2PP6A

Crystal structure of the atp-binding sugar transporter-like protein from salmonella typhimurium
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
88
Chain Sequence
SNAMADLFDGMKRRMDALIAERFGMKVNINGTDCIVVESDFLAGKNVVVFSGNVIPRRGDRVVLRGSEFTVTRIRRFNGKPQLTLEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ATP-binding sugar transporter-like protein from Salmonella typhimurium.
rcsb
source organism Salmonella typhimurium lt2
molecule tags Transport protein
molecule keywords Gifsy-2 prophage ATP-binding sugar transporter-like protein
total genus 18
structure length 88
sequence length 96
ec nomenclature
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13856 Gifsy-2 ATP-binding sugar transporter from pro-phage
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2pp6A01
2.40.10.210 Mainly Beta Beta Barrel Thrombin, subunit H Phage tail proteins (gpFII-like) 2pp6A02
5CCHC 3RK2C 3P8CE 5CCGA 1N7SD 1N7SA 2NPSC 4WY4B 3HTKB 2N1TB 5CCGC 2NPSD 1GL2D 3M0DC 4WY4A 4OH8B 2M8RA 3RK3C 1URQC 5KJ7D 3B5NA 2N1TA 3RL0C 3VOPA 1L4AD 1URQD 1L4AA 1URQA 1NHLA 2N1TC 2HFED 1SFCD 4W80A 2WZ7A 4LGDE 2YMYA 2NPSB 1GL2A 3RL0B 2HG5D 3KYQA 3RK2D 3HD7B 1URQB 5KJ7A 1KILA 4JF7A 1KILD 3RK3B 2PP6A 4WY4C 2XDJA 1XTGB 2KOGA 1N7SC 2NPSA 3TSIA 1SFCB 1L4AB 3PP5A 1T3JA 3B5ND 1JTHB 3RK3D 1KILB 3HD7D 4N78E 2H8PD 3RK2B 3RL0D 5CCGD 4W7YA 1SFCC 1HVVA 5CCHD 3B5NC 1SFCA 1GL2B 2N1TD 1L4AC 3HD7A 1N7SB 1JTHA 1GL2C 4WY4D 5CCHA 3B5NB 3HD7C 5KJ7C 1KILC 4W7ZA
chains in the Genus database with same CATH superfamily
3RLYH 4NIWA 4Y71A 4YOJA 5A2MH 3M5MA 1DS2E 4YT6H 1NVOA 3Q2YA 1MKXH 2PGDA 1NTZE 5AW1B 3A7TA 2A7CA 4ESTE 2TGDA 1PV3A 1ELVA 4X6NA 3OYPA 2J98A 1BGYJ 2SGPE 2ANWA 2QN5T 4WY4B 1JY3N 2A45B 3II6A 1DXPA 2D8WA 4KTCA 2FYQA 1C9TA 2VVVA 2YKOA 2KZIA 5A09A 3BN9A 4PV1D 1MCTA 2J34A 1FNIA 3AEFC 1DH3A 3PV5A 2XYAA 2YIUC 3CCRP 1LVMA 1NJIQ 1MH0A 2PKSC 4GVUA 2G3AA 3G71P 4VGCC 3B8JA 4AB9A 2B89A 1S9KD 2BZAA 5CHBA 1FN8A 1OWHA 3Q3KA 4B86A 1FC2C 5AW0B 2JH6D 3AE8C 1RTKA 2KS1A 4I6MC 4NPDA 3ATMA 1N1LA 4RJTA 2Y80A 1L4AA 4IFMA 1HPGA 3VB5A 4LZ4B 5HM9A 3N7NA 1BCCD 1AUJA 1GK6A 1EXFA 3TGUD 4TY7A 1RH5B 1NTME 1Q86Q 3L70E 1L1GA 1NTPA 3SNAA 1J1EB 2ZEBA 3SZEA 1QJ6B 1OYTH 4CHAC 1EAWA 4RO0A 2A0QB 2B7DH 4ISLA 1YCPH 3SJ9A 3V2NA 1TPOA 3W1EA 2E76C 2ZA5A 1HJBA 3HUSA 2JWDA 2YMYA 3H1IE 3L71E 3G4SP 4EOTA 1E79D 3CWBE 1Y3XA 2W6JH 3AW0A 3U69H 3V0XA 4K69A 1T2KD 1DEEG 1DUEA 1O2HA 1HAXB 1V2LT 3HD7B 3QUMP 3SNDA 3H1JJ 3R4YA 3MIWA 4RN6A 1ZJKA 4IL6E 2FESH 4FUGA 4DURA 4AFQA 1BMAA 2XNIA 1SMFE 3U1IB 2QE7H 3PMAB 2K0QA 2R2WU 4Y79A 2ZTYA 2VB0A 1DANH 1H88A 1VQ6P 4LZ1H 6LPRA 1NESE 1YKTA 2PKSB 2O01H 1TNGA 3V13A 1AGJA 5B66H 1H9HE 3KGPA 4FXGH 3C27B 2CK3D 3M36A 3P8OA 2PGBB 1Q2NA 1B0EA 4A1XA 3I55P 2KK7A 1BBRK 3A8AA 3PP5A 2G55A 1ZRTD 2Q5UA 5APUA 4I33A 2E5YA 3A83A 4XBDA 3RK3D 1Y59T 3FWNA 2FYRA 3MOCA 1LP1A 1LHEH 1U7MA 2BM2A 1DPOA 3BEUA 3JCUE 1LPGB 1BSHA 1P03A 1RF1B 1PPJG 2LXBA 4D6TG 3QN7A 1HB0B 2NWNA 2OQUA 3ZVGA 3GY7A 1EDLA 1CU1A 1BRUP 2L5GB 1ZLLA 5AVTB 1TE0A 2ZHFH 5F8ZA 1E79H 2ZHEH 2ZQ1A 3L3TA 3WY8A 2RKLA 2ZAEB 1FDMA 3GDUA 1YM0A 1BHXF 5B6LA 2LKMA 1FDOA 2KLUA 4IC5A 4RKUJ 1PQAA 4B76A 5C1UA 5GIBA 4ABAA 3WWFA 4Q63A 4OM9A 1FXYA 3O6QB 1NTKG 1ZMLA 2XBYA 4OGQC 3H7OA 1LKAA 3LJOA 3G3ZA 1O2TA 1GHZA 1BRCE 4FU8A 1K1PA 4OS6A 5H2FH 2HLCA 1VF5D 2WSEJ 1Y3WA 4YTAA 1ZSKA 2EQNA 2CPBA 1A02F 1A0HB 3SI4H 3ZVCA 2I1KA 2QXIA 1DY8A 3SV9A 2J92A 1VJ9U 1PP9J 3L72J 2DUCA 1SQBG 1TQ7B 5C5OA 1GGDC 5HIYA 2K9JA 1FBMA 4Y28J 2Z4EA 4HFPB 1GI0A 3GY3A 5FXLA 1KN7A 3N4XA 3I56P 1C2HA 1JO5A 1GJCB 3WUUA 1Z71A 2XNDD 5EG4A 5BU5A 1C2FA 1MTNC 3RMNH 3B5NA 1CHGA 2R44A 2OC8A 3RXBA 2JDIH 2QC2A 2ZFRH 1SC8U 3F9EA 2BZ6H 1GJ8B 4TY6A 3M3VA 3KZIH 2FX6A 1YPKH 5AVXB 1C4V2 2ITAA 4ZXXH 2GZ8A 2OBOA 4I7YH 2QF5A 4NWKA 5GWZA 4ASHA 3T97B 2HNTE 1O3HA 1RRKA 1T8LA 1GD2E 3TNTA 1PPJE 2FOFA 3OU0A 4Y8ZA 1KD1Q 2QJKB 1GL0E 1NTMK 3JSVC 1HXEH 1KLTA 3PYHA 3SO3A 1P2JA 1BE3J 3UOPA 2CHAB 4DJZB 1G2CA 4YTPC 1G2MA 3MO9A 4L75A 3QH9A 5AVWB 4CBNA 2KCAA 2NPSB 2OYIA 4YLUA 3AE4C 2Y9ZA 1ANDA 2AIQA 3BTGE 3RU4D 1ESBA 4IFDK 1NRQH 1MKMA 3MU5A 2V3HH 1K8AQ 1YTZT 1O31A 1DEBA 1MU6B 2GZ7A 2OP9A 2YMSD 1HCGA 4X2VA 1RQVA 2A4GA 1FZBA 2FY8A 4XBBA 5E8EH 2KZJA 4CREA 1ZJDA 1AFOA 1ZR0A 1M7LA 1GMJA 3A5TA 3TGUE 5F53A 2ZYDA 4TWYA 2ZDMA 1BT7A 3TSIA 2PSYA 1OYQA 1BUIA 4U7JA 1TBRH 1SPJA 1AKSB 2Z5IA 9LPRA 2BLQA 4GUXA 4RT1A 1X7AC 2F9OA 1NGMB 1W0ZU 5LPEA 2H43A 1VZQH 2C0WA 1QB6A 5AVDA 3H1LG 2GKVE 1S84A 1P06A 5FPSA 2JH5D 1RF0A 1F92A 3ZZ7A 1C4U2 4DVAU 1SQXE 3CX5D 3GCTG 3KN2A 1COWD 1KQSO 4TWWA 3AAVA 1C5TA 1A7SA 4YPCA 1FY3A 2NRGA 3C9IA 1GBBA 1KSNA 2W83C 1K28D 1ZHPA 4ZKNU 2F9NA 3MU8A 4O97A 5K0HA 1P8VC 4WVZA 1DITH 1MTSA 4AYYB 4XDEA 1H89A 2KX4A 2BY5X 2R0LA 1O2VA 3URCA 5CCHC 2ZC9H 2W6ID 2BYAX 2GZ9A 3GS9A 1S5LH 2ZVOB 2AEIH 3BATA 4UEHH 3ZZAA 3S4RA 1VDFA 3S1KA 1L0NJ 3KYGA 1C5RA 1TABE 1IZNB 1H9IE 3KQBA 4I8JA 4ASWA 1LNQA 1GI3A 3P8FA 8KME2 3RU4E 1JMOH 1Z8GA 4ZH8A 2Q1KA 2N1TB 1AN1E 1UCYE 3CC2P 1C2IA 2QJPB 1K1MA 1GL2D 3BRTB 3M0DC 2ZDNA 4Y7BA 3M0AA 3UWIA 2LELA 2STBE 2FYUE 2KNCB 3BCCE 3L70G 1GMCG 4X6OA 4X8SH 1E5WA 4NA8A 1W0YH 1CI6A 2C8YB 3RU4T 2P94A 1ZOYC 5A8YA 1URQC 1J9CH 2H9TH 2OARA 1FI8A 2UUFB 2A2QH 3PWBA 1KQGB 3FXDA 1NOHA 4GSOA 3G6EP 3TNSA 5B6OA 2BY6X 5DGJA 1G32B 1VQOP 2B5TB 3H1HG 1P2NA 4DCKA 2VWOA 5J4SA 1EFRD 1O3KA 2WITA 2WZ7A 4PD4H 1RD3B 1O2XA 1UVUH 2AIPA 3OFND 4X2XA 4AYVB 1F5LA 1LTJB 3H1LD 5KLVK 2TGAA 2OTVA 3KXDA 1GMDG 1G3BA 1TLDA 3GY5A 3MGNA 1PP9G 1EAUA 3SZNA 4D6TJ 5AFZH 2E74D 4YXDC 1SQPE 3LGVA 3MH5A 1G2LA 2RN0A 3KQ5A 1CGJE 1QGFA 2OC1A 3LGYA 4F49A 1TGNA 2H7HA 2J94A 3L33A 4BAHB 4ZKRU 3SYJA 2ZGXH 1EZSC 1OWDA 2ZYGA 2L74A 2A4QA 2XC5A 2XNDH 1U57A 2FOHA 1AY6H 1CGIE 3GHGC 3S9OA 1O36A 3F0PA 1B0FA 1WUNH 3MI4A 3K9XB 1O2UA 1N73B 3SI3H 2CXVA 1WTGH 1VQ8P 4AORA 1P12E 1SQXJ 1OP8A 2TPIZ 1S4XA 4DT4A 3AEEC 4A5TS 4H4FA 1SLQA 1HJ0A 2H8PD 3KHUA 3RL0D 2GA1A 3E3TA 4WXVA 5DJ7A 3S7HB 3SFEC 4W7YA 2OLGA 1IQJA 1WOFA 3BTTE 4NFEA 2FZZA 3SHAH 3CWBG 3PHLA 1SQAA 3MMGA 1OOKB 2AXCA 3RMOH 4IL6X 2I6SA 1DWEH 3P8MC 1ZRTE 4B1TA 2SFAA 2BTCE 1PGOA 1YQ3C 2Q3EA 4PROA 1GDTA 5LPFA 1JTHA 3P8GA 3GF3A 4INLA 5ESTE 1FQ3A 1FY8E 1BTYA 3TPIZ 2CN0H 2FKWB 1GHAG 1T32A 3DSOA 2FXOA 3V5BA 3M7TA 5C17A 3CPWO 1BMNH 1GHBG 3UPEA 3WWBA 3TVJB 2ZQ2A 4JYUH 3Q3DA 4WY3A 1FY4A 1EAIA 2UWOA 1UVTH 1HIAB 1BRAA 1AUTC 1N6YA 1P2QA 2BCCE 2G00A 4X2WA 2H88C 4KHXA 1MUEB 3RDZA 3I77A 2EY4C 4XBCA 3EE7A 1YGCH 1SGPE 1Y5BT 2ODQA 1SQQG 1TPAE 2VINA 1W5CE 3GMAA 1C1NA 1ELEE 3UREA 4OWFA 4AGKA 4CR9A 1QQ4A 3F3BA 4UFFH 4OS5A 4OS7A 2AYWA 1X22A 1PYTD 1C1WH 1O3IA 1KXBA 1HAIH 3B9FH 3KPEA 1GHWH 2BY9X 1IQHA 2Z3EA 2QIQA 2M5AA 5KJ7D 2ZU3A 1H8HD 2CK3H 2FMJA 2BDBA 1ELCA 3ZZ5A 1JMMA 2E76D 4KT0J 1IFJA 1MTWA 1UW7A 4Y8YA 4FUBA 3A7OA 1JY2O 1UTNA 3L73D 2VJ1A 3BTQE 3VXEH 2KZ4A 4B2CA 4I8HA 1BB0B 2UWJE 2FOGA 1TIOA 5ESBA 3RLWH 5M1BA 3PO1B 3FXEA 2ANYA 3A0BH 2R9PA 4DT0A 1G37A 1KMHB 3H1LJ 5A8ZA 4BRYA 3OW2O 1O3MA 2ZI2H 4AFSA 2A31A 1NAYA 2M5TA 1OX1A 1SQPG 5CMZA 3A8DA 1GBFA 1NTKJ 1L0NK 1JBUH 2VWLA 1CHOG 3L70D 1LTAC 2ESTE 3AEDC 3STJA 1DLKB 1C1RA 3JZ2B 2KLVA 1KYOI 1UHBB 3TJVA 4ZKSU 1ZPCA 3VB6A 3TK1A 1EZVI 4CRGA 4CR5A 2PHBA 1ZLRA 3NK8A 1GBEA 3E6PH 2A5AA 3LGIA 3BVHA 4PD4D 2AFQB 1R5LA 1JUNA 2PP6A 1LT9C 1BSNA 3AASA 3UNQA 3VGCC 4CH2B 3UR9A 3U59A 1D7MA 3T62A 1S6HA 5FPYA 3VTPC 2AMQA 4O9VA 1XXDA 4AFUA 1QRXA 4ZNCA 3T26A 2R3UA 5KLVE 3LIDA 2KI7B 2JP3A 1ZR2A 1N8RQ 1HAHH 1KLIH 1C2EA 1Z6EA 2KAIA 3DSPA 3FZZA 3A0HH 4QMAA 3BTDE 2ZVNB 2OINA 3GW6A 1O3CA 1ANBA 2FI5E 2WUBA 4MNVA 5T6DA 2QF4A 3M7UA 1AVGH 1MKWH 3QDZB 2TGTA 1DX5M 1K1NA 1ZV8A 3E1IA 1SGYE 4IMQA 3EWKA 2ZPQA 3M61U 3EAJA 3JCUH 4AGJA 2M5AB 1PPEE 1EB2A 4A1VA 4X8VH 4YESB 2BY7X 4NPFX 5E2PA 2VVUA 3B5NB 1AZZA 4UE7H 4MVNA 4UFEH 1O5BB 1ZPBA 4Y6DA 5A0CA 1KDQB 2BCCJ 3PTNA 3HD7C 1KY9A 3RXAA 4Q7YA 2GCHG 2FI3E 2GT7A 1L0LE 3Q5PA 3HUSC 1BA8B 5T6GA 3PJSK 3RK2C 3A0BE 1PZQA 3AE2C 3GICB 3MU0A 4ZHAA 2Z9KA 1S82A 1C2KA 1HAVA 4RI0A 3HKJB 3W94A 1NTMJ 3QZRA 2ZFTA 2WPDD 3SHCH 2OYHB 4NGAH 1PGPA 3R2PA 4O9BA 3GHGA 2LPRA 1F2SE 1OMIA 2HNTC 2R32A 1C9PA 4Y0ZE 1PPCE 2GCTB 5C67A 2SGEE 1SLVB 3I29A 1AD8H 4HZHA 1IFMA 3P8NA 4YLQH 1IK7A 3QWOC 1QRZA 7GCHG 2GTBA 1SGCA 1HFDA 1HAGE 2FXPA 3RK3C 3GCHB 3RXJA 2WPVB 1G3EA 1GJAB 5DO4H 1UTKA 1GI6A 1FZZA 3E8LA 1FN6A 2A06E 2FWWA 1OP2A 1SQVK 4NIYA 2O1JA 2L6OA 1H1BA 1VQ9P 2VRSA 1GHYH 1XUFA 1LVYA 3FKSD 4HTCH 1QCPA 4WMEA 4AUWA 2ZGJA 2FP7B 3RC6A 1Q90D 2THFB 2ZXEB 4EIJA 5G4BA 3BCCD 2WWWA 5KAIH 4O03A 1OWAA 5EPYA 1NKZB 1DE7H 2ZP0H 5APQA 3GYMA 1BTUA 4LK4A 3CC7P 2HRVA 1BHXB 1MQ5A 1N7LA 4U3FD 3VP8A 1FOSF 1HRTH 4JYBA 1ZN5A 2IJOB 1M8OB 1D3TB 2ZHDA 1CA0C 1JCDA 4XSKU 1Y3UA 2OC7A 3DCLA 4ZAEA 4EDFA 2OYHA 2KCPA 4CRAA 3RK3B 1U7JA 3L75D 5I46H 3LC5A 5KLVJ 1TNIA 3L72D 2B9BA 2XDJA 3GY6A 4U32A 2IX7C 2WPQA 1C5YB 2JDID 4JYTA 2GCTC 1NC6A 1A02J 1G1IA 3Q77A 4WBAA 1IQLA 1G30B 4N78D 1YWUA 3PM3A 4MNWA 1Z56A 3UIAA 5T1VA 4M3LA 3FAOA 4BAMB 1CO7E 1RTLA 1EPTC 3ODFA 2ZDVH 3SSUA 3RK2B 1XM1A 2D1JA 1SFCC 1UJ1A 1P9SA 1V2TT 5HYOA 3L74D 1PYTC 4IN2A 3C1KA 2YO3A 2ALVA 2GM4A 4UB6H 1AQ5A 1O3JA 1AWHB 1QLED 1C1UH 1CQQA 1P05A 1SFCA 1MKXK 2FOAA 2XC4A 3A85A 1PPJD 3CCMP 2IFNA 1GK4A 4NA7A 1GJ7B 5CBNA 2P3FH 4DZOA 2UUJB 1GBAA 3O8CA 3MUDC 5CCHA 3MO3A 3ZV8A 2GCHF 4DOQA 2GUVA 