2PP6A

Crystal structure of the atp-binding sugar transporter-like protein from salmonella typhimurium
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
88
Chain Sequence
SNAMADLFDGMKRRMDALIAERFGMKVNINGTDCIVVESDFLAGKNVVVFSGNVIPRRGDRVVLRGSEFTVTRIRRFNGKPQLTLEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ATP-binding sugar transporter-like protein from Salmonella typhimurium.
rcsb
source organism Salmonella typhimurium lt2
molecule tags Transport protein
molecule keywords Gifsy-2 prophage ATP-binding sugar transporter-like protein
total genus 18
structure length 88
sequence length 96
ec nomenclature
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13856 Gifsy-2 ATP-binding sugar transporter from pro-phage
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2pp6A01
2.40.10.210 Mainly Beta Beta Barrel Thrombin, subunit H Phage tail proteins (gpFII-like) 2pp6A02
3VOPA 5CCGA 4W80A 5CCHD 1KILD 3HD7B 3RL0B 1JTHB 4WY4B 1N7SB 2NPSD 2N1TD 2KOGA 1URQD 3RK3D 1L4AD 3HD7C 1SFCD 3RL0C 1N7SD 2XDJA 4LGDE 5CCGC 5CCGD 1N7SC 1URQC 3RK3C 2WZ7A 5KJ7C 5KJ7A 1L4AB 5CCHA 3B5NB 2N1TB 1URQB 3RK3B 1NHLA 2M8RA 5KJ7D 2YMYA 2HFED 3HD7A 3RL0D 1KILA 1SFCC 3B5NC 2NPSB 2HG5D 1GL2D 3HTKB 1URQA 1GL2C 1L4AA 1KILC 1SFCA 5CCHC 1XTGB 3RK2B 4W7YA 3HD7D 1GL2B 2H8PD 1KILB 3B5NA 4WY4D 2N1TC 2NPSC 3PP5A 2PP6A 1HVVA 3RK2D 4N78E 4WY4C 2NPSA 1GL2A 1L4AC 3TSIA 1JTHA 1N7SA 3KYQA 1SFCB 3M0DC 4JF7A 3RK2C 1T3JA 3B5ND 4WY4A 4OH8B 4W7ZA 3P8CE 2N1TA
chains in the Genus database with same CATH superfamily
2CPBA 2ZJSE 2VU8E 2WSCH 2VIVA 5CCGA 3GCNA 3L70E 4JBZA 1D3QB 1OP2A 3TGUJ 2QGRA 1FDPA 5LH8A 5JYIA 1GBCA 2STBE 1S5LX 2KIKA 4OM9A 1BDAA 4ISHH 2QEXP 3USSA 1OX1A 1TGNA 5JDUB 2D2CC 2R0LA 3U1JB 1YLNA 1URQD 1NU7B 3P8CD 2M5AA 1FY1A 3D49H 2Z9KA 1ELDE 4X1NU 3SWYA 4HH2A 1UHBB 3RK3E 1H1BA 4PD4D 1GCTC 1HB0B 1SQXG 1Y8AA 1LHFH 2ZGBH 3LH1A 4AGJA 2BASA 3V2RA 3EWKA 1ZTKA 1NRSH 2FS8A 3ZZCA 1NTZE 3CCUP 2QE7H 3U59A 1AIXH 4ISNA 1JB0J 5AVRB 1M1KQ 1VITG 4H0LD 2KLUA 3MD0A 4ISIH 1MAYA 5TJHA 4JQ0D 3WMM0 1DX5M 3A82A 1CBWC 1R5SA 5BU5A 4WVPE 2WHXA 3CCEP 1BE3D 3CC4P 5LGOA 4R0IA 2N9BA 2OD3B 3M7QA 3CXHD 4L73A 1NS3A 4FXGH 3RM0H 1Q82Q 1BMLA 3SNAA 2ZC9H 2BLVA 1AUTC 2O1JA 2RKLA 5K0HA 2UUKB 1OMIA 3HD7A 4D6TJ 2GA1A 1F2SE 2A0QB 2I6SA 2FZZA 2W3IA 3T29A 4WJG2 2AS9A 1C5QA 4INHA 2FTMA 1GI6A 1OZHA 3HRNA 2PLXA 1GDUA 2ZGHA 3DUXH 3CXHE 2O9QA 2XNDH 1T2KC 3DA9B 4LZ4B 3TH3H 3RGUA 3LC3A 1BRUP 4AYVB 1L0LJ 1TPPA 1TBQH 2R3CA 1H9HE 1LQEA 1PQAA 2XNIA 1GL2B 2AGEX 1C9TA 2OYIC 1UVOA 3A3YB 1GI5A 3U8OH 2IDBA 1SQVK 5B5EE 5K5GB 2Q3IA 1ZGIA 1V2VT 1M57D 2WSSD 1BQYA 2JIZD 1NKNA 4HG6A 5DKMA 1SP4A 3K6ZA 2CPSA 2HR3A 4DJZB 4J2YB 2YO2A 2TRMA 1SQVD 3U8RH 3E1XB 4K1SA 4DT7B 1QFKH 3CX5I 1P0SH 1TQ0B 1LKAA 3F9HA 3LKWA 1KB9E 2BVRH 2BD7A 2JO1A 1PFXC 1CT4E 2WSFH 3P70B 3Q76A 4ZXXH 1TB6H 3BCCJ 5C3NA 1CO7E 3GCHB 4BAHB 5AVWB 1RIWB 3VMZA 2YMSB 2IN2A 1PPJD 1PZQA 3S9OA 3FZZA 3OYPA 1PPHE 1GHAG 3FFGA 3RXVA 3VXFH 3MUDA 2P67A 5E8EH 3GCTG 1P01A 4MTBA 1EZUC 3D62A 1AQ7A 1OWDA 1P2KA 1SVPA 1UTKA 4HJGH 1TYNA 3AE1C 2ZFFH 4U7JA 2CJIA 3VMYA 5F03A 1M90Q 2E74C 1S5SA 3I78A 3LC5A 1OW8A 2TGPZ 1BE3J 3MWIU 4U2WA 2GX4A 3F2FA 2J98A 1X22A 1TRYA 1DUAA 2XV5A 2MJZA 1SKYE 4I8LA 3KZIH 3JCUE 4CRAA 2N9YB 4ESTE 3RXAA 1KQGB 1ABIH 2E75C 5B66H 1ETRH 4DVAU 4Y0ZE 4AB8A 1YYCA 3FWNA 3SUGA 1ARBA 5AVUB 1SQAA 1TBRH 3SV2H 3S9CA 2WZ7A 1K21H 3AK5A 3VTPC 2PV9B 1JIRA 2W6AA 5JBBS 2H1UA 2Z94A 1N73A 1ZPZA 3M37A 1KYOI 1B0FA 3TJNA 1PV3A 3O6QA 2ZU5A 5E0JA 3WWFA 2E74D 3A7ZA 2R32A 1BE3G 5GTHE 1FAXA 4Y8XA 1C4Y2 3MU1A 2FOBA 1KQSO 4AG1A 5CE1A 3L6PA 1SQQJ 2WTYA 1BIOA 5F8ZA 2PKAA 3JSVC 3NMDA 3KQDA 1FDMA 1ZRBA 1AMHA 3R0FA 3S7HB 1SFCC 3CCRP 3ELAH 2Y9YA 2ZXEB 1HBTH 1LHDH 4JYBA 2YKOA 1LMWB 3UOUA 3L72J 1IOEA 5C1XA 4I7ZB 1SGTA 1LT1A 1PGPA 4WBAA 1CA8B 3TJVA 1MFTA 2P16A 2J34A 1EP5A 4XOJA 2A32A 1BMFD 2BCCG 1BMNH 4KT0J 1HYLA 2TGDA 1HRTH 3EAJA 2AEIH 1OWIA 3F89A 4JK5A 4UE7H 5DG6A 1ZGVA 3GYLB 1GJ6A 3N7EA 3AECC 5PTPA 4TPYA 3UPEA 3EFGA 4WY3A 3B4SA 5CBOA 2VB0A 2AEFA 5DP5A 1HAPH 1O2MA 3VYIA 1QEXA 1MTUA 2W7UA 2E76B 3QTVH 1GMDG 1ZJKA 4H13D 1KB9H 3H1LD 1P2JA 1HBWA 2YNAA 5KGOA 3LGIA 4PV1B 2BB4A 2ZU1A 1GBEA 2ZHWH 1AFOA 1C2FA 2QSIA 4H13B 4UFEH 1ZMJA 2FDAA 5C39A 1PQ7A 4D8NA 2FXRA 1YPHC 4B2CA 1JIMA 4BANB 1YITP 3C8VA 1SQPD 2R0KA 3HATH 2JWAA 2KCAA 2JETC 5TCAA 3SGQE 3GMAA 3ZZ8A 2OARA 3CPWO 4DOJA 1WDIA 2ZDNA 4YT6H 3H1ID 5H2FE 4ASWA 2V3HH 5DSFA 1GJ4H 4ZAEA 1WYKA 1PPGE 1EASA 1LO6A 3LPRA 4CR5A 1O2NA 1VZQH 4NG9H 1SQPK 5KLIC 3UR6A 5AW5B 2P58A 4NSVA 4JK6A 3PB1E 1S9KD 2CGAA 1NRNH 3EQ2A 1MKWH 3L70D 2ANMH 2JDID 2WPDD 2PFXA 4GPGA 3V0XA 2BCCD 1HV7A 2Z9IA 1L0LE 4DT0A 2PFEA 4ASVA 1SQXK 3E0PB 3W1EA 2R3YA 1R5LA 1GBLA 2WUBA 2QJPB 2ZPQA 1J1EC 3FP8E 3H1HJ 4Y7AA 4AB9A 2FLBH 5DJ7A 3RK3D 1P2QA 2CN0H 2WV5A 3Q3YA 3RL0C 2ZDVH 3STJA 3KGPA 3ENSB 1INCA 1E79D 2ANKH 1VQ9P 2H6MA 2FFDB 3C1KA 1D3DB 1LNQA 1P3EA 1GHAF 3P8GA 2EI6A 5BPEA 4D6TE 4Y10E 4E7NA 1EZVD 1KXAA 3EE0B 3NCLA 1LTJC 2ZDLA 1O5FH 1EXFA 1Z8GA 2KZ4A 2JEEA 3HKIB 1LVBA 2Z3EA 1F5RA 3UOPA 1A02F 1EAIA 2E75B 1HTLC 1FV9A 4IN2A 5CBNA 5CMZA 2NU3E 2UWOA 2ZP0H 5CHBA 1QIXB 2QXJA 2YMYA 4UB8H 4X8VH 4PD4H 1O3LA 1S84A 1LTIC 3H1JG 1LPKB 4N3YB 5GIBA 3KHUA 1SLUB 2KCOA 1YHQP 3H1KJ 3A0BE 1GI0A 3Q5PA 1YPJH 4B86A 2A1DB 2IPQX 2FM2A 2OTKE 3HTKB 1CGIE 4IN1A 5FPTA 3RL0g 2ZEBA 4RO0A 4A7IB 2OYOA 4PD4I 3AAVA 3AW0A 4ABIA 2XZRA 2W3KA 1YQ3C 3AVZA 4Y8ZA 1SQXJ 1SQOA 1FQ3A 1J17T 1RQVA 1A3BH 2GV6A 1J14A 3GY8A 2KFWA 3O6QB 1QL8A 3MI4A 1BT7A 2W7SA 1LQDB 3VMAA 3UQVA 1LKBA 1ELFA 1EB2A 4GDOA 4WXIA 4XBCA 1SQPJ 3PP5A 1EOLA 5EXMA 2BM2A 4I31A 1C5TA 5A09A 2NU4E 1P84E 1DUEA 3NFQA 1L1JA 3E6PH 1O3BA 5T6DA 1SQQE 2SNVA 1NTZJ 2G4TA 3AE8C 3M0AA 1MQ6A 2K9JB 1GMJA 2D2DA 5DGJA 1JY3O 4CBNA 1GL0E 1SL3A 2B9BA 2HPCB 3M7TA 4D76A 3M5NA 1EPTC 2A2QH 1EZVG 5E0GA 4KTCA 1C2HA 3L73E 5HXFA 5J4SA 5DJTB 3EDXB 3ZVAA 3QDZB 5A0BA 2A45H 3NRLA 1OYQA 2V3MA 4ZUHA 1ZSLA 2GCHF 1H8AA 1UK2A 2GVFA 1SQXE 1LVMA 3A8DA 1FZCB 2B8OH 1JCCA 5HM9A 5TCCA 4F49A 2R9PA 2RA0A 2ZO3H 1NTME 2P95A 1UJ1A 4A6LA 1C5XB 4OS5A 1K2I1 3ZVCA 3PYHA 1EZVI 4MG3A 1C5NH 3CMAP 1ZTLA 1RFNA 1ARCA 2ZTZA 1NU1G 3AE3C 3VOPA 1FZEA 1FXYA 4K2YA 4D9RA 1VF5C 3O8DA 3PROA 1TBZH 4B2BA 3WU2H 2W26A 1ZLRA 1O5BB 2UUJB 1KILD 1GHYH 4DY7B 2WYGA 1UK3A 3P8MC 2HPCA 2OUAA 2A45B 1O5GH 1PPEE 2BQWB 1DANH 1IQIA 2HGTH 4QMAA 1C5RA 1SGDE 2KP8A 2UWJE 3RLYH 1G30B 1GBFA 5ETXA 1ANEA 1P02A 3BCCG 1H8IH 3BTME 1QL9A 5KLIB 1URQC 3CWBJ 5AVTB 4ISOA 4LZ1H 5FCRA 1Z6JH 5FBEA 1VITH 3SUFA 1M1JC 2P1JA 4ABDA 1QURH 2ZIQH 1A5HA 3GY4A 3KIDU 3VB5A 3SFEC 2SFAA 1V2OT 3AE5C 1PYTD 1F0SA 2IX7C 1TONA 2C8ZB 4IL6E 2Z5IA 2ANWA 1NWQA 1P10A 2P8OB 1UTJA 2OYHA 1O3JA 3A7OA 1F5LA 1TGCA 5AVXB 5F8XA 3RC4A 4YTPC 1X7AC 4NCYA 3S9BA 1HJAB 1BUIA 1DLKB 1FY4A 1GMDF 2IYPA 1MCVA 2OC1A 2BLOA 1W0KD 1IFPA 3BTFE 4FU8A 4NIYA 1UTMA 4K1EA 2BD2A 4NIVA 1NBME 1F92A 3AASA 4K3JA 3BTHE 2AEJA 2FFDA 1A4WH 1KSNA 3TLOA 4X1SU 1CA0C 1AN1E 2Q9IA 5EJ1A 1A1RA 5GCHF 5KAFH 1O33A 1NTMK 3IWMA 4QT8C 1SQPE 2AFQB 3F2GA 2IBZG 4ZKOU 1SQBK 2IZ1A 1G37A 4B73A 3MMGA 1LHGH 1GI4A 3PWBA 1Q3XA 1LTJA 2K3RA 1UK4A 2TBSA 3DT0H 1JO5A 3ZIAD 1TPAE 3CMEP 2I6QA 3QGNB 3ZZ4A 3SZEA 1ZRTD 3RK2D 1BHXB 3H7OA 1NTKG 4OS6A 3O8RA 1M56D 5KLVD 1Z8IB 1VPCA 2KCYA 2J92A 4ABEA 2Y0DA 1IK9A 2BLQA 3N99A 3MU8A 4ZNCA 1O2UA 1RHZB 3H1LJ 2E76C 4OGQB 1C2LA 4CREA 3G4SP 1GJ8B 1ZHPA 2QF5A 3SGBE 3T26A 1JRTA 4BAOB 2KYVA 2XCNA 2XBYA 1VQPP 3ZVBA 5KLVK 2BQ7B 2PUQH 3O8CA 1OP0A 2BHGA 5KEDA 1OPHB 2XWBI 3TNTA 1NTKE 1DSUA 4XE5B 1AFQB 1DXWA 5APSA 4N6JA 1GI3A 4R4MA 3OW2O 3BTGE 1KYOD 2E43A 1VQNP 1V2UT 2WV9A 1NTKJ 4JCNA 1CI6B 5CJ0A 3T27A 4CBOA 4CRFA 5B6LA 3BASA 1LHEH 3SN8A 2F43B 4I86A 2IBZI 1DY8A 2K9JA 3U9AH 1XTCC 1DSTA 3L75J 2W90A 3RXHA 1MKXH 3RUOA 1W11U 1GVZA 1N6XA 2Y5FA 3OA7A 1N73B 2A5AA 2FI5E 4Y8YA 1DM4B 4W80A 5CCHD 1P84D 1VQKP 1XUHA 3F2HA 1L0NE 2W6JH 3PO1C 4H6TA 2QRXA 3O8BA 2RDEA 3PH0A 2DE8A 2QXHA 5C20A 4O9BA 1ZZZA 1K22H 1N7SC 2UUYA 4DGJA 1YJ9P 2BTCE 2O8UA 2TGTA 2NRGA 4BXWA 4IOIH 2IFNA 1QBVH 3RU4T 1H0TA 1IK7A 2BMGB 3L71D 2G00A 2OGUA 3QGJA 1LTGC 1YJNP 1NHLA 2LR2A 3UREA 1OWKA 3V12A 3OY5U 3CWBD 1DEBA 5JB9S 4LC1A 4X6NA 1S83A 1RE4C 3BIUH 1SQVE 3CCLP 3ZZBA 4EDFA 1AJYA 3VGCB 1CHOG 2XYAA 7LPRA 2V7QD 1BHXF 1KILA 2GDDA 1ELVA 1G1IA 1UCYH 4K35A 4I32A 1GL2D 1MTSA 1Y5AT 2KK7A 3GY6A 3SZNA 1KQFB 5E2OA 3PLBA 5H4IB 1HJBA 2GJGA 3KYFA 1L0ND 1UTOA 1N1LA 2GUSA 4JPZB 1NN6A 3MU4A 3RXUA 4A1VA 2OYHB 1OVUA 2UUFB 1FDIA 1IQKA 1JBUH 1GMCG 1P03A 5CHAC 5FX5A 3TH4H 1X8YA 2ZF0H 3UFAA 2A7CA 1EUFA 1MD8A 4YPCA 1S85A 1YIJP 1S6FA 1HXEH 2XC4A 3BIVH 3FANA 2ITAA 1B0EA 1VJAU 1QCPA 1N73C 3C9IA 5AFZH 1C2KA 3CD6P 2CV3A 5EODA 1L4DA 2B87B 1NFWA 3OJAB 1NTKK 2AGGX 1FN6A 3AEGC 3N7DA 4O3UA 3DHKH 4PJ0E 2KXPB 3R3GB 3HK6B 3GF3A 3BEFB 3CC7P 2ZU3A 1VCPA 3RXOA 2J9NA 2JP3A 1G32B 3P95A 3OU0A 5AVDA 2AXTH 2FKWB 3N7OA 1P12E 4L74A 1TAWA 1BZXE 1W10U 2O3JA 4AN7A 2SGAA 4B1TA 2QYIA 1LGHB 1NU9A 2VVUA 1EZVE 2RN0A 2RFKC 1CT0E 1QJ6B 1MZDA 1E1RD 2FBWC 4NA7A 3CL3D 2YIUB 3FWLA 5CJ4A 7KMEH 2ZFCA 4NA9H 4P00A 2J94A 1EDIA 1UTNA 5T1VA 3LW5H 1GBJA 2XNDD 2QF3A 5B6OA 1AQTA 2C8WB 4WMEA 3P8FA 3MUDC 3FXDA 3P8CE 2OQQA 3ZZ7A 1FPCH 5F6MA 3ATIA 1QL2A 1EZSC 2GCTB 2ZTXA 1Q7YQ 3GY7A 4XD7D 3ZVFA 4UB8E 4FUBA 2QC2A 1FAKH 3QZQA 2TIOA 1L0NJ 