2PP6A

Crystal structure of the atp-binding sugar transporter-like protein from salmonella typhimurium
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
88
Chain Sequence
SNAMADLFDGMKRRMDALIAERFGMKVNINGTDCIVVESDFLAGKNVVVFSGNVIPRRGDRVVLRGSEFTVTRIRRFNGKPQLTLEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ATP-binding sugar transporter-like protein from Salmonella typhimurium.
rcsb
source organism Salmonella typhimurium lt2
molecule tags Transport protein
molecule keywords Gifsy-2 prophage ATP-binding sugar transporter-like protein
total genus 18
structure length 88
sequence length 96
ec nomenclature
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13856 Gifsy-2 ATP-binding sugar transporter from pro-phage
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2pp6A01
2.40.10.210 Mainly Beta Beta Barrel Thrombin, subunit H Phage tail proteins (gpFII-like) 2pp6A02
1N7SA 3RL0C 3B5NC 4W7ZA 3VOPA 1GL2B 3RK2C 1GL2D 1SFCD 1L4AA 5KJ7D 1SFCB 1GL2A 2HG5D 3HD7C 1GL2C 3P8CE 3RK2B 2N1TB 3RK3D 4WY4C 1URQA 1SFCA 5CCGD 3B5NB 3RL0B 2NPSC 4N78E 2N1TA 3KYQA 1KILD 5CCHA 1URQC 4WY4A 1L4AC 1NHLA 5CCHC 1KILC 3HD7D 1JTHB 3RK3C 2H8PD 4WY4D 1N7SD 4JF7A 1N7SB 5CCGC 2PP6A 1URQB 2HFED 2KOGA 4W80A 3B5NA 2XDJA 2NPSA 4OH8B 3M0DC 1HVVA 1URQD 4W7YA 1JTHA 2WZ7A 1XTGB 2N1TC 3PP5A 1L4AB 2M8RA 1L4AD 2YMYA 3TSIA 3RL0D 1SFCC 5CCGA 1N7SC 5CCHD 2N1TD 3RK3B 1KILB 3HTKB 4WY4B 5KJ7C 3HD7B 3HD7A 3B5ND 2NPSD 1KILA 3RK2D 1T3JA 4LGDE 2NPSB 5KJ7A
chains in the Genus database with same CATH superfamily
4DJGA 1D4PB 5APYA 5C20A 3QTVH 3SGBE 2FXOA 2A5KA 1SQVE 3LW5J 3KCGH 2O8UA 3R2PA 3UIRA 1JOUB 1TBQH 2V0BA 3Q3YA 4NGAH 1R5LA 1FDPA 3KQCA 3MH4A 2Q6FA 1QQUA 1J1DB 4A1XA 1DWEH 2GCTB 3KIDU 5HIYA 4ZKSU 5ESBA 1K1NA 4NPDA 1QLED 2VVVA 1H9LB 1PPFE 4K1EA 2PGQB 2V3MA 3S9AA 1T4VH 5KEDA 4JZEH 3VG8A 5I46H 1HBTH 4NWLA 1EASA 4N78E 1BDCA 2G52A 2XBWA 2ZU1A 3ZVDA 2QAAA 5EG4A 3P8FA 1NH4A 8GCHG 2W27A 1GJ4H 4FUEA 3FX0A 4HKZH 4IGDA 4GT1A 4IL6X 2CHAC 2BY8X 1SGRE 2Y82A 4ABHA 3HE4A 1DXPA 2FESH 3UNQA 1BITA 4NFEA 1EKBB 4I1LA 3U1IB 3PM3A 2J98B 1S9KD 1O3MA 1CBWB 3BF6H 4D6TJ 3A7XA 1LVMA 2ZAEB 1O5DH 1O30A 2YMKA 4IFMA 3F9EA 1G9IE 3EQ2A 4ABAA 3G01A 1BGYE 2QJPB 1DSUA 5DK1A 1GCTB 3EE7A 1FZAA 1URQB 1GDQA 3H1KE 2W3IA 3MWIU 1Z8JB 1E38B 2B5TB 3QGJA 1KYOE 1E79H 1FBMA 4R8TB 4DURA 1HAIH 1YM0A 3UIAA 3A82A 1E1QD 1E35B 3AE3C 1E34B 4H13D 3SV7A 2OYHA 4GODA 3MU8A 2ZT9C 4X2VA 1VQLP 1OSSA 1KLJH 2VIQA 3K9XB 2OQUA 3ABVC 3HE5A 5K7RA 1YHQP 1G30B 4VGCC 2A45H 2I8DA 2N1TC 1K8AQ 4BAKB 1GI5A 1GJBB 1NTPA 3G3ZA 2Y0CA 2SGAA 3ENSB 5JPMH 2PUXB 1QA0A 1SKYE 1X79B 2KB7P 2C8YB 3DSGA 4OS1A 2ZGHA 1K0HA 1JRSA 1N7SC 2Z9IA 3CWBJ 1ZTJA 5TJXA 3P8CD 3H1LE 2JJLA 1SQBD 2JKHA 2Q9IA 4A1VA 1DUAA 3CLQA 4AZ2B 3SI3H 4B86A 1F5KU 2AYWA 4XD7D 2XCFA 4BNRA 2XC4A 2BB4A 2R5BA 1UVOA 4INHA 4AOQA 1XUIA 4GOEA 1F92A 1SHHB 2BTCE 1LWUA 2FOMB 2Z3CA 3EDXB 5A8XA 3U28C 2FEQH 1RGQA 4PV1B 1L0LK 2BCCG 1OW6A 1ELAA 5T6FA 1FE6A 2WSEH 3A87A 1RFNA 1CSBA 1LO6A 5DPAA 1LTAC 1CGIE 3A8AA 3STJA 5KLVD 4BAHB 2F3CE 1GBDA 1N8RQ 3UB0A 4YXDC 4X6MA 1V2JT 1ZRTE 2BXTH 2Z9KA 1V2MT 1K28D 1O2ZA 3VEQB 2R3YA 3MFJA 1F0RA 1HBWA 3W94A 4CHAB 1OZHA 1UIIA 4H0LB 3Q5PA 4Q80A 1BTYA 3DSOA 4K69A 2OYHB 2GUSA 1OP0A 3ZYEA 1GVZA 5JYIA 1BCUH 2QGRA 2ZZUH 1AKSA 2QV1A 5EXMA 1BMAA 1O33A 1BZXE 1LTJC 4ZKOU 1IQFA 1IQKA 2ZT9B 1HIAB 3GCNA 2OYIB 5AW0B 1JO5A 1HAOH 1NU7B 1G3BA 4GOFA 1VQ4P 3AE5C 1NAFA 1MAXA 1VCPA 1O3EA 3A8DA 3FAOA 1O3OA 3DCLA 2J97A 1FU1A 2KSJA 3CMEP 1TNHA 1FNIA 2FOAA 3DFLA 3HATH 5EPYA 2AXCA 2XNDD 3HKJB 1C9PA 2OLGA 1J16A 2Q6GA 5CJ4A 2ZFTA 2GDDA 2ZFSA 1AVOA 4BXWA 3II6A 1ZJKA 2L5GB 1K73Q 3ATKA 5A8YA 3L72D 2IJD1 3PRBA 2ZTYA 3L36A 3RMNH 4AYCA 1CBWC 2JR8A 5IDKA 1C5SA 3OY6U 5AVDA 1N7SB 2IBZI 4HB1A 1M1KQ 3CCUP 1T8NA 1GDTA 1ABJH 3GS9A 1T6AA 1GHYH 3ITIA 2QRXA 1Z6EA 3KYGA 1AFOA 3H1HE 2NPSA 3SFEC 1SQVG 3T27A 4RO0A 1BHXF 2HNTE 4X2WA 5GNDA 4FUHA 4Y0ZE 3MH6A 1KLTA 1GBIA 3TGUG 2BD4A 2G55A 3PV4A 3FP6E 2FI5E 2CGAA 2Z4EA 1BDAA 3AEBC 3A8CA 3GW6A 3L70E 1M1JA 3B71A 5KAIH 1S0RA 3CS7A 3QK1A 4YO9A 4CRFA 1DT2A 1IK7A 1M8OB 1SQBG 3L3TA 2FIRH 3SJKA 1GVKB 2HLOA 1Z8RA 1N6YA 4O3UA 1S5LH 4D6TD 4LC1A 3RK3B 3ZZ9A 1C2EA 3MH7A 1ZLRA 1JY3N 1C5QA 3LPRA 5E8EH 3S9BA 1M1JB 2AXTE 3TF5A 1FDMA 2WSFH 4JYTA 4TWYA 2E75D 2YNAA 2KCOA 3OYPA 4ISIH 2FDAA 3L74D 1EATA 1C2LA 2A2XH 3RM0H 3T62A 1FIZA 1MD7A 2K9JB 4IMQA 4NA9H 3ZZ8A 4LOYH 1H8HD 2KAIA 2WV4A 3CP7A 3S1KA 2P58A 1DWDH 2W3KA 1HPGA 3H09A 1WXRA 3NXSA 1KTSB 3CS0A 5E2OA 3SHAH 2PKSB 1BMNH 4AFUA 4K3AA 5GDSH 4D6TG 4YM9A 3BIUH 2STBE 4R4MA 5KJ7A 1L0LG 1S1CX 1N7SA 1VQ9P 1QNJA 1GJ8B 1HNEE 3AE7C 1FUJA 1LT1A 2QXGA 3NUMA 1GL2B 4NSVA 3VGCC 3H1KG 2D2CB 1FMGA 2KX4A 4XE5B 1TONA 1O3AA 4C7NA 1S2EA 5FPTA 5LPEA 3O8CA 1VZQH 3PLPA 1A0JA 1MTWA 1OWJA 2YO2A 2ZVOB 1Y8TA 5HXFA 2FS9A 1VCWA 1QJ6B 1SQTA 3CC7P 1SLVB 4E05H 1TPSA 1O2RA 1UO6A 3VMZA 3S7KB 3RK3D 2XBVA 1EZVI 1BMLA 1GMJA 3VP9A 4YLUA 3QUMP 1X0TA 1LPGB 1EQ7A 1W13U 2HGTH 1FZCB 1T7CA 1YTZI 3GDUA 1G32B 4PV1D 3EE0B 3F9FA 3R4YA 3V13A 3UNRA 4EI2A 1HJ8A 4I31A 3SJIA 1HDTH 5APVA 2P2UA 1NY22 3NTNA 1OMIA 1C5ZB 4BAMB 2FS8A 1IAUA 2EY4C 2AGEX 2RH0A 3H1IE 2WPHS 3A7VA 3HK6B 5EPNA 5HMAA 1W7GH 1KXDA 1JBUH 3M0AA 1BRUP 1V2VT 3A5TA 2GMTC 4DCDA 3WU2H 3NKKA 3MMGA 1XUGA 1A4WH 2OARA 3VXFH 4O9BA 1DWCH 4WY4D 1RJXB 2VIVA 3BTME 3F68H 4GHQA 4E7RG 1RY3A 2G81E 3M5LA 6GCHF 1PFXC 1ZR4A 1C1TA 3LW5H 1RQVA 3FXEA 3RXCA 3WWBA 2ZDVH 1SGQE 3K2UA 1VQMP 3A83A 1MU8B 3DT0H 3MU5A 1CU1A 3RXVA 2K9YA 1RH5B 4H4FA 3GCHC 4DOJA 1K22H 1SGTA 1PZQA 2Q6DA 1TOMH 1JM0A 1EUFA 4ZXXH 3BTWE 5ABWA 3L70D 4YOGA 2O8LA 1SOZA 3H32B 2QYIA 4UFFH 5T6GA 2F4LA 2THFB 2KLUA 3C27B 1KXEA 2V3HH 3JZ2B 1G36A 2FOHA 2ZKSA 4Y11E 5A0CA 3HTKA 4J1YA 1WCZA 2SGPE 2PV9B 4WMFA 2ZA5A 1N7LA 4TT3H 3H1HD 3D62A 3OAKA 2FYQA 3A7ZA 1OVVA 4NIWA 1O2GH 3A89A 2O1KA 1ZZZA 2O1JA 2PGDA 1T8LA 1GHWH 1AE5A 1CE5A 1UCYK 5EQRA 3VGCB 2QJKC 3H1JJ 1HGVA 3BCCG 3CC2P 3I5CA 1GCDA 4LZ1H 1BTHH 5BU8B 4GDOA 1P11E 5C0UA 2E76B 2VU8E 4TWWA 5CHAB 3OE7D 4DJZB 1XVMA 2G5VA 1FZBA 2NU2E 3K6YA 1J2JB 4HH2A 2Y9ZA 1O3HA 2NU1E 4ABEA 3LKWA 3I55P 3NK8A 2CF8H 3F9GA 4Y10E 1SLQA 1SQVK 1SQPG 1LTJA 1AZZA 5HGGA 1YI2P 5JBBS 2GUVA 5AVWB 3GCOA 2HODB 3CX5E 1N8OB 2OXSA 2BASA 2OGUA 2F43B 3OW2O 3E90B 1UHBA 3RXDA 1QCPA 1AVWA 5EODA 2WSEJ 1Q3XA 3QO6A 1VQ5P 3HUSC 3SU4A 1PYTC 3E3TA 4I7ZC 1P3CA 1TAWA 1GMDG 2ZO3H 4GUXA 3KQBA 1S4XA 4Z6AH 3BTHE 1MZ9A 2K0QA 2O3JA 2CJIA 4U30A 4DW2U 5CCGD 3E7KA 1L0LD 1PGOA 4L74A 3BIVH 1MKMA 4MDSA 4BANB 5A0AE 1C5XB 2A4GA 3AEDC 3HRNA 2GZ8A 3H32A 2V35A 2ZWLH 1SPJA 5C1YA 3MZWB 3EFFK 3SJOA 4D7FA 5FCRA 1IQIA 2YNBA 1MZDA 3WWFA 2JWDA 5KAIE 1ZPZA 4FU8A 2OTJP 2V6NA 4WBAA 2GD4B 5AVYB 1W11U 3TNTA 1X8YA 4B71A 1TRYA 1YLDA 3GHGA 4VGCB 4Q7ZA 1O2XA 4XBDA 4FUDA 3ITKA 2D2DA 2B87A 2JO1A 1YGCH 2Z9JA 4CREA 1KV4A 1P2QA 2ZTXA 4HJGH 1FDOA 4A7PA 1S6LA 1VJAU 4ZHLU 2ZFCA 3LH1A 1GJ5H 4MNWA 1IQMA 1NRRH 1KB9H 1GJ9B 1OWIA 3KL6A 1G1JA 1OWEA 5EQSA 4Y71A 5JBCS 1QEXA 1EB1H 5HIZA 2Q6QA 3FWLA 5AF9H 1V2ST 2IFMA 2AS9A 2HLDD 1NO9H 2A1DB 2OQQA 1ACBE 1CO7E 1O0DH 2ZDMA 1RF0C 1HXFH 1ZW0A 1QRWA 1YBWA 1YLNA 2D1JA 2EI6A 2NU3E 4GPGA 1SQBJ 1O2HA 2H9TH 1YJNP 1NU1E 1LHFH 1L1NA 1ZPBA 4ASUD 1O2TA 4UB8H 2FYNC 2SGFE 1FV9A 2YMSD 3M5MA 1SFIA 5DKMA 2PKAB 1A5HA 2KZ4A 3RL0D 1PP9D 4GCHF 2WV9A 1FXYA 2BD8A 1SQXE 3AECC 5TISH 1KIGH 2N1TD 1GW4A 1VQ7P 4NFFA 3RXKA 2SFAA 3A3YB 2BHGA 1S72P 3MP7B 4A5TS 2ANMH 3TJNA 2ZHFH 3ATIA 4WY4B 3V2QA 1WT6A 1FN8A 2L6OA 2Z7FE 2XNDH 3GY6A 3LT3A 2VWNA 4THNH 1XVOA 3Q3KA 1YPHE 2H5DA 1KILA 1YCPH 3P7KA 3WUUA 1OVUA 4RSPA 2NZ2A 2A7CA 2KNCA 4MPVA 3HUSA 3SUGA 2OYIC 3A0BE 2AFQB 1ZSLA 2A4RA 4W7ZA 9LPRA 1ANBA 3VOPA 1K1IA 1O32A 1KQSO 2TIOA 2TGPZ 3QX5H 2GZ9A 4X2YA 3RK2C 1HFDA 2TGDA 1CVWH 2ZCHP 3GHGC 2QXIA 3KEEA 1FZGA 3PMBB 2ITAA 5GCHG 5LPRA 1BRBE 1HB0B 2B9BA 4DCKA 1AMHA 3PLKA 4ISLA 4RKJB 4TPYA 3EA7A 3V12A 1TNLA 2FXRA 4TY6A 3LGIA 3S4RA 3T97A 1NKZB 1KXCA 1P01A 2BMGB 4YXWH 1SGFA 3LC3A 1GG6C 3KPEA 2ZCLP 3PYHA 1SOTA 4UEHH 3SNBA 1GL2C 3O8RA 4I2LC 1NO4A 4U3FJ 3QWOC 3MNCA 4L75A 1BGYG 1SR5C 5L8RJ 1JIRA 1G2CA 1ELCA 4KGAA 5B66H 1A2CH 1CHOF 4X1QU 3TYYA 1ZMNA 2KP8A 3LU9B 3N99A 1ELTA 3QDZB 4I8HA 3TDKA 2HPCA 2V3OH 2BVRH 1BCCE 2R5DA 4PV1C 3TGUJ 1GU4A 3FN8A 3T26A 3LONA 3AAVA 1JY2P 4INLA 3AE9C 4WWYA 3SZEA 1ABIH 2VJ1A 1UVSH 2PGBB 4F49A 1MCVA 1QL7A 1BTUA 1UTPA 3SV6A 1AGJA 1CT4E 1KQLA 5AW5B 2F9PA 1ZRBA 5K5GB 4PD4D 2FTMA 3T5FH 1HGTH 3JCUH 4F48B 1GBFA 4NA8A 1GJ6A 2H8PD 1KILE 2YMSB 1QIXB 3EGKH 3GYLB 2XNIA 4WH8A 1XMNB 4B76A 1QHRB 1FOSF 3NPSA 5HM2A 1GMHG 2WPLS 3UPEA 3MUDC 2C0WA 5AFZH 2LR2A 2FBWC 1YPMH 2F9NA 2J5UA 3L71G 1PPBH 3PB1E 4DG4A 3ZZ5A 1MTSA 1NU1G 4AYYB 3BATA 3LIEA 5M1BA 5AW8B 3U1CA 1USDA 1TBRH 2Z3EA 2ZHQH 4ABIA 2C9LY 2BD3A 2OC1A 1O37A 3BEIB 1XTGB 1SBWA 1K1MA 2HWLB 1W2EA 3H25A 4DOQA 1EDLA 2YIUC 2L91A 4ACAA 4ZKPA 1AKSB 3R0FA 2EC9H 1AQ5A 1FPHH 2TGAA 1MH0A 2R3CA 2EI7A 2I6QA 1J9CH 2GKVE 1FS0E 1HAXB 4RT1A 2WV5A 1AVYA 1ZMEC 1D6WA 3ATLA 2WT7B 3DA9B 3M5OA 3F2HA 1ANEA 1KTMA 3EFGA 2EQNA 2GT8A 4MQAA 1FY8E 1AV1A 5EGMA 2Q3EA 3H1JE 1F7ZA 5CBOA 1V2NT 5ETXA 3BTKE 1Y3VA 2O01J 2M5AB 3D6ZA 8GCHF 4FU7A 1W0ZU 1Z56A 1UIXA 3RXLA 1WMKA 5T1VA 5L30H 2BZ6H 1OFCX 1C5PA 5DSFA 1H9HE 1QL1A 2E5YA 3GF3A 3TNUA 1DE7H 1WSSH 2F9OA 2WPKS 5LGOA 1T3JA 1NT1A 2JETB 4ABDA 4QT8C 