D6TJ 1GJ7B 2VB0A 1FY4A 3TJOA 3PLPA 3CP7A 3SU0A 1C4V2 4DGJA 3QTVH 3BRTB 2KCPA 1T8OA 2QJPB 4C46A 4INKA 2FWWA 3AEGC 4FVBA 5E8EH 1CE5A 3FO8D 2V3HH 2AGEX 4Q2KA 2ZHDA 1SBWA 3T97A 2GT7A 1EAXA 1W13U 2C8XB 2KXPB 3KIDU 4D6TD 4GSOA 1SPJA 1AZ8A 1LT9A 1NAFA 2AMQA 1Z1JA 3UTUH 1GMDF 1EPTB 3NPSA 4IN2A 2AEIH 3B71A 3L35A 4PV1C 2FP7B 2YKOA 3TGUE 3PRDA 4BXLA 1DVAH 1O3JA 1CQQA 2Z9LA 2IZ0A 3RC5A 3E1RA 4CPGA 1VDFA 2QJYC 4ZNCA 3KNXA 1C1NA 4U2WA 2HLDD 3OEHD 1FDMA 2VH0A 4IS5A 3VB6A 2A4GA 4X6OA 1O2NA 2ZGCA 2V7QJ 4DY7B 2XW9A 2GMTB 1DPOA 2BQ7B 1GVLA 3N4XA 4H6SB 1SQVK 1EAIA 1S5SA 1AQ5A 2LXBA 3BIVH 3M5OA 2FI3E 1E37B 1NFXA 5AVDA 4ABHA 2Q9IA 2ZFCA 3MUDA 4HJGH 1TPSA 3DD2H 1MAXA 3KF2A 1FZCC 2G55A 1SFCA 4WXIA 1S82A 2OTKE 2FKWB 2V7QD 2GZ7A 3KEEA 2KIKA 2K88A 2HFED 1ABJH 1O2ZA 2L91A 3OA7A 1GJDB 1YM0A 2ZTYA 5EOKA 1INCA 1O2WA 1EXIA 1HJAC 1U6QA 2FXOA 3RXFA 3KDPB 2WV4A 1H0TB 1SKYE 1NBMD 3HE5A 2OC0A 4ZH8A 5CDFE 1VJAU 2WHXA 4IFFA 1KSNA 1NHLA 4K8YA 1S0RA 2IPPA 2BY9X 4ABAA 2A06D 3S1KA 4A92A 3B5ND 4XRNA 2NPSA 4XD7D 3DFLA 1S2EA 1XUGA 3VMXA 2HNTC 1ESBA 3H6PA 3ZZAA 1E38B 1MUEB 1L0LE 4I31A 1L4AA 1T32A 1CI6A 3P8GA 2FYZA 3C1LA 3IN6A 3VB4A 1P84I 1ZHPA 4X2XA 5EPNA 5T6DA 3A8AA 1W0YH 1P11E 1LTSC 1EZSC 3OSYA 3QX5H 2AGGX 4GT1A 1XXDA 2IN2A 4Y8YA 1WBGB 4TYDA 1N8OC 4FXGH 1GDQA 2A7JA 1Y3VA 5GXPA 1P09A 1SGTA 3MH6A 3V5BA 3L73G 3L70J 2VIVA 3DUXH 3RXPA 5F8ZA 1LTJA 2Z5IA 2QM8A 1EFRD 2BLOA 3GCTF 2WMMA 3UREA 8LPRA 2LR2A 1N73A 2YMKA 4PV1D 2BMGB 1QB1A 3RXLA 1BTYA 1NPMA 1QQUA 2LNCA 3H5CB 1RGQA 2JIZD 3GF7A 1OXZA 3A0HH 3CCUP 3I77A 1C2HA 1D6RA 3TLOA 3SUDA 3L70D 1G37A 1ZMEC 2WYGA 3GY3A 4OH8B 4BAQB 3AEAC 2ZQ1A 5JBTA 1NS3A 5L8RJ 1MQ6A 1C1RA 2BQ6B 2VIWA 1FMGA 4RT1A 5T6FA 1EX3A 1BMFD 1ZOYC 2BB4A 1SQXG 2WT7A 5APTA 1T2KC 1TGSZ 5APQA 1USEA 1NT1A 1Z8RA 4X1NU 8ESTE 1KXFA 1ZJKA 1SOTA 2KI7B 1EJNA 3RM2H 2ALPA 3SU5A 1C2DA 2PSYA 3ZIAD 2P2UA 4N3YB 1FN6A 3Q76A 3RXMA 3F2HA 3UOUA 3ZYEA 3RK3E 3TGKE 1N86A 3P8CD 2XYAA 2Y5FA 3M0AA 1KYOD 1AWFH 1BGYG 2JH5D 1E34B 2STAE 5GPIB 5DP4A 2W27A 1H8DH 3PROA 1A3EH 1J8AA 2G8YA 2P10A 3RXTA 1KFNA 1A02F 4GUXA 1ZZZA 3BTME 1N7LA 2W83C 1W3CA 2ASUB 3D6ZA 1VL2A 3SWYA 4DZOA 1HGZA 3HD7B 1ZV8A 1SGDE 1JY2P 1Z6JH 2Y7ZA 2W6BA 3FKSD 2M5TA 4I8KA 2C8YB 1NKNA 3KYQA 3M9BA 2OCVB 2F3CE 3MO6A 1SQBE 5DK1A 3HUSB 2KUBA 1SGNE 2Y0DA 2BHGA 1DLKB 4OS1A 3TIUA 2ZDMA 2IOTA 3MHWU 3FGAD 1P3CA 1JY3P 4DT0A 2XRCA 3OTPA 2C9LY 3ZZ8A 2ZEBA 4Y7AA 3O8RA 1SGQE 3WUVA 3EQ0H 3PP5A 2E74D 1MMJN 3BTKE 5HYOA 2XWBI 3S4RA 4ASWA 2A2XH 2AMDA 2WQYC 1K05A 1P2KA 1THSH 3MYWA 1CGJE 3F6UH 1BTUA 3ZV8A 1SG8B 2H8PD 3T25A 4HTCH 1GBKA 2RFKC 4ZKUA 3M91A 3MD0A 4IL6E 1PQAA 1PP9G 3M0DA 1EB2A 2BLWA 1OYTH 1GDNA 2FLBH 5HGGA 1SGIB 3O6QA 3RL0g 1SR5C 4DT7B 1KYOI 2GUVA 5E0HA 1VCPA 4GLYA 4XBDA 2KZIA 1YTZT 4M3LA 2V0BA 3L37A 1W5CE 3S0NA 1THPB 2F9NA 2WYJA 3TU7H 4AG2A 1AHTH 4X6NA 2AXTE 1NFYA 1AUTC 1T2KD 2IBZI 3LH1A 2BQWB 3ZVEA 1Q2NA 1WTHD 2WINI 4NIVA 3CC4P 3GCNA 1NU1K 3M3TA 4H4FA 2BOHB 2OYIB 1KMIZ 4ZHMU 1RE3C 3ZZBA 4BANB 1SGCA 5JBAS 4BOHA 1SQQK 1BE3J 1GI5A 1FDOA 1QJ6B 2AHME 1A3BH 2O01H 1MTUA 1C1UH 2H9TH 4B2AA 1C4U2 2WPDD 2V6NA 4UFFH 2UUKB 3OYPA 3ZVAA 5AVYB 1ZW0A 4UEHH 4E7RG 1EDIA 3H09A 3GISB 3KCGH 3V0XA 1C2EA 1DWDH 1JXPA 1L0ZA 4HH2A 4KHXA 4GKGA 3GHGA 1VITG 3H1JJ 1BE3D 2TPIZ 3AW1A 3SOSA 1MTNB 2HALA 3P8FA 2BLVA 1EZVD 5IK2D 3MP7B 2V4HA 1UVUH 2QY0B 2V3MA 4NCYA 1GHBG 1KB9I 2A4RA 2FOCA 4ABBA 2WSCJ 1BZXE 3AK5A 1NESE 1NC6A 1Y3YA 1QIXB 2W6ID 2D2CB 3H1JD 2O8MA 1LTAC 1NTMG 1YP9A 3B5NB 2W26A 4ABEA 5AW5B 1GJ9B 1OX1A 1D6WA 4Z6AH 5AW1B 3FP7E 1OWHA 1TLDA 3MOCA 4AQRD 1CA0C 2VINA 4ISHH 2VWLA 3L72E 1FDIA 4XA4A 1ANBA 1TAWA 2JETC 2Y6TA 2P1JA 4ABFA 2ZIQH 5TJHA 3SWFA 5AW4B 5A8YA 5EQRA 4K1SA 1NU1G 1KC8Q 1BCCG 1TE0A 4BTIB 2JDID 3NKKA 4OS7A 3V13A 5E2PA 1V2RT 3EGKH 1SQQG 1TA6A 3SYJA 1O3EA 1SQVJ 3VB3A 2KK7A 4VGCB 3G4SP 1VPCA 1MCTA 1QLED 1GHVH 1RJXB 1WQVH 3LKWA 1NTZE 4PV1B 3D23A 2JWDA 1ZGVA 3E90B 1EDKA 4DOQA 1HJ0A 1DM4B 2EC9H 3M35A 3ODDA 4OS5A 4RKOB 1GHAF 4Q4LA 4RKUJ 3SJKA 1CSOE 4TY7A 2KAIB 1SQVD 1O0DH 3MZWB 3WU2E 4NFEA 1YJ9P 3E0PB 5HMAA 2NWNA 2PFEA 4ZROA 3MU4A 2H1UA 6GCHF 1A0HB 4YESB 1S6FA 5DP9A 2XOKD 2A5KA 1R8EA 1O39A 4C7NA 2ZG0H 2R3CA 1GBIA 3EQ2A 5JDUB 4Y8XA 3ITKA 3BTFE 1KXEA 2W7SA 2ZGBH 3M7QA 2PRRA 1ANEA 4Y0ZE 1VITH 1V2VT 3MU8A 2XNDH 3PTBA 1L0LK 4JZFH 1N1LA 3AECC 2E43A 4PD4H 5F53A 3RLYH 1S9KE 2KLUA 5FPTA 1FZCB 1VQKP 1AB9B 2KB7P 1IFDA 4HKZH 1QL1A 3LU9B 5IYTA 1UCYE 3RLWH 4NPDA 1W0JD 4YOGA 3VG8A 3I55P 1KXBA 3B8JA 2A32A 5KLVE 3EA9A 4RJTA 3D62A 3N7DA 3LIEA 1N7SA 4B2CA 1PPJG 3CX5H 2GD4B 1JMOH 1HJAB 1L4DA 4XDEA 3WMM0 5F6MA 3PWCA 2PV9B 2JH6D 5CJ4A 1C5TA 1Q2WA 4O9VA 2Y5GA 3F0PA 2Y0CA 5AVTB 3H7OA 5C20A 2VWNA 3HKIB 4X8SH 4PROA 1TX7A 2FY8A 5CCHA 1RF1C 2PGQB 3SV8A 1W7GH 1LPGB 1RFNA 5FXLA 2E74B 1T3UA 1YJNP 2CXVA 4UONA 2P3TB 2Z3CA 1PV3A 1XXFA 2RG3A 3E0NB 3OTJE 1ETSH 1YCPM 1N8OB 1GCTB 4Y0YE 2GX4A 2ZU5A 1SMFE 2R32A 3EFFK 4JYBA 2Z3EA 1P05A 4K1EA 5FHTA 5LH8A 3U1CA 5GTHH 1QZ8A 3BIUH 1SGEE 1FIZA 3SORA 1NYHA 2AEMA 3FXDA 1QVGO 1MAYA 4FUGA 4FVDA 4WMEA 1F7ZA 4OVNF 3G6EP 2CJIA 4JCNA 3CCJP 5KJ7A 1P2QA 3B4SA 2BYAX 3KL6A 4WH6A 2J94A 4X1RU 3CXHI 1Z6EA 1D9IA 1GBHA 1AUJA 1V2JT 3H1KJ 2TGAA 4AN7A 2ZWLH 3M3VA 4X6PA 3A2AA 2I6QA 4Q7XA 3UNSA 3Q3XA 5DN6D 1HRTH 2HPCB 1P8VC 1R5SA 1NOHA 2BVSH 2CV3A 1KXDA 4JYUH 4TT3H 1SOZA 3PRBA 1HAPH 2M5AB 3L3TA 3V3MA 5CMXH 3GY7A 1JTHA 3LGTA 3H1KD 5L6NH 2VIQA 3NRLA 3LOXA 4B74A 2Z5HA 4Y76A 1BDAA 2RDLA 2KSJA 2DE8A 3KHVA 3UFAA 3SNEA 3K5BA 2BEQD 1TNHA 3CWBJ 1GI1A 1C2IA 2BEZF 2OUAA 1LGHB 3L74E 3U98H 2GTBA 4UB8H 5L2YH 4TPIZ 4WY3A 3A8BA 3A0HE 4HZHA 3BCCE 2L5GB 2O01N 1KILE 2GV7A 2IJOB 2R2MB 4DVAU 2Z9IA 3SN8A 4CH2B 3M5MA 5APYA 4WBAA 2VVCA 3CWBD 4GAWA 3ATLA 2IPQX 4I7YH 1Y5UT 1MFZA 2YXQB 2K3RA 5GNDA 3H1IJ 5AW8B 4H0LB 1GI2A 1O2PA 1A0LA 3T26A 4INHA 3BSQA 4JK6A 2K9JB 4U7JA 1VQLP 1O5BB 3LGVA 1NTKJ 3RU4D 3EAJA 5APWA 1H4WA 3GCTG 1FZFA 1H9HE 2VWMA 1YYY1 1GHZA 1KDQA 1NROH 3RXDA 1C5VA 2QA9E 1L0NE 3H1ID 1ANCA 1DOJA 5T3HA 3W95A 4AG1A 4AZ2B 1XTCC 2HVYB 2AFQB 1SC8U 3CC7P 2ZTXA 3QLPH 1NTKD 1RD3B 2P3FH 3HKJB 3RMOH 4SGAE 2VNTA 1PL5A 4D6TG 2XC4A 2ZXXA 4NA8A 1RF0A 5JYIA 3GCOA 3I29A 1EB1H 1C1SA 2BCCD 1PPEE 1HGTH 3SV2H 1PPZA 2FYUE 1DUAA 2B87B 4GOFA 6ESTA 3S7HB 3D6YA 2H88C 1FY3A 1HVVA 4LGDE 3SGAE 3NZIA 1GW3A 4F4OC 5H2FE 2HG5D 3KQ5A 2XBXA 4K3AA 3SFDC 4YLQH 1EXFA 4Y11E 3TK1A 4AFZA 3ZZ3A 1URQA 1J16A 4B1TA 3K6ZA 1VCWA 4JQ0D 3EE0B 1JOCA 4ASHA 3TGUJ 2K1QA 2ZA5A 1IQHA 1NRRH 2KCYA 5ESBA 1K1PA 3A0BE 2FTMA 4RT0A 1NKZB 3MIWA 1VQ9P 1NTPA 2HPPH 1XUIA 2J4IA 1LHGH 4DURA 2IPHA 1BCUH 3TGUD 1HDTH 1OP2A 4F49A 1DE7H 3CENA 3M9HA 4B6EA 1SQPG 1XMNB 1G2CB 1KY9A 5E0GA 1Y5BT 1BRAA 1K73Q 4WWYA 1EQ7A 2GUSA 3Q3DA 1EDJA 2BY7X 3LIWA 4JZ1A 3H32B 1GHWH 1C5XB 1NTZK 1DD3A 2F9VA 1L4ZA 1BGYE 2OTLP 1M8OB 2YMSB 3D49H 2A06G 4UB6H 3HD7C 2BD8A 1OFCX 2UWLA 3STJA 2QEXP 4XE4A 1DSTA 3RK3C 1EC5A 4I1LA 2GCTB 3FX0A 1O30A 1O3FA 2Y9ZA 2JETB 1QR3E 2PKAB 1OWIA 3A88A 1KQLA 1PGQA 1HUCA 5AW9B 3CCRP 1QTFA 4I2LC 1QGFA 1VQOP 4EYYQ 2WSEJ 3UQOA 2AEFA 3ZVCA 4DW2U 1HF9A 2PR3A 1GBFA 1L0LJ 1BTWA 1YCPH 2ZU2A 1GHBF 3F2GA 2W8ZA 1O2QA 1P84H 1TWXB 1R5LA 1UCYK 1YWUA 4Y7BA 2FOBA 4D9QA 1MTSA 1IFJA 2ZFRH 2C8WB 1MFTA 2O1KA 3L70G 3W68A 1LVYA 1L0LD 2PHBA 1MD7A 3ZVDA 1O3LA 1G1JA 4LC1A 4OS4A 1GDTA 4P02A 3RUOA 1ARBA 1LWUC 1HAXB 4Y79A 4L76A 4MN4C 1MBMA 1O2MA 1Y3XA 4E06H 3RC6A 2PGBB 3PO1C 1IQLA 3KQCA 4WVPE 1PJPA 5A8ZA 4N6JA 1TB6H 4LK4A 4JZEH 1GVKB 2ZDVH 1TGBA 5AW0B 3LJJA 2F9OA 4B76A 4E7NA 1ESAA 1RS0A 2NU4E 2TIOA 4XFQA 5DP8A 1C9TA 1GI9B 4RI0A 1ORFA 1K0HA 4XE5B 4ZKPA 3CS7A 4NA9H 2Y81A 2I1JA 2UWPA 3RGUA 1OSSA 1HGVA 2QJKC 3U1IB 2HODB 1NZQH 2QN5T 1O2KA 3SNCA 1AQTA 3SU3A 1P9UA 3S9BA 2Q1JA 1OOKB 2WPIS 4LOYH 5EU8A 1S3JA 2FOMB 4EIJA 4ASUD 3CC2P 3I5CA 2TBSA 1SLWB 1GL2A 1UK3A 3RK3D 1RF1B 2R0LA 1NRNH 3P32A 3U28C 2BD3A 1CGHA 2PWXA 2VIOA 1A5IA 2B88A 1QBVH 4GVUA 3T2NA 2ZCHP 1BJUA 1SGYE 1PQ7A 1Q31A 2J2UA 3TH4H 4AGJA 2KS1A 2F9PA 3A7YA 2ANKH 2D2CC 3C1KA 3R2PA 