3AEGC 1IAUA 4E05H 2IFMA 2QAAA 1PGQA 1SSXA 1EZVE 1JRSA 1S81A 2FFDA 2Q6GA 4DT7B 2AXTE 4FOUC 1KIGH 2XOKD 1SGFG 1RGQA 2D26C 2PTNA 2Y6TA 3NCLA 2HODB 1BGYD 4GLYA 4DOJA 3DA9B 1C5VA 1SLUB 3UAIC 1O3PB 1AVYA 1SGNE 3BCCG 1NY22 2B0FA 5FHTA 2ZDLA 3LU9B 5CCGC 5EXLA 3ZZ8A 5J4QA 3UNSA 4TPYA 2J98B 5DK1A 4XFJA 1SGQE 1T6AA 4D7GA 3V2RA 1KXEA 1CSBA 2HPCA 5EQRA 2E74C 1GBKA 2R3CA 5APYA 2XWBI 1ZMEC 2VNTA 3N7DA 1GMHG 1NTMG 2N9BA 2PTCE 3QO6A 1T8ZA 1OXGA 3UB0A 1GBCA 3RXTA 3RM0H 1FZGA 4UFGH 2O8TA 2GT8A 1ZW0A 5KTBA 1J1EC 2PAJA 1SVPA 4H42U 1QA0A 4IN1A 1WRGA 1SQOA 2Y0CA 1W3CA 3RM2H 2HFED 1SR5C 1S2EA 4N6JA 2QM8A 1P10A 3A80A 3O8BA 2WQYC 3PO1C 1D3QB 3TGUG 1BBRE 1FMGA 2V3OH 1SQQE 4D8NA 2BD7A 1TMUH 2SPZA 2GGVB 1L2EA 5KGOA 1DD3A 4AZ2B 2YMSC 2PFEA 5F03A 1O2JA 3B71A 1Z1JA 2JKHA 3K2UA 1MBMA 5KLVD 1GJ9B 2ZU2A 1LTIC 1FPHH 3E0NB 4F55A 1GJDB 4HB1A 3VPKA 2Z9JA 2VGCC 1L0LD 2UUKB 4WY4C 4NPEA 3RXVA 3A7XA 2PKAB 4GOFA 1ELDE 3L75G 1THSH 1WQVH 4K1SA 1GDUA 5GTHE 4A6LA 2ZU1A 3CCVP 3ZYEA 1T31A 2W27A 3ZZ4A 3LC3A 4EYYQ 1JTHB 2XW9A 1Z8JB 3M0DA 1SG8B 3BV9B 3UIRA 2O8LA 3H1JE 1HV7A 1S5LX 2ZT9D 1EXIA 2H1UA 4NIXA 1KQLA 3D70A 2OUAA 2Q6DA 1A5HA 1GL1A 4FUFA 1SQBK 1UTMA 4GHTA 1KB9D 3SV2H 1ZMJA 3SNEA 3TJUA 1O2IA 1TGTA 1GWAA 2GD4B 2J2UA 1WT6A 1DDJA 4E7RG 5HXFA 1LPZB 1TNJA 1Z1IA 1GBDA 1TX6A 5E79E 1GHXH 1NT1A 4B2BA 2VWNA 2VIQA 5I25A 1G2CB 3FZDA 5AW6B 2OYIC 4MQAA 1QBVH 1GI4A 2BMGB 1BDAA 2A4RA 1Y5AT 1CHOF 2PUXB 2HPCB 3SU3A 1EKBB 4NZQA 5BPEA 5GJ4B 4YXWH 5H2FE 1GBTA 1GI9B 1DVAH 1TOCB 3BG8A 3PRBA 3AK5A 5IDKA 1SGEE 1RQUA 3CLQA 2M0BA 1MZ9A 1P84D 3VN0A 1D6RA 1TPPA 2JETB 1KLJH 3MH7A 1P57B 1QFKH 1K9OE 2ILNA 1QL9A 4MNXA 1ZTLA 1BBRH 3LIEA 2NPSC 1SQVG 1O2ZA 4ABGA 2F43B 1TGCA 1Q82Q 3M37A 1HNEE 3BIVH 6CHAC 1XUKA 2NU4E 2I8DA 2ZTZA 4ACAA 3GF7A 2P3UB 5EXMA 3UR6A 2KUBA 1V2UT 1FJKA 3TNUB 1IO4A 3FP8E 4XFQA 1LTJA 1QURH 1C2DA 1LJ2A 4R4MA 3U1JB 1HH0A 2O1KA 1L0LK 3L70J 3E1XB 5EPNA 1SLXB 1AHTH 1SHYA 2FYZA 2HVXA 2QCYA 2W7SA 3TITA 1MTNB 1TAWA 1ZTKA 2EI8A 2EI7A 2Y7ZA 4FU9A 3LW5J 3M5NA 1PFXC 1LGHB 1QA7A 3VB3A 2ZPSA 1V2JT 2YNAA 1C2MA 1GGDB 5C20A 5CHAB 5A0AE 3CMEP 1OWKA 3KQCA 5HM2A 3OTPA 2W8ZA 4H0LC 1NKNA 1PP9D 4OGYA 1CI6B 2ZECA 1IFNA 1IQKA 2WPHS 1G9IE 4JZEH 1A3BH 1WQSA 2JETC 2TIOA 1DSUA 1TOMH 3RXHA 2M3BA 4ABIA 3U1AA 3M9BA 1H0TB 2C93B 2WPSA 2HG5D 4BXLA 4CPGA 1IQMA 1Y47A 1JMBA 1GCDA 1V2NT 1L4ZA 2BD8A 1J8AA 2BVSH 3ESTA 1URQB 5AW3B 3KIDU 4OGQB 3ENSB 5FL7D 3URDA 1NTZD 1IFIA 2C8XB 2VIVA 5JBAS 1SP4A 1BTPA 2A7JA 4X0WU 5CDFE 3E90B 3LW5H 3HKIB 2BX3A 4IS5A 4RT0A 4WH6A 2P59A 1O3BA 2P95A 1LHDH 2C0XA 4PV1C 1C1PA 2ZFQH 4UD9H 1ETTH 5E0JA 4Z1MD 4K8YA 1TRYA 4KELA 3UY9A 1J14A 3P32A 4BXWA 4OGQD 1V6DA 1EP5A 1NROH 4P00A 1FPCH 5DP6A 2RMZA 1O2GH 2QE7D 1W13U 5APSA 5FX5A 5FCRA 4ACBA 1NRRH 1USDA 1RF1C 4I2LC 1NU1J 1FDPA 2UWPA 2PFXA 1BQYA 1NU1G 5EOKA 1PPZA 2P7JA 2QRXA 1YJWP 2W3IA 4UB8H 1JIRA 7ESTE 4JCNA 2IJD1 3NXSA 1VQKP 1DM4B 2B9LA 1CA8B 2VGCB 3RMLH 1O0DH 3F6UH 1RIWC 2RA3A 4YO9A 1UIXA 1TGBA 2NU1E 1WBGB 4B6FA 2XCNA 1CT4E 1SGTA 3KYFA 2H89C 5CE1A 3SGQE 4HH2A 1C1QA 1C5NH 4M9FA 1JY3O 1C2JA 3TDKA 1V2MT 5BRRE 3MHVA 3MTUE 1HDTH 3OY6U 2FFDB 1EOJA 4K35A 5KLVG 1P0SH 1UCYH 1GBJA 6GCHF 1M57D 1QR3E 3SWKA 1J1DB 2Z9GA 2YNBA 4YZUA 5LH8A 1S0QA 1QZ8A 1UK4A 2K9YA 2V7QH 2HLDD 3H1KG 7LPRA 2VBCA 1HJ8A 2I6QA 3SU0A 1T3UA 2PV9B 2E76B 4B75A 1AMHA 2RH0A 1GW4A 4X8TH 3USSA 1Z7KA 2OYOA 3WUVA 1UVPA 4JBZA 1YBKA 5BU8B 1BTZA 2P93A 3ZZDA 5KECA 1A4WH 2BOKA 3L74E 2CGAA 3LGUA 3RXKA 3UTUH 2M8RA 1MTUA 3NUMA 2P1JA 3M06A 5CBOA 3DHKH 4FUJA 4YT7H 2BB4A 2E74B 2GJGA 1PIXA 2A1DB 3M3SA 4CBOA 1M9UA 2LP6A 1C2LA 1PPHE 1Z8IB 3IITA 4KGAA 4ZXYH 4ZKOU 2WV9A 4ABFA 4Y8XA 5HKKD 2OGUA 1EDKA 2F83A 3RXEA 1KFNA 1TMBH 4O3TA 2W90A 3WMM0 1BITA 2O8WA 2YNYA 3ATLA 3EE0B 2BD4A 1FJSA 3VMYA 1OPHB 4H13D 1SFQB 2Y5HA 4ASVA 1ANEA 3ZVBA 1QL1A 2WSSH 1SHHB 1GDQA 3CX5H 1YYCA 3EQ0H 1ZRKA 1FJPA 3P70B 5EIYA 1XUJA 4C7RA 2H5CA 2B8OH 5GXPA 2ZXXA 3L71D 5AVYB 1DY9A 5GTIH 1P09A 3A81A 3FO8D 3UWJH 1FZAA 2Y0EA 1L0NE 3H1JG 1LQDB 1LTOA 1S6LA 2Z9IA 4Q4LA 1AVXA 3SJ8A 3SQEE 3SFDC 4HYTB 1ZGVA 1TPSA 1XKBC 2J58A 2AGIX 3HE4A 3ZZBA 5DJUB 3A89A 1ZP0C 4FVDA 2QXJA 2ANKH 1OS8A 2WYJA 2ZDKA 4AX9H 2RG3A 5AF9H 3A7WA 1V2QT 2JIZD 2QXGA 1F0UA 4X6MA 7GCHF 2BOHB 4ASUD 1QL8A 2FLRH 5TCAA 4ZKPA 4UONA 3A87A 2AMDA 1ZYOA 2GDEH 2RCEA 4INKA 3M9HA 5CCGD 1ZPZA 1MMJN 1SQTA 3H1KD 3SGBE 1HAZB 1P84E 2Z6BD 1F0SA 2Q6QA 3A84A 5CMXH 3WU2E 1SQQD 1XX9A 1BMLA 3BTKE 5CCHD 3SJOA 3VFEA 4JPZB 1AE8H 3PTZA 3ODDA 3MP7B 3E0PB 3TU7H 1CZQA 2JEEA 4GIFA 1PPBH 1TRNA 2WHXA 5APXA 2YMKA 4X2YA 2W6AA 3ATWA 5H4IB 1EQ7A 3OA7A 2JJ2D 2GDDA 1CA0B 4H13C 3F68H 3SWFA 2IZ0A 1Z8RA 1C5ZB 2GVFA 4ABHA 1QBOA 4MN4C 2BCCG 1AFQC 1BDDA 1L0LJ 1SB1H 1Q81Q 3AAUA 4FU7A 1WMKA 4ABBA 1WXRA 2FBWC 3L75E 1UVOA 1WTHD 1EJNA 2Q1JA 4C7NA 1P2IA 1BMFD 2KP8A 3CCEP 1HUCA 1ETSH 2A32A 4NSYA 2XU6A 2IBZI 1PFIA 4D6TD 3CD6P 1NS3A 2C9LY 1C1TA 1RTFB 1EZQA 1TA2A 1LP1B 1YPHE 3H1HJ 2KM0A 1OW7A 3F5HA 3M3TA 1O3LA 1FOSE 3PH0A 1RE4A 2ZHQH 3T29A 1W14U 3DD2H 3ZV9A 1YF4A 2KSEA 4OH8B 1UVSH 2KIKA 1GMCF 4GCHF 1L2PA 5GTIE 1ELTA 3SJIA 1C5MD 1KORA 1AU8A 3HK6B 1UTPA 3CC4P 1O2KA 4K60A 5AVUB 3BF6H 2FOEA 3C1LA 3GCHC 1FONA 3V2PA 4H44C 1TONA 2XCFA 2JKVA 3KL6A 2PLXA 1Y9BA 1NRNH 2W3KA 2A5KA 2W6BA 2BEQD 3B4SA 1IFPA 1O3AA 5GCHG 1S83A 4U30A 2FYNC 3A3YB 1BCCE 1P04A 4WWYA 4E06H 2VWMA 1N86A 3NRLA 5C39A 4EI2A 3DUXH 3KF2A 1S6FA 4LGDE 3AECC 2QV1A 1X8YA 1NFUA 1TBZH 2E75C 2HPQH 4DIHH 2WV4A 2WZQA 1UCYK 4X1PU 2OK5A 1TX8A 4DGJA 4K8BA 2FOMB 3QTOH 4FUIA 3B8EB 4PJ0E 3RXSA 2FYNB 1VQ5P 1SGFA 1H8IH 1SQPK 4RKJB 2OD3B 1GL2A 3ELAH 3OJAB 2XBWA 1FZCA 3EFFK 5KJ7A 3VMXA 1PQ8A 3RP2A 3LKWA 2V6NA 2CV3A 1TGSZ 1RE3C 4PJ0H 1KMIZ 2P10A 2FFDC 3CMAP 1OP0A 3ZYDA 1AV1A 1FAXA 3FWLA 2QEXP 1ZHMA 1HAOH 2AEJA 3D65E 2YIUB 1OW8A 2KOGA 2WUCA 3CS7A 2FPZA 3BASA 3EA7A 3HGPA 2ZPRA 1EXJA 1RIWB 1PQ5A 3D6ZA 2AMPA 4DIIH 1DIPA 4IBLH 2H2ZA 5L2YH 2J5UA 3H1HD 1QEXA 1USEA 3B5ND 3H1HE 1S72P 2O8MA 1M1JA 5AFYH 1ZSJA 3SU4A 3D49H 1U6QA 2ZIQH 3T97A 1HLTH 4TSFD 4K3AA 2QSIA 1QX8A 4GODA 1GI1A 2G4UA 2WYGA 2K8IA 4DG4A 4CRFA 1M1JC 1W10U 4AN7A 1MZDA 3GDVA 1XVOA 1TALA 2SGFE 3T28A 2FYUK 4KKDA 1BE3E 3I78A 4X1RU 4H13B 1IHTH 3ATKA 3CCQP 1SLWB 4NSVA 4R0IA 1MFZA 5C3NA 4I31A 4N3YB 1TFXA 1VITH 1KB9E 3CS0A 1CT0E 3DFJA 4PV1B 3ZZ3A 2DE8A 1WU1A 1PGJA 5T3HA 3SOSA 5F6MA 1AVOA 1UMAH 2CF8H 1EPTB 4D7FA 1O2PA 1QB1A 3AE9C 4WMFA 3CCLP 5DP9A 3CP7A 1CBWC 1VCPA 2PUQH 4AOQA 3F9GA 1NU1K 5DP8A 5L2ZH 3IN6A 2G4TA 4PD4I 1V2OT 1C4Y2 4Q2KA 1TU3F 3AE1C 1P3EA 1FIWA 1SQRA 1SVFA 1W0KD 4NFFA 1O5DH 1KTSB 1IQNA 4RKOB 3VYIA 3W67A 1C5XB 2P8OB 4ISOA 1AQ7A 1N7SD 3F2GA 5HIZA 3M5OA 3SU2A 3E91A 4DW2U 1V2WT 2IPHA 5EODA 2WPKS 3SU1A 4FUEA 2OTLP 3EDXB 3S69A 1NO4A 3RXIA 3BG4B 4WY4A 2E75D 3CCUP 4LLHA 4UB8E 1C5SA 1C2GA 1KXAA 1ZHRA 1BTXA 2R5BA 1HIAA 1SQXG 1DWCH 1K21H 4AYCA 1O3NA 1Y3VA 3PLKA 1LTSC 2B87B 3L37A 3FVFB 1LWUA 4NWLA 5FBEA 1AWFH 2YXQB 5B66E 3FOAA 1P84I 1A0LA 4WXIA 1L0LG 1OVUA 1XTCC 3RL0g 1LHFH 1V3XA 2AGEX 2QF3A 2EEKA 2ZKSA 1P02A 3GISB 1XUGA 2BASA 1AA0A 3MUDA 1T4UH 1T8MA 1TRMA 3GYLB 4U3FE 4J1YA 1N8OB 1SFCD 2JJLA 1ESTA 1NFWA 2F9UA 2HWLB 1AZ8A 4FETA 6CHAB 2YKPA 1O3FA 3FP6E 2NU0E 3MNCA 5BVZA 1PQ7A 1C5UA 4OVNF 2I1JA 3RBXA 3UNRA 3CI9A 1O2SA 3E1RA 3ZVEA 1O38A 4BWNA 1JY2P 2Q3IA 3OY5U 1O3OA 5DN6D 1DOJA 5E2OA 3KYQA 4XD7D 1C5QA 3L71G 3TH2H 1DWBH 1OX3A 1KB9H 1K1IA 3ATIA 5EW2H 1FU1A 2A06D 3JZ1B 2STAE 5GPIB 4ISHH 5EGMA 1RE4C 5TISE 2HVYB 1GCTB 2BD2A 2OYHC 3A7ZA 3V7TA 5CJ0A 1XTGB 1R5SA 1L4DA 4B71A 2VU8E 1E36B 2PWXA 1EJAA 1EUFA 1ZMNA 4WWIA 1S3JA 1YLNA 3OTJE 2NPSA 2OYIB 1JXPA 4KP0A 3OSYA 3STIA 2XZRA 3ZZ6A 3F1SB 5EFWB 1GVZA 3QK1A 3HUSB 3TGJE 2BD9A 2KCOA 1FZCB 1KILB 1DICA 3LOXA 1Y5UT 4PD4E 1AVWA 1UO6A 3RXMA 1F7ZA 3V3MA 5APTA 1QVFO 4MLFB 1N73C 2P3TB 3SU6A 4CRCA 3S7KB 2OXSA 2SGAA 4BANB 1AFEH 1WAYB 1HVVA 1D3PB 2ALPA 4D76A 1BDCA 1IQGA 1SGRE 1OFCX 1EZUC 2PW8H 3TJNA 1ARBA 2FODA 3NPSA 3O8DA 2MKVA 2AEMA 3RGUA 3NFQA 3VMAA 1A3EH 2JH0D 4TPIZ 3V12A 2KYVA 3M5LA 1J2JB 1HXFH 1KDQA 4TT3D 5KJ7C 1SQVJ 3D23A 1SQBJ 1SOZA 2ASUB 4OS1A 3HATH 3KZIE 4U01A 4BTTB 2P58A 5CHXA 3AW1A 1TNKA 1YCPM 2HALA 2DW3A 2UWLA 3F0OA 4JYVH 2A4OA 2BDIA 1DWDH 4GPGA 2VIPA 2L91A 1HAVB 1Z6JH 3LT3A 1HJAC 1MD7A 2OQQA 3L74G 1K22H 1VITF 3SWYA 1HJ9A 3VGCB 1Y3YA 1K9MQ 2IOTA 2W26A 1E0FD 1S5LE 1A5GH 1BJUA 3VB4A 3TGKE 5TCCA 1K1JA 4I32A 5C2ZA 2ZGBH 5APVA 2SGQE 1FAVA 2Y7XA 2K88A 2BQWB 2XC0A 1FLEE 1P9UA 1W12U 2QIWA 1NU1D 1CW5A 1SQQK 4GDOA 1Q31A 1WDIA 2DE9A 3SV8A 3MZWB 5JYIA 2V3MA 3KHVA 5HGGA 4AFZA 1UK3A 2BEZF 1Y8AA 2GV6A 4JK5A 5TJHA 2AEFA 2RFKC 3RBZA 1O30A 2FOCA 5AHGH 5AVRB 1Q2WA 3L36A 1YPEH 4ZUHA 3Q1MA 3WW7A 2N1TA 1L4AD 2P16A 3VG8A 1S1CX 4Y7AA 3TK6A 2CF9H 1RF1A 2YXRB 1V2KT 2JR8A 2G51A 4ZCNA 2N1TC 5APWA 3H5CB 4R8TB 3TK5A 1T7CA 5C0TA 1P2MA 2D2CB 1O35A 2CMYA 3VP9A 4H0LB 5AVVB 1YYY1 4JYCA 2CJIA 4TYDA 5HMAA 1EJMA 8LPRA 4LC1A 2M2AA 1V2RT 3VEQB 2ZCKP 1SS1A 2E43A 1TYNA 4A1TA 2FS8A 2LR2A 3Q3XA 2A45I 1A0JA 3HRNA 2A45G 5KLIC 2KS1B 1LO6A 2PGQB 3H09A 2HPPH 1LCYA 4UB6E 1R8EA 1Q3XA 4BNRA 5KEDA 3A82A 2ZU4A 3KEEA 1K0HA 2C3SA 1MU8B 1W11U 4JZDH 2K3RA 2Q6FA 5GTHH 3M7QA 1S0RA 1ZGIA 3QLPH 1SQBD 4X6PA 3H1KJ 3SUDA 3K65B 1VITG 3E16B 2IYOA 3GY4A 3G9RA 1EQ9A 1HWTC 2WSFH 1N7SC 3BSQA 1GHVH 3ZVAA 4JQ0D 2IZ1A 2VH0A 2ZO3H 2Z7FE 3R0FA 3QX5H 4INHA 2MJZA 