2PP6A

Crystal structure of the atp-binding sugar transporter-like protein from salmonella typhimurium
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
88
Chain Sequence
b'SNAMADLFDGMKRRMDALIAERFGMKVNINGTDCIVVESDFLAGKNVVVFSGNVIPRRGDRVVLRGSEFTVTRIRRFNGKPQLTLEEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gifsy-2 prophage ATP-binding sugar transporter-like protein
publication title Crystal structure of the ATP-binding sugar transporter-like protein from Salmonella typhimurium.
rcsb
source organism Salmonella typhimurium lt2
molecule tags Transport protein
total genus 18
structure length 88
sequence length 96
ec nomenclature
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13856 Gifsy-2 ATP-binding sugar transporter from pro-phage
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2pp6A01
2.40.10.210 Mainly Beta Beta Barrel Thrombin, subunit H Phage tail proteins (gpFII-like) 2pp6A02
2NPSD 2N1TA 2NPSA 3B5NC 1L4AD 3RK2B 1L4AA 2HG5D 3TSIA 1T3JA 3KYQA 2M8RA 3RL0B 5KJ7C 2XDJA 4WY4C 2YMYA 1GL2D 1GL2A 1N7SC 5CCGD 3RK3B 1XTGB 3RK2D 2N1TC 2NPSC 4WY4B 3HD7C 2PP6A 4LGDE 3P8CE 3HTKB 3RL0D 1HVVA 3B5ND 3B5NB 4W7YA 1URQC 3HD7B 2HFED 3M0DC 4W7ZA 5KJ7D 1KILC 3RK3D 3PP5A 5KJ7A 1SFCC 5CCGA 5CCHC 1GL2C 1JTHB 1URQB 1NHLA 4WY4D 4WY4A 1L4AC 1N7SB 1N7SD 1KILB 1SFCB 3B5NA 2N1TB 2NPSB 4OH8B 2H8PD 3HD7D 4JF7A 3RL0C 3HD7A 1L4AB 4W80A 3VOPA 1URQD 1JTHA 1URQA 5CCGC 3RK3C 3RK2C 4N78E 2WZ7A 1N7SA 1KILD 2KOGA 1SFCD 1KILA 5CCHD 1GL2B 2N1TD 1SFCA 5CCHA
chains in the Genus database with same CATH superfamily
2P16A 1FZZA 2WSCH 1BGYE 1NFUA 1CSBA 2ZFCA 2KZ4A 3UNSA 3L71G 1NBMD 3GY4A 2ZDAH 1AVGH 3MU8A 1HGTH 5B66E 1L4AA 2VU8E 4P00A 2ZQ1A 8KME2 1MBQA 4J1YA 1SG8B 4HKZH 3EFGA 1BZXE 1NU7B 5H4IB 1C1MA 1TA6A 4PD4I 3A89A 3GICB 1T2KD 4KTUA 1S6HA 1OPHB 4JK6A 4DJGA 1E35B 4KT0J 1QCPA 3HUSA 2YMSD 2V35A 1S4XA 1ZMEC 1J14A 2WPJS 1TX7A 3FWLA 5T3HA 1D4PB 3TVJB 1TMUH 3TH4H 4GIFA 1Y8AA 3PMBB 5CCGD 3UAIC 4Y10E 3QLPH 3S9OA 5TCAA 1GI2A 2WITA 2J4IA 3GDUA 3SHCH 5DP3A 5C39A 2BZAA 4PV1B 1ZJDA 4DIHH 1C9PA 3B8JA 1LCYA 2KNCB 4DIIH 3Q5SA 1GMJA 3DHKH 3ZZ6A 4OGYA 3L75G 4LGDE 1AHTH 1WQSA 4NFEA 2BD4A 3RXFA 1ZYOA 3RL0D 1O2XA 4DCKA 5EOKA 3L72D 1NTZD 3TNUA 4Y99C 2W26A 5JYIA 3PO1C 1YPLH 2FPZA 2OXSA 4X1QU 2BVSH 4K3AA 9ESTA 3RLWH 4HG6A 5A0BA 1G2CB 3BIVH 5BU5A 3IF4A 1YPEH 4X2XA 3M0DC 1BMFD 1UIXA 2GD4B 4U2WA 1PP9G 5EJZA 4RESB 1BBRK 1L1GA 2E5TA 1HXFH 1TALA 1DE7H 2SGDE 3BEIB 2PKAA 3F2HA 4M7GA 3RXKA 2FWWA 3LC3A 3LU9B 1GWAA 1TB6H 1BCCD 2ZFTA 5CHAC 1AZZA 3VMAA 1THRH 5FCRA 2C0XA 1SQXE 1OP0A 2GZ7A 1TGBA 3CX5D 1XVMA 3A83A 4PD4H 2GUVA 2BB4A 1ESBA 4I32A 3L71D 1N7SB 1RTFB 5APXA 3E90B 8GCHF 1NU1E 2AGIX 4U3FJ 1E0FD 3MH4A 1COWD 4DW2U 1CHOG 3JZ2B 4FU8A 3CENA 2TIOA 2QCYA 1ZSJA 4JMYA 1QBOA 2VB0A 3MNBA 3U28C 1AWHB 5CDFE 3MNSA 4Y71A 1SS1A 2XBYA 2NZ2A 1K9MQ 1F5RA 1TFXA 1FBMA 2YO2A 3KN2A 3AE1C 1JIRA 4DT4A 6GCHG 1V3XA 1GBEA 3ZVDA 2XV5A 2V3HH 5KLVE 1EB1H 2VWLA 4ISOA 2VGCB 3U1CA 1NKNA 1PFIA 3SU3A 3LH1A 4JYUH 4ZROA 3Q00A 2HYNA 1P2JA 4K1TA 1MTNB 2GGVB 5HIZA 3A7VA 1Q31A 3RU4T 1GL2B 1ZMJA 2PTCE 3A85A 1HF9A 5BVZA 5APTA 1ESTA 1VITG 2JJ1D 3L73G 3FZDA 1O5CB 4IC6A 1Y9BA 1OHHD 1A7SA 1TX6A 3D23A 3UQOA 1MKXH 3CX5I 2ZCLP 4ABDA 5AW6B 1C5RA 2LP6A 2A0QB 3TLOA 3JC22 2B9BA 1KORA 1GCTB 3FP7E 1IAUA 5A8ZA 1O3DA 5AW9B 1MFZA 2M8RA 1GPZA 1VJAU 1GW3A 1PP9D 1N73C 1OWDA 2FX4A 2SNWA 