4R4LA 1XXFA 1KXBA 4UFDH 1VL2A 2D2CC 1NU9A 4NZLA 2FYUK 4GVUA 1H8AA 3D6YA 4HG6A 1L0NE 1SGDE 3PWBA 2R2WU 4YOIA 5BPEA 1L4ZA 2WSSD 1O2MA 1WTGH 3I29A 3BASA 3GY5A 4Y6DA 2KK7A 1SQPD 4CPGA 2XU6A 2BDGA 3U59A 1HLTH 2J58A 1ZSKA 4FOUC 5JB9S 2BEZF 2BDHA 3PTBA 2IN2A 4HYTB 1PYTD 4X8UH 1SFCB 5APTA 5IK2D 1TPOA 3EYDA 2A32A 4FVDA 2RDEA 7ESTE 2VNTA 3BRVB 1HAHH 2HPPH 4K60A 3Q00A 1J14A 3VN0A 3B8JA 3Q76A 1JB0J 1HJBA 1ETRH 3FKSD 4E7NA 3ZZ7A 2ZPRA 2QA9E 4AG1A 4IL6E 3H1HG 4Q63A 3H1IJ 4JK5A 4JK6A 4K8BA 5PTPA 2R32A 5CCHA 3P92A 1YPHC 2KR7A 2ZQ1A 1L4AC 3CWBE 1C1WH 1OXZA 1C2HA 1RTFB 2XXLA 3RXOA 4M9FA 3SUEA 2K37A 3USSA 2XRCA 2Y80A 1O2IA 1U57A 1L2EA 5HKKD 2H43A 1SQXJ 3CWBD 1PV3A 1JXPA 1PPJD 1Z1IA 1Y5BT 1YYCA 3L75D 1G3CA 2WPIS 4FUBA 2P10A 3RMMH 2E5TA 1WYKA 3D49H 3EAJA 5E2PA 3M3SA 3VYIA 2WUBA 5KKZC 2V7QJ 5KLVE 2ZJSE 1ELEE 2SPZA 2G4UA 1K1JA 2PTCE 3ODDA 4IBLH 4XBBA 1DWBH 4W80A 4ABFA 1TPAE 1Q7YQ 3UWIA 2KCYA 4Y99B 2VIWA 5DGJA 2B88A 2KSEA 3UR6A 1XM1A 2QSIA 2QCYA 1P84D 1G2LA 3AASA 3ZYDA 1C2IA 1AI8H 5E0HA 1CZQA 2R44A 4H13B 2GMTB 1L0NK 3KNXA 4XA4A 3M0DA 5C3NA 3KF2A 3V4QA 1EOLA 3SSUA 3H1JD 1HJ9A 1OW8A 2OQ5A 2PUQH 2UUKB 4AC9A 1Q31A 5GIBA 3TJUA 2YMYA 1EPTB 1L0LE 2ULLA 1QB9A 1Z7KA 1GHAG 3CC4P 3GG2A 2CMYA 1YITP 1O35A 1YP9A 2FOGA 2ZCKP 3PO1B 1ZRKA 1YIJP 4I8GA 2N9BA 4WF8A 1C5YB 3T28A 2ZXXA 4H42U 1SQQG 2WT7A 4HZHA 2R9PA 3SV8A 4BRYB 3M7TA 4Y79A 2ZHEH 3TNUB 4CR9A 4F4OC 2DE9A 2PRRA 4Y28J 1C4Y2 4Y99C 5H2FE 1LPZB 2CV3A 2DE8A 2WSCH 3K5BA 1G2MA 2J38A 2ZDAH 4ZKNU 2FYZA 2WSSH 1ZHMA 1GI1A 3LOXA 1NFWA 2Z94A 3RXPA 2GCHF 1AFQC 1PPZA 3SNDA 2AIPA 1KYOD 1UW7A 3VP8A 2FOBA 3KQDA 4OS7A 5CHAC 1BTZA 3EWKA 5DJ7A 1V2PT 3RUOA 2PLXA 1NU1K 1S84A 1TGBA 1UTJA 2VH6A 3N4XA 1GI4A 3UWJH 1LT9A 4ASVA 4UFEH 3TU7H 1GPZA 3JSVC 2SNVA 1VITG 1TGNA 4JZFH 1SGIB 2HVXA 1GG6B 2E42A 4FU9A 3L72J 2W83C 5APSA 1TX8A 3KGPA 4B1TA 1CA8B 1GHVH 2UUFB 2FYUD 3ZZ4A 1GMHF 1J1DC 3RK3E 1BBRE 3MU0A 4FUGA 2BY7X 1HUTH 3M9HA 5APWA 4HGCA 1T32A 3L74G 2LELA 3QLPH 2FOFA 1LP1B 1Y3UA 3A7OA 4IL6H 3KHUA 2W6JH 1DLKB 1TE0A 1ZGIA 2JWAA 5KLIC 3LDXH 4SGBE 1NC6A 1EP6A 3C1KA 3B5NB 3BEFB 4MNXA 2PFEA 2P3FH 4P02A 1K1LA 4JYUH 5JDUB 1BGYD 3KYQA 1NTKK 3GLMA 1KZUB 2WQYC 3ESTA 2P1JA 1SVFA 2AHME 1G2CB 2B89A 2H9HA 4GIFA 1BHXB 1S82A 4IC5A 2P94A 4ZUHA 5DJUB 1DX5M 1VQOP 3LC5A 1KXFA 2VIDA 1C1SA 2BLWA 3G4SP 3AE4C 1NHLA 1YPKH 1MV8A 3P8NA 4CRGA 1QFKH 1O5BB 1NN6A 2F9UA 1L0LJ 2ZFRH 4K1TA 1PPGE 2PWXA 3H7TA 3RXHA 2Y5HA 3JCUE 4OGYA 2BX4A 1S6HA 3B23B 1K2I1 1EC5A 1SQVD 1XXDA 1KN7A 1BMMH 1MQ5A 3S9OA 5CCGC 1O3JA 2N9YB 1MTVA 2HFED 1NS3A 1ETTH 2LPRA 4GHTA 3RXMA 4I8LA 2BY5X 1PPCE 3NXPA 3BCCE 1LWUC 5DJTB 2A31A 1THSH 1FAKH 1RS0A 1GK4A 2JH0D 1JCCA 1RTKA 2G5NA 3L72G 1GBKA 2UWPA 2IPQX 2ZGCA 5FX6A 1JY2O 4BTTB 3BSQA 5B5EH 3PP5A 1N86A 1EXIA 4RT0A 1DXWA 1PIXA 4JBZA 3MYWA 2RFKC 1DICA 1RHZB 1P2OA 2XTTB 1FC2C 2Q1JA 1XUFA 3CXHH 1EZUC 2RA3A 1TNJA 1HAPH 1IQEA 1ZJDA 2ZI2H 3HUSB 1TA2A 1S5SA 3Q77A 4BTIB 1PP9E 1O2JA 9ESTA 1V2UT 2VWLA 1O3PB 1SGNE 1E5WA 4ZMAH 1NJIQ 1DVAH 2ANKH 1KILB 1QBNA 1EDIA 1KYNA 1O2QA 1UJ1A 5A8ZA 6CHAB 2XWAA 5GWZA 2OYHC 1VQKP 3TGUE 1BCCJ 1C4U2 1VQ6P 4PJ0H 4ZMDA 1LJ2A 1V2WT 4YT6H 1TGTA 3L70G 1TX7A 5L2ZH 2QF0A 1HGZA 3F6UH 2XW9A 1THPB 2HNTC 4WMDA 3OEHD 3A86A 2YMSC 3KXDA 1IJDB 1IFNA 1NTMD 4C46A 2PHBA 3MOCA 1C1OA 5FBIA 1FLEE 2QG4A 3B5NC 5EJZA 1QVGO 2QC2A 5DP6A 2WPDD 3RXEA 4CRDA 4XE4A 3CX5I 1ZHRA 2PKAA 1PQAA 3VPKA 2CK3H 1NTZD 2A4OA 1IFPA 2ZHWH 5C0TA 1UK4A 4X6PA 1DX7A 2M3EA 1V6DA 1KTTB 1P03A 2GT7A 1JOCA 4L76A 3U98H 2XBYA 3V3MA 3SQHE 4KTCA 3P8OA 4AG2A 4AUWA 3ATWA 6GCHG 1HRTH 4B74A 1C2MA 5KAFH 1DITH 3AE1C 2Q5UA 1THRH 4ACBA 1FZZA 1HJ0A 1O2UA 4IC6A 1C1MA 2V4HA 5H2FH 4D6TE 3MH5A 1BA8B 1H8ED 1SQAA 2F9VA 5L6NH 1NBMD 4KKDA 4BAQB 1F0SA 2LXCB 3NFQA 2WPSA 4X8VH 4IN1A 4JCNA 2BOKA 3M06A 1OX3A 2BZAA 3MNXA 4A7IB 2B87B 1GHAF 5LPFA 3V4WA 3RXBA 4QMAA 3GHGB 1GHXH 2GX4A 2AMPA 3B8EB 1P57B 1W8BH 4AYVB 1SG8B 1Y8AA 2A5AA 2QF3A 4WVPE 3UNSA 2QY0B 2W6AA 2Q1KA 1BTXA 2QJKB 1LPKB 1K21H 1TWXB 3PHLA 3QGNB 4I7YH 1F0TA 2GV7A 3F2FA 3HD7D 8ESTE 3HE5B 1SC8U 1JNMA 7KMEH 1P3EA 4FVBA 4D9QA 2G3AA 1N7SD 3CX5D 2B9LA 2Z9LA 1SQXG 5DP5A 3RC5A 1AFEH 3MNSA 3MTUE 1ELGA 4XFJA 3A85A 1KSNA 1BBRK 1NU1J 2ZECA 1X7AC 2AXTH 3GOVB 1G1IA 3L71J 3M61U 1NBME 1GCTC 2KFWA 3CXHI 2ODYB 3FO8D 3TNSA 4CR5A 1FZFA 3A7WA 2ZEBA 3P8MC 1HJAB 5B5EE 4OH8B 4YLQH 1SLUB 3SU5A 1PQ7A 3H1IG 2BDBA 1LGHB 3H1HJ 3FFGA 4IMZA 4NZQA 1PGPA 4ZXYH 1LTBC 1BT7A 3V5BA 1O39A 3L71E 1DLEA 2OD3B 3K65B 1EZXC 3NCLA 4LZ4B 1NWQA 4FUCA 1NOHA 2OTKE 3TGUD 2IOTA 2FX4A 1IQJA 1GBJA 3Q1MA 4IOIH 1KLIH 3RM2H 1LQEA 2QM8A 2I1KA 2J98A 2UWOA 1UTQA 4ISHH 1LTOA 2KCAA 5EQQA 4MPUA 5CCGA 5GJ4B 5AW1B 1CGHA 3HE4B 3CCSP 1ESAA 3C9IA 3TK9A 2Z5HA 3A84A 1D7MA 4INKA 2YKOA 1YPEH 4NG9H 4TYDA 3HTKB 5SGAE 1AU8A 3W1EA 1U7MA 4XFQA 1KQFB 3M37A 2FI4E 4HFPB 1L4DA 2E74D 2NPSD 1MBQA 1C5VA 1ELVA 1OVRA 2JEEA 1EZQA 1K1PA 5FAHA 1GI6A 2ZU3A 5DP7A 2GCTC 3E6PH 2O01N 2A7HA 3U8TH 2BVXH 5EU8A 1JRTA 3SGAE 1SGPE 1TALA 4K5ZA 4B73A 3FZDA 3I77A 1SGEE 4BTUB 4MN4C 4OGQB 5J4QA 2OC8A 1GI7B 1W3CA 2D2CD 1P10A 4ZROA 3MU1A 2HOBA 3SV2H 1H88A 3TLOA 1L4AA 1AQ7A 1QBVH 4CHAC 2I1JA 2IYOA 2RCEA 4CRBA 5C1XA 1COWD 1EPTC 2ANYA 3SU3A 1LVBA 2PW8H 2J59M 4RJTA 2DUCA 3SORA 2K1QA 3HD7C 2N1TB 4YZUA 3P17H 1QA7A 4RI0A 3ZVGA 3FANA 1JEKA 3D70A 2ZYAA 1O2LA 3RL0B 1OWHA 1XKAC 2K1AA 2FWWA 3BG8A 2Z3DA 5C17A 5DO4H 3CNRA 1C1QA 2WHXA 4ZCNA 4Y8ZA 3UUZA 2XZRA 1VF5B 1GL0E 4GCHG 1P84H 1OYTH 4WMEA 2JJ1D 1URQC 2BDYA 1E1RD 1AQTA 3GY2A 3CD6P 1WQSA 2E43A 1S0QA 5AVUB 2TGTA 5FBEA 1PP9J 2JDIH 1N8OC 3VTPC 2FFDA 1RIWC 3DUXH 1MTNC 5FPYA 1BMFD 3AEGC 2YXRB 1TLDA 2ZTZA 1W0YH 1MD8A 4ABGA 2G8YA 1TMBH 1UCYE 2KCPA 1U7JA 1GZLA 3E0NB 1EJAA 5EXLA 4Y8YA 1S83A 3UOPA 3E1RA 5C39A 3RLYH 3L73E 1FDIA 4RESB 1PPHE 3OU0A 4O9VA 2MKVA 1T3UA 1SS1A 1ZTKA 2ZC9H 3ZV9A 2XDJA 2OCVB 1SQXD 1D3TB 2BDIA 2R3UA 5KLVG 1TNGA 3OTPA 3SNCA 4BWNA 4CH8B 3M5NA 1Q90D 1DOJA 1YTZT 2ZU4A 3CX5H 1JIMA 1WRGA 1AHTH 1FY3A 2H1UA 1ID5H 2P16A 2FYUE 5AVTB 2F91A 3G9RA 3AE2C 4YTPC 1C2JA 4I33A 1S3JA 1F0UA 5JB8S 4H0LC 2AEJA 2WVRA 2VVUA 3GISB 1GHZA 2XC5A 2BDAA 5KLVK 5E79H 4O03A 3GCTF 4J2YB 1TNIA 3SI4H 1P2MA 2FYNB 3W67A 3S7HB 1ZV8A 1ZYOA 4OS4A 5GTIH 3CCEP 4LK4A 1QQ4A 4OS2A 1N2DC 1OWAA 1Z8IB 1C5UA 1MAYA 1KXAA 2A0QB 3ZZBA 1Y5AT 2Y7XA 2ZP0H 1S81A 2KLVA 4DT0A 4AGKA 4DIHH 3N7DA 4ZH8A 3AEAC 3RL0g 1CHOG 2K88A 2Y7ZA 3V2NA 3ZVFA 2FYRA 2QE7D 2V7QD 2VIPA 1TPPA 1MCTA 3OAAD 3VMXA 2HPCB 3P32A 1P09A 2GJGA 4NIXA 1DUEA 2FOEA 1CT0E 2ZQ2A 1Y47A 1A0HB 2KYVA 1UTLM 3BVHA 1MQ6A 2FYUJ 4JYVH 2AEFA 1LKAA 4AGJA 2NPSB 1T8OA 2IDBA 3RL0C 1WOFA 3UQOA 1FJKA 1WBGB 1R5SA 1AN1E 1H8DH 1Z1JA 3L75E 4FUFA 4D8NA 1YCPM 3DD2H 1AIXH 3RXUA 1SMFE 1YJ9P 3W95A 1LHGH 3DFJA 1TFXA 2KZIA 3TITA 2FLBH 4ESTE 1ZOMA 3L72E 1EJMA 2ODQA 2Y0EA 3FGAD 2QEXP 2C9NY 1EP5A 2B7DH 1A5GH 4Q2KA 1RF0A 1QR3E 1RE3C 1LHDH 4ZHAA 1FOSE 1P84I 2O01H 2XCNA 1O2YA 1KORA 2OYOA 1ESTA 2Q3IA 3D71A 3P8GA 1HUCA 3BN9A 4ZKUA 1CHGA 5APXA 3M35A 3WU2E 1P2NA 1SHYA 3M3TA 4BOHA 2KNCB 2HNTF 3AE8C 3P95A 4UD9H 3S0NA 1ZHPA 2O8WA 2CPSA 1CSOE 1AB9C 1BE3J 3URDA 2ZU2A 2KUBA 1C4V2 4ZHMU 4U7JA 1H9IE 5BRRE 1YY3A 1O2SA 2SGDE 3DSPA 4Q4LA 1LT9B 3VFEA 3M9QA 1NRNH 2OUAA 1M7LA 1EB2A 1ZPCA 1CA0B 4Y7BA 1TGCA 4WY4A 4U3FD 4KJMA 3SU0A 1YLCA 3RC6A 3A0HE 2QXHA 1O2WA 2C8ZB 3UR9A 2FFDB 3TK5A 4IFFA 4U3FE 1E79D 1UVTH 2ZDNA 2QVAA 1W2BO 2XWBI 5TJHA 1MTNB 3EA8A 4CRCA 1PJPA 1P2KA 1ZMJA 2C8WB 2W90A 3KQ5A 4MLFB 2OYIA 3ZZ3A 2OBOA 3GY3A 1HWTC 1YYY1 2P3UB 2NU0E 2BD9A 5BU5A 1OPHB 2CHAB 1VF5C 3O8DA 1UK3A 4TLFA 2IX7C 2RKLA 4TSFD 1A1RA 3CCMP 3T25A 2POHA 1C2FA 1ZN5A 2BLOA 3MI4A 4B2BA 7GCHF 2BDCA 1IFJA 2NRGA 4W7YA 2QM7A 1W0KD 1TU3F 2BOHB 1USEA 3MHWU 1GBHA 1QZ8A 3K6ZA 4YOJA 2KZJA 1L4AB 2VH0A 1V2LT 2XOKD 1JY2N 2M8RA 1YQ3C 2EA3A 1QBOA 1KDQB 3CENA 3PRJA 3U8RH 2IBZE 1QTFA 3VB3A 4AFZA 3LGYA 1EZVD 1NFXA 3B4SA 1C5RA 2TPIZ 1FZCC 1O5AB 5DP4A 1TGSZ 1GW3A 3RXGA 2KIKA 4YT7H 2C4FH 1T31A 1H89A 5BVZA 1W0JD 3TGIE 1LWUB 2WSCJ 1A02F 2ZVNB 3F5HA 4KTUA 1EQ9A 4WXIA 4YESB 4MNYA 1A02J 1DANH 1SQPJ 2GP9B 3S9CA 1ANDA 1AVXA 4B6FA 3SU1A 2IJOB 1V2RT 2ZHDA 4Y8XA 1L2PA 1B0EA 1FAXA 2CF9H 3RP2A 4AORA 1JUNA 1C5NH 3WW7A 1PGQA 3H1ID 1N6XA 3KDPB 2F83A 3F1SB 1GBBA 1BJVA 3E91A 4EOTA 3KYFA 1XUKA 5KTBA 3F0OA 4WY3A 2R2MB 2Y5GA 3L73G 2D8WA 4K2YA 1O3NA 2QXJA 3V2PA 4C7RA 1UCYH 2G00A 3TPIZ 3M36A 1HYLA 2BEQD 2Y5FA 3FZZA 2HODA 1O38A 2H7HA 1AD8H 3SYJA 3RK2B 1OP8A 1W12U 3UQVA 3TGKE 3JZ1B 1URQA 2A45G 3SOSA 2HALA 4OVNF 1SFCA 4WVZA 2SGEE 4NA7A 3VXEH 1M57D 1GJAB 2XV5A 1SI5H 2CN0H 5FPSA 4UB6E 3MHVA 1J15A 5FL7D 1LVYA 2WPJS 2VGCC 3FXDA 1IQGA 1NPMA 2JH5D 4I86A 1Y59T 1NTMG 1TBZH 4FUIA 1MZAA 1UTOA 2BXUH 1GTWA 1FIWA 1J8AA 1L1JA 1KB9I 3CI9A 2JDID 2ZGXH 3BTEE 2WPRA 1KY9A 4U3FG 2VIOA 2XYAA 3AVZA 4FXGH 3H1LJ 1YPJH 3BCCD 4CBNA 1BE3E 1IZNB 1QURH 1S85A 1WUNH 2F9BH 3ZZAA 6ESTA 5GXPA 1GHBG 3IR9A 5JBAS 5DP3A 1FY5A 2WSFJ 4Y7AA 3A80A 1C9TA 4R0IA 4WB4A 3JC22 4XRNA 3RXSA 2M5AA 1DM4B 3E1IA 1HH0A 2QF5A 1NTZG 3GDVA 1IOEA 5L2YH 2GCHG 3M3VA 4B6EA 2STAE 2VWOA 1ANCA 2W5EA 2A45B 1E0FD 2WMMA 3L75G 2IPPA 1LHCH 2A06E 1KFNA 3ZZ6A 1GU5A 2RG3A 1PGJA 3F0PA 1VQ8P 3A7TA 3EA9A 3H1KJ 1VITF 2WZ7A 1EAXA 3SHCH 3PV2A 1HJAC 1PQ8A 1GJDB 1P04A 3VMYA 3SZNA 4E06H 5G4BA 5DN6D 3SWKA 5F53A 1WQVH 2P8OC 2QIQA 2YKPA 1RQUA 5GTHH 1OX1A 5ESTE 1GDUA 1UVPA 