5EQQA 2VWMA 2GZ7A 1LWUB 1SQBJ 1KXFA 2ZU2A 1O3MA 3H7TA 4TWWA 1DOJA 5SGAE 4YOIA 5I46H 3PTZA 3A0HH 3TGUD 5F8TA 2Z5HA 4U3FD 1RTLA 5L8RJ 1YKTA 1SLVB 1HGVA 3FX0A 3V4QA 5AW9B 2OTJP 1O2SA 1SHYA 4FETA 1FIZA 4IC5A 4B6EA 3W68A 3D71A 3F0OA 5KAIH 5C0TA 1HAHH 3VB7A 2A4RA 1Z1JA 2RA3A 5EXNA 1CHOF 1GJBB 1MTNC 3N4XA 3M91A 2Y80A 3SNBA 3KPEA 1O5AB 4CH8B 2ILNA 3AE2C 2ZHDA 2L74A 1TLDA 3U28C 3H1LE 2PUXB 3BG4B 1K04A 1E1QD 1P8VC 2FOCA 2ZZUH 2K8IA 4X0WU 8GCHG 1GU4A 4NFEA 3A7XA 4YXDC 1BTXA 2HFED 2KZJA 1PYTC 1V2MT 3T25A 3LOXA 1F5KU 3RU4D 3V13A 1W0YH 3A83A 1CZQA 2HVXA 1PJPA 3F9FA 2XBXA 1PQ5A 2HWLB 2JH6D 3KEEA 4Y71A 5DK1A 1CQQA 3UUZA 1NFYA 4CRBA 1ZJDA 2KS1B 4BAMB 3DSGA 3UB0A 4F4OC 1GVLA 1DWCH 2G81E 3RXGA 2RCEA 1BOQA 1GHBF 1OWEA 1GDTA 1WSSH 1XUJA 1ZW0A 1YLCA 4WH8A 4X2VA 3ZV8A 3DD2H 1A2CH 4OGYA 2VINA 5AW3B 3ZVGA 1LTTC 1Z8RA 3M3TA 1K1OA 2WPHS 1W8BH 1KILB 2LKMA 4B75A 4DZOA 1KD1Q 4KTSA 1M9UA 3MO9A 1IFDA 2FESH 3QZRA 1HWTC 3UWIA 1VGCC 2O01H 2PGQB 4B76A 2G5NA 2PR3A 5IK2D 1RY3A 5HMAA 2B9LA 3TNUB 1PPCE 2M3EA 2SNWA 3HGNA 2R44A 2CHAB 3S4RA 4SGAE 3CWBE 4YLQH 1WRGA 3BTKE 3MIWA 4GHQA 2H43A 2XC0A 1W2KH 2YMSD 5H2FH 1GJ7B 1KQLA 1AB9B 2A7JA 2ZHEH 2VRSA 1BRCE 5C5OA 1MKMA 3D70A 1SFQB 5T6GA 1RS0A 1YWUA 4KGAA 3B71A 1GMCF 2E42A 1HJAC 3RXDA 1L1NA 2B87A 1HNEE 5EJZA 3ESTA 4MNXA 4ZMAH 1K1NA 2Y0EA 3CCVP 1CU1A 2WPKS 3PM3A 4WF8A 3UQOA 1KXCA 1OXGA 2QIQA 3LGUA 1YTZT 2ZCLP 4I7ZC 1BBRE 1JWTA 4I33A 1PP9G 5J4QA 4B71A 1UHBA 2VJ1A 2PSYA 1TQ7B 1HUCA 1O2IA 1DWBH 1QNJA 4AFSA 2LXCB 1UIIA 6GCHG 1HAVB 1EOJA 3VP9A 2UWLA 1IQHA 2A45I 2K9YA 3A8AA 2BDYA 3KQCA 5DP7A 1H8HD 2QE7D 2QXGA 2ZQ1A 1ZMEC 4XFQA 5LPEA 2KCPA 5JB8S 3BTDE 3L74E 1GPZA 1QL1A 2WMMA 1P9SA 3ZZ3A 4GKGA 3MNSA 1E34B 1GBAA 2WPSA 3OTJE 4YZUA 4ZKNU 5CCGC 1FZFA 1OWAA 1EAXA 5AVZB 3HK3B 2QF4A 3RC5A 1MCTA 2ZDKA 1F0UA 1FOSE 2PAJA 2FI4E 3L74D 1TWXB 3M9QA 1WQVH 3NXPA 1SGNE 2P8OC 2W6JD 3GY5A 3BSQA 3OY6U 4IS5A 1BSHA 5DPAA 2ZXXA 1EPTA 1ZHRA 1UCYE 3H1IG 3RMOH 3A85A 3TF5A 1CSOE 1U6QA 1THSH 1QA0A 3E90B 5KLVG 1HAVA 1G3CA 2FX6A 4AC9A 1BE3E 2DE9A 4H0LB 5A2MH 4HB1A 4WMFA 3PTNA 2JDIH 2JH0D 2Y7ZA 3PMHB 1NM6A 1T8OA 5DO4H 3ZVEA 2BOHB 1W3CA 3AE4C 2V3OH 1DXPA 2ZHQH 4UDWH 2B89A 3NXSA 2AMQA 2HALA 1TPSA 1LJ2A 3RP2A 2XXLA 3EA7A 3GDVA 4J1YA 1XTGB 2LP6A 1BTUA 3RXEA 1A61H 2STAE 2Q6FA 1ELTA 3VN0A 4CR9A 3A7VA 1C2MA 2Y81A 3ITKA 3URCA 3M5OA 1AO5A 1LWUC 1WAYB 3K6YA 1YPLH 1SGYE 1O2ZA 4X6MA 1RE3C 2ZGCA 2P59A 5LPRA 1MU8B 1EJAA 3Q00A 1DWEH 2WT7A 1BGYD 1OXZA 1SI5H 3RXJA 4L75A 5B5EH 2BDGA 5CDFE 2XBVA 2B5TB 3E8LA 2FO9A 4X2XA 1M7LA 4WY4C 1NTMG 1HXFH 1DS2E 2FX4A 2QA4P 4R4LA 2GMTB 2VVCA 1S5LE 4Z1MD 3P6ZB 6CHAC 3SO3A 1N7SA 1NTZD 2L5GB 4D6TG 2ZYGA 1D3PB 1C5UA 1WOFA 1S6LA 1NKZB 2CMYA 3S69A 2SGPE 1YJWP 1FJPA 1DVAH 3AE9C 1ORFA 5L2YH 3IG6B 1FY3A 3BCCD 4AG2A 3SW2B 4A5TS 1W0ZU 5GTIE 5L2ZH 1Q2NA 1A02J 3GDSA 4ZHLU 3BN9A 2ZKSA 3BG8A 3SQHE 3A84A 4MLFB 3M06A 4Y28J 1OW7A 3Q5RA 4KP0A 1BTWA 1KB9I 3TK1A 1C1MA 5JBAS 3WUUA 2WITA 1SOTA 2K1AA 2XU6A 1KTSB 2M0BA 3F9GA 1NTMD 1MV8A 1G2LA 1P2NA 2R5DA 1GW3A 1ACBE 4WY4B 1OWHA 1C1WH 2BXUH 4TPIZ 5C1UA 3N7NA 2ZAEB 2N1TD 3FVFB 1FUJA 1DX7A 3H5CB 3GY2A 1O3PB 3VB3A 1O2GH 1FZCA 1T3UA 5CCGD 2A06E 3WUTA 1HJ9A 1P3CA 1AWHB 2W6BA 1UVSH 2YOLA 3KQ5A 5KAFE 2HOBA 2JKVA 2A4OA 1KLTA 4LLHA 1V3XA 4B6FA 4H13C 3QN7A 1MUUA 2R2WU 2ZDAH 3Q1MA 4THNH 2FOGA 2R3UA 1C4U2 2F4LA 3G9RA 5KKZB 1BB0B 3GICB 2Y5HA 1CI6A 1T6AA 1SQQG 2G3AA 1YF4A 2H5CA 2BDCA 2ZT9D 1SQRA 2GV7A 2H5DA 3MTUE 2O01N 5FHTA 4ASUD 4DW2U 2ZT9C 3U8TH 6CHAB 1ZV8A 4K8BA 4LK4A 1P57B 2ZYAA 1NAFA 1BGYJ 3SSUA 4RKUJ 1B5GH 3GISB 4BOHA 2LXBA 3G3ZA 1GK4A 1P06A 2ZU4A 2XRCA 4FUCA 4BTUB 3IR9A 1VQOP 1O3HA 4ABHA 3JZ1B 3U1IB 1C5YB 1TX6A 1GL2C 3K5BA 2BCCE 2BEQD 5CCHC 1O39A 3FOAA 1S0RA 1G3EA 3PMJA 4GIFA 4AOQA 1T4UH 3L72G 1MH0A 3WW7A 3RXIA 2KX4A 5I25A 4RESB 2H8PD 1AUJA 2E5TA 1Z56A 2ZFQH 3KQGA 1H0TB 3GS9A 1O5CB 1NH4A 3KCGH 1IO4A 2HLCA 4KKDA 3UR9A 1MFZA 3LGTA 1XKBC 1QZ8A 5GWZA 3BV9B 5A8XA 3A8CA 1MAXA 4AORA 3E0NB 1RRKA 1GBHA 1DH3A 4C7NB 1W0JD 3LGVA 2ULLA 1YBKA 4MPWA 3TGUE 3SWKA 1GBKA 3V5BA 2BX4A 2A4GA 1GHZA 2LPRA 2W27A 4X2YA 1JY3N 1CGJE 2ESTE 3M9BA 1TMBH 2BD9A 3L75G 1G2CB 1VKYA 2E76D 2WSEJ 1O2PA 1JMBA 1O3OA 1OW6A 3CCMP 2C4FH 1DWDH 2WQYC 1C9PA 3UNSA 1GZLA 3LIDA 3A7TA 1KMHB 4HI3A 1O3AA 1UTLM 2VVVA 3RK2C 2C90B 1P84H 5EFWB 1O3IA 2AERH 2IPHA 4RSPA 4Y7BA 1Y5BT 2OC7A 4ZCNA 2KLVA 3SGAE 5JBTA 3A2AA 4JYTA 2Q5UA 1BCCJ 2IFMA 1AVYA 2JETB 3PHLA 3CNRA 3FKSD 1XUKA 2XTTB 1G2MA 3RBZA 3IITA 1VQMP 1P05A 1O3DA 3RMNH 2VH0A 1JXPA 4Y79A 1SGRE 2QJKB 4D7GA 3H32A 1G2CA 1GBIA 1CT2E 1TNJA 1N7SB 1JUNA 3MHWU 4YO9A 2NPSD 3E7KA 1WCZA 1EFRD 2O1KA 2PKSB 1YPKH 1NYHA 1DIPA 2JJ2D 4MVNA 1VITF 4OS1A 1N7SD 3QO6A 1SS1A 1YPEH 3U1CA 1C2DA 4X1QU 6ESTA 4XRNA 1DE7H 1O3GA 2H88C 1D6RA 5EQSA 1KORA 4OS7A 1O5DH 1DITH 4DIIH 1JNMA 3OSYA 1GDNA 3SUEA 1C2IA 3GYMA 3A7WA 3B5NB 1O5EH 1S1CX 3FN8A 1TABE 3OX7U 3SOSA 1RGQA 1GI2A 1K9OE 3SI3H 3SV7A 2JKHA 2HPQH 2OBQA 5FAHA 3UIRA 4WMDA 1EP6A 1ELEE 1Z1IA 1KIGH 1GVKB 2JWDA 4TT3H 1U7MA 3VPKA 8ESTE 5KJ7D 4YXWH 3VB6A 3V6IA 3MH4A 2F9NA 3ZVDA 1AWFH 2OTLP 1TMUH 1HFDA 3LGYA 3PRBA 3GCOA 3RC6A 2OYIB 2RMZA 1A0LA 1VF5B 2Z4EA 1FPHH 2FS9A 3WUVA 3A7YA 4VGCC 4K3AA 2FPZA 4HZHA 2EI7A 3TNUA 5EPYA 2ZPSA 1OX3A 1VCQA 1SGCA 3SNDA 3L75D 4ZMDA 1O32A 1KC8Q 4CH2B 1MUEB 3BTTE 2QA9E 3BATA 4GODA 4WXVA 4FVBA 4CHAC 4NWLA 4NIXA 3RLWH 1A5GH 1XUGA 2AHME 2N1TC 3F68H 1WTGH 4AFQA 2FYNB 1NZQH 2Q6QA 1WQSA 3A86A 1C5LH 4TWYA 5K7RA 3H1JD 3ABVC 1YLDA 1RF0C 3JC22 1ZR4A 4NFFA 2ZVOB 2BVSH 4FOUC 2ODQA 1C4V2 1HVVA 2BCCJ 4BRYB 2NU2E 3K65B 1ZSJA 4DCKA 5HGGA 4F48B 1P04A 2ALVA 5AVQB 4JMYA 2GZ9A 3FP7E 4GVUA 4XBDA 2OK5A 5KAIE 3SWFA 1AU8A 3RXTA 3ODFA 3MQKC 1LP1B 3OTPA 2BD4A 1BGYE 4OWFA 1CGHA 2KSJA 3QTOH 4NGAH 4NPFX 3SJ9A 1KFNA 5KLVJ 4VGCB 4I6MC 5ESBA 2GCHG 2GT8A 3P8OA 4D9QA 4BXLA 3CCSP 1A5IA 5AW4B 3M35A 5BU8B 1A3EH 1O36A 1GHBG 2FLRH 2WPQA 3SU1A 3VG8A 2BY7X 1GBBA 1QL7A 2GMTC 1ZHMA 2QF0A 2GCTC 3UNQA 3CCQP 1P2MA 1MZ9A 3SNCA 4B2AA 2HODB 4Y11E 4WY4A 2ZGJA 4OH8B 1JOUB 1S5LH 3M61U 3H1HE 3SU2A 4Q63A 5GDSH 1S3JA 2GT7A 1C2JA 5DP6A 1C1TA 4NIWA 7GCHG 4MQAA 2OC8A 2FOAA 2C8YB 1GCTB 2WSFJ 1QR3E 4C46A 1NU1J 1GJ5H 1AE5A 1ZMNA 2GDEH 3SU3A 1G3DA 4DOQA 2SGEE 3TVJB 3V4WA 2BZ6H 3QWCH 1CVWH 1K73Q 1PPBH 5ABWA 2FYUJ 3UY9A 3R2PA 1JMOH 3OEHD 2XDJA 1VCWA 2PTNA 1ID5H 2SGQE 4FVDA 4O9VA 1DY9A 4DT4A 3OAAD 2VNTA 5APXA 1VQ5P 1YC0A 2G51A 1Y3WA 1T2KD 2QJYC 3IFMA 1VQ8P 2HODA 4PV1D 1IQLA 1UIXA 1GI9B 1RE4A 1SG8B 1FMGA 3F0PA 4Z6AH 1EQ7A 3KXDA 5KECA 3G01A 5FX6A 2VWOA 1XUFA 3A81A 1D3TB 4K5ZA 3MO3A 1AD8H 1XKAC 2OYHC 4TSFD 1G36A 2EA3A 4X8UH 2QG4A 1J8AA 2HVYB 5EQRA 1AV1A 1V2NT 1KFMA 5B66E 2C8XB 1C1RA 1NO4A 1P2IA 3TITA 4GOFA 1O2TA 3I77A 2NPSB 2A5KA 2HG5D 4BNRA 2XWAA 2D2CB 1Y8TA 3QX5H 3DFLA 1KXBA 2V35A 1H8ED 1OOKB 3TDKA 2WT7B 1URQA 1OP8A 4NPEA 1Y9BA 1FNIA 1KILC 3PRDA 1YGCH 3DCLA 1X9VA 5HIZA 1GHXH 2P93A 2HLDD 4I8HA 3S1KA 3A89A 3SNEA 1GDQA 1C5MD 3AAUA 4C7RA 1TMTH 1HAIH 2D8WA 2YMSC 2V0BA 1QB1A 3M7UA 2D2CD 2IPPA 1L0LD 1MTNB 2J58A 2GGVB 1GBTA 2R2MB 1TPOA 4HKZH 3H1HG 2WINI 2A7HA 1S9KE 3LT3A 1Q90D 4I7YH 4XA4A 2H89C 5DP8A 4GSOA 2EI8A 3AEEC 2XNXA 4MNVA 3S9AA 5HM2A 1V2WT 1LVOA 1ANBA 3OFND 4YT7H 1Y3XA 2P3FH 1ZPCA 2WSCJ 1JTHA 3TSIA 4X1RU 1QHRB 2Y9ZA 4U01A 2AYWA 2ZNKH 2KI7B 2OBOA 1C5SA 1KTTB 1ZPBA 3PMAB 4M9FA 3S0NA 4NWKA 3ZZDA 3MHVA 1NT1A 4XE4A 4KJMA 1EDLA 4YM9A 1IHSH 1JY2P 3HUSA 3HUSC 2KAIB 3H25A 1OWJA 1ZYOA 4NZLA 1WXRA 5BVZA 2BY9X 3H32B 1RE3A 1HGTH 4UEHH 1PPJE 1HPGA 1MBMA 1NTKD 2O8TA 1HJ0A 2N1TA 1USEA 4MNWA 2XC5A 5EIYA 1K9MQ 1N8OB 1YPMH 1DFPA 1ETSH 2FP7B 1C1VH 3F6UH 1X0TA 1VR1H 3SHCH 2L91A 1V2RT 6LPRA 4A92A 1HIAA 2IZ0A 4H44C 2ZG0H 2ZFRH 3VGCC 1YY3A 2NU1E 1SLXB 2IBZD 1SR5C 1AVXA 5APVA 4ZH8A 2K1QA 5C94A 5DP3A 1C5ZB 2OQ5A 1JOCA 2QM8A 4OGQD 4E06H 5A8YA 1ANDA 4IFMA 1GK6A 3RXPA 3SFDC 3Q3XA 1O3CA 4XSKU 1ZMLA 1YYY1 2H9TH 2ZT9B 2O8LA 1L4AB 1KY9A 3HKJB 3S7KB 4YXWD 1Z8JB 1LHCH 2G8YA 1EB1H 2NU0E 1EZXC 2P3UB 2Z7FE 1QJ1B 2O8MA 2FYUD 2WSSH 8GCHF 3TJUA 2Z3CA 1FONA 4UB6H 3NK8A 2PW8H 5F53A 2A31A 3SORA 1A46H 2HNTC 3LIEA 4K8YA 2QCYA 2Z3DA 3T97B 3ATLA 4YOGA 4Q7XA 1O30A 1RH5B 2VWNA 4RKOB 4ABGA 3AEAC 4D6TD 3A88A 5EW1H 1DICA 1BBRK 3L73D 1MABB 3OAKA 4MPXA 5DJUB 3RL0D 3MTYA 4YOJA 3NWUA 2FYZA 3SU0A 1FN8A 1W7XH 1YQ4C 1FZZA 1T4VH 2BVXH 4X6PA 3VXEH 4ABJA 4MPVA 1L0LG 2A5IA 3CS0A 3L71J 1FBMA 3CCJP 1EAWA 1UW7A 3K2UA 2D1JA 1P9UA 4ZKUA 3TJOA 2VBCA 3RXKA 1IC2A 2V7QH 1NFUA 1SGIB 1P11E 2P10A 4NPDA 1O3EA 1OS8A 4Q7ZA 4IL6H 2NPSC 1OIPA 2VIOA 1AZ8A 4X6OA 4Z1MH 5DP9A 1SFIA 1W12U 1RF1C 3TGIE 1FDOA 3L72E 1AHTH 1EKBB 2PSXA 1KTMA 5FXLA 1YPGH 5JBCS 4N78E 1SQBD 4LOYH 3T28A 1OHHD 1IQGA 4O97A 1U57A 2CK3D 5FPSA 3SQEE 2YKQA 3V7TA 5GPIB 1O35A 1IZNB 2OC0A 1KLIH 1D7MA 1SB1H 4U3FE 3SV8A 1L2PA 1WBGB 1GJDB 1ZOMA 3GHGC 4NZQA 1LTBC 5L6NH 3AE6C 1T7CA 1GJCB 3M0DC 1SGFA 1H9IE 3SYJA 4H4FA 3URDA 2BQ6B 1W5CE 1BCUH 1T8LA 1DD4A 1IQJA 4XDEA 3MU0A 3E3TA 1R8EA 5AVSB 4OS2A 1ETTH 2G55A 1BGYG 1QX8A 3RXQA 2F9VA 1RF1A 4WWYA 5KLVE 1GG6C 4TT3D 1C5PA 1OVVA 1LVYA 5GXPA 2AXTE 2RH0A 1WV7H 3P92A 5HIYA 1KN7A 1L0NG 5E2PA 3KYGA 5DN6D 1SQXD 3I56P 3BF6H 3D65E 2WZQA 1S81A 1EDKA 2FFDC 3A80A 3SUDA 2WUCA 3MZWB 2CF8H 1UO6A 1O34A 4FUEA 2YNYA 1VQ4P 1AQ5A 3MO6A 3IF4A 2SGDE 1JTHB 2XCFA 2ZFTA 2POHA 1IFJA 1QGKB 2HNTF 1S4XA 2GM4A 3SJKA 2K0QA 