3DFJA 2A5KA 5AFZH 3T29A 3NTNA 1PV3A 1H8DH 4Y0YE 4ZHLU 2XU6A 1JO5A 2EQNA 3M0DA 3SNEA 2STAE 2XCFA 5F8TA 1RE3C 1WV7H 1YJ9P 3D65E 2WINI 1ELTA 4WY3A 5HM9A 3S0NA 1W11U 4NSVA 3ZVGA 1T8NA 2I1JA 3ATLA 3QDZB 2R2MB 5EJLA 1XTGB 1KC8Q 1BIOA 1QQ4A 2KAIB 3SJKA 1SQVK 3FXEA 5A0CA 4GLYA 4ZXXH 1LP1B 2C8XB 3KYFA 5APUA 1HBWA 2BQ7B 2TGTA 1QNJA 1JMOH 1GBDA 1F0UA 2HODB 3P8CE 2GDDA 3N7DA 2BOHB 4RN6A 3RDZA 5AW3B 3L4FA 1MQ5A 1X7AC 1P11E 1O33A 3OAAD 5C20A 3AEEC 3JSVC 3O8BA 4SGAE 1C1PA 2I8DA 4RKUJ 5JPMH 1DXWA 1H8HD 1OSSA 2UWLA 5GNDA 3SOSA 2QV1A 2ANWA 2FFDA 1GI9B 4CBOA 2FY8A 1XTCC 3L70E 1TYNA 3MO9A 4X1SU 1WYKA 2FXPA 2BXUH 2PWXA 1TPAE 3SU4A 1XM1A 3FP6E 1QRZA 1YITP 3EGKH 3GY6A 3LGUA 2O01N 2BVRH 1O38A 1P9UA 5EODA 4I7ZB 1JEKA 1V2KT 1O3NA 2ZECA 1OVVA 2QE7D 5C67A 1PPEE 2Y9YA 3OX7U 2ZFSA 3L73D 3V0XA 4KTSA 3CWBE 2ZGCA 4ABGA 5L2ZH 4H13D 1QL1A 3GCHC 3U1IB 2ZT9B 1JBUH 3LGWA 1AB9C 2J94A 4B74A 1Z56A 1C1TA 2R2WU 4GHTA 2W8ZA 2EA3A 3HTKA 3A7TA 3A3YB 3LIWA 1AKSB 2J34A 2RMZA 1N7LA 4ISIH 5L30H 2FP7B 3RM2H 4FUGA 1SR5C 3II6A 1VQPP 1T2KC 2PTNA 1GI6A 3HATH 3PV4A 3DD2H 5B5EH 1PPFE 1U57A 3PTBA 1IJDB 2WV5A 2MKVA 3H1LG 1N73A 4TLFA 5ABWA 2NWNA 1GJ8B 1UTLM 1VQ8P 1DICA 3NXPA 1WBGB 1UVPA 1GBMA 5HMAA 1ZN5A 5CCGC 4K60A 1RE3A 2E42A 2LPRA 3RXAA 2ZU4A 4Q7ZA 4IFDK 3LJOA 3ELAH 3NXSA 3QK1A 2KOGA 2E74C 2F9BH 2ZU2A 2YKPA 2WMMA 3SI3H 2FOFA 4CR5A 1TABE 1GU4A 2IPPA 1OX3A 2HR3A 1VQKP 2ZTZA 1GBAA 2QC2A 3A7WA 4YXDC 4BNRA 3SUEA 1O3AA 1RQUA 4MPXA 2ZGHA 2G5NA 5C3NA 4RT0A 3A0HE 1DVAH 4XE4A 2W27A 2GM4A 1J1DC 1EZQA 5AVDA 3T28A 2ZAEB 3ODDA 1CBWB 4THNH 1NTME 3M0AA 2Z3CA 3FFGA 1C2EA 2R9PA 4K8BA 3V7TA 5HGGA 1HJAB 2ZDVH 3TJVA 1TX8A 1J15A 1BE3E 1ZOYC 1W12U 2PKSB 2LXBA 3VXEH 1YLNA 4EI2A 1SLWB 4ZNCA 2BHGA 4O3TA 1N6XA 1Q81Q 1OWHA 1U7JA 2C8ZB 4FU7A 1GG6B 4YESB 5JBCS 1OYTH 3SFDC 1UO6A 5L6NH 1L0LE 3O6QA 1ARCA 1MAYA 3VB6A 2A2XH 1SQTA 3WMM0 4AGJA 2Y5GA 4NFFA 2QF0A 3L74J 3IG6B 2HVYB 2PGDA 2MJZA 2KIKA 1MU8B 1TBQH 1SQXD 1DFPA 3PV2A 1Y3YA 7GCHF 2XW9A 1YCPK 1G3EA 3HGPA 2YNBA 1GDTA 3SUFA 3ZZ8A 2OQUA 3MNXA 1ZLLA 2P59A 1ZHPA 2F91A 1VQLP 1NN6A 3H1LD 1O3BA 5DPAA 2QM7A 1AFQC 2POHA 1O3FA 2WPHS 1VQ5P 1J1EB 2ZU3A 1GI0A 2WSFJ 1SKYE 2OARA 2RA3A 1DXPA 1HB0B 1Q7YQ 3A7YA 2AMDA 2Q1KA 3RK3E 3BIUH 1HNEE 4O3UA 1HUTH 3R3GB 2R32A 3PP5A 5KJ7A 1D6RA 1W7GH 5CCGA 1VR1H 1D3TB 1GHAG 1L0LK 1YJWP 2OYIA 1URQB 4WY4D 5KLVD 4A7PA 1RE4C 1GGDB 2JETC 2C0WA 1P9SA 4Q7YA 3W95A 4AYCA 2P3FH 3BG8A 2I6QA 2XC4A 3K2UA 3KQCA 1KTSB 2B8OH 4UFGH 1ZPBA 1TNGA 1C5MD 1JY3P 3VB5A 2QN5T 5AW4B 1TRYA 5C1UA 2AGGX 4UB6E 5APQA 3S4RA 1TNKA 2XTTB 3AAUA 3URDA 1P84E 4KP0A 1BBRH 4A1TA 1GJ6A 2QVAA 2XNDD 3HKJB 4UB8H 2BCCJ 4E7RG 2P58A 1RF1A 3EDXB 2ZDNA 4MPUA 5FX5A 3GY2A 5KECA 3GCTG 3SZNA 1Y47A 2Z3DA 3IN6A 4ZHAA 1HIAA 4WMDA 2H89C 1L2EA 5GIBA 1JWTA 2IFMA 4H42U 1ZPZA 3QUMP 2W7UA 1BRUP 1PGOA 4KHXA 1S5SA 3BVHA 2K8IA 4BAMB 1IQGA 5APSA 4Z6AH 1L0NK 1HRTH 2FTMA 2Q6DA 1O3PB 2PSXA 3A86A 1FONA 4MNYA 6ESTA 4D6TJ 4ZKNU 1OKXA 2FZZA 2K88A 2WPIS 4AYYB 1C5SA 3AE5C 2GP9B 1SFCA 3L37A 3SNAA 1LTJB 3N4XA 3CXHH 1ORFA 2WPKS 1UCYE 3RC4A 5AW8B 4GT1A 3BCCE 3RXEA 2ZA5A 2XWBI 1L4AD 2OUAA 4RKJB 1O3HA 1IQMA 1AE5A 2WPRA 1LPZB 2OBQA 4ISNA 4DOJA 1Q82Q 1GU5A 1IFNA 1AQTA 2FYUE 3UWJH 3RXOA 4CRAA 3ZZDA 3CC7P 1BCUH 2K9JA 2EI6A 2IDBA 1O35A 1V2VT 3M36A 3E1XB 1OX1A 4QT8C 1G2MA 1GMCG 1O2IA 1ZGVA 3P8CD 1EJAA 1K04A 4O97A 2ZHWH 1FPHH 3ATIA 1EDLA 2BOKA 1SGIB 1O3KA 5GCHG 2NRGA 