1GHAG 3BEFB 3NFQA 3A81A 3LGWA 2OXSA 1O2UA 1JM0A 3S9CA 1KTSB 2Z9KA 3KN2A 4ISLA 5JBBS 2ZHQH 3CX5E 2BXUH 3A80A 4A5TS 1TMBH 1C2JA 1YC0A 2RA0A 1SQBD 4ISNA 2ZDNA 2IYPA 3CCSP 1IQFA 1FPCH 2SGFE 2ZGXH 4B2BA 2W6JD 3IF4A 3GS9A 1SQTA 4VGCC 2PP6A 5E79E 3A7XA 1C1MA 5GWZA 2WITA 1PPFE 1VQPP 2ITAA 1OZHA 1T8ZA 3K9XB 1S5LH 3QWCH 1U7MA 1FX0B 1ETTH 2A2QH 1DEBA 1KYOH 1BB0B 1LO6A 3D65E 5DGJA 5E2OA 1TMTH 5LPRA 4U32A 3ZZ6A 1QA0A 3Q1MA 4LXBH 2FZZA 4I7ZB 2QXGA 5KTBA 4ASVA 2GGVB 4M9FA 1M57D 4W80A 2P59A 1O2HA 1V2UT 1FAXA 1F5KU 4JMYA 2BD4A 1E79H 1YLCA 1G2MA 2OYOA 2C90B 3UNRA 1BE3G 1AFQB 1BJVA 4ZHLU 2EEKA 1DEEG 1PZQA 1RXPA 2PUXB 1ZMNA 1C2GA 1YPHE 4MNXA 1AVGH 1MZ9A 3A86A 3QGJA 2JWAA 2KYVA 1AB9C 2OC1A 1YQ4C 2BTCE 2FI4E 3F9GA 1GBJA 1H9IE 4UFGH 3IWMA 2BASA 3H1JG 2ZF0H 1WRGA 1H8AA 3EWKA 2BD7A 2O8TA 4NFFA 2ZNKH 2J34A 4BRYA 1DY8A 1KB9H 1PFXC 2R5BA 3PV5A 3MU5A 1AWHB 3GOVB 1C2KA 2BOKA 4FUEA 2D2CD 2NZ2A 4L73A 3TNUB 4WWIA 1P0SH 5EIYA 3MHVA 3ENSB 4W7ZA 1UTKA 4AC9A 3NXSA 3VTPC 2C9NY 2PFXA 1KQGB 5A0BA 4UB8E 3RDZA 3M9QA 3UIRA 2Y80A 3V4QA 3FN8A 2Q7CA 1KLJH 2E74C 3A5TA 1Y9BA 5GCHG 4NIWA 1GI8B 2BVRH 4D7FA 1X0TA 5EFWB 1UMAH 3GW6A 1GCTC 4RKJB 2WSSD 5KAIH 1B5GH 1UHBA 1LHEH 1NU9A 1HLTH 1TBQH 1WU1A 3RXJA 1NFWA 2UUFB 4R8TB 3HE4A 1SQVG 1TNGA 5EGMA 2QF5A 4HI3A 4I32A 1RE4A 1G3CA 1AA0A 1MZAA 3EE7A 5C5OA 4CREA 3MTUE 3HGPA 1NTZJ 2AGIX 2ZKSA 1AY6H 2WZ7A 1B0FA 1IZNB 4Q63A 1UW7A 2OBQA 3LC3A 4ZKOU 3M61U 5TISH 5A2MH 1BRUP 4YOJA 3H1LE 1P04A 3KXDA 2JJ1D 3UWIA 4I8HA 1DWEH 1JCDA 4X1QU 2KNCB 4ZMAH 2OYHB 1NTZD 4D9RA 3GY5A 4RESB 5AVSB 2GJGA 3MH4A 4Z1MD 1P57B 1MABB 2FFDA 1ZPZA 3K65B 3VOPA 3GY6A 1HIAA 2NRGA 4AYCA 2QGRA 1EZXC 3BTGE 4KT0J 9LPRA 3U1JB 2GDEH 4FUFA 2J95A 5AHGH 2FTLE 3RXRA 1T6AA 2GA1A 2WSCH 2D1JA 1D4PB 1ZLRA 3SUFA 2N1TB 1FZAA 5B66H 2LP6A 1BTPA 1FIWA 2ILNA 3C8VA 5K0HA 1LT9C 1GGDC 5AW7B 3KHUA 2XTTB 2ZHEH 5DP5A 5KLVJ 1FOSF 4KELA 1UTLM 2BDYA 2JDIH 3RK3B 4U3FE 3C27B 2QYIA 1S9KD 1AVYA 1D3PB 1AFOA 1C5NH 1H8IH 2BDAA 1BBRK 5T1VA 3D70A 3ZYDA 2J98B 4CRBA 3A3YB 3Q2YA 1OS8A 1W0ZU 3M7TA 3PMJA 2ZCKP 2WV5A 1P2MA 4H0LC 2JO1A 3L71E 3RK2C 3AEEC 5KLVD 1QX8A 2XNIA 4Q80A 3M3SA 1M1JA 4Q7ZA 1ELEE 1KILC 1D3DB 3BTQE 2OTVA 5HKKD 2MKVA 4Y71A 1HJ8A 2CF8H 3JCUH 3L6PA 3AE8C 5K5GB 3DA9B 3MNXA 1BSNA 3PH0A 6CHAC 4WY4A 2XWAA 1A1RA 3ZZCA 1SL3A 2ANYA 1NFUA 1ZRBA 4F48B 1SFCC 1L1NA 4UB6E 1UTNA 1ZGIA 3FOAA 7LPRA 4B75A 1OX3A 4JYCA 1D3QB 1LWUB 1YBKA 4DJGA 3W94A 1ELGA 5CCGC 2FLRH 1BDDA 5AF9H 2P67A 3ZDMA 1BOQA 3CXHH 3G9RA 3M7UA 3H1KG 1GWAA 3QN7A 3UR6A 1A4WH 1NTKK 1S4XA 5KAFH 1P06A 1RH5B 2CF9H 1DIPA 1Y47A 2PLXA 2Y0EA 1C2MA 2FM2A 1PPHE 2BXTH 1F0TA 4FUIA 1TYNA 5GDSH 1O32A 5JPMH 4RO0A 2CHAC 5EW2H 1W2KH 1J17T 2NPSC 1BTZA 2JH0D 1NRQH 1P84E 1RY3A 3RL0C 3M06A 4SGBE 5KECA 5KKZC 3P17H 1S72P 3GYMA 4CRDA 1HTLC 1X79B 2QJKB 5T6GA 3B23B 2H9EH 1PPCE 2ODQA 3GY2A 1OVUA 3UWJH 3WW7A 3U8OH 3CWBG 1MD8A 4AB8A 1IQGA 1OWKA 5GTIH 4NIXA 1RTFB 1TQ7B 4MPUA 1CA8B 2BDGA 1LTJC 2PKSC 3KZIE 3L74J 1EAWA 2HWLB 1EP6A 2G3AA 1WTGH 2H6MA 1N73C 2OP9A 2GCHG 5FX6A 2ZYDA 2ESTE 1LTTC 1AI8H 3A8DA 3SU4A 7GCHG 1FAVA 1G1IA 3BCCJ 1ELFA 3T29A 1SQPE 3HTKA 1QL8A 4MPXA 3RXQA 5LPFA 1HAZB 2IFNA 4K35A 4D76A 3H1IG 4YO9A 4H0LD 3RK2D 3L74D 1PYTC 5FBIA 3VFEA 2ZFSA 3PMHB 1EUFA 4YXWH 1IQEA 3GDVA 5E0JA 1TBZH 3TK5A 4DJZB 2YMSC 1ID5H 2ZU3A 1NTKG 3BCCD 2M3BA 1K22H 1OP0A 1KILD 4IFDK 4GHTA 3GCHC 2GCTC 3L75G 1MZDA 1E5WA 1IO4A 1XVMA 1L1JA 2AERH 2O9QA 2B89A 4OGQC 1FQ3A 5JBCS 1L0NJ 1UJ1A 4ABIA 4BAHB 2GM4A 1OYQA 2AH4X 2WUBA 5AFZH 2W3IA 3A7OA 5BU8B 1SFCD 4ISIH 2RDEA 2QA4P 2YO2A 2HNTF 3RXIA 3TDKA 2M2AA 1EPTA 1F0UA 4RSPA 3PYHA 1MKWK 1L0ND 1WDIA 1K1NA 5CCGD 3A7ZA 4NSVA 1VQ4P 5JB8S 4PJ0H 1YPGH 1JEKA 3E16B 2FYUJ 1FONA 1Q81Q 1O37A 2XDJA 2G5VA 3VEQB 1IFMA 2B9BA 2YIUC 4GHQA 1N6XA 4P00A 3Q3KA 1WSSH 3OAAD 1EZVI 3A87A 3LONA 3KQBA 2BD5A 1P03A 1UTPA 3K2UA 4UE7H 3SU2A 2NPSD 4ABJA 2FXRA 2FIRH 2H5DA 2FYUD 1OW8A 1QL2A 3RL0D 3EA8A 3RBZA 1CVWH 1L4AD 5ETXA 3TGUG 2JEEA 1AD8H 3TJUA 2C4FH 3URDA 2Q6FA 1GVZA 4C7RA 2FI5E 2GV6A 4IC6A 2XBVA 4HFPB 5EXMA 2TGDA 1HBWA 3AASA 1L2EA 1NVOA 1NY22 1O3BA 4LZ4B 1MH0A 2O8LA 2LKMA 4H44C 1GBTA 1O3CA 1Q7YQ 2ZFFH 4H13C 2A0QB 1ZR2A 1IFNA 2ZDKA 1VCQA 3A8CA 3G01A 1KQSO 2ZQ2A 3VXFH 5AVQB 2IJD1 1IQNA 5LPEA 3UUZA 2NU1E 3H1HE 4IFMA 1H0TA 3FWLA 4X1PU 4CRGA 2LELA 3MH5A 4ZMDA 3GF3A 2CPBA 2XKMA 5C17A 1PYTD 2WPVB 4NZLA 1Y8TA 8GCHG 3OFND 1TRNA 2IBZE 3TF5A 3E1XB 3U1AA 3PLKA 4DCKA 1SP4A 5CE1A 5KEDA 5APSA 1EJMA 2OTJP 1V2LT 1O5FH 2I6SA 1EQ9A 2KCAA 1VZQH 2YMSD 2W7UA 3LJOA 1QGKB 1UTJA 4R0IA 2Z6BD 1A61H 5EXNA 3O8CA 5GIBA 3EDXB 1O2JA 2R2WU 5CMZA 4OGQD 1O3KA 4NSYA 2O01J 4FOUC 5CHAC 1CHOF 1GBBA 2O3JA 2E75B 1TNLA 2XXLA 1BGYD 4CRCA 3CCEP 1OXGA 1AVOA 3CCMP 1NJIQ 2BM2A 2OC8A 3FP8E 4WXVA 5J4QA 4AFQA 2JP3A 4CHAC 2O8UA 3UIAA 2WZQA 1TMUH 1L0LG 4Y99C 3SNDA 5J4SA 1BHXB 4MPVA 2B0FA 2K9YA 2H2ZA 1KB9E 2RKLA 3AE2C 1USDA 4AUWA 3ZZDA 4I8LA 1A5HA 4YT7H 1AJYA 1RIWC 2KLVA 1O2YA 3AE3C 2XZRA 2Q3IA 2RH0A 1NRPH 4GPGA 2N9YB 1HJ9A 1DUEA 4J1YA 3LGYA 4YPCA 2QC2A 1O36A 1TOMH 2ZGHA 3L33A 3OJAB 4O9BA 1ZSLA 3BTTE 2UWJE 3FANA 1AFEH 2FO9A 2BZAA 1SQBK 5GCHF 3ZVGA 1C5RA 2QF3A 2PTNA 2B5TB 3PTNA 1UTOA 3GICB 3WUUA 1KXAA 2R3YA 2ZYGA 4I33A 5DP7A 5KAIE 1X8YA 3ELAH 4I7ZC 3ABVC 1FPHH 3H7TA 3RMMH 2E42A 3PV2A 4H44D 1MCVA 1ELAA 2NU0E 2ZU4A 2SGEE 8KME2 2QG4A 3T97B 4H13D 2CMYA 1ZR4A 1J2JB 1J9CH 3L36A 1O3DA 3VB5A 1BMNH 1TRYA 1N8RQ 3UNQA 1LT9B 3HD7A 1GGDB 1QHRB 1SGFG 1YQ3C 4IW4E 1AFQC 4Y28J 2L74A 4Y8ZA 2EQNA 5HIYA 1FI8A 4OGXA 5TISE 2A4QA 2FOEA 1AKSB 3HK6B 1JO5A 3HUSA 2AMPA 1Z1IA 1RQVA 3RK2B 2BD9A 3TH3H 2OGUA 7KMEH 1NRSH 2IX7C 1GD2E 1G36A 4BTTB 1SI5H 4IMQA 2WSEH 3SW2B 1KILB 1S83A 1YPHC 1PPBH 2D8WA 4BAKB 1ELBA 4FUDA 2BCCJ 1FC2C 2BDHA 1ARCA 1BIOA 1FY5A 2OLGA 3N99A 4FU9A 3T5FH 6CHAB 1V2PT 1W12U 2Q6QA 4BXSA 1WT6A 4I8GA 3V2NA 1SFCB 3A7TA 1A2CH 3A82A 1TABE 2ZI2H 3RXVA 5AVWB 1OWAA 1W2BO 1LKAA 1N7SC 1OWEA 2KZJA 1GJ8B 1K1LA 1CO7E 1XUKA 3HE5B 1QVFO 1MKXK 4GCHG 4R4LA 1HAIH 3DSOA 3TVJB 1PGOA 3CX5D 3V6IA 1TGNA 2CHAB 5AVZB 2W90A 1HAGE 2STBE 3L73E 2NPSB 1S6LA 1ETRH 3KGPA 4IMZA 4X0WU 1GJ6A 5CCHC 1M7LA 3RL0B 1J14A 2OYIA 1JRTA 1IFIA 1P2OA 5C2ZA 2J5UA 1L4AB 1CI6B 4B86A 5KKZB 3BTWE 2JJ2D 3P70B 1LCYA 3O8DA 2P58A 2QVAA 1DH3A 2B7DH 3IFMA 3S7KB 3ZZ5A 1VGCB 1O3PB 2K0QA 2OYHC 4K8BA 2C3SA 2FODA 1OW7A 1HAYB 2Q5UA 1M56D 2W6AA 1K8AQ 4ZHAA 1GI7B 1LTJB 3SUEA 2P16A 2PKSB 1SQXE 2VGCB 4MDSA 1LTOA 1IHSH 2FXPA 1N73B 4JF7A 3MFJA 4KKDA 3CXHE 1GJBB 1ANDA 1ZSKA 2ZFPH 1X9VA 3SNAA 2WPQA 2Z9GA 4INLA 3GY4A 2E5TA 1FZGA 5DJTB 1IQMA 3F3BA 2AIQA 4IC5A 3SI3H 1QFKH 3F9EA 1K28D 3RP2A 2DUCA 5B6OA 4NA7A 3ODFA 1WXRA 1ELDE 3ATIA 2FDAA 1CU1A 2N1TC 3TK6A 5C67A 1U57A 1XKAC 2J38A 3B5NA 4ZXXH 4O3TA 1FN8A 1S81A 5C5NA 3SV9A 3JC22 3V2QA 2WT7B 1KFMA 3VXEH 3GCHB 2XBYA 3KPEA 1AN1E 1RQUA 1SS1A 4BWNA 1LQDB 4OGQB 2HLOA 3CD6P 2CK3D 2B9LA 5FL7D 3IITA 1FE6A 1CT4E 1P9SA 1QQ4A 1TNJA 2BY8X 2TGPZ 3F0OA 1K04A 4GDOA 3C9IA 2M8RA 1KORA 1JMMA 1FU1A 1VQ7P 4K5ZA 1SHHB 3U59A 5L2ZH 1CBWC 2GCHF 1XKBC 4FUHA 3SI4H 4IL6H 4O97A 5LGOA 2ZJSE 3A83A 7GCHF 1BMMH 3PB1E 1QRWA 3KQDA 1PPGE 2PTCE 1N7SD 5C39A 2A5AA 1UIXA 4NG9H 2KAIA 5KLVK 3TGIE 4AB9A 1CGIE 2YIUB 2Y7XA 3H25A 3QGNB 4A1TA 1IOEA 1ZRKA 5A0CA 1VF5C 3V4WA 1JWTA 3ZV9A 3MNBA 1HBTH 2AXTH 4U01A 1G2LA 1PP9E 5CCHD 1NTZG 3SZEA 1ESTA 4NIYA 1C1TA 2YNAA 5DPAA 2WPHS 1TQ0B 2V7QH 1LKBA 3U8TH 1O34A 1P2NA 2YXRB 1Q90D 5F03A 1K1JA 1YI2P 1Y8AA 2AEJA 3H1KE 1F5LA 2ZDLA 3GDSA 2C0WA 3H1LJ 1FZCA 5AVRB 3BTHE 4H44B 4NPFX 1ELVA 1O2SA 3GDUA 2K8IA 4H13B 1RTKA 3E91A 4PJ0E 1GHYH 1BTXA 4X2WA 1QL7A 1TU3F 4YXDC 1GHXH 3QO6A 1K9MQ 3ITIA 3H1LD 3PMAB 5KJ7D 4X8TH 4WB4A 2IDBA 3S69A 2Y5HA 1LMWB 2VIDA 1Y3WA 1Q3XA 2YNYA 1WQSA 3F1SB 3TSIA 2N1TD 1JUNA 1TA2A 2QE7D 4U30A 4MNVA 1BA8B 4LLHA 1XM1A 5HM2A 1EZUC 1GJ5H 3SGQE 3U69H 3BASA 3CWBE 5KLVG 2VVVA 2DE9A 2WSSH 1URQC 1K21H 1JNMA 2KFWA 3BV9B 3NK8A 4X1SU 2XCNA 2FMJA 3CCLP 3PV4A 4U3FJ 2ZECA 7ESTE 1VJ9U 4PD4E 3VPKA 5CHAB 2A45I 1QB6A 3B9FH 4XOJA 3ZZ7A 2WSFJ 1SQBJ 1HJBA 2ZHFH 4UDWH 3L71J 1OIPA 3CMAP 1B0EA 1NU7B 4M7GA 3TNTA 3UPEA 4CHAB 1O3HA 2WPJS 1O5CB 2P7JA 4U3FD 1WYKA 4Y99B 1BRBE 4TLFA