5CMXH 4K60A 1IFMA 3L37A 3VMXA 1SFCD 2Y7XA 3TH2H 2WVRA 3ZZ6A 2RDLA 3T2NA 4L76A 3TIUA 5E79E 1GJ9B 3AE7C 3QUMP 4GCHG 2OYIA 4Z0KA 3FGAD 1HIAB 1EATA 1FY5A 1AB9C 5CCHA 3H1JE 2DUCA 2VIWA 5T3HA 1AE8H 3B9FH 2Q1KA 1BJVA 2WV4A 3KZIE 1AI8H 1VQLP 1O2HA 1C2GA 3RXSA 3H1JJ 2KS1A 2A4QA 2K88A 2J98B 4Y6DA 3T5FH 3TK9A 1O2VA 1AVWA 3HGPA 4MN4C 1TOCB 2M3BA 2BD5A 2M8RA 2EEKA 2FWWA 3FZDA 2W8ZA 3I29A 3LDXH 1NY22 4MDSA 1AFEH 1E38B 3RM2H 5TISE 3CS7A 2AEMA 3EE7A 1ELGA 2FYRA 1O2QA 3Q2YA 3PTBA 4Q2KA 5APWA 1PGQA 1V2LT 2GZ8A 2JH5D 5C2ZA 2FYNC 3MOCA 2RG3A 3BTQE 4X8SH 3AEFC 1HGZA 4BRYA 2QAAA 3H1KD 1W2EA 2FIRH 2V6NA 4JZ1A 4BAQB 2WPLS 4H6SB 2IBZE 1PGJA 1SMFE 1BMAA 1THRH 3UIAA 2PTCE 2GTBA 2BDIA 3RXBA 1L4ZA 3TNSA 3CI9A 5APQA 1BCCD 3PLKA 3NUMA 5EG4A 1C1QA 4M7GA 2PRRA 3G71P 3B5NA 3L70G 1BTZA 3E1IA 2AGIX 1ELBA 1YCPM 3SV9A 1NU1K 3H1KE 1L0NK 3TU7H 3L35A 1UMAH 4OGXA 1YTZI 4UB6E 4UONA 2I8DA 1SBWA 2PGBB 3ITIA 3E16B 3GOVB 2FYUE 4H44D 3PO1B 1K28D 3FAOA 1YPHE 1IQEA 1PGOA 1T31A 5AHGH 5FL7D 4YTAA 1JCDA 3HUSB 1SVFA 5AVVB 1UVPA 1CBWB 2KAIA 1E5WA 1NGMB 1AFQC 4XFJA 1EX3A 1XXDA 1C1NA 1QRZA 2ASUB 1EJNA 5EJLA 5T6FA 1FOSF 3F1SB 1UVTH 3D6ZA 1NOHA 1GI7B 1S2EA 1XVOA 1RXPA 2ZI2H 1MQ5A 3GLMA 1ESBA 4A7PA 2C93B 1MTWA 5CHXA 3SBKA 3MNXA 2M5AB 2XKMA 1T3JA 3PMBB 2HPPH 3I55P 1USDA 2QVAA 3CP7A 1OFCX 1ZP0C 1T32A 1KYNA 3L33A 2W6ID 1N2DC 3EFFK 2ZHFH 5TISH 3AEBC 1A0JA 1LPGB 1SQTA 5IDKA 3H1KG 4AQRD 1O3NA 2ODPA 3RU4E 1QGFA 1QLED 1SQVJ 1FY8E 2NWNA 1O2LA 3MH6A 4EI2A 2FOMB 1V6DA 2IJD1 2BY6X 2A45G 4GCHF 4H0LC 2BYAX 1FZBA 1EPTB 4EYYQ 3LONA 1L0LK 2R3SA 1ZSKA 2PWXA 3L73J 1AGJA 5AW0B 2Q3EA 2ZECA 4ZHMU 4FUFA 2FXOA 4K1TA 1C5OH 2GUVA 1J1DC 4TY6A 1CA0B 5A8ZA 5TJXA 5KTBA 1XMNB 3BEUA 4OGQC 3HE5A 3V2NA 4D7FA 1K8AQ 3ODDA 3M0DA 3GHGB 1H9LB 2OINA 1NESE 4KELA 2Y6TA 5LPFA 3H1IE 2SGFE 1TRMA 2QJYB 1D9IA 3MGNA 5ESTE 5E0HA 1WUNH 1BDDA 1TGSZ 2ZFPH 2BLWA 1QB9A 1QBOA 2BD3A 1FIWA 4EOTA 2FMJA 2TGAA 1BA8B 3CC2P 3BTWE 3GY3A 3PWCA 1QTFA 1H88A 3ZDMA 1K1PA 5A0CA 4N78D 3QH9A 1NO9H 1TNKA 2M2AA 2ZWLH 3A87A 2FXMA 4RT0A 4A1XA 1LTAC 1OKXA 4UD9H 1KMIZ 1RD3B 1FX0B 1TGBA 1TGTA 2XW9A 3CENA 2EY4C 4GUXA 1LT9C 3JCUH 3RXRA 2NZ2A 4E7RG 1N6YA 4YESB 2YO3A 1T8MA 1RTKA 2G8TA 3FXEA 2FOFA 2ZVNB 4BAKB 3VB4A 4RN6A 1V2ST 4U3FG 1SFCA 7GCHF 4WB4A 3B23B 3TPIZ 1IJDB 8KME2 1GTWA 3TK5A 1EC5A 4Y99C 1HJ8A 1LCYA 1GD2E 1K1IA 4BXSA 3RXLA 1M1JB 5C17A 1KV4A 1D4PB 2F83A 5C5NA 1NVOA 4DIHH 2CXVA 1YP9A 1H8DH 4B74A 3ATWA 4SGBE 1LTOA 1BBRH 3PLNA 1GJAB 4U3FJ 4LXBH 2FTLE 1RF0A 2QN5T 1E36B 4ABFA 2PP6A 2V4HA 1W2BO 2G5VA 2B0FA 1Z7KA 2C9LY 1DEEG 3SHAH 2ZYDA 3WU2E 1GBMA 2AIPA 2BZAA 2M5TA 1Q2WA 4X2WA 3QWOC 1WU1A 1RIWC 2JJ1D 1S6HA 3M9HA 1P2OA 1QBNA 5AF9H 1LDTT 1PPJG 2F9OA 2NPSA 4TYDA 2FI3E 2ZGXH 1E79H 1GGDC 1GMHG 1VDFA 1CE5A 1AKSB 1UTPA 3W67A 1C5VA 5EPNA 2A06G 2PGDA 2AIQA 3E91A 4AGKA 1QA7A 4IW4E 4OS4A 1VGCB 4IMQA 5AVYB 1C2EA 2BOKA 3O8ZA 4JZFH 2I1JA 4INLA 4JYUH 2SPZA 3R4YA 1HUTH 3CX5E 2WPJS 3KF2A 3B5ND 1FJSA 3A0BH 3L71G 2IYOA 1QQ4A 1V2PT 2KNCA 2W5EA 3HPTB 5G4BA 4ABAA 1PPZA 1SHHB 1O0DH 1ZXGA 3L74G 2BDHA 3GCHC 1KDQA 1V2TT 4P02A 4F55A 1ZN5A 4PD4E 2H2ZA 3RMMH 4ZXYH 1O2RA 1F7ZA 3SV6A 1GHWH 1QVFO 1W14U 1N7LA 4WVZA 2BY8X 1K1MA 2P7JA 3IN6A 2C9NY 3L71E 4HFPB 4IGDA 1RTFB 4BTIB 1NROH 1PP9J 1O2KA 3HD7B 4FUDA 2ZA5A 5L30H 1NTMJ 1HCGA 3L4FA 1TNLA 1GHVH 1XM1A 1TALA 2OTVA 2Z9GA 1VL2A 4U30A 1PP9E 1KILE 1MKWK 2KZIA 3LIWA 4I8GA 2Q6DA 2TPIZ 3ATMA 1ELCA 2J97A 1H4WA 2XBWA 1P84I 1L4AD 3HD7C 3L3TA 4K69A 1FE6A 2YMKA 1AVGH 1MD7A 1QQUA 2FEQH 1IQMA 3BRTB 1DD3A 3RK3C 1XXFA 3H09A 1EDJA 5KJ7C 5KJ7A 1SPJA 2IOTA 3KQEA 5FPYA 2DW3A 5APYA 2BDAA 1OVRA 2KM0A 3WY8A 2KNCB 3A5TA 3RK3B 1T8NA 2J2UA 1NTPA 3SJ8A 4AFZA 1VQ6P 4DCDA 3PV2A 3CX5D 3MFJA 1J1EB 3CXHI 1EXJA 1C1OA 2CHAC 4IBLH 4NA8A 3ZYEA 4PV1C 3M36A 1ZR2A 4TY7A 5BRRE 1V2JT 1N8RQ 4FUGA 2BDBA 1ZRKA 1IQFA 1PIXA 3HE5B 1J9CH 1TFXA 1W13U 2J95A 3EYDA 1O2JA 4BWNA 3L73G 3P7KA 2WSEH 3D6YA 3CXHH 3H1IJ 4C7NA 1TA2A 1OYTH 3LGWA 2O01J 2YXQB 4FUHA 1FAVA 3GCTF 4GLYA 2C3SA 1BRAA 3HE4B 1SLQA 2BY5X 2FOEA 1TX7A 1TNGA 3Q3KA 1SOZA 1QY6A 1NBMD 4Q4LA 1DPOA 2ZCHP 1H89A 1Y3YA 2AMDA 3P8NA 4FU7A 5DP4A 2OQUA 4W7YA 1P09A 3KQBA 1SQBG 5HKKD 3PLPA 1YM0A 1O2WA 1ZR0A 5GCHG 2OLGA 1LPZB 5JPMH 3TYYA 2VIDA 1SGEE 2KR7A 5AFYH 1IHTH 2QIWA 4WWIA 3CX5H 1SGPE 1GI8B 3P17H 4AYYB 3T97A 1C1UH 1D6WA 3DFJA 1CSBA 3ZZAA 4TLFA 2R5BA 3SJIA 5IYTA 2Y82A 4Y99B 1EZQA 1K1LA 1E0FD 4R8TB 1AZZA 4ASHA 4Q7YA 3H1LG 3H6PA 2WYJA 1SQPG 5E79H 1BJUA 1K1JA 2XOKD 4MPUA 3BVHA 1ELAA 3NKKA 3RBXA 4UFDH 1TNIA 5AW2B 4ZKRU 2OP9A 3CLQA 5EOKA 3SU4A 1GL2A 1O31A 2LELA 2ZDMA 4I1LA 2E75D 2Q6GA 2I1KA 4A1TA 4PJ0H 1O2XA 3U69H 1M1JA 2BD8A 3BRVB 3FP6E 1GW4A 4O3TA 1O3FA 1NAYA 2CF9H 3A8BA 3OEED 1ESTA 1HDTH 4HTCH 1NPMA 4INKA 4XBBA 4RKJB 2KB7P 4RI0A 4ISLA 1C1PA 2Y0CA 4W7ZA 1B7XB 2K37A 4CPGA 1QRWA 1NTZK 3KDPB 1Z71A 3C27B 2H9EH 3KN2A 3T62A 1LT9A 2GP9B 1A0HB 3V2QA 1AA0A 3H1HD 4X8TH 1ZRTE 1ABJH 2FYUG 3Q5SA 1TX8A 3NTNA 5M1BA 4EIJA 5AW1B 1XUIA 2PKAB 1EXIA 1SGFG 1Y3VA 1J2JB 2J4IA 1FU1A 2JJLA 1DT2A 3SU5A 3FO8D 3GHGA 1GMHF 2AH4X 1SGQE 1KXDA 4CRCA 3ZZ5A 1FZAA 1PPFE 3EA9A 3ZYDA 2C0XA 1KDQB 1Q31A 1G9IE 4GT1A 1BTPA 2HRVA 1JRSA 3EA8A 1ANCA 1SQQD 1NC6A 3PV5A 1MZAA 1SSXA 1L1GA 1IAUA 4BTTB 2Q7CA 9ESTA 2ZPRA 4UFGH 3GG2A 1YI2P 1DDJA 4NSYA 1RQUA 1J15A 4AZ2B 5C67A 1T8ZA 4ACAA 1GU5A 2N1TB 1C1SA 5EU8A 3MNBA 3L72D 3M5MA 2FY8A 2F3CE 2J5UA 3Q3DA 1GG6B 1UTQA 2JR8A 3EQ0H 1COWD 2QM7A 1EJMA 1RJXB 1NRPH 1GWAA 3LJOA 4ZKSU 2WPRA 4DG4A 2VGCC 5FBIA 2OXSA 1F0RA 3LJJA 4I8JA 1GI1A 3L36A 2AMPA 2A06D 1DLEA 3M3VA 4ABBA 2J59M 4IFFA 4HGCA 3UWJH 3M3SA 5EXLA 1FI8A 5GTHH 1F0TA 3MH5A 4IC6A 1Y3UA 1BDCA 3MP7B 1JY2N 3L75E 4WH6A 1S72P 3BTEE 3ZZ9A 2F9PA 3W95A 3RXMA 1HAXB 1FZGA 1L4AA 1TIOA 2VIQA 4Y0YE 2VIPA 1BCCE 1XX9A 4ZHAA 1KYOE 3D23A 1LP1A 4KHXA 4JZEH 2YIUC 1S0QA 3I5CA 1YCPK 2O8WA 1W7GH 3RK2B 2P3TB 1K0HA 2P94A 3GDUA 1JY3P 3P32A 3W94A 1VQ7P 5KKZC 1TE0A 1G3BA 3MU5A 3VEQB 4CRGA 1ZTJA 4H42U 2LNCA 4H44B 2WPIS 5GTIH 1ZOYC 1O2OA 1UCYK 3HE4A 4PROA 3B8EB 4E05H 2ODYB 2FYQA 1IFNA 2Z9LA 3KL6A 4KTUA 1QB6A 4ACBA 2F9BH 1FZCC 2G4UA 1SQVG 2B88A 1NJIQ 2L6OA 3GW6A 1U7JA 1JMMA 2QJKC 4AUWA 1XVMA 4GOEA 2IJOB 4IMZA 3SJOA 1V2KT 3IAOA 1A7SA 4AYCA 1L4AC 4DJGA 4ZKPA 1KXEA 1TRNA 2QV1A 4JZDH 1O38A 9LPRA 3LW5J 3V3MA 4I8KA 1NTZG 3KYQA 2Z9JA 3M5LA 3U1AA 1HH0A 2GKVE 3TK6A 2FOHA 4X1PU 5CHAB 1CHGA 5C1YA 1Y5UT 4JF7A 1G1JA 1AY6H 1C5WB 2H9HA 2OCVB 4Y76A 2VGCB 1VF5D 1JY2O 1QRXA 1TNHA 1YBWA 5GJ4B 1Q86Q 3G6EP 2QXIA 2E5YA 3U98H 1MTVA 3SI4H 1FC2C 1O3KA 1Z6EA 2E74B 1NRQH 1HAGE 4CRDA 1BMMH 1LTSC 2ZFSA 3LU9B 3PV4A 5A0AE 4RT1A 5GNDA 1KYOH 2BX3A 1IQNA 3NPSA 3BCCE 3PJSK 1NFXA 2Q1JA 2CK3H 2PHBA 2ALPA 2VWLA 3L70J 3RL0B 1NU1D 1MU6B 1Y59T 2H7HA 5AW6B 1OSSA 1EQ9A 4OVNF 1KB9D 2D26C 2KOGA 2EC9H 2ZTYA 1E35B 4JYVH 3RMLH 4IL6X 3PRJA 2W83C 4LGDE 4AFUA 2FODA 2QY0B 5EW2H 3MYWA 1TOMH 3EGKH 1YCPH 3F5HA 3QK1A 4I2LC 3RDZA 1O37A 1VJ9U 4JYCA 4GHTA 4U32A 1RF1B 3A0HE 1J1DB 3AEDC 3F3BA 2YNBA 3TGKE 3E1RA 5AW7B 1S82A 3RXFA 1LT9B 1M8OB 3TGJE 1URQB 1LWUA 1Y47A 5AW8B 3BG4C 3L74J 1CW5A 1K05A 1SQQK 1HAOH 8LPRA 1KZUB 1L0ZA 2PKSC 1IFIA 1O2YA 4M3LA 2WPVB 3CWBG 1MBQA 2HYNA 1LTJB 3DSOA 3DSPA 2KSEA 3UNRA 3GF7A 2V7QJ 4UFFH 2ZCKP 2P2UA 3WWBA 3BEIB 1PL5A 1HAYB 2F9UA 3UTUH 2Y5GA 1BTYA 3MH7A 3STIA 1KLJH 3B5NC 1THPB 4GAWA 1Q81Q 2HNTE 5APUA 1BRBE 2EQNA 3SU6A 1ZLLA 1BCCG 1FLEE 1AVOA 2J38A 4CHAB 2THFB 3ATKA 1QVGO 6GCHF 2FYUK 2YKPA 1PFIA 1WTHD 3KNXA 4JZIA 5HYOA 1EAUA 3OE7D 3HD7D 1L2EA 1X79B 1AKSA 4WY4D 2F91A 3QLPH 3ZV9A 2Z6BD 4HYTB 1NU1E 2UWPA 1SLWB 1GBDA 1GGDB 2HLOA 1BITA 3MNCA 5APTA 4IFDK 1NRRH 2B7DH 4ZROA 1GL1A 3AW1A 1FJKA 3K9XB 1HF9A 1BTHH 2G52A 3F9EA 5C0UA 4DURA 4O03A 1HAZB 1V2QT 3HTKA 1JEKA 2BEZF 2QJPC 1PP9D 2BXTH 7ESTE 2WPMS 1BSNA 3VP8A 3LH3A 4RJTA 4Q80A 3Q77A 1WT6A 1MKXK 1SQBE 2KUBA 3NZIA 2C0WA 1MMJN 3II6A 1ESAA 3JZ2B 1WMKA 3RXCA 1TU3F 3V2PA 2VH6A 2A2XH 1SC8U 4FUIA 2WWWA 1E37B 1SFCB 1N8OC 2GD4B 1N86A 5EGMA 1UVUH 2AXCA 3C1LA 2FXPA 1J16A 1GCDA 5FCKA 3TGUG 4FUJA 1QJ7B 4MNYA 1HLTH 1TA6A 2ZQ2A 3UAIC 3VFEA 3KHVA 4FU9A 2YXRB 1FS0E 3B8JA 4YLUA 1JM0A 4AX9H 2MKVA 1PQ8A 2ANYA
chains in the Genus database with same CATH topology