4F55A 2HVYB 1RF1A 2BYAX 1TMUH 1TQ7B 3OTJE 5CHBA 4U01A 2R0KA 3KHVA 2WINI 4N3YB 1EAIA 3GY7A 5F8XA 4BAOB 1NGMB 4AB8A 2W8ZA 1T8MA 4PJ0E 3AAUA 1AB9B 1MU6B 3BEUA 3SFDC 1KB9D 3FP7E 3L33A 4HI3A 1CGJE 2HRVA 1NTKD 1ELFA 2AEIH 5CDFE 1K05A 2AIQA 8LPRA 4DY7B 3KZIH 1P2IA 4U32A 2FMJA 2WWWA 1GDNA 3SUFA 3VB7A 4KHXA 2Z5IA 1AVGH 2GVFA 3TH3H 1PPJE 1SQXK 4KELA 5KKZB 5DP9A 2FM2A 2BD5A 1C1UH 1FY4A 1BB0B 4KT0J 1LNQA 1EDJA 3MO6A 1AA0A 3RK2D 5A0BA 1YBKA 2IZ0A 3PRDA 3GICB 4AB9A 1LMWB 3UREA 3C8VA 1J1EB 1SQQE 2ZPQA 1UTMA 1FZEA 3I56P 2Y0DA 4LLHA 1GBEA 3ZVCA 2FKWB 2IYPA 2MJZA 2GM4A 2OC7A 1DIPA 1M1JC 3E0PB 3PWCA 1UVUH 2WPQA 5FHTA 5AW4B 1EAUA 1TMTH 3WY8A 1AE8H 1GL2D 1NZQH 1Y3XA 4C7NB 1W10U 1V2KT 3IF4A 5KJ7D 1SSXA 1KD1Q 4X6NA 4Z1MH 2ZFQH 1BSNA 1SQVJ 1BGYJ 1EXJA 1GL2A 2FI3E 1LCYA 1VKYA 1Y5UT 5T3HA 5KECA 4JQ0D 2P8OB 2LXBA 4EDFA 1Q86Q 4KTSA 3KQEA 1N73A 1NFUA 1RF1C 4ZKRU 4NWKA 2FLRH 3ELAH 1MBMA 1TRNA 4JZDH 2PAJA 1O5EH 2P7JA 1DY8A 2ZDKA 2N1TA 4H44C 2K9JA 4PD4H 3BTQE 4ABBA 2FZZA 2H6MA 1L0ND 1S6FA 2NWNA 1O3FA 2BQWB 1N1LA 1ZSJA 2OTLP 3U1AA 1D6RA 2FXPA 1G37A 1RTLA 5B6LA 1EX3A 2GDEH 3UFAA 5EW1H 2RDLA 3SJ8A 1KILC 4IFDK 2O8TA 1VR1H 2O9QA 4CRAA 4D9RA 1J17T 5HM9A 3RK3C 1NTZE 1XUHA 4GKGA 1QJ7B 1ZP0C 1EZVG 3AE6C 5TCAA 1C5WB 3F89A 2VRSA 3OEED 4RKUJ 3WMM0 2KOGA 4MPWA 1IO4A 2FXMA 3MNBA 4ISNA 1QVFO 3HKIB 3H1LG 1HTLC 4UONA 2OTVA 3B5NA 1NTZK 1VF5D 1P06A 1HAYB 4I8KA 4X1SU 4B75A 1NAYA 4D7GA 1A61H 4H6SB 2OK5A 1QGKB 2WYGA 1DEEG 1HVVA 1LP1A 1C1PA 3P70B 1NTMJ 3WUVA 1PPEE 1SLXB 1AO5A 1C5OH 3AK5A 1JTHA 1O3IA 2P67A 1NM6A 1R8EA 1C2KA 1Q2WA 1ZTLA 1ARBA 1ZLLA 3TJOA 3OFND 4ISOA 5FXLA 1NTMK 1K9OE 1O5CB 1SFCC 1FJSA 3D23A 5CCHD 1IHTH 1GBCA 1QL2A 1BQYA 1TYNA 2ZGBH 3AW0A 5DP8A 4RKOB 3M7UA 1RE4C 4I6MC 2LNCA 5CMXH 4UB8E 4NPEA 2FFDC 1PPJG 5KJ7C 1GBTA 1UMAH 1JWTA 3HD7B 1UTNA 3SV9A 3PLNA 1BTWA 4PD4E 2GZ7A 2ZXEB 2ODPA 1EZSC 1TIOA 1K1OA 1SGCA 1AWFH 1HAVA 3SO3A 4BXSA 1BOQA 4GAWA 1OIPA 1HIAA 5AW3B 1FI8A 2GA1A 2BQ7B 4GLYA 3ATMA 1NTKE 4LGDE 1C2GA 2YO3A 3H6PA 3PTNA 1KB9E 1O36A 3L70J 5EFWB 3Q3DA 4K8YA 2E76D 3CXHD 1IK9A 2VINA 1BCCD 5C5OA 1O3CA 3S69A 3ZZCA 1BCCG 3LGUA 1T2KC 5AW6B 4N78D 1XTCC 2P59A 3RMOH 2J2UA 4XSKU 1PL5A 1EPTA 3R3GB 3RLWH 1SFCD 3PTZA 1HF9A 1P8VC 3RXRA 3A0HH 1EXFA 2VVCA 1O34A 2UUJB 3L75J 2BX3A 1BUIA 3V7TA 1O5GH 1QL9A 5C5NA 1E37B 1IC2A 1VGCB 2A2QH 3P8CE 2A06D 2W6ID 1T4UH 2ALVA 1HCGA 1NTZJ 6CHAC 3QN7A 4BXLA 1KDQA 1W7XH 2XC0A 1FX0B 1W2KH 4H13C 1EAWA 5EOKA 3FWNA 2BLQA 4X1PU 2NPSC 1MABB 2B0FA 7LPRA 1F2SE 4HTCH 2G4TA 1FN6A 1QRZA 4U2WA 2BCCD 5AVRB 3Q5RA 5EJLA 3CXHE 1GJ7B 1ZXGA 1VCQA 4XBCA 2UWLA 3SWFA 1DS2E 3QZQA 1B5GH 1TB6H 4WXVA 3VB5A 3UAIC 2FYUG 1GGDC 1YCPK 1GWAA 1JMBA 2R3SA 1T2KD 5C67A 2LKMA 4DZOA 1L1GA 1SB1H 1IQHA 5C94A 1FPCH 1MUEB 4JZ1A 3A2AA 1JMOH 1JTHB 3UY9A 1LVOA 3F2GA 4CH2B 1S5LE 2FOCA 3W68A 3LGVA 4TPIZ 3QWCH 1GBLA 1IFMA 4MVNA 1NRSH 4K1SA 1QY6A 1LQDB 1RD3B 1A3BH 1YF4A 2FX6A 2AH4X 3LGTA 4JPZB 3MD0A 4MTBA 5EIYA 2E75C 1S9KE 4O97A 1IHSH 1A3EH 2GTBA 3RU4D 3SUDA 1SQQJ 2XBXA 1SLWB 1MKXK 3SU6A 5A2MH 3L73J 3LGWA 2AMDA 2Y6TA 2WPVB 3E16B 1SQBK 1FJPA 1NROH 1OYQA 1NU1D 3MTYA 3SGQE 2PSXA 3L71D 1K9MQ 1O3KA 4A92A 3L74J 4MPXA 1IFIA 1BRCE 3NZIA 1O3DA 1YKTA 1RE4A 3GMAA 3LIDA 1SQRA 2K3RA 8KME2 1KQGB 2VGCB 2G51A 3TVJB 3TH4H 2ZU5A 4AFSA 1GBMA 1RE3A 5AVZB 3MO3A 1GGDB 1BE3G 2P95A 2GGVB 2ILNA 3GY4A 3BTFE 3T29A 4PD4I 4YXWD 3A0BH 1GMCG 2C8XB 5APUA 1CA0C 3A88A 4P00A 3ZV8A 4M3LA 1C5LH 2JJ2D 2QE7H 2V7QH 2ZDLA 1JY3O 1G3EA 1HXEH 3T2NA 2PSYA 4TT3D 2OC0A 2BY6X 5CE1A 1S5LX 3OJAB 2ASUB 4NIYA 1O3LA 1OP2A 3H5CB 2IBZD 1PQ5A 3UOUA 1H1BA 3ZVEA 1WDIA 2A45I 1YC0A 3G6EP 2W7SA 4O3TA 2RA0A 1XX9A 3LIWA 4NSYA 3H1JG 3KZIE 2WPMS 4Q7XA 3RC4A 3RXJA 1WU1A 2WTYA 3CMAP 2BLVA 1O2OA 1DSTA 1OWKA 3IN6A 2EI8A 3SNEA 1OHHD 2ZYGA 1P84E 2YIUB 2KXPB 5AW7B 4IW4E 5AVXB 3CCLP 2HYNA 1GI8B 1SFQB 5LH8A 1QB6A 1VQNP 2BQ6B 2KS1B 3BG4C 3SJ9A 5C2ZA 4K35A 3BRTB 5TCCA 3I78A 2E74B 2AEMA 3FP8E 2DW3A 2G8TA 4NCYA 1UTKA 4MG3A 3AEEC 1BDDA 1ELBA 1XKBC 5AHGH 3TH2H 2NU4E 1YWUA 3GCTG 1N73C 1JY3P 3BV9B 1IFDA 4Z1MD 1P05A 3O8BA 3M91A 4DT7B 4EYYQ 2EEKA 2H9EH 1KYOH 5CCHC 5AVVB 4UB6H 1Q82Q 1GL1A 1ZMLA 1VQPP 2WUCA 2Z6BD 4X1NU 1HAGE 2WZQA 4JZIA 1NESE 3GDSA 1PFIA 1RIWB 3V6IA 1ZRTD 1O2PA 1TRMA 2BD7A 2L74A 4MNVA 1ZR2A 4Q7YA 3ZDMA 5CMZA 2PP6A 2KS1A 5AW9B 1FONA 3E8LA 2Y81A 2Y9YA 1PP9G 3O8ZA 1DD3A 2IPHA 4JYBA 1TQ0B 1Z71A 3RBXA 2XKMA 2RN0A 2I6SA 1C5MD 1URQD 1CW5A 1TNKA 4B2CA 1DH3A 1H4WA 3CCQP 2XNXA 2BCCJ 3MIWA 1WTHD 2H2ZA 2PTNA 1ZOYC 2W26A 3A7YA 1VPCA 1Q81Q 2A5IA 4GSOA 4AN7A 1OOKB 2GV6A 3IAOA 4X1RU 3PMAB 5A09A 1VGCC 4BRYA 1MMJN 2JIZD 3CCJP 2TBSA 4FETA 2B8OH 1BTPA 2ZT9D 4I32A 1U6QA 1L0ZA 3H1LD 1O2NA 4OGXA 1MKWH 4I7ZB 1TA6A 2VWMA 1BRAA 1FAVA 1EOJA 4DIIH 3PMHB 5F6MA 2P3TB 1MKXH 5AFYH 2J34A 3L6PA 4X0WU 4DT4A 3GCHB 2QN5T 3VMAA 1V2OT 2O8MA 5GPIB 4H6TA 3SW2B 1LDTT 4I8JA 1AWHB 4YTAA 1G3DA 1OKXA 3F9HA 3RXQA 1QX8A 5EXNA 1AJYA 3RU4E 1BE3D 2C3SA 4OM9A 1LHEH 5FX5A 1B0FA 1SQQD 2C0XA 2YOLA 3H1KD 1SQBE 2E76C 3L73D 1RXPA 1V2TT 1LKBA 1A7SA 1IQLA 1YQ4C 2HR3A 3MUDA 4IN2A 1D3QB 1O3GA 1M9UA 5EW2H 1SGYE 4X6OA 1DY9A 1CQQA 4JMYA 1EDKA 2J95A 1AUTC 1JMMA 1GJCB 2PKSC 1OWDA 1OW7A 2HLCA 1LTTC 1VDFA 1H8IH 3E1XB 4TY7A 3ODFA 2HPQH 3L4FA 5KLVJ 1H0TA 3ZVAA 1Y9BA 1P2JA 5HYOA 5E0GA 1T8ZA 2J4IA 1NFYA 3RXTA 3LJJA 1NKNA 1TX6A 3V2RA 4OGQC 1RRKA 2CK3D 5AVQB 2ZGJA 1MTUA 4ASWA 4X8SH 5KLIB 4WJG2 1ESBA 7GCHG 1D3PB 2ANWA 1ARCA 4IS5A 1L0NG 2WITA 1D9IA 5IYTA 3RDZA 3SN8A 1DEBA 2ZFFH 2AERH 4DGJA 2Z9GA 5J4SA 3PJSK 1INCA 1DDJA 3BTGE 3HGNA 5B6OA 1KILD 1KC8Q 3CCVP 1GVLA 1DD4A 1P12E 1ELDE 1DPOA 2W7UA 1O31A 2ZYDA 5T6DA 1LTIC 3RBZA 1B7XB 3RXFA 6LPRA 1GI0A 1QB1A 1F5RA 1QL8A 5GTIE 1FY1A 1SQPK 2VBCA 2SGQE 3FOAA 1KYOI 1X9VA 1YPLH 3Q3XA 2KI7B 1ZR0A 4K3JA 2R0LA 3TIUA 2M0BA 3L74E 5E79E 2CXVA 2FO9A 3NMDA 3MGNA 2JETC 3LJOA 3M9BA 1M56D 4B2AA 3SWYA 1MFTA 2BCCE 1ORFA 2ZF0H 1GMCF 1NYHA 1GI9B 1MKWK 1SQOA 5EJ1A 5F8ZA 1KMIZ 1GK6A 2QA4P 3M7QA 4ZNCA 1QJ1B 1GMDF 1A0LA 2OBQA 3B9FH 2ALPA 3URCA 3TK1A 2D26C 4ZAEA 2JP3A 4XOJA 1YJWP 1JCDA 4H44B 4N6JA 3MQKC 3FVFB 3M0DC 3CWBG 2K8IA 1Z8GA 3U69H 3VB4A 3D65E 5GTHE 3RMLH 1WAYB 4ASHA 3QZRA 2PFXA 5KAFE 1L0NJ 1GI2A 3A81A 3G71P 4WWIA 1OS8A 1SL3A 3PH0A 5FCKA 1NRPH 2SNWA 3PO1C 4AFQA 3TSIA 3P6ZB 3MO9A 2CPBA 3QH9A 3U1JB 2W6BA 1O3BA 1UHBB 5AVSB 3PROA 3RU4T 4NIVA 4ABJA 4OWFA 3ZZDA 2TRMA 1BJUA 2E74C 2H5CA 3SBKA 4RN6A 1MFZA 1AZ8A 2BY9X 3NWUA 1LTJB 4Z0KA 2OP9A 1HAVB 4EIJA 5F8TA 1QGFA 2OINA 2ZFPH 1J1EC 1D3DB 3HD7A 1LTSC 2M5TA 3N7OA 3TJVA 1EFRD 4KP0A 3ZIAD 2A4QA 2M3BA 4OGQD 2YXQB 1A5IA 1NVOA 4UFGH 1AY6H 2IBZG 1GI3A 4LXBH 1ZGVA 1E36B 1O2VA 1FQ3A 3OY5U 2J9NA 1DFPA 3VB6A 5APQA 1GHBF 2YNYA 1Z6JH 3Q2YA 3OA7A 3WUTA 4AX9H 3F3BA 5E0JA 3EQ0H 3PMJA 3V0XA 1BBRH 2JKVA 1H0TB 2AGGX 4M7GA 3STIA 1EJNA 1A46H 2IFNA 3OSYA 2UUYA 2VB0A 2AGIX 3RGUA 3PV5A 2WYJA 2ESTE 1VITH 1TABE 3L35A 3GF7A 1LTGC 1OXGA 2QJYB 1C5TA 1P9UA 5F03A 3KN2A 2FTLE 2HG5D 1V2QT 3GYMA 1YPGH 3OX7U 4WY4C 1VJ9U 1EZVE 1KMHB 3TGJE 2J92A 3QTOH 3KQGA 3IITA 1C1VH 1BIOA 1SQPE 1M90Q 3C1LA 1V3XA 3AW1A 3HPTB 1Y3WA 2BD2A 4PROA 1NRQH 3U8OH 5DG6A 3Q5SA 2FP7B 2J94A 3T97B 1X22A 3A8BA 2W6JD 5C1UA 1GD2E 5CHXA 3BTDE 2Q7CA 2A7JA 2AMQA 1P02A 5B66E 3PLBA 5JBTA 2BM2A 1W14U 2KM0A 1KFMA 3NRLA 3TK6A 1ETSH 3GY8A 3H7OA 3BTTE 4OS5A 1K04A 4A6LA 3N7EA 1SP4A 2E75B 1QRXA 4DVAU 4JF7A 5GCHF 2LP6A 5I25A 1SGFG 5H4IB 5KGOA 2QIWA 1CI6A 4WH6A 3O6QB 3CPWO 1N73B 4D76A 4XDEA 4CBOA 2ZG0H 1FZCA 1NTME 3BCCJ 2FY8A 1AUJA 2QJPC 1F5LA 3UTUH 1HAZB 2BVSH 2PR3A 3MU4A 3IWMA 4UE7H 3CCRP 2P93A 4Y0YE 3CL3D 3AEFC 1Q2NA 2FODA 3IG6B 1O2KA 2IZ1A 3L37A 3IFMA 4UDWH 1MUUA 1SQQK 3SQEE 4X2XA 3BG4B 4AQRD 1WV7H 4H44D 1NTKJ 3U9AH 1C1NA 1UK2A 2H89C 4L73A 1XUJA 3DHKH 1GBAA 1P9SA 4FUJA 3SNAA 3LH3A 5K0HA 1NTKG 1C1RA 2UWJE 4A1TA 1L4AD 3N7NA 1Y3YA 3HK3B 5AW2B 2ZPSA 3HGPA 4X8TH 4H0LD 2YKQA 1P0SH 2A06G 1RF1B 3O6QA 1CI6B 3SU2A 2JH6D 4SGAE 2ZIQH 3RXAA 2H88C 1O5FH 1TOCB 3ZVBA 5CJ0A 5TISE 1BSHA 1IQNA 2QF4A 1C2DA 3B5ND 4NPFX 2QJYC 2KAIB 2C93B 1SVPA 1AFQB 1LT9C 2M2AA 1HV7A 2ZNKH 2RMZA 4JYCA 4YPCA 4OS6A 5CBNA 4Y76A 1W5CE 2FPZA 3RXIA 2C90B 1CT2E
chains in the Genus database with same CATH topology