2QIQA 1V2OT 1FAVA 4ISHH 4MLFB 3MIWA 3L74G 4YPCA 2QRXA 1HUCA 4YXWH 5GTIH 1DWEH 2O3JA 4FU9A 2FOCA 4JYVH 1RRKA 4IFMA 5GWZA 3RK2D 1TA2A 1U7MA 3RGUA 3A8DA 4JZIA 1O2ZA 1C5PA 1P01A 4BAHB 1BRCE 4INLA 2PP6A 1HLTH 2ODPA 4KTCA 2BEZF 1EPTC 2PAJA 4H6SB 1E37B 3B5ND 3IITA 3CCRP 1G30B 4OVNF 4GKGA 4MPWA 1DLEA 1SGDE 5KAIE 3TK1A 3KEEA 1CA0B 4TYDA 5E2PA 4XE5B 2W3IA 1ZHRA 3ZVCA 2IOTA 1MMJN 4NIWA 3AEFC 1ZW0A 1H0TA 2Z9JA 1N8OC 1SGYE 1E5WA 4TWWA 3PTZA 2K37A 2E5YA 2XCNA 3OW2O 1C5XB 1SQPJ 1FY1A 1O3GA 1ZRTE 2AS9A 1QHRB 4Y11E 1WDIA 1JCCA 1AVOA 1JTHB 1H89A 1ELBA 1T4UH 1KDQA 2QF3A 3F9HA 2PGBB 1MZDA 3JCUH 2Y0DA 5AVWB 3BRVB 3ZIAD 5APYA 4I7YH 1TPPA 1YQ3C 2VH6A 1O5FH 1CT2E 3H1KE 1RD3B 1JCDA 3M37A 3AEBC 3E1RA 1ABIH 3GCOA 4ACAA 1CHGA 1F92A 3ATWA 3K6ZA 3UNQA 5A2MH 3H1IE 3MNCA 5CHAB 1QEXA 1BT7A 4HZHA 2BDAA 1EP5A 3S7HB 2EI7A 3H32A 1LVMA 1K05A 3P32A 2BLQA 4X2VA 3SU5A 4CHAB 3WUVA 1TGCA 1X8YA 1P2NA 1IK9A 1NO9H 1EOJA 3MHWU 4NCYA 1ZGIA 3SV2H 3RXUA 3F68H 4TT3D 1EZVE 1SQPK 2G55A 4DVAU 3UQVA 2A45G 1NTMD 1T8LA 1OXGA 1GJCB 2H9TH 2M5AB 4NGAH 4ACBA 4N3YB 1TMBH 5HIYA 4OGQB 5KAFH 3M5LA 3EE7A 2UUJB 5FX6A 3WW7A 1HGZA 2A45B 1ACBE 1LTGC 1KIGH 2FYNC 1KILA 1Z8JB 1YBKA 2BVXH 2KCYA 5AVYB 3E8LA 5KLIB 3BF6H 4OS6A 3SU2A 4OS1A 1HAPH 2YXQB 1O32A 5CHBA 1DUAA 2AFQB 3CMAP 1OWJA 3GF3A 2FEQH 1L0ZA 3C8VA 1FUJA 1DX5M 3PLNA 2VWOA 4E05H 2HGTH 1EPTA 1KTMA 2W7SA 2AGEX 1VGCC 1DEEG 2KLUA 3B8EB 2Q9IA 1ELAA 1O3LA 2W3KA 1DDJA 3GY3A 2QA4P 1BMMH 1V2TT 3MU0A 2UWOA 3PROA 4NSYA 1HJ0A 1EX3A 2J59M 1MKXK 2SGFE 5HM2A 2OTLP 4BAQB 1O31A 3I56P 3L72J 1NTZJ 4U32A 3AEDC 2ZNKH 2BY7X 3TNSA 2SGPE 1N86A 3T97B 2JP3A 4WY4C 1MAXA 1YTZI 1T3UA 4ZKUA 5GXPA 3BSQA 2A2QH 1QVGO 1THSH 1SGPE 1UK4A 1NYHA 3GHGA 1LT9C 3VTPC 2A5IA 2OC7A 2PW8H 2V0BA 1RHZB 4MVNA 4GCHG 1SQQE 1A0LA 1NTKE 2FOEA 3SQHE 2VIVA 2BD5A 1TPOA 1W10U 5DJUB 1UHBA 1S81A 2ZEBA 4NA7A 5E0GA 3L71J 2H1UA 2ZP0H 4H0LD 3NK8A 1HVVA 3OE7D 2EI8A 3MFJA 1KYOE 1LTOA 3BTEE 5T6DA 1P3EA 2OBOA 3H7OA 2WSEJ 3HPTB 3TGUE 1F0RA 4GAWA 3MHVA 2PHBA 2ZVNB 2Y7XA 5TCCA 3RMMH 3BTDE 1EAIA 1GVZA 1GJAB 4X0WU 4BXWA 5GTHE 2G4UA 5APVA 1ZR4A 3GY5A 4HB1A 5B5EE 3HKIB 2Z4EA 2B88A 1O0DH 1K2I1 4NIXA 4XSKU 3VMXA 5ESBA 1TLDA 2IZ1A 4UDWH 1HJBA 4DJZB 1KXFA 1C1SA 3A8BA 1L4AC 2BDCA 2VVVA 2FBWC 4K8YA 1W0JD 3VB7A 2FOGA 1WOFA 5DP7A 1BMAA 5L2YH 1QX8A 3RBZA 4C7NA 4NPEA 4ABAA 3Q3KA 4IOIH 1GVLA 1PGJA 3F3BA 2ALVA 4I8KA 1DEBA 1KB9H 2OQQA 1R8EA 1KXEA 1AB9B 3HUSC 1AMHA 4RO0A 1FY8E 4WMEA 4L73A 1KLIH 5EQRA 4ZHMU 1SC8U 3SWKA 1QJ7B 2FYUD 3W68A 1OZHA 2R0LA 2ZGBH 2YKQA 2CJIA 1PP9J 1MFTA 1EZUC 2FOAA 5J4QA 1LKAA 2ODYB 1IQJA 3HE4A 4ZKSU 4YT7H 1O3IA 1P02A 3RK2C 2A45I 1XKAC 2M2AA 1DY9A 2YMSB 4IS5A 1LT9A 1LWUB 4JBZA 1J9CH 5LH8A 3P6ZB 1LPGB 2WSFH 1SPJA 1SQRA 1IOEA 2XNXA 1HAZB 1P06A 3U69H 5CBOA 2P2UA 1ZSLA 2AIPA 3PLBA 3KNXA 3SO3A 3DFLA 4YM9A 2BY8X 3B5NC 2BX4A 1DOJA 3FKSD 4DG4A 2K1AA 3DUXH 1DH3A 1K22H 1FXYA 2ZHQH 3MUDC 4Y8XA 3MQKC 1S85A 3F0PA 4K2YA 2RG3A 3VN0A 4D9RA 2QM8A 2XKMA 2WWWA 4X6PA 3QWOC 2AEJA 3ZZ3A 3LIDA 2R5BA 3HK6B 3NFQA 1LNQA 3RL0B 1SGEE 3V2RA 1KMHB 3OTPA 3ZZ9A 3HE5A 1RFNA 2OTJP 1SGTA 4CBNA 1LTSC 1TWXB 2ZPQA 1E1QD 3MP7B 1J1DB 1BCCG 1UVTH 2V7QD 1N8RQ 4Y8ZA 1GI8B 2JDIH 2CV3A 1YTZT 3M9BA 3MOCA 3WWBA 3Q3XA 1LHCH 1E34B 1KXCA 4N6JA 3U1JB 3QO6A 1IQEA 1TNJA 2N1TC 5C17A 1M1JA 3L73J 2W6JD 1M57D 1YPHE 4MNXA 5B6OA 2H2ZA 4U30A 1VCPA 2R3SA 2R3YA 5T6GA 5AVVB 3PMJA 2IJD1 1QB6A 1H9HE 2O8MA 1H1BA 