2CPBA 1XTCC 2WSCH 4AQRD 5CCGA 3OA7A 1N73B 2A45G 4W80A 5CCHD 1FZBA 3H32A 1G2CA 1L0LK 1N7SB 1JUNA 2NPSD 2O1KA 5AW0B 1URQD 2GUVA 1J1DC 1N7SD 3P8CD 4O9BA 3U1CA 3SWYA 1N7SC 4HH2A 5KTBA 1JNMA 3HE5A 2BASA 3V2RA 3V2NA 3M0DA 3B5NB 3U59A 3GHGB 2IFNA 5AVRB 3MD0A 1LTGC 1NHLA 3MGNA 3WMM0 5BU5A 1DEBA 4LC1A 4EOTA 2N9BA 1RE4C 5KJ7D 1H88A 4N78D 2FXMA 2O1JA 1LTAC 3HD7A 1KILA 2OYIB 1G1IA 1LT9C 2Z4EA 1GL2D 2YO3A 3HRNA 1HJBA 3TNUA 1SFCA 2GUSA 1T2KC 4WB4A 2OYHB 1IJDB 1GTWA 4Y99C 1GD2E 3BATA 1X8YA 1M1JB 2R3CA 1GL2B 2N1TC 2OYIC 3A3YB 1SQVK 1N73C 3C9IA 2Q3IA 1RF0A 1RF0C 1ZR4A 2PP6A 2C9LY 1HVVA 3OJAB 1NKNA 1NTKK 1SP4A 5AVQB 2CPSA 3SWFA 2YO2A 3M9HA 2KSJA 2NPSA 2FKWB 1KFNA 1VDFA 4I6MC 5AW4B 1LGHB 5BU8B 2WSFH 5AVYB 3O8ZA 2WPQA 3CL3D 5CJ4A 2I1JA 2ZFCA 5AVWB 3VMZA 1MZ9A 2HODB 3LW5H 3B5ND 4WY4A 4OH8B 3P8CE 3MUDA 1QL2A 2P67A 1ZN5A 1N7LA 2P7JA 3VMYA 4C46A 2C9NY 1LWUB 3HD7B 2XV5A 2MJZA 3V4WA 3L4FA 2Z5HA 3R2PA 1L4AD 3HD7C 1HGVA 2XDJA 3V4QA 5AW9B 1YYCA 3BRTB 5APXA 5AVUB 3RK3C 2WZ7A 5KJ7C 5KJ7A 1T2KD 3IFMA 3VTPC 5APYA 2HODA 2W6AA 1RE4A 1N73A 3N4XA 3A5TA 3RK3B 3M91A 1EQ7A 2R32A 1J1EB 3KPEA 1ZR2A 2OYHC 2WTYA 1GU4A 3NMDA 1FDMA 3HE5B 2HFED 1KFMA 1SFCC 1NO4A 3P7KA 2WSEH 2NPSB 2ZXEB 2HG5D 4C7NA 1CZQA 4JYBA 1FAVA 2YKOA 2WT7B 3HE4B 1SLQA 1URQA 1KILC 1X9VA 4WBAA 1GDTA 1H89A 4W7YA 4C7RA 5AW3B 1LTTC 1KILB 2LKMA 2IPPA 4DZOA 2J58A 3TYYA 1IFDA 1HWTC 1S9KE 2O01H 3EFGA 3T97A 1RY3A 1CSBA 4XA4A 2R5BA 3VYIA 3TNUB 4Y99B 2XNXA 3H6PA 1HBWA 3BVHA 1WRGA 5AW2B 3MIWA 3CLQA 2H43A 1AFOA 1GL2A 1KQLA 4I1LA 2VRSA 3TSIA 1JTHA 2I1KA 2E42A 1M1JA 3BRVB 1GW4A 1JY2P 3HUSA 3HUSC 2KB7P 1YTZT 5BVZA 2OARA 3H32B 1RE3A 4DOJA 4W7ZA 1NTZK 3KDPB 2N1TA 1LT9A 1HUCA 3V2QA 1SQPK 3NTNA 5AW5B 4EIJA 1S9KD 5AW1B 3VP9A 2A45I 1J2JB 1FU1A 2JJLA 3EQ2A 3GHGA 1FZAA 5APVA 1SQXK 1QL1A 1JOCA 2QM8A 1J1EC 2C0XA 4GKGA 3RK3D 4GT1A 2WPSA 3RL0C 4IFMA 1GK6A 5CCGC 1FZFA 2FFDB 1OWAA 2Q7CA 5AVZB 1L4AB 1FOSE 2PAJA 1T8ZA 3M9QA 1GU5A 1LTJC 2N1TB 2JEEA 2QM7A 1A02F 1HTLC 3LIEA 2WPRA 5CMZA 2YMYA 3L36A 1LTIC 3OAKA 4N3YB 2J59M 4IFFA 3RL0D 2FYZA 1JY2N 4B86A 3HTKB 1FZGA 1L4AA 3NXSA 1FBMA 2XZRA 4ZKUA 4KHXA 1XTGB 3I5CA 1IC2A 3RK2B 1JY3P 3P32A 3VN0A 2NPSC 3PP5A 1LWUC 1RF1C 3NFQA 3HE4A 3B8EB 1RE3C 1IFNA 4N78E 2WT7A 1OXZA 3M0AA 1FZCC 1JY3O 2HPCB 1JMMA 1M7LA 4AUWA 2YKQA 4WY4C 4ZKPA 4AYCA 1L4AC 1N7SA 2A45H 3KYQA 3GHGC 2L5GB 1LTBC 3U1AA 1HH0A 1H8AA 3M0DC 1NKZB 1FZCB 4JF7A 1JCCA 1G1JA 1FJPA 5AVSB 1JY2O 1A02J 1RF1A 3M06A 3TK1A 1LTSC 3VOPA 1FZEA 2WITA 2FFDC 2XU6A 1MV8A 2YNYA 1KILD 2R5DA 1GW3A 1AQ5A 3P8MC 2HPCA 3RL0B 1JTHB 4WY4B 2H7HA 2POHA 5AW6B 1IFJA 2GM4A 3N7NA 2N1TD 2KOGA 2KP8A 1DX7A 1IFMA 3L37A 3VMXA 1SFCD 1FZCA 1T3UA 4LGDE 5CCGD 2W6BA 1URQC 5AVTB 2OYIA 4LLHA 4I2LC 5CCHA 4JYCA 1MUUA 1M1JC 2P1JA 1RF1B 1J1DB 5AW7B 1LT9B 1URQB 1LWUA 5AW8B 1CW5A 1CI6A 1SQQK 1KZUB 1IFIA 2IX7C 4M3LA 2M3BA 2HYNA 1LTJB 2Z5IA 1NWQA 2M8RA 2OYHA 3MTUE 3A7OA 2P2UA 5AVXB 1ZV8A 5APWA 3B5NC 1NAFA 5APUA 1ZLLA 3G3ZA 1GK4A 1HGZA 1W2EA 3IR9A 2FFDA 1GL2C 2Q9IA 3UIAA 5CCHC 2FYUK 2YKPA 1PFIA 4GIFA 3CI9A 1NTMK 5APQA 3HD7D 1X79B 4RESB 2H8PD 1SQBK 3B5NA 3E1IA 1Z56A 4WY4D 3KQGA 4HYTB 1NU1K 1NH4A 1IO4A 1L0NK 3L35A 2HLOA 1LTJA 1MFZA 1YTZI 5APTA 4IFDK 1JO5A 1FJKA 1DH3A 4C7NB 3RK2D 3HTKA 3V5BA 3VP8A 1JCDA 3HUSB 1SVFA 5AVVB 1WT6A 1E5WA 2W27A 1VPCA 1JY3N 2C0WA 3M9BA 3II6A 1G2CB 1IK9A 1FOSF 3V2PA 1NOHA 2WWWA 1SFCB 1N86A 2KYVA 1GZLA 3LIDA 5KLVK 5CHXA 3RK2C 2XKMA 1T3JA 4XE5B 5APSA 4N6JA 2KLVA 2E43A 1CI6B 3A2AA 5CJ0A 1N2DC 2Q5UA 2IFMA 3BASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VOP A;  5CCG A;  4W80 A;  5CCH D;  1KIL D;  3HD7 B;  3RL0 B;  1JTH B;  4WY4 B;  1N7S B;  2NPS D;  2N1T D;  2KOG A;  1URQ D;  3RK3 D;  1L4A D;  3HD7 C;  1SFC D;  3RL0 C;  1N7S D;  2XDJ A;  4LGD E;  5CCG C;  5CCG D;  1N7S C;  1URQ C;  3RK3 C;  2WZ7 A;  5KJ7 C;  5KJ7 A;  1L4A B;  5CCH A;  3B5N B;  2N1T B;  1URQ B;  3RK3 B;  1NHL A;  2M8R A;  5KJ7 D;  2YMY A;  2HFE D;  3HD7 A;  3RL0 D;  1KIL A;  1SFC C;  3B5N C;  2NPS B;  2HG5 D;  1GL2 D;  3HTK B;  1URQ A;  1GL2 C;  1L4A A;  1KIL C;  1SFC A;  5CCH C;  1XTG B;  3RK2 B;  4W7Y A;  3HD7 D;  1GL2 B;  2H8P D;  1KIL B;  3B5N A;  4WY4 D;  2N1T C;  2NPS C;  3PP5 A;  2PP6 A;  1HVV A;  3RK2 D;  4N78 E;  4WY4 C;  2NPS A;  1GL2 A;  1L4A C;  3TSI A;  1JTH A;  1N7S A;  3KYQ A;  1SFC B;  3M0D C;  4JF7 A;  3RK2 C;  1T3J A;  3B5N D;  4WY4 A;  4OH8 B;  4W7Z A;  3P8C E;  2N1T A; 
#chains in the Genus database with same CATH topology
 2CPB A;  2ZJS E;  2VU8 E;  2WSC H;  2VIV A;  5CCG A;  3GCN A;  3L70 E;  4JBZ A;  1D3Q B;  1OP2 A;  3TGU J;  2QGR A;  1FDP A;  5LH8 A;  5JYI A;  1GBC A;  2STB E;  1S5L X;  2KIK A;  4OM9 A;  1BDA A;  4ISH H;  2QEX P;  3USS A;  1OX1 A;  1TGN A;  5JDU B;  2D2C C;  2R0L A;  3U1J B;  1YLN A;  1URQ D;  1NU7 B;  3P8C D;  2M5A A;  1FY1 A;  3D49 H;  2Z9K A;  1ELD E;  4X1N U;  3SWY A;  4HH2 A;  1UHB B;  3RK3 E;  1H1B A;  4PD4 D;  1GCT C;  1HB0 B;  1SQX G;  1Y8A A;  1LHF H;  2ZGB H;  3LH1 A;  4AGJ A;  2BAS A;  3V2R A;  3EWK A;  1ZTK A;  1NRS H;  2FS8 A;  3ZZC A;  1NTZ E;  3CCU P;  2QE7 H;  3U59 A;  1AIX H;  4ISN A;  1JB0 J;  5AVR B;  1M1K Q;  1VIT G;  4H0L D;  2KLU A;  3MD0 A;  4ISI H;  1MAY A;  5TJH A;  4JQ0 D;  3WMM 0;  1DX5 M;  3A82 A;  1CBW C;  1R5S A;  5BU5 A;  4WVP E;  2WHX A;  3CCE P;  1BE3 D;  3CC4 P;  5LGO A;  4R0I A;  2N9B A;  2OD3 B;  3M7Q A;  3CXH D;  4L73 A;  1NS3 A;  4FXG H;  3RM0 H;  1Q82 Q;  1BML A;  3SNA A;  2ZC9 H;  2BLV A;  1AUT C;  2O1J A;  2RKL A;  5K0H A;  2UUK B;  1OMI A;  3HD7 A;  4D6T J;  2GA1 A;  1F2S E;  2A0Q B;  2I6S A;  2FZZ A;  2W3I A;  3T29 A;  4WJG 2;  2AS9 A;  1C5Q A;  4INH A;  2FTM A;  1GI6 A;  1OZH A;  3HRN A;  2PLX A;  1GDU A;  2ZGH A;  3DUX H;  3CXH E;  2O9Q A;  2XND H;  1T2K C;  3DA9 B;  4LZ4 B;  3TH3 H;  3RGU A;  3LC3 A;  1BRU P;  4AYV B;  1L0L J;  1TPP A;  1TBQ H;  2R3C A;  1H9H E;  1LQE A;  1PQA A;  2XNI A;  1GL2 B;  2AGE X;  1C9T A;  2OYI C;  1UVO A;  3A3Y B;  1GI5 A;  3U8O H;  2IDB A;  1SQV K;  5B5E E;  5K5G B;  2Q3I A;  1ZGI A;  1V2V T;  1M57 D;  2WSS D;  1BQY A;  2JIZ D;  1NKN A;  4HG6 A;  5DKM A;  1SP4 A;  3K6Z A;  2CPS A;  2HR3 A;  4DJZ B;  4J2Y B;  2YO2 A;  2TRM A;  1SQV D;  3U8R H;  3E1X B;  4K1S A;  4DT7 B;  1QFK H;  3CX5 I;  1P0S H;  1TQ0 B;  1LKA A;  3F9H A;  3LKW A;  1KB9 E;  2BVR H;  2BD7 A;  2JO1 A;  1PFX C;  1CT4 E;  2WSF H;  3P70 B;  3Q76 A;  4ZXX H;  1TB6 H;  3BCC J;  5C3N A;  1CO7 E;  3GCH B;  4BAH B;  5AVW B;  1RIW B;  3VMZ A;  2YMS B;  2IN2 A;  1PPJ D;  1PZQ A;  3S9O A;  3FZZ A;  3OYP A;  1PPH E;  1GHA G;  3FFG A;  3RXV A;  3VXF H;  3MUD A;  2P67 A;  5E8E H;  3GCT G;  1P01 A;  4MTB A;  1EZU C;  3D62 A;  1AQ7 A;  1OWD A;  1P2K A;  1SVP A;  1UTK A;  4HJG H;  1TYN A;  3AE1 C;  2ZFF H;  4U7J A;  2CJI A;  3VMY A;  5F03 A;  1M90 Q;  2E74 C;  1S5S A;  3I78 A;  3LC5 A;  1OW8 A;  2TGP Z;  1BE3 J;  3MWI U;  4U2W A;  2GX4 A;  3F2F A;  2J98 A;  1X22 A;  1TRY A;  1DUA A;  2XV5 A;  2MJZ A;  1SKY E;  4I8L A;  3KZI H;  3JCU E;  4CRA A;  2N9Y B;  4EST E;  3RXA A;  1KQG B;  1ABI H;  2E75 C;  5B66 H;  1ETR H;  4DVA U;  4Y0Z E;  4AB8 A;  1YYC A;  3FWN A;  3SUG A;  1ARB A;  5AVU B;  1SQA A;  1TBR H;  3SV2 H;  3S9C A;  2WZ7 A;  1K21 H;  3AK5 A;  3VTP C;  2PV9 B;  1JIR A;  2W6A A;  5JBB S;  2H1U A;  2Z94 A;  1N73 A;  1ZPZ A;  3M37 A;  1KYO I;  1B0F A;  3TJN A;  1PV3 A;  3O6Q A;  2ZU5 A;  5E0J A;  3WWF A;  2E74 D;  3A7Z A;  2R32 A;  1BE3 G;  5GTH E;  1FAX A;  4Y8X A;  1C4Y 2;  3MU1 A;  2FOB A;  1KQS O;  4AG1 A;  5CE1 A;  3L6P A;  1SQQ J;  2WTY A;  1BIO A;  5F8Z A;  2PKA A;  3JSV C;  3NMD A;  3KQD A;  1FDM A;  1ZRB A;  1AMH A;  3R0F A;  3S7H B;  1SFC C;  3CCR P;  3ELA H;  2Y9Y A;  2ZXE B;  1HBT H;  1LHD H;  4JYB A;  2YKO A;  1LMW B;  3UOU A;  3L72 J;  1IOE A;  5C1X A;  4I7Z B;  1SGT A;  1LT1 A;  1PGP A;  4WBA A;  1CA8 B;  3TJV A;  1MFT A;  2P16 A;  2J34 A;  1EP5 A;  4XOJ A;  2A32 A;  1BMF D;  2BCC G;  1BMN H;  4KT0 J;  1HYL A;  2TGD A;  1HRT H;  3EAJ A;  2AEI H;  1OWI A;  3F89 A;  4JK5 A;  4UE7 H;  5DG6 A;  1ZGV A;  3GYL B;  1GJ6 A;  3N7E A;  3AEC C;  5PTP A;  4TPY A;  3UPE A;  3EFG A;  4WY3 A;  3B4S A;  5CBO A;  2VB0 A;  2AEF A;  5DP5 A;  1HAP H;  1O2M A;  3VYI A;  1QEX A;  1MTU A;  2W7U A;  2E76 B;  3QTV H;  1GMD G;  1ZJK A;  4H13 D;  1KB9 H;  3H1L D;  1P2J A;  1HBW A;  2YNA A;  5KGO A;  3LGI A;  4PV1 B;  2BB4 A;  2ZU1 A;  1GBE A;  2ZHW H;  1AFO A;  1C2F A;  2QSI A;  4H13 B;  4UFE H;  1ZMJ A;  2FDA A;  5C39 A;  1PQ7 A;  4D8N A;  2FXR A;  1YPH C;  4B2C A;  1JIM A;  4BAN B;  1YIT P;  3C8V A;  1SQP D;  2R0K A;  3HAT H;  2JWA A;  2KCA A;  2JET C;  5TCA A;  3SGQ E;  3GMA A;  3ZZ8 A;  2OAR A;  3CPW O;  4DOJ A;  1WDI A;  2ZDN A;  4YT6 H;  3H1I D;  5H2F E;  4ASW A;  2V3H H;  5DSF A;  1GJ4 H;  4ZAE A;  1WYK A;  1PPG E;  1EAS A;  1LO6 A;  3LPR A;  4CR5 A;  1O2N A;  1VZQ H;  4NG9 H;  1SQP K;  5KLI C;  3UR6 A;  5AW5 B;  2P58 A;  4NSV A;  4JK6 A;  3PB1 E;  1S9K D;  2CGA A;  1NRN H;  3EQ2 A;  1MKW H;  3L70 D;  2ANM H;  2JDI D;  2WPD D;  2PFX A;  4GPG A;  3V0X A;  2BCC D;  1HV7 A;  2Z9I A;  1L0L E;  4DT0 A;  2PFE A;  4ASV A;  1SQX K;  3E0P B;  3W1E A;  2R3Y A;  1R5L A;  1GBL A;  2WUB A;  2QJP B;  2ZPQ A;  1J1E C;  3FP8 E;  3H1H J;  4Y7A A;  4AB9 A;  2FLB H;  5DJ7 A;  3RK3 D;  1P2Q A;  2CN0 H;  2WV5 A;  3Q3Y A;  3RL0 C;  2ZDV H;  3STJ A;  3KGP A;  3ENS B;  1INC A;  1E79 D;  2ANK H;  1VQ9 P;  2H6M A;  2FFD B;  3C1K A;  1D3D B;  1LNQ A;  1P3E A;  1GHA F;  3P8G A;  2EI6 A;  5BPE A;  4D6T E;  4Y10 E;  4E7N A;  1EZV D;  1KXA A;  3EE0 B;  3NCL A;  1LTJ C;  2ZDL A;  1O5F H;  1EXF A;  1Z8G A;  2KZ4 A;  2JEE A;  3HKI B;  1LVB A;  2Z3E A;  1F5R A;  3UOP A;  1A02 F;  1EAI A;  2E75 B;  1HTL C;  1FV9 A;  4IN2 A;  5CBN A;  5CMZ A;  2NU3 E;  2UWO A;  2ZP0 H;  5CHB A;  1QIX B;  2QXJ A;  2YMY A;  4UB8 H;  4X8V H;  4PD4 H;  1O3L A;  1S84 A;  1LTI C;  3H1J G;  1LPK B;  4N3Y B;  5GIB A;  3KHU A;  1SLU B;  2KCO A;  1YHQ P;  3H1K J;  3A0B E;  1GI0 A;  3Q5P A;  1YPJ H;  4B86 A;  2A1D B;  2IPQ X;  2FM2 A;  2OTK E;  3HTK B;  1CGI E;  4IN1 A;  5FPT A;  3RL0 g;  2ZEB A;  4RO0 A;  4A7I B;  2OYO A;  4PD4 I;  3AAV A;  3AW0 A;  4ABI A;  2XZR A;  2W3K A;  1YQ3 C;  3AVZ A;  4Y8Z A;  1SQX J;  1SQO A;  1FQ3 A;  1J17 T;  1RQV A;  1A3B H;  2GV6 A;  1J14 A;  3GY8 A;  2KFW A;  3O6Q B;  