chains in the Genus database with same CATH topology
1LT9C 2OARA 3EQ2A 5AW7B 1FOSF 3GHGB 1GU5A 3RK3B 2Z4EA 1HH0A 2JJLA 5CHXA 1S9KD 1AFOA 4DOJA 1L0LK 3A3YB 2E43A 1S9KE 2HPCA 3RK2C 1FZCB 2KB7P 1IFDA 2KP8A 3HE4B 1M1JA 1QL1A 3LIDA 1DX7A 1KILC 1NWQA 1GZLA 3LIEA 1N7SA 1N2DC 2XV5A 2XU6A 3WMM0 5KJ7C 1GK4A 3O8ZA 1NH4A 1IK9A 1T3JA 1JY2N 2HYNA 5CJ4A 4WY4A 1IJDB 2I1KA 2WSFH 5AVTB 1L0NK 1SFCC 3BATA 1GK6A 3G3ZA 5AW3B 5CCHA 4JYCA 1RF1C 1LWUB 2YKQA 1JY3N 5CCGC 2FFDB 3N7NA 2P67A 1T3UA 1JY2O 1A02J 1NTKK 2FYUK 2R32A 4JYBA 2NPSC 3U1CA 1URQD 4C7NB 1KILA 1JY3O 1RY3A 2WPSA 2N9BA 3M06A 3RL0C 1HTLC 1X79B 5KJ7A 1FBMA 1GTWA 3HUSC 3NMDA 3A2AA 2HPCB 1NOHA 1LTJC 1M1JB 5AW6B 1N73C 1JTHA 1LTTC 5CCGA 2YKPA 1FAVA 1G1IA 1YYCA 1N7SB 3HTKA 2CPSA 2Z5HA 1J1DC 1SQXK 1ZN5A 4GIFA 3BVHA 2IFNA 2KSJA 4WY4B 3RK2D 3VMZA 1H88A 1LTBC 3VP9A 1LGHB 2M3BA 1KILD 1RF0C 3EFGA 4IFDK 1GW4A 5APVA 1GL2C 1E5WA 1RE3A 1IO4A 2L5GB 2POHA 3CL3D 4HYTB 5APYA 4WBAA 2GM4A 2WWWA 1MFZA 3A7OA 5BU8B 1SFCD 5AW8B 2YO2A 4N78D 3V2RA 1G2CA 5CCGD 5APWA 1NO4A 5CJ0A 2OYIC 1FZFA 4N78E 2XDJA 1J1EB 3H32A 2J58A 1IFMA 1XTCC 1MUUA 2NPSD 3P7KA 1QL2A 1RF0A 3RL0D 1XTGB 3HD7D 1L4AD 2JEEA 5AVXB 3LW5H 1JTHB 4C7RA 1IC2A 3HTKB 1HBWA 1CW5A 1FJKA 1HVVA 4LGDE 1GU4A 3BRVB 2LKMA 1GW3A 1LTIC 3VP8A 2HG5D 4EOTA 3B5NC 1ZR2A 3TK1A 1FJPA 1IFNA 1URQA 5AVQB 1JOCA 1H89A 4IFMA 5APXA 2MJZA 3BRTB 1HWTC 3B8EB 4C46A 2CPBA 3CI9A 2XKMA 1NKZB 3MIWA 3T97A 3U1AA 1SP4A 5APSA 1LT9A 1NAFA 3M9HA 1GL2D 3HRNA 3L35A 1G2CB 2YKOA 5CMZA 1EQ7A 2GUSA 3H32B 1VDFA 1NTZK 2R5DA 1FDMA 5BU5A 3UIAA 4Y99C 3HD7C 1L4AC 3RK3C 4I1LA 4AUWA 2HODA 3N4XA 1SQVK 3MGNA 1AQ5A 1FZBA 1NTMK 2KLVA 1FOSE 2XZRA 2Q3IA 2Q9IA 1KQLA 2ZFCA 1HUCA 3MUDA 5AW9B 1FZCC 4I2LC 1SFCA 2FKWB 3OJAB 4O9BA 4W7YA 2YO3A 1RE4C 1Z56A 2HFED 1SQBK 1RF1A 3OA7A 1URQB 4I6MC 3KDPB 3II6A 3HE5A 1X8YA 1IFJA 4IFFA 2E42A 2YMYA 2O1KA 1NHLA 2IPPA 1ZR4A 1J2JB 3B5ND 2NPSA 3L36A 1G1JA 4LC1A 3VMXA 1GDTA 3H6PA 1LT9B 1LWUC 3HD7A 1L4AA 1CI6A 2FYZA 2FFDC 1LTSC 4N6JA 4GT1A 1JO5A 3HUSA 2VRSA 5AW0B 3RK2B 3V5BA 3VN0A 1LTJA 2Z5IA 2IX7C 2QM8A 1KZUB 1GD2E 2WSEH 3TYYA 1FZEA 1N73A 1KILB 4XE5B 4ZKPA 2I1JA 1HGVA 1OXZA 2HODB 2WTYA 4OH8B 5AVUB 2FXMA 1WT6A 3V2NA 4EIJA 1SFCB 3I5CA 2WT7A 1M1JC 5APTA 1T2KC 5APQA 2ZXEB 5AVWB 1PFIA 1GL2A 1OWAA 3RK3D 1RF1B 3P32A 3E1IA 1N7SC 2P2UA 4N3YB 2QM7A 3HE5B 1N86A 3P8CD 4WY4C 3M0AA 3R2PA 3NFQA 2W27A 5BVZA 5AVZB 3P8CE 1KFNA 3M0DC 2NPSB 1A02F 1N7LA 5CCHC 1M7LA 3RL0B 1HGZA 3SWYA 3HD7B 1IFIA 1ZV8A 4DZOA 1JY2P 1L4AB 2OYIA 2W6BA 1CI6B 1YTZI 5AW2B 4B86A 3L4FA 1NKNA 3KYQA 3TNUA 3M9BA 1DH3A 3IFMA 3HUSB 1CSBA 1CZQA 2OYHC 2Q5UA 2PP6A 2WITA 1JY3P 2W6AA 1T8ZA 1LTJB 2C9LY 1DEBA 3CLQA 2XNXA 3PP5A 4JF7A 1N73B 1X9VA 2WPQA 1J1EC 3NTNA 1FZGA 3V2PA 2H7HA 1J1DB 2H8PD 5KTBA 2KOGA 2IFMA 2N1TC 4ZKUA 3M91A 3MD0A 4W80A 3B5NA 3M0DA 3OAKA 3GHGC 3V2QA 1KFMA 2A45G 2WT7B 3VMYA 2H43A 1GL2B 2GUVA 3KPEA 5APUA 1YTZT 2HLOA 4M3LA 3L37A 1MZ9A 1SVFA 2KYVA 3C9IA 2OYHA 2M8RA 1JMMA 1FU1A 2C0XA 1T2KD 3U59A 2BASA 3VYIA 3KQGA 1WRGA 2O1JA 1H8AA 1NU1K 1N7SD 2OYIB 1RE3C 2R5BA 1SQQK 2O01H 5KLVK 4WY4D 3TNUB 2PAJA 1W2EA 1JCCA 4W7ZA 2N1TA 5AVYB 3V4WA 3NXSA 3VTPC 2C9NY 4HH2A 3M9QA 4GKGA 3GHGA 4KHXA 5CCHD 3V4QA 2Q7CA 2WPRA 3A5TA 2C0WA 1FZCA 5AVRB 1LTAC 1SLQA 3HE4A 1ZLLA 1RE4A 3B5NB 5AW5B 5AW1B 3MTUE 1LTGC 2WZ7A 4AQRD 5KJ7D 4XA4A 2A45H 4WB4A 2P1JA 3SWFA 5AW4B 2YNYA 1MV8A 3TSIA 2N1TD 1JUNA 1JCDA 3P8MC 4LLHA 2OYHB 3BASA 4RESB 1LWUA 1VPCA 5AVSB 1URQC 1JNMA 2FFDA 3IR9A 3VOPA 4AYCA 2A45I 5AVVB 1HJBA 2WSCH 2J59M 1SQPK 2N1TB 4Y99B 1FZAA 2P7JA 4C7NA 2R3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H8P D;  1URQ B;  2KOG A;  3RK3 B;  2N1T C;  1SFC D;  4W80 A;  3B5N A;  2YMY A;  5CCG D;  1NHL A;  1GL2 B;  3RK2 C;  4N78 E;  3B5N D;  2NPS A;  2XDJ A;  1KIL C;  3HD7 A;  1L4A A;  1N7S A;  2M8R A;  2NPS D;  5KJ7 C;  1T3J A;  3RL0 D;  1XTG B;  3HD7 D;  4WY4 A;  1L4A D;  1N7S D;  1JTH B;  3RK2 B;  1SFC C;  3HTK B;  1HVV A;  4LGD E;  4WY4 D;  5CCH A;  1KIL B;  5CCG C;  4W7Z A;  2N1T A;  2HG5 D;  3B5N C;  1URQ A;  4OH8 B;  5CCH D;  1SFC B;  2NPS C;  1URQ D;  1KIL A;  3RL0 C;  1GL2 A;  3RK3 D;  1N7S C;  5KJ7 A;  3B5N B;  1GL2 D;  4WY4 C;  2WZ7 A;  5KJ7 D;  3P8C E;  3M0D C;  2NPS B;  5CCH C;  3RL0 B;  3HD7 B;  1JTH A;  3TSI A;  2N1T D;  1L4A B;  5CCG A;  1N7S B;  3KYQ A;  3HD7 C;  1URQ C;  1L4A C;  4WY4 B;  3RK2 D;  3RK3 C;  3VOP A;  2PP6 A;  1KIL D;  1GL2 C;  3PP5 A;  4JF7 A;  1SFC A;  2N1T B;  4W7Y A;  2HFE D; 
#chains in the Genus database with same CATH topology
 1NTM E;  4AYV B;  1LNQ A;  3GHG B;  1H8H D;  1DLE A;  3SNB A;  2CGA A;  1GU5 A;  1P2J A;  2Z4E A;  1HCG A;  1LQE A;  3WWB A;  1JIR A;  1YIJ P;  1C9P A;  1QNJ A;  3L75 E;  5DP3 A;  2VBC A;  8GCH F;  3L71 D;  1EAT A;  1F92 A;  4DOJ A;  1C1W H;  1RIW B;  3HAT H;  1GI6 A;  3CCV P;  4A7I B;  2DW3 A;  3JZ2 B;  2HPC A;  4LZ1 H;  3LPR A;  3W67 A;  1C5Q A;  2KSE A;  1NU1 E;  1VF5 D;  1BCC E;  1TAL A;  1VKY A;  4YLU A;  3WU2 H;  3F5H A;  1KLI H;  5EG4 A;  1DX5 M;  2BZ6 H;  2M5A A;  4IOI H;  3TH2 H;  1GJA B;  1O5E H;  1SQQ E;  1Q86 Q;  1IQI A;  1SVP A;  1WMK A;  3E8L A;  1NWQ A;  1ZSJ A;  1GZL A;  3R4Y A;  2G4U A;  2PSX A;  2UWO A;  4X6M A;  2HRV A;  5DSF A;  5KGO A;  3SQE E;  2XV5 A;  1W0K D;  1Y5A T;  2XU6 A;  4HGC A;  2C8Z B;  1BMA A;  2QF0 A;  2G81 E;  1GK4 A;  1WAY B;  2TGT A;  3O8Z A;  1KLT A;  1T3J A;  1L2P A;  1JY2 N;  2HYN A;  1TBR H;  2QXI A;  2ZP0 H;  1RRK A;  4F55 A;  4TWY A;  3MU0 A;  2I1K A;  1VQN P;  1LPK B;  1YGC H;  3URC A;  5GTH E;  1L0N K;  1KQF B;  1WV7 H;  1GK6 A;  3AED C;  3Q5R A;  1E0F D;  3FVF B;  1FJS A;  1GBD A;  2A31 A;  4WF8 A;  1UCY H;  4BTU B;  2PGD A;  1LVM A;  2IZ1 A;  2YKQ A;  2WPM S;  1JY3 N;  1OKX A;  3MMG A;  3SJ8 A;  2FOA A;  1EZV G;  1A02 J;  2ZT9 C;  1AKS A;  2AYW A;  1U7J A;  2LXC B;  1GPZ A;  4KP0 A;  1CHO G;  3V12 A;  1V2M T;  2O8W A;  3HK3 B;  2FYU K;  2VJ1 A;  1P84 D;  2P93 A;  5SGA E;  1JMB A;  1LVO A;  1Z7K A;  3L74 G;  2W3K A;  2K9J A;  2FPZ A;  1G30 B;  4C7N B;  1URQ D;  2M3E A;  1KIL A;  1VR1 H;  2WPS A;  1WUN H;  5C1U A;  3BCC G;  1AIX H;  3FWN A;  4CBN A;  2A4O A;  4L75 A;  1T8N A;  4QT8 C;  2ZU1 A;  1C5P A;  1EZQ A;  4JZD H;  1SQP J;  1AZZ A;  1AE8 H;  1QJ7 B;  2OD3 B;  1PPJ E;  1LVB A;  1V2Q T;  1JOU B;  2J9N A;  3U9A H;  3LT3 A;  3RXO A;  3STI A;  1QA7 A;  1ZTL A;  3QUM P;  5C94 A;  3LGI A;  4EST E;  3NMD A;  1ABI H;  2OBO A;  5EQQ A;  2SGD E;  2PW8 H;  2P8O B;  1FXY A;  1O3G A;  1SQP D;  3QWO C;  1HB0 B;  5AW6 B;  4YM9 A;  3PJS K;  1QEX A;  5CCG A;  5KLI C;  4J2Y B;  1L0N G;  2B87 A;  2H9H A;  1N7S B;  3L72 J;  3OU0 A;  2E75 C;  2HPQ H;  2CPS A;  2R9P A;  1J1D C;  1SQX K;  1ZN5 A;  3AAV A;  1BIT A;  2QXJ A;  4X2Y A;  2FYR A;  3UOP A;  3EYD A;  4DT4 A;  3VMZ A;  3TJV A;  1YPM H;  1HUT H;  1ZJD A;  1LTB C;  1C1P A;  2SGQ E;  4HB1 A;  2A45 B;  3L72 D;  2BY6 X;  3LW5 J;  3EFG A;  1PGJ A;  1A0J A;  2G52 A;  4IGD A;  3RXE A;  3WWF A;  5APV A;  2M0B A;  1GL2 C;  2FYU G;  1T31 A;  1BDC A;  3P8O A;  3JSV C;  1RE3 A;  2FOF A;  1UO6 A;  2GP9 B;  2POH A;  3CL3 D;  1HAV B;  3R0F A;  4TPY A;  2UUJ B;  1HNE E;  1Z8J B;  1E1R D;  3TNS A;  2A7H A;  2WWW A;  5DKM A;  4MNY A;  1SFI A;  2RA3 A;  1SQR A;  1EP5 A;  4K1T A;  3BG4 C;  1YPE H;  1C2F A;  5IDK A;  1G2C A;  1O3N A;  4MG3 A;  4MLF B;  1NO4 A;  5CJ0 A;  4ZUH A;  5M1B A;  4N78 E;  4ZKR U;  2F91 A;  2ZT9 D;  4KJM A;  4GCH F;  3H32 A;  4EDF A;  1BML A;  3A7W A;  4CRA A;  5B6L A;  2ZPR A;  3Q3Y A;  1LT1 A;  4AYY B;  1OW6 A;  1MUU A;  3AVZ A;  1FS0 E;  4UD9 H;  1MKM A;  2BDC A;  5HIZ A;  1CT2 E;  3AE5 C;  1Y3U A;  5K7R A;  1IFP A;  4JBZ A;  3MI4 A;  3P7K A;  1AVX A;  1KIG H;  1KMH B;  4MQA A;  3HGN A;  5EJL A;  1GCD A;  2QAA