2A45H 5CJ4A 1PQ8A 1OW6A 2V4HA 2GT7A 3M3SA 2ZFFH 2NU2E 3BG4B 3ZZCA 2KP8A 3UIAA 1CU1A 1V2PT 1EUFA 1BBRE 1O2JA 2GCTC 3P70B 1V2UT 5EU8A 1KD1Q 3P8FA 3SV8A 3AEAC 2SPZA 4UB8E 3NWUA 5KJ7D 1ZMLA 3HRNA 2BDGA 1VF5C 1LVBA 3IAOA 4F55A 4RI0A 5AF9H 2J98B 2KR7A 3OAKA 1W8BH 3QZRA 1SGQE 4FUJA 3USSA 1O30A 1BTHH 2E74D 2GA1A 1BA8B 2ZWLH 3FAOA 5A09A 2PRRA 3UTUH 1KYNA 1TGNA 1X79B 1O3OA 4MQAA 1ZXGA 3B5NA 1GHXH 4AN7A 1GJ9B 2QJPC 3MUDA 1ZRBA 2JETB 3H1HE 1YP9A 1DD3A 3BTFE 2PSYA 1OW8A 3UUZA 1Z8GA 3HD7A 1A3EH 1ESAA 1XUFA 1GCDA 2Y5HA 3CXHE 1J8AA 3D62A 3F0OA 4PJ0H 1NM6A 1N1LA 1S9KD 1JY2P 1VQ6P 4X8TH 1C1VH 1Z1IA 4EIJA 2OGUA 5M1BA 5DN6D 3KXDA 1CHOF 4AUWA 2PV9B 1EAUA 3P8NA 2WPSA 1NRRH 3M91A 4FOUC 3RK3C 3H1JE 1SQBG 2ZXXA 3CD6P 2OK5A 4U3FE 1P12E 5LPEA 2FX6A 3VB4A 1SFCD 4Y79A 5AVXB 1S1CX 6GCHF 2R5DA 1GL0E 2FOHA 4FUEA 1SGNE 2STBE 3F6UH 4B6FA 2N1TA 4H0LC 1RIWB 1C2LA 1D3PB 1SI5H 3QTVH 5EXMA 5GTIE 1KLTA 2KCOA 2CK3H 2ZCHP 2Z9IA 3DT0H 1SQQD 4IBLH 2C3SA 4YLUA 1LQDB 1P2KA 1GMDG 2E75C 2FFDC 2OYHB 1NTKD 3MU5A 1AV1A 4FVBA 2YIUB 1Y3UA 3RXRA 1SQXJ 5F8XA 1S72P 3KQ5A 1GK6A 5AW0B 3KQBA 4DY7B 2GMTC 5HKKD 1D6WA 1KZUB 2JH6D 4WMFA 3W94A 1VITF 1CW5A 1AZ8A 2GZ8A 2ZPRA 1GHYH 1K1IA 3H1LJ 2ZPSA 4B2AA 1CI6A 1KYOD 3CCMP 3SGAE 2BLOA 3PLKA 1GBKA 2W6BA 3ENSB 1F7ZA 2C90B 1WXRA 5DG6A 5EPNA 1FJSA 2IBZE 3E0PB 5A8XA 2HNTF 2E76B 1DWCH 2FIRH 2P93A 2WPLS 1SQVE 4DT0A 3L6PA 4B1TA 4O9VA 1JRTA 2Y9ZA 2QGRA 5APWA 4L76A 1ZP0C 1BDAA 2ANYA 3RLYH 2NPSC 4AFUA 4XFJA 2ZFRH 4K1EA 3AE2C 1Z71A 3D6YA 4H13B 1O5AB 2C8YB 1BMLA 2KZJA 3JCUE 2FESH 1KMIZ 1YKTA 3A7XA 1FZGA 1BGYG 2CHAC 1K28D 1PPJE 3ITIA 2BXTH 1EASA 2BDIA 2W90A 4KJMA 3ZV8A 2BX3A 4Q80A 3ODFA 1NAFA 5K0HA 2QSIA 2UWJE 6CHAC 1LGHB 3GOVB 1Y8TA 2A7JA 3SU6A 4IL6H 1ETRH 1SQBD 2HALA 4X8UH 3SV7A 2BDYA 2A7HA 1ELDE 5CMXH 3LH3A 4PROA 5AFYH 4MN4C 3RC5A 3RXLA 1EOLA 1P8VC 8LPRA 4CR9A 2HWLB 3EA9A 5I25A 5DP6A 3UNRA 1J2JB 3MO3A 1SFQB 1N7SD 1L1JA 1ABJH 4I31A 4VGCB 5KAFE 1HV7A 1TOMH 2B87A 4B6EA 1LKBA 1UTQA 3SJOA 3KF2A 3Q3YA 2XC5A 3NUMA 5KKZC 3I78A 3AASA 3U8TH 2AMPA 1AVWA 3FVFB 4LOYH 3RXGA 5T6FA 1MUUA 3AW1A 2JH5D 2DW3A 1O3CA 3CX5H 3VGCC 4ISLA 2Q3IA 3KZIH 2L74A 4EDFA 2ZYGA 4R0IA 4FVDA 3VB3A 2YOLA 3LT3A 1HH0A 4CH8B 4DCDA 3P17H 1O5DH 4N78E 1TNIA 4K5ZA 2R3UA 1PPZA 2SGAA 1T8OA 2WSEH 1KILD 4ABJA 1RF0C 1IQLA 4MPVA 3T27A 1W0YH 4LK4A 2ZG0H 1GJ7B 3L3TA 4K3JA 1SQXG 2NPSA 1S82A 1BGYD 1A1RA 2JJLA 1A0JA 1DANH 1TQ0B 4FUHA 3MH5A 4AGKA 3QN7A 2ZC9H 1H88A 3GY8A 4K69A 2FXOA 4U7JA 1NU1G 3A5TA 2KS1B 1ZTLA 2G8TA 2ILNA 3IFMA 1O2VA 1UTOA 3GISB 2Q7CA 1YLDA 1HJ9A 3B9FH 1DIPA 5KJ7C 1V6DA 3EE0B 4NZQA 3G9RA 1DSUA 3JZ1B 2OYIC 2NU1E 1OXZA 1LHDH 2WSSD 3T25A 1NOHA 1V2LT 1IQNA 1V2QT 5CE1A 2FTLE 1TMTH 5KLVG 1ZZZA 1BHXF 2SFAA 1WSSH 1AUJA 2ZYAA 9LPRA 4CH2B 3Q1MA 3SZEA 2QJKC 3KPEA 3LGIA 3O8DA 1BTYA 2DUCA 1SGFG 1QB9A 1SLVB 3LIEA 4WY4B 1QRXA 3PRDA 1RF1C 2ZDKA 1PPCE 3TK5A 2ZTXA 2WT7B 3KDPB 2B0FA 1NS3A 2XC0A 3S7KB 2J9NA 1XMNB 3SQEE 2F9PA 1AVYA 1C2KA 3DSPA 5EW1H 2XBWA 1FZCB 1BHXB 3OY5U 2KFWA 3MI4A 3H25A 1HAXB 1P57B 1TBRH 3Q3DA 3H1HD 4X2YA 3MTUE 1H4WA 1LO6A 2P8OC 3OU0A 1KB9E 2CN0H 1P03A 2GUSA 3E7KA 1C2GA 1QA0A 1W14U 1YPGH 2C4FH 1IC2A 3ZYDA 1SFCC 1O36A 1LTTC 3CPWO 2A31A 5JBBS 1IFJA 1JXPA 1SOZA 1M8OB 1IHTH 1LTIC 1NTMJ 5F03A 1JNMA 1KFNA 4NPDA 1ZTKA 4UFEH 1RF0A 2A06E 1C5LH 3H1JD 4WWYA 3O8CA 1NO4A 5BPEA 1NU1D 5TJXA 3VFEA 1EXJA 1QY6A 2K0QA 2AXTH 2FS9A 1MKWH 3WWFA 2QIWA 