1QL8 A;  3MI4 A;  1BT7 A;  2W7S A;  1LQD B;  3VMA A;  3UQV A;  1LKB A;  1ELF A;  1EB2 A;  4GDO A;  4WXI A;  4XBC A;  1SQP J;  3PP5 A;  1EOL A;  5EXM A;  2BM2 A;  4I31 A;  1C5T A;  5A09 A;  2NU4 E;  1P84 E;  1DUE A;  3NFQ A;  1L1J A;  3E6P H;  1O3B A;  5T6D A;  1SQQ E;  2SNV A;  1NTZ J;  2G4T A;  3AE8 C;  3M0A A;  1MQ6 A;  2K9J B;  1GMJ A;  2D2D A;  5DGJ A;  1JY3 O;  4CBN A;  1GL0 E;  1SL3 A;  2B9B A;  2HPC B;  3M7T A;  4D76 A;  3M5N A;  1EPT C;  2A2Q H;  1EZV G;  5E0G A;  4KTC A;  1C2H A;  3L73 E;  5HXF A;  5J4S A;  5DJT B;  3EDX B;  3ZVA A;  3QDZ B;  5A0B A;  2A45 H;  3NRL A;  1OYQ A;  2V3M A;  4ZUH A;  1ZSL A;  2GCH F;  1H8A A;  1UK2 A;  2GVF A;  1SQX E;  1LVM A;  3A8D A;  1FZC B;  2B8O H;  1JCC A;  5HM9 A;  5TCC A;  4F49 A;  2R9P A;  2RA0 A;  2ZO3 H;  1NTM E;  2P95 A;  1UJ1 A;  4A6L A;  1C5X B;  4OS5 A;  1K2I 1;  3ZVC A;  3PYH A;  1EZV I;  4MG3 A;  1C5N H;  3CMA P;  1ZTL A;  1RFN A;  1ARC A;  2ZTZ A;  1NU1 G;  3AE3 C;  3VOP A;  1FZE A;  1FXY A;  4K2Y A;  4D9R A;  1VF5 C;  3O8D A;  3PRO A;  1TBZ H;  4B2B A;  3WU2 H;  2W26 A;  1ZLR A;  1O5B B;  2UUJ B;  1KIL D;  1GHY H;  4DY7 B;  2WYG A;  1UK3 A;  3P8M C;  2HPC A;  2OUA A;  2A45 B;  1O5G H;  1PPE E;  2BQW B;  1DAN H;  1IQI A;  2HGT H;  4QMA A;  1C5R A;  1SGD E;  2KP8 A;  2UWJ E;  3RLY H;  1G30 B;  1GBF A;  5ETX A;  1ANE A;  1P02 A;  3BCC G;  1H8I H;  3BTM E;  1QL9 A;  5KLI B;  1URQ C;  3CWB J;  5AVT B;  4ISO A;  4LZ1 H;  5FCR A;  1Z6J H;  5FBE A;  1VIT H;  3SUF A;  1M1J C;  2P1J A;  4ABD A;  1QUR H;  2ZIQ H;  1A5H A;  3GY4 A;  3KID U;  3VB5 A;  3SFE C;  2SFA A;  1V2O T;  3AE5 C;  1PYT D;  1F0S A;  2IX7 C;  1TON A;  2C8Z B;  4IL6 E;  2Z5I A;  2ANW A;  1NWQ A;  1P10 A;  2P8O B;  1UTJ A;  2OYH A;  1O3J A;  3A7O A;  1F5L A;  1TGC A;  5AVX B;  5F8X A;  3RC4 A;  4YTP C;  1X7A C;  4NCY A;  3S9B A;  1HJA B;  1BUI A;  1DLK B;  1FY4 A;  1GMD F;  2IYP A;  1MCV A;  2OC1 A;  2BLO A;  1W0K D;  1IFP A;  3BTF E;  4FU8 A;  4NIY A;  1UTM A;  4K1E A;  2BD2 A;  4NIV A;  1NBM E;  1F92 A;  3AAS A;  4K3J A;  3BTH E;  2AEJ A;  2FFD A;  1A4W H;  1KSN A;  3TLO A;  4X1S U;  1CA0 C;  1AN1 E;  2Q9I A;  5EJ1 A;  1A1R A;  5GCH F;  5KAF H;  1O33 A;  1NTM K;  3IWM A;  4QT8 C;  1SQP E;  2AFQ B;  3F2G A;  2IBZ G;  4ZKO U;  1SQB K;  2IZ1 A;  1G37 A;  4B73 A;  3MMG A;  1LHG H;  1GI4 A;  3PWB A;  1Q3X A;  1LTJ A;  2K3R A;  1UK4 A;  2TBS A;  3DT0 H;  1JO5 A;  3ZIA D;  1TPA E;  3CME P;  2I6Q A;  3QGN B;  3ZZ4 A;  3SZE A;  1ZRT D;  3RK2 D;  1BHX B;  3H7O A;  1NTK G;  4OS6 A;  3O8R A;  1M56 D;  5KLV D;  1Z8I B;  1VPC A;  2KCY A;  2J92 A;  4ABE A;  2Y0D A;  1IK9 A;  2BLQ A;  3N99 A;  3MU8 A;  4ZNC A;  1O2U A;  1RHZ B;  3H1L J;  2E76 C;  4OGQ B;  1C2L A;  4CRE A;  3G4S P;  1GJ8 B;  1ZHP A;  2QF5 A;  3SGB E;  3T26 A;  1JRT A;  4BAO B;  2KYV A;  2XCN A;  2XBY A;  1VQP P;  3ZVB A;  5KLV K;  2BQ7 B;  2PUQ H;  3O8C A;  1OP0 A;  2BHG A;  5KED A;  1OPH B;  2XWB I;  3TNT A;  1NTK E;  1DSU A;  4XE5 B;  1AFQ B;  1DXW A;  5APS A;  4N6J A;  1GI3 A;  4R4M A;  3OW2 O;  3BTG E;  1KYO D;  2E43 A;  1VQN P;  1V2U T;  2WV9 A;  1NTK J;  4JCN A;  1CI6 B;  5CJ0 A;  3T27 A;  4CBO A;  4CRF A;  5B6L A;  3BAS A;  1LHE H;  3SN8 A;  2F43 B;  4I86 A;  2IBZ I;  1DY8 A;  2K9J A;  3U9A H;  1XTC C;  1DST A;  3L75 J;  2W90 A;  3RXH A;  1MKX H;  3RUO A;  1W11 U;  1GVZ A;  1N6X A;  2Y5F A;  3OA7 A;  1N73 B;  2A5A A;  2FI5 E;  4Y8Y A;  1DM4 B;  4W80 A;  5CCH D;  1P84 D;  1VQK P;  1XUH A;  3F2H A;  1L0N E;  2W6J H;  3PO1 C;  4H6T A;  2QRX A;  3O8B A;  2RDE A;  3PH0 A;  2DE8 A;  2QXH A;  5C20 A;  4O9B A;  1ZZZ A;  1K22 H;  1N7S C;  2UUY A;  4DGJ A;  1YJ9 P;  2BTC E;  2O8U A;  2TGT A;  2NRG A;  4BXW A;  4IOI H;  2IFN A;  1QBV H;  3RU4 T;  1H0T A;  1IK7 A;  2BMG B;  3L71 D;  2G00 A;  2OGU A;  3QGJ A;  1LTG C;  1YJN P;  1NHL A;  2LR2 A;  3URE A;  1OWK A;  3V12 A;  3OY5 U;  3CWB D;  1DEB A;  5JB9 S;  4LC1 A;  4X6N A;  1S83 A;  1RE4 C;  3BIU H;  1SQV E;  3CCL P;  3ZZB A;  4EDF A;  1AJY A;  3VGC B;  1CHO G;  2XYA A;  7LPR A;  2V7Q D;  1BHX F;  1KIL A;  2GDD A;  1ELV A;  1G1I A;  1UCY H;  4K35 A;  4I32 A;  1GL2 D;  1MTS A;  1Y5A T;  2KK7 A;  3GY6 A;  3SZN A;  1KQF B;  5E2O A;  3PLB A;  5H4I B;  1HJB A;  2GJG A;  3KYF A;  1L0N D;  1UTO A;  1N1L A;  2GUS A;  4JPZ B;  1NN6 A;  3MU4 A;  3RXU A;  4A1V A;  2OYH B;  1OVU A;  2UUF B;  1FDI A;  1IQK A;  1JBU H;  1GMC G;  1P03 A;  5CHA C;  5FX5 A;  3TH4 H;  1X8Y A;  2ZF0 H;  3UFA A;  2A7C A;  1EUF A;  1MD8 A;  4YPC A;  1S85 A;  1YIJ P;  1S6F A;  1HXE H;  2XC4 A;  3BIV H;  3FAN A;  2ITA A;  1B0E A;  1VJA U;  1QCP A;  1N73 C;  3C9I A;  5AFZ H;  1C2K A;  3CD6 P;  2CV3 A;  5EOD A;  1L4D A;  2B87 B;  1NFW A;  3OJA B;  1NTK K;  2AGG X;  1FN6 A;  3AEG C;  3N7D A;  4O3U A;  3DHK H;  4PJ0 E;  2KXP B;  3R3G B;  3HK6 B;  3GF3 A;  3BEF B;  3CC7 P;  2ZU3 A;  1VCP A;  3RXO A;  2J9N A;  2JP3 A;  1G32 B;  3P95 A;  3OU0 A;  5AVD A;  2AXT H;  2FKW B;  3N7O A;  1P12 E;  4L74 A;  1TAW A;  1BZX E;  1W10 U;  2O3J A;  4AN7 A;  2SGA A;  4B1T A;  2QYI A;  1LGH B;  1NU9 A;  2VVU A;  1EZV E;  2RN0 A;  2RFK C;  1CT0 E;  1QJ6 B;  1MZD A;  1E1R D;  2FBW C;  4NA7 A;  3CL3 D;  2YIU B;  3FWL A;  5CJ4 A;  7KME H;  2ZFC A;  4NA9 H;  4P00 A;  2J94 A;  1EDI A;  1UTN A;  5T1V A;  3LW5 H;  1GBJ A;  2XND D;  2QF3 A;  5B6O A;  1AQT A;  2C8W B;  4WME A;  3P8F A;  3MUD C;  3FXD A;  3P8C E;  2OQQ A;  3ZZ7 A;  1FPC H;  5F6M A;  3ATI A;  1QL2 A;  1EZS C;  2GCT B;  2ZTX A;  1Q7Y Q;  3GY7 A;  4XD7 D;  3ZVF A;  4UB8 E;  4FUB A;  2QC2 A;  1FAK H;  3QZQ A;  2TIO A;  1L0N J;  5EQQ A;  2VWM A;  2GZ7 A;  1LWU B;  1SQB J;  1KXF A;  2ZU2 A;  1O3M A;  3H7T A;  4TWW A;  1DOJ A;  5SGA E;  4YOI A;  5I46 H;  3PTZ A;  3A0H H;  3TGU D;  5F8T A;  2Z5H A;  4U3F D;  1RTL A;  5L8R J;  1YKT A;  1SLV B;  1HGV A;  3FX0 A;  3V4Q A;  5AW9 B;  2OTJ P;  1O2S A;  1SHY A;  4FET A;  1FIZ A;  4IC5 A;  4B6E A;  3W68 A;  3D71 A;  3F0O A;  5KAI H;  5C0T A;  1HAH H;  3VB7 A;  2A4R A;  1Z1J A;  2RA3 A;  5EXN A;  1CHO F;  1GJB B;  1MTN C;  3N4X A;  3M91 A;  2Y80 A;  3SNB A;  3KPE A;  1O5A B;  4CH8 B;  2ILN A;  3AE2 C;  2ZHD A;  2L74 A;  1TLD A;  3U28 C;  3H1L E;  2PUX B;  3BG4 B;  1K04 A;  1E1Q D;  1P8V C;  2FOC A;  2ZZU H;  2K8I A;  4X0W U;  8GCH G;  1GU4 A;  4NFE A;  3A7X A;  4YXD C;  1BTX A;  2HFE D;  2KZJ A;  1PYT C;  1V2M T;  3T25 A;  3LOX A;  1F5K U;  3RU4 D;  3V13 A;  1W0Y H;  3A83 A;  1CZQ A;  2HVX A;  1PJP A;  3F9F A;  2XBX A;  1PQ5 A;  2HWL B;  2JH6 D;  3KEE A;  4Y71 A;  5DK1 A;  1CQQ A;  3UUZ A;  1NFY A;  4CRB A;  1ZJD A;  2KS1 B;  4BAM B;  3DSG A;  3UB0 A;  4F4O C;  1GVL A;  1DWC H;  2G81 E;  3RXG A;  2RCE A;  1BOQ A;  1GHB F;  1OWE A;  1GDT A;  1WSS H;  1XUJ A;  1ZW0 A;  1YLC A;  4WH8 A;  4X2V A;  3ZV8 A;  3DD2 H;  1A2C H;  4OGY A;  2VIN A;  5AW3 B;  3ZVG A;  1LTT C;  1Z8R A;  3M3T A;  1K1O A;  2WPH S;  1W8B H;  1KIL B;  2LKM A;  4B75 A;  4DZO A;  1KD1 Q;  4KTS A;  1M9U A;  3MO9 A;  1IFD A;  2FES H;  3QZR A;  1HWT C;  3UWI A;  1VGC C;  2O01 H;  2PGQ B;  4B76 A;  2G5N A;  2PR3 A;  5IK2 D;  1RY3 A;  5HMA A;  2B9L A;  3TNU B;  1PPC E;  2M3E A;  2SNW A;  3HGN A;  2R44 A;  2CHA B;  3S4R A;  4SGA E;  3CWB E;  4YLQ H;  1WRG A;  3BTK E;  3MIW A;  4GHQ A;  2H43 A;  2XC0 A;  1W2K H;  2YMS D;  5H2F H;  1GJ7 B;  1KQL A;  1AB9 B;  2A7J A;  2ZHE H;  2VRS A;  1BRC E;  5C5O A;  1MKM A;  3D70 A;  1SFQ B;  5T6G A;  1RS0 A;  1YWU A;  4KGA A;  3B71 A;  1GMC F;  2E42 A;  1HJA C;  3RXD A;  1L1N A;  2B87 A;  1HNE E;  5EJZ A;  3EST A;  4MNX A;  4ZMA H;  1K1N A;  2Y0E A;  3CCV P;  1CU1 A;  2WPK S;  3PM3 A;  4WF8 A;  3UQO A;  1KXC A;  1OXG A;  2QIQ A;  3LGU A;  1YTZ T;  2ZCL P;  4I7Z C;  1BBR E;  1JWT A;  4I33 A;  1PP9 G;  5J4Q A;  4B71 A;  1UHB A;  2VJ1 A;  2PSY A;  1TQ7 B;  1HUC A;  1O2I A;  1DWB H;  1QNJ A;  4AFS A;  2LXC B;  1UII A;  6GCH G;  1HAV B;  1EOJ A;  3VP9 A;  2UWL A;  1IQH A;  2A45 I;  2K9Y A;  3A8A A;  2BDY A;  3KQC A;  5DP7 A;  1H8H D;  2QE7 D;  2QXG A;  2ZQ1 A;  1ZME C;  4XFQ A;  5LPE A;  2KCP A;  5JB8 S;  3BTD E;  3L74 E;  1GPZ A;  1QL1 A;  2WMM A;  1P9S A;  3ZZ3 A;  4GKG A;  3MNS A;  1E34 B;  1GBA A;  2WPS A;  3OTJ E;  4YZU A;  4ZKN U;  5CCG C;  1FZF A;  1OWA A;  1EAX A;  5AVZ B;  3HK3 B;  2QF4 A;  3RC5 A;  1MCT A;  2ZDK A;  1F0U A;  1FOS E;  2PAJ A;  2FI4 E;  3L74 D;  1TWX B;  3M9Q A;  1WQV H;  3NXP A;  1SGN E;  2P8O C;  2W6J D;  3GY5 A;  3BSQ A;  3OY6 U;  4IS5 A;  1BSH A;  5DPA A;  2ZXX A;  1EPT A;  1ZHR A;  1UCY E;  3H1I G;  3RMO H;  3A85 A;  3TF5 A;  1CSO E;  1U6Q A;  1THS H;  1QA0 A;  3E90 B;  5KLV G;  1HAV A;  1G3C A;  2FX6 A;  4AC9 A;  1BE3 E;  2DE9 A;  4H0L B;  5A2M H;  4HB1 A;  4WMF A;  3PTN A;  2JDI H;  2JH0 D;  2Y7Z A;  3PMH B;  1NM6 A;  1T8O A;  5DO4 H;  3ZVE A;  2BOH B;  1W3C A;  3AE4 C;  2V3O H;  1DXP A;  2ZHQ H;  4UDW H;  2B89 A;  3NXS A;  2AMQ A;  2HAL A;  1TPS A;  1LJ2 A;  3RP2 A;  2XXL A;  3EA7 A;  3GDV A;  4J1Y A;  1XTG B;  2LP6 A;  1BTU A;  3RXE A;  1A61 H;  2STA E;  2Q6F A;  1ELT A;  3VN0 A;  4CR9 A;  3A7V A;  1C2M A;  2Y81 A;  3ITK A;  3URC A;  3M5O A;  1AO5 A;  1LWU C;  1WAY B;  3K6Y A;  1YPL H;  1SGY E;  1O2Z A;  4X6M A;  1RE3 C;  