5APYA 1IK9A 4W7ZA 3VOPA 1T2KC 3R2PA 3RK2C 5AW6B 4N78D 1XTCC 3GHGC 1FZGA 1SFCD 1H88A 1L4AA 1J1DB 2I1JA 3T97A 1NKZB 1IC2A 2J59M 3KPEA 3HD7C 3P8CE 1GL2C 4I2LC 2N1TB 1NO4A 1G2CA 3RL0B 2NPSC 4N78E 3TYYA 2KP8A 1NH4A 2W27A 2HPCA 5AVRB 2XZRA 2R5DA 1GU4A 4GT1A 1JY2P 1URQC 3HE4A 3SWFA 4I1LA 2E43A 5AVUB 1S9KD 3VTPC 2FFDA 1T2KD 1KQLA 2LKMA 5AW5B 4DZOA 3A2AA 1JTHB 1GZLA 4IFMA 2H8PD 3EQ2A 1FOSF 1FZAA 1URQB 4RESB 1IFMA 1T3UA 2C0WA 1FBMA 2XDJA 3MD0A 1S9KE 3UIAA 2OYHA 3BATA 3LIEA 1YTZT 5AW8B 3U1CA 1WRGA 2C9LY 3HE5A 1SQBK 2A45H 1XTGB 2N1TC 5AVTB 1FJPA 1W2EA 3G3ZA 4ZKPA 1X79B 2KB7P 1IFIA 5KLVK 1AQ5A 2R3CA 1N7SC 1RE4A 3LIDA 1ZV8A 2WT7B 3P8CD 2JJLA 3EFGA 2Q9IA 1N2DC 1OWAA 3CLQA 4B86A 1RE3A 5AVZB 2KLVA 2R5BA 3V2NA 1LWUA 1Z56A 3VMXA 3P32A 2HPCB 5APUA 4M3LA 2KYVA 1QL1A 1L0LK 3TNUA 1JY3O 3BVHA 2WSEH 1T3JA 1CSBA 1LTAC 2NPSB 2FYUK 3RL0C 1H8AA 3OJAB 1FJKA 3BASA 2A45I 2XU6A 3U59A 2J58A 2C9NY 4HYTB 1RF0A 1SFCB 5APTA 2WTYA 1RE3C 1HBWA 1FOSE 2O01H 5AW7B 2Q3IA 3BRVB 5AVXB 2OYHB 2GUSA 2HYNA 1HUCA 4ZKUA 5APXA 3VN0A 1LTJC 1HJBA 3BRTB 2OYIB 5AW0B 2CPSA 1JO5A 1NAFA 1LT9B 3M9QA 1FU1A 1M7LA 2KSJA 2R32A 5CCHA 1N73C 4WY4A 1JY3P 1L4AC 1IFDA 5CJ4A 1OXZA 3M91A 3II6A 5CCHC 5AVVB 2L5GB 2FFDB 2H43A 4IFFA 3L36A 4AYCA 1YYCA 1PFIA 2OYIA 1N7SB 1ZR2A 1HWTC 5CMZA 2PP6A 3VYIA 5BU5A 5AW9B 1GDTA 3O8ZA 4W80A 1AFOA 4JYBA 2NPSA 2XKMA 2IX7C 4Y99B 1URQD 1CW5A 2POHA 1ZN5A 1CZQA 1DH3A 1L0NK 1IFJA 4W7YA 3MIWA 2XNXA 2QM7A 3M0DA 4XA4A 2Z4EA 3V4QA 1VPCA 1M1JA 1L4AB 1JY2N 2M8RA 2YMYA 2HLOA 2N9BA 1FAVA 4LC1A 3RK3B 2WT7A 1FZCC 1JY3N 1GW3A 3TNUB 1M1JB 1FDMA 2WSFH 1H89A 5BVZA 4Y99C 1LWUB 1A02F 2WSCH 2FYZA 1A02J 3NXSA 1JUNA 3VP8A 3KDPB 2C0XA 5KJ7A 1N7SA 1NU1K 4EOTA 3N4XA 3MUDA 5KTBA 1LT9A 1GL2B 2E42A 1JMMA 4XE5B 5APSA 4C7NA 3V2PA 4C7RA 1LTTC 1VDFA 2YO2A 3L4FA 1J1DC 1T8ZA 3M9HA 2HODA 5APWA 2H7HA 1NKNA 3V2RA 3RK2B 3VMZA 3RK3D 5AVQB 3A7OA 3VP9A 1URQA 2A45G 1SFCA 2WITA 2XV5A 3B5NB 1DEBA 1EQ7A 1FZCB 1YTZI 3KYQA 1NTKK 1KZUB 1KILD 2P1JA 1SVFA 1G2CB 2P2UA 5APVA 4GIFA 3NTNA 1GTWA 3CI9A 1LTIC 2WPRA 1NHLA 1MV8A 1SQPK 3M0AA 1X9VA 3IR9A 3A5TA 3NMDA 3MGNA 4WB4A 2OARA 3M9BA 4O9BA 3SWYA 4WY4D 1RY3A 3E1IA 5CCGC 1HH0A 1ZR4A 1GK6A 2HFED 3LW5H 3TK1A 1JCDA 4N6JA 1LWUC 2IPPA 3M0DC 1KFNA 1GK4A 1GU5A 4DOJA 1JCCA 2WZ7A 1JY2O 3H32B 3PP5A 3VMYA 1N86A 2YKPA 3HTKA 3TSIA 2CPBA 1RF1A 2W6BA 1N7LA 5AVSB 4N3YB 3OAKA 3HUSB 2O1KA 2O1JA 1MFZA 1E5WA 1LTJB 1KILB 4EIJA 1HGVA 2WWWA 3I5CA 2OYHC 5BU8B 1J1EC 4KHXA 2Z5IA 3HD7A 1LTSC 1SQXK 1HGZA 2M3BA 1FZBA 1J2JB 4HH2A 3RK2D 1IJDB 1IFNA 4C46A 1SLQA 1SQVK 1LTJA 3B5NC 1J1EB 5APQA 2YNYA 1FZEA 3OA7A 2GUVA 5AVWB 2HODB 4LLHA 2FKWB 2MJZA 2GM4A 2BASA 1M1JC 2WPQA 1DX7A 5AW4B 2IFNA 1GL2D 3HUSC 1JOCA 4C7NB 5KJ7D 4AUWA 1GL2A 3L35A 2Q5UA 1LTGC 1MZ9A 2HG5D 4WY4C 1N73A 5CCGD 1RF1C 3KQGA 3NFQA 2PAJA 3HRNA 2P7JA 2WPSA 3H32A 2N1TA 3M06A 3V4WA 3GHGB 4WBAA 3B8EB 3U1AA 1GD2E 5AVYB 5CHXA 1X8YA 2Q7CA 3GHGA 2W6AA 1KILC 1KFMA 4IFDK 3HD7D 3HE5B 3RK3C 1JNMA 4GKGA 1SP4A 1N7SD 2ZFCA 4JF7A 3MTUE 1CI6A 2VRSA 1G1JA 1N73B 3WMM0 2KOGA 1IO4A 1G1IA 2FXMA 1FZCA 1HTLC 3B5NA 1NTZK 2IFMA 1FZFA 3P8MC 4OH8B 3CL3D 1LGHB 1HVVA 1RF0C 1LTBC 3L37A 3V5BA 3IFMA 1MUUA 1SQQK 1JTHA 1NWQA 4AQRD 1NOHA 2P67A 1ZLLA 2QM8A 2I1KA 1L4AD 1NTMK 3N7NA 3RL0D 1SFCC 5CCGA 5AW1B 3HE4B 5CCHD 5AW2B 1QL2A 3C9IA 2Z5HA 2N1TD 1GW4A 2YKQA 3A3YB 1RE4C 4I6MC 2YKOA 1RF1B 1CI6B 2FFDC 3HTKB 4WY4B 5KJ7C 3V2QA 5CJ0A 1WT6A 3HD7B 3B5ND 2ZXEB 2NPSD 1KILA 2JEEA 3P7KA 1LT9C 5AW3B 4JYCA 3HUSA 4LGDE 2YO3A 3H6PA 2OYIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7S A;  3RL0 C;  3B5N C;  4W7Z A;  3VOP A;  1GL2 B;  3RK2 C;  1GL2 D;  1SFC D;  1L4A A;  5KJ7 D;  1SFC B;  1GL2 A;  2HG5 D;  3HD7 C;  1GL2 C;  3P8C E;  3RK2 B;  2N1T B;  3RK3 D;  4WY4 C;  1URQ A;  1SFC A;  5CCG D;  3B5N B;  3RL0 B;  2NPS C;  4N78 E;  2N1T A;  3KYQ A;  1KIL D;  5CCH A;  1URQ C;  4WY4 A;  1L4A C;  1NHL A;  5CCH C;  1KIL C;  3HD7 D;  1JTH B;  3RK3 C;  2H8P D;  4WY4 D;  1N7S D;  4JF7 A;  1N7S B;  5CCG C;  2PP6 A;  1URQ B;  2HFE D;  2KOG A;  4W80 A;  3B5N A;  2XDJ A;  2NPS A;  4OH8 B;  3M0D C;  1HVV A;  1URQ D;  4W7Y A;  1JTH A;  2WZ7 A;  1XTG B;  2N1T C;  3PP5 A;  1L4A B;  2M8R A;  1L4A D;  2YMY A;  3TSI A;  3RL0 D;  1SFC C;  5CCG A;  1N7S C;  5CCH D;  2N1T D;  3RK3 B;  1KIL B;  3HTK B;  4WY4 B;  5KJ7 C;  3HD7 B;  3HD7 A;  3B5N D;  2NPS D;  1KIL A;  3RK2 D;  1T3J A;  4LGD E;  2NPS B;  5KJ7 A; 
#chains in the Genus database with same CATH topology
 4DJG A;  1D4P B;  5APY A;  5C20 A;  3QTV H;  3SGB E;  2FXO A;  2A5K A;  1SQV E;  3LW5 J;  3KCG H;  2O8U A;  3R2P A;  3UIR A;  1JOU B;  1TBQ H;  2V0B A;  3Q3Y A;  4NGA H;  1R5L A;  1FDP A;  3KQC A;  3MH4 A;  2Q6F A;  1QQU A;  1J1D B;  4A1X A;  1DWE H;  2GCT B;  3KID U;  5HIY A;  4ZKS U;  5ESB A;  1K1N A;  4NPD A;  1QLE D;  2VVV A;  1H9L B;  1PPF E;  4K1E A;  2PGQ B;  2V3M A;  3S9A A;  1T4V H;  5KED A;  4JZE H;  3VG8 A;  5I46 H;  1HBT H;  4NWL A;  1EAS A;  4N78 E;  1BDC A;  2G52 A;  2XBW A;  2ZU1 A;  3ZVD A;  2QAA A;  5EG4 A;  3P8F A;  1NH4 A;  8GCH G;  2W27 A;  1GJ4 H;  4FUE A;  3FX0 A;  4HKZ H;  4IGD A;  4GT1 A;  4IL6 X;  2CHA C;  2BY8 X;  1SGR E;  2Y82 A;  4ABH A;  3HE4 A;  1DXP A;  2FES H;  3UNQ A;  1BIT A;  4NFE A;  1EKB B;  4I1L A;  3U1I B;  3PM3 A;  2J98 B;  1S9K D;  1O3M A;  1CBW B;  3BF6 H;  4D6T J;  3A7X A;  1LVM A;  2ZAE B;  1O5D H;  1O30 A;  2YMK A;  4IFM A;  3F9E A;  1G9I E;  3EQ2 A;  4ABA A;  3G01 A;  1BGY E;  2QJP B;  1DSU A;  5DK1 A;  1GCT B;  3EE7 A;  1FZA A;  1URQ B;  1GDQ A;  3H1K E;  2W3I A;  3MWI U;  1Z8J B;  1E38 B;  2B5T B;  3QGJ A;  1KYO E;  1E79 H;  1FBM A;  4R8T B;  4DUR A;  1HAI H;  1YM0 A;  3UIA A;  3A82 A;  1E1Q D;  1E35 B;  3AE3 C;  1E34 B;  4H13 D;  3SV7 A;  2OYH A;  4GOD A;  3MU8 A;  2ZT9 C;  4X2V A;  1VQL P;  1OSS A;  1KLJ H;  2VIQ A;  3K9X B;  2OQU A;  3ABV C;  3HE5 A;  5K7R A;  1YHQ P;  1G30 B;  4VGC C;  2A45 H;  2I8D A;  2N1T C;  1K8A Q;  4BAK B;  1GI5 A;  1GJB B;  1NTP A;  3G3Z A;  2Y0C A;  2SGA A;  3ENS B;  5JPM H;  2PUX B;  1QA0 A;  1SKY E;  1X79 B;  2KB7 P;  2C8Y B;  3DSG A;  4OS1 A;  2ZGH A;  1K0H A;  1JRS A;  1N7S C;  2Z9I A;  3CWB J;  1ZTJ A;  5TJX A;  3P8C D;  3H1L E;  2JJL A;  1SQB D;  2JKH A;  2Q9I A;  4A1V A;  1DUA A;  3CLQ A;  4AZ2 B;  3SI3 H;  4B86 A;  1F5K U;  2AYW A;  4XD7 D;  2XCF A;  4BNR A;  2XC4 A;  2BB4 A;  2R5B A;  1UVO A;  4INH A;  4AOQ A;  1XUI A;  4GOE A;  1F92 A;  1SHH B;  2BTC E;  1LWU A;  2FOM B;  2Z3C A;  3EDX B;  5A8X A;  3U28 C;  2FEQ H;  1RGQ A;  4PV1 B;  1L0L K;  2BCC G;  1OW6 A;  1ELA A;  5T6F A;  1FE6 A;  2WSE H;  3A87 A;  1RFN A;  1CSB A;  1LO6 A;  5DPA A;  1LTA C;  1CGI E;  3A8A A;  3STJ A;  5KLV D;  4BAH B;  2F3C E;  1GBD A;  1N8R Q;  3UB0 A;  4YXD C;  4X6M A;  1V2J T;  1ZRT E;  2BXT H;  2Z9K A;  1V2M T;  1K28 D;  1O2Z A;  3VEQ B;  2R3Y A;  3MFJ A;  1F0R A;  1HBW A;  3W94 A;  4CHA B;  1OZH A;  1UII A;  4H0L B;  3Q5P A;  4Q80 A;  1BTY A;  3DSO A;  4K69 A;  2OYH B;  2GUS A;  1OP0 A;  3ZYE A;  1GVZ A;  5JYI A;  1BCU H;  2QGR A;  2ZZU H;  1AKS A;  2QV1 A;  5EXM A;  1BMA A;  1O33 A;  1BZX E;  1LTJ C;  4ZKO U;  1IQF A;  1IQK A;  2ZT9 B;  1HIA B;  3GCN A;  2OYI B;  5AW0 B;  1JO5 A;  1HAO H;  1NU7 B;  1G3B A;  4GOF A;  1VQ4 P;  3AE5 C;  1NAF A;  1MAX A;  1VCP A;  1O3E A;  3A8D A;  3FAO A;  1O3O A;  3DCL A;  2J97 A;  1FU1 A;  2KSJ A;  3CME P;  1TNH A;  1FNI A;  2FOA A;  3DFL A;  3HAT H;  5EPY A;  2AXC A;  2XND D;  3HKJ B;  1C9P A;  2OLG A;  1J16 A;  2Q6G A;  5CJ4 A;  2ZFT A;  2GDD A;  2ZFS A;  1AVO A;  4BXW A;  3II6 A;  1ZJK A;  2L5G B;  1K73 Q;  3ATK A;  5A8Y A;  3L72 D;  2IJD 1;  3PRB A;  2ZTY A;  3L36 A;  3RMN H;  4AYC A;  1CBW C;  2JR8 A;  5IDK A;  1C5S A;  3OY6 U;  5AVD A;  1N7S B;  2IBZ I;  4HB1 A;  1M1K Q;  3CCU P;  1T8N A;  1GDT A;  1ABJ H;  3GS9 A;  1T6A A;  1GHY H;  3ITI A;  2QRX A;  1Z6E A;  3KYG A;  1AFO A;  3H1H E;  2NPS A;  3SFE C;  1SQV G;  3T27 A;  4RO0 A;  1BHX F;  2HNT E;  4X2W A;  5GND A;  4FUH A;  4Y0Z E;  3MH6 A;  1KLT A;  1GBI A;  3TGU G;  2BD4 A;  2G55 A;  3PV4 A;  3FP6 E;  2FI5 E;  2CGA A;  2Z4E A;  1BDA A;  3AEB C;  3A8C A;  3GW6 A;  3L70 E;  1M1J A;  3B71 A;  5KAI H;  1S0R A;  3CS7 A;  3QK1 A;  4YO9 A;  4CRF A;  1DT2 A;  1IK7 A;  1M8O B;  1SQB G;  3L3T A;  2FIR H;  3SJK A;  1GVK B;  2HLO A;  1Z8R A;  1N6Y A;  4O3U A;  1S5L H;  4D6T D;  4LC1 A;  3RK3 B;  3ZZ9 A;  1C2E A;  3MH7 A;  1ZLR A;  1JY3 N;  1C5Q A;  3LPR A;  5E8E H;  3S9B A;  1M1J B;  2AXT E;  3TF5 A;  1FDM A;  2WSF H;  4JYT A;  4TWY A;  2E75 D;  2YNA A;  2KCO A;  3OYP A;  4ISI H;  2FDA A;  3L74 D;  1EAT A;  1C2L A;  2A2X H;  3RM0 H;  3T62 A;  1FIZ A;  1MD7 A;  2K9J B;  4IMQ A;  4NA9 H;  3ZZ8 A;  4LOY H;  1H8H D;  2KAI A;  2WV4 A;  3CP7 A;  3S1K A;  2P58 A;  1DWD H;  2W3K A;  1HPG A;  3H09 A;  1WXR A;  3NXS A;  1KTS B;  3CS0 A;  5E2O A;  3SHA H;  2PKS B;  1BMN H;  4AFU A;  4K3A A;  5GDS H;  4D6T G;  4YM9 A;  3BIU H;  2STB E;  4R4M A;  5KJ7 A;  1L0L G;  1S1C X;  1N7S A;  1VQ9 P;  1QNJ A;  1GJ8 B;  1HNE E;  3AE7 C;  1FUJ A;  1LT1 A;  2QXG A;  3NUM A;  1GL2 B;  4NSV A;  3VGC C;  3H1K G;  2D2C B;  1FMG A;  2KX4 A;  4XE5 B;  1TON A;  1O3A A;  4C7N A;  1S2E A;  5FPT A;  5LPE A;  3O8C A;  1VZQ H;  3PLP A;  1A0J A;  1MTW A;  1OWJ A;  2YO2 A;  2ZVO B;  1Y8T A;  5HXF A;  2FS9 A;  1VCW A;  1QJ6 B;  1SQT A;  3CC7 P;  1SLV B;  4E05 H;  1TPS A;  1O2R A;  1UO6 A;  3VMZ A;  3S7K B;  3RK3 D;  2XBV A;  1EZV I;  1BML A;  1GMJ A;  3VP9 A;  4YLU A;  3QUM P;  1X0T A;  1LPG B;  1EQ7 A;  1W13 U;  2HGT H;  1FZC B;  1T7C A;  1YTZ I;  3GDU A;  1G32 B;  4PV1 D;  3EE0 B;  3F9F A;  3R4Y A;  3V13 A;  3UNR A;  4EI2 A;  1HJ8 A;  4I31 A;  3SJI A;  1HDT H;  5APV A;  2P2U A;  1NY2 2;  3NTN A;  1OMI A;  1C5Z B;  4BAM B;  2FS8 A;  1IAU A;  2EY4 C;  2AGE X;  2RH0 A;  3H1I E;  2WPH S;  3A7V A;  3HK6 B;  5EPN A;  5HMA A;  1W7G H;  1KXD A;  1JBU H;  3M0A A;  1BRU P;  1V2V T;  3A5T A;  2GMT C;  4DCD A;  3WU2 H;  3NKK A;  3MMG A;  1XUG A;  1A4W H;  2OAR A;  3VXF H;  4O9B A;  1DWC H;  4WY4 D;  1RJX B;  2VIV A;  3BTM E;  3F68 H;  4GHQ A;  4E7R G;  1RY3 A;  2G81 E;  3M5L A;  6GCH F;  1PFX C;  1ZR4 A;  1C1T A;  3LW5 H;  1RQV A;  3FXE A;  3RXC A;  3WWB A;  2ZDV H;  1SGQ E;  3K2U A;  1VQM P;  3A83 A;  1MU8 B;  3DT0 H;  3MU5 A;  1CU1 A;  3RXV A;  2K9Y A;  1RH5 B;  