1QL2A 3SBKA 3NXPA 1K73Q 3F9HA 1EDIA 5E79H 4DY7B 2BXTH 2WT7A 1FE6A 1NTKK 3T5FH 1GVKB 1J17T 2J59M 1A1RA 1JWTA 2HYNA 5L8RJ 1TWXB 1V2VT 3BTEE 2N1TD 4IL6H 1W7GH 5KAFE 3MNBA 1YPJH 1O3DA 1RFNA 5DP4A 1NH4A 1UTQA 1O2NA 3DSGA 1L1NA 3AEAC 1VL2A 1DX7A 5LGOA 3L71J 1DFPA 1O2QA 3MHWU 1SQVD 3WU2H 2F9BH 1FIZA 1D3DB 3GY8A 4W7ZA 2BDAA 1NU7B 1GMDF 1BJVA 2W5EA 3O6QA 3P8CD 2CHAC 3EYDA 4HGCA 2G5VA 3FN8A 2K9JB 1AQTA 3F2HA 5JDUB 1ZZZA 3B23B 3O8RA 1Y8TA 3PWCA 1O5GH 4DJGA 1UIIA 3EA9A 4IC6A 2V4HA 1L1JA 4MDSA 4BOHA 4E7NA 1PJPA 1XXFA 1WSSH 2YKQA 3A8CA 3DFLA 1OKXA 1VCWA 2Z5HA 3H1IG 3PLNA 5KKZB 1J15A 3P92A 4XOJA 5A0BA 5EXNA 3IWMA 1BMMH 2J97A 4B73A 1VKYA 1FAKH 1AI8H 5AW4B 4Z6AH 1LTBC 4GT1A 3GOVB 1GJBB 4NG9H 1GJ4H 4U3FG 4KTUA 4LOYH 1VF5C 1ZR4A 3H1ID 4I86A 3L74J 2QYIA 3MH4A 2N9YB 1F0RA 3CWBJ 4HKZH 4NCYA 3TH4H 1KB9I 1RF0C 1OW6A 2VH6A 1JRTA 2YMSB 2QGRA 1BTWA 1LTJC 1M90Q 3QGNB 3RC5A 3H25A 1URQD 3AVZA 3GCTF 1T4VH 5FCKA 3D6YA 1ID5H 1VGCB 2FDAA 2NZ2A 4YXWD 4BAOB 4Y11E 4KTSA 1QY6A 3PB1E 2FYUG 4Y0YE 3KCGH 2BLWA 3HE5B 3PRJA 1EOLA 2XKMA 1EC5A 1TQ0B 3CNRA 2C8WB 2ANMH 4XA4A 3MO6A 4OS2A 5EJ1A 5LPRA 4P02A 2R2MB 2P67A 1E37B 4K5ZA 4BTUB 2B88A 2RDLA 3PMHB 4IGDA 1JEKA 1GHAF 2FOBA 4H6SB 2OQ5A 3H1KE 4XE4A 4BAQB 2BVXH 2F4LA 1MBQA 5AVZB 3RK3E 1CGHA 1PL5A 4L74A 1GI2A 1QGKB 1KXCA 5K5GB 2GP9B 3UFAA 2HOBA 1SGIB 4MPXA 1C1VH 4RSPA 2KNCA 3QTVH 2QXHA 3K6YA 1MFTA 1KZUB 2GUSA 3V6IA 5L30H 3A0HE 1EDJA 2QJYC 5JPMH 1NM6A 1OSSA 2M3EA 2K37A 2FTMA 2GV7A 1OVRA 1GVLA 2H9HA 3MFJA 3OAAD 1GZLA 1LT9A 2CPSA 1AJYA 1E1RD 2VIDA 3VB7A 2VVCA 2BLVA 1NU9A 1L4AB 2ZFCA 3L72E 1GBMA 1YQ4C 1T3JA 2KAIB 2AGGX 4TLFA 1NN6A 1DSTA 3HD7D 1XVMA 1YIJP 4Q7XA 3S9BA 5KAIE 1H0TA 1O2YA 5DSFA 1KXDA 3TGUJ 4CH8B 3Q3YA 2VIOA 1THRH 1ELAA 1ELBA 4MPWA 4X1NU 2RA0A 3A2AA 2H9EH 1FX0B 3ZVFA 2BD3A 1NO9H 4MG3A 3NMDA 1OIPA 3N99A 4X1QU 2AHME 1AB9B 2KB7P 1GL2B 2FEQH 1L4AC 1YC0A 1TNHA 3W68A 3HD7A 3HTKA 1JNMA 3SQHE 2WSCJ 1DXWA 2O01N 1EATA 1NPMA 4ZHMU 3VXFH 1YPLH 1F5KU 1VJAU 3T27A 2YO2A 1KILC 3BTHE 1LHGH 5EU8A 1ESAA 4ZMAH 1W7XH 3SN8A 1QQUA 4MNYA 1ZRBA 5T6FA 2QY0B 1RY3A 1K05A 2WTYA 4GAWA 2ZGHA 1G3CA 2G52A 4CRDA 4H0LD 3V4WA 3AE7C 3TYYA 1HGTH 1HAYB 1QJ1B 5JBCS 1O34A 1AE5A 2QVAA 1QTFA 4JMYA 4IMZA 4F4OC 2J95A 1NTZG 1P01A 2ZCLP 3GCOA 1GI7B 3LONA 2IYPA 4FUCA 2TBSA 2Q7CA 2IBZE 4MPUA 1VGCC 1K1OA 4BAKB 4ZKUA 4YM9A 4WB4A 1MQ6A 1V2ST 2A2XH 3BRVB 1V2PT 5PTPA 1QBNA 3M91A 4VGCB 1X9VA 2TRMA 3Q5RA 2BY8X 5F8TA 3RL0C 2OCVB 3K6ZA 3VOPA 3MU1A 1LTTC 4AG1A 1BCUH 3CXHD 3IF4A 3AE6C 4HG6A 5FBIA 1NBMD 3TIUA 1NBME 2WT7B 1VF5B 1NHLA 1C5LH 3UQVA 2IBZG 3CX5I 1BGYE 1TA6A 2V35A 1X79B 1HBTH 1A2CH 3FX0A 1GBHA 1L0NG 2Y9YA 1FZFA 2J9NA 2JO1A 2XXLA 4SGAE 2IPQX 3H1IJ 1HGVA 1EASA 1JCCA 1RS0A 4THNH 5FAHA 4NZLA 3RL0B 1WV7H 3IAOA 3LGWA 5AVQB 1O5FH 1TNLA 2C8ZB 3NWUA 3HK3B 3I5CA 1MAYA 1UHBA 2WMMA 2BVRH 3A7VA 1QVGO 2WPIS 4ISIH 1YITP 2B87A 2RDEA 3D71A 3ZVDA 3H32B 5DP5A 2P8OC 2FTLE 3T2NA 4BRYB 1IHSH 4H44D 1YI2P 3GCNA 2D2CD 1O5EH 4QT8C 5L6NH 4AB8A 2FYUJ 1LMWB 3CENA 1YJNP 3O8ZA 1LPKB 3EFGA 3PV4A 1SGDE 3HE4B 2OBQA 4UDWH 1AIXH 2FI4E 1IFDA 1C1SA 1PPFE 4MPVA 3L4FA 1CT2E 1ABJH 3C8VA 3LPRA 1HUTH 3RXQA 2E5TA 1G36A 2AS9A 1JOUB 2BDYA 4ZHLU 2Z9LA 2O3JA 1SQQJ 1LDTT 1YPMH 3CWBD 1ZOMA 2EI6A 1FS0E 2V7QD 5JBTA 3ITIA 3B5NC 3GG2A 1O3GA 2ZU5A 4I8GA 2GMTB 1O5CB 2FM2A 1O32A 3FP7E 3NZIA 4ABDA 1N7SB 1M1JB 1OWEA 1GL2C 3TF5A 1XKAC 5JB8S 1AB9C 1ORFA 5B5EH 1JY2N 3MNXA 1KYOD 2XWAA 5C5NA 3N7OA 1GI5A 4O3UA 3UUZA 1EZVD 3BCCJ 1C5WB 3U9AH 1XUHA 4I8LA 1IJDB 1W8BH 2NU3E 4WMDA 3RMMH 3BEIB 3IR9A 3SJKA 3H6PA 4L76A 1SQXK 3CXHI 3SU5A 3RXLA 1VCQA 3GLMA 5CCGA 2PRRA 3L73G 3CCJP 2ZGCA 4CRBA 3Q5SA 2QA9E 3QWCH 4UFDH 4DCDA 2F91A 3HTKB 2YOLA 3LGTA 2AXTH 2KXPB 2D2DA 3BTWE 3ABVC 2KSJA 2NU2E 4ZROA 1SQXD 3CX5E 3RXGA 4IFFA 1GW3A 1PPGE 2KFWA 1VQ4P 1TMTH 2QJYB 1PP9E 2D2CC 2WPRA 5ETXA 3RUOA 7KMEH 3FFGA 1W2EA 1LT9B 4Y99B 2XNXA 1A46H 1GMHF 1ZSLA 1WCZA 2O9QA 2ZFFH 2EC9H 4GCHG 1MABB 2ZF0H 1KC8Q 2BD5A 3NKKA 3KQDA 4FUDA 4MTBA 2AERH 1TBQH 4Y10E 4K1EA 2WSEH 3DT0H 3CXHE 1E38B 1P2OA 1OHHD 2OTKE 1RXPA 4CHAB 2E75B 2WINI 1D6WA 2F9PA 3L6PA 4JZ1A 1VPCA 5DJTB 1MAXA 5AW8B 1UTOA 1W0JD 5AW5B 5GNDA 3TLOA 1N73A 3RXDA 1FZEA 1YLDA 2WPLS 1HAPH 1EX3A 4TT3H 1MTVA 3M35A 3A88A 2Y5FA 2ZCHP 4YOIA 1GG6B 1ZTJA 2QJPC 1J1DC 1ELFA 2IPPA 1LQEA 3OE7D 4H44B 1B7XB 1NFYA 2V7QJ 4I7ZB 2ZWLH 3FANA 3T25A 2QF0A 2W6JD 2KR7A 5JB9S 1DLEA 1GTWA 1HJAB 5EJLA 3RK2D 3L73E 1LTGC 4SGBE 1O2MA 1O2OA 2IDBA 3L75J 1ABIH 4JF7A 5IK2D 3V2QA 1BCCJ 1KILD 2ZHWH 1NAFA 1NTKE 3E7KA 1YHQP 1IC2A 1HGZA 4R4LA 1BZXE 4ZMDA 1NFXA 3BTFE 2R3SA 5B5EE 4C7NB 3HE5A 3EQ2A 1ETRH 1J16A 3OEED 1GDNA 1YP9A 1SBWA 4D9RA 5F8XA 1OWIA 5KKZC 2OC0A 1GU4A 1EAXA 3EA8A 1ANCA 1MKWK 1A5IA 3PMJA 4WH8A 2ODYB 1O3EA 2O01J 3BIUH 2ULLA 1L0ZA 1VR1H 1QNJA 5DP7A 2E42A 2H6MA 1W2BO 5SGAE 2GX4A 3N7EA 2V0BA 1SI5H 1GU5A 4JZFH 1TB6H 3MTYA 1C5OH 2QM7A 1YPHC 4I8KA 2SGDE 1H8DH 1E1QD 5DP3A 3D62A 3S9CA 3KDPB 3LDXH 1HF9A 2Y0DA 4NIVA 1LWUB 1SKYE 3H1LE 1YLCA 2HGTH 2XTTB 3AE5C 1VQLP 1O37A 4OGXA 4Z0KA 2C4FH 1LKBA 2HLOA 3RXPA 3CCSP 1NRSH 2FIRH 1OXZA 4L73A 3PROA 1C5PA 2ZTXA 4X1SU 4KJMA 1K1LA 3G01A 3RXCA 4IW4E 2FS9A 1IK9A 2HODA 3K5BA 2P2UA 2A45H 1P11E 5DPAA 1H8ED 3P8CE 2ZFSA 1LVOA 1A61H 3UOUA 6GCHG 1EZVG 3OAKA 5C94A 3F2FA 2K1QA 4C46A 3OEHD 4BXSA 1ZXGA 3H1JD 1KXFA 4A7IB 3F9FA 3L73J 3GHGB 1QB9A 2BXUH 1GBIA 2WV5A 4JK6A 9ESTA 1HYLA 1P2KA 4K2YA 5DKMA 1JM0A 3KQEA 4K1TA 4B6EA 2JWAA 1E35B 1OWJA 3MU4A 5E0GA 3RXRA 1C1MA 1N8OC 3LIWA 3RXOA 1RHZB 3U8OH 1QHRB 1JOCA 3R3GB 1HBWA 1BE3G 3ITKA 1D4PB 2BX4A 1XMNB 3KQGA 1RJXB 1GBLA 3SUFA 2O8UA 2TGPZ 1O2RA 2HNTF 4I1LA 1O5AB 2SNVA 2WPMS 5KLIB 3ZZ9A 1FUJA 2QG4A 1VQMP 1AKSA 1XUIA 1H8AA 2BQ7B 3OX7U 2ZNKH 3MQKC 1QJ7B 3H7TA 1IQEA 2BCCD 2FLBH 2POHA 2ODPA 3P95A 4W80A 1O2LA 2Q9IA 1QRWA 2XRCA 3BG4C 5FX6A 2Y82A 1Q7YQ 1K04A 5EJZA 4BTIB 1FY1A 2WVRA 1BOQA 8ESTE 3L35A 2G8TA 3TJOA 3M9QA 1NTKD 2ZT9B 5TISH 2FXRA 1GI8B 4D6TE 1QL7A 2QA4P 1YBWA 1UTLM 3QGJA 1SFIA 1SQPJ 3U28C 1UTJA 2F9VA 1IQFA 4XE5B 1BIOA 4X8UH 4GHQA 3MD0A 1F0TA 3PMBB 4B2AA 1INCA 1NZQH 2H5DA 1M56D 2G81E 3A86A 3PV2A 2IBZD 3JC22 5FPTA 1DT2A 1G3DA 1LVBA 1O33A 1SOTA 1L0ND 3AE3C 3SUEA 3SV6A 1W2KH 3W95A 1N2DC 1KTTB 1AO5A 2G8YA 3IG6B 5TJXA 2UUYA 1YJ9P 2R0KA 4WF8A 5K7RA 3ZDMA 1QIXB 3GDSA 3PLPA 1S9KE 5GDSH 3FGAD 2OTJP 1E34B 3AEBC 2BLOA 3BEFB 3BTME 3V4QA 1KYNA 1KQFB 1GJ6A 2ZDAH 5JBBS 4JZIA 5CJ4A 1OVVA 4YOGA 1JIMA 3QZQA 1NTMD 2J4IA 3ZIAD 3S0NA 1H4WA 4M7GA 4HI3A 1S5SA 1WYKA 1NWQA 3P6ZB 4WVPE 5C1YA 1LT1A 3MH6A 3NTNA 8GCHG 5IYTA 1D9IA 1KYOH 2W7UA 2WSCH 1CSOE 2LNCA 3U8TH 5AVSB 3TNUA 1YCPK 4I7ZC 4A92A 1KTMA 1TX7A 3TH3H 4Q80A 1M1KQ 1EZXC 1O2WA 2A5IA 4OS4A 2Z94A 1GG6C 3Q76A 1FZCC 3SORA 3EGKH 1KYOE 3LJJA 1N7SA 2BDGA 4Q7ZA 1NRPH 3HPTB 3KNXA 1NTZK 1MCVA 1RE3A 2ZYAA 2FO9A 4AG2A 3MWIU 1SQPD 1MV8A 2NPSD 1NTZJ 1GPZA 2XBXA 4IOIH 3IFMA 1THPB 3U1CA 3U98H 1IQIA 4U2WA 3F89A 1GCTC 1VQ7P 1BGYG 2ZT9C 3UQOA 3SNBA 3TGIE 2A7HA 3CL3D 4U3FJ 1BCCG 3MNSA 4Z1MH 4Y76A 4Y99C 2ZG0H 2BQ6B 3LH1A 4H6TA 2R3YA 4RESB 1B5GH 1UK2A 1X0TA 3SW2B 3SV7A 1URQA 2Z3CA 5ABWA 2XV5A 3WUTA 3ZZCA 4ABEA 2EA3A 5CHAC 4FVBA 5GCHF 2G5NA 3RXFA 1EP6A 2QJKC 1SL3A 1S85A 3H32A 2PSXA 3RC4A 1KV4A 4D9QA 3A7YA 1NU1E 1P3CA 3A8BA 5C0UA 1MUUA 2Z3DA 2Y81A 2J38A 6ESTA 1JB0J 2ZJSE 1IOEA 1GHBF 2C90B 1HTLC 2FYUD 1SQVE 3U8RH 5EW1H 5EQSA 1BRBE 3RXUA 2R5DA 4A7PA 2IN2A 2BDCA 3P17H 2BDHA 1KILA 1T2KC 4B74A 1FV9A 1GJ5H 1AFQB 1VQNP 4LXBH 2C9NY 4XRNA 2GMTC 2PR3A 1EB1H 1BTHH 1N6XA 3SUGA 1ACBE 1YPGH 3L72G 2ZZUH 4K3JA 2PKAA 3CXHH 4WJG2 3SGAE 1ARCA 3SNCA 1JY3P 1MZAA 1LHCH 1VQPP 1SFCB 5AW2B 3VMZA 1YTZI 3P7KA 2ZFPH 1O39A 1MD8A 1EPTA 2SNWA 2WSFJ 3HGNA 5A8XA 2JJ1D 4N78E 1ELGA 1T8NA 1KILE 4HJGH 2WPJS 5AW7B 1C1OA 4J2YB 1DD4A 3TK9A 3S9AA 5KAFH 2KCYA 2XBVA 1KFMA 3PLBA 1CE5A 5EQQA 2FX4A 5C1XA 3MYWA 4ISNA 4FUHA 2VIWA 1LWUC 1CBWB 5E0HA 1G1JA 3GY2A 5DG6A 2AH4X 1CVWH 3LH3A 4ABJA 2WSSD 4F48B 1SQBE 2Y5GA 1BE3D 1T8OA 3PTBA 4GKGA 2HR3A 4AQRD 2BHGA 4AC9A 4NA9H 2F3CE 4GOEA 1F5RA 1P84H 2A06G 4WY4D 1FY5A 2LXCB 2K1AA 1OZHA 2FXMA 5AW9B 3Q00A 8GCHF 1H9LB 1FDIA 1DUAA 1K2I1 1YY3A 3PRDA 1NYHA
chains in the Genus database with same CATH topology