A;  1IHT H;  2I8D A;  2ODP A;  1DT2 A;  4NGA H;  4YTA A;  1JTH B;  3H1H J;  3E3T A;  4DIH H;  2JKV A;  2PKA A;  3SZN A;  1GJ4 H;  3PWB A;  1FJK A;  3TIT A;  5HM9 A;  4ZCN A;  4B6F A;  1P02 A;  3M36 A;  1YHQ P;  2K37 A;  2RN0 A;  4I86 A;  1ZRT E;  1QL9 A;  1V3X A;  3VP8 A;  1O3O A;  3SUG A;  4AFS A;  3UY9 A;  3Q5P A;  3H1H D;  1FJP A;  1T4U H;  1AQ7 A;  1CBW B;  1O3I A;  1O2V A;  1V2T T;  3DCL A;  3VGC C;  3MU1 A;  1SLX B;  2BD2 A;  1EKB B;  2OK5 A;  4FUB A;  1H89 A;  5APX A;  3I78 A;  4WMD A;  2MJZ A;  1HWT C;  2E75 D;  3B8E B;  2IBZ D;  1PIX A;  4RN6 A;  1TPA E;  1KN7 A;  2E5Y A;  3QH9 A;  1DWC H;  1C5S A;  3CI9 A;  2KCO A;  5DO4 H;  1S85 A;  1EJA A;  2ZFT A;  1E79 D;  1EAU A;  2ZYA A;  2XBW A;  3LC5 A;  3MUD C;  1KYN A;  1G3B A;  3AAU A;  3EST A;  5FPS A;  1E36 B;  1O33 A;  1VF5 B;  5H2F H;  2GDD A;  3KQE A;  2NU2 E;  5EOD A;  3ATM A;  3N7E A;  4D6T E;  1GL2 D;  3FXE A;  3D71 A;  2VIP A;  1GL0 E;  3HRN A;  3OW2 O;  1KV4 A;  1ZHM A;  2AS9 A;  4TY6 A;  1KDQ B;  1VQ5 P;  1COW D;  5BRR E;  1TNI A;  4BXW A;  4Y10 E;  4KTC A;  2QV1 A;  1NGM B;  4A7P A;  3SO3 A;  3SSU A;  4AOQ A;  3A0B H;  1L1G A;  2R5D A;  3SFE C;  5BU5 A;  9EST A;  1KB9 D;  2HOB A;  4UFE H;  1W11 U;  4KTS A;  1C5Z B;  3GG2 A;  2RMZ A;  2Z9J A;  5EW1 H;  3EA7 A;  2VU8 E;  1L4A C;  1FY8 E;  1K1O A;  1QJ1 B;  2BX3 A;  4YT6 H;  3U8R H;  1P2I A;  2HOD A;  1UK2 A;  4HG6 A;  3MGN A;  1FZB A;  1NTM K;  1FOS E;  2Y82 A;  3P8N A;  1ZOM A;  3QZQ A;  1NN6 A;  3KYF A;  5EST E;  1VGC C;  2VWO A;  1ZTJ A;  2E76 C;  1HV7 A;  1GMC G;  1Z71 A;  5A09 A;  6LPR A;  1UVS H;  4AFU A;  3OEE D;  2G00 A;  4CRF A;  4W7Y A;  1QCP A;  2V35 A;  5HXF A;  1RE4 C;  2YO3 A;  3VMA A;  1Z56 A;  2OQ5 A;  2VGC C;  4O03 A;  1RF1 A;  1ZHR A;  3QK1 A;  1O3M A;  3TGJ E;  1URQ B;  2FX4 A;  3USS A;  4I6M C;  4BNR A;  3II6 A;  1HFD A;  2G51 A;  4EI2 A;  1ELT A;  1MBQ A;  1QY6 A;  3BTD E;  4ZXY H;  4AOR A;  5FAH A;  2G4T A;  2YMY A;  3GMA A;  4ZKS U;  1NBM E;  4MNW A;  3SV7 A;  3RBX A;  1X7A C;  2HR3 A;  1PQ8 A;  2R0K A;  5DJU B;  1AU8 A;  4K3J A;  3MO9 A;  1H1B A;  1C2L A;  2ANM H;  1Z8I B;  3VB7 A;  1AE5 A;  2Q3E A;  3FFG A;  1XUF A;  2A06 E;  1D3T B;  4I8J A;  2FFD C;  4K2Y A;  1TPO A;  3F9F A;  1ZPC A;  1GI0 A;  4XSK U;  2ZZU H;  2BCC G;  1H9L B;  2H89 C;  2THF B;  4FU7 A;  2EI7 A;  2VRS A;  4B71 A;  5L30 H;  3ZVB A;  1LPZ B;  2FOG A;  4KGA A;  1QB9 A;  1NO9 H;  3VN0 A;  2EY4 C;  1KZU B;  3TYY A;  2SGA A;  1FZE A;  1ZXG A;  2KZ4 A;  2K1A A;  1YPK H;  1BBR H;  1MTW A;  1THR H;  2WVR A;  5PTP A;  3TPI Z;  1N6Y A;  4FET A;  2ZDA H;  3PO1 B;  1VQ6 P;  1DFP A;  2WTY A;  5AVU B;  2FXM A;  4MPW A;  5FCR A;  1VQM P;  2HGT H;  1XVO A;  3L70 E;  1HYL A;  4ABG A;  1BHX F;  1DXP A;  2WV9 A;  1GMH G;  4B73 A;  1M1J C;  1ZP0 C;  3L73 J;  3ZZ9 A;  1GG6 C;  2ZXE B;  1PFI A;  4GOD A;  4ACA A;  3GLM A;  1C1O A;  1CT0 E;  1AMH A;  2A1D B;  4YZU A;  4Z0K A;  1WCZ A;  1O2G H;  2BDI A;  3PM3 A;  3E1I A;  5EQS A;  1JIM A;  1T4V H;  2QM7 A;  2ZT9 B;  1KTM A;  1SGR E;  2TRM A;  3RXS A;  2FES H;  2SGP E;  1O5D H;  1QRX A;  4WY4 C;  2QJY B;  3L73 D;  1DAN H;  2G8T A;  2E76 D;  4JZI A;  2JR8 A;  1DSU A;  2OQQ A;  1DD4 A;  4OM9 A;  4THN H;  1S5L E;  5BVZ A;  3P8C E;  4IBL H;  3ATW A;  3M0D C;  5CBO A;  1GJC B;  1KYO E;  4OS6 A;  1SQX J;  2Q1K A;  2BX4 A;  5FX5 A;  3OY5 U;  1OMI A;  1YTZ I;  1ZML A;  5AW2 B;  3MNS A;  1SHY A;  1GI4 A;  3PHL A;  4WVZ A;  2OIN A;  1T8M A;  5TCA A;  3L4F A;  2LPR A;  2EI6 A;  5B5E H;  3RC4 A;  3TNU A;  4AX9 H;  2Q6G A;  1ZPB A;  2RCE A;  3SHA H;  4FU8 A;  1D7M A;  1G9I E;  2L6O A;  2XCF A;  1SQX D;  1CSB A;  1CZQ A;  4Q7Y A;  1BGY J;  4X2V A;  2SNW A;  2FYN C;  3CXH D;  3W1E A;  2FBW C;  1ZTK A;  3M37 A;  2OC7 A;  3P6Z B;  4ZKN U;  1KD1 Q;  1IAU A;  3CLQ A;  1LP1 B;  2XNX A;  1FUJ A;  2J97 A;  2SPZ A;  5KLI B;  2HNT E;  2ULL A;  3FZD A;  5F8T A;  4IL6 X;  1TGT A;  4JK5 A;  1J1E C;  3NTN A;  3G71 P;  1TRM A;  2ZFQ H;  3V2P A;  2H7H A;  2BY5 X;  2VH6 A;  3BTE E;  1BT7 A;  3Q77 A;  1J1D B;  1DIT H;  5AFY H;  4OGY A;  5EXL A;  2KOG A;  3GY8 A;  2IFM A;  1RHZ B;  1H8E D;  1C5W B;  3Q5S A;  3OAK A;  3GHG C;  1AVW A;  2ZPS A;  2A45 G;  5E79 H;  3QTO H;  3VMY A;  2H43 A;  2QF4 A;  3DHK H;  3FZZ A;  5GJ4 B;  5C0T A;  1GL2 B;  3SJO A;  1O2L A;  1SQO A;  1HAV A;  1GMD G;  5JB9 S;  5FCK A;  5APU A;  3ZVF A;  3M5N A;  1MTV A;  4YTP C;  2Z94 A;  1O31 A;  1E1Q D;  3F2F A;  1J15 A;  5C0U A;  2AXC A;  2KS1 B;  1SVF A;  1TON A;  2KNC A;  1K1M A;  2OYH A;  1GBM A;  3AEB C;  4O3U A;  1UK4 A;  3M5L A;  3RU4 T;  2C0X A;  3RXU A;  3MWI U;  3VYI A;  3RML H;  1C1Q A;  3KQG A;  3BG4 B;  5C1X A;  2QIQ A;  1PP9 J;  2O1J A;  1S84 A;  2XC5 A;  5C1Y A;  2FYQ A;  1EOJ A;  1WOF A;  3R3G B;  3HPT B;  1TPP A;  1DY9 A;  1UTM A;  5CHB A;  1V2K T;  4CH8 B;  4FUC A;  4YXW D;  2HLC A;  2GZ8 A;  2QJP C;  3DSP A;  2BVX H;  2D26 C;  2F43 B;  1YF4 A;  3IG6 B;  3H1L G;  2R3S A;  4WY4 D;  3UB0 A;  1MQ5 A;  2PAJ A;  1W2E A;  1PP9 D;  1JCC A;  1W7X H;  2CN0 H;  2N1T A;  3AW0 A;  3E7K A;  3CNR A;  3S9A A;  1MKW H;  1SGF A;  4OS2 A;  3NXP A;  4NWK A;  1IQK A;  2FX6 A;  2CK3 H;  4JYT A;  1EPT C;  1TFX A;  3SU1 A;  1C5O H;  2WPR A;  1V2N T;  3BN9 A;  4JYV H;  3A7V A;  3RM0 H;  4DII H;  4NZQ A;  1BE3 E;  2WUC A;  2J98 A;  5H4I B;  2GZ9 A;  3SV6 A;  1EZV E;  2QXH A;  2W5E A;  3MQK C;  1OPH B;  4KTU A;  2ZHW H;  3RXB A;  1VQ8 P;  2WPK S;  1SLQ A;  1A7S A;  1JBU H;  1ZLL A;  1UTQ A;  1GBL A;  1E35 B;  2Y9Y A;  1DIC A;  1UVP A;  1V2O T;  2ZCL P;  3KYG A;  3WUT A;  5G4B A;  3H1J E;  5A0A E;  2WPL S;  3MH7 A;  3K6Y A;  4U3F G;  3VGC B;  1V6D A;  1LTG C;  2GMT C;  1G3E A;  1PGP A;  4TWW A;  3LDX H;  4D8N A;  5DP6 A;  1YBW A;  1YCP K;  3MNC A;  2EA3 A;  2A45 H;  3SJI A;  3BEU A;  4OWF A;  1SQB G;  3T62 A;  2IYO A;  1ELC A;  1PQ5 A;  4WJG 2;  3L71 G;  1ACB E;  2FOH A;  1MV8 A;  4K60 A;  5B66 E;  1O38 A;  1LDT T;  2ANW A;  1K1I A;  1T7C A;  4MTB A;  1OWD A;  3P8M C;  2NU3 E;  1GBA A;  2P8O C;  5TCC A;  1XUJ A;  3F68 H;  4A1X A;  1O35 A;  1KTT B;  4IN1 A;  2XND D;  2KM0 A;  1LWU A;  1NTM J;  2H5C A;  4PD4 D;  1CHG A;  1DDJ A;  1EXJ A;  1TX8 A;  3MO3 A;  3IR9 A;  1S5L X;  2C93 B;  3P92 A;  3L75 J;  4BRY B;  2J92 A;  1K2I 1;  2ZGJ A;  3DFJ A;  5FBE A;  2SFA A;  3AE7 C;  4BAO B;  5AVV B;  2KR7 A;  4D7G A;  2J59 M;  1K9O E;  1NTM D;  1FY1 A;  1SQP K;  1GDU A;  1NU1 J;  3AE6 C;  1BCC J;  1G32 B;  3CS0 A;  1UII A;  2ZO3 H;  1LHD H;  2Z7F E;  3OE7 D;  1SQV E;  1SQQ J;  2GVF A;  2OAR A;  3L75 D;  2XC0 A;  3AE9 C;  2FEQ H;  1O2O A;  2QE7 H;  3S9O A;  1OWJ A;  3JCU E;  1HH0 A;  2JJL A;  4GOE A;  5CHX A;  1LHF H;  4TSF D;  4FUJ A;  1NU1 D;  1F5R A;  1BCC D;  1A46 H;  3V7T A;  2F83 A;  2OQU A;  2V3O H;  3SBK A;  1SQQ D;  1C5U A;  4QMA A;  1O2I A;  1UHB B;  2ALV A;  2KX4 A;  3UQV A;  2E76 B;  3JZ1 B;  2F9B H;  2KP8 A;  3HE4 B;  3F9H A;  2ZAE B;  2F9U A;  2PUQ H;  3LID A;  4Y6D A;  3UAI C;  1KXC A;  1DX7 A;  4H6T A;  3A89 A;  1GBC A;  4NPE A;  3NWU A;  3AE1 C;  1A5G H;  1FV9 A;  1N2D C;  1G3D A;  2A5I A;  1C5M D;  3CPW O;  3FAO A;  3Q00 A;  1GI3 A;  2B8O H;  5KAF E;  1QBO A;  5KJ7 C;  1NH4 A;  1IK9 A;  1XX9 A;  1BUI A;  2EI8 A;  3NUM A;  1HAO H;  1DWB H;  2YNB A;  1YY3 A;  1Y59 T;  4NWL A;  4PD4 I;  2F4L A;  4ZAE A;  1SGP E;  1C1V H;  1IJD B;  4BAM B;  2WSF H;  2P3U B;  3P95 A;  3QDZ B;  3SGB E;  1GMJ A;  3BAT A;  1YLD A;  3DSG A;  4WMF A;  3G3Z A;  5AW3 B;  3PMB B;  5EJZ A;  2P94 A;  1FZZ A;  1O5G H;  1RTL A;  1OVV A;  2W6J H;  1XUH A;  1ZYO A;  4ABD A;  5C3N A;  2FFD B;  3N7N A;  2BDB A;  3RXA A;  1O5A B;  1QRZ A;  3MTY A;  1JY2 O;  3CX5 I;  1W10 U;  3WY8 A;  1BRC E;  1HIA B;  4JPZ B;  1O2T A;  1OP8 A;  1QBN A;  4TT3 D;  1DS2 E;  1BTH H;  1GMC F;  4UFD H;  3OY6 U;  1NAY A;  3ATK A;  3SJ9 A;  3TJN A;  5GTI