4H4F A;  3GCH C;  4DOJ A;  1K22 H;  1SGT A;  1PZQ A;  2Q6D A;  1TOM H;  1JM0 A;  1EUF A;  4ZXX H;  3BTW E;  5ABW A;  3L70 D;  4YOG A;  2O8L A;  1SOZ A;  3H32 B;  2QYI A;  4UFF H;  5T6G A;  2F4L A;  2THF B;  2KLU A;  3C27 B;  1KXE A;  2V3H H;  3JZ2 B;  1G36 A;  2FOH A;  2ZKS A;  4Y11 E;  5A0C A;  3HTK A;  4J1Y A;  1WCZ A;  2SGP E;  2PV9 B;  4WMF A;  2ZA5 A;  1N7L A;  4TT3 H;  3H1H D;  3D62 A;  3OAK A;  2FYQ A;  3A7Z A;  1OVV A;  4NIW A;  1O2G H;  3A89 A;  2O1K A;  1ZZZ A;  2O1J A;  2PGD A;  1T8L A;  1GHW H;  1AE5 A;  1CE5 A;  1UCY K;  5EQR A;  3VGC B;  2QJK C;  3H1J J;  1HGV A;  3BCC G;  3CC2 P;  3I5C A;  1GCD A;  4LZ1 H;  1BTH H;  5BU8 B;  4GDO A;  1P11 E;  5C0U A;  2E76 B;  2VU8 E;  4TWW A;  5CHA B;  3OE7 D;  4DJZ B;  1XVM A;  2G5V A;  1FZB A;  2NU2 E;  3K6Y A;  1J2J B;  4HH2 A;  2Y9Z A;  1O3H A;  2NU1 E;  4ABE A;  3LKW A;  3I55 P;  3NK8 A;  2CF8 H;  3F9G A;  4Y10 E;  1SLQ A;  1SQV K;  1SQP G;  1LTJ A;  1AZZ A;  5HGG A;  1YI2 P;  5JBB S;  2GUV A;  5AVW B;  3GCO A;  2HOD B;  3CX5 E;  1N8O B;  2OXS A;  2BAS A;  2OGU A;  2F43 B;  3OW2 O;  3E90 B;  1UHB A;  3RXD A;  1QCP A;  1AVW A;  5EOD A;  2WSE J;  1Q3X A;  3QO6 A;  1VQ5 P;  3HUS C;  3SU4 A;  1PYT C;  3E3T A;  4I7Z C;  1P3C A;  1TAW A;  1GMD G;  2ZO3 H;  4GUX A;  3KQB A;  1S4X A;  4Z6A H;  3BTH E;  1MZ9 A;  2K0Q A;  2O3J A;  2CJI A;  4U30 A;  4DW2 U;  5CCG D;  3E7K A;  1L0L D;  1PGO A;  4L74 A;  3BIV H;  1MKM A;  4MDS A;  4BAN B;  5A0A E;  1C5X B;  2A4G A;  3AED C;  3HRN A;  2GZ8 A;  3H32 A;  2V35 A;  2ZWL H;  1SPJ A;  5C1Y A;  3MZW B;  3EFF K;  3SJO A;  4D7F A;  5FCR A;  1IQI A;  2YNB A;  1MZD A;  3WWF A;  2JWD A;  5KAI E;  1ZPZ A;  4FU8 A;  2OTJ P;  2V6N A;  4WBA A;  2GD4 B;  5AVY B;  1W11 U;  3TNT A;  1X8Y A;  4B71 A;  1TRY A;  1YLD A;  3GHG A;  4VGC B;  4Q7Z A;  1O2X A;  4XBD A;  4FUD A;  3ITK A;  2D2D A;  2B87 A;  2JO1 A;  1YGC H;  2Z9J A;  4CRE A;  1KV4 A;  1P2Q A;  2ZTX A;  4HJG H;  1FDO A;  4A7P A;  1S6L A;  1VJA U;  4ZHL U;  2ZFC A;  3LH1 A;  1GJ5 H;  4MNW A;  1IQM A;  1NRR H;  1KB9 H;  1GJ9 B;  1OWI A;  3KL6 A;  1G1J A;  1OWE A;  5EQS A;  4Y71 A;  5JBC S;  1QEX A;  1EB1 H;  5HIZ A;  2Q6Q A;  3FWL A;  5AF9 H;  1V2S T;  2IFM A;  2AS9 A;  2HLD D;  1NO9 H;  2A1D B;  2OQQ A;  1ACB E;  1CO7 E;  1O0D H;  2ZDM A;  1RF0 C;  1HXF H;  1ZW0 A;  1QRW A;  1YBW A;  1YLN A;  2D1J A;  2EI6 A;  2NU3 E;  4GPG A;  1SQB J;  1O2H A;  2H9T H;  1YJN P;  1NU1 E;  1LHF H;  1L1N A;  1ZPB A;  4ASU D;  1O2T A;  4UB8 H;  2FYN C;  2SGF E;  1FV9 A;  2YMS D;  3M5M A;  1SFI A;  5DKM A;  2PKA B;  1A5H A;  2KZ4 A;  3RL0 D;  1PP9 D;  4GCH F;  2WV9 A;  1FXY A;  2BD8 A;  1SQX E;  3AEC C;  5TIS H;  1KIG H;  2N1T D;  1GW4 A;  1VQ7 P;  4NFF A;  3RXK A;  2SFA A;  3A3Y B;  2BHG A;  1S72 P;  3MP7 B;  4A5T S;  2ANM H;  3TJN A;  2ZHF H;  3ATI A;  4WY4 B;  3V2Q A;  1WT6 A;  1FN8 A;  2L6O A;  2Z7F E;  2XND H;  3GY6 A;  3LT3 A;  2VWN A;  4THN H;  1XVO A;  3Q3K A;  1YPH E;  2H5D A;  1KIL A;  1YCP H;  3P7K A;  3WUU A;  1OVU A;  4RSP A;  2NZ2 A;  2A7C A;  2KNC A;  4MPV A;  3HUS A;  3SUG A;  2OYI C;  3A0B E;  2AFQ B;  1ZSL A;  2A4R A;  4W7Z A;  9LPR A;  1ANB A;  3VOP A;  1K1I A;  1O32 A;  1KQS O;  2TIO A;  2TGP Z;  3QX5 H;  2GZ9 A;  4X2Y A;  3RK2 C;  1HFD A;  2TGD A;  1CVW H;  2ZCH P;  3GHG C;  2QXI A;  3KEE A;  1FZG A;  3PMB B;  2ITA A;  5GCH G;  5LPR A;  1BRB E;  1HB0 B;  2B9B A;  4DCK A;  1AMH A;  3PLK A;  4ISL A;  4RKJ B;  4TPY A;  3EA7 A;  3V12 A;  1TNL A;  2FXR A;  4TY6 A;  3LGI A;  3S4R A;  3T97 A;  1NKZ B;  1KXC A;  1P01 A;  2BMG B;  4YXW H;  1SGF A;  3LC3 A;  1GG6 C;  3KPE A;  2ZCL P;  3PYH A;  1SOT A;  4UEH H;  3SNB A;  1GL2 C;  3O8R A;  4I2L C;  1NO4 A;  4U3F J;  3QWO C;  3MNC A;  4L75 A;  1BGY G;  1SR5 C;  5L8R J;  1JIR A;  1G2C A;  1ELC A;  4KGA A;  5B66 H;  1A2C H;  1CHO F;  4X1Q U;  3TYY A;  1ZMN A;  2KP8 A;  3LU9 B;  3N99 A;  1ELT A;  3QDZ B;  4I8H A;  3TDK A;  2HPC A;  2V3O H;  2BVR H;  1BCC E;  2R5D A;  4PV1 C;  3TGU J;  1GU4 A;  3FN8 A;  3T26 A;  3LON A;  3AAV A;  1JY2 P;  4INL A;  3AE9 C;  4WWY A;  3SZE A;  1ABI H;  2VJ1 A;  1UVS H;  2PGB B;  4F49 A;  1MCV A;  1QL7 A;  1BTU A;  1UTP A;  3SV6 A;  1AGJ A;  1CT4 E;  1KQL A;  5AW5 B;  2F9P A;  1ZRB A;  5K5G B;  4PD4 D;  2FTM A;  3T5F H;  1HGT H;  3JCU H;  4F48 B;  1GBF A;  4NA8 A;  1GJ6 A;  2H8P D;  1KIL E;  2YMS B;  1QIX B;  3EGK H;  3GYL B;  2XNI A;  4WH8 A;  1XMN B;  4B76 A;  1QHR B;  1FOS F;  3NPS A;  5HM2 A;  1GMH G;  2WPL S;  3UPE A;  3MUD C;  2C0W A;  5AFZ H;  2LR2 A;  2FBW C;  1YPM H;  2F9N A;  2J5U A;  3L71 G;  1PPB H;  3PB1 E;  4DG4 A;  3ZZ5 A;  1MTS A;  1NU1 G;  4AYY B;  3BAT A;  3LIE A;  5M1B A;  5AW8 B;  3U1C A;  1USD A;  1TBR H;  2Z3E A;  2ZHQ H;  4ABI A;  2C9L Y;  2BD3 A;  2OC1 A;  1O37 A;  3BEI B;  1XTG B;  1SBW A;  1K1M A;  2HWL B;  1W2E A;  3H25 A;  4DOQ A;  1EDL A;  2YIU C;  2L91 A;  4ACA A;  4ZKP A;  1AKS B;  3R0F A;  2EC9 H;  1AQ5 A;  1FPH H;  2TGA A;  1MH0 A;  2R3C A;  2EI7 A;  2I6Q A;  1J9C H;  2GKV E;  1FS0 E;  1HAX B;  4RT1 A;  2WV5 A;  1AVY A;  1ZME C;  1D6W A;  3ATL A;  2WT7 B;  3DA9 B;  3M5O A;  3F2H A;  1ANE A;  1KTM A;  3EFG A;  2EQN A;  2GT8 A;  4MQA A;  1FY8 E;  1AV1 A;  5EGM A;  2Q3E A;  3H1J E;  1F7Z A;  5CBO A;  1V2N T;  5ETX A;  3BTK E;  1Y3V A;  2O01 J;  2M5A B;  3D6Z A;  8GCH F;  4FU7 A;  1W0Z U;  1Z56 A;  1UIX A;  3RXL A;  1WMK A;  5T1V A;  5L30 H;  2BZ6 H;  1OFC X;  1C5P A;  5DSF A;  1H9H E;  1QL1 A;  2E5Y A;  3GF3 A;  3TNU A;  1DE7 H;  1WSS H;  2F9O A;  2WPK S;  5LGO A;  1T3J A;  1NT1 A;  2JET B;  4ABD A;  4QT8 C;  4R4L A;  1XXF A;  1KXB A;  4UFD H;  1VL2 A;  2D2C C;  1NU9 A;  4NZL A;  2FYU K;  4GVU A;  1H8A A;  3D6Y A;  4HG6 A;  1L0N E;  1SGD E;  3PWB A;  2R2W U;  4YOI A;  5BPE A;  1L4Z A;  2WSS D;  1O2M A;  1WTG H;  3I29 A;  3BAS A;  3GY5 A;  4Y6D A;  2KK7 A;  1SQP D;  4CPG A;  2XU6 A;  2BDG A;  3U59 A;  1HLT H;  2J58 A;  1ZSK A;  4FOU C;  5JB9 S;  2BEZ F;  2BDH A;  3PTB A;  2IN2 A;  4HYT B;  1PYT D;  4X8U H;  1SFC B;  5APT A;  5IK2 D;  1TPO A;  3EYD A;  2A32 A;  4FVD A;  2RDE A;  7EST E;  2VNT A;  3BRV B;  1HAH H;  2HPP H;  4K60 A;  3Q00 A;  1J14 A;  3VN0 A;  3B8J A;  3Q76 A;  1JB0 J;  1HJB A;  1ETR H;  3FKS D;  4E7N A;  3ZZ7 A;  2ZPR A;  2QA9 E;  4AG1 A;  4IL6 E;  3H1H G;  4Q63 A;  3H1I J;  4JK5 A;  4JK6 A;  4K8B A;  5PTP A;  2R32 A;  5CCH A;  3P92 A;  1YPH C;  2KR7 A;  2ZQ1 A;  1L4A C;  3CWB E;  1C1W H;  1OXZ A;  1C2H A;  1RTF B;  2XXL A;  3RXO A;  4M9F A;  3SUE A;  2K37 A;  3USS A;  2XRC A;  2Y80 A;  1O2I A;  1U57 A;  1L2E A;  5HKK D;  2H43 A;  1SQX J;  3CWB D;  1PV3 A;  1JXP A;  1PPJ D;  1Z1I A;  1Y5B T;  1YYC A;  3L75 D;  1G3C A;  2WPI S;  4FUB A;  2P10 A;  3RMM H;  2E5T A;  1WYK A;  3D49 H;  3EAJ A;  5E2P A;  3M3S A;  3VYI A;  2WUB A;  5KKZ C;  2V7Q J;  5KLV E;  2ZJS E;  1ELE E;  2SPZ A;  2G4U A;  1K1J A;  2PTC E;  3ODD A;  4IBL H;  4XBB A;  1DWB H;  4W80 A;  4ABF A;  1TPA E;  1Q7Y Q;  3UWI A;  2KCY A;  4Y99 B;  2VIW A;  5DGJ A;  2B88 A;  2KSE A;  3UR6 A;  1XM1 A;  2QSI A;  2QCY A;  1P84 D;  1G2L A;  3AAS A;  3ZYD A;  1C2I A;  1AI8 H;  5E0H A;  1CZQ A;  2R44 A;  4H13 B;  2GMT B;  1L0N K;  3KNX A;  4XA4 A;  3M0D A;  5C3N A;  3KF2 A;  3V4Q A;  1EOL A;  3SSU A;  3H1J D;  1HJ9 A;  1OW8 A;  2OQ5 A;  2PUQ H;  2UUK B;  4AC9 A;  1Q31 A;  5GIB A;  3TJU A;  2YMY A;  1EPT B;  1L0L E;  2ULL A;  1QB9 A;  1Z7K A;  1GHA G;  3CC4 P;  3GG2 A;  2CMY A;  1YIT P;  1O35 A;  1YP9 A;  2FOG A;  2ZCK P;  3PO1 B;  1ZRK A;  1YIJ P;  4I8G A;  2N9B A;  4WF8 A;  1C5Y B;  3T28 A;  2ZXX A;  4H42 U;  1SQQ G;  2WT7 A;  4HZH A;  2R9P A;  3SV8 A;  4BRY B;  3M7T A;  4Y79 A;  2ZHE H;  3TNU B;  4CR9 A;  4F4O C;  2DE9 A;  2PRR A;  4Y28 J;  1C4Y 2;  4Y99 C;  5H2F E;  1LPZ B;  2CV3 A;  2DE8 A;  2WSC H;  3K5B A;  1G2M A;  2J38 A;  2ZDA H;  4ZKN U;  2FYZ A;  2WSS H;  1ZHM A;  1GI1 A;  3LOX A;  1NFW A;  2Z94 A;  3RXP A;  2GCH F;  1AFQ C;  1PPZ A;  3SND A;  2AIP A;  1KYO D;  1UW7 A;  3VP8 A;  2FOB A;  3KQD A;  4OS7 A;  5CHA C;  1BTZ A;  3EWK A;  5DJ7 A;  1V2P T;  3RUO A;  2PLX A;  1NU1 K;  1S84 A;  1TGB A;  1UTJ A;  2VH6 A;  3N4X A;  1GI4 A;  3UWJ H;  1LT9 A;  4ASV A;  4UFE H;  3TU7 H;  1GPZ A;  3JSV C;  2SNV A;  1VIT G;  1TGN A;  4JZF H;  1SGI B;  2HVX A;  1GG6 B;  2E42 A;  4FU9 A;  3L72 J;  2W83 C;  5APS A;  1TX8 A;  3KGP A;  4B1T A;  1CA8 B;  1GHV H;  2UUF B;  2FYU D;  3ZZ4 A;  1GMH F;  1J1D C;  3RK3 E;  1BBR E;  3MU0 A;  4FUG A;  2BY7 X;  1HUT H;  3M9H A;  5APW A;  4HGC A;  1T32 A;  3L74 G;  2LEL A;  3QLP H;  2FOF A;  1LP1 B;  1Y3U A;  3A7O A;  4IL6 H;  3KHU A;  2W6J H;  1DLK B;  1TE0 A;  1ZGI A;  2JWA A;  5KLI C;  3LDX H;  4SGB E;  1NC6 A;  1EP6 A;  3C1K A;  3B5N B;  3BEF B;  4MNX A;  2PFE A;  2P3F H;  4P02 A;  1K1L A;  4JYU H;  5JDU B;  1BGY D;  3KYQ A;  1NTK K;  3GLM A;  1KZU B;  2WQY C;  3EST A;  2P1J A;  1SVF A;  2AHM E;  1G2C B;  2B89 A;  2H9H A;  4GIF A;  1BHX B;  1S82 A;  4IC5 A;  2P94 A;  4ZUH A;  5DJU B;  1DX5 M;  1VQO P;  3LC5 A;  1KXF A;  2VID A;  1C1S A;  2BLW A;  3G4S P;  3AE4 C;  1NHL A;  1YPK H;  1MV8 A;  3P8N A;  4CRG A;  1QFK H;  1O5B B;  1NN6 A;  2F9U A;  1L0L J;  2ZFR H;  4K1T A;  