3HUSC 3RK2C 5AW1B 4C7NA 1RY3A 2WTYA 2KP8A 1HUCA 3V4WA 2XU6A 3TYYA 1PFIA 2OYHB 4WY4B 1JY3N 3R2PA 3II6A 4O9BA 2C9LY 3GHGA 2YKOA 2R32A 1FOSE 1RE4A 1DH3A 4OH8B 1IFMA 2Q7CA 4ZKUA 5AVUB 3RK3C 1S9KD 4WB4A 3BRVB 3V2PA 4B86A 3M91A 1X9VA 5AW0B 1SQVK 2O1JA 4I6MC 3RL0C 3VOPA 1LTTC 2W6BA 2VRSA 1L4AA 4IFMA 3A3YB 3N7NA 2WT7B 1GK6A 4AUWA 1NHLA 1N86A 2ZXEB 1X79B 4EIJA 1J1EB 2WWWA 4LGDE 1OWAA 1X8YA 1NKZB 1FZFA 5APQA 3V2NA 3HUSA 1HGVA 4EOTA 2YMYA 1HJBA 3B8EB 1N7LA 3VP8A 1SQPK 1JCCA 1FOSF 1GL2A 4JYBA 1ZN5A 1T2KD 3RL0B 3OJAB 3HD7B 1JCDA 1FZCA 3MIWA 5AVQB 5KJ7A 3VMXA 3I5CA 2OYHA 3RK3B 1RE3C 2FFDC 1H88A 2XDJA 2O01H 2IX7C 2WPQA 3H32B 2KOGA 3BASA 1A02J 1G1IA 3PP5A 4WBAA 4N78D 3O8ZA 2Q5UA 3EFGA 5APUA 3HE4B 3B5ND 1Z56A 3UIAA 3RK3D 1M1JA 4M3LA 3T97A 1IFDA 3L4FA 3RK2B 1M1JC 1RF1B 1SFCC 2FYUK 2YO3A 2L5GB 1MFZA 1ZLLA 5AVTB 2GM4A 1AQ5A 3B5NC 4N3YB 1SFCA 2IFNA 1GK4A 1FDMA 4DZOA 1N7SB 1M1JB 1GL2C 5CCHA 2LKMA 1JY2N 2GUVA 2IFMA 1NU1K 2FFDA 1IJDB 3IR9A 3H6PA 1SQXK 3G3ZA 1SVFA 2HODB 5CCGA 3VYIA 4DOJA 1N7SD 3HTKB 2CPBA 5CCGC 1A02F 2KSJA 1NO4A 2I1KA 4IFFA 1GW3A 4WY4A 3V2RA 4LLHA 2WPRA 1CSBA 2HPCA 1W2EA 1LT9B 4Y99B 2XNXA 2R3CA 5APYA 2R5BA 1FBMA 2Z4EA 2N9BA 1T8ZA 4AYCA 1LTSC 3L37A 3N4XA 1LWUA 1FZGA 2WSEH 1JO5A 5BU5A 3B5NA 1XTCC 1VPCA 5KTBA 1J1EC 2PAJA 5AW8B 5AW5B 1N73A 1WRGA 1FZEA 5AVXB 2BASA 3MUDA 2HFED 1SFCD 4N6JA 2JJLA 2QM8A 1GD2E 2YKPA 1J1DC 2IPPA 1NTMK 5BVZA 1G2CA 2I1JA 5AVWB 3CI9A 2NPSB 2OYIA 1JY2P 2Q3IA 1GTWA 3KYQA 4IFDK 3RK2D 1LTGC 1YTZT 1DEBA 4JF7A 3V2QA 1KILD 1FU1A 1NAFA 1LTIC 1IC2A 1HGZA 1FZBA 1RE4C 4C7NB 3HE5A 3EQ2A 4WY4C 2OYHC 1AFOA 1M7LA 5CJ0A 1XTGB 3A5TA 2NPSA 3TSIA 2OYIB 1GU4A 2XZRA 3HUSB 2W27A 2Z5IA 1FZCB 1JTHB 1KILB 3M0DA 2H43A 1KQLA 5APTA 1N73C 2C0WA 1SQBK 2E42A 1GU5A 1HVVA 1RF0A 1WT6A 2QM7A 3KDPB 1LWUB 3C9IA 3NFQA 1G2CB 5AW6B 2HLOA 2OYIC 1OXZA 2KYVA 1J2JB 2HPCB 5KJ7C 1H89A 1IK9A 2HODA 3CLQA 5CCHC 5CHXA 2P2UA 2A45H 1MZ9A 3VN0A 3BATA 3P8CE 1VDFA 3OAKA 3SWYA 3LIEA 2NPSC 4C46A 2N1TB 3GHGB 5APVA 1GL2D 1FAVA 3BRTB 3M0DC 3M0AA 1CW5A 1SQQK 1E5WA 1FJKA 3TNUB 1IO4A 1CI6A 1LTJA 1JOCA 1HBWA 1HH0A 2O1KA 1L0LK 3KQGA 1URQC 2FYZA 2OARA 5AVRB 3L36A 4I1LA 2N1TA 1NOHA 1L4AD 1LGHB 1RF1A 1H8AA 2N1TC 5APWA 2POHA 2WITA 4W80A 2WZ7A 3VP9A 5AVVB 1NKNA 4JYCA 2Q9IA 1CI6B 1LTJB 1IFNA 4LC1A 5KLVK 2E43A 3L35A 2A45I 3HRNA 2A45G 3M9QA 2M3BA 3U1AA 3M9BA 3MGNA 2WPSA 2HG5D 1URQB 5AW3B 1IFIA 4XE5B 3MD0A 1SP4A 2H7HA 3LW5H 1HWTC 2WSFH 1N7SC 2C0XA 3GHGC 1N2DC 1N73B 3P32A 2MJZA 1QL2A 1S9KE 1SLQA 5APSA 2H8PD 1RF1C 4I2LC 3RL0D 3V4QA 2WT7A 4W7YA 1NTKK 5CJ4A 2P7JA 2J59M 2HYNA 3NXSA 2N1TD 3P8MC 1NH4A 1GDTA 1JTHA 1DX7A 1NWQA 2FKWB 3NTNA 3V5BA 4HH2A 1JY3O 4W7ZA 3MTUE 2WSCH 3P8CD 2FFDB 5AVSB 3TNUA 1J1DB 1FZCC 4KHXA 1N7SA 2YKQA 1NTZK 1T3UA 1RE3A 2Z5HA 1MV8A 2NPSD 1GW4A 3IFMA 3U1CA 5AW4B 5BU8B 1LTBC 4GT1A 1ZR4A 2M8RA 3KPEA 2P1JA 3M06A 3CL3D 1RF0C 5KJ7D 4Y99C 1LTJC 4RESB 1JMMA 1IFJA 1URQD 3A7OA 1JY2O 1URQA 2XV5A 1KFNA 3WMM0 3H32A 2YNYA 3HE5B 2XKMA 1MUUA 5CMZA 4XA4A 3VMYA 1L0NK 2P67A 1LTAC 1HTLC 1QL1A 2KLVA 1YYCA 5AVZB 2R5DA 1FJPA 3TK1A 4C7RA 5AVYB 1KILA 1T2KC 3BVHA 1FZAA 2C9NY 1JUNA 2PP6A 1LT9C 1KZUB 2GUSA 3U59A 4HYTB 3VTPC 1JY3P 2J58A 3HE4A 1GZLA 1LT9A 2CPSA 1SFCB 5AW2B 3VMZA 1YTZI 3P7KA 3LIDA 1L4AB 2ZFCA 1ZR2A 1T3JA 3HD7D 4N78E 5AW7B 4ZKPA 1KFMA 3M9HA 3A2AA 5CCGD 1LWUC 3NMDA 1G1JA 1ZV8A 3E1IA 5CCHD 2KB7P 1GL2B 4GKGA 4AQRD 1L4AC 3HD7A 3HTKA 1CZQA 2JEEA 4GIFA 1JNMA 5APXA 4WY4D 2W6AA 3B5NB 2FXMA 5AW9B 1EQ7A 3OA7A 3HD7C 2YO2A 3SWFA 1KILC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCH C;  3RK2 C;  3P8C E;  5CCG A;  1N7S D;  1N7S A;  2NPS C;  4WY4 B;  3HTK B;  2N1T B;  5CCG C;  2NPS D;  1GL2 D;  3M0D C;  4WY4 A;  4OH8 B;  2M8R A;  3RK3 C;  1URQ C;  5KJ7 D;  3B5N A;  2N1T A;  3RL0 C;  3VOP A;  1L4A D;  1URQ D;  1L4A A;  1URQ A;  1NHL A;  2N1T C;  2HFE D;  1SFC D;  4W80 A;  2WZ7 A;  4LGD E;  2YMY A;  2NPS B;  1GL2 A;  3RL0 B;  2HG5 D;  3KYQ A;  3RK2 D;  3HD7 B;  1URQ B;  5KJ7 A;  1KIL A;  4JF7 A;  1KIL D;  3RK3 B;  2PP6 A;  4WY4 C;  2XDJ A;  1XTG B;  2KOG A;  1N7S C;  2NPS A;  3TSI A;  1SFC B;  1L4A B;  3PP5 A;  1T3J A;  3B5N D;  1JTH B;  3RK3 D;  1KIL B;  3HD7 D;  4N78 E;  2H8P D;  3RK2 B;  3RL0 D;  5CCG D;  4W7Y A;  1SFC C;  1HVV A;  5CCH D;  3B5N C;  1SFC A;  1GL2 B;  2N1T D;  1L4A C;  3HD7 A;  1N7S B;  1JTH A;  1GL2 C;  4WY4 D;  5CCH A;  3B5N B;  3HD7 C;  5KJ7 C;  1KIL C;  4W7Z A; 
#chains in the Genus database with same CATH topology
 3RLY H;  4NIW A;  4Y71 A;  4YOJ A;  5A2M H;  3M5M A;  1DS2 E;  4YT6 H;  1NVO A;  3Q2Y A;  1MKX H;  2PGD A;  1NTZ E;  5AW1 B;  3A7T A;  2A7C A;  4EST E;  2TGD A;  1PV3 A;  1ELV A;  4X6N A;  3OYP A;  2J98 A;  1BGY J;  2SGP E;  2ANW A;  2QN5 T;  4WY4 B;  1JY3 N;  2A45 B;  3II6 A;  1DXP A;  2D8W A;  4KTC A;  2FYQ A;  1C9T A;  2VVV A;  2YKO A;  2KZI A;  5A09 A;  3BN9 A;  4PV1 D;  1MCT A;  2J34 A;  1FNI A;  3AEF C;  1DH3 A;  3PV5 A;  2XYA A;  2YIU C;  3CCR P;  1LVM A;  1NJI Q;  1MH0 A;  2PKS C;  4GVU A;  2G3A A;  3G71 P;  4VGC C;  3B8J A;  4AB9 A;  2B89 A;  1S9K D;  2BZA A;  5CHB A;  1FN8 A;  1OWH A;  3Q3K A;  4B86 A;  1FC2 C;  5AW0 B;  2JH6 D;  3AE8 C;  1RTK A;  2KS1 A;  4I6M C;  4NPD A;  3ATM A;  1N1L A;  4RJT A;  2Y80 A;  1L4A A;  4IFM A;  1HPG A;  3VB5 A;  4LZ4 B;  5HM9 A;  3N7N A;  1BCC D;  1AUJ A;  1GK6 A;  1EXF A;  3TGU D;  4TY7 A;  1RH5 B;  1NTM E;  1Q86 Q;  3L70 E;  1L1G A;  1NTP A;  3SNA A;  1J1E B;  2ZEB A;  3SZE A;  1QJ6 B;  1OYT H;  4CHA C;  1EAW A;  4RO0 A;  2A0Q B;  2B7D H;  4ISL A;  1YCP H;  3SJ9 A;  3V2N A;  1TPO A;  3W1E A;  2E76 C;  2ZA5 A;  1HJB A;  3HUS A;  2JWD A;  2YMY A;  3H1I E;  3L71 E;  3G4S P;  4EOT A;  1E79 D;  3CWB E;  1Y3X A;  2W6J H;  3AW0 A;  3U69 H;  3V0X A;  4K69 A;  1T2K D;  1DEE G;  1DUE A;  1O2H A;  1HAX B;  1V2L T;  3HD7 B;  3QUM P;  3SND A;  3H1J J;  3R4Y A;  3MIW A;  4RN6 A;  1ZJK A;  4IL6 E;  2FES H;  4FUG A;  4DUR A;  4AFQ A;  1BMA A;  2XNI A;  1SMF E;  3U1I B;  2QE7 H;  3PMA B;  2K0Q A;  2R2W U;  4Y79 A;  2ZTY A;  2VB0 A;  1DAN H;  1H88 A;  1VQ6 P;  4LZ1 H;  6LPR A;  1NES E;  1YKT A;  2PKS B;  2O01 H;  1TNG A;  3V13 A;  1AGJ A;  5B66 H;  1H9H E;  3KGP A;  4FXG H;  3C27 B;  2CK3 D;  3M36 A;  3P8O A;  2PGB B;  1Q2N A;  1B0E A;  4A1X A;  3I55 P;  2KK7 A;  1BBR K;  3A8A A;  3PP5 A;  2G55 A;  1ZRT D;  2Q5U A;  5APU A;  4I33 A;  2E5Y A;  3A83 A;  4XBD A;  3RK3 D;  1Y59 T;  3FWN A;  2FYR A;  3MOC A;  1LP1 A;  1LHE H;  1U7M A;  2BM2 A;  1DPO A;  3BEU A;  3JCU E;  1LPG B;  1BSH A;  1P03 A;  1RF1 B;  1PPJ G;  2LXB A;  4D6T G;  3QN7 A;  1HB0 B;  2NWN A;  2OQU A;  3ZVG A;  3GY7 A;  1EDL A;  1CU1 A;  1BRU P;  2L5G B;  1ZLL A;  5AVT B;  1TE0 A;  2ZHF H;  5F8Z A;  1E79 H;  2ZHE H;  2ZQ1 A;  3L3T A;  3WY8 A;  2RKL A;  2ZAE B;  1FDM A;  3GDU A;  1YM0 A;  1BHX F;  5B6L A;  2LKM A;  1FDO A;  2KLU A;  4IC5 A;  4RKU J;  1PQA A;  4B76 A;  5C1U A;  5GIB A;  4ABA A;  3WWF A;  4Q63 A;  4OM9 A;  1FXY A;  3O6Q B;  1NTK G;  1ZML A;  2XBY A;  4OGQ C;  3H7O A;  1LKA A;  3LJO A;  3G3Z A;  1O2T A;  1GHZ A;  1BRC E;  4FU8 A;  1K1P A;  4OS6 A;  5H2F H;  2HLC A;  1VF5 D;  2WSE J;  1Y3W A;  4YTA A;  1ZSK A;  2EQN A;  2CPB A;  1A02 F;  1A0H B;  3SI4 H;  3ZVC A;  2I1K A;  2QXI A;  1DY8 A;  3SV9 A;  2J92 A;  1VJ9 U;  1PP9 J;  3L72 J;  2DUC A;  1SQB G;  1TQ7 B;  5C5O A;  1GGD C;  5HIY A;  2K9J A;  1FBM A;  4Y28 J;  2Z4E A;  4HFP B;  1GI0 A;  3GY3 A;  5FXL A;  1KN7 A;  3N4X A;  3I56 P;  1C2H A;  1JO5 A;  1GJC B;  3WUU A;  1Z71 A;  2XND D;  5EG4 A;  5BU5 A;  1C2F A;  1MTN C;  3RMN H;  3B5N A;  1CHG A;  2R44 A;  2OC8 A;  3RXB A;  2JDI H;  2QC2 A;  2ZFR H;  1SC8 U;  3F9E A;  2BZ6 H;  1GJ8 B;  4TY6 A;  3M3V A;  3KZI H;  2FX6 A;  1YPK H;  5AVX B;  1C4V 2;  2ITA A;  4ZXX H;  2GZ8 A;  2OBO A;  4I7Y H;  2QF5 A;  4NWK A;  5GWZ A;  4ASH A;  3T97 B;  2HNT E;  1O3H A;  1RRK A;  1T8L A;  1GD2 E;  3TNT A;  1PPJ E;  2FOF A;  3OU0 A;  4Y8Z A;  1KD1 Q;  2QJK B;  1GL0 E;  1NTM K;  3JSV C;  1HXE H;  1KLT A;  3PYH A;  3SO3 A;  1P2J A;  1BE3 J;  3UOP A;  2CHA B;  4DJZ B;  1G2C A;  4YTP C;  1G2M A;  3MO9 A;  4L75 A;  3QH9 A;  5AVW B;  4CBN A;  2KCA A;  2NPS B;  2OYI A;  4YLU A;  3AE4 C;  2Y9Z A;  1AND A;  2AIQ A;  3BTG E;  3RU4 D;  1ESB A;  4IFD K;  1NRQ H;  1MKM A;  3MU5 A;  2V3H H;  1K8A Q;  1YTZ T;  1O31 A;  1DEB A;  1MU6 B;  2GZ7 A;  2OP9 A;  2YMS D;  1HCG A;  4X2V A;  1RQV A;  2A4G A;  1FZB A;  2FY8 A;  4XBB A;  5E8E H;  2KZJ A;  4CRE A;  1ZJD A;  1AFO A;  1ZR0 A;  1M7L A;  1GMJ A;  3A5T A;  3TGU E;  5F53 A;  2ZYD A;  4TWY A;  2ZDM A;  1BT7 A;  3TSI A;  2PSY A;  1OYQ A;  1BUI A;  4U7J A;  1TBR H;  1SPJ A;  1AKS B;  2Z5I A;  9LPR A;  2BLQ A;  4GUX A;  4RT1 A;  1X7A C;  2F9O A;  1NGM B;  1W0Z U;  5LPE A;  2H43 A;  1VZQ H;  2C0W A;  1QB6 A;  5AVD A;  3H1L G;  2GKV E;  1S84 A;  1P06 A;  5FPS A;  2JH5 D;  1RF0 A;  1F92 A;  3ZZ7 A;  1C4U 2;  4DVA U;  1SQX E;  3CX5 D;  3GCT G;  3KN2 A;  1COW D;  1KQS O;  4TWW A;  3AAV A;  1C5T A;  1A7S A;  4YPC A;  1FY3 A;  2NRG A;  3C9I A;  1GBB A;  1KSN A;  2W83 C;  1K28 D;  1ZHP A;  4ZKN U;  2F9N A;  3MU8 A;  4O97 A;  5K0H A;  1P8V C;  4WVZ A;  1DIT H;  1MTS A;  4AYY B;  4XDE A;  1H89 A;  2KX4 A;  2BY5 X;  2R0L A;  1O2V A;  3URC A;  5CCH C;  2ZC9 H;  2W6I D;  2BYA X;  2GZ9 A;  3GS9 A;  1S5L H;  2ZVO B;  2AEI H;  3BAT A;  4UEH H;  3ZZA A;  3S4R A;  1VDF A;  3S1K A;  1L0N J;  3KYG A;  1C5R A;  1TAB E;  1IZN B;  1H9I E;  3KQB A;  4I8J A;  4ASW A;  1LNQ A;  1GI3 A;  3P8F A;  8KME 2;  3RU4 E;  1JMO H;  1Z8G A;  4ZH8 A;  2Q1K A;  2N1T B;  1AN1 E;  1UCY E;  3CC2 P;  1C2I A;  2QJP B;  1K1M A;  1GL2 D;  3BRT B;  3M0D C;  2ZDN A;  4Y7B A;  3M0A A;  3UWI A;  2LEL A;  2STB E;  2FYU E;  2KNC B;  3BCC E;  3L70 G;  1GMC G;  4X6O A;  4X8S H;  1E5W A;  4NA8 A;  1W0Y H;  1CI6 A;  2C8Y B;  3RU4 T;  2P94 A;  1ZOY C;  5A8Y A;  1URQ C;  1J9C H;  2H9T H;  2OAR A;  1FI8 A;  2UUF B;  2A2Q H;  3PWB A;  1KQG B;  3FXD A;  1NOH A;  4GSO A;  3G6E P;  3TNS A;  5B6O A;  2BY6 X;  5DGJ A;  1G32 B;  1VQO P;  2B5T B;  3H1H G;  1P2N A;  4DCK A;  2VWO A;  5J4S A;  1EFR D;  1O3K A;  2WIT A;  2WZ7 A;  4PD4 H;  1RD3 B;  1O2X A;  1UVU H;  2AIP A;  3OFN D;  4X2X A;  4AYV B;  1F5L A;  1LTJ B;  3H1L D;  5KLV K;  2TGA A;  2OTV A;  3KXD A;  1GMD G;  1G3B A;  1TLD A;  3GY5 A;  3MGN A;  1PP9 G;  