E;  2GT8 A;  3BG8 A;  4E05 H;  1LHC H;  1BQY A;  5BPE A;  5I46 H;  1YIT P;  1TIO A;  1V2S T;  1SQA A;  3SWK A;  1B7X B;  3RXK A;  3I56 P;  1O3A A;  1JY3 O;  1PPJ D;  3A85 A;  2N9B A;  1T8L A;  3L72 G;  1SLV B;  4YOI A;  1S1C X;  1BSH A;  1CA0 B;  1DXW A;  3UR9 A;  1FBM A;  5DG6 A;  2VVU A;  3BF6 H;  1FAK H;  3DT0 H;  3TK9 A;  5ABW A;  3BEI B;  4X8U H;  5I25 A;  1GTW A;  3CCQ P;  3HUS C;  1YKT A;  1C4Y 2;  1VIT F;  1P01 A;  3CME P;  4ACB A;  1M1J B;  3RXC A;  2R3U A;  1GG6 B;  2FS8 A;  4DG4 A;  2QIW A;  2YKP A;  4A6L A;  1O2R A;  5A8X A;  1OHH D;  1YYC A;  3ZZ4 A;  1ZR0 A;  5EPY A;  4GIF A;  1V2W T;  3BVH A;  2QRX A;  2HVX A;  3T27 A;  1F0S A;  4WY4 B;  4X8V H;  3FP6 E;  3QZR A;  2YOL A;  1Z8G A;  1H88 A;  1M9U A;  1EOL A;  3VP9 A;  1UVO A;  1HXE H;  1W14 U;  3PLB A;  2QSI A;  3N7O A;  5TJX A;  1RF0 C;  1YPL H;  3O8B A;  4A1V A;  1GW4 A;  1AV1 A;  1BBR E;  1FNI A;  3AE4 C;  1NM6 A;  1SSX A;  2AIP A;  3O6Q B;  1JB0 J;  3KZI H;  2ZPQ A;  3SHC H;  4XFJ A;  1UVT H;  1MKX H;  4MVN A;  3PTZ A;  1LJ2 A;  4ISO A;  1AGJ A;  3RXG A;  4HYT B;  2UUY A;  1YJW P;  3AEF C;  1C5Y B;  1EAS A;  4R4M A;  1P3E A;  1HAH H;  1GMH F;  1IK7 A;  3PRJ A;  1GL1 A;  2G5N A;  4AGK A;  1TNK A;  1F0R A;  2ODY B;  1TX6 A;  2FYN B;  4N78 D;  3E6P H;  3IAO A;  5CBN A;  1M1K Q;  2JKH A;  4DCD A;  3V2R A;  1TOC B;  3H1H G;  1LP1 A;  2ZVO B;  2OYI C;  1FLE E;  2ZVN B;  2QCY A;  1TGC A;  5EJ1 A;  1EDL A;  1F2S E;  2P95 A;  1HXF H;  2ZTZ A;  5DJ7 A;  3T28 A;  1J1E B;  1X22 A;  3RU4 E;  3GYL B;  2J58 A;  1IQJ A;  3SQH E;  2IBZ G;  1SFQ B;  1GBE A;  4CR5 A;  1YLN A;  5FPY A;  2D2D A;  1JRS A;  1P12 E;  3RMN H;  3LGU A;  3H1I E;  1HPG A;  1Q82 Q;  1SB1 H;  2BLQ A;  2ZC9 H;  1S6H A;  1O2X A;  4L74 A;  2GKV E;  4WH8 A;  1MU6 B;  3OX7 U;  4CBO A;  1XTG B;  3HD7 D;  1NTK E;  3PLN A;  1MTN C;  3LH3 A;  2A7C A;  2Q6D A;  5AVX B;  3RXH A;  3LW5 H;  1C5L H;  2Z3D A;  1MU8 B;  1ZMJ A;  3F89 A;  1IC2 A;  5B5E E;  1FDP A;  4K69 A;  4CR9 A;  1ZRT D;  3HTK B;  1W8B H;  3SU6 A;  4H42 U;  1S0Q A;  1CW5 A;  1M90 Q;  4Z1M H;  1AO5 A;  2BCC E;  1YPJ H;  1P10 A;  1GU4 A;  3BRV B;  3A84 A;  4XBC A;  2R44 A;  1LTI C;  4EOT A;  2SNV A;  5F8X A;  1OVR A;  1QUR H;  1SLU B;  3B5N C;  2FS9 A;  4XBB A;  3NCL A;  6GCH G;  4D6T J;  1GJ7 B;  2VB0 A;  1FY4 A;  3TJO A;  3PLP A;  3CP7 A;  3SU0 A;  1C4V 2;  4DGJ A;  3QTV H;  3BRT B;  2KCP A;  1T8O A;  2QJP B;  4C46 A;  4INK A;  2FWW A;  3AEG C;  4FVB A;  5E8E H;  1CE5 A;  3FO8 D;  2V3H H;  2AGE X;  4Q2K A;  2ZHD A;  1SBW A;  3T97 A;  2GT7 A;  1EAX A;  1W13 U;  2C8X B;  2KXP B;  3KID U;  4D6T D;  4GSO A;  1SPJ A;  1AZ8 A;  1LT9 A;  1NAF A;  2AMQ A;  1Z1J A;  3UTU H;  1GMD F;  1EPT B;  3NPS A;  4IN2 A;  2AEI H;  3B71 A;  3L35 A;  4PV1 C;  2FP7 B;  2YKO A;  3TGU E;  3PRD A;  4BXL A;  1DVA H;  1O3J A;  1CQQ A;  2Z9L A;  2IZ0 A;  3RC5 A;  3E1R A;  4CPG A;  1VDF A;  2QJY C;  4ZNC A;  3KNX A;  1C1N A;  4U2W A;  2HLD D;  3OEH D;  1FDM A;  2VH0 A;  4IS5 A;  3VB6 A;  2A4G A;  4X6O A;  1O2N A;  2ZGC A;  2V7Q J;  4DY7 B;  2XW9 A;  2GMT B;  1DPO A;  2BQ7 B;  1GVL A;  3N4X A;  4H6S B;  1SQV K;  1EAI A;  1S5S A;  1AQ5 A;  2LXB A;  3BIV H;  3M5O A;  2FI3 E;  1E37 B;  1NFX A;  5AVD A;  4ABH A;  2Q9I A;  2ZFC A;  3MUD A;  4HJG H;  1TPS A;  3DD2 H;  1MAX A;  3KF2 A;  1FZC C;  2G55 A;  1SFC A;  4WXI A;  1S82 A;  2OTK E;  2FKW B;  2V7Q D;  2GZ7 A;  3KEE A;  2KIK A;  2K88 A;  2HFE D;  1ABJ H;  1O2Z A;  2L91 A;  3OA7 A;  1GJD B;  1YM0 A;  2ZTY A;  5EOK A;  1INC A;  1O2W A;  1EXI A;  1HJA C;  1U6Q A;  2FXO A;  3RXF A;  3KDP B;  2WV4 A;  1H0T B;  1SKY E;  1NBM D;  3HE5 A;  2OC0 A;  4ZH8 A;  5CDF E;  1VJA U;  2WHX A;  4IFF A;  1KSN A;  1NHL A;  4K8Y A;  1S0R A;  2IPP A;  2BY9 X;  4ABA A;  2A06 D;  3S1K A;  4A92 A;  3B5N D;  4XRN A;  2NPS A;  4XD7 D;  3DFL A;  1S2E A;  1XUG A;  3VMX A;  2HNT C;  1ESB A;  3H6P A;  3ZZA A;  1E38 B;  1MUE B;  1L0L E;  4I31 A;  1L4A A;  1T32 A;  1CI6 A;  3P8G A;  2FYZ A;  3C1L A;  3IN6 A;  3VB4 A;  1P84 I;  1ZHP A;  4X2X A;  5EPN A;  5T6D A;  3A8A A;  1W0Y H;  1P11 E;  1LTS C;  1EZS C;  3OSY A;  3QX5 H;  2AGG X;  4GT1 A;  1XXD A;  2IN2 A;  4Y8Y A;  1WBG B;  4TYD A;  1N8O C;  4FXG H;  1GDQ A;  2A7J A;  1Y3V A;  5GXP A;  1P09 A;  1SGT A;  3MH6 A;  3V5B A;  3L73 G;  3L70 J;  2VIV A;  3DUX H;  3RXP A;  5F8Z A;  1LTJ A;  2Z5I A;  2QM8 A;  1EFR D;  2BLO A;  3GCT F;  2WMM A;  3URE A;  8LPR A;  2LR2 A;  1N73 A;  2YMK A;  4PV1 D;  2BMG B;  1QB1 A;  3RXL A;  1BTY A;  1NPM A;  1QQU A;  2LNC A;  3H5C B;  1RGQ A;  2JIZ D;  3GF7 A;  1OXZ A;  3A0H H;  3CCU P;  3I77 A;  1C2H A;  1D6R A;  3TLO A;  3SUD A;  3L70 D;  1G37 A;  1ZME C;  2WYG A;  3GY3 A;  4OH8 B;  4BAQ B;  3AEA C;  2ZQ1 A;  5JBT A;  1NS3 A;  5L8R J;  1MQ6 A;  1C1R A;  2BQ6 B;  2VIW A;  1FMG A;  4RT1 A;  5T6F A;  1EX3 A;  1BMF D;  1ZOY C;  2BB4 A;  1SQX G;  2WT7 A;  5APT A;  1T2K C;  1TGS Z;  5APQ A;  1USE A;  1NT1 A;  1Z8R A;  4X1N U;  8EST E;  1KXF A;  1ZJK A;  1SOT A;  2KI7 B;  1EJN A;  3RM2 H;  2ALP A;  3SU5 A;  1C2D A;  2PSY A;  3ZIA D;  2P2U A;  4N3Y B;  1FN6 A;  3Q76 A;  3RXM A;  3F2H A;  3UOU A;  3ZYE A;  3RK3 E;  3TGK E;  1N86 A;  3P8C D;  2XYA A;  2Y5F A;  3M0A A;  1KYO D;  1AWF H;  1BGY G;  2JH5 D;  1E34 B;  2STA E;  5GPI B;  5DP4 A;  2W27 A;  1H8D H;  3PRO A;  1A3E H;  1J8A A;  2G8Y A;  2P10 A;  3RXT A;  1KFN A;  1A02 F;  4GUX A;  1ZZZ A;  3BTM E;  1N7L A;  2W83 C;  1W3C A;  2ASU B;  3D6Z A;  1VL2 A;  3SWY A;  4DZO A;  1HGZ A;  3HD7 B;  1ZV8 A;  1SGD E;  1JY2 P;  1Z6J H;  2Y7Z A;  2W6B A;  3FKS D;  2M5T A;  4I8K A;  2C8Y B;  1NKN A;  3KYQ A;  3M9B A;  2OCV B;  2F3C E;  3MO6 A;  1SQB E;  5DK1 A;  3HUS B;  2KUB A;  1SGN E;  2Y0D A;  2BHG A;  1DLK B;  4OS1 A;  3TIU A;  2ZDM A;  2IOT A;  3MHW U;  3FGA D;  1P3C A;  1JY3 P;  4DT0 A;  2XRC A;  3OTP A;  2C9L Y;  3ZZ8 A;  2ZEB A;  4Y7A A;  3O8R A;  1SGQ E;  3WUV A;  3EQ0 H;  3PP5 A;  2E74 D;  1MMJ N;  3BTK E;  5HYO A;  2XWB I;  3S4R A;  4ASW A;  2A2X H;  2AMD A;  2WQY C;  1K05 A;  1P2K A;  1THS H;  3MYW A;  1CGJ E;  3F6U H;  1BTU A;  3ZV8 A;  1SG8 B;  2H8P D;  3T25 A;  4HTC H;  1GBK A;  2RFK C;  4ZKU A;  3M91 A;  3MD0 A;  4IL6 E;  1PQA A;  1PP9 G;  3M0D A;  1EB2 A;  2BLW A;  1OYT H;  1GDN A;  2FLB H;  5HGG A;  1SGI B;  3O6Q A;  3RL0 g;  1SR5 C;  4DT7 B;  1KYO I;  2GUV A;  5E0H A;  1VCP A;  4GLY A;  4XBD A;  2KZI A;  1YTZ T;  4M3L A;  2V0B A;  3L37 A;  1W5C E;  3S0N A;  1THP B;  2F9N A;  2WYJ A;  3TU7 H;  4AG2 A;  1AHT H;  4X6N A;  2AXT E;  1NFY A;  1AUT C;  1T2K D;  2IBZ I;  3LH1 A;  2BQW B;  3ZVE A;  1Q2N A;  1WTH D;  2WIN I;  4NIV A;  3CC4 P;  3GCN A;  1NU1 K;  3M3T A;  4H4F A;  2BOH B;  2OYI B;  1KMI Z;  4ZHM U;  1RE3 C;  3ZZB A;  4BAN B;  1SGC A;  5JBA S;  4BOH A;  1SQQ K;  1BE3 J;  1GI5 A;  1FDO A;  1QJ6 B;  2AHM E;  1A3B H;  2O01 H;  1MTU A;  1C1U H;  2H9T H;  4B2A A;  1C4U 2;  2WPD D;  2V6N A;  4UFF H;  2UUK B;  3OYP A;  3ZVA A;  5AVY B;  1ZW0 A;  4UEH H;  4E7R G;  1EDI A;  3H09 A;  3GIS B;  3KCG H;  3V0X A;  1C2E A;  1DWD H;  1JXP A;  1L0Z A;  4HH2 A;  4KHX A;  4GKG A;  3GHG A;  1VIT G;  3H1J J;  1BE3 D;  2TPI Z;  3AW1 A;  3SOS A;  1MTN B;  2HAL A;  3P8F A;  2BLV A;  1EZV D;  5IK2 D;  3MP7 B;  2V4H A;  1UVU H;  2QY0 B;  2V3M A;  4NCY A;  1GHB G;  1KB9 I;  2A4R A;  2FOC A;  4ABB A;  2WSC J;  1BZX E;  3AK5 A;  1NES E;  1NC6 A;  1Y3Y A;  1QIX B;  2W6I D;  2D2C B;  3H1J D;  2O8M A;  1LTA C;  1NTM G;  1YP9 A;  3B5N B;  2W26 A;  4ABE A;  5AW5 B;  1GJ9 B;  1OX1 A;  1D6W A;  4Z6A H;  5AW1 B;  3FP7 E;  1OWH A;  1TLD A;  3MOC A;  4AQR D;  1CA0 C;  2VIN A;  4ISH H;  2VWL A;  3L72 E;  1FDI A;  4XA4 A;  1ANB A;  1TAW A;  2JET C;  2Y6T A;  2P1J A;  4ABF A;  2ZIQ H;  5TJH A;  3SWF A;  5AW4 B;  5A8Y A;  5EQR A;  4K1S A;  1NU1 G;  1KC8 Q;  1BCC G;  1TE0 A;  4BTI B;  2JDI D;  3NKK A;  4OS7 A;  