1GHAF 4DURA 2H8PD 1C2FA 2CMYA 4WXIA 4NIYA 1FY3A 2Z5IA 2F83A 3CNRA 4AX9H 4ZKPA 1L4AB 2VH0A 5FPTA 1FJKA 1E79D 1OOKB 2KLVA 5TISE 2QE7H 2HPCA 2F9OA 2D2CB 1VITH 1G3BA 4A1VA 1H8ED 3PMAB 1YGCH 3TDKA 2R3CA 2BASA 3BV9B 1GHBG 1L0NE 4NPFX 2PLXA 3WUUA 3PRBA 2BY6X 4OS4A 1O5BB 1QJ1B 5C0UA 2TRMA 2WTYA 5DP9A 1HAVA 3HUSB 3L70G 4EYYQ 3CC4P 3WU2E 1CGHA 3GCTF 1NJIQ 1O2TA 4FUCA 4X1PU 1DUEA 1PQ7A 1Z8RA 5DP8A 1C1OA 1K21H 1GJ4H 5CCHA 2Y7ZA 3RXMA 2YXRB 4X8VH 2BCCE 4YT6H 5B66H 3CWBG 3K65B 1SQVD 3R0FA 3SUDA 3RK2B 4XA4A 3CCLP 4C46A 2HG5D 3GDSA 3P8OA 3MH6A 1FAKH 1IZNB 2FKWB 2BD9A 3MTYA 1JOCA 5K5GB 1CGIE 3F1SB 1FDPA 1GHWH 3TPIZ 3UWIA 3E16B 4JCNA 2JR8A 3TNUB 4BRYA 1NRNH 2P1JA 2FLBH 1JY3O 4K35A 4Q7XA 5EGMA 4D6TE 2WQYC 3SU1A 1PPJD 4X2WA 3FANA 2VNTA 1TRNA 2YMYA 1VQ7P 2G8YA 2OLGA 1OS8A 1ANEA 4LXBH 1L2PA 4ZAEA 1N7SC 1O3MA 3TITA 1VZQH 2O8LA 1HCGA 1BOQA 2PKAB 1SMFE 3G6EP 2WHXA 4ASVA 1GI7B 1GMCF 3B23B 1C2DA 3I29A 3P92A 1GMHG 4FUFA 3PMHB 3SNCA 1G36A 5DP5A 1QBNA 4TY7A 5GCHF 4H4FA 3ZZ7A 4Z1MD 5EJ1A 4HJGH 2B5TB 1D7MA 2QA9E 2FI4E 3CCEP 4I2LC 1EJMA 1FDIA 3BTME 1MTVA 4NWLA 3RU4E 2FO9A 1EXFA 1GHVH 3AAVA 3CCQP 3AE8C 2WPDD 3PWCA 3A88A 4CRGA 3A8AA 2Q3EA 2N9BA 4OS5A 1T31A 4ABFA 5CBNA 1NH4A 3L70D 1C2HA 1VDFA 2TGDA 1NTMG 2OP9A 3V2NA 1KILC 2F9NA 2FYUJ 4PJ0E 4NWKA 1SQAA 1GL2C 4GDOA 1BE3G 2XYAA 1RTKA 2RFKC 1NHLA 2AEMA 2NU0E 1F0TA 1BQYA 1SLQA 5PTPA 3SJ8A 2GCTB 2KB7P 2KNCA 3CWBD 4BTTB 5SGAE 1MABB 1KQFB 1G1IA 4PD4E 2F9VA 2KI7B 2YNAA 3QZQA 3VEQB 3V5BA 2KCAA 2JKVA 1L0LG 5TJHA 2F4LA 4HGCA 1HTLC 3F9EA 2QXJA 4EOTA 3GDVA 2GCHF 5EQQA 1MV8A 1SFIA 1GCTC 1P3CA 3KQEA 2ASUB 4ASUD 5H2FH 1KFMA 2Z6BD 3HD7D 1V2ST 1IHSH 3MU4A 1MZ9A 1P10A 1AJYA 1JB0J 1G2CA 2IYOA 5LPRA 2CF8H 1K0HA 1SQPE 3Q76A 3A84A 1GBIA 4IL6X 1BTXA 1MCTA 2LKMA 1O3EA 2WZQA 3T26A 4Y99B 1EDJA 2J97A 3GHGC 4MNVA 3PO1B 2QAAA 1TBZH 1XXFA 1YWUA 2QXHA 5GJ4B 1ZSKA 4NG9H 1NROH 3TU7H 3RXBA 1CT0E 2PR3A 3O8ZA 3MD0A 2WV4A 1N7SA 1FQ3A 1FZAA 3EA8A 1QVFO 3LJJA 2BTCE 2XNDH 3M06A 2H9HA 2PUQH 4B75A 2V7QJ 1V2JT 4R4MA 2N1TD 1INCA 1GDQA 1GL1A 5KEDA 3EQ0H 1OP2A 1A5HA 1A3BH 2ZJSE 1TOCB 1UJ1A 1JMBA 7LPRA 2OTVA 3K9XB 3CL3D 1OWEA 3AE3C 1C2IA 2O1JA 1N2DC 5C94A 1Z1JA 1C4Y2 3AE4C 1BDDA 1GTWA 1BRAA 2AERH 1UTKA 4OWFA 2OYHA 2C8WB 3MO6A 4B71A 4JYTA 1C5QA 1JMMA 1XUHA 2RDLA 2P67A 1H8AA 2O8UA 4H0LB 2ULLA 1G1JA 1DS2E 4MNWA 4KKDA 4I7ZC 3G01A 2OYOA 1BE3D 2FFDB 1JUNA 4ABBA 3Q5PA 3V4QA 1VF5D 2BY9X 1EQ7A 1A2CH 3A82A 3STIA 2GMTB 3FN8A 1J16A 1GL2A 1XUJA 5E2OA 1C4U2 1FNIA 4BAOB 1NT1A 1ELFA 1L0LD 4IL6E 1K1JA 2HRVA 1PL5A 4JZEH 3PWBA 4X8SH 4AB9A 5FAHA 2G00A 2VWNA 1CZQA 2Y80A 4GODA 2C9LY 1GJDB 3M7QA 2ZTYA 4AG1A 2AYWA 5E8EH 1SOTA 2F43B 1SLXB 1OWAA 1QLED 2YO3A 3HTKB 1EDIA 2A06D 3RMNH 2FI3E 3L72E 1NTZE 4YLQH 2VWMA 3H5CB 3S9AA 3VXFH 2Q6QA 3BCCG 3NRLA 1X9VA 1QR3E 2EY4C 3BN9A 4GCHF 2VVCA 1T32A 3TF5A 1O37A 1UTPA 1MTUA 2FYUG 4JZ1A 5C5OA 3U1AA 2WV9A 2AEIH 3GMAA 3P7KA 2BY5X 4Q2KA 1N73B 5I46H 3UFAA 2ODQA 1AFOA 1HYLA 3RK3D 5DK1A 4DOQA 1AY6H 1DWDH 4GHQA 2HLCA 2WPQA 1PQAA 1BCCJ 3T5FH 2QF5A 1FOSE 2XZRA 2KAIA 1FZBA 3VMYA 1L0ND 1HWTC 1W0KD 1YF4A 3F2GA 3L71E 2BDBA 6CHAB 3TYYA 1LP1A 1O2OA 3KZIE 1YYY1 1OFCX 1WTHD 3UR9A 3U98H 3UREA 4ZMDA 4IN1A 1PGPA 4WVZA 1C5UA 2HODA 2Y5FA 2ZGJA 3AVZA 4WJG2 4E7NA 1J17T 1IO4A 2Y0EA 3KCGH 1NTZK 2E75D 1QBVH 2ZQ2A 1P84D 4RKOB 1ZHMA 1V2RT 3UOPA 3AW0A 1YHQP 1Q3XA 1HJAC 2CPSA 1SQQJ 5CHXA 4BANB 1NTKJ 1P09A 1V2NT 1OIPA 