1EAU A;  3SZN A;  4D6T J;  5AFZ H;  2E74 D;  4YXD C;  1SQP E;  3LGV A;  3MH5 A;  1G2L A;  2RN0 A;  3KQ5 A;  1CGJ E;  1QGF A;  2OC1 A;  3LGY A;  4F49 A;  1TGN A;  2H7H A;  2J94 A;  3L33 A;  4BAH B;  4ZKR U;  3SYJ A;  2ZGX H;  1EZS C;  1OWD A;  2ZYG A;  2L74 A;  2A4Q A;  2XC5 A;  2XND H;  1U57 A;  2FOH A;  1AY6 H;  1CGI E;  3GHG C;  3S9O A;  1O36 A;  3F0P A;  1B0F A;  1WUN H;  3MI4 A;  3K9X B;  1O2U A;  1N73 B;  3SI3 H;  2CXV A;  1WTG H;  1VQ8 P;  4AOR A;  1P12 E;  1SQX J;  1OP8 A;  2TPI Z;  1S4X A;  4DT4 A;  3AEE C;  4A5T S;  4H4F A;  1SLQ A;  1HJ0 A;  2H8P D;  3KHU A;  3RL0 D;  2GA1 A;  3E3T A;  4WXV A;  5DJ7 A;  3S7H B;  3SFE C;  4W7Y A;  2OLG A;  1IQJ A;  1WOF A;  3BTT E;  4NFE A;  2FZZ A;  3SHA H;  3CWB G;  3PHL A;  1SQA A;  3MMG A;  1OOK B;  2AXC A;  3RMO H;  4IL6 X;  2I6S A;  1DWE H;  3P8M C;  1ZRT E;  4B1T A;  2SFA A;  2BTC E;  1PGO A;  1YQ3 C;  2Q3E A;  4PRO A;  1GDT A;  5LPF A;  1JTH A;  3P8G A;  3GF3 A;  4INL A;  5EST E;  1FQ3 A;  1FY8 E;  1BTY A;  3TPI Z;  2CN0 H;  2FKW B;  1GHA G;  1T32 A;  3DSO A;  2FXO A;  3V5B A;  3M7T A;  5C17 A;  3CPW O;  1BMN H;  1GHB G;  3UPE A;  3WWB A;  3TVJ B;  2ZQ2 A;  4JYU H;  3Q3D A;  4WY3 A;  1FY4 A;  1EAI A;  2UWO A;  1UVT H;  1HIA B;  1BRA A;  1AUT C;  1N6Y A;  1P2Q A;  2BCC E;  2G00 A;  4X2W A;  2H88 C;  4KHX A;  1MUE B;  3RDZ A;  3I77 A;  2EY4 C;  4XBC A;  3EE7 A;  1YGC H;  1SGP E;  1Y5B T;  2ODQ A;  1SQQ G;  1TPA E;  2VIN A;  1W5C E;  3GMA A;  1C1N A;  1ELE E;  3URE A;  4OWF A;  4AGK A;  4CR9 A;  1QQ4 A;  3F3B A;  4UFF H;  4OS5 A;  4OS7 A;  2AYW A;  1X22 A;  1PYT D;  1C1W H;  1O3I A;  1KXB A;  1HAI H;  3B9F H;  3KPE A;  1GHW H;  2BY9 X;  1IQH A;  2Z3E A;  2QIQ A;  2M5A A;  5KJ7 D;  2ZU3 A;  1H8H D;  2CK3 H;  2FMJ A;  2BDB A;  1ELC A;  3ZZ5 A;  1JMM A;  2E76 D;  4KT0 J;  1IFJ A;  1MTW A;  1UW7 A;  4Y8Y A;  4FUB A;  3A7O A;  1JY2 O;  1UTN A;  3L73 D;  2VJ1 A;  3BTQ E;  3VXE H;  2KZ4 A;  4B2C A;  4I8H A;  1BB0 B;  2UWJ E;  2FOG A;  1TIO A;  5ESB A;  3RLW H;  5M1B A;  3PO1 B;  3FXE A;  2ANY A;  3A0B H;  2R9P A;  4DT0 A;  1G37 A;  1KMH B;  3H1L J;  5A8Z A;  4BRY A;  3OW2 O;  1O3M A;  2ZI2 H;  4AFS A;  2A31 A;  1NAY A;  2M5T A;  1OX1 A;  1SQP G;  5CMZ A;  3A8D A;  1GBF A;  1NTK J;  1L0N K;  1JBU H;  2VWL A;  1CHO G;  3L70 D;  1LTA C;  2EST E;  3AED C;  3STJ A;  1DLK B;  1C1R A;  3JZ2 B;  2KLV A;  1KYO I;  1UHB B;  3TJV A;  4ZKS U;  1ZPC A;  3VB6 A;  3TK1 A;  1EZV I;  4CRG A;  4CR5 A;  2PHB A;  1ZLR A;  3NK8 A;  1GBE A;  3E6P H;  2A5A A;  3LGI A;  3BVH A;  4PD4 D;  2AFQ B;  1R5L A;  1JUN A;  2PP6 A;  1LT9 C;  1BSN A;  3AAS A;  3UNQ A;  3VGC C;  4CH2 B;  3UR9 A;  3U59 A;  1D7M A;  3T62 A;  1S6H A;  5FPY A;  3VTP C;  2AMQ A;  4O9V A;  1XXD A;  4AFU A;  1QRX A;  4ZNC A;  3T26 A;  2R3U A;  5KLV E;  3LID A;  2KI7 B;  2JP3 A;  1ZR2 A;  1N8R Q;  1HAH H;  1KLI H;  1C2E A;  1Z6E A;  2KAI A;  3DSP A;  3FZZ A;  3A0H H;  4QMA A;  3BTD E;  2ZVN B;  2OIN A;  3GW6 A;  1O3C A;  1ANB A;  2FI5 E;  2WUB A;  4MNV A;  5T6D A;  2QF4 A;  3M7U A;  1AVG H;  1MKW H;  3QDZ B;  2TGT A;  1DX5 M;  1K1N A;  1ZV8 A;  3E1I A;  1SGY E;  4IMQ A;  3EWK A;  2ZPQ A;  3M61 U;  3EAJ A;  3JCU H;  4AGJ A;  2M5A B;  1PPE E;  1EB2 A;  4A1V A;  4X8V H;  4YES B;  2BY7 X;  4NPF X;  5E2P A;  2VVU A;  3B5N B;  1AZZ A;  4UE7 H;  4MVN A;  4UFE H;  1O5B B;  1ZPB A;  4Y6D A;  5A0C A;  1KDQ B;  2BCC J;  3PTN A;  3HD7 C;  1KY9 A;  3RXA A;  4Q7Y A;  2GCH G;  2FI3 E;  2GT7 A;  1L0L E;  3Q5P A;  3HUS C;  1BA8 B;  5T6G A;  3PJS K;  3RK2 C;  3A0B E;  1PZQ A;  3AE2 C;  3GIC B;  3MU0 A;  4ZHA A;  2Z9K A;  1S82 A;  1C2K A;  1HAV A;  4RI0 A;  3HKJ B;  3W94 A;  1NTM J;  3QZR A;  2ZFT A;  2WPD D;  3SHC H;  2OYH B;  4NGA H;  1PGP A;  3R2P A;  4O9B A;  3GHG A;  2LPR A;  1F2S E;  1OMI A;  2HNT C;  2R32 A;  1C9P A;  4Y0Z E;  1PPC E;  2GCT B;  5C67 A;  2SGE E;  1SLV B;  3I29 A;  1AD8 H;  4HZH A;  1IFM A;  3P8N A;  4YLQ H;  1IK7 A;  3QWO C;  1QRZ A;  7GCH G;  2GTB A;  1SGC A;  1HFD A;  1HAG E;  2FXP A;  3RK3 C;  3GCH B;  3RXJ A;  2WPV B;  1G3E A;  1GJA B;  5DO4 H;  1UTK A;  1GI6 A;  1FZZ A;  3E8L A;  1FN6 A;  2A06 E;  2FWW A;  1OP2 A;  1SQV K;  4NIY A;  2O1J A;  2L6O A;  1H1B A;  1VQ9 P;  2VRS A;  1GHY H;  1XUF A;  1LVY A;  3FKS D;  4HTC H;  1QCP A;  4WME A;  4AUW A;  2ZGJ A;  2FP7 B;  3RC6 A;  1Q90 D;  2THF B;  2ZXE B;  4EIJ A;  5G4B A;  3BCC D;  2WWW A;  5KAI H;  4O03 A;  1OWA A;  5EPY A;  1NKZ B;  1DE7 H;  2ZP0 H;  5APQ A;  3GYM A;  1BTU A;  4LK4 A;  3CC7 P;  2HRV A;  1BHX B;  1MQ5 A;  1N7L A;  4U3F D;  3VP8 A;  1FOS F;  1HRT H;  4JYB A;  1ZN5 A;  2IJO B;  1M8O B;  1D3T B;  2ZHD A;  1CA0 C;  1JCD A;  4XSK U;  1Y3U A;  2OC7 A;  3DCL A;  4ZAE A;  4EDF A;  2OYH A;  2KCP A;  4CRA A;  3RK3 B;  1U7J A;  3L75 D;  5I46 H;  3LC5 A;  5KLV J;  1TNI A;  3L72 D;  2B9B A;  2XDJ A;  3GY6 A;  4U32 A;  2IX7 C;  2WPQ A;  1C5Y B;  2JDI D;  4JYT A;  2GCT C;  1NC6 A;  1A02 J;  1G1I A;  3Q77 A;  4WBA A;  1IQL A;  1G30 B;  4N78 D;  1YWU A;  3PM3 A;  4MNW A;  1Z56 A;  3UIA A;  5T1V A;  4M3L A;  3FAO A;  4BAM B;  1CO7 E;  1RTL A;  1EPT C;  3ODF A;  2ZDV H;  3SSU A;  3RK2 B;  1XM1 A;  2D1J A;  1SFC C;  1UJ1 A;  1P9S A;  1V2T T;  5HYO A;  3L74 D;  1PYT C;  4IN2 A;  3C1K A;  2YO3 A;  2ALV A;  2GM4 A;  4UB6 H;  1AQ5 A;  1O3J A;  1AWH B;  1QLE D;  1C1U H;  1CQQ A;  1P05 A;  1SFC A;  1MKX K;  2FOA A;  2XC4 A;  3A85 A;  1PPJ D;  3CCM P;  2IFN A;  1GK4 A;  4NA7 A;  1GJ7 B;  5CBN A;  2P3F H;  4DZO A;  2UUJ B;  1GBA A;  3O8C A;  3MUD C;  5CCH A;  3MO3 A;  3ZV8 A;  2GCH F;  4DOQ A;  2GUV A;  3AEG C;  1IAU A;  4E05 H;  2IFM A;  2QAA A;  1PGQ A;  1SSX A;  1EZV E;  1JRS A;  1S81 A;  2FFD A;  2Q6G A;  4DT7 B;  2AXT E;  4FOU C;  1KIG H;  2XOK D;  1SGF G;  1RGQ A;  2D26 C;  2PTN A;  2Y6T A;  3NCL A;  2HOD B;  1BGY D;  4GLY A;  4DOJ A;  3DA9 B;  1C5V A;  1SLU B;  3UAI C;  1O3P B;  1AVY A;  1SGN E;  3BCC G;  1NY2 2;  2B0F A;  5FHT A;  2ZDL A;  3LU9 B;  5CCG C;  5EXL A;  3ZZ8 A;  5J4Q A;  3UNS A;  4TPY A;  2J98 B;  5DK1 A;  4XFJ A;  1SGQ E;  1T6A A;  4D7G A;  3V2R A;  1KXE A;  1CSB A;  2HPC A;  5EQR A;  2E74 C;  1GBK A;  2R3C A;  5APY A;  2XWB I;  1ZME C;  2VNT A;  3N7D A;  1GMH G;  1NTM G;  2N9B A;  2PTC E;  3QO6 A;  1T8Z A;  1OXG A;  3UB0 A;  1GBC A;  3RXT A;  3RM0 H;  1FZG A;  4UFG H;  2O8T A;  2GT8 A;  1ZW0 A;  5KTB A;  1J1E C;  2PAJ A;  1SVP A;  4H42 U;  1QA0 A;  4IN1 A;  1WRG A;  1SQO A;  2Y0C A;  1W3C A;  3RM2 H;  2HFE D;  1SR5 C;  1S2E A;  4N6J A;  2QM8 A;  1P10 A;  3A80 A;  3O8B A;  2WQY C;  3PO1 C;  1D3Q B;  3TGU G;  1BBR E;  1FMG A;  2V3O H;  1SQQ E;  4D8N A;  2BD7 A;  1TMU H;  2SPZ A;  2GGV B;  1L2E A;  5KGO A;  1DD3 A;  4AZ2 B;  2YMS C;  2PFE A;  5F03 A;  1O2J A;  3B71 A;  1Z1J A;  2JKH A;  3K2U A;  1MBM A;  5KLV D;  1GJ9 B;  2ZU2 A;  1LTI C;  1FPH H;  3E0N B;  4F55 A;  1GJD B;  4HB1 A;  3VPK A;  2Z9J A;  2VGC C;  1L0L D;  2UUK B;  4WY4 C;  4NPE A;  3RXV A;  3A7X A;  2PKA B;  4GOF A;  1ELD E;  3L75 G;  1THS H;  1WQV H;  4K1S A;  1GDU A;  5GTH E;  4A6L A;  2ZU1 A;  3CCV P;  3ZYE A;  1T31 A;  2W27 A;  3ZZ4 A;  3LC3 A;  4EYY Q;  1JTH B;  2XW9 A;  1Z8J B;  3M0D A;  1SG8 B;  3BV9 B;  3UIR A;  2O8L A;  3H1J E;  1HV7 A;  1S5L X;  2ZT9 D;  1EXI A;  2H1U A;  4NIX A;  1KQL A;  3D70 A;  2OUA A;  2Q6D A;  1A5H A;  1GL1 A;  4FUF A;  1SQB K;  1UTM A;  4GHT A;  1KB9 D;  3SV2 H;  1ZMJ A;  3SNE A;  3TJU A;  1O2I A;  1TGT A;  1GWA A;  2GD4 B;  2J2U A;  1WT6 A;  1DDJ A;  4E7R G;  5HXF A;  1LPZ B;  1TNJ A;  1Z1I A;  1GBD A;  1TX6 A;  5E79 E;  1GHX H;  1NT1 A;  4B2B A;  2VWN A;  2VIQ A;  5I25 A;  1G2C B;  3FZD A;  5AW6 B;  2OYI C;  4MQA A;  1QBV H;  1GI4 A;  2BMG B;  1BDA A;  2A4R A;  1Y5A T;  1CHO F;  2PUX B;  2HPC B;  3SU3 A;  1EKB B;  4NZQ A;  5BPE A;  5GJ4 B;  4YXW H;  5H2F E;  1GBT A;  1GI9 B;  1DVA H;  1TOC B;  3BG8 A;  3PRB A;  3AK5 A;  5IDK A;  1SGE E;  1RQU A;  3CLQ A;  2M0B A;  1MZ9 A;  1P84 D;  3VN0 A;  1D6R A;  1TPP A;  2JET B;  1KLJ H;  3MH7 A;  1P57 B;  1QFK H;  1K9O E;  2ILN A;  1QL9 A;  4MNX A;  1ZTL A;  1BBR H;  3LIE A;  2NPS C;  1SQV G;  1O2Z A;  4ABG A;  2F43 B;  1TGC A;  1Q82 Q;  3M37 A;  1HNE E;  3BIV H;  6CHA C;  1XUK A;  2NU4 E;  2I8D A;  2ZTZ A;  4ACA A;  3GF7 A;  2P3U B;  5EXM A;  3UR6 A;  2KUB A;  1V2U T;  1FJK A;  3TNU B;  1IO4 A;  3FP8 E;  4XFQ A;  1LTJ A;  1QUR H;  1C2D A;  1LJ2 A;  4R4M A;  3U1J B;  1HH0 A;  2O1K A;  1L0L K;  3L70 J;  3E1X B;  5EPN A;  1SLX B;  1AHT H;  1SHY A;  2FYZ A;  2HVX A;  2QCY A;  2W7S A;  3TIT A;  1MTN B;  1TAW A;  1ZTK A;  2EI8 A;  2EI7 A;  2Y7Z A;  4FU9 A;  3LW5 J;  3M5N A;  1PFX C;  1LGH B;  1QA7 A;  3VB3 A;  2ZPS A;  1V2J T;  2YNA A;  1C2M A;  1GGD B;  5C20 A;  5CHA B;  5A0A E;  3CME P;  1OWK A;  3KQC A;  5HM2 A;  3OTP A;  2W8Z A;  4H0L C;  1NKN A;  1PP9 D;  4OGY A;  1CI6 B;  2ZEC A;  1IFN A;  1IQK A;  2WPH S;  1G9I E;  4JZE H;  1A3B H;  1WQS A;  2JET C;  2TIO A;  1DSU A;  1TOM H;  3RXH A;  2M3B A;  4ABI A;  3U1A A;  3M9B A;  1H0T B;  2C93 B;  2WPS A;  2HG5 D;  4BXL A;  4CPG A;  1IQM A;  1Y47 A;  1JMB A;  1GCD A;  1V2N T;  1L4Z A;  2BD8 A;  1J8A A;  2BVS H;  3EST A;  1URQ B;  5AW3 B;  3KID U;  4OGQ B;  