3V13 A;  5E2P A;  1V2R T;  3EGK H;  1SQQ G;  1TA6 A;  3SYJ A;  1O3E A;  1SQV J;  3VB3 A;  2KK7 A;  4VGC B;  3G4S P;  1VPC A;  1MCT A;  1QLE D;  1GHV H;  1RJX B;  1WQV H;  3LKW A;  1NTZ E;  4PV1 B;  3D23 A;  2JWD A;  1ZGV A;  3E90 B;  1EDK A;  4DOQ A;  1HJ0 A;  1DM4 B;  2EC9 H;  3M35 A;  3ODD A;  4OS5 A;  4RKO B;  1GHA F;  4Q4L A;  4RKU J;  3SJK A;  1CSO E;  4TY7 A;  2KAI B;  1SQV D;  1O0D H;  3MZW B;  3WU2 E;  4NFE A;  1YJ9 P;  3E0P B;  5HMA A;  2NWN A;  2PFE A;  4ZRO A;  3MU4 A;  2H1U A;  6GCH F;  1A0H B;  4YES B;  1S6F A;  5DP9 A;  2XOK D;  2A5K A;  1R8E A;  1O39 A;  4C7N A;  2ZG0 H;  2R3C A;  1GBI A;  3EQ2 A;  5JDU B;  4Y8X A;  3ITK A;  3BTF E;  1KXE A;  2W7S A;  2ZGB H;  3M7Q A;  2PRR A;  1ANE A;  4Y0Z E;  1VIT H;  1V2V T;  3MU8 A;  2XND H;  3PTB A;  1L0L K;  4JZF H;  1N1L A;  3AEC C;  2E43 A;  4PD4 H;  5F53 A;  3RLY H;  1S9K E;  2KLU A;  5FPT A;  1FZC B;  1VQK P;  1AB9 B;  2KB7 P;  1IFD A;  4HKZ H;  1QL1 A;  3LU9 B;  5IYT A;  1UCY E;  3RLW H;  4NPD A;  1W0J D;  4YOG A;  3VG8 A;  3I55 P;  1KXB A;  3B8J A;  2A32 A;  5KLV E;  3EA9 A;  4RJT A;  3D62 A;  3N7D A;  3LIE A;  1N7S A;  4B2C A;  1PPJ G;  3CX5 H;  2GD4 B;  1JMO H;  1HJA B;  1L4D A;  4XDE A;  3WMM 0;  5F6M A;  3PWC A;  2PV9 B;  2JH6 D;  5CJ4 A;  1C5T A;  1Q2W A;  4O9V A;  2Y5G A;  3F0P A;  2Y0C A;  5AVT B;  3H7O A;  5C20 A;  2VWN A;  3HKI B;  4X8S H;  4PRO A;  1TX7 A;  2FY8 A;  5CCH A;  1RF1 C;  2PGQ B;  3SV8 A;  1W7G H;  1LPG B;  1RFN A;  5FXL A;  2E74 B;  1T3U A;  1YJN P;  2CXV A;  4UON A;  2P3T B;  2Z3C A;  1PV3 A;  1XXF A;  2RG3 A;  3E0N B;  3OTJ E;  1ETS H;  1YCP M;  1N8O B;  1GCT B;  4Y0Y E;  2GX4 A;  2ZU5 A;  1SMF E;  2R32 A;  3EFF K;  4JYB A;  2Z3E A;  1P05 A;  4K1E A;  5FHT A;  5LH8 A;  3U1C A;  5GTH H;  1QZ8 A;  3BIU H;  1SGE E;  1FIZ A;  3SOR A;  1NYH A;  2AEM A;  3FXD A;  1QVG O;  1MAY A;  4FUG A;  4FVD A;  4WME A;  1F7Z A;  4OVN F;  3G6E P;  2CJI A;  4JCN A;  3CCJ P;  5KJ7 A;  1P2Q A;  3B4S A;  2BYA X;  3KL6 A;  4WH6 A;  2J94 A;  4X1R U;  3CXH I;  1Z6E A;  1D9I A;  1GBH A;  1AUJ A;  1V2J T;  3H1K J;  2TGA A;  4AN7 A;  2ZWL H;  3M3V A;  4X6P A;  3A2A A;  2I6Q A;  4Q7X A;  3UNS A;  3Q3X A;  5DN6 D;  1HRT H;  2HPC B;  1P8V C;  1R5S A;  1NOH A;  2BVS H;  2CV3 A;  1KXD A;  4JYU H;  4TT3 H;  1SOZ A;  3PRB A;  1HAP H;  2M5A B;  3L3T A;  3V3M A;  5CMX H;  3GY7 A;  1JTH A;  3LGT A;  3H1K D;  5L6N H;  2VIQ A;  3NRL A;  3LOX A;  4B74 A;  2Z5H A;  4Y76 A;  1BDA A;  2RDL A;  2KSJ A;  2DE8 A;  3KHV A;  3UFA A;  3SNE A;  3K5B A;  2BEQ D;  1TNH A;  3CWB J;  1GI1 A;  1C2I A;  2BEZ F;  2OUA A;  1LGH B;  3L74 E;  3U98 H;  2GTB A;  4UB8 H;  5L2Y H;  4TPI Z;  4WY3 A;  3A8B A;  3A0H E;  4HZH A;  3BCC E;  2L5G B;  2O01 N;  1KIL E;  2GV7 A;  2IJO B;  2R2M B;  4DVA U;  2Z9I A;  3SN8 A;  4CH2 B;  3M5M A;  5APY A;  4WBA A;  2VVC A;  3CWB D;  4GAW A;  3ATL A;  2IPQ X;  4I7Y H;  1Y5U T;  1MFZ A;  2YXQ B;  2K3R A;  5GND A;  3H1I J;  5AW8 B;  4H0L B;  1GI2 A;  1O2P A;  1A0L A;  3T26 A;  4INH A;  3BSQ A;  4JK6 A;  2K9J B;  4U7J A;  1VQL P;  1O5B B;  3LGV A;  1NTK J;  3RU4 D;  3EAJ A;  5APW A;  1H4W A;  3GCT G;  1FZF A;  1H9H E;  2VWM A;  1YYY 1;  1GHZ A;  1KDQ A;  1NRO H;  3RXD A;  1C5V A;  2QA9 E;  1L0N E;  3H1I D;  1ANC A;  1DOJ A;  5T3H A;  3W95 A;  4AG1 A;  4AZ2 B;  1XTC C;  2HVY B;  2AFQ B;  1SC8 U;  3CC7 P;  2ZTX A;  3QLP H;  1NTK D;  1RD3 B;  2P3F H;  3HKJ B;  3RMO H;  4SGA E;  2VNT A;  1PL5 A;  4D6T G;  2XC4 A;  2ZXX A;  4NA8 A;  1RF0 A;  5JYI A;  3GCO A;  3I29 A;  1EB1 H;  1C1S A;  2BCC D;  1PPE E;  1HGT H;  3SV2 H;  1PPZ A;  2FYU E;  1DUA A;  2B87 B;  4GOF A;  6EST A;  3S7H B;  3D6Y A;  2H88 C;  1FY3 A;  1HVV A;  4LGD E;  3SGA E;  3NZI A;  1GW3 A;  4F4O C;  5H2F E;  2HG5 D;  3KQ5 A;  2XBX A;  4K3A A;  3SFD C;  4YLQ H;  1EXF A;  4Y11 E;  3TK1 A;  4AFZ A;  3ZZ3 A;  1URQ A;  1J16 A;  4B1T A;  3K6Z A;  1VCW A;  4JQ0 D;  3EE0 B;  1JOC A;  4ASH A;  3TGU J;  2K1Q A;  2ZA5 A;  1IQH A;  1NRR H;  2KCY A;  5ESB A;  1K1P A;  3A0B E;  2FTM A;  4RT0 A;  1NKZ B;  3MIW A;  1VQ9 P;  1NTP A;  2HPP H;  1XUI A;  2J4I A;  1LHG H;  4DUR A;  2IPH A;  1BCU H;  3TGU D;  1HDT H;  1OP2 A;  4F49 A;  1DE7 H;  3CEN A;  3M9H A;  4B6E A;  1SQP G;  1XMN B;  1G2C B;  1KY9 A;  5E0G A;  1Y5B T;  1BRA A;  1K73 Q;  4WWY A;  1EQ7 A;  2GUS A;  3Q3D A;  1EDJ A;  2BY7 X;  3LIW A;  4JZ1 A;  3H32 B;  1GHW H;  1C5X B;  1NTZ K;  1DD3 A;  2F9V A;  1L4Z A;  1BGY E;  2OTL P;  1M8O B;  2YMS B;  3D49 H;  2A06 G;  4UB6 H;  3HD7 C;  2BD8 A;  1OFC X;  2UWL A;  3STJ A;  2QEX P;  4XE4 A;  1DST A;  3RK3 C;  1EC5 A;  4I1L A;  2GCT B;  3FX0 A;  1O30 A;  1O3F A;  2Y9Z A;  2JET B;  1QR3 E;  2PKA B;  1OWI A;  3A88 A;  1KQL A;  1PGQ A;  1HUC A;  5AW9 B;  3CCR P;  1QTF A;  4I2L C;  1QGF A;  1VQO P;  4EYY Q;  2WSE J;  3UQO A;  2AEF A;  3ZVC A;  4DW2 U;  1HF9 A;  2PR3 A;  1GBF A;  1L0L J;  1BTW A;  1YCP H;  2ZU2 A;  1GHB F;  3F2G A;  2W8Z A;  1O2Q A;  1P84 H;  1TWX B;  1R5L A;  1UCY K;  1YWU A;  4Y7B A;  2FOB A;  4D9Q A;  1MTS A;  1IFJ A;  2ZFR H;  2C8W B;  1MFT A;  2O1K A;  3L70 G;  3W68 A;  1LVY A;  1L0L D;  2PHB A;  1MD7 A;  3ZVD A;  1O3L A;  1G1J A;  4LC1 A;  4OS4 A;  1GDT A;  4P02 A;  3RUO A;  1ARB A;  1LWU C;  1HAX B;  4Y79 A;  4L76 A;  4MN4 C;  1MBM A;  1O2M A;  1Y3X A;  4E06 H;  3RC6 A;  2PGB B;  3PO1 C;  1IQL A;  3KQC A;  4WVP E;  1PJP A;  5A8Z A;  4N6J A;  1TB6 H;  4LK4 A;  4JZE H;  1GVK B;  2ZDV H;  1TGB A;  5AW0 B;  3LJJ A;  2F9O A;  4B76 A;  4E7N A;  1ESA A;  1RS0 A;  2NU4 E;  2TIO A;  4XFQ A;  5DP8 A;  1C9T A;  1GI9 B;  4RI0 A;  1ORF A;  1K0H A;  4XE5 B;  4ZKP A;  3CS7 A;  4NA9 H;  2Y81 A;  2I1J A;  2UWP A;  3RGU A;  1OSS A;  1HGV A;  2QJK C;  3U1I B;  2HOD B;  1NZQ H;  2QN5 T;  1O2K A;  3SNC A;  1AQT A;  3SU3 A;  1P9U A;  3S9B A;  2Q1J A;  1OOK B;  2WPI S;  4LOY H;  5EU8 A;  1S3J A;  2FOM B;  4EIJ A;  4ASU D;  3CC2 P;  3I5C A;  2TBS A;  1SLW B;  1GL2 A;  1UK3 A;  3RK3 D;  1RF1 B;  2R0L A;  1NRN H;  3P32 A;  3U28 C;  2BD3 A;  1CGH A;  2PWX A;  2VIO A;  1A5I A;  2B88 A;  1QBV H;  4GVU A;  3T2N A;  2ZCH P;  1BJU A;  1SGY E;  1PQ7 A;  1Q31 A;  2J2U A;  3TH4 H;  4AGJ A;  2KS1 A;  2F9P A;  3A7Y A;  2ANK H;  2D2C C;  3C1K A;  3R2P A;  1GHA G;  3BEF B;  3NFQ A;  3A81 A;  3LGW A;  2OXS A;  1O2U A;  1JM0 A;  3S9C A;  1KTS B;  2Z9K A;  3KN2 A;  4ISL A;  5JBB S;  2ZHQ H;  3CX5 E;  2BXU H;  3A80 A;  4A5T S;  1TMB H;  1C2J A;  1YC0 A;  2RA0 A;  1SQB D;  4ISN A;  2ZDN A;  2IYP A;  3CCS P;  1IQF A;  1FPC H;  2SGF E;  2ZGX H;  4B2B A;  2W6J D;  3IF4 A;  3GS9 A;  1SQT A;  4VGC C;  2PP6 A;  5E79 E;  3A7X A;  1C1M A;  5GWZ A;  2WIT A;  1PPF E;  1VQP P;  2ITA A;  1OZH A;  1T8Z A;  3K9X B;  1S5L H;  3QWC H;  1U7M A;  1FX0 B;  1ETT H;  2A2Q H;  1DEB A;  1KYO H;  1BB0 B;  1LO6 A;  3D65 E;  5DGJ A;  5E2O A;  1TMT H;  5LPR A;  4U32 A;  3ZZ6 A;  1QA0 A;  3Q1M A;  4LXB H;  2FZZ A;  4I7Z B;  2QXG A;  5KTB A;  4ASV A;  2GGV B;  4M9F A;  1M57 D;  4W80 A;  2P59 A;  1O2H A;  1V2U T;  1FAX A;  1F5K U;  4JMY A;  2BD4 A;  1E79 H;  1YLC A;  1G2M A;  2OYO A;  2C90 B;  3UNR A;  1BE3 G;  1AFQ B;  1BJV A;  4ZHL U;  2EEK A;  1DEE G;  1PZQ A;  1RXP A;  2PUX B;  1ZMN A;  1C2G A;  1YPH E;  4MNX A;  1AVG H;  1MZ9 A;  3A86 A;  3QGJ A;  2JWA A;  2KYV A;  1AB9 C;  2OC1 A;  1YQ4 C;  2BTC E;  2FI4 E;  3F9G A;  1GBJ A;  1H9I E;  4UFG H;  3IWM A;  2BAS A;  3H1J G;  2ZF0 H;  1WRG A;  1H8A A;  3EWK A;  2BD7 A;  2O8T A;  4NFF A;  2ZNK H;  2J34 A;  4BRY A;  1DY8 A;  1KB9 H;  1PFX C;  2R5B A;  3PV5 A;  3MU5 A;  1AWH B;  3GOV B;  1C2K A;  2BOK A;  4FUE A;  2D2C D;  2NZ2 A;  4L73 A;  3TNU B;  4WWI A;  1P0S H;  5EIY A;  3MHV A;  3ENS B;  4W7Z A;  1UTK A;  4AC9 A;  3NXS A;  3VTP C;  2C9N Y;  2PFX A;  1KQG B;  5A0B A;  4UB8 E;  3RDZ A;  3M9Q A;  3UIR A;  2Y80 A;  3V4Q A;  3FN8 A;  2Q7C A;  1KLJ H;  2E74 C;  3A5T A;  