2ZGC A;  2P59 A;  5LPR A;  1MU8 B;  1EJA A;  3Q00 A;  1DWE H;  2WT7 A;  1BGY D;  1OXZ A;  1SI5 H;  3RXJ A;  4L75 A;  5B5E H;  2BDG A;  5CDF E;  2XBV A;  2B5T B;  3E8L A;  2FO9 A;  4X2X A;  1M7L A;  4WY4 C;  1NTM G;  1HXF H;  1DS2 E;  2FX4 A;  2QA4 P;  4R4L A;  2GMT B;  2VVC A;  1S5L E;  4Z1M D;  3P6Z B;  6CHA C;  3SO3 A;  1N7S A;  1NTZ D;  2L5G B;  4D6T G;  2ZYG A;  1D3P B;  1C5U A;  1WOF A;  1S6L A;  1NKZ B;  2CMY A;  3S69 A;  2SGP E;  1YJW P;  1FJP A;  1DVA H;  3AE9 C;  1ORF A;  5L2Y H;  3IG6 B;  1FY3 A;  3BCC D;  4AG2 A;  3SW2 B;  4A5T S;  1W0Z U;  5GTI E;  5L2Z H;  1Q2N A;  1A02 J;  3GDS A;  4ZHL U;  3BN9 A;  2ZKS A;  3BG8 A;  3SQH E;  3A84 A;  4MLF B;  3M06 A;  4Y28 J;  1OW7 A;  3Q5R A;  4KP0 A;  1BTW A;  1KB9 I;  3TK1 A;  1C1M A;  5JBA S;  3WUU A;  2WIT A;  1SOT A;  2K1A A;  2XU6 A;  1KTS B;  2M0B A;  3F9G A;  1NTM D;  1MV8 A;  1G2L A;  1P2N A;  2R5D A;  1GW3 A;  1ACB E;  4WY4 B;  1OWH A;  1C1W H;  2BXU H;  4TPI Z;  5C1U A;  3N7N A;  2ZAE B;  2N1T D;  3FVF B;  1FUJ A;  1DX7 A;  3H5C B;  3GY2 A;  1O3P B;  3VB3 A;  1O2G H;  1FZC A;  1T3U A;  5CCG D;  2A06 E;  3WUT A;  1HJ9 A;  1P3C A;  1AWH B;  2W6B A;  1UVS H;  2YOL A;  3KQ5 A;  5KAF E;  2HOB A;  2JKV A;  2A4O A;  1KLT A;  4LLH A;  1V3X A;  4B6F A;  4H13 C;  3QN7 A;  1MUU A;  2R2W U;  2ZDA H;  3Q1M A;  4THN H;  2FOG A;  2R3U A;  1C4U 2;  2F4L A;  3G9R A;  5KKZ B;  1BB0 B;  3GIC B;  2Y5H A;  1CI6 A;  1T6A A;  1SQQ G;  2G3A A;  1YF4 A;  2H5C A;  2BDC A;  2ZT9 D;  1SQR A;  2GV7 A;  2H5D A;  3MTU E;  2O01 N;  5FHT A;  4ASU D;  4DW2 U;  2ZT9 C;  3U8T H;  6CHA B;  1ZV8 A;  4K8B A;  4LK4 A;  1P57 B;  2ZYA A;  1NAF A;  1BGY J;  3SSU A;  4RKU J;  1B5G H;  3GIS B;  4BOH A;  2LXB A;  3G3Z A;  1GK4 A;  1P06 A;  2ZU4 A;  2XRC A;  4FUC A;  4BTU B;  3IR9 A;  1VQO P;  1O3H A;  4ABH A;  3JZ1 B;  3U1I B;  1C5Y B;  1TX6 A;  1GL2 C;  3K5B A;  2BCC E;  2BEQ D;  5CCH C;  1O39 A;  3FOA A;  1S0R A;  1G3E A;  3PMJ A;  4GIF A;  4AOQ A;  1T4U H;  3L72 G;  1MH0 A;  3WW7 A;  3RXI A;  2KX4 A;  5I25 A;  4RES B;  2H8P D;  1AUJ A;  2E5T A;  1Z56 A;  2ZFQ H;  3KQG A;  1H0T B;  3GS9 A;  1O5C B;  1NH4 A;  3KCG H;  1IO4 A;  2HLC A;  4KKD A;  3UR9 A;  1MFZ A;  3LGT A;  1XKB C;  1QZ8 A;  5GWZ A;  3BV9 B;  5A8X A;  3A8C A;  1MAX A;  4AOR A;  3E0N B;  1RRK A;  1GBH A;  1DH3 A;  4C7N B;  1W0J D;  3LGV A;  2ULL A;  1YBK A;  4MPW A;  3TGU E;  3SWK A;  1GBK A;  3V5B A;  2BX4 A;  2A4G A;  1GHZ A;  2LPR A;  2W27 A;  4X2Y A;  1JY3 N;  1CGJ E;  2EST E;  3M9B A;  1TMB H;  2BD9 A;  3L75 G;  1G2C B;  1VKY A;  2E76 D;  2WSE J;  1O2P A;  1JMB A;  1O3O A;  1OW6 A;  3CCM P;  2C4F H;  1DWD H;  2WQY C;  1C9P A;  3UNS A;  1GZL A;  3LID A;  3A7T A;  1KMH B;  4HI3 A;  1O3A A;  1UTL M;  2VVV A;  3RK2 C;  2C90 B;  1P84 H;  5EFW B;  1O3I A;  2AER H;  2IPH A;  4RSP A;  4Y7B A;  1Y5B T;  2OC7 A;  4ZCN A;  2KLV A;  3SGA E;  5JBT A;  3A2A A;  4JYT A;  2Q5U A;  1BCC J;  2IFM A;  1AVY A;  2JET B;  3PHL A;  3CNR A;  3FKS D;  1XUK A;  2XTT B;  1G2M A;  3RBZ A;  3IIT A;  1VQM P;  1P05 A;  1O3D A;  3RMN H;  2VH0 A;  1JXP A;  4Y79 A;  1SGR E;  2QJK B;  4D7G A;  3H32 A;  1G2C A;  1GBI A;  1CT2 E;  1TNJ A;  1N7S B;  1JUN A;  3MHW U;  4YO9 A;  2NPS D;  3E7K A;  1WCZ A;  1EFR D;  2O1K A;  2PKS B;  1YPK H;  1NYH A;  1DIP A;  2JJ2 D;  4MVN A;  1VIT F;  4OS1 A;  1N7S D;  3QO6 A;  1SS1 A;  1YPE H;  3U1C A;  1C2D A;  4X1Q U;  6EST A;  4XRN A;  1DE7 H;  1O3G A;  2H88 C;  1D6R A;  5EQS A;  1KOR A;  4OS7 A;  1O5D H;  1DIT H;  4DII H;  1JNM A;  3OSY A;  1GDN A;  3SUE A;  1C2I A;  3GYM A;  3A7W A;  3B5N B;  1O5E H;  1S1C X;  3FN8 A;  1TAB E;  3OX7 U;  3SOS A;  1RGQ A;  1GI2 A;  1K9O E;  3SI3 H;  3SV7 A;  2JKH A;  2HPQ H;  2OBQ A;  5FAH A;  3UIR A;  4WMD A;  1EP6 A;  1ELE E;  1Z1I A;  1KIG H;  1GVK B;  2JWD A;  4TT3 H;  1U7M A;  3VPK A;  8EST E;  5KJ7 D;  4YXW H;  3VB6 A;  3V6I A;  3MH4 A;  2F9N A;  3ZVD A;  1AWF H;  2OTL P;  1TMU H;  1HFD A;  3LGY A;  3PRB A;  3GCO A;  3RC6 A;  2OYI B;  2RMZ A;  1A0L A;  1VF5 B;  2Z4E A;  1FPH H;  2FS9 A;  3WUV A;  3A7Y A;  4VGC C;  4K3A A;  2FPZ A;  4HZH A;  2EI7 A;  3TNU A;  5EPY A;  2ZPS A;  1OX3 A;  1VCQ A;  1SGC A;  3SND A;  3L75 D;  4ZMD A;  1O32 A;  1KC8 Q;  4CH2 B;  1MUE B;  3BTT E;  2QA9 E;  3BAT A;  4GOD A;  4WXV A;  4FVB A;  4CHA C;  4NWL A;  4NIX A;  3RLW H;  1A5G H;  1XUG A;  2AHM E;  2N1T C;  3F68 H;  1WTG H;  4AFQ A;  2FYN B;  1NZQ H;  2Q6Q A;  1WQS A;  3A86 A;  1C5L H;  4TWY A;  5K7R A;  3H1J D;  3ABV C;  1YLD A;  1RF0 C;  3JC2 2;  1ZR4 A;  4NFF A;  2ZVO B;  2BVS H;  4FOU C;  2ODQ A;  1C4V 2;  1HVV A;  2BCC J;  4BRY B;  2NU2 E;  3K65 B;  1ZSJ A;  4DCK A;  5HGG A;  4F48 B;  1P04 A;  2ALV A;  5AVQ B;  4JMY A;  2GZ9 A;  3FP7 E;  4GVU A;  4XBD A;  2OK5 A;  5KAI E;  3SWF A;  1AU8 A;  3RXT A;  3ODF A;  3MQK C;  1LP1 B;  3OTP A;  2BD4 A;  1BGY E;  4OWF A;  1CGH A;  2KSJ A;  3QTO H;  4NGA H;  4NPF X;  3SJ9 A;  1KFN A;  5KLV J;  4VGC B;  4I6M C;  5ESB A;  2GCH G;  2GT8 A;  3P8O A;  4D9Q A;  4BXL A;  3CCS P;  1A5I A;  5AW4 B;  3M35 A;  5BU8 B;  1A3E H;  1O36 A;  1GHB G;  2FLR H;  2WPQ A;  3SU1 A;  3VG8 A;  2BY7 X;  1GBB A;  1QL7 A;  2GMT C;  1ZHM A;  2QF0 A;  2GCT C;  3UNQ A;  3CCQ P;  1P2M A;  1MZ9 A;  3SNC A;  4B2A A;  2HOD B;  4Y11 E;  4WY4 A;  2ZGJ A;  4OH8 B;  1JOU B;  1S5L H;  3M61 U;  3H1H E;  3SU2 A;  4Q63 A;  5GDS H;  1S3J A;  2GT7 A;  1C2J A;  5DP6 A;  1C1T A;  4NIW A;  7GCH G;  4MQA A;  2OC8 A;  2FOA A;  2C8Y B;  1GCT B;  2WSF J;  1QR3 E;  4C46 A;  1NU1 J;  1GJ5 H;  1AE5 A;  1ZMN A;  2GDE H;  3SU3 A;  1G3D A;  4DOQ A;  2SGE E;  3TVJ B;  3V4W A;  2BZ6 H;  3QWC H;  1CVW H;  1K73 Q;  1PPB H;  5ABW A;  2FYU J;  3UY9 A;  3R2P A;  1JMO H;  3OEH D;  2XDJ A;  1VCW A;  2PTN A;  1ID5 H;  2SGQ E;  4FVD A;  4O9V A;  1DY9 A;  4DT4 A;  3OAA D;  2VNT A;  5APX A;  1VQ5 P;  1YC0 A;  2G51 A;  1Y3W A;  1T2K D;  2QJY C;  3IFM A;  1VQ8 P;  2HOD A;  4PV1 D;  1IQL A;  1UIX A;  1GI9 B;  1RE4 A;  1SG8 B;  1FMG A;  3F0P A;  4Z6A H;  1EQ7 A;  3KXD A;  5KEC A;  3G01 A;  5FX6 A;  2VWO A;  1XUF A;  3A81 A;  1D3T B;  4K5Z A;  3MO3 A;  1AD8 H;  1XKA C;  2OYH C;  4TSF D;  1G36 A;  2EA3 A;  4X8U H;  2QG4 A;  1J8A A;  2HVY B;  5EQR A;  1AV1 A;  1V2N T;  1KFM A;  5B66 E;  2C8X B;  1C1R A;  1NO4 A;  1P2I A;  3TIT A;  4GOF A;  1O2T A;  3I77 A;  2NPS B;  2A5K A;  2HG5 D;  4BNR A;  2XWA A;  2D2C B;  1Y8T A;  3QX5 H;  3DFL A;  1KXB A;  2V35 A;  1H8E D;  1OOK B;  3TDK A;  2WT7 B;  1URQ A;  1OP8 A;  4NPE A;  1Y9B A;  1FNI A;  1KIL C;  3PRD A;  1YGC H;  3DCL A;  1X9V A;  5HIZ A;  1GHX H;  2P93 A;  2HLD D;  4I8H A;  3S1K A;  3A89 A;  3SNE A;  1GDQ A;  1C5M D;  3AAU A;  4C7R A;  1TMT H;  1HAI H;  2D8W A;  2YMS C;  2V0B A;  1QB1 A;  3M7U A;  2D2C D;  2IPP A;  1L0L D;  1MTN B;  2J58 A;  2GGV B;  1GBT A;  2R2M B;  1TPO A;  4HKZ H;  3H1H G;  2WIN I;  2A7H A;  1S9K E;  3LT3 A;  1Q90 D;  4I7Y H;  4XA4 A;  2H89 C;  5DP8 A;  4GSO A;  2EI8 A;  3AEE C;  2XNX A;  4MNV A;  3S9A A;  5HM2 A;  1V2W T;  1LVO A;  1ANB A;  3OFN D;  4YT7 H;  1Y3X A;  2P3F H;  1ZPC A;  2WSC J;  1JTH A;  3TSI A;  4X1R U;  1QHR B;  2Y9Z A;  4U01 A;  2AYW A;  2ZNK H;  2KI7 B;  2OBO A;  1C5S A;  1KTT B;  1ZPB A;  3PMA B;  4M9F A;  3S0N A;  4NWK A;  3ZZD A;  3MHV A;  1NT1 A;  4XE4 A;  4KJM A;  1EDL A;  4YM9 A;  1IHS H;  1JY2 P;  3HUS A;  3HUS C;  2KAI B;  3H25 A;  1OWJ A;  1ZYO A;  4NZL A;  1WXR A;  5BVZ A;  2BY9 X;  3H32 B;  1RE3 A;  1HGT H;  4UEH H;  1PPJ E;  1HPG A;  1MBM A;  1NTK D;  2O8T A;  1HJ0 A;  2N1T A;  1USE A;  4MNW A;  2XC5 A;  5EIY A;  1K9M Q;  1N8O B;  1YPM H;  1DFP A;  1ETS H;  2FP7 B;  1C1V H;  3F6U H;  1X0T A;  1VR1 H;  3SHC H;  2L91 A;  1V2R T;  6LPR A;  4A92 A;  1HIA A;  2IZ0 A;  4H44 C;  2ZG0 H;  2ZFR H;  3VGC C;  1YY3 A;  2NU1 E;  1SLX B;  2IBZ D;  1SR5 C;  1AVX A;  5APV A;  4ZH8 A;  2K1Q A;  5C94 A;  5DP3 A;  1C5Z B;  2OQ5 A;  1JOC A;  2QM8 A;  4OGQ D;  4E06 H;  5A8Y A;  1AND A;  4IFM A;  1GK6 A;  3RXP A;  3SFD C;  3Q3X A;  1O3C A;  4XSK U;  1ZML A;  1YYY 1;  2H9T H;  2ZT9 B;  2O8L A;  1L4A B;  1KY9 A;  3HKJ B;  3S7K B;  4YXW D;  1Z8J B;  1LHC H;  2G8Y A;  1EB1 H;  2NU0 E;  1EZX C;  2P3U B;  2Z7F E;  1QJ1 B;  2O8M A;  2FYU D;  2WSS H;  8GCH F;  3TJU A;  2Z3C A;  1FON A;  4UB6 H;  3NK8 A;  2PW8 H;  5F53 A;  2A31 A;  3SOR A;  1A46 H;  2HNT C;  3LIE A;  4K8Y A;  2QCY A;  2Z3D A;  3T97 B;  3ATL A;  4YOG A;  4Q7X A;  1O30 A;  1RH5 B;  2VWN A;  4RKO B;  4ABG A;  3AEA C;  4D6T D;  3A88 A;  5EW1 H;  1DIC A;  1BBR K;  3L73 D;  1MAB B;  3OAK A;  4MPX A;  5DJU B;  3RL0 D;  3MTY A;  4YOJ A;  3NWU A;  2FYZ A;  3SU0 A;  1FN8 A;  1W7X H;  1YQ4 C;  1FZZ A;  1T4V H;  2BVX H;  4X6P A;  3VXE H;  4ABJ A;  4MPV A;  1L0L G;  2A5I A;  3CS0 A;  3L71 J;  1FBM A;  3CCJ P;  1EAW A;  1UW7 A;  3K2U A;  2D1J A;  1P9U A;  4ZKU A;  3TJO A;  2VBC A;  3RXK A;  1IC2 A;  2V7Q H;  1NFU A;  1SGI B;  1P11 E;  2P10 A;  4NPD A;  1O3E A;  1OS8 A;  4Q7Z A;  4IL6 H;  2NPS C;  1OIP A;  2VIO A;  1AZ8 A;  4X6O A;  4Z1M H;  5DP9 A;  1SFI A;  1W12 U;  1RF1 C;  3TGI E;  1FDO A;  3L72 E;  1AHT H;  1EKB B;  2PSX A;  1KTM A;  5FXL A;  1YPG H;  5JBC S;  4N78 E;  1SQB D;  4LOY H;  