1PPG E;  2PWX A;  3H7T A;  3RXH A;  2Y5H A;  3JCU E;  4OGY A;  2BX4 A;  1S6H A;  3B23 B;  1K2I 1;  1EC5 A;  1SQV D;  1XXD A;  1KN7 A;  1BMM H;  1MQ5 A;  3S9O A;  5CCG C;  1O3J A;  2N9Y B;  1MTV A;  2HFE D;  1NS3 A;  1ETT H;  2LPR A;  4GHT A;  3RXM A;  4I8L A;  2BY5 X;  1PPC E;  3NXP A;  3BCC E;  1LWU C;  5DJT B;  2A31 A;  1THS H;  1FAK H;  1RS0 A;  1GK4 A;  2JH0 D;  1JCC A;  1RTK A;  2G5N A;  3L72 G;  1GBK A;  2UWP A;  2IPQ X;  2ZGC A;  5FX6 A;  1JY2 O;  4BTT B;  3BSQ A;  5B5E H;  3PP5 A;  1N86 A;  1EXI A;  4RT0 A;  1DXW A;  1PIX A;  4JBZ A;  3MYW A;  2RFK C;  1DIC A;  1RHZ B;  1P2O A;  2XTT B;  1FC2 C;  2Q1J A;  1XUF A;  3CXH H;  1EZU C;  2RA3 A;  1TNJ A;  1HAP H;  1IQE A;  1ZJD A;  2ZI2 H;  3HUS B;  1TA2 A;  1S5S A;  3Q77 A;  4BTI B;  1PP9 E;  1O2J A;  9EST A;  1V2U T;  2VWL A;  1O3P B;  1SGN E;  1E5W A;  4ZMA H;  1NJI Q;  1DVA H;  2ANK H;  1KIL B;  1QBN A;  1EDI A;  1KYN A;  1O2Q A;  1UJ1 A;  5A8Z A;  6CHA B;  2XWA A;  5GWZ A;  2OYH C;  1VQK P;  3TGU E;  1BCC J;  1C4U 2;  1VQ6 P;  4PJ0 H;  4ZMD A;  1LJ2 A;  1V2W T;  4YT6 H;  1TGT A;  3L70 G;  1TX7 A;  5L2Z H;  2QF0 A;  1HGZ A;  3F6U H;  2XW9 A;  1THP B;  2HNT C;  4WMD A;  3OEH D;  3A86 A;  2YMS C;  3KXD A;  1IJD B;  1IFN A;  1NTM D;  4C46 A;  2PHB A;  3MOC A;  1C1O A;  5FBI A;  1FLE E;  2QG4 A;  3B5N C;  5EJZ A;  1QVG O;  2QC2 A;  5DP6 A;  2WPD D;  3RXE A;  4CRD A;  4XE4 A;  3CX5 I;  1ZHR A;  2PKA A;  1PQA A;  3VPK A;  2CK3 H;  1NTZ D;  2A4O A;  1IFP A;  2ZHW H;  5C0T A;  1UK4 A;  4X6P A;  1DX7 A;  2M3E A;  1V6D A;  1KTT B;  1P03 A;  2GT7 A;  1JOC A;  4L76 A;  3U98 H;  2XBY A;  3V3M A;  3SQH E;  4KTC A;  3P8O A;  4AG2 A;  4AUW A;  3ATW A;  6GCH G;  1HRT H;  4B74 A;  1C2M A;  5KAF H;  1DIT H;  3AE1 C;  2Q5U A;  1THR H;  4ACB A;  1FZZ A;  1HJ0 A;  1O2U A;  4IC6 A;  1C1M A;  2V4H A;  5H2F H;  4D6T E;  3MH5 A;  1BA8 B;  1H8E D;  1SQA A;  2F9V A;  5L6N H;  1NBM D;  4KKD A;  4BAQ B;  1F0S A;  2LXC B;  3NFQ A;  2WPS A;  4X8V H;  4IN1 A;  4JCN A;  2BOK A;  3M06 A;  1OX3 A;  2BZA A;  3MNX A;  4A7I B;  2B87 B;  1GHA F;  5LPF A;  3V4W A;  3RXB A;  4QMA A;  3GHG B;  1GHX H;  2GX4 A;  2AMP A;  3B8E B;  1P57 B;  1W8B H;  4AYV B;  1SG8 B;  1Y8A A;  2A5A A;  2QF3 A;  4WVP E;  3UNS A;  2QY0 B;  2W6A A;  2Q1K A;  1BTX A;  2QJK B;  1LPK B;  1K21 H;  1TWX B;  3PHL A;  3QGN B;  4I7Y H;  1F0T A;  2GV7 A;  3F2F A;  3HD7 D;  8EST E;  3HE5 B;  1SC8 U;  1JNM A;  7KME H;  1P3E A;  4FVB A;  4D9Q A;  2G3A A;  1N7S D;  3CX5 D;  2B9L A;  2Z9L A;  1SQX G;  5DP5 A;  3RC5 A;  1AFE H;  3MNS A;  3MTU E;  1ELG A;  4XFJ A;  3A85 A;  1KSN A;  1BBR K;  1NU1 J;  2ZEC A;  1X7A C;  2AXT H;  3GOV B;  1G1I A;  3L71 J;  3M61 U;  1NBM E;  1GCT C;  2KFW A;  3CXH I;  2ODY B;  3FO8 D;  3TNS A;  4CR5 A;  1FZF A;  3A7W A;  2ZEB A;  3P8M C;  1HJA B;  5B5E E;  4OH8 B;  4YLQ H;  1SLU B;  3SU5 A;  1PQ7 A;  3H1I G;  2BDB A;  1LGH B;  3H1H J;  3FFG A;  4IMZ A;  4NZQ A;  1PGP A;  4ZXY H;  1LTB C;  1BT7 A;  3V5B A;  1O39 A;  3L71 E;  1DLE A;  2OD3 B;  3K65 B;  1EZX C;  3NCL A;  4LZ4 B;  1NWQ A;  4FUC A;  1NOH A;  2OTK E;  3TGU D;  2IOT A;  2FX4 A;  1IQJ A;  1GBJ A;  3Q1M A;  4IOI H;  1KLI H;  3RM2 H;  1LQE A;  2QM8 A;  2I1K A;  2J98 A;  2UWO A;  1UTQ A;  4ISH H;  1LTO A;  2KCA A;  5EQQ A;  4MPU A;  5CCG A;  5GJ4 B;  5AW1 B;  1CGH A;  3HE4 B;  3CCS P;  1ESA A;  3C9I A;  3TK9 A;  2Z5H A;  3A84 A;  1D7M A;  4INK A;  2YKO A;  1YPE H;  4NG9 H;  4TYD A;  3HTK B;  5SGA E;  1AU8 A;  3W1E A;  1U7M A;  4XFQ A;  1KQF B;  3M37 A;  2FI4 E;  4HFP B;  1L4D A;  2E74 D;  2NPS D;  1MBQ A;  1C5V A;  1ELV A;  1OVR A;  2JEE A;  1EZQ A;  1K1P A;  5FAH A;  1GI6 A;  2ZU3 A;  5DP7 A;  2GCT C;  3E6P H;  2O01 N;  2A7H A;  3U8T H;  2BVX H;  5EU8 A;  1JRT A;  3SGA E;  1SGP E;  1TAL A;  4K5Z A;  4B73 A;  3FZD A;  3I77 A;  1SGE E;  4BTU B;  4MN4 C;  4OGQ B;  5J4Q A;  2OC8 A;  1GI7 B;  1W3C A;  2D2C D;  1P10 A;  4ZRO A;  3MU1 A;  2HOB A;  3SV2 H;  1H88 A;  3TLO A;  1L4A A;  1AQ7 A;  1QBV H;  4CHA C;  2I1J A;  2IYO A;  2RCE A;  4CRB A;  5C1X A;  1COW D;  1EPT C;  2ANY A;  3SU3 A;  1LVB A;  2PW8 H;  2J59 M;  4RJT A;  2DUC A;  3SOR A;  2K1Q A;  3HD7 C;  2N1T B;  4YZU A;  3P17 H;  1QA7 A;  4RI0 A;  3ZVG A;  3FAN A;  1JEK A;  3D70 A;  2ZYA A;  1O2L A;  3RL0 B;  1OWH A;  1XKA C;  2K1A A;  2FWW A;  3BG8 A;  2Z3D A;  5C17 A;  5DO4 H;  3CNR A;  1C1Q A;  2WHX A;  4ZCN A;  4Y8Z A;  3UUZ A;  2XZR A;  1VF5 B;  1GL0 E;  4GCH G;  1P84 H;  1OYT H;  4WME A;  2JJ1 D;  1URQ C;  2BDY A;  1E1R D;  1AQT A;  3GY2 A;  3CD6 P;  1WQS A;  2E43 A;  1S0Q A;  5AVU B;  2TGT A;  5FBE A;  1PP9 J;  2JDI H;  1N8O C;  3VTP C;  2FFD A;  1RIW C;  3DUX H;  1MTN C;  5FPY A;  1BMF D;  3AEG C;  2YXR B;  1TLD A;  2ZTZ A;  1W0Y H;  1MD8 A;  4ABG A;  2G8Y A;  1TMB H;  1UCY E;  2KCP A;  1U7J A;  1GZL A;  3E0N B;  1EJA A;  5EXL A;  4Y8Y A;  1S83 A;  3UOP A;  3E1R A;  5C39 A;  3RLY H;  3L73 E;  1FDI A;  4RES B;  1PPH E;  3OU0 A;  4O9V A;  2MKV A;  1T3U A;  1SS1 A;  1ZTK A;  2ZC9 H;  3ZV9 A;  2XDJ A;  2OCV B;  1SQX D;  1D3T B;  2BDI A;  2R3U A;  5KLV G;  1TNG A;  3OTP A;  3SNC A;  4BWN A;  4CH8 B;  3M5N A;  1Q90 D;  1DOJ A;  1YTZ T;  2ZU4 A;  3CX5 H;  1JIM A;  1WRG A;  1AHT H;  1FY3 A;  2H1U A;  1ID5 H;  2P16 A;  2FYU E;  5AVT B;  2F91 A;  3G9R A;  3AE2 C;  4YTP C;  1C2J A;  4I33 A;  1S3J A;  1F0U A;  5JB8 S;  4H0L C;  2AEJ A;  2WVR A;  2VVU A;  3GIS B;  1GHZ A;  2XC5 A;  2BDA A;  5KLV K;  5E79 H;  4O03 A;  3GCT F;  4J2Y B;  1TNI A;  3SI4 H;  1P2M A;  2FYN B;  3W67 A;  3S7H B;  1ZV8 A;  1ZYO A;  4OS4 A;  5GTI H;  3CCE P;  4LK4 A;  1QQ4 A;  4OS2 A;  1N2D C;  1OWA A;  1Z8I B;  1C5U A;  1MAY A;  1KXA A;  2A0Q B;  3ZZB A;  1Y5A T;  2Y7X A;  2ZP0 H;  1S81 A;  2KLV A;  4DT0 A;  4AGK A;  4DIH H;  3N7D A;  4ZH8 A;  3AEA C;  3RL0 g;  1CHO G;  2K88 A;  2Y7Z A;  3V2N A;  3ZVF A;  2FYR A;  2QE7 D;  2V7Q D;  2VIP A;  1TPP A;  1MCT A;  3OAA D;  3VMX A;  2HPC B;  3P32 A;  1P09 A;  2GJG A;  4NIX A;  1DUE A;  2FOE A;  1CT0 E;  2ZQ2 A;  1Y47 A;  1A0H B;  2KYV A;  1UTL M;  3BVH A;  1MQ6 A;  2FYU J;  4JYV H;  2AEF A;  1LKA A;  4AGJ A;  2NPS B;  1T8O A;  2IDB A;  3RL0 C;  1WOF A;  3UQO A;  1FJK A;  1WBG B;  1R5S A;  1AN1 E;  1H8D H;  1Z1J A;  3L75 E;  4FUF A;  4D8N A;  1YCP M;  3DD2 H;  1AIX H;  3RXU A;  1SMF E;  1YJ9 P;  3W95 A;  1LHG H;  3DFJ A;  1TFX A;  2KZI A;  3TIT A;  2FLB H;  4EST E;  1ZOM A;  3L72 E;  1EJM A;  2ODQ A;  2Y0E A;  3FGA D;  2QEX P;  2C9N Y;  1EP5 A;  2B7D H;  1A5G H;  4Q2K A;  1RF0 A;  1QR3 E;  1RE3 C;  1LHD H;  4ZHA A;  1FOS E;  1P84 I;  2O01 H;  2XCN A;  1O2Y A;  1KOR A;  2OYO A;  1EST A;  2Q3I A;  3D71 A;  3P8G A;  1HUC A;  3BN9 A;  4ZKU A;  1CHG A;  5APX A;  3M35 A;  3WU2 E;  1P2N A;  1SHY A;  3M3T A;  4BOH A;  2KNC B;  2HNT F;  3AE8 C;  3P95 A;  4UD9 H;  3S0N A;  1ZHP A;  2O8W A;  2CPS A;  1CSO E;  1AB9 C;  1BE3 J;  3URD A;  2ZU2 A;  2KUB A;  1C4V 2;  4ZHM U;  4U7J A;  1H9I E;  5BRR E;  1YY3 A;  1O2S A;  2SGD E;  3DSP A;  4Q4L A;  1LT9 B;  3VFE A;  3M9Q A;  1NRN H;  2OUA A;  1M7L A;  1EB2 A;  1ZPC A;  1CA0 B;  4Y7B A;  1TGC A;  4WY4 A;  4U3F D;  4KJM A;  3SU0 A;  1YLC A;  3RC6 A;  3A0H E;  2QXH A;  1O2W A;  2C8Z B;  3UR9 A;  2FFD B;  3TK5 A;  4IFF A;  4U3F E;  1E79 D;  1UVT H;  2ZDN A;  2QVA A;  1W2B O;  2XWB I;  5TJH A;  1MTN B;  3EA8 A;  4CRC A;  1PJP A;  1P2K A;  1ZMJ A;  2C8W B;  2W90 A;  3KQ5 A;  4MLF B;  2OYI A;  3ZZ3 A;  2OBO A;  3GY3 A;  1HWT C;  1YYY 1;  2P3U B;  2NU0 E;  2BD9 A;  5BU5 A;  1OPH B;  2CHA B;  1VF5 C;  3O8D A;  1UK3 A;  4TLF A;  2IX7 C;  2RKL A;  4TSF D;  1A1R A;  3CCM P;  3T25 A;  2POH A;  1C2F A;  1ZN5 A;  2BLO A;  3MI4 A;  4B2B A;  7GCH F;  2BDC A;  1IFJ A;  2NRG A;  4W7Y A;  2QM7 A;  1W0K D;  1TU3 F;  2BOH B;  1USE A;  3MHW U;  1GBH A;  1QZ8 A;  3K6Z A;  4YOJ A;  2KZJ A;  1L4A B;  2VH0 A;  1V2L T;  2XOK D;  1JY2 N;  2M8R A;  1YQ3 C;  2EA3 A;  1QBO A;  1KDQ B;  3CEN A;  3PRJ A;  3U8R H;  2IBZ E;  1QTF A;  3VB3 A;  4AFZ A;  3LGY A;  1EZV D;  1NFX A;  3B4S A;  1C5R A;  2TPI Z;  1FZC C;  1O5A B;  5DP4 A;  1TGS Z;  1GW3 A;  3RXG A;  2KIK A;  4YT7 H;  2C4F H;  1T31 A;  1H89 A;  5BVZ A;  1W0J D;  3TGI E;  1LWU B;  2WSC J;  1A02 F;  2ZVN B;  3F5H A;  4KTU A;  1EQ9 A;  4WXI A;  4YES B;  4MNY A;  1A02 J;  1DAN H;  1SQP J;  2GP9 B;  3S9C A;  1AND A;  1AVX A;  4B6F A;  3SU1 A;  2IJO B;  1V2R T;  2ZHD A;  4Y8X A;  1L2P A;  1B0E A;  1FAX A;  2CF9 H;  3RP2 A;  4AOR A;  1JUN A;  1C5N H;  3WW7 A;  1PGQ A;  3H1I D;  1N6X A;  3KDP B;  2F83 A;  3F1S B;  1GBB A;  1BJV A;  3E91 A;  4EOT A;  3KYF A;  1XUK A;  5KTB A;  3F0O A;  4WY3 A;  2R2M B;  2Y5G A;  3L73 G;  2D8W A;  4K2Y A;  1O3N A;  2QXJ A;  3V2P A;  4C7R A;  1UCY H;  2G00 A;  3TPI Z;  3M36 A;  1HYL A;  2BEQ D;  2Y5F A;  3FZZ A;  2HOD A;  1O38 A;  2H7H A;  1AD8 H;  3SYJ A;  3RK2 B;  1OP8 A;  1W12 U;  3UQV A;  3TGK E;  3JZ1 B;  1URQ A;  2A45 G;  3SOS A;  2HAL A;  4OVN F;  1SFC A;  4WVZ A;  2SGE E;  4NA7 A;  3VXE H;  1M57 D;  1GJA B;  2XV5 A;  1SI5 H;  2CN0 H;  5FPS A;  4UB6 E;  3MHV A;  1J15 A;  5FL7 D;  1LVY A;  2WPJ S;  2VGC C;  3FXD A;  1IQG A;  1NPM A;  2JH5 D;  4I86 A;  1Y59 T;  1NTM G;  1TBZ H;  