3ENS B;  5FL7 D;  3URD A;  1NTZ D;  1IFI A;  2C8X B;  2VIV A;  5JBA S;  1SP4 A;  1BTP A;  2A7J A;  4X0W U;  5CDF E;  3E90 B;  3LW5 H;  3HKI B;  2BX3 A;  4IS5 A;  4RT0 A;  4WH6 A;  2P59 A;  1O3B A;  2P95 A;  1LHD H;  2C0X A;  4PV1 C;  1C1P A;  2ZFQ H;  4UD9 H;  1ETT H;  5E0J A;  4Z1M D;  4K8Y A;  1TRY A;  4KEL A;  3UY9 A;  1J14 A;  3P32 A;  4BXW A;  4OGQ D;  1V6D A;  1EP5 A;  1NRO H;  4P00 A;  1FPC H;  5DP6 A;  2RMZ A;  1O2G H;  2QE7 D;  1W13 U;  5APS A;  5FX5 A;  5FCR A;  4ACB A;  1NRR H;  1USD A;  1RF1 C;  4I2L C;  1NU1 J;  1FDP A;  2UWP A;  2PFX A;  1BQY A;  1NU1 G;  5EOK A;  1PPZ A;  2P7J A;  2QRX A;  1YJW P;  2W3I A;  4UB8 H;  1JIR A;  7EST E;  4JCN A;  2IJD 1;  3NXS A;  1VQK P;  1DM4 B;  2B9L A;  1CA8 B;  2VGC B;  3RML H;  1O0D H;  3F6U H;  1RIW C;  2RA3 A;  4YO9 A;  1UIX A;  1TGB A;  2NU1 E;  1WBG B;  4B6F A;  2XCN A;  1CT4 E;  1SGT A;  3KYF A;  2H89 C;  5CE1 A;  3SGQ E;  4HH2 A;  1C1Q A;  1C5N H;  4M9F A;  1JY3 O;  1C2J A;  3TDK A;  1V2M T;  5BRR E;  3MHV A;  3MTU E;  1HDT H;  3OY6 U;  2FFD B;  1EOJ A;  4K35 A;  5KLV G;  1P0S H;  1UCY H;  1GBJ A;  6GCH F;  1M57 D;  1QR3 E;  3SWK A;  1J1D B;  2Z9G A;  2YNB A;  4YZU A;  5LH8 A;  1S0Q A;  1QZ8 A;  1UK4 A;  2K9Y A;  2V7Q H;  2HLD D;  3H1K G;  7LPR A;  2VBC A;  1HJ8 A;  2I6Q A;  3SU0 A;  1T3U A;  2PV9 B;  2E76 B;  4B75 A;  1AMH A;  2RH0 A;  1GW4 A;  4X8T H;  3USS A;  1Z7K A;  2OYO A;  3WUV A;  1UVP A;  4JBZ A;  1YBK A;  5BU8 B;  1BTZ A;  2P93 A;  3ZZD A;  5KEC A;  1A4W H;  2BOK A;  3L74 E;  2CGA A;  3LGU A;  3RXK A;  3UTU H;  2M8R A;  1MTU A;  3NUM A;  2P1J A;  3M06 A;  5CBO A;  3DHK H;  4FUJ A;  4YT7 H;  2BB4 A;  2E74 B;  2GJG A;  1PIX A;  2A1D B;  3M3S A;  4CBO A;  1M9U A;  2LP6 A;  1C2L A;  1PPH E;  1Z8I B;  3IIT A;  4KGA A;  4ZXY H;  4ZKO U;  2WV9 A;  4ABF A;  4Y8X A;  5HKK D;  2OGU A;  1EDK A;  2F83 A;  3RXE A;  1KFN A;  1TMB H;  4O3T A;  2W90 A;  3WMM 0;  1BIT A;  2O8W A;  2YNY A;  3ATL A;  3EE0 B;  2BD4 A;  1FJS A;  3VMY A;  1OPH B;  4H13 D;  1SFQ B;  2Y5H A;  4ASV A;  1ANE A;  3ZVB A;  1QL1 A;  2WSS H;  1SHH B;  1GDQ A;  3CX5 H;  1YYC A;  3EQ0 H;  1ZRK A;  1FJP A;  3P70 B;  5EIY A;  1XUJ A;  4C7R A;  2H5C A;  2B8O H;  5GXP A;  2ZXX A;  3L71 D;  5AVY B;  1DY9 A;  5GTI H;  1P09 A;  3A81 A;  3FO8 D;  3UWJ H;  1FZA A;  2Y0E A;  1L0N E;  3H1J G;  1LQD B;  1LTO A;  1S6L A;  2Z9I A;  4Q4L A;  1AVX A;  3SJ8 A;  3SQE E;  3SFD C;  4HYT B;  1ZGV A;  1TPS A;  1XKB C;  2J58 A;  2AGI X;  3HE4 A;  3ZZB A;  5DJU B;  3A89 A;  1ZP0 C;  4FVD A;  2QXJ A;  2ANK H;  1OS8 A;  2WYJ A;  2ZDK A;  4AX9 H;  2RG3 A;  5AF9 H;  3A7W A;  1V2Q T;  2JIZ D;  2QXG A;  1F0U A;  4X6M A;  7GCH F;  2BOH B;  4ASU D;  1QL8 A;  2FLR H;  5TCA A;  4ZKP A;  4UON A;  3A87 A;  2AMD A;  1ZYO A;  2GDE H;  2RCE A;  4INK A;  3M9H A;  5CCG D;  1ZPZ A;  1MMJ N;  1SQT A;  3H1K D;  3SGB E;  1HAZ B;  1P84 E;  2Z6B D;  1F0S A;  2Q6Q A;  3A84 A;  5CMX H;  3WU2 E;  1SQQ D;  1XX9 A;  1BML A;  3BTK E;  5CCH D;  3SJO A;  3VFE A;  4JPZ B;  1AE8 H;  3PTZ A;  3ODD A;  3MP7 B;  3E0P B;  3TU7 H;  1CZQ A;  2JEE A;  4GIF A;  1PPB H;  1TRN A;  2WHX A;  5APX A;  2YMK A;  4X2Y A;  2W6A A;  3ATW A;  5H4I B;  1EQ7 A;  3OA7 A;  2JJ2 D;  2GDD A;  1CA0 B;  4H13 C;  3F68 H;  3SWF A;  2IZ0 A;  1Z8R A;  1C5Z B;  2GVF A;  4ABH A;  1QBO A;  4MN4 C;  2BCC G;  1AFQ C;  1BDD A;  1L0L J;  1SB1 H;  1Q81 Q;  3AAU A;  4FU7 A;  1WMK A;  4ABB A;  1WXR A;  2FBW C;  3L75 E;  1UVO A;  1WTH D;  1EJN A;  2Q1J A;  4C7N A;  1P2I A;  1BMF D;  2KP8 A;  3CCE P;  1HUC A;  1ETS H;  2A32 A;  4NSY A;  2XU6 A;  2IBZ I;  1PFI A;  4D6T D;  3CD6 P;  1NS3 A;  2C9L Y;  1C1T A;  1RTF B;  1EZQ A;  1TA2 A;  1LP1 B;  1YPH E;  3H1H J;  2KM0 A;  1OW7 A;  3F5H A;  3M3T A;  1O3L A;  1FOS E;  3PH0 A;  1RE4 A;  2ZHQ H;  3T29 A;  1W14 U;  3DD2 H;  3ZV9 A;  1YF4 A;  2KSE A;  4OH8 B;  1UVS H;  2KIK A;  1GMC F;  4GCH F;  1L2P A;  5GTI E;  1ELT A;  3SJI A;  1C5M D;  1KOR A;  1AU8 A;  3HK6 B;  1UTP A;  3CC4 P;  1O2K A;  4K60 A;  5AVU B;  3BF6 H;  2FOE A;  3C1L A;  3GCH C;  1FON A;  3V2P A;  4H44 C;  1TON A;  2XCF A;  2JKV A;  3KL6 A;  2PLX A;  1Y9B A;  1NRN H;  2W3K A;  2A5K A;  2W6B A;  2BEQ D;  3B4S A;  1IFP A;  1O3A A;  5GCH G;  1S83 A;  4U30 A;  2FYN C;  3A3Y B;  1BCC E;  1P04 A;  4WWY A;  4E06 H;  2VWM A;  1N86 A;  3NRL A;  5C39 A;  4EI2 A;  3DUX H;  3KF2 A;  1S6F A;  4LGD E;  3AEC C;  2QV1 A;  1X8Y A;  1NFU A;  1TBZ H;  2E75 C;  2HPQ H;  4DIH H;  2WV4 A;  2WZQ A;  1UCY K;  4X1P U;  2OK5 A;  1TX8 A;  4DGJ A;  4K8B A;  2FOM B;  3QTO H;  4FUI A;  3B8E B;  4PJ0 E;  3RXS A;  2FYN B;  1VQ5 P;  1SGF A;  1H8I H;  1SQP K;  4RKJ B;  2OD3 B;  1GL2 A;  3ELA H;  3OJA B;  2XBW A;  1FZC A;  3EFF K;  5KJ7 A;  3VMX A;  1PQ8 A;  3RP2 A;  3LKW A;  2V6N A;  2CV3 A;  1TGS Z;  1RE3 C;  4PJ0 H;  1KMI Z;  2P10 A;  2FFD C;  3CMA P;  1OP0 A;  3ZYD A;  1AV1 A;  1FAX A;  3FWL A;  2QEX P;  1ZHM A;  1HAO H;  2AEJ A;  3D65 E;  2YIU B;  1OW8 A;  2KOG A;  2WUC A;  3CS7 A;  2FPZ A;  3BAS A;  3EA7 A;  3HGP A;  2ZPR A;  1EXJ A;  1RIW B;  1PQ5 A;  3D6Z A;  2AMP A;  4DII H;  1DIP A;  4IBL H;  2H2Z A;  5L2Y H;  2J5U A;  3H1H D;  1QEX A;  1USE A;  3B5N D;  3H1H E;  1S72 P;  2O8M A;  1M1J A;  5AFY H;  1ZSJ A;  3SU4 A;  3D49 H;  1U6Q A;  2ZIQ H;  3T97 A;  1HLT H;  4TSF D;  4K3A A;  2QSI A;  1QX8 A;  4GOD A;  1GI1 A;  2G4U A;  2WYG A;  2K8I A;  4DG4 A;  4CRF A;  1M1J C;  1W10 U;  4AN7 A;  1MZD A;  3GDV A;  1XVO A;  1TAL A;  2SGF E;  3T28 A;  2FYU K;  4KKD A;  1BE3 E;  3I78 A;  4X1R U;  4H13 B;  1IHT H;  3ATK A;  3CCQ P;  1SLW B;  4NSV A;  4R0I A;  1MFZ A;  5C3N A;  4I31 A;  4N3Y B;  1TFX A;  1VIT H;  1KB9 E;  3CS0 A;  1CT0 E;  3DFJ A;  4PV1 B;  3ZZ3 A;  2DE8 A;  1WU1 A;  1PGJ A;  5T3H A;  3SOS A;  5F6M A;  1AVO A;  1UMA H;  2CF8 H;  1EPT B;  4D7F A;  1O2P A;  1QB1 A;  3AE9 C;  4WMF A;  3CCL P;  5DP9 A;  3CP7 A;  1CBW C;  1VCP A;  2PUQ H;  4AOQ A;  3F9G A;  1NU1 K;  5DP8 A;  5L2Z H;  3IN6 A;  2G4T A;  4PD4 I;  1V2O T;  1C4Y 2;  4Q2K A;  1TU3 F;  3AE1 C;  1P3E A;  1FIW A;  1SQR A;  1SVF A;  1W0K D;  4NFF A;  1O5D H;  1KTS B;  1IQN A;  4RKO B;  3VYI A;  3W67 A;  1C5X B;  2P8O B;  4ISO A;  1AQ7 A;  1N7S D;  3F2G A;  5HIZ A;  3M5O A;  3SU2 A;  3E91 A;  4DW2 U;  1V2W T;  2IPH A;  5EOD A;  2WPK S;  3SU1 A;  4FUE A;  2OTL P;  3EDX B;  3S69 A;  1NO4 A;  3RXI A;  3BG4 B;  4WY4 A;  2E75 D;  3CCU P;  4LLH A;  4UB8 E;  1C5S A;  1C2G A;  1KXA A;  1ZHR A;  1BTX A;  2R5B A;  1HIA A;  1SQX G;  1DWC H;  1K21 H;  4AYC A;  1O3N A;  1Y3V A;  3PLK A;  1LTS C;  2B87 B;  3L37 A;  3FVF B;  1LWU A;  4NWL A;  5FBE A;  1AWF H;  2YXQ B;  5B66 E;  3FOA A;  1P84 I;  1A0L A;  4WXI A;  1L0L G;  1OVU A;  1XTC C;  3RL0 g;  1LHF H;  1V3X A;  2AGE X;  2QF3 A;  2EEK A;  2ZKS A;  1P02 A;  3GIS B;  1XUG A;  2BAS A;  1AA0 A;  3MUD A;  1T4U H;  1T8M A;  1TRM A;  3GYL B;  4U3F E;  4J1Y A;  1N8O B;  1SFC D;  2JJL A;  1EST A;  1NFW A;  2F9U A;  2HWL B;  1AZ8 A;  4FET A;  6CHA B;  2YKP A;  1O3F A;  3FP6 E;  2NU0 E;  3MNC A;  5BVZ A;  1PQ7 A;  1C5U A;  4OVN F;  2I1J A;  3RBX A;  3UNR A;  3CI9 A;  1O2S A;  3E1R A;  3ZVE A;  1O38 A;  4BWN A;  1JY2 P;  2Q3I A;  3OY5 U;  1O3O A;  5DN6 D;  1DOJ A;  5E2O A;  3KYQ A;  4XD7 D;  1C5Q A;  3L71 G;  3TH2 H;  1DWB H;  1OX3 A;  1KB9 H;  1K1I A;  3ATI A;  5EW2 H;  1FU1 A;  2A06 D;  3JZ1 B;  2STA E;  5GPI B;  4ISH H;  5EGM A;  1RE4 C;  5TIS E;  2HVY B;  1GCT B;  2BD2 A;  2OYH C;  3A7Z A;  3V7T A;  5CJ0 A;  1XTG B;  1R5S A;  1L4D A;  4B71 A;  2VU8 E;  1E36 B;  2PWX A;  1EJA A;  1EUF A;  1ZMN A;  4WWI A;  1S3J A;  1YLN A;  3OTJ E;  2NPS A;  2OYI B;  1JXP A;  4KP0 A;  3OSY A;  3STI A;  2XZR A;  3ZZ6 A;  3F1S B;  5EFW B;  1GVZ A;  3QK1 A;  3HUS B;  3TGJ E;  2BD9 A;  2KCO A;  1FZC B;  1KIL B;  1DIC A;  3LOX A;  1Y5U T;  4PD4 E;  1AVW A;  1UO6 A;  3RXM A;  1F7Z A;  3V3M A;  5APT A;  1QVF O;  4MLF B;  1N73 C;  2P3T B;  3SU6 A;  4CRC A;  3S7K B;  2OXS A;  2SGA A;  4BAN B;  1AFE H;  1WAY B;  1HVV A;  1D3P B;  2ALP A;  4D76 A;  1BDC A;  1IQG A;  1SGR E;  1OFC X;  1EZU C;  2PW8 H;  3TJN A;  1ARB A;  2FOD A;  3NPS A;  3O8D A;  2MKV A;  2AEM A;  3RGU A;  3NFQ A;  3VMA A;  1A3E H;  2JH0 D;  4TPI Z;  3V12 A;  2KYV A;  3M5L A;  1J2J B;  1HXF H;  1KDQ A;  4TT3 D;  5KJ7 C;  1SQV J;  3D23 A;  1SQB J;  1SOZ A;  2ASU B;  4OS1 A;  3HAT H;  3KZI E;  4U01 A;  4BTT B;  2P58 A;  5CHX A;  3AW1 A;  1TNK A;  1YCP M;  2HAL A;  2DW3 A;  2UWL A;  3F0O A;  4JYV H;  2A4O A;  2BDI A;  1DWD H;  4GPG A;  2VIP A;  2L91 A;  1HAV B;  1Z6J H;  3LT3 A;  1HJA C;  1MD7 A;  2OQQ A;  3L74 G;  1K22 H;  1VIT F;  3SWY A;  1HJ9 A;  3VGC B;  1Y3Y A;  1K9M Q;  2IOT A;  2W26 A;  1E0F D;  1S5L E;  1A5G H;  1BJU A;  3VB4 A;  3TGK E;  5TCC A;  1K1J A;  4I32 A;  5C2Z A;  2ZGB H;  5APV A;  2SGQ E;  1FAV A;  2Y7X A;  2K88 A;  2BQW B;  2XC0 A;  1FLE E;  1P9U A;  1W12 U;  2QIW A;  1NU1 D;  1CW5 A;  1SQQ K;  4GDO A;  1Q31 A;  1WDI A;  2DE9 A;  3SV8 A;  3MZW B;  5JYI A;  2V3M A;  3KHV A;  5HGG A;  4AFZ A;  1UK3 A;  2BEZ F;  1Y8A A;  2GV6 A;  4JK5 A;  5TJH A;  2AEF A;  2RFK C;  3RBZ A;  1O30 A;  2FOC A;  5AHG H;  5AVR B;  1Q2W A;  3L36 A;  1YPE H;  4ZUH A;  