3EFFK 3VOPA 2L6OA 2CF9H 1Q2WA 3G3ZA 4E06H 5KKZB 3M5OA 3SJIA 3KHUA 2HVXA 4I8LA 3H6PA 1NRSH 5JB8S 2IZ0A 1H8IH 3VP9A 1M1JC 2Z3EA 3RXQA 3FGAD 2ZF0H 2JWAA 1P2OA 1C2MA 5AVSB 4WBAA 1S6FA 3L75E 1AKSA 4IMZA 1FIZA 1O2NA 5AW5B 1YY3A 3O6QB 2NPSD 1FV9A 2FYRA 1E36B 1H9IE 2XXLA 3UOUA 3GCHB 5DP4A 1MKMA 4L75A 1AU8A 3ZZBA 1RJXB 4TT3H 3BCCD 3RMLH 2VINA 1NC6A 5FHTA 1VQ4P 1UTNA 2GV6A 3PYHA 1J1EC 3TSIA 3H1KG 3SWFA 1WQVH 3V4WA 5C0TA 3ZVFA 1TONA 3AE6C 1PP9E 2AH4X 2KUBA 3H1IG 1Q2NA 1Z8IB 3L33A 1VCWA 3QGJA 3S9CA 2Z5HA 1P84I 3ZDMA 1HGVA 5F8ZA 5DJTB 4YOIA 1DSTA 4AFQA 1SGCA 1QIXB 4K1SA 4DZOA 2WYGA 1EZVG 5G4BA 1SQBJ 4AB8A 4AOQA 3W67A 1NKZB 2BEQD 5AW7B 2FLRH 2GKVE 2ZZUH 2LR2A 4I8HA 4BAKB 3URCA 1YPJH 2OYIB 1BDCA 2VIDA 1GI4A 3V13A 4I86A 4AFSA 4JQ0D 1GJ5H 4AFZA 1JM0A 2E74B 3FX0A 3HD7C 4JPZB 1ZLRA 2AIQA 2UUYA 3ZVBA 2I6SA 1G2LA 1U6QA 2ALPA 1CT4E 4PD4D 1FOSF 3CI9A 2QJKB 1YI2P 4AORA 1TU3F 2O01J 4X6OA 3RL0g 1S83A 3S69A 1BMNH 2BLVA 2AXTE 3BTGE 1RF1B 1XUIA 5K7RA 1FC2C 2SGEE 4TPYA 2BD7A 3HK3B 3Q77A 4SGBE 3SYJA 1EAWA 4W7ZA 1S84A 3M7UA 1C1NA 4JZDH 4R4LA 1HIAB 1LHFH 1OYQA 3T2NA 3CP7A 2WUCA 5F53A 1ZRTD 2H88C 4JYCA 2OQ5A 3FOAA 2ZFPH 5GDSH 2KK7A 3L73E 3PLPA 1L4ZA 4CRDA 2GZ9A 1LTJC 4INHA 2KM0A 1WT6A 5EXLA 4D7FA 2FDAA 4UB6H 3EAJA 4D9QA 1O2RA 1YLCA 1SFCB 3H1KD 2Y81A 1SQQG 1FZFA 4CRFA 2HNTE 1ZJKA 1P04A 5DO4H 1NTKG 1GBTA 3H1ID 1VPCA 3CLQA 4Y7BA 1BGYJ 1DLKB 2P95A 1RGQA 2L91A 4H44D 5ESTE 1DX7A 2C93B 1DT2A 1MKWK 4U01A 3I5CA 3SJ9A 1S5LH 1FDMA 1PPBH 1NWQA 1AQ5A 2A5AA 2K9JB 2FYZA 1SL3A 1AFQB 1EZVD 4ASWA 3L35A 1BTUA 3TGUG 1DD4A 1GBBA 1URQA 4MDSA 4XFQA 1FU1A 3WY8A 1DY8A 1CA8B 1O34A 3OY6U 2ZXEB 3G71P 3SHAH 1QJ6B 2WZ7A 1O5GH 1O2PA 4IFFA 2ZHEH 3NMDA 4B86A 1MBMA 5CCHD 3EA7A 1UCYH 1C5YB 1VQNP 1BSHA 1JY3N 2F3CE 1WRGA 2XWAA 1LPKB 1CGJE 1S3JA 1HAOH 1UTJA 3NPSA 2IFNA 1W2KH 1CA0C 4GVUA 1NESE 1AD8H 1VQMP 2M0BA 3F9FA 3Q2YA 5IYTA 3BEUA 2V6NA 2N9YB 1IFPA 1ANDA 1LVYA 5FPYA 1XVOA 1O2QA 1GVKB 1BRBE 3V6IA 5J4SA 3UPEA 5EW2H 1JIMA 4DGJA 3M9HA 4ZKRU 1P0SH 1AE8H 3C9IA 3F2FA 2H7HA 1KTTB 2Y82A 1Y3VA 1KXAA 1LHEH 3SNBA 2OCVB 3PTNA 1CQQA 1Z7KA 2BQ6B 1A02J 1PZQA 1C5ZB 1MD8A 1H0TB 2EC9H 2A7CA 1A0HB 4JZFH 1C1QA 1GMDF 3U59A 3H1HJ 2GDEH 3A7OA 2QEXP 1GBCA 2D8WA 1ELCA 2VRSA 2CGAA 1ZOMA 2G52A 2NU4E 1LTJA 4FUIA 4OS7A 3P8MC 3A0BH 3AECC 1JY2O 2KZIA 1KDQB 1EZVI 1EFRD 4R8TB 1HXEH 3N7EA 2P7JA 3GG2A 1C5NH 4M9FA 4CRCA 1Y5AT 5DKMA 2Z9GA 2ZDLA 2RA0A 2ZHDA 3A8CA 2IJOB 3RXPA 1FPCH 4CHAC 3H1JJ 3H1LE 1FMGA 1NU1J 1RXPA 5KAIH 3KL6A 1VL2A 3OJAB 4I1LA 5AVUB 2FXRA 2GVFA 4RT1A 1QQUA 3RXDA 2V7QH 4AG2A 4LLHA 4RSPA 4B2CA 1FX0B 3H32B 3PB1E 2YKOA 1GBFA 3TGUD 3L36A 5H2FE 4L74A 8GCHG 1SHYA 3LGVA 1TQ7B 1KQGB 1VJ9U 4HI3A 4OGQC 2P94A 1LT1A 2LXCB 3D6ZA 1GK4A 2W6JH 3RM0H 2VVUA 1YM0A 4CREA 1V2WT 4PV1D 5KLIC 5A8YA 5KLVJ 2FI5E 3KIDU 3LGTA 1H9LB 1FN6A 2XOKD 5T1VA 3RXHA 3ZZAA 4ASHA 4GSOA 4UFFH 1E1RD 5BU8B 3LW5J 1SQXK 2OC0A 3OYPA 2UUFB 1BSNA 2GJGA 1KILB 1A4WH 1L4DA 3A81A 4YOJA 5EG4A 3RXJA 3W1EA 1NZQH 1GD2E 1NU1K 2LNCA 3L75D 1PFXC 5C1YA 4OH8B 2O1KA 1UVUH 1T7CA 1O2UA 4Q63A 1SQVJ 1SLUB 4Z0KA 1EPTB 2AMQA 3F9GA 5AVZB 3BRTB 1SQOA 1QA7A 2ZI2H 2ZYDA 3GY7A 4XD7D 1FIWA 5KGOA 3RXIA 1F5KU 1G3CA 2B89A 4OGXA 1MTSA 1JTHA 2O8TA 4XBDA 2ANKH 3N99A 4YZUA 1KYOI 1THPB 5KLVK 2WYJA 1N8OB 1B0FA 5DJ7A 5A0AE 3GCNA 1WU1A 1RY3A 4JYBA 4AQRD 2BMGB 3EYDA 1LTBC 3OTJE 1XUGA 1BTWA 3TJUA 2AHME 3LPRA 1C5TA 3TH2H 3GHGB 4F49A 1TAWA 2RCEA 