4FUI A;  1MZA A;  1UTO A;  2BXU H;  1GTW A;  1FIW A;  1J8A A;  1L1J A;  1KB9 I;  3CI9 A;  2JDI D;  2ZGX H;  3BTE E;  2WPR A;  1KY9 A;  4U3F G;  2VIO A;  2XYA A;  3AVZ A;  4FXG H;  3H1L J;  1YPJ H;  3BCC D;  4CBN A;  1BE3 E;  1IZN B;  1QUR H;  1S85 A;  1WUN H;  2F9B H;  3ZZA A;  6EST A;  5GXP A;  1GHB G;  3IR9 A;  5JBA S;  5DP3 A;  1FY5 A;  2WSF J;  4Y7A A;  3A80 A;  1C9T A;  4R0I A;  4WB4 A;  3JC2 2;  4XRN A;  3RXS A;  2M5A A;  1DM4 B;  3E1I A;  1HH0 A;  2QF5 A;  1NTZ G;  3GDV A;  1IOE A;  5L2Y H;  2GCH G;  3M3V A;  4B6E A;  2STA E;  2VWO A;  1ANC A;  2W5E A;  2A45 B;  1E0F D;  2WMM A;  3L75 G;  2IPP A;  1LHC H;  2A06 E;  1KFN A;  3ZZ6 A;  1GU5 A;  2RG3 A;  1PGJ A;  3F0P A;  1VQ8 P;  3A7T A;  3EA9 A;  3H1K J;  1VIT F;  2WZ7 A;  1EAX A;  3SHC H;  3PV2 A;  1HJA C;  1PQ8 A;  1GJD B;  1P04 A;  3VMY A;  3SZN A;  4E06 H;  5G4B A;  5DN6 D;  3SWK A;  5F53 A;  1WQV H;  2P8O C;  2QIQ A;  2YKP A;  1RQU A;  5GTH H;  1OX1 A;  5EST E;  1GDU A;  1UVP A;  4F55 A;  2HVY B;  1RF1 A;  2BYA X;  1TMU H;  1TQ7 B;  3OTJ E;  5CHB A;  4U01 A;  2R0K A;  3KHV A;  2WIN I;  4N3Y B;  1EAI A;  3GY7 A;  5F8X A;  4BAO B;  1NGM B;  4AB8 A;  2W8Z A;  1T8M A;  4PJ0 E;  3AAU A;  1AB9 B;  1MU6 B;  3BEU A;  3SFD C;  1KB9 D;  3FP7 E;  3L33 A;  4HI3 A;  1CGJ E;  2HRV A;  1NTK D;  1ELF A;  2AEI H;  5CDF E;  1K05 A;  2AIQ A;  8LPR A;  4DY7 B;  3KZI H;  1P2I A;  4U32 A;  2FMJ A;  2WWW A;  1GDN A;  3SUF A;  3VB7 A;  4KHX A;  2Z5I A;  1AVG H;  2GVF A;  3TH3 H;  1PPJ E;  1SQX K;  4KEL A;  5KKZ B;  5DP9 A;  2FM2 A;  2BD5 A;  1C1U H;  1FY4 A;  1BB0 B;  4KT0 J;  1LNQ A;  1EDJ A;  3MO6 A;  1AA0 A;  3RK2 D;  5A0B A;  1YBK A;  2IZ0 A;  3PRD A;  3GIC B;  4AB9 A;  1LMW B;  3URE A;  3C8V A;  1J1E B;  1SQQ E;  2ZPQ A;  1UTM A;  1FZE A;  3I56 P;  2Y0D A;  4LLH A;  1GBE A;  3ZVC A;  2FKW B;  2IYP A;  2MJZ A;  2GM4 A;  2OC7 A;  1DIP A;  1M1J C;  3E0P B;  3PWC A;  1UVU H;  2WPQ A;  5FHT A;  5AW4 B;  1EAU A;  1TMT H;  3WY8 A;  1AE8 H;  1GL2 D;  1NZQ H;  1Y3X A;  4C7N B;  1W10 U;  1V2K T;  3IF4 A;  5KJ7 D;  1SSX A;  1KD1 Q;  4X6N A;  4Z1M H;  2ZFQ H;  1BSN A;  1SQV J;  1BGY J;  1EXJ A;  1GL2 A;  2FI3 E;  1LCY A;  1VKY A;  1Y5U T;  5T3H A;  5KEC A;  4JQ0 D;  2P8O B;  2LXB A;  4EDF A;  1Q86 Q;  4KTS A;  3KQE A;  1N73 A;  1NFU A;  1RF1 C;  4ZKR U;  4NWK A;  2FLR H;  3ELA H;  1MBM A;  1TRN A;  4JZD H;  2PAJ A;  1O5E H;  2P7J A;  1DY8 A;  2ZDK A;  2N1T A;  4H44 C;  2K9J A;  4PD4 H;  3BTQ E;  4ABB A;  2FZZ A;  2H6M A;  1L0N D;  1S6F A;  2NWN A;  1O3F A;  2BQW B;  1N1L A;  1ZSJ A;  2OTL P;  3U1A A;  1D6R A;  2FXP A;  1G37 A;  1RTL A;  5B6L A;  1EX3 A;  2GDE H;  3UFA A;  5EW1 H;  2RDL A;  3SJ8 A;  1KIL C;  4IFD K;  2O8T A;  1VR1 H;  2O9Q A;  4CRA A;  4D9R A;  1J17 T;  5HM9 A;  3RK3 C;  1NTZ E;  1XUH A;  4GKG A;  1QJ7 B;  1ZP0 C;  1EZV G;  3AE6 C;  5TCA A;  1C5W B;  3F89 A;  2VRS A;  3OEE D;  4RKU J;  3WMM 0;  2KOG A;  4MPW A;  1IO4 A;  2FXM A;  3MNB A;  4ISN A;  1QVF O;  3HKI B;  3H1L G;  1HTL C;  4UON A;  2OTV A;  3B5N A;  1NTZ K;  1VF5 D;  1P06 A;  1HAY B;  4I8K A;  4X1S U;  4B75 A;  1NAY A;  4D7G A;  1A61 H;  4H6S B;  2OK5 A;  1QGK B;  2WYG A;  1DEE G;  1HVV A;  1LP1 A;  1C1P A;  3P70 B;  1NTM J;  3WUV A;  1PPE E;  1SLX B;  1AO5 A;  1C5O H;  3AK5 A;  1JTH A;  1O3I A;  2P67 A;  1NM6 A;  1R8E A;  1C2K A;  1Q2W A;  1ZTL A;  1ARB A;  1ZLL A;  3TJO A;  3OFN D;  4ISO A;  5FXL A;  1NTM K;  1K9O E;  1O5C B;  1SFC C;  1FJS A;  3D23 A;  5CCH D;  1IHT H;  1GBC A;  1QL2 A;  1BQY A;  1TYN A;  2ZGB H;  3AW0 A;  5DP8 A;  4RKO B;  3M7U A;  1RE4 C;  4I6M C;  2LNC A;  5CMX H;  4UB8 E;  4NPE A;  2FFD C;  1PPJ G;  5KJ7 C;  1GBT A;  1UMA H;  1JWT A;  3HD7 B;  1UTN A;  3SV9 A;  3PLN A;  1BTW A;  4PD4 E;  2GZ7 A;  2ZXE B;  2ODP A;  1EZS C;  1TIO A;  1K1O A;  1SGC A;  1AWF H;  1HAV A;  3SO3 A;  4BXS A;  1BOQ A;  4GAW A;  1OIP A;  1HIA A;  5AW3 B;  1FI8 A;  2GA1 A;  2BQ7 B;  4GLY A;  3ATM A;  1NTK E;  4LGD E;  1C2G A;  2YO3 A;  3H6P A;  3PTN A;  1KB9 E;  1O36 A;  3L70 J;  5EFW B;  3Q3D A;  4K8Y A;  2E76 D;  3CXH D;  1IK9 A;  2VIN A;  1BCC D;  5C5O A;  1O3C A;  3S69 A;  3ZZC A;  1BCC G;  3LGU A;  1T2K C;  5AW6 B;  4N78 D;  1XTC C;  2P59 A;  3RMO H;  2J2U A;  4XSK U;  1PL5 A;  1EPT A;  3R3G B;  3RLW H;  1SFC D;  3PTZ A;  1HF9 A;  1P8V C;  3RXR A;  3A0H H;  1EXF A;  2VVC A;  1O34 A;  2UUJ B;  3L75 J;  2BX3 A;  1BUI A;  3V7T A;  1O5G H;  1QL9 A;  5C5N A;  1E37 B;  1IC2 A;  1VGC B;  2A2Q H;  3P8C E;  2A06 D;  2W6I D;  1T4U H;  2ALV A;  1HCG A;  1NTZ J;  6CHA C;  3QN7 A;  4BXL A;  1KDQ A;  1W7X H;  2XC0 A;  1FX0 B;  1W2K H;  4H13 C;  1EAW A;  5EOK A;  3FWN A;  2BLQ A;  4X1P U;  2NPS C;  1MAB B;  2B0F A;  7LPR A;  1F2S E;  4HTC H;  2G4T A;  1FN6 A;  1QRZ A;  4U2W A;  2BCC D;  5AVR B;  3Q5R A;  5EJL A;  3CXH E;  1GJ7 B;  1ZXG A;  1VCQ A;  4XBC A;  2UWL A;  3SWF A;  1DS2 E;  3QZQ A;  1B5G H;  1TB6 H;  4WXV A;  3VB5 A;  3UAI C;  2FYU G;  1GGD C;  1YCP K;  1GWA A;  1JMB A;  2R3S A;  1T2K D;  5C67 A;  2LKM A;  4DZO A;  1L1G A;  1SB1 H;  1IQH A;  5C94 A;  1FPC H;  1MUE B;  4JZ1 A;  3A2A A;  1JMO H;  1JTH B;  3UY9 A;  1LVO A;  3F2G A;  4CH2 B;  1S5L E;  2FOC A;  3W68 A;  3LGV A;  4TPI Z;  3QWC H;  1GBL A;  1IFM A;  4MVN A;  1NRS H;  4K1S A;  1QY6 A;  1LQD B;  1RD3 B;  1A3B H;  1YF4 A;  2FX6 A;  2AH4 X;  3LGT A;  4JPZ B;  3MD0 A;  4MTB A;  5EIY A;  2E75 C;  1S9K E;  4O97 A;  1IHS H;  1A3E H;  2GTB A;  3RU4 D;  3SUD A;  1SQQ J;  2XBX A;  1SLW B;  1MKX K;  3SU6 A;  5A2M H;  3L73 J;  3LGW A;  2AMD A;  2Y6T A;  2WPV B;  3E16 B;  1SQB K;  1FJP A;  1NRO H;  1OYQ A;  1NU1 D;  3MTY A;  3SGQ E;  2PSX A;  3L71 D;  1K9M Q;  1O3K A;  4A92 A;  3L74 J;  4MPX A;  1IFI A;  1BRC E;  3NZI A;  1O3D A;  1YKT A;  1RE4 A;  3GMA A;  3LID A;  1SQR A;  2K3R A;  8KME 2;  1KQG B;  2VGC B;  2G51 A;  3TVJ B;  3TH4 H;  2ZU5 A;  4AFS A;  1GBM A;  1RE3 A;  5AVZ B;  3MO3 A;  1GGD B;  1BE3 G;  2P95 A;  2GGV B;  2ILN A;  3GY4 A;  3BTF E;  3T29 A;  4PD4 I;  4YXW D;  3A0B H;  1GMC G;  2C8X B;  5APU A;  1CA0 C;  3A88 A;  4P00 A;  3ZV8 A;  4M3L A;  1C5L H;  2JJ2 D;  2QE7 H;  2V7Q H;  2ZDL A;  1JY3 O;  1G3E A;  1HXE H;  3T2N A;  2PSY A;  4TT3 D;  2OC0 A;  2BY6 X;  5CE1 A;  1S5L X;  3OJA B;  2ASU B;  4NIY A;  1O3L A;  1OP2 A;  3H5C B;  2IBZ D;  1PQ5 A;  3UOU A;  1H1B A;  3ZVE A;  1WDI A;  2A45 I;  1YC0 A;  3G6E P;  2W7S A;  4O3T A;  2RA0 A;  1XX9 A;  3LIW A;  4NSY A;  3H1J G;  3KZI E;  2WPM S;  4Q7X A;  3RC4 A;  3RXJ A;  1WU1 A;  2WTY A;  3CMA P;  2BLV A;  1O2O A;  1DST A;  1OWK A;  3IN6 A;  2EI8 A;  3SNE A;  1OHH D;  2ZYG A;  1P84 E;  2YIU B;  2KXP B;  5AW7 B;  4IW4 E;  5AVX B;  3CCL P;  2HYN A;  1GI8 B;  1SFQ B;  5LH8 A;  1QB6 A;  1VQN P;  2BQ6 B;  2KS1 B;  3BG4 C;  3SJ9 A;  5C2Z A;  4K35 A;  3BRT B;  5TCC A;  3I78 A;  2E74 B;  2AEM A;  3FP8 E;  2DW3 A;  2G8T A;  4NCY A;  1UTK A;  4MG3 A;  3AEE C;  1BDD A;  1ELB A;  1XKB C;  5AHG H;  3TH2 H;  2NU4 E;  1YWU A;  3GCT G;  1N73 C;  1JY3 P;  3BV9 B;  1IFD A;  4Z1M D;  1P05 A;  3O8B A;  3M91 A;  4DT7 B;  4EYY Q;  2EEK A;  2H9E H;  1KYO H;  5CCH C;  5AVV B;  4UB6 H;  1Q82 Q;  1GL1 A;  1ZML A;  1VQP P;  2WUC A;  2Z6B D;  4X1N U;  1HAG E;  2WZQ A;  4JZI A;  1NES E;  3GDS A;  1PFI A;  1RIW B;  3V6I A;  1ZRT D;  1O2P A;  1TRM A;  2BD7 A;  2L74 A;  4MNV A;  1ZR2 A;  4Q7Y A;  3ZDM A;  5CMZ A;  2PP6 A;  2KS1 A;  5AW9 B;  1FON A;  3E8L A;  2Y81 A;  2Y9Y A;  1PP9 G;  3O8Z A;  1DD3 A;  2IPH A;  4JYB A;  1TQ0 B;  1Z71 A;  3RBX A;  2XKM A;  2RN0 A;  2I6S A;  1C5M D;  1URQ D;  1CW5 A;  1TNK A;  4B2C A;  1DH3 A;  1H4W A;  3CCQ P;  2XNX A;  2BCC J;  3MIW A;  1WTH D;  2H2Z A;  2PTN A;  1ZOY C;  2W26 A;  3A7Y A;  1VPC A;  1Q81 Q;  2A5I A;  4GSO A;  4AN7 A;  1OOK B;  2GV6 A;  3IAO A;  4X1R U;  3PMA B;  5A09 A;  1VGC C;  4BRY A;  1MMJ N;  2JIZ D;  3CCJ P;  2TBS A;  4FET A;  2B8O H;  1BTP A;  2ZT9 D;  4I32 A;  1U6Q A;  1L0Z A;  3H1L D;  1O2N A;  4OGX A;  1MKW H;  4I7Z B;  1TA6 A;  2VWM A;  1BRA A;  1FAV A;  1EOJ A;  4DII H;  3PMH B;  5F6M A;  2P3T B;  1MKX H;  5AFY H;  2J34 A;  3L6P A;  4X0W U;  4DT4 A;  3GCH B;  2QN5 T;  3VMA A;  1V2O T;  2O8M A;  5GPI B;  4H6T A;  3SW2 B;  1LDT T;  4I8J A;  1AWH B;  4YTA A;  1G3D A;  1OKX A;  3F9H A;  3RXQ A;  1QX8 A;  5EXN A;  1AJY A;  3RU4 E;  1BE3 D;  2C3S A;  4OM9 A;  1LHE H;  5FX5 A;  1B0F A;  1SQQ D;  2C0X A;  2YOL A;  3H1K D;  1SQB E;  2E76 C;  3L73 D;  1RXP A;  1V2T T;  1LKB A;  1A7S A;  1IQL A;  1YQ4 C;  2HR3 A;  3MUD A;  4IN2 A;  1D3Q B;  1O3G A;  1M9U A;  5EW2 H;  1SGY E;  4X6O A;  1DY9 A;  1CQQ A;  4JMY A;  1EDK A;  2J95 A;  1AUT C;  1JMM A;  1GJC B;  2PKS C;  1OWD A;  1OW7 A;  2HLC A;  1LTT C;  1VDF A;  1H8I H;  3E1X B;  4TY7 A;  3ODF A;  2HPQ H;  3L4F A;  5KLV J;  1H0T A;  3ZVA A;  1Y9B A;  1P2J A;  5HYO A;  5E0G A;  1T8Z A;  2J4I A;  1NFY A;  3RXT A;  3LJJ A;  1NKN A;  1TX6 A;  3V2R A;  4OGQ C;  1RRK A;  2CK3 D;  5AVQ B;  2ZGJ A;  1MTU A;  4ASW A;  4X8S H;  5KLI B;  4WJG 2;  1ESB A;  7GCH G;  1D3P B;  2ANW A;  1ARC A;  4IS5 A;  1L0N G;  2WIT A;  1D9I A;  5IYT A;  3RDZ A;  3SN8 A;  1DEB A;  2ZFF H;  2AER H;  4DGJ A;  2Z9G A;  5J4S A;  3PJS K;  1INC A;  