3Q1M A;  3WW7 A;  2N1T A;  1L4A D;  2P16 A;  3VG8 A;  1S1C X;  4Y7A A;  3TK6 A;  2CF9 H;  1RF1 A;  2YXR B;  1V2K T;  2JR8 A;  2G51 A;  4ZCN A;  2N1T C;  5APW A;  3H5C B;  4R8T B;  3TK5 A;  1T7C A;  5C0T A;  1P2M A;  2D2C B;  1O35 A;  2CMY A;  3VP9 A;  4H0L B;  5AVV B;  1YYY 1;  4JYC A;  2CJI A;  4TYD A;  5HMA A;  1EJM A;  8LPR A;  4LC1 A;  2M2A A;  1V2R T;  3VEQ B;  2ZCK P;  1SS1 A;  2E43 A;  1TYN A;  4A1T A;  2FS8 A;  2LR2 A;  3Q3X A;  2A45 I;  1A0J A;  3HRN A;  2A45 G;  5KLI C;  2KS1 B;  1LO6 A;  2PGQ B;  3H09 A;  2HPP H;  1LCY A;  4UB6 E;  1R8E A;  1Q3X A;  4BNR A;  5KED A;  3A82 A;  2ZU4 A;  3KEE A;  1K0H A;  2C3S A;  1MU8 B;  1W11 U;  4JZD H;  2K3R A;  2Q6F A;  5GTH H;  3M7Q A;  1S0R A;  1ZGI A;  3QLP H;  1SQB D;  4X6P A;  3H1K J;  3SUD A;  3K65 B;  1VIT G;  3E16 B;  2IYO A;  3GY4 A;  3G9R A;  1EQ9 A;  1HWT C;  2WSF H;  1N7S C;  3BSQ A;  1GHV H;  3ZVA A;  4JQ0 D;  2IZ1 A;  2VH0 A;  2ZO3 H;  2Z7F E;  3R0F A;  3QX5 H;  4INH A;  2MJZ A;  1QL2 A;  3SBK A;  3NXP A;  1K73 Q;  3F9H A;  1EDI A;  5E79 H;  4DY7 B;  2BXT H;  2WT7 A;  1FE6 A;  1NTK K;  3T5F H;  1GVK B;  1J17 T;  2J59 M;  1A1R A;  1JWT A;  2HYN A;  5L8R J;  1TWX B;  1V2V T;  3BTE E;  2N1T D;  4IL6 H;  1W7G H;  5KAF E;  3MNB A;  1YPJ H;  1O3D A;  1RFN A;  5DP4 A;  1NH4 A;  1UTQ A;  1O2N A;  3DSG A;  1L1N A;  3AEA C;  1VL2 A;  1DX7 A;  5LGO A;  3L71 J;  1DFP A;  1O2Q A;  3MHW U;  1SQV D;  3WU2 H;  2F9B H;  1FIZ A;  1D3D B;  3GY8 A;  4W7Z A;  2BDA A;  1NU7 B;  1GMD F;  1BJV A;  2W5E A;  3O6Q A;  3P8C D;  2CHA C;  3EYD A;  4HGC A;  2G5V A;  3FN8 A;  2K9J B;  1AQT A;  3F2H A;  5JDU B;  1ZZZ A;  3B23 B;  3O8R A;  1Y8T A;  3PWC A;  1O5G H;  4DJG A;  1UII A;  3EA9 A;  4IC6 A;  2V4H A;  1L1J A;  4MDS A;  4BOH A;  4E7N A;  1PJP A;  1XXF A;  1WSS H;  2YKQ A;  3A8C A;  3DFL A;  1OKX A;  1VCW A;  2Z5H A;  3H1I G;  3PLN A;  5KKZ B;  1J15 A;  3P92 A;  4XOJ A;  5A0B A;  5EXN A;  3IWM A;  1BMM H;  2J97 A;  4B73 A;  1VKY A;  1FAK H;  1AI8 H;  5AW4 B;  4Z6A H;  1LTB C;  4GT1 A;  3GOV B;  1GJB B;  4NG9 H;  1GJ4 H;  4U3F G;  4KTU A;  4LOY H;  1VF5 C;  1ZR4 A;  3H1I D;  4I86 A;  3L74 J;  2QYI A;  3MH4 A;  2N9Y B;  1F0R A;  3CWB J;  4HKZ H;  4NCY A;  3TH4 H;  1KB9 I;  1RF0 C;  1OW6 A;  2VH6 A;  1JRT A;  2YMS B;  2QGR A;  1BTW A;  1LTJ C;  1M90 Q;  3QGN B;  3RC5 A;  3H25 A;  1URQ D;  3AVZ A;  3GCT F;  1T4V H;  5FCK A;  3D6Y A;  1ID5 H;  1VGC B;  2FDA A;  2NZ2 A;  4YXW D;  4BAO B;  4Y11 E;  4KTS A;  1QY6 A;  3PB1 E;  2FYU G;  4Y0Y E;  3KCG H;  2BLW A;  3HE5 B;  3PRJ A;  1EOL A;  2XKM A;  1EC5 A;  1TQ0 B;  3CNR A;  2C8W B;  2ANM H;  4XA4 A;  3MO6 A;  4OS2 A;  5EJ1 A;  5LPR A;  4P02 A;  2R2M B;  2P67 A;  1E37 B;  4K5Z A;  4BTU B;  2B88 A;  2RDL A;  3PMH B;  4IGD A;  1JEK A;  1GHA F;  2FOB A;  4H6S B;  2OQ5 A;  3H1K E;  4XE4 A;  4BAQ B;  2BVX H;  2F4L A;  1MBQ A;  5AVZ B;  3RK3 E;  1CGH A;  1PL5 A;  4L74 A;  1GI2 A;  1QGK B;  1KXC A;  5K5G B;  2GP9 B;  3UFA A;  2HOB A;  1SGI B;  4MPX A;  1C1V H;  4RSP A;  2KNC A;  3QTV H;  2QXH A;  3K6Y A;  1MFT A;  1KZU B;  2GUS A;  3V6I A;  5L30 H;  3A0H E;  1EDJ A;  2QJY C;  5JPM H;  1NM6 A;  1OSS A;  2M3E A;  2K37 A;  2FTM A;  2GV7 A;  1OVR A;  1GVL A;  2H9H A;  3MFJ A;  3OAA D;  1GZL A;  1LT9 A;  2CPS A;  1AJY A;  1E1R D;  2VID A;  3VB7 A;  2VVC A;  2BLV A;  1NU9 A;  1L4A B;  2ZFC A;  3L72 E;  1GBM A;  1YQ4 C;  1T3J A;  2KAI B;  2AGG X;  4TLF A;  1NN6 A;  1DST A;  3HD7 D;  1XVM A;  1YIJ P;  4Q7X A;  3S9B A;  5KAI E;  1H0T A;  1O2Y A;  5DSF A;  1KXD A;  3TGU J;  4CH8 B;  3Q3Y A;  2VIO A;  1THR H;  1ELA A;  1ELB A;  4MPW A;  4X1N U;  2RA0 A;  3A2A A;  2H9E H;  1FX0 B;  3ZVF A;  2BD3 A;  1NO9 H;  4MG3 A;  3NMD A;  1OIP A;  3N99 A;  4X1Q U;  2AHM E;  1AB9 B;  2KB7 P;  1GL2 B;  2FEQ H;  1L4A C;  1YC0 A;  1TNH A;  3W68 A;  3HD7 A;  3HTK A;  1JNM A;  3SQH E;  2WSC J;  1DXW A;  2O01 N;  1EAT A;  1NPM A;  4ZHM U;  3VXF H;  1YPL H;  1F5K U;  1VJA U;  3T27 A;  2YO2 A;  1KIL C;  3BTH E;  1LHG H;  5EU8 A;  1ESA A;  4ZMA H;  1W7X H;  3SN8 A;  1QQU A;  4MNY A;  1ZRB A;  5T6F A;  2QY0 B;  1RY3 A;  1K05 A;  2WTY A;  4GAW A;  2ZGH A;  1G3C A;  2G52 A;  4CRD A;  4H0L D;  3V4W A;  3AE7 C;  3TYY A;  1HGT H;  1HAY B;  1QJ1 B;  5JBC S;  1O34 A;  1AE5 A;  2QVA A;  1QTF A;  4JMY A;  4IMZ A;  4F4O C;  2J95 A;  1NTZ G;  1P01 A;  2ZCL P;  3GCO A;  1GI7 B;  3LON A;  2IYP A;  4FUC A;  2TBS A;  2Q7C A;  2IBZ E;  4MPU A;  1VGC C;  1K1O A;  4BAK B;  4ZKU A;  4YM9 A;  4WB4 A;  1MQ6 A;  1V2S T;  2A2X H;  3BRV B;  1V2P T;  5PTP A;  1QBN A;  3M91 A;  4VGC B;  1X9V A;  2TRM A;  3Q5R A;  2BY8 X;  5F8T A;  3RL0 C;  2OCV B;  3K6Z A;  3VOP A;  3MU1 A;  1LTT C;  4AG1 A;  1BCU H;  3CXH D;  3IF4 A;  3AE6 C;  4HG6 A;  5FBI A;  1NBM D;  3TIU A;  1NBM E;  2WT7 B;  1VF5 B;  1NHL A;  1C5L H;  3UQV A;  2IBZ G;  3CX5 I;  1BGY E;  1TA6 A;  2V35 A;  1X79 B;  1HBT H;  1A2C H;  3FX0 A;  1GBH A;  1L0N G;  2Y9Y A;  1FZF A;  2J9N A;  2JO1 A;  2XXL A;  4SGA E;  2IPQ X;  3H1I J;  1HGV A;  1EAS A;  1JCC A;  1RS0 A;  4THN H;  5FAH A;  4NZL A;  3RL0 B;  1WV7 H;  3IAO A;  3LGW A;  5AVQ B;  1O5F H;  1TNL A;  2C8Z B;  3NWU A;  3HK3 B;  3I5C A;  1MAY A;  1UHB A;  2WMM A;  2BVR H;  3A7V A;  1QVG O;  2WPI S;  4ISI H;  1YIT P;  2B87 A;  2RDE A;  3D71 A;  3ZVD A;  3H32 B;  5DP5 A;  2P8O C;  2FTL E;  3T2N A;  4BRY B;  1IHS H;  4H44 D;  1YI2 P;  3GCN A;  2D2C D;  1O5E H;  4QT8 C;  5L6N H;  4AB8 A;  2FYU J;  1LMW B;  3CEN A;  1YJN P;  3O8Z A;  1LPK B;  3EFG A;  3PV4 A;  1SGD E;  3HE4 B;  2OBQ A;  4UDW H;  1AIX H;  2FI4 E;  1IFD A;  1C1S A;  1PPF E;  4MPV A;  3L4F A;  1CT2 E;  1ABJ H;  3C8V A;  3LPR A;  1HUT H;  3RXQ A;  2E5T A;  1G36 A;  2AS9 A;  1JOU B;  2BDY A;  4ZHL U;  2Z9L A;  2O3J A;  1SQQ J;  1LDT T;  1YPM H;  3CWB D;  1ZOM A;  2EI6 A;  1FS0 E;  2V7Q D;  5JBT A;  3ITI A;  3B5N C;  3GG2 A;  1O3G A;  2ZU5 A;  4I8G A;  2GMT B;  1O5C B;  2FM2 A;  1O32 A;  3FP7 E;  3NZI A;  4ABD A;  1N7S B;  1M1J B;  1OWE A;  1GL2 C;  3TF5 A;  1XKA C;  5JB8 S;  1AB9 C;  1ORF A;  5B5E H;  1JY2 N;  3MNX A;  1KYO D;  2XWA A;  5C5N A;  3N7O A;  1GI5 A;  4O3U A;  3UUZ A;  1EZV D;  3BCC J;  1C5W B;  3U9A H;  1XUH A;  4I8L A;  1IJD B;  1W8B H;  2NU3 E;  4WMD A;  3RMM H;  3BEI B;  3IR9 A;  3SJK A;  3H6P A;  4L76 A;  1SQX K;  3CXH I;  3SU5 A;  3RXL A;  1VCQ A;  3GLM A;  5CCG A;  2PRR A;  3L73 G;  3CCJ P;  2ZGC A;  4CRB A;  3Q5S A;  2QA9 E;  3QWC H;  4UFD H;  4DCD A;  2F91 A;  3HTK B;  2YOL A;  3LGT A;  2AXT H;  2KXP B;  2D2D A;  3BTW E;  3ABV C;  2KSJ A;  2NU2 E;  4ZRO A;  1SQX D;  3CX5 E;  3RXG A;  4IFF A;  1GW3 A;  1PPG E;  2KFW A;  1VQ4 P;  1TMT H;  2QJY B;  1PP9 E;  2D2C C;  2WPR A;  5ETX A;  3RUO A;  7KME H;  3FFG A;  1W2E A;  1LT9 B;  4Y99 B;  2XNX A;  1A46 H;  1GMH F;  1ZSL A;  1WCZ A;  2O9Q A;  2ZFF H;  2EC9 H;  4GCH G;  1MAB B;  2ZF0 H;  1KC8 Q;  2BD5 A;  3NKK A;  3KQD A;  4FUD A;  4MTB A;  2AER H;  1TBQ H;  4Y10 E;  4K1E A;  2WSE H;  3DT0 H;  3CXH E;  1E38 B;  1P2O A;  1OHH D;  2OTK E;  1RXP A;  4CHA B;  2E75 B;  2WIN I;  1D6W A;  2F9P A;  3L6P A;  4JZ1 A;  1VPC A;  5DJT B;  1MAX A;  5AW8 B;  1UTO A;  1W0J D;  5AW5 B;  5GND A;  3TLO A;  1N73 A;  3RXD A;  1FZE A;  1YLD A;  2WPL S;  1HAP H;  1EX3 A;  4TT3 H;  1MTV A;  3M35 A;  3A88 A;  2Y5F A;  2ZCH P;  4YOI A;  1GG6 B;  1ZTJ A;  2QJP C;  1J1D C;  1ELF A;  2IPP A;  1LQE A;  3OE7 D;  4H44 B;  1B7X B;  1NFY A;  2V7Q J;  4I7Z B;  2ZWL H;  3FAN A;  3T25 A;  2QF0 A;  2W6J D;  2KR7 A;  5JB9 S;  1DLE A;  1GTW A;  1HJA B;  5EJL A;  3RK2 D;  3L73 E;  1LTG C;  4SGB E;  1O2M A;  1O2O A;  2IDB A;  3L75 J;  1ABI H;  4JF7 A;  5IK2 D;  3V2Q A;  1BCC J;  1KIL D;  2ZHW H;  1NAF A;  1NTK E;  3E7K A;  1YHQ P;  1IC2 A;  1HGZ A;  4R4L A;  1BZX E;  4ZMD A;  1NFX A;  3BTF E;  2R3S A;  5B5E E;  4C7N B;  3HE5 A;  3EQ2 A;  1ETR H;  1J16 A;  3OEE D;  1GDN A;  1YP9 A;  1SBW A;  4D9R A;  5F8X A;  1OWI A;  5KKZ C;  2OC0 A;  1GU4 A;  1EAX A;  3EA8 A;  1ANC A;  1MKW K;  1A5I A;  3PMJ A;  4WH8 A;  2ODY B;  1O3E A;  2O01 J;  3BIU H;  2ULL A;  1L0Z A;  1VR1 H;  1QNJ A;  5DP7 A;  2E42 A;  2H6M A;  1W2B O;  5SGA E;  2GX4 A;  3N7E A;  2V0B A;  1SI5 H;  1GU5 A;  4JZF H;  1TB6 H;  3MTY A;  1C5O H;  2QM7 A;  1YPH C;  4I8K A;  2SGD E;  1H8D H;  1E1Q D;  5DP3 A;  3D62 A;  3S9C A;  3KDP B;  3LDX H;  1HF9 A;  2Y0D A;  4NIV A;  1LWU B;  1SKY E;  3H1L E;  1YLC A;  2HGT H;  2XTT B;  3AE5 C;  1VQL P;  1O37 A;  4OGX A;  4Z0K A;  2C4F H;  1LKB A;  2HLO A;  3RXP A;  3CCS P;  1NRS H;  2FIR H;  1OXZ A;  4L73 A;  3PRO A;  1C5P A;  2ZTX A;  4X1S U;  4KJM A;  1K1L A;  3G01 A;  3RXC A;  4IW4 E;  2FS9 A;  1IK9 A;  2HOD A;  3K5B A;  2P2U A;  2A45 H;  1P11 E;  5DPA A;  1H8E D;  3P8C E;  2ZFS A;  1LVO A;  1A61 H;  3UOU A;  6GCH G;  1EZV G;  3OAK A;  5C94 A;  3F2F A;  2K1Q A;  4C46 A;  3OEH D;  4BXS A;  1ZXG A;  3H1J D;  1KXF A;  4A7I B;  3F9F A;  3L73 J;  3GHG B;  1QB9 A;  2BXU H;  1GBI A;  2WV5 A;  4JK6 A;  9EST A;  1HYL A;  1P2K A;  4K2Y A;  5DKM A;  1JM0 A;  3KQE A;  4K1T A;  4B6E A;  2JWA A;  1E35 B;  1OWJ A;  3MU4 A;  5E0G A;  3RXR A;  1C1M A;  1N8O C;  3LIW A;  3RXO A;  1RHZ B;  3U8O H;  1QHR B;  1JOC A;  