4Y7AA 3GS9A 1AFEH 1A02F 4OM9A 2BQWB 1PPGE 2H6MA 5EXNA 1NY22 1P2IA 5C2ZA 5FXLA 2D26C 1HAGE 1IFMA 3CC2P 3SV6A 1UHBB 1O2GH 3B71A 1GBJA 1O2MA 1O2KA 1UK2A 1T3JA 1W2EA 1FI8A 1QL2A 2FS8A 1W7XH 3ZZ4A 1O3JA 2XBVA 1AIXH 3RXSA 1KN7A 1KXDA 4GUXA 1CE5A 1W13U 3H1HG 5HXFA 1EAXA 3STJA 1NAYA 2A4QA 1PPHE 4B2BA 2M5AA 1NFWA 4P02A 5IDKA 1T6AA 1DM4B 5AVRB 1GL2D 1EQ9A 3E91A 3L70J 1QFKH 3CS0A 2A1DB 2G5VA 4UD9H 5LPFA 3TK9A 2E76D 2K9YA 2SGQE 1XUKA 2KSJA 1N6YA 3ESTA 1TNHA 1X0TA 2QYIA 3H1JG 4D76A 4U3FG 2UWPA 1O2YA 3VMZA 2FYNB 3BTWE 4ZKOU 3CWBJ 2QJYC 1RQVA 1GDNA 3QX5H 4IW4E 4TSFD 1G37A 4UE7H 1KYOH 4H44C 3F5HA 3RXCA 2G81E 4TPIZ 4C7NB 1EZSC 3SGQE 4XBBA 2YNYA 1K1NA 3SFEC 4JK5A 1ELGA 1TE0A 5ETXA 3P8GA 3FZZA 1TIOA 1VGCB 1BB0B 3T97A 2KYVA 4BTUB 5GTHH 5E79H 1K8AQ 1O2SA 1MQ6A 1EKBB 1GBLA 2FOMB 2YMSC 1D3DB 1LWUC 1WTGH 2ZKSA 2Z9LA 5CCHC 3BEFB 1O39A 2FMJA 1AVXA 1GBHA 3HE4B 1GI5A 1SB1H 2G4TA 3M3TA 3C27B 3MZWB 3ATMA 2E43A 2M3EA 5AW1B 1Y5BT 2IBZG 2VBCA 3GF7A 1LT9B 4Y8YA 3TNTA 8ESTE 1SQVG 4WWIA 1GJBB 4XRNA 4ZH8A 3GYLB 4ZMAH 1SHHB 5EQSA 4YTPC 3H09A 2THFB 3RL0C 7KMEH 2D1JA 3A7ZA 3KHVA 1GW4A 1PYTD 1FZEA 2CXVA 4D8NA 1FS0E 3QTOH 2HPPH 2ZU5A 4WB4A 4FUDA 2RH0A 3CXHD 3SORA 3SNDA 2F9UA 1EZXC 3OSYA 3SGBE 1W3CA 3SV9A 3L74E 1ETSH 4W80A 1PPJG 5JBTA 2FXMA 4I33A 2L5GB 1Z6EA 2AXCA 1EB2A 2J58A 2G3AA 3HE5B 3TIUA 2JH0D 1A5GH 2JIZD 4O03A 2ZT9D 2HLDD 1SVFA 3E1IA 3PJSK 5DGJA 1O2HA 3HGNA 1BE3J 5EPYA 5FBIA 4OS2A 4DT7B 2O01H 3MMGA 3S9BA 2WVRA 4U3FD 1LMWB 3DSOA 4D7GA 1DWBH 3TGJE 2PFXA 1SVPA 1K1PA 2BD2A 4I8GA 1K73Q 5C5NA 1KSNA 2Q6FA 2A4RA 1T8ZA 4F4OC 1GHBF 3KYGA 1L0LJ 3MWIU 1YQ4C 4ABEA 1M1JB 1M90Q 2C9NY 1QURH 2QXGA 4GOFA 4WF8A 3G4SP 1VKYA 2BYAX 4YXWD 2HPQH 4X6NA 3BG4C 3C1LA 1ZRKA 2VIQA 2TPIZ 3KQGA 2XBXA 3PM3A 3AEGC 3PHLA 1TRMA 2J92A 4INKA 4CRBA 1S5LX 4ZXYH 3IR9A 3M5MA 2OINA 3A87A 2AEFA 1E38B 5GPIB 1EXIA 3E6PH 4TY6A 2Q6GA 1NTMK 1NGMB 2O9QA 2NU3E 2BLWA 3LC5A 3M3VA 4YOGA 2Z9KA 1KV4A 2P10A 4PV1C 3S1KA 2TGPZ 3UIRA 1SP4A 5C1XA 3TGIE 1Y3WA 3CCUP 3SI4H 4GPGA 1FJPA 1LWUA 7GCHG 4Y6DA 3CXHI 1Q86Q 1FY4A 3D49H 7ESTE 2CPBA 2IBZD 4XDEA 3D71A 1WUNH 1QB1A 1C1RA 1VCQA 3ZVAA 1XX9A 1W5CE 1Y5UT 3IWMA 1YYCA 5DSFA 3UY9A 4CPGA 1L0NJ 3AE9C 5CMZA 4XBCA 3R2PA 4Y28J 4ZCNA 2WSSH 3B5NB 5AVTB 2OTKE 5BRRE 2RDEA 1IQHA 3TGKE 1B0EA 3U8RH 1C5WB 1GMHF 3TJOA 2XNIA 1NRQH 3K5BA 3HD7B 2H43A 1Z6JH 4TWYA 2IYPA 2VIWA 3BTQE 1T8MA 2HFED 5FCKA 3RBXA 4IMQA 2WSCJ 3CCSP 4BWNA 1UW7A 1G9IE 1S5LE 3SSUA 1MU6B 1S0RA 2B9LA 3DCLA 2QXIA 4A7IB 2A4OA 2B7DH 2H9EH 4I8JA 1ZV8A 1RIWC 1P2QA 1P2MA 2H5DA 4FUBA 3M5NA 3WUTA 1C4V2 1OWKA 2VIOA 1GZLA 1NRPH 1T4VH 2RKLA 4RJTA 1LVOA 2OYHC 3GLMA 2J2UA 4HTCH 3RC6A 5E0JA 2YIUC 2ITAA 4Y76A 4GOEA 2IBZI 2N1TB 1C5VA 4F48B 3V2QA 2VGCC 1KXBA 1S6LA 4JF7A 3BTTE 1W0ZU 1NFYA 1BITA 3ZYEA 2ZVOB 1GI1A 1QL8A 1OW7A 3BCCJ 1M56D 1OP8A 1ZTJA 1NTPA 4M3LA 2GV7A 1MTNC 4NA8A 1QRWA 1C5OH 2D2CD 3I77A 4MTBA 1GHZA 1UMAH 4WVPE 5CJ0A 2VJ1A 2PUXB 2LELA 2ESTE 2OC1A 3UR6A 3ZV9A 1YCPM 1URQD 2J98A 3T62A 1IK7A 1RS0A 1CSOE 2TBSA 2E76C 3UB0A 1CI6B 1KY9A 3N7NA 3OFND 1UTMA 1YPKH 2ANMH 3CCVP 1HAYB 2R44A 3ITKA 4LC1A 1KQLA 4N78D 3SW2B 4X6MA 1VF5B 4BXLA 1AI8H 1DITH 2JJ2D 2V3MA 3CCJP 2IN2A 1AN1E 2HOBA 3FWNA 4H13C 1YPHC 5LGOA 4LZ4B 1QL9A 2O8WA 2A4GA 2Q1JA 1E79H 1TPSA 1RE4A 3VYIA 2BDHA 4B76A 1WCZA 2KCPA 6LPRA 3NZIA 1UCYK 2A06G 3A0BE 4NIVA 4WXVA 3P95A 1GI3A 1MH0A 2HNTC 1FLEE 1XXDA 1YC0A 3ATKA 2ZFQH 2QJPB 