1Y9B A;  5GCH G;  4NIW A;  1GI8 B;  2BVR H;  4D7F A;  1X0T A;  5EFW B;  1UMA H;  3GW6 A;  1GCT C;  4RKJ B;  2WSS D;  5KAI H;  1B5G H;  1UHB A;  1LHE H;  1NU9 A;  1HLT H;  1TBQ H;  1WU1 A;  3RXJ A;  1NFW A;  2UUF B;  4R8T B;  3HE4 A;  1SQV G;  1TNG A;  5EGM A;  2QF5 A;  4HI3 A;  4I32 A;  1RE4 A;  1G3C A;  1AA0 A;  1MZA A;  3EE7 A;  5C5O A;  4CRE A;  3MTU E;  3HGP A;  1NTZ J;  2AGI X;  2ZKS A;  1AY6 H;  2WZ7 A;  1B0F A;  1IZN B;  4Q63 A;  1UW7 A;  2OBQ A;  3LC3 A;  4ZKO U;  3M61 U;  5TIS H;  5A2M H;  1BRU P;  4YOJ A;  3H1L E;  1P04 A;  3KXD A;  2JJ1 D;  3UWI A;  4I8H A;  1DWE H;  1JCD A;  4X1Q U;  2KNC B;  4ZMA H;  2OYH B;  1NTZ D;  4D9R A;  3GY5 A;  4RES B;  5AVS B;  2GJG A;  3MH4 A;  4Z1M D;  1P57 B;  1MAB B;  2FFD A;  1ZPZ A;  3K65 B;  3VOP A;  3GY6 A;  1HIA A;  2NRG A;  4AYC A;  2QGR A;  1EZX C;  3BTG E;  4KT0 J;  9LPR A;  3U1J B;  2GDE H;  4FUF A;  2J95 A;  5AHG H;  2FTL E;  3RXR A;  1T6A A;  2GA1 A;  2WSC H;  2D1J A;  1D4P B;  1ZLR A;  3SUF A;  2N1T B;  1FZA A;  5B66 H;  2LP6 A;  1BTP A;  1FIW A;  2ILN A;  3C8V A;  5K0H A;  1LT9 C;  1GGD C;  5AW7 B;  3KHU A;  2XTT B;  2ZHE H;  5DP5 A;  5KLV J;  1FOS F;  4KEL A;  1UTL M;  2BDY A;  2JDI H;  3RK3 B;  4U3F E;  3C27 B;  2QYI A;  1S9K D;  1AVY A;  1D3P B;  1AFO A;  1C5N H;  1H8I H;  2BDA A;  1BBR K;  5T1V A;  3D70 A;  3ZYD A;  2J98 B;  4CRB A;  3A3Y B;  3Q2Y A;  1OS8 A;  1W0Z U;  3M7T A;  3PMJ A;  2ZCK P;  2WV5 A;  1P2M A;  4H0L C;  2JO1 A;  3L71 E;  3RK2 C;  3AEE C;  5KLV D;  1QX8 A;  2XNI A;  4Q80 A;  3M3S A;  1M1J A;  4Q7Z A;  1ELE E;  1KIL C;  1D3D B;  3BTQ E;  2OTV A;  5HKK D;  2MKV A;  4Y71 A;  1HJ8 A;  2CF8 H;  3JCU H;  3L6P A;  3AE8 C;  5K5G B;  3DA9 B;  3MNX A;  1BSN A;  3PH0 A;  6CHA C;  4WY4 A;  2XWA A;  1A1R A;  3ZZC A;  1SL3 A;  2ANY A;  1NFU A;  1ZRB A;  4F48 B;  1SFC C;  1L1N A;  4UB6 E;  1UTN A;  1ZGI A;  3FOA A;  7LPR A;  4B75 A;  1OX3 A;  4JYC A;  1D3Q B;  1LWU B;  1YBK A;  4DJG A;  3W94 A;  1ELG A;  5CCG C;  2FLR H;  1BDD A;  5AF9 H;  2P67 A;  3ZDM A;  1BOQ A;  3CXH H;  3G9R A;  3M7U A;  3H1K G;  1GWA A;  3QN7 A;  3UR6 A;  1A4W H;  1NTK K;  1S4X A;  5KAF H;  1P06 A;  1RH5 B;  2CF9 H;  1DIP A;  1Y47 A;  2PLX A;  2Y0E A;  1C2M A;  2FM2 A;  1PPH E;  2BXT H;  1F0T A;  4FUI A;  1TYN A;  5GDS H;  1O32 A;  5JPM H;  4RO0 A;  2CHA C;  5EW2 H;  1W2K H;  1J17 T;  2NPS C;  1BTZ A;  2JH0 D;  1NRQ H;  1P84 E;  1RY3 A;  3RL0 C;  3M06 A;  4SGB E;  5KEC A;  5KKZ C;  3P17 H;  1S72 P;  3GYM A;  4CRD A;  1HTL C;  1X79 B;  2QJK B;  5T6G A;  3B23 B;  2H9E H;  1PPC E;  2ODQ A;  3GY2 A;  1OVU A;  3UWJ H;  3WW7 A;  3U8O H;  3CWB G;  1MD8 A;  4AB8 A;  1IQG A;  1OWK A;  5GTI H;  4NIX A;  1RTF B;  1TQ7 B;  4MPU A;  1CA8 B;  2BDG A;  1LTJ C;  2PKS C;  3KZI E;  3L74 J;  1EAW A;  2HWL B;  1EP6 A;  2G3A A;  1WTG H;  2H6M A;  1N73 C;  2OP9 A;  2GCH G;  5FX6 A;  2ZYD A;  2EST E;  1LTT C;  1AI8 H;  3A8D A;  3SU4 A;  7GCH G;  1FAV A;  1G1I A;  3BCC J;  1ELF A;  3T29 A;  1SQP E;  3HTK A;  1QL8 A;  4MPX A;  3RXQ A;  5LPF A;  1HAZ B;  2IFN A;  4K35 A;  4D76 A;  3H1I G;  4YO9 A;  4H0L D;  3RK2 D;  3L74 D;  1PYT C;  5FBI A;  3VFE A;  2ZFS A;  3PMH B;  1EUF A;  4YXW H;  1IQE A;  3GDV A;  5E0J A;  1TBZ H;  3TK5 A;  4DJZ B;  2YMS C;  1ID5 H;  2ZU3 A;  1NTK G;  3BCC D;  2M3B A;  1K22 H;  1OP0 A;  1KIL D;  4IFD K;  4GHT A;  3GCH C;  2GCT C;  3L75 G;  1MZD A;  1E5W A;  1IO4 A;  1XVM A;  1L1J A;  2AER H;  2O9Q A;  2B89 A;  4OGQ C;  1FQ3 A;  5JBC S;  1L0N J;  1UJ1 A;  4ABI A;  4BAH B;  2GM4 A;  1OYQ A;  2AH4 X;  2WUB A;  5AFZ H;  2W3I A;  3A7O A;  5BU8 B;  1SFC D;  4ISI H;  2RDE A;  2QA4 P;  2YO2 A;  2HNT F;  3RXI A;  3TDK A;  2M2A A;  1EPT A;  1F0U A;  4RSP A;  3PYH A;  1MKW K;  1L0N D;  1WDI A;  1K1N A;  5CCG D;  3A7Z A;  4NSV A;  1VQ4 P;  5JB8 S;  4PJ0 H;  1YPG H;  1JEK A;  3E16 B;  2FYU J;  1FON A;  1Q81 Q;  1O37 A;  2XDJ A;  2G5V A;  3VEQ B;  1IFM A;  2B9B A;  2YIU C;  4GHQ A;  1N6X A;  4P00 A;  3Q3K A;  1WSS H;  3OAA D;  1EZV I;  3A87 A;  3LON A;  3KQB A;  2BD5 A;  1P03 A;  1UTP A;  3K2U A;  4UE7 H;  3SU2 A;  2NPS D;  4ABJ A;  2FXR A;  2FIR H;  2H5D A;  2FYU D;  1OW8 A;  1QL2 A;  3RL0 D;  3EA8 A;  3RBZ A;  1CVW H;  1L4A D;  5ETX A;  3TGU G;  2JEE A;  1AD8 H;  3TJU A;  2C4F H;  3URD A;  2Q6F A;  1GVZ A;  4C7R A;  2FI5 E;  2GV6 A;  4IC6 A;  2XBV A;  4HFP B;  5EXM A;  2TGD A;  1HBW A;  3AAS A;  1L2E A;  1NVO A;  1NY2 2;  1O3B A;  4LZ4 B;  1MH0 A;  2O8L A;  2LKM A;  4H44 C;  1GBT A;  1O3C A;  1Q7Y Q;  2ZFF H;  4H13 C;  2A0Q B;  1ZR2 A;  1IFN A;  2ZDK A;  1VCQ A;  3A8C A;  3G01 A;  1KQS O;  2ZQ2 A;  3VXF H;  5AVQ B;  2IJD 1;  1IQN A;  5LPE A;  3UUZ A;  2NU1 E;  3H1H E;  4IFM A;  1H0T A;  3FWL A;  4X1P U;  4CRG A;  2LEL A;  3MH5 A;  4ZMD A;  3GF3 A;  2CPB A;  2XKM A;  5C17 A;  1PYT D;  2WPV B;  4NZL A;  1Y8T A;  8GCH G;  3OFN D;  1TRN A;  2IBZ E;  3TF5 A;  3E1X B;  3U1A A;  3PLK A;  4DCK A;  1SP4 A;  5CE1 A;  5KED A;  5APS A;  1EJM A;  2OTJ P;  1V2L T;  1O5F H;  2I6S A;  1EQ9 A;  2KCA A;  1VZQ H;  2YMS D;  2W7U A;  3LJO A;  1QGK B;  1UTJ A;  4R0I A;  2Z6B D;  1A61 H;  5EXN A;  3O8C A;  5GIB A;  3EDX B;  1O2J A;  2R2W U;  5CMZ A;  4OGQ D;  1O3K A;  4NSY A;  2O01 J;  4FOU C;  5CHA C;  1CHO F;  1GBB A;  2O3J A;  2E75 B;  1TNL A;  2XXL A;  1BGY D;  4CRC A;  3CCE P;  1OXG A;  1AVO A;  3CCM P;  1NJI Q;  2BM2 A;  2OC8 A;  3FP8 E;  4WXV A;  5J4Q A;  4AFQ A;  2JP3 A;  4CHA C;  2O8U A;  3UIA A;  2WZQ A;  1TMU H;  1L0L G;  4Y99 C;  3SND A;  5J4S A;  1BHX B;  4MPV A;  2B0F A;  2K9Y A;  2H2Z A;  1KB9 E;  2RKL A;  3AE2 C;  1USD A;  4AUW A;  3ZZD A;  4I8L A;  1A5H A;  4YT7 H;  1AJY A;  1RIW C;  2KLV A;  1O2Y A;  3AE3 C;  2XZR A;  2Q3I A;  2RH0 A;  1NRP H;  4GPG A;  2N9Y B;  1HJ9 A;  1DUE A;  4J1Y A;  3LGY A;  4YPC A;  2QC2 A;  1O36 A;  1TOM H;  2ZGH A;  3L33 A;  3OJA B;  4O9B A;  1ZSL A;  3BTT E;  2UWJ E;  3FAN A;  1AFE H;  2FO9 A;  2BZA A;  1SQB K;  5GCH F;  3ZVG A;  1C5R A;  2QF3 A;  2PTN A;  2B5T B;  3PTN A;  1UTO A;  3GIC B;  3WUU A;  1KXA A;  2R3Y A;  2ZYG A;  4I33 A;  5DP7 A;  5KAI E;  1X8Y A;  3ELA H;  4I7Z C;  3ABV C;  1FPH H;  3H7T A;  3RMM H;  2E42 A;  3PV2 A;  4H44 D;  1MCV A;  1ELA A;  2NU0 E;  2ZU4 A;  2SGE E;  8KME 2;  2QG4 A;  3T97 B;  4H13 D;  2CMY A;  1ZR4 A;  1J2J B;  1J9C H;  3L36 A;  1O3D A;  3VB5 A;  1BMN H;  1TRY A;  1N8R Q;  3UNQ A;  1LT9 B;  3HD7 A;  1GGD B;  1QHR B;  1SGF G;  1YQ3 C;  4IW4 E;  1AFQ C;  4Y28 J;  2L74 A;  4Y8Z A;  2EQN A;  5HIY A;  1FI8 A;  4OGX A;  5TIS E;  2A4Q A;  2FOE A;  1AKS B;  3HK6 B;  1JO5 A;  3HUS A;  2AMP A;  1Z1I A;  1RQV A;  3RK2 B;  2BD9 A;  3TH3 H;  2OGU A;  7KME H;  1NRS H;  2IX7 C;  1GD2 E;  1G36 A;  4BTT B;  1SI5 H;  4IMQ A;  2WSE H;  3SW2 B;  1KIL B;  1S83 A;  1YPH C;  1PPB H;  2D8W A;  4BAK B;  1ELB A;  4FUD A;  2BCC J;  1FC2 C;  2BDH A;  1ARC A;  1BIO A;  1FY5 A;  2OLG A;  3N99 A;  4FU9 A;  3T5F H;  6CHA B;  1V2P T;  1W12 U;  2Q6Q A;  4BXS A;  1WT6 A;  4I8G A;  3V2N A;  1SFC B;  3A7T A;  1A2C H;  3A82 A;  1TAB E;  2ZI2 H;  3RXV A;  5AVW B;  1OWA A;  1W2B O;  1LKA A;  1N7S C;  1OWE A;  2KZJ A;  1GJ8 B;  1K1L A;  1CO7 E;  1XUK A;  3HE5 B;  1QVF O;  1MKX K;  4GCH G;  4R4L A;  1HAI H;  3DSO A;  3TVJ B;  1PGO A;  3CX5 D;  3V6I A;  1TGN A;  2CHA B;  5AVZ B;  2W90 A;  1HAG E;  2STB E;  3L73 E;  2NPS B;  1S6L A;  1ETR H;  3KGP A;  4IMZ A;  4X0W U;  1GJ6 A;  5CCH C;  1M7L A;  3RL0 B;  1J14 A;  2OYI A;  1JRT A;  1IFI A;  1P2O A;  5C2Z A;  2J5U A;  1L4A B;  1CI6 B;  4B86 A;  5KKZ B;  3BTW E;  2JJ2 D;  3P70 B;  1LCY A;  3O8D A;  2P58 A;  2QVA A;  1DH3 A;  2B7D H;  3IFM A;  3S7K B;  3ZZ5 A;  1VGC B;  1O3P B;  2K0Q A;  2OYH C;  4K8B A;  2C3S A;  2FOD A;  1OW7 A;  1HAY B;  2Q5U A;  1M56 D;  2W6A A;  1K8A Q;  4ZHA A;  1GI7 B;  1LTJ B;  3SUE A;  2P16 A;  2PKS B;  1SQX E;  2VGC B;  4MDS A;  1LTO A;  1IHS H;  2FXP