3R3G B;  1HBW A;  1BE3 G;  3ITK A;  1D4P B;  2BX4 A;  1XMN B;  3KQG A;  1RJX B;  1GBL A;  3SUF A;  2O8U A;  2TGP Z;  1O2R A;  2HNT F;  4I1L A;  1O5A B;  2SNV A;  2WPM S;  5KLI B;  3ZZ9 A;  1FUJ A;  2QG4 A;  1VQM P;  1AKS A;  1XUI A;  1H8A A;  2BQ7 B;  3OX7 U;  2ZNK H;  3MQK C;  1QJ7 B;  3H7T A;  1IQE A;  2BCC D;  2FLB H;  2POH A;  2ODP A;  3P95 A;  4W80 A;  1O2L A;  2Q9I A;  1QRW A;  2XRC A;  3BG4 C;  5FX6 A;  2Y82 A;  1Q7Y Q;  1K04 A;  5EJZ A;  4BTI B;  1FY1 A;  2WVR A;  1BOQ A;  8EST E;  3L35 A;  2G8T A;  3TJO A;  3M9Q A;  1NTK D;  2ZT9 B;  5TIS H;  2FXR A;  1GI8 B;  4D6T E;  1QL7 A;  2QA4 P;  1YBW A;  1UTL M;  3QGJ A;  1SFI A;  1SQP J;  3U28 C;  1UTJ A;  2F9V A;  1IQF A;  4XE5 B;  1BIO A;  4X8U H;  4GHQ A;  3MD0 A;  1F0T A;  3PMB B;  4B2A A;  1INC A;  1NZQ H;  2H5D A;  1M56 D;  2G81 E;  3A86 A;  3PV2 A;  2IBZ D;  3JC2 2;  5FPT A;  1DT2 A;  1G3D A;  1LVB A;  1O33 A;  1SOT A;  1L0N D;  3AE3 C;  3SUE A;  3SV6 A;  1W2K H;  3W95 A;  1N2D C;  1KTT B;  1AO5 A;  2G8Y A;  3IG6 B;  5TJX A;  2UUY A;  1YJ9 P;  2R0K A;  4WF8 A;  5K7R A;  3ZDM A;  1QIX B;  3GDS A;  3PLP A;  1S9K E;  5GDS H;  3FGA D;  2OTJ P;  1E34 B;  3AEB C;  2BLO A;  3BEF B;  3BTM E;  3V4Q A;  1KYN A;  1KQF B;  1GJ6 A;  2ZDA H;  5JBB S;  4JZI A;  5CJ4 A;  1OVV A;  4YOG A;  1JIM A;  3QZQ A;  1NTM D;  2J4I A;  3ZIA D;  3S0N A;  1H4W A;  4M7G A;  4HI3 A;  1S5S A;  1WYK A;  1NWQ A;  3P6Z B;  4WVP E;  5C1Y A;  1LT1 A;  3MH6 A;  3NTN A;  8GCH G;  5IYT A;  1D9I A;  1KYO H;  2W7U A;  2WSC H;  1CSO E;  2LNC A;  3U8T H;  5AVS B;  3TNU A;  1YCP K;  4I7Z C;  4A92 A;  1KTM A;  1TX7 A;  3TH3 H;  4Q80 A;  1M1K Q;  1EZX C;  1O2W A;  2A5I A;  4OS4 A;  2Z94 A;  1GG6 C;  3Q76 A;  1FZC C;  3SOR A;  3EGK H;  1KYO E;  3LJJ A;  1N7S A;  2BDG A;  4Q7Z A;  1NRP H;  3HPT B;  3KNX A;  1NTZ K;  1MCV A;  1RE3 A;  2ZYA A;  2FO9 A;  4AG2 A;  3MWI U;  1SQP D;  1MV8 A;  2NPS D;  1NTZ J;  1GPZ A;  2XBX A;  4IOI H;  3IFM A;  1THP B;  3U1C A;  3U98 H;  1IQI A;  4U2W A;  3F89 A;  1GCT C;  1VQ7 P;  1BGY G;  2ZT9 C;  3UQO A;  3SNB A;  3TGI E;  2A7H A;  3CL3 D;  4U3F J;  1BCC G;  3MNS A;  4Z1M H;  4Y76 A;  4Y99 C;  2ZG0 H;  2BQ6 B;  3LH1 A;  4H6T A;  2R3Y A;  4RES B;  1B5G H;  1UK2 A;  1X0T A;  3SW2 B;  3SV7 A;  1URQ A;  2Z3C A;  5ABW A;  2XV5 A;  3WUT A;  3ZZC A;  4ABE A;  2EA3 A;  5CHA C;  4FVB A;  5GCH F;  2G5N A;  3RXF A;  1EP6 A;  2QJK C;  1SL3 A;  1S85 A;  3H32 A;  2PSX A;  3RC4 A;  1KV4 A;  4D9Q A;  3A7Y A;  1NU1 E;  1P3C A;  3A8B A;  5C0U A;  1MUU A;  2Z3D A;  2Y81 A;  2J38 A;  6EST A;  1JB0 J;  2ZJS E;  1IOE A;  1GHB F;  2C90 B;  1HTL C;  2FYU D;  1SQV E;  3U8R H;  5EW1 H;  5EQS A;  1BRB E;  3RXU A;  2R5D A;  4A7P A;  2IN2 A;  2BDC A;  3P17 H;  2BDH A;  1KIL A;  1T2K C;  4B74 A;  1FV9 A;  1GJ5 H;  1AFQ B;  1VQN P;  4LXB H;  2C9N Y;  4XRN A;  2GMT C;  2PR3 A;  1EB1 H;  1BTH H;  1N6X A;  3SUG A;  1ACB E;  1YPG H;  3L72 G;  2ZZU H;  4K3J A;  2PKA A;  3CXH H;  4WJG 2;  3SGA E;  1ARC A;  3SNC A;  1JY3 P;  1MZA A;  1LHC H;  1VQP P;  1SFC B;  5AW2 B;  3VMZ A;  1YTZ I;  3P7K A;  2ZFP H;  1O39 A;  1MD8 A;  1EPT A;  2SNW A;  2WSF J;  3HGN A;  5A8X A;  2JJ1 D;  4N78 E;  1ELG A;  1T8N A;  1KIL E;  4HJG H;  2WPJ S;  5AW7 B;  1C1O A;  4J2Y B;  1DD4 A;  3TK9 A;  3S9A A;  5KAF H;  2KCY A;  2XBV A;  1KFM A;  3PLB A;  1CE5 A;  5EQQ A;  2FX4 A;  5C1X A;  3MYW A;  4ISN A;  4FUH A;  2VIW A;  1LWU C;  1CBW B;  5E0H A;  1G1J A;  3GY2 A;  5DG6 A;  2AH4 X;  1CVW H;  3LH3 A;  4ABJ A;  2WSS D;  4F48 B;  1SQB E;  2Y5G A;  1BE3 D;  1T8O A;  3PTB A;  4GKG A;  2HR3 A;  4AQR D;  2BHG A;  4AC9 A;  4NA9 H;  2F3C E;  4GOE A;  1F5R A;  1P84 H;  2A06 G;  4WY4 D;  1FY5 A;  2LXC B;  2K1A A;  1OZH A;  2FXM A;  5AW9 B;  3Q00 A;  8GCH F;  1H9L B;  1FDI A;  1DUA A;  1K2I 1;  1YY3 A;  3PRD A;  1NYH A; 
#chains in the Genus database with same CATH homology
 3HUS C;  3RK2 C;  5AW1 B;  4C7N A;  1RY3 A;  2WTY A;  2KP8 A;  1HUC A;  3V4W A;  2XU6 A;  3TYY A;  1PFI A;  2OYH B;  4WY4 B;  1JY3 N;  3R2P A;  3II6 A;  4O9B A;  2C9L Y;  3GHG A;  2YKO A;  2R32 A;  1FOS E;  1RE4 A;  1DH3 A;  4OH8 B;  1IFM A;  2Q7C A;  4ZKU A;  5AVU B;  3RK3 C;  1S9K D;  4WB4 A;  3BRV B;  3V2P A;  4B86 A;  3M91 A;  1X9V A;  5AW0 B;  1SQV K;  2O1J A;  4I6M C;  3RL0 C;  3VOP A;  1LTT C;  2W6B A;  2VRS A;  1L4A A;  4IFM A;  3A3Y B;  3N7N A;  2WT7 B;  1GK6 A;  4AUW A;  1NHL A;  1N86 A;  2ZXE B;  1X79 B;  4EIJ A;  1J1E B;  2WWW A;  4LGD E;  1OWA A;  1X8Y A;  1NKZ B;  1FZF A;  5APQ A;  3V2N A;  3HUS A;  1HGV A;  4EOT A;  2YMY A;  1HJB A;  3B8E B;  1N7L A;  3VP8 A;  1SQP K;  1JCC A;  1FOS F;  1GL2 A;  4JYB A;  1ZN5 A;  1T2K D;  3RL0 B;  3OJA B;  3HD7 B;  1JCD A;  1FZC A;  3MIW A;  5AVQ B;  5KJ7 A;  3VMX A;  3I5C A;  2OYH A;  3RK3 B;  1RE3 C;  2FFD C;  1H88 A;  2XDJ A;  2O01 H;  2IX7 C;  2WPQ A;  3H32 B;  2KOG A;  3BAS A;  1A02 J;  1G1I A;  3PP5 A;  4WBA A;  4N78 D;  3O8Z A;  2Q5U A;  3EFG A;  5APU A;  3HE4 B;  3B5N D;  1Z56 A;  3UIA A;  3RK3 D;  1M1J A;  4M3L A;  3T97 A;  1IFD A;  3L4F A;  3RK2 B;  1M1J C;  1RF1 B;  1SFC C;  2FYU K;  2YO3 A;  2L5G B;  1MFZ A;  1ZLL A;  5AVT B;  2GM4 A;  1AQ5 A;  3B5N C;  4N3Y B;  1SFC A;  2IFN A;  1GK4 A;  1FDM A;  4DZO A;  1N7S B;  1M1J B;  1GL2 C;  5CCH A;  2LKM A;  1JY2 N;  2GUV A;  2IFM A;  1NU1 K;  2FFD A;  1IJD B;  3IR9 A;  3H6P A;  1SQX K;  3G3Z A;  1SVF A;  2HOD B;  5CCG A;  3VYI A;  4DOJ A;  1N7S D;  3HTK B;  2CPB A;  5CCG C;  1A02 F;  2KSJ A;  1NO4 A;  2I1K A;  4IFF A;  1GW3 A;  4WY4 A;  3V2R A;  4LLH A;  2WPR A;  1CSB A;  2HPC A;  1W2E A;  1LT9 B;  4Y99 B;  2XNX A;  2R3C A;  5APY A;  2R5B A;  1FBM A;  2Z4E A;  2N9B A;  1T8Z A;  4AYC A;  1LTS C;  3L37 A;  3N4X A;  1LWU A;  1FZG A;  2WSE H;  1JO5 A;  5BU5 A;  3B5N A;  1XTC C;  1VPC A;  5KTB A;  1J1E C;  2PAJ A;  5AW8 B;  5AW5 B;  1N73 A;  1WRG A;  1FZE A;  5AVX B;  2BAS A;  3MUD A;  2HFE D;  1SFC D;  4N6J A;  2JJL A;  2QM8 A;  1GD2 E;  2YKP A;  1J1D C;  2IPP A;  1NTM K;  5BVZ A;  1G2C A;  2I1J A;  5AVW B;  3CI9 A;  2NPS B;  2OYI A;  1JY2 P;  2Q3I A;  1GTW A;  3KYQ A;  4IFD K;  3RK2 D;  1LTG C;  1YTZ T;  1DEB A;  4JF7 A;  3V2Q A;  1KIL D;  1FU1 A;  1NAF A;  1LTI C;  1IC2 A;  1HGZ A;  1FZB A;  1RE4 C;  4C7N B;  3HE5 A;  3EQ2 A;  4WY4 C;  2OYH C;  1AFO A;  1M7L A;  5CJ0 A;  1XTG B;  3A5T A;  2NPS A;  3TSI A;  2OYI B;  1GU4 A;  2XZR A;  3HUS B;  2W27 A;  2Z5I A;  1FZC B;  1JTH B;  1KIL B;  3M0D A;  2H43 A;  1KQL A;  5APT A;  1N73 C;  2C0W A;  1SQB K;  2E42 A;  1GU5 A;  1HVV A;  1RF0 A;  1WT6 A;  2QM7 A;  3KDP B;  1LWU B;  3C9I A;  3NFQ A;  1G2C B;  5AW6 B;  2HLO A;  2OYI C;  1OXZ A;  2KYV A;  1J2J B;  2HPC B;  5KJ7 C;  1H89 A;  1IK9 A;  2HOD A;  3CLQ A;  5CCH C;  5CHX A;  2P2U A;  2A45 H;  1MZ9 A;  3VN0 A;  3BAT A;  3P8C E;  1VDF A;  3OAK A;  3SWY A;  3LIE A;  2NPS C;  4C46 A;  2N1T B;  3GHG B;  5APV A;  1GL2 D;  1FAV A;  3BRT B;  3M0D C;  3M0A A;  1CW5 A;  1SQQ K;  1E5W A;  1FJK A;  3TNU B;  1IO4 A;  1CI6 A;  1LTJ A;  1JOC A;  1HBW A;  1HH0 A;  2O1K A;  1L0L K;  3KQG A;  1URQ C;  2FYZ A;  2OAR A;  5AVR B;  3L36 A;  4I1L A;  2N1T A;  1NOH A;  1L4A D;  1LGH B;  1RF1 A;  1H8A A;  2N1T C;  5APW A;  2POH A;  2WIT A;  4W80 A;  2WZ7 A;  3VP9 A;  5AVV B;  1NKN A;  4JYC A;  2Q9I A;  1CI6 B;  1LTJ B;  1IFN A;  4LC1 A;  5KLV K;  2E43 A;  3L35 A;  2A45 I;  3HRN A;  2A45 G;  3M9Q A;  2M3B A;  3U1A A;  3M9B A;  3MGN A;  2WPS A;  2HG5 D;  1URQ B;  5AW3 B;  1IFI A;  4XE5 B;  3MD0 A;  1SP4 A;  2H7H A;  3LW5 H;  1HWT C;  2WSF H;  1N7S C;  2C0X A;  3GHG C;  1N2D C;  1N73 B;  3P32 A;  2MJZ A;  1QL2 A;  1S9K E;  1SLQ A;  5APS A;  2H8P D;  1RF1 C;  4I2L C;  3RL0 D;  3V4Q A;  2WT7 A;  4W7Y A;  1NTK K;  5CJ4 A;  2P7J A;  2J59 M;  2HYN A;  3NXS A;  2N1T D;  3P8M C;  1NH4 A;  1GDT A;  1JTH A;  1DX7 A;  1NWQ A;  2FKW B;  3NTN A;  3V5B A;  4HH2 A;  1JY3 O;  4W7Z A;  3MTU E;  2WSC H;  3P8C D;  2FFD B;  5AVS B;  3TNU A;  1J1D B;  1FZC C;  4KHX A;  1N7S A;  2YKQ A;  1NTZ K;  1T3U A;  1RE3 A;  2Z5H A;  1MV8 A;  2NPS D;  1GW4 A;  3IFM A;  3U1C A;  5AW4 B;  5BU8 B;  1LTB C;  4GT1 A;  1ZR4 A;  2M8R A;  3KPE A;  2P1J A;  3M06 A;  3CL3 D;  1RF0 C;  5KJ7 D;  4Y99 C;  1LTJ C;  4RES B;  1JMM A;  1IFJ A;  1URQ D;  3A7O A;  1JY2 O;  1URQ A;  2XV5 A;  1KFN A;  3WMM 0;  3H32 A;  2YNY A;  3HE5 B;  2XKM A;  1MUU A;  5CMZ A;  4XA4 A;  3VMY A;  1L0N K;  2P67 A;  1LTA C;  1HTL C;  1QL1 A;  2KLV A;  1YYC A;  5AVZ B;  2R5D A;  1FJP A;  3TK1 A;  4C7R A;  5AVY B;  1KIL A;  1T2K C;  3BVH A;  1FZA A;  2C9N Y;  1JUN A;  2PP6 A;  1LT9 C;  1KZU B;  2GUS A;  3U59 A;  4HYT B;  3VTP C;  1JY3 P;  2J58 A;  3HE4 A;  1GZL A;  1LT9 A;  2CPS A;  1SFC B;  5AW2 B;  3VMZ A;  1YTZ I;  3P7K A;  3LID A;  1L4A B;  2ZFC A;  1ZR2 A;  1T3J A;  3HD7 D;  4N78 E;  5AW7 B;  4ZKP A;  1KFM A;  3M9H A;  3A2A A;  5CCG D;  1LWU C;  3NMD A;  1G1J A;  1ZV8 A;  3E1I A;  5CCH D;  2KB7 P;  1GL2 B;  4GKG A;  4AQR D;  1L4A C;  3HD7 A;  3HTK A;  1CZQ A;  2JEE A;  4GIF A;  1JNM A;  5APX A;  4WY4 D;  2W6A A;  3B5N B;  2FXM A;  5AW9 B;  1EQ7 A;  3OA7 A;  3HD7 C;  2YO2 A;  3SWF A;  1KIL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...