3KYQA 4WH8A 2FYUK 3BATA 2GX4A 2KSEA 1JY2N 2QG4A 3LW5H 2IPQX 1SSXA 3MGNA 2DE8A 5JB9S 3NCLA 2K1QA 3H7TA 2GT8A 1BUIA 5JBAS 2FYQA 4QMAA 1X22A 1JRSA 1K1MA 3DA9B 1A5IA 1FY5A 3U8OH 3CS7A 1IQFA 1KLJH 2J5UA 4C7RA 4FXGH 3TK6A 3LKWA 3ABVC 1ELEE 1L0NG 2Y0CA 2I1KA 1NBME 1VQ9P 2GCHG 3RK3B 4O9BA 2V3OH 4VGCC 1NU9A 1C1WH 1PGQA 1EJNA 1M7LA 5F6MA 3F89A 4HH2A 1HPGA 2BD3A 1AUTC 1PYTC 2QY0B 1QGFA 2BM2A 3V12A 4BXSA 1LDTT 1QZ8A 3BTHE 4X1NU 1UK3A 2BCCG 3H1KJ 3M9QA 2B87B 2ZGXH 4ESTE 5B6LA 1P05A 5EFWB 2P3TB 3SUGA 2W5EA 4A1XA 2E75B 2K3RA 2H5CA 4LZ1H 3H1IJ 4BTIB 5EIYA 1LJ2A 4ABIA 1F5LA 1ELVA 1Y3XA 4UFDH 2ZT9C 1NFXA 3TJNA 1KB9D 3M7TA 1WMKA 1QGKB 1VQOP 3FXDA 2OC8A 4Z1MH 2ZO3H 4D6TG 2Z7FE 2PGQB 3L74D 1CO7E 2ZIQH 1YIJP 1LTAC 4YO9A 1IQKA 3AE7C 5AVQB 1B7XB 3EQ2A 3RMOH 1R5LA 1WAYB 4UONA 2WPMS 3U9AH 1FDOA 2R0KA 1TNLA 1IQIA 2P3UB 2NPSB 1USEA 1LQEA 1LHGH 3VPKA 3MH7A 3ZZ5A 1HAIH 4Y0ZE 3RXTA 1Q90D 1YBWA 1S9KE 2IX7C 3Q5RA 1YPMH 1A46H 1BTZA 1NVOA 1C2JA 3QH9A 4FETA 2CHAB 4IN2A 3ZVEA 2BZ6H 1BCCE 5IK2D 1SGRE 3A2AA 3BASA 1MUEB 1M1KQ 1FAXA 1HBTH 3CX5E 1TGTA 3C1KA 3LONA 3N7OA 4MG3A 1XKBC 1D3QB 3RUOA 1ZPCA 3OEED 2D2DA 1AQ7A 3KGPA 3SWYA 1RTLA 1QL7A 5FBEA 1D9IA 2Q5UA 2XRCA 3QWCH 1MZAA 1DPOA 2W6AA 3CMEP 1KB9I 1CBWC 1M9UA 3FO8D 3LGYA 1AA0A 2BCCD 2WPVB 1K1LA 2PKSC 2WUBA 1QTFA 2JDID 2JEEA 1FZCC 3V2PA 3RP2A 1MCVA 3R4YA 2UUKB 4X1RU 1EDKA 3OA7A 1NPMA 2M3BA 1K9OE 1ZR0A 2M5TA 1OWIA 1GG6C 3M35A 2FM2A 2ZHFH 2QF4A 3PV5A 4I6MC 1L1NA 3FP8E 4J2YB 1AGJA 4AYVB 3VP8A 4OGQD 2XDJA 2PFEA 1UVOA 4D6TD 1SQPG 2VIPA 3TGUJ 1HFDA 3VGCB 1OMIA 4AZ2B 1EC5A 4H6TA 4XOJA 4WH6A 3NKKA 4AC9A 3KQDA 5AHGH 3LDXH 5E79E 1HDTH 3I55P 1ANBA 3A0HH 1YCPH 5E0HA 4KELA 2W6ID 1RH5B 1ARBA 2ZU1A 1SQQK 1MTWA 1NTKK 2KS1A 3PH0A 4A6LA 4BOHA 1C1UH 4NA9H 3SU0A 3V3MA 3VG8A 1SBWA 2ZCKP 2D2CC 1MD7A 1EP6A 3MYWA 2JKHA 3E3TA 4ABHA 4W7YA 1ZMNA 1K1OA 1Y59T 1AO5A 3L75J 2DE9A 4ZUHA 3MU1A 1PIXA 1ZR2A 3RU4D 4A5TS 1URQC 1ETTH 2ZDMA 1GGDC 1PJPA 1O2WA 4NZLA 2JO1A 1USDA 2QJYB 1SQBE 2Z94A 4YTAA 4H44B 2HPCB 1BTPA 3RXVA 3GW6A 1O2LA 1ID5H 2W83C 5JDUB 2YMKA 3SN8A 5AW2B 1HAHH 3BTKE 1FE6A 2J38A 1OVRA 1F0SA 3K6YA 4UEHH 2RN0A 5L8RJ 1S2EA 2FOBA 2G51A 3SBKA 1TGSZ 1HAVB 4Q4LA 4WY4A 1JOUB 1CVWH 3O8RA 3AK5A 2HLOA 2TGAA 4HFPB 1BJVA 5FPSA 1C9TA 2WT7A 1F2SE 2BD8A 3A80A 1SGFA 3PRJA 1FN8A 2FODA 4IGDA 4HYTB 3M61U 3EWKA 2IPHA 1FZCA 1S0QA 2GTBA 1B5GH 5TISH 4IC5A 2KXPB 2KX4A 3QGNB 1W2BO 1UIIA 1AWFH 3TH3H 1SQBK 1V2MT 1SQPD 3L72G 1NTZG 1O5EH 2CK3D 1IFDA 5KTBA 2SNVA 1ANCA 3B4SA 2JWDA 4B73A 1IFIA 1EATA 4BRYB 4KGAA 4A92A 5HYOA 2J95A 3WU2H 1GDUA 2EEKA 3OEHD 5FL7D 2P8OB 1YJNP 1PQ5A 1KILE 1BJUA 1OVUA 2OD3B 1A61H 3DSGA 1P84H 3GYMA 2Y6TA 3E0NB 1G32B 1R5SA 3LOXA 2A32A 1HJ8A 1UVSH 1G3DA 3D70A 1KQSO
chains in the Genus database with same CATH topology
2WSCH 1A02F 1CSBA 2ZFCA 3RK2B 4XA4A 1L4AA 1IFMA 4C46A 2HG5D 2Q9IA 3B8EB 2FKWB 1T3JA 1W2EA 1QL2A 1JOCA 3EFGA 1T2KD 2J59M 3TNUB 2P1JA 1JY3O 3HUSA 1N86A 4WY4C 2YMYA 1YTZI 1T3UA 4ZKUA 5AVRB 1GL2D 1N7SC 3GHGA 4GIFA 1LT9C 3VTPC 5CCGD 2KSJA 2WITA 3VMZA 4LGDE 4I2LC 1HVVA 3RL0D 4C7NB 3TNUA 4Y99C 2YNYA 2N9BA 3T97A 2KYVA 1G2CB 5BU5A 1NH4A 3M0DC 4RESB 1VDFA 5APVA 1ZR4A 3V2NA 1KILC 1LWUC 2Z4EA 5CCHC 1GL2C 3VMXA 1NHLA 2C0XA 1HJBA 3HE4B 1SLQA 2GUVA 2KB7P 2E43A 1L4AC 1N7SB 5AW1B 5APXA 1G1IA 1LT9B 3V5BA 1HTLC 4EOTA 1MV8A 4C7NA 1KFMA 1DEBA 3HD7D 3RL0C 1MZ9A 1GW4A 1FZEA 3HUSC 1G2CA 4WB4A 1FBMA 2YO