A;  1N73 B;  4JF7 A;  3MFJ A;  4KKD A;  3CXH E;  1GJB B;  1AND A;  1ZSK A;  2ZFP H;  1X9V A;  3SNA A;  2WPQ A;  2Z9G A;  4INL A;  3GY4 A;  2E5T A;  1FZG A;  5DJT B;  1IQM A;  3F3B A;  2AIQ A;  4IC5 A;  3SI3 H;  1QFK H;  3F9E A;  1K28 D;  3RP2 A;  2DUC A;  5B6O A;  4NA7 A;  3ODF A;  1WXR A;  1ELD E;  3ATI A;  2FDA A;  1CU1 A;  2N1T C;  3TK6 A;  5C67 A;  1U57 A;  1XKA C;  2J38 A;  3B5N A;  4ZXX H;  4O3T A;  1FN8 A;  1S81 A;  5C5N A;  3SV9 A;  3JC2 2;  3V2Q A;  2WT7 B;  1KFM A;  3VXE H;  3GCH B;  2XBY A;  3KPE A;  1AN1 E;  1RQU A;  1SS1 A;  4BWN A;  1LQD B;  4OGQ B;  2HLO A;  3CD6 P;  2CK3 D;  2B9L A;  5FL7 D;  3IIT A;  1FE6 A;  1CT4 E;  1P9S A;  1QQ4 A;  1TNJ A;  2BY8 X;  2TGP Z;  3F0O A;  1K04 A;  4GDO A;  3C9I A;  2M8R A;  1KOR A;  1JMM A;  1FU1 A;  1VQ7 P;  4K5Z A;  1SHH B;  3U59 A;  5L2Z H;  1CBW C;  2GCH F;  1XKB C;  4FUH A;  3SI4 H;  4IL6 H;  4O97 A;  5LGO A;  2ZJS E;  3A83 A;  7GCH F;  1BMM H;  3PB1 E;  1QRW A;  3KQD A;  1PPG E;  2PTC E;  1N7S D;  5C39 A;  2A5A A;  1UIX A;  4NG9 H;  2KAI A;  5KLV K;  3TGI E;  4AB9 A;  1CGI E;  2YIU B;  2Y7X A;  3H25 A;  3QGN B;  4A1T A;  1IOE A;  1ZRK A;  5A0C A;  1VF5 C;  3V4W A;  1JWT A;  3ZV9 A;  3MNB A;  1HBT H;  2AXT H;  4U01 A;  1G2L A;  1PP9 E;  5CCH D;  1NTZ G;  3SZE A;  1EST A;  4NIY A;  1C1T A;  2YNA A;  5DPA A;  2WPH S;  1TQ0 B;  2V7Q H;  1LKB A;  3U8T H;  1O34 A;  1P2N A;  2YXR B;  1Q90 D;  5F03 A;  1K1J A;  1YI2 P;  1Y8A A;  2AEJ A;  3H1K E;  1F5L A;  2ZDL A;  3GDS A;  2C0W A;  3H1L J;  1FZC A;  5AVR B;  3BTH E;  4H44 B;  4NPF X;  1ELV A;  1O2S A;  3GDU A;  2K8I A;  4H13 B;  1RTK A;  3E91 A;  4PJ0 E;  1GHY H;  1BTX A;  4X2W A;  1QL7 A;  1TU3 F;  4YXD C;  1GHX H;  3QO6 A;  1K9M Q;  3ITI A;  3H1L D;  3PMA B;  5KJ7 D;  4X8T H;  4WB4 A;  2IDB A;  3S69 A;  2Y5H A;  1LMW B;  2VID A;  1Y3W A;  1Q3X A;  2YNY A;  1WQS A;  3F1S B;  3TSI A;  2N1T D;  1JUN A;  1TA2 A;  2QE7 D;  4U30 A;  4MNV A;  1BA8 B;  4LLH A;  1XM1 A;  5HM2 A;  1EZU C;  1GJ5 H;  3SGQ E;  3U69 H;  3BAS A;  3CWB E;  5KLV G;  2VVV A;  2DE9 A;  2WSS H;  1URQ C;  1K21 H;  1JNM A;  2KFW A;  3BV9 B;  3NK8 A;  4X1S U;  2XCN A;  2FMJ A;  3CCL P;  3PV4 A;  4U3F J;  2ZEC A;  7EST E;  1VJ9 U;  4PD4 E;  3VPK A;  5CHA B;  2A45 I;  1QB6 A;  3B9F H;  4XOJ A;  3ZZ7 A;  2WSF J;  1SQB J;  1HJB A;  2ZHF H;  4UDW H;  3L71 J;  1OIP A;  3CMA P;  1B0E A;  1NU7 B;  4M7G A;  3TNT A;  3UPE A;  4CHA B;  1O3H A;  2WPJ S;  1O5C B;  2P7J A;  4U3F D;  1WYK A;  4Y99 B;  1BRB E;  4TLF A; 
#chains in the Genus database with same CATH homology
 1LT9 C;  2OAR A;  3EQ2 A;  5AW7 B;  1FOS F;  3GHG B;  1GU5 A;  3RK3 B;  2Z4E A;  1HH0 A;  2JJL A;  5CHX A;  1S9K D;  1AFO A;  4DOJ A;  1L0L K;  3A3Y B;  2E43 A;  1S9K E;  2HPC A;  3RK2 C;  1FZC B;  2KB7 P;  1IFD A;  2KP8 A;  3HE4 B;  1M1J A;  1QL1 A;  3LID A;  1DX7 A;  1KIL C;  1NWQ A;  1GZL A;  3LIE A;  1N7S A;  1N2D C;  2XV5 A;  2XU6 A;  3WMM 0;  5KJ7 C;  1GK4 A;  3O8Z A;  1NH4 A;  1IK9 A;  1T3J A;  1JY2 N;  2HYN A;  5CJ4 A;  4WY4 A;  1IJD B;  2I1K A;  2WSF H;  5AVT B;  1L0N K;  1SFC C;  3BAT A;  1GK6 A;  3G3Z A;  5AW3 B;  5CCH A;  4JYC A;  1RF1 C;  1LWU B;  2YKQ A;  1JY3 N;  5CCG C;  2FFD B;  3N7N A;  2P67 A;  1T3U A;  1JY2 O;  1A02 J;  1NTK K;  2FYU K;  2R32 A;  4JYB A;  2NPS C;  3U1C A;  1URQ D;  4C7N B;  1KIL A;  1JY3 O;  1RY3 A;  2WPS A;  2N9B A;  3M06 A;  3RL0 C;  1HTL C;  1X79 B;  5KJ7 A;  1FBM A;  1GTW A;  3HUS C;  3NMD A;  3A2A A;  2HPC B;  1NOH A;  1LTJ C;  1M1J B;  5AW6 B;  1N73 C;  1JTH A;  1LTT C;  5CCG A;  2YKP A;  1FAV A;  1G1I A;  1YYC A;  1N7S B;  3HTK A;  2CPS A;  2Z5H A;  1J1D C;  1SQX K;  1ZN5 A;  4GIF A;  3BVH A;  2IFN A;  2KSJ A;  4WY4 B;  3RK2 D;  3VMZ A;  1H88 A;  1LTB C;  3VP9 A;  1LGH B;  2M3B A;  1KIL D;  1RF0 C;  3EFG A;  4IFD K;  1GW4 A;  5APV A;  1GL2 C;  1E5W A;  1RE3 A;  1IO4 A;  2L5G B;  2POH A;  3CL3 D;  4HYT B;  5APY A;  4WBA A;  2GM4 A;  2WWW A;  1MFZ A;  3A7O A;  5BU8 B;  1SFC D;  5AW8 B;  2YO2 A;  4N78 D;  3V2R A;  1G2C A;  5CCG D;  5APW A;  1NO4 A;  5CJ0 A;  2OYI C;  1FZF A;  4N78 E;  2XDJ A;  1J1E B;  3H32 A;  2J58 A;  1IFM A;  1XTC C;  1MUU A;  2NPS D;  3P7K A;  1QL2 A;  1RF0 A;  3RL0 D;  1XTG B;  3HD7 D;  1L4A D;  2JEE A;  5AVX B;  3LW5 H;  1JTH B;  4C7R A;  1IC2 A;  3HTK B;  1HBW A;  1CW5 A;  1FJK A;  1HVV A;  4LGD E;  1GU4 A;  3BRV B;  2LKM A;  1GW3 A;  1LTI C;  3VP8 A;  2HG5 D;  4EOT A;  3B5N C;  1ZR2 A;  3TK1 A;  1FJP A;  1IFN A;  1URQ A;  5AVQ B;  1JOC A;  1H89 A;  4IFM A;  5APX A;  2MJZ A;  3BRT B;  1HWT C;  3B8E B;  4C46 A;  2CPB A;  3CI9 A;  2XKM A;  1NKZ B;  3MIW A;  3T97 A;  3U1A A;  1SP4 A;  5APS A;  1LT9 A;  1NAF A;  3M9H A;  1GL2 D;  3HRN A;  3L35 A;  1G2C B;  2YKO A;  5CMZ A;  1EQ7 A;  2GUS A;  3H32 B;  1VDF A;  1NTZ K;  2R5D A;  1FDM A;  5BU5 A;  3UIA A;  4Y99 C;  3HD7 C;  1L4A C;  3RK3 C;  4I1L A;  4AUW A;  2HOD A;  3N4X A;  1SQV K;  3MGN A;  1AQ5 A;  1FZB A;  1NTM K;  2KLV A;  1FOS E;  2XZR A;  2Q3I A;  2Q9I A;  1KQL A;  2ZFC A;  1HUC A;  3MUD A;  5AW9 B;  1FZC C;  4I2L C;  1SFC A;  2FKW B;  3OJA B;  4O9B A;  4W7Y A;  2YO3 A;  1RE4 C;  1Z56 A;  2HFE D;  1SQB K;  1RF1 A;  3OA7 A;  1URQ B;  4I6M C;  3KDP B;  3II6 A;  3HE5 A;  1X8Y A;  1IFJ A;  4IFF A;  2E42 A;  2YMY A;  2O1K A;  1NHL A;  2IPP A;  1ZR4 A;  1J2J B;  3B5N D;  2NPS A;  3L36 A;  1G1J A;  4LC1 A;  3VMX A;  1GDT A;  3H6P A;  1LT9 B;  1LWU C;  3HD7 A;  1L4A A;  1CI6 A;  2FYZ A;  2FFD C;  1LTS C;  4N6J A;  4GT1 A;  1JO5 A;  3HUS A;  2VRS A;  5AW0 B;  3RK2 B;  3V5B A;  3VN0 A;  1LTJ A;  2Z5I A;  2IX7 C;  2QM8 A;  1KZU B;  1GD2 E;  2WSE H;  3TYY A;  1FZE A;  1N73 A;  1KIL B;  4XE5 B;  4ZKP A;  2I1J A;  1HGV A;  1OXZ A;  2HOD B;  2WTY A;  4OH8 B;  5AVU B;  2FXM A;  1WT6 A;  3V2N A;  4EIJ A;  1SFC B;  3I5C A;  2WT7 A;  1M1J C;  5APT A;  1T2K C;  5APQ A;  2ZXE B;  5AVW B;  1PFI A;  1GL2 A;  1OWA A;  3RK3 D;  1RF1 B;  3P32 A;  3E1I A;  1N7S C;  2P2U A;  4N3Y B;  2QM7 A;  3HE5 B;  1N86 A;  3P8C D;  4WY4 C;  3M0A A;  3R2P A;  3NFQ A;  2W27 A;  5BVZ A;  5AVZ B;  3P8C E;  1KFN A;  3M0D C;  2NPS B;  1A02 F;  1N7L A;  5CCH C;  1M7L A;  3RL0 B;  1HGZ A;  3SWY A;  3HD7 B;  1IFI A;  1ZV8 A;  4DZO A;  1JY2 P;  1L4A B;  2OYI A;  2W6B A;  1CI6 B;  1YTZ I;  5AW2 B;  4B86 A;  3L4F A;  1NKN A;  3KYQ A;  3TNU A;  3M9B A;  1DH3 A;  3IFM A;  3HUS B;  1CSB A;  1CZQ A;  2OYH C;  2Q5U A;  2PP6 A;  2WIT A;  1JY3 P;  2W6A A;  1T8Z A;  1LTJ B;  2C9L Y;  1DEB A;  3CLQ A;  2XNX A;  3PP5 A;  4JF7 A;  1N73 B;  1X9V A;  2WPQ A;  1J1E C;  3NTN A;  1FZG A;  3V2P A;  2H7H A;  1J1D B;  2H8P D;  5KTB A;  2KOG A;  2IFM A;  2N1T C;  4ZKU A;  3M91 A;  3MD0 A;  4W80 A;  3B5N A;  3M0D A;  3OAK A;  3GHG C;  3V2Q A;  1KFM A;  2A45 G;  2WT7 B;  3VMY A;  2H43 A;  1GL2 B;  2GUV A;  3KPE A;  5APU A;  1YTZ T;  2HLO A;  4M3L A;  3L37 A;  1MZ9 A;  1SVF A;  2KYV A;  3C9I A;  2OYH A;  2M8R A;  1JMM A;  1FU1 A;  2C0X A;  1T2K D;  3U59 A;  2BAS A;  3VYI A;  3KQG A;  1WRG A;  2O1J A;  1H8A A;  1NU1 K;  1N7S D;  2OYI B;  1RE3 C;  2R5B A;  1SQQ K;  2O01 H;  5KLV K;  4WY4 D;  3TNU B;  2PAJ A;  1W2E A;  1JCC A;  4W7Z A;  2N1T A;  5AVY B;  3V4W A;  3NXS A;  3VTP C;  2C9N Y;  4HH2 A;  3M9Q A;  4GKG A;  3GHG A;  4KHX A;  5CCH D;  3V4Q A;  2Q7C A;  2WPR A;  3A5T A;  2C0W A;  1FZC A;  5AVR B;  1LTA C;  1SLQ A;  3HE4 A;  1ZLL A;  1RE4 A;  3B5N B;  5AW5 B;  5AW1 B;  3MTU E;  1LTG C;  2WZ7 A;  4AQR D;  5KJ7 D;  4XA4 A;  2A45 H;  4WB4 A;  2P1J A;  3SWF A;  5AW4 B;  2YNY A;  1MV8 A;  3TSI A;  2N1T D;  1JUN A;  1JCD A;  3P8M C;  4LLH A;  2OYH B;  3BAS A;  4RES B;  1LWU A;  1VPC A;  5AVS B;  1URQ C;  1JNM A;  2FFD A;  3IR9 A;  3VOP A;  4AYC A;  2A45 I;  5AVV B;  1HJB A;  2WSC H;  2J59 M;  1SQP K;  2N1T B;  4Y99 B;  1FZA A;  2P7J A;  4C7N A;  2R3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...