1DDJ A;  3BTG E;  3HGN A;  5B6O A;  1KIL D;  1KC8 Q;  3CCV P;  1GVL A;  1DD4 A;  1P12 E;  1ELD E;  1DPO A;  2W7U A;  1O31 A;  2ZYD A;  5T6D A;  1LTI C;  3RBZ A;  1B7X B;  3RXF A;  6LPR A;  1GI0 A;  1QB1 A;  1F5R A;  1QL8 A;  5GTI E;  1FY1 A;  1SQP K;  2VBC A;  2SGQ E;  3FOA A;  1KYO I;  1X9V A;  1YPL H;  3Q3X A;  2KI7 B;  1ZR0 A;  4K3J A;  2R0L A;  3TIU A;  2M0B A;  3L74 E;  5E79 E;  2CXV A;  2FO9 A;  3NMD A;  3MGN A;  2JET C;  3LJO A;  3M9B A;  1M56 D;  4B2A A;  3SWY A;  1MFT A;  2BCC E;  1ORF A;  2ZF0 H;  1GMC F;  1NYH A;  1GI9 B;  1MKW K;  1SQO A;  5EJ1 A;  5F8Z A;  1KMI Z;  1GK6 A;  2QA4 P;  3M7Q A;  4ZNC A;  1QJ1 B;  1GMD F;  1A0L A;  2OBQ A;  3B9F H;  2ALP A;  3URC A;  3TK1 A;  2D26 C;  4ZAE A;  2JP3 A;  4XOJ A;  1YJW P;  1JCD A;  4H44 B;  4N6J A;  3MQK C;  3FVF B;  3M0D C;  3CWB G;  2K8I A;  1Z8G A;  3U69 H;  3VB4 A;  3D65 E;  5GTH E;  3RML H;  1WAY B;  4ASH A;  3QZR A;  2PFX A;  5KAF E;  1L0N J;  1GI2 A;  3A81 A;  3G71 P;  4WWI A;  1OS8 A;  1SL3 A;  3PH0 A;  5FCK A;  1NRP H;  2SNW A;  3PO1 C;  4AFQ A;  3TSI A;  3P6Z B;  3MO9 A;  2CPB A;  3QH9 A;  3U1J B;  2W6B A;  1O3B A;  1UHB B;  5AVS B;  3PRO A;  3RU4 T;  4NIV A;  4ABJ A;  4OWF A;  3ZZD A;  2TRM A;  1BJU A;  2E74 C;  2H5C A;  3SBK A;  4RN6 A;  1MFZ A;  1AZ8 A;  2BY9 X;  3NWU A;  1LTJ B;  4Z0K A;  2OP9 A;  1HAV B;  4EIJ A;  5F8T A;  1QGF A;  2OIN A;  2ZFP H;  1J1E C;  1D3D B;  3HD7 A;  1LTS C;  2M5T A;  3N7O A;  3TJV A;  1EFR D;  4KP0 A;  3ZIA D;  2A4Q A;  2M3B A;  4OGQ D;  2YXQ B;  1A5I A;  1NVO A;  4UFG H;  1AY6 H;  2IBZ G;  1GI3 A;  4LXB H;  1ZGV A;  1E36 B;  1O2V A;  1FQ3 A;  3OY5 U;  2J9N A;  1DFP A;  3VB6 A;  5APQ A;  1GHB F;  2YNY A;  1Z6J H;  3Q2Y A;  3OA7 A;  3WUT A;  4AX9 H;  3F3B A;  5E0J A;  3EQ0 H;  3PMJ A;  3V0X A;  1BBR H;  2JKV A;  1H0T B;  2AGG X;  4M7G A;  3STI A;  1EJN A;  1A46 H;  2IFN A;  3OSY A;  2UUY A;  2VB0 A;  2AGI X;  3RGU A;  3PV5 A;  2WYJ A;  2EST E;  1VIT H;  1TAB E;  3L35 A;  3GF7 A;  1LTG C;  1OXG A;  2QJY B;  1C5T A;  1P9U A;  5F03 A;  3KN2 A;  2FTL E;  2HG5 D;  1V2Q T;  3GYM A;  1YPG H;  3OX7 U;  4WY4 C;  1VJ9 U;  1EZV E;  1KMH B;  3TGJ E;  2J92 A;  3QTO H;  3KQG A;  3IIT A;  1C1V H;  1BIO A;  1SQP E;  1M90 Q;  3C1L A;  1V3X A;  3AW1 A;  3HPT B;  1Y3W A;  2BD2 A;  4PRO A;  1NRQ H;  3U8O H;  5DG6 A;  3Q5S A;  2FP7 B;  2J94 A;  3T97 B;  1X22 A;  3A8B A;  2W6J D;  5C1U A;  1GD2 E;  5CHX A;  3BTD E;  2Q7C A;  2A7J A;  2AMQ A;  1P02 A;  5B66 E;  3PLB A;  5JBT A;  2BM2 A;  1W14 U;  2KM0 A;  1KFM A;  3NRL A;  3TK6 A;  1ETS H;  3GY8 A;  3H7O A;  3BTT E;  4OS5 A;  1K04 A;  4A6L A;  3N7E A;  1SP4 A;  2E75 B;  1QRX A;  4DVA U;  4JF7 A;  5GCH F;  2LP6 A;  5I25 A;  1SGF G;  5H4I B;  5KGO A;  2QIW A;  1CI6 A;  4WH6 A;  3O6Q B;  3CPW O;  1N73 B;  4D76 A;  4XDE A;  4CBO A;  2ZG0 H;  1FZC A;  1NTM E;  3BCC J;  2FY8 A;  1AUJ A;  2QJP C;  1F5L A;  3UTU H;  1HAZ B;  2BVS H;  2PR3 A;  3MU4 A;  3IWM A;  4UE7 H;  3CCR P;  2P93 A;  4Y0Y E;  3CL3 D;  3AEF C;  1Q2N A;  2FOD A;  3IG6 B;  1O2K A;  2IZ1 A;  3L37 A;  3IFM A;  4UDW H;  1MUU A;  1SQQ K;  3SQE E;  4X2X A;  3BG4 B;  4AQR D;  1WV7 H;  4H44 D;  1NTK J;  3U9A H;  1C1N A;  1UK2 A;  2H89 C;  4L73 A;  1XUJ A;  3DHK H;  1GBA A;  1P9S A;  4FUJ A;  3SNA A;  3LH3 A;  5K0H A;  1NTK G;  1C1R A;  2UWJ E;  4A1T A;  1L4A D;  3N7N A;  1Y3Y A;  3HK3 B;  5AW2 B;  2ZPS A;  3HGP A;  4X8T H;  4H0L D;  2YKQ A;  1P0S H;  2A06 G;  1RF1 B;  3O6Q A;  1CI6 B;  3SU2 A;  2JH6 D;  4SGA E;  2ZIQ H;  3RXA A;  2H88 C;  1O5F H;  1TOC B;  3ZVB A;  5CJ0 A;  5TIS E;  1BSH A;  1IQN A;  2QF4 A;  1C2D A;  3B5N D;  4NPF X;  2QJY C;  2KAI B;  2C93 B;  1SVP A;  1AFQ B;  1LT9 C;  2M2A A;  1HV7 A;  2ZNK H;  2RMZ A;  4JYC A;  4YPC A;  4OS6 A;  5CBN A;  4Y76 A;  1W5C E;  2FPZ A;  3RXI A;  2C90 B;  1CT2 E; 
#chains in the Genus database with same CATH homology
 5APY A;  1IK9 A;  4W7Z A;  3VOP A;  1T2K C;  3R2P A;  3RK2 C;  5AW6 B;  4N78 D;  1XTC C;  3GHG C;  1FZG A;  1SFC D;  1H88 A;  1L4A A;  1J1D B;  2I1J A;  3T97 A;  1NKZ B;  1IC2 A;  2J59 M;  3KPE A;  3HD7 C;  3P8C E;  1GL2 C;  4I2L C;  2N1T B;  1NO4 A;  1G2C A;  3RL0 B;  2NPS C;  4N78 E;  3TYY A;  2KP8 A;  1NH4 A;  2W27 A;  2HPC A;  5AVR B;  2XZR A;  2R5D A;  1GU4 A;  4GT1 A;  1JY2 P;  1URQ C;  3HE4 A;  3SWF A;  4I1L A;  2E43 A;  5AVU B;  1S9K D;  3VTP C;  2FFD A;  1T2K D;  1KQL A;  2LKM A;  5AW5 B;  4DZO A;  3A2A A;  1JTH B;  1GZL A;  4IFM A;  2H8P D;  3EQ2 A;  1FOS F;  1FZA A;  1URQ B;  4RES B;  1IFM A;  1T3U A;  2C0W A;  1FBM A;  2XDJ A;  3MD0 A;  1S9K E;  3UIA A;  2OYH A;  3BAT A;  3LIE A;  1YTZ T;  5AW8 B;  3U1C A;  1WRG A;  2C9L Y;  3HE5 A;  1SQB K;  2A45 H;  1XTG B;  2N1T C;  5AVT B;  1FJP A;  1W2E A;  3G3Z A;  4ZKP A;  1X79 B;  2KB7 P;  1IFI A;  5KLV K;  1AQ5 A;  2R3C A;  1N7S C;  1RE4 A;  3LID A;  1ZV8 A;  2WT7 B;  3P8C D;  2JJL A;  3EFG A;  2Q9I A;  1N2D C;  1OWA A;  3CLQ A;  4B86 A;  1RE3 A;  5AVZ B;  2KLV A;  2R5B A;  3V2N A;  1LWU A;  1Z56 A;  3VMX A;  3P32 A;  2HPC B;  5APU A;  4M3L A;  2KYV A;  1QL1 A;  1L0L K;  3TNU A;  1JY3 O;  3BVH A;  2WSE H;  1T3J A;  1CSB A;  1LTA C;  2NPS B;  2FYU K;  3RL0 C;  1H8A A;  3OJA B;  1FJK A;  3BAS A;  2A45 I;  2XU6 A;  3U59 A;  2J58 A;  2C9N Y;  4HYT B;  1RF0 A;  1SFC B;  5APT A;  2WTY A;  1RE3 C;  1HBW A;  1FOS E;  2O01 H;  5AW7 B;  2Q3I A;  3BRV B;  5AVX B;  2OYH B;  2GUS A;  2HYN A;  1HUC A;  4ZKU A;  5APX A;  3VN0 A;  1LTJ C;  1HJB A;  3BRT B;  2OYI B;  5AW0 B;  2CPS A;  1JO5 A;  1NAF A;  1LT9 B;  3M9Q A;  1FU1 A;  1M7L A;  2KSJ A;  2R32 A;  5CCH A;  1N73 C;  4WY4 A;  1JY3 P;  1L4A C;  1IFD A;  5CJ4 A;  1OXZ A;  3M91 A;  3II6 A;  5CCH C;  5AVV B;  2L5G B;  2FFD B;  2H43 A;  4IFF A;  3L36 A;  4AYC A;  1YYC A;  1PFI A;  2OYI A;  1N7S B;  1ZR2 A;  1HWT C;  5CMZ A;  2PP6 A;  3VYI A;  5BU5 A;  5AW9 B;  1GDT A;  3O8Z A;  4W80 A;  1AFO A;  4JYB A;  2NPS A;  2XKM A;  2IX7 C;  4Y99 B;  1URQ D;  1CW5 A;  2POH A;  1ZN5 A;  1CZQ A;  1DH3 A;  1L0N K;  1IFJ A;  4W7Y A;  3MIW A;  2XNX A;  2QM7 A;  3M0D A;  4XA4 A;  2Z4E A;  3V4Q A;  1VPC A;  1M1J A;  1L4A B;  1JY2 N;  2M8R A;  2YMY A;  2HLO A;  2N9B A;  1FAV A;  4LC1 A;  3RK3 B;  2WT7 A;  1FZC C;  1JY3 N;  1GW3 A;  3TNU B;  1M1J B;  1FDM A;  2WSF H;  1H89 A;  5BVZ A;  4Y99 C;  1LWU B;  1A02 F;  2WSC H;  2FYZ A;  1A02 J;  3NXS A;  1JUN A;  3VP8 A;  3KDP B;  2C0X A;  5KJ7 A;  1N7S A;  1NU1 K;  4EOT A;  3N4X A;  3MUD A;  5KTB A;  1LT9 A;  1GL2 B;  2E42 A;  1JMM A;  4XE5 B;  5APS A;  4C7N A;  3V2P A;  4C7R A;  1LTT C;  1VDF A;  2YO2 A;  3L4F A;  1J1D C;  1T8Z A;  3M9H A;  2HOD A;  5APW A;  2H7H A;  1NKN A;  3V2R A;  3RK2 B;  3VMZ A;  3RK3 D;  5AVQ B;  3A7O A;  3VP9 A;  1URQ A;  2A45 G;  1SFC A;  2WIT A;  2XV5 A;  3B5N B;  1DEB A;  1EQ7 A;  1FZC B;  1YTZ I;  3KYQ A;  1NTK K;  1KZU B;  1KIL D;  2P1J A;  1SVF A;  1G2C B;  2P2U A;  5APV A;  4GIF A;  3NTN A;  1GTW A;  3CI9 A;  1LTI C;  2WPR A;  1NHL A;  1MV8 A;  1SQP K;  3M0A A;  1X9V A;  3IR9 A;  3A5T A;  3NMD A;  3MGN A;  4WB4 A;  2OAR A;  3M9B A;  4O9B A;  3SWY A;  4WY4 D;  1RY3 A;  3E1I A;  5CCG C;  1HH0 A;  1ZR4 A;  1GK6 A;  2HFE D;  3LW5 H;  3TK1 A;  1JCD A;  4N6J A;  1LWU C;  2IPP A;  3M0D C;  1KFN A;  1GK4 A;  1GU5 A;  4DOJ A;  1JCC A;  2WZ7 A;  1JY2 O;  3H32 B;  3PP5 A;  3VMY A;  1N86 A;  2YKP A;  3HTK A;  3TSI A;  2CPB A;  1RF1 A;  2W6B A;  1N7L A;  5AVS B;  4N3Y B;  3OAK A;  3HUS B;  2O1K A;  2O1J A;  1MFZ A;  1E5W A;  1LTJ B;  1KIL B;  4EIJ A;  1HGV A;  2WWW A;  3I5C A;  2OYH C;  5BU8 B;  1J1E C;  4KHX A;  2Z5I A;  3HD7 A;  1LTS C;  1SQX K;  1HGZ A;  2M3B A;  1FZB A;  1J2J B;  4HH2 A;  3RK2 D;  1IJD B;  1IFN A;  4C46 A;  1SLQ A;  1SQV K;  1LTJ A;  3B5N C;  1J1E B;  5APQ A;  2YNY A;  1FZE A;  3OA7 A;  2GUV A;  5AVW B;  2HOD B;  4LLH A;  2FKW B;  2MJZ A;  2GM4 A;  2BAS A;  1M1J C;  2WPQ A;  1DX7 A;  5AW4 B;  2IFN A;  1GL2 D;  3HUS C;  1JOC A;  4C7N B;  5KJ7 D;  4AUW A;  1GL2 A;  3L35 A;  2Q5U A;  1LTG C;  1MZ9 A;  2HG5 D;  4WY4 C;  1N73 A;  5CCG D;  1RF1 C;  3KQG A;  3NFQ A;  2PAJ A;  3HRN A;  2P7J A;  2WPS A;  3H32 A;  2N1T A;  3M06 A;  3V4W A;  3GHG B;  4WBA A;  3B8E B;  3U1A A;  1GD2 E;  5AVY B;  5CHX A;  1X8Y A;  2Q7C A;  3GHG A;  2W6A A;  1KIL C;  1KFM A;  4IFD K;  3HD7 D;  3HE5 B;  3RK3 C;  1JNM A;  4GKG A;  1SP4 A;  1N7S D;  2ZFC A;  4JF7 A;  3MTU E;  1CI6 A;  2VRS A;  1G1J A;  1N73 B;  3WMM 0;  2KOG A;  1IO4 A;  1G1I A;  2FXM A;  1FZC A;  1HTL C;  3B5N A;  1NTZ K;  2IFM A;  1FZF A;  3P8M C;  4OH8 B;  3CL3 D;  1LGH B;  1HVV A;  1RF0 C;  1LTB C;  3L37 A;  3V5B A;  3IFM A;  1MUU A;  1SQQ K;  1JTH A;  1NWQ A;  4AQR D;  1NOH A;  2P67 A;  1ZLL A;  2QM8 A;  2I1K A;  1L4A D;  1NTM K;  3N7N A;  3RL0 D;  1SFC C;  5CCG A;  5AW1 B;  3HE4 B;  5CCH D;  5AW2 B;  1QL2 A;  3C9I A;  2Z5H A;  2N1T D;  1GW4 A;  2YKQ A;  3A3Y B;  1RE4 C;  4I6M C;  2YKO A;  1RF1 B;  1CI6 B;  2FFD C;  3HTK B;  4WY4 B;  5KJ7 C;  3V2Q A;  5CJ0 A;  1WT6 A;  3HD7 B;  3B5N D;  2ZXE B;  2NPS D;  1KIL A;  2JEE A;  3P7K A;  1LT9 C;  5AW3 B;  4JYC A;  3HUS A;  4LGD E;  2YO3 A;  3H6P A;  2OYI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...