3T28 A;  1OHH D;  1IQG A;  4O97 A;  1U57 A;  2CK3 D;  5FPS A;  3SQE E;  2YKQ A;  3V7T A;  5GPI B;  1O35 A;  1IZN B;  2OC0 A;  1KLI H;  1D7M A;  1SB1 H;  4U3F E;  3SV8 A;  1L2P A;  1WBG B;  1GJD B;  1ZOM A;  3GHG C;  4NZQ A;  1LTB C;  5L6N H;  3AE6 C;  1T7C A;  1GJC B;  3M0D C;  1SGF A;  1H9I E;  3SYJ A;  4H4F A;  3URD A;  2BQ6 B;  1W5C E;  1BCU H;  1T8L A;  1DD4 A;  1IQJ A;  4XDE A;  3MU0 A;  3E3T A;  1R8E A;  5AVS B;  4OS2 A;  1ETT H;  2G55 A;  1BGY G;  1QX8 A;  3RXQ A;  2F9V A;  1RF1 A;  4WWY A;  5KLV E;  1GG6 C;  4TT3 D;  1C5P A;  1OVV A;  1LVY A;  5GXP A;  2AXT E;  2RH0 A;  1WV7 H;  3P92 A;  5HIY A;  1KN7 A;  1L0N G;  5E2P A;  3KYG A;  5DN6 D;  1SQX D;  3I56 P;  3BF6 H;  3D65 E;  2WZQ A;  1S81 A;  1EDK A;  2FFD C;  3A80 A;  3SUD A;  2WUC A;  3MZW B;  2CF8 H;  1UO6 A;  1O34 A;  4FUE A;  2YNY A;  1VQ4 P;  1AQ5 A;  3MO6 A;  3IF4 A;  2SGD E;  1JTH B;  2XCF A;  2ZFT A;  2POH A;  1IFJ A;  1QGK B;  2HNT F;  1S4X A;  2GM4 A;  3SJK A;  2K0Q A;  5CMX H;  4K60 A;  1IFM A;  3L37 A;  3VMX A;  1SFC D;  2Y7X A;  3TH2 H;  2WVR A;  3ZZ6 A;  2RDL A;  3T2N A;  4L76 A;  3TIU A;  5E79 E;  1GJ9 B;  3AE7 C;  3QUM P;  4GCH G;  2OYI A;  4Z0K A;  3FGA D;  1HIA B;  1EAT A;  1FY5 A;  1AB9 C;  5CCH A;  3H1J E;  2DUC A;  2VIW A;  5T3H A;  1AE8 H;  3B9F H;  2Q1K A;  1BJV A;  2WV4 A;  3KZI E;  1AI8 H;  1VQL P;  1O2H A;  1C2G A;  3RXS A;  3H1J J;  2KS1 A;  2A4Q A;  2K88 A;  2J98 B;  4Y6D A;  3T5F H;  3TK9 A;  1O2V A;  1AVW A;  3HGP A;  4MN4 C;  1TOC B;  2M3B A;  2BD5 A;  2M8R A;  2EEK A;  2FWW A;  3FZD A;  2W8Z A;  3I29 A;  3LDX H;  1NY2 2;  4MDS A;  1AFE H;  1E38 B;  3RM2 H;  5TIS E;  3CS7 A;  2AEM A;  3EE7 A;  1ELG A;  2FYR A;  1O2Q A;  3Q2Y A;  3PTB A;  4Q2K A;  5APW A;  1PGQ A;  1V2L T;  2GZ8 A;  2JH5 D;  5C2Z A;  2FYN C;  3MOC A;  2RG3 A;  3BTQ E;  4X8S H;  3AEF C;  1HGZ A;  4BRY A;  2QAA A;  3H1K D;  1W2E A;  2FIR H;  2V6N A;  4JZ1 A;  4BAQ B;  2WPL S;  4H6S B;  2IBZ E;  1PGJ A;  1SMF E;  1BMA A;  1THR H;  3UIA A;  2PTC E;  2GTB A;  2BDI A;  3RXB A;  1L4Z A;  3TNS A;  3CI9 A;  5APQ A;  1BCC D;  3PLK A;  3NUM A;  5EG4 A;  1C1Q A;  4M7G A;  2PRR A;  3G71 P;  3B5N A;  3L70 G;  1BTZ A;  3E1I A;  2AGI X;  1ELB A;  1YCP M;  3SV9 A;  1NU1 K;  3H1K E;  1L0N K;  3TU7 H;  3L35 A;  1UMA H;  4OGX A;  1YTZ I;  4UB6 E;  4UON A;  2I8D A;  1SBW A;  2PGB B;  3ITI A;  3E16 B;  3GOV B;  2FYU E;  4H44 D;  3PO1 B;  1K28 D;  3FAO A;  1YPH E;  1IQE A;  1PGO A;  1T31 A;  5AHG H;  5FL7 D;  4YTA A;  1JCD A;  3HUS B;  1SVF A;  5AVV B;  1UVP A;  1CBW B;  2KAI A;  1E5W A;  1NGM B;  1AFQ C;  4XFJ A;  1EX3 A;  1XXD A;  1C1N A;  1QRZ A;  2ASU B;  1EJN A;  5EJL A;  5T6F A;  1FOS F;  3F1S B;  1UVT H;  3D6Z A;  1NOH A;  1GI7 B;  1S2E A;  1XVO A;  1RXP A;  2ZI2 H;  1MQ5 A;  3GLM A;  1ESB A;  4A7P A;  2C93 B;  1MTW A;  5CHX A;  3SBK A;  3MNX A;  2M5A B;  2XKM A;  1T3J A;  3PMB B;  2HPP H;  3I55 P;  1USD A;  2QVA A;  3CP7 A;  1OFC X;  1ZP0 C;  1T32 A;  1KYN A;  3L33 A;  2W6I D;  1N2D C;  3EFF K;  2ZHF H;  5TIS H;  3AEB C;  1A0J A;  1LPG B;  1SQT A;  5IDK A;  3H1K G;  4AQR D;  1O3N A;  2ODP A;  3RU4 E;  1QGF A;  1QLE D;  1SQV J;  1FY8 E;  2NWN A;  1O2L A;  3MH6 A;  4EI2 A;  2FOM B;  1V6D A;  2IJD 1;  2BY6 X;  2A45 G;  4GCH F;  4H0L C;  2BYA X;  1FZB A;  1EPT B;  4EYY Q;  3LON A;  1L0L K;  2R3S A;  1ZSK A;  2PWX A;  3L73 J;  1AGJ A;  5AW0 B;  2Q3E A;  2ZEC A;  4ZHM U;  4FUF A;  2FXO A;  4K1T A;  1C5O H;  2GUV A;  1J1D C;  4TY6 A;  1CA0 B;  5A8Z A;  5TJX A;  5KTB A;  1XMN B;  3BEU A;  4OGQ C;  3HE5 A;  3V2N A;  4D7F A;  1K8A Q;  3ODD A;  3M0D A;  3GHG B;  1H9L B;  2OIN A;  1NES E;  4KEL A;  2Y6T A;  5LPF A;  3H1I E;  2SGF E;  1TRM A;  2QJY B;  1D9I A;  3MGN A;  5EST E;  5E0H A;  1WUN H;  1BDD A;  1TGS Z;  2ZFP H;  2BLW A;  1QB9 A;  1QBO A;  2BD3 A;  1FIW A;  4EOT A;  2FMJ A;  2TGA A;  1BA8 B;  3CC2 P;  3BTW E;  3GY3 A;  3PWC A;  1QTF A;  1H88 A;  3ZDM A;  1K1P A;  5A0C A;  4N78 D;  3QH9 A;  1NO9 H;  1TNK A;  2M2A A;  2ZWL H;  3A87 A;  2FXM A;  4RT0 A;  4A1X A;  1LTA C;  1OKX A;  4UD9 H;  1KMI Z;  1RD3 B;  1FX0 B;  1TGB A;  1TGT A;  2XW9 A;  3CEN A;  2EY4 C;  4GUX A;  1LT9 C;  3JCU H;  3RXR A;  2NZ2 A;  4E7R G;  1N6Y A;  4YES B;  2YO3 A;  1T8M A;  1RTK A;  2G8T A;  3FXE A;  2FOF A;  2ZVN B;  4BAK B;  3VB4 A;  4RN6 A;  1V2S T;  4U3F G;  1SFC A;  7GCH F;  4WB4 A;  3B23 B;  3TPI Z;  1IJD B;  8KME 2;  1GTW A;  3TK5 A;  1EC5 A;  4Y99 C;  1HJ8 A;  1LCY A;  1GD2 E;  1K1I A;  4BXS A;  3RXL A;  1M1J B;  5C17 A;  1KV4 A;  1D4P B;  2F83 A;  5C5N A;  1NVO A;  4DIH H;  2CXV A;  1YP9 A;  1H8D H;  4B74 A;  3ATW A;  4SGB E;  1LTO A;  1BBR H;  3PLN A;  1GJA B;  4U3F J;  4LXB H;  2FTL E;  1RF0 A;  2QN5 T;  1E36 B;  4ABF A;  2PP6 A;  2V4H A;  1W2B O;  2G5V A;  2B0F A;  1Z7K A;  2C9L Y;  1DEE G;  3SHA H;  2ZYD A;  3WU2 E;  1GBM A;  2AIP A;  2BZA A;  2M5T A;  1Q2W A;  4X2W A;  3QWO C;  1WU1 A;  1RIW C;  2JJ1 D;  1S6H A;  3M9H A;  1P2O A;  1QBN A;  5AF9 H;  1LDT T;  1PPJ G;  2F9O A;  2NPS A;  4TYD A;  2FI3 E;  2ZGX H;  1E79 H;  1GGD C;  1GMH G;  1VDF A;  1CE5 A;  1AKS B;  1UTP A;  3W67 A;  1C5V A;  5EPN A;  2A06 G;  2PGD A;  2AIQ A;  3E91 A;  4AGK A;  1QA7 A;  4IW4 E;  4OS4 A;  1VGC B;  4IMQ A;  5AVY B;  1C2E A;  2BOK A;  3O8Z A;  4JZF H;  2I1J A;  4INL A;  4JYU H;  2SPZ A;  3R4Y A;  1HUT H;  3CX5 E;  2WPJ S;  3KF2 A;  3B5N D;  1FJS A;  3A0B H;  3L71 G;  2IYO A;  1QQ4 A;  1V2P T;  2KNC A;  2W5E A;  3HPT B;  5G4B A;  4ABA A;  1PPZ A;  1SHH B;  1O0D H;  1ZXG A;  3L74 G;  2BDH A;  3GCH C;  1KDQ A;  1V2T T;  4P02 A;  4F55 A;  1ZN5 A;  4PD4 E;  2H2Z A;  3RMM H;  4ZXY H;  1O2R A;  1F7Z A;  3SV6 A;  1GHW H;  1QVF O;  1W14 U;  1N7L A;  4WVZ A;  2BY8 X;  1K1M A;  2P7J A;  3IN6 A;  2C9N Y;  3L71 E;  4HFP B;  4IGD A;  1RTF B;  4BTI B;  1NRO H;  1PP9 J;  1O2K A;  3HD7 B;  4FUD A;  2ZA5 A;  5L30 H;  1NTM J;  1HCG A;  3L4F A;  1TNL A;  1GHV H;  1XM1 A;  1TAL A;  2OTV A;  2Z9G A;  1VL2 A;  4U30 A;  1PP9 E;  1KIL E;  1MKW K;  2KZI A;  3LIW A;  4I8G A;  2Q6D A;  2TPI Z;  3ATM A;  1ELC A;  2J97 A;  1H4W A;  2XBW A;  1P84 I;  1L4A D;  3HD7 C;  3L3T A;  4K69 A;  1FE6 A;  2YMK A;  1AVG H;  1MD7 A;  1QQU A;  2FEQ H;  1IQM A;  3BRT B;  1DD3 A;  3RK3 C;  1XXF A;  3H09 A;  1EDJ A;  5KJ7 C;  5KJ7 A;  1SPJ A;  2IOT A;  3KQE A;  5FPY A;  2DW3 A;  5APY A;  2BDA A;  1OVR A;  2KM0 A;  3WY8 A;  2KNC B;  3A5T A;  3RK3 B;  1T8N A;  2J2U A;  1NTP A;  3SJ8 A;  4AFZ A;  1VQ6 P;  4DCD A;  3PV2 A;  3CX5 D;  3MFJ A;  1J1E B;  3CXH I;  1EXJ A;  1C1O A;  2CHA C;  4IBL H;  4NA8 A;  3ZYE A;  4PV1 C;  3M36 A;  1ZR2 A;  4TY7 A;  5BRR E;  1V2J T;  1N8R Q;  4FUG A;  2BDB A;  1ZRK A;  1IQF A;  1PIX A;  3HE5 B;  1J9C H;  1TFX A;  1W13 U;  2J95 A;  3EYD A;  1O2J A;  4BWN A;  3L73 G;  3P7K A;  2WSE H;  3D6Y A;  3CXH H;  3H1I J;  4C7N A;  1TA2 A;  1OYT H;  3LGW A;  2O01 J;  2YXQ B;  4FUH A;  1FAV A;  3GCT F;  4GLY A;  2C3S A;  1BRA A;  3HE4 B;  1SLQ A;  2BY5 X;  2FOE A;  1TX7 A;  1TNG A;  3Q3K A;  1SOZ A;  1QY6 A;  1NBM D;  4Q4L A;  1DPO A;  2ZCH P;  1H89 A;  1Y3Y A;  2AMD A;  3P8N A;  4FU7 A;  5DP4 A;  2OQU A;  4W7Y A;  1P09 A;  3KQB A;  1SQB G;  5HKK D;  3PLP A;  1YM0 A;  1O2W A;  1ZR0 A;  5GCH G;  2OLG A;  1LPZ B;  5JPM H;  3TYY A;  2VID A;  1SGE E;  2KR7 A;  5AFY H;  1IHT H;  2QIW A;  4WWI A;  3CX5 H;  1SGP E;  1GI8 B;  3P17 H;  4AYY B;  3T97 A;  1C1U H;  1D6W A;  3DFJ A;  1CSB A;  3ZZA A;  4TLF A;  2R5B A;  3SJI A;  5IYT A;  2Y82 A;  4Y99 B;  1EZQ A;  1K1L A;  1E0F D;  4R8T B;  1AZZ A;  4ASH A;  4Q7Y A;  3H1L G;  3H6P A;  2WYJ A;  1SQP G;  5E79 H;  1BJU A;  1K1J A;  2XOK D;  4MPU A;  3BVH A;  1ELA A;  3NKK A;  3RBX A;  4UFD H;  1TNI A;  5AW2 B;  4ZKR U;  2OP9 A;  3CLQ A;  5EOK A;  3SU4 A;  1GL2 A;  1O31 A;  2LEL A;  2ZDM A;  4I1L A;  2E75 D;  2Q6G A;  2I1K A;  4A1T A;  4PJ0 H;  1O2X A;  3U69 H;  1M1J A;  2BD8 A;  3BRV B;  3FP6 E;  1GW4 A;  4O3T A;  1O3F A;  1NAY A;  2CF9 H;  3A8B A;  3OEE D;  1EST A;  1HDT H;  4HTC H;  1NPM A;  4INK A;  4XBB A;  4RKJ B;  2KB7 P;  4RI0 A;  4ISL A;  1C1P A;  2Y0C A;  4W7Z A;  1B7X B;  2K37 A;  4CPG A;  1QRW A;  1NTZ K;  3KDP B;  1Z71 A;  3C27 B;  2H9E H;  3KN2 A;  3T62 A;  1LT9 A;  2GP9 B;  1A0H B;  3V2Q A;  1AA0 A;  3H1H D;  4X8T H;  1ZRT E;  1ABJ H;  2FYU G;  3Q5S A;  1TX8 A;  3NTN A;  5M1B A;  4EIJ A;  5AW1 B;  1XUI A;  2PKA B;  1EXI A;  1SGF G;  1Y3V A;  1J2J B;  2J4I A;  1FU1 A;  2JJL A;  1DT2 A;  3SU5 A;  3FO8 D;  3GHG A;  1GMH F;  2AH4 X;  1SGQ E;  1KXD A;  4CRC A;  3ZZ5 A;  1FZA A;  1PPF E;  3EA9 A;  3ZYD A;  2C0X A;  1KDQ B;  1Q31 A;  1G9I E;  4GT1 A;  1BTP A;  2HRV A;  1JRS A;  3EA8 A;  1ANC A;  1SQQ D;  1NC6 A;  3PV5 A;  1MZA A;  1SSX A;  1L1G A;  1IAU A;  4BTT B;  2Q7C A;  9EST A;  2ZPR A;  4UFG H;  3GG2 A;  1YI2 P;  1DDJ A;  4NSY A;  1RQU A;  1J15 A;  4AZ2 B;  5C67 A;  1T8Z A;  4ACA A;  1GU5 A;  2N1T B;  1C1S A;  5EU8 A;  3MNB A;  3L72 D;  3M5M A;  2FY8 A;  2F3C E;  2J5U A;  3Q3D A;  1GG6 B;  1UTQ A;  2JR8 A;  3EQ0 H;  1COW D;  2QM7 A;  1EJM A;  1RJX B;  1NRP H;  1GWA A;  3LJO A;  4ZKS U;  2WPR A;  4DG4 A;  2VGC C;  5FBI A;  2OXS A;  1F0R A;  3LJJ A;  4I8J A;  1GI1 A;  3L36 A;  2AMP A;  2A06 D;  1DLE A;  3M3V A;  4ABB A;  2J59 M;  4IFF A;  4HGC A;  3UWJ H;  3M3S A;  5EXL A;  1FI8 A;  5GTH H;  1F0T A;  3MH5 A;  4IC6 A;  1Y3U A;  1BDC A;  3MP7 B;  1JY2 N;  3L75 E;  4WH6 A;  1S72 P;  3BTE E;  3ZZ9 A;  2F9P A;  3W95 A;  3RXM A;  1HAX B;  1FZG A;  1L4A A;  1TIO A;  2VIQ A;  4Y0Y E;  2VIP A;  1BCC E;  1XX9 A;  4ZHA A;  1KYO E;  3D23 A;  1LP1 A;  4KHX A;  4JZE H;  2YIU C;  1S0Q A;  3I5C A;  1YCP K;  2O8W A;  1W7G H;  3RK2 B;  2P3T B;  1K0H A;  2P94 A;  3GDU A;  1JY3 P;  3P32 A;  3W94 A;  1VQ7 P;  5KKZ C;  1TE0 A;  1G3B A;  3MU5 A;  3VEQ B;  4CRG A;  1ZTJ A;  4H42 U;  2LNC A;  4H44 B;  2WPI S;  5GTI H;  1ZOY C;  1O2O A;  1UCY K;  3HE4 A;  4PRO A;  3B8E B;  4E05 H;  2ODY B;  2FYQ A;  1IFN A;  2Z9L A;  3KL6 A;  4KTU A;  1QB6 A;  4ACB A;  2F9B H;  1FZC C;  2G4U A;  1SQV G;  2B88 A;  1NJI Q;  2L6O A;  3GW6 A;  1U7J A;  1JMM A;  2QJK C;  4AUW A;  1XVM A;  4GOE A;  2IJO B;  4IMZ A;  3SJO A;  1V2K T;  3IAO A;  1A7S A;  4AYC A;  1L4A C;  4DJG A;  4ZKP A;  1KXE A;  1TRN A;  2QV1 A;  4JZD H;  1O38 A;  9LPR A;  3LW5 J;  3V3M A;  4I8K A;  1NTZ G;  3KYQ A;  2Z9J A;  3M5L A;  3U1A A;  1HH0 A;  2GKV E;  3TK6 A;  2FOH A;  4X1P U;  5CHA B;  1CHG A;  5C1Y A;  1Y5U T;  4JF7 A;  1G1J A;  1AY6 H;  1C5W B;  2H9H A;  2OCV B;  4Y76 A;  2VGC B;  1VF5 D;  1JY2 O;  1QRX A;  1TNH A;  1YBW A;  5GJ4 B;  1Q86 Q;  3G6E P;  2QXI A;  2E5Y A;  3U98 H;  1MTV A;  3SI4 H;  1FC2 C;  1O3K A;  1Z6E A;  2E74 B;  1NRQ H;  1HAG E;  4CRD A;  1BMM H;  1LTS C;  2ZFS A;  3LU9 B;  3PV4 A;  5A0A E;  4RT1 A;  5GND A;  1KYO H;  2BX3 A;  1IQN A;  3NPS A;  3BCC E;  3PJS K;  1NFX A;  2Q1J A;  2CK3 H;  2PHB A;  2ALP A;  2VWL A;  3L70 J;  3RL0 B;  1NU1 D;  1MU6 B;  1Y59 T;  2H7H A;  5AW6 B;  1OSS A;  1EQ9 A;  4OVN F;  1KB9 D;  2D26 C;  2KOG A;  2EC9 H;  2ZTY A;  1E35 B;  4JYV H;  3RML H;  4IL6 X;  3PRJ A;  2W83 C;  4LGD E;  4AFU A;  2FOD A;  2QY0 B;  5EW2 H;  3MYW A;  1TOM H;  3EGK H;  1YCP H;  3F5H A;  3QK1 A;  4I2L C;  3RDZ A;  1O37 A;  1VJ9 U;  4JYC A;  4GHT A;  4U32 A;  1RF1 B;  3A0H E;  1J1D B;  3AED C;  3F3B A;  2YNB A;  3TGK E;  3E1R A;  5AW7 B;  1S82 A;  3RXF A;  1LT9 B;  1M8O B;  3TGJ E;  1URQ B;  1LWU A;  1Y47 A;  5AW8 B;  3BG4 C;  3L74 J;  1CW5 A;  1K05 A;  1SQQ K;  1HAO H;  8LPR A;  1KZU B;  1L0Z A;  2PKS C;  1IFI A;  1O2Y A;  4M3L A;  2WPV B;  3CWB G;  1MBQ A;  2HYN A;  1LTJ B;  3DSO A;  3DSP A;  2KSE A;  3UNR A;  3GF7 A;  2V7Q J;  4UFF H;  2ZCK P;  2P2U A;  3WWB A;  3BEI B;  1PL5 A;  1HAY B;  2F9U A;  3UTU H;  2Y5G A;  1BTY A;  3MH7 A;  3STI A;  1KLJ H;  3B5N C;  1THP B;  4GAW A;  1Q81 Q;  2HNT E;  5APU A;  1BRB E;  2EQN A;  3SU6 A;  1ZLL A;  1BCC G;  1FLE E;  1AVO A;  2J38 A;  4CHA B;  2THF B;  3ATK A;  1QVG O;  6GCH F;  2FYU K;  2YKP A;  1PFI A;  1WTH D;  3KNX A;  4JZI A;  5HYO A;  1EAU A;  3OE7 D;  3HD7 D;  1L2E A;  1X79 B;  1AKS A;  4WY4 D;  2F91 A;  3QLP H;  3ZV9 A;  2Z6B D;  4HYT B;  1NU1 E;  2UWP A;  1SLW B;  1GBD A;  1GGD B;  2HLO A;  1BIT A;  3MNC A;  5APT A;  4IFD K;  1NRR H;  2B7D H;  4ZRO A;  1GL1 A;  3AW1 A;  1FJK A;  3K9X B;  1HF9 A;  1BTH H;  2G52 A;  3F9E A;  5C0U A;  4DUR A;  4O03 A;  1HAZ B;  1V2Q T;  3HTK A;  1JEK A;  2BEZ F;  2QJP C;  1PP9 D;  2BXT H;  7EST E;  2WPM S;  1BSN A;  3VP8 A;  3LH3 A;  4RJT A;  4Q80 A;  3Q77 A;  1WT6 A;  1MKX K;  1SQB E;  2KUB A;  3NZI A;  2C0W A;  1MMJ N;  3II6 A;  1ESA A;  3JZ2 B;  1WMK A;  3RXC A;  1TU3 F;  3V2P A;  2VH6 A;  2A2X H;  1SC8 U;  4FUI A;  2WWW A;  1E37 B;  1SFC B;  1N8O C;  2GD4 B;  1N86 A;  5EGM A;  1UVU H;  2AXC A;  3C1L A;  2FXP A;  1J16 A;  1GCD A;  5FCK A;  3TGU G;  4FUJ A;  1QJ7 B;  4MNY A;  1HLT H;  1TA6 A;  2ZQ2 A;  3UAI C;  3VFE A;  3KHV A;  4FU9 A;  2YXR B;  1FS0 E;  3B8J A;  4YLU A;  1JM0 A;  4AX9 H;  2MKV A;  1PQ8 A;  2ANY A; 
#chains in the Genus database with same CATH homology
 2CPB A;  1XTC C;  2WSC H;  4AQR D;  5CCG A;  3OA7 A;  1N73 B;  2A45 G;  4W80 A;  5CCH D;  1FZB A;  3H32 A;  1G2C A;  1L0L K;  1N7S B;  1JUN A;  2NPS D;  2O1K A;  5AW0 B;  1URQ D;  2GUV A;  1J1D C;  1N7S D;  3P8C D;  4O9B A;  3U1C A;  3SWY A;  1N7S C;  4HH2 A;  5KTB A;  1JNM A;  3HE5 A;  2BAS A;  3V2R A;  3V2N A;  3M0D A;  3B5N B;  3U59 A;  3GHG B;  2IFN A;  5AVR B;  3MD0 A;  1LTG C;  1NHL A;  3MGN A;  3WMM 0;  5BU5 A;  1DEB A;  4LC1 A;  4EOT A;  2N9B A;  1RE4 C;  5KJ7 D;  1H88 A;  4N78 D;  2FXM A;  2O1J A;  1LTA C;  3HD7 A;  1KIL A;  2OYI B;  1G1I A;  1LT9 C;  2Z4E A;  1GL2 D;  2YO3 A;  3HRN A;  1HJB A;  3TNU A;  1SFC A;  2GUS A;  1T2K C;  4WB4 A;  2OYH B;  1IJD B;  1GTW A;  4Y99 C;  1GD2 E;  3BAT A;  1X8Y A;  1M1J B;  2R3C A;  1GL2 B;  2N1T C;  2OYI C;  3A3Y B;  1SQV K;  1N73 C;  3C9I A;  2Q3I A;  1RF0 A;  1RF0 C;  1ZR4 A;  2PP6 A;  2C9L Y;  1HVV A;  3OJA B;  1NKN A;  1NTK K;  1SP4 A;  5AVQ B;  2CPS A;  3SWF A;  2YO2 A;  3M9H A;  2KSJ A;  2NPS A;  2FKW B;  1KFN A;  1VDF A;  4I6M C;  5AW4 B;  1LGH B;  5BU8 B;  2WSF H;  5AVY B;  3O8Z A;  2WPQ A;  3CL3 D;  5CJ4 A;  2I1J A;  2ZFC A;  5AVW B;  3VMZ A;  1MZ9 A;  2HOD B;  3LW5 H;  3B5N D;  4WY4 A;  4OH8 B;  3P8C E;  3MUD A;  1QL2 A;  2P67 A;  1ZN5 A;  1N7L A;  2P7J A;  3VMY A;  4C46 A;  2C9N Y;  1LWU B;  3HD7 B;  2XV5 A;  2MJZ A;  3V4W A;  3L4F A;  2Z5H A;  3R2P A;  1L4A D;  3HD7 C;  1HGV A;  2XDJ A;  3V4Q A;  5AW9 B;  1YYC A;  3BRT B;  5APX A;  5AVU B;  3RK3 C;  2WZ7 A;  5KJ7 C;  5KJ7 A;  1T2K D;  3IFM A;  3VTP C;  5APY A;  2HOD A;  2W6A A;  1RE4 A;  1N73 A;  3N4X A;  3A5T A;  3RK3 B;  3M91 A;  1EQ7 A;  2R32 A;  1J1E B;  3KPE A;  1ZR2 A;  2OYH C;  2WTY A;  1GU4 A;  3NMD A;  1FDM A;  3HE5 B;  2HFE D;  1KFM A;  1SFC C;  1NO4 A;  3P7K A;  2WSE H;  2NPS B;  2ZXE B;  2HG5 D;  4C7N A;  1CZQ A;  4JYB A;  1FAV A;  2YKO A;  2WT7 B;  3HE4 B;  1SLQ A;  1URQ A;  1KIL C;  1X9V A;  4WBA A;  1GDT A;  1H89 A;  4W7Y A;  4C7R A;  5AW3 B;  1LTT C;  1KIL B;  2LKM A;  2IPP A;  4DZO A;  2J58 A;  3TYY A;  1IFD A;  1HWT C;  1S9K E;  2O01 H;  3EFG A;  3T97 A;  1RY3 A;  1CSB A;  4XA4 A;  2R5B A;  3VYI A;  3TNU B;  4Y99 B;  2XNX A;  3H6P A;  1HBW A;  3BVH A;  1WRG A;  5AW2 B;  3MIW A;  3CLQ A;  2H43 A;  1AFO A;  1GL2 A;  1KQL A;  4I1L A;  2VRS A;  3TSI A;  1JTH A;  2I1K A;  2E42 A;  1M1J A;  3BRV B;  1GW4 A;  1JY2 P;  3HUS A;  3HUS C;  2KB7 P;  1YTZ T;  5BVZ A;  2OAR A;  3H32 B;  1RE3 A;  4DOJ A;  4W7Z A;  1NTZ K;  3KDP B;  2N1T A;  1LT9 A;  1HUC A;  3V2Q A;  1SQP K;  3NTN A;  5AW5 B;  4EIJ A;  1S9K D;  5AW1 B;  3VP9 A;  2A45 I;  1J2J B;  1FU1 A;  2JJL A;  3EQ2 A;  3GHG A;  1FZA A;  5APV A;  1SQX K;  1QL1 A;  1JOC A;  2QM8 A;  1J1E C;  2C0X A;  4GKG A;  3RK3 D;  4GT1 A;  2WPS A;  3RL0 C;  4IFM A;  1GK6 A;  5CCG C;  1FZF A;  2FFD B;  1OWA A;  2Q7C A;  5AVZ B;  1L4A B;  1FOS E;  2PAJ A;  1T8Z A;  3M9Q A;  1GU5 A;  1LTJ C;  2N1T B;  2JEE A;  2QM7 A;  1A02 F;  1HTL C;  3LIE A;  2WPR A;  5CMZ A;  2YMY A;  3L36 A;  1LTI C;  3OAK A;  4N3Y B;  2J59 M;  4IFF A;  3RL0 D;  2FYZ A;  1JY2 N;  4B86 A;  3HTK B;  1FZG A;  1L4A A;  3NXS A;  1FBM A;  2XZR A;  4ZKU A;  4KHX A;  1XTG B;  3I5C A;  1IC2 A;  3RK2 B;  1JY3 P;  3P32 A;  3VN0 A;  2NPS C;  3PP5 A;  1LWU C;  1RF1 C;  3NFQ A;  3HE4 A;  3B8E B;  1RE3 C;  1IFN A;  4N78 E;  2WT7 A;  1OXZ A;  3M0A A;  1FZC C;  1JY3 O;  2HPC B;  1JMM A;  1M7L A;  4AUW A;  2YKQ A;  4WY4 C;  4ZKP A;  4AYC A;  1L4A C;  1N7S A;  2A45 H;  3KYQ A;  3GHG C;  2L5G B;  1LTB C;  3U1A A;  1HH0 A;  1H8A A;  3M0D C;  1NKZ B;  1FZC B;  4JF7 A;  1JCC A;  1G1J A;  1FJP A;  5AVS B;  1JY2 O;  1A02 J;  1RF1 A;  3M06 A;  3TK1 A;  1LTS C;  3VOP A;  1FZE A;  2WIT A;  2FFD C;  2XU6 A;  1MV8 A;  2YNY A;  1KIL D;  2R5D A;  1GW3 A;  1AQ5 A;  3P8M C;  2HPC A;  3RL0 B;  1JTH B;  4WY4 B;  2H7H A;  2POH A;  5AW6 B;  1IFJ A;  2GM4 A;  3N7N A;  2N1T D;  2KOG A;  2KP8 A;  1DX7 A;  1IFM A;  3L37 A;  3VMX A;  1SFC D;  1FZC A;  1T3U A;  4LGD E;  5CCG D;  2W6B A;  1URQ C;  5AVT B;  2OYI A;  4LLH A;  4I2L C;  5CCH A;  4JYC A;  1MUU A;  1M1J C;  2P1J A;  1RF1 B;  1J1D B;  5AW7 B;  1LT9 B;  1URQ B;  1LWU A;  5AW8 B;  1CW5 A;  1CI6 A;  1SQQ K;  1KZU B;  1IFI A;  2IX7 C;  4M3L A;  2M3B A;  2HYN A;  1LTJ B;  2Z5I A;  1NWQ A;  2M8R A;  2OYH A;  3MTU E;  3A7O A;  2P2U A;  5AVX B;  1ZV8 A;  5APW A;  3B5N C;  1NAF A;  5APU A;  1ZLL A;  3G3Z A;  1GK4 A;  1HGZ A;  1W2E A;  3IR9 A;  2FFD A;  1GL2 C;  2Q9I A;  3UIA A;  5CCH C;  2FYU K;  2YKP A;  1PFI A;  4GIF A;  3CI9 A;  1NTM K;  5APQ A;  3HD7 D;  1X79 B;  4RES B;  2H8P D;  1SQB K;  3B5N A;  3E1I A;  1Z56 A;  4WY4 D;  3KQG A;  4HYT B;  1NU1 K;  1NH4 A;  1IO4 A;  1L0N K;  3L35 A;  2HLO A;  1LTJ A;  1MFZ A;  1YTZ I;  5APT A;  4IFD K;  1JO5 A;  1FJK A;  1DH3 A;  4C7N B;  3RK2 D;  3HTK A;  3V5B A;  3VP8 A;  1JCD A;  3HUS B;  1SVF A;  5AVV B;  1WT6 A;  1E5W A;  2W27 A;  1VPC A;  1JY3 N;  2C0W A;  3M9B A;  3II6 A;  1G2C B;  1IK9 A;  1FOS F;  3V2P A;  1NOH A;  2WWW A;  1SFC B;  1N86 A;  2KYV A;  1GZL A;  3LID A;  5KLV K;  5CHX A;  3RK2 C;  2XKM A;  1T3J A;  4XE5 B;  5APS A;  4N6J A;  2KLV A;  2E43 A;  1CI6 B;  3A2A A;  5CJ0 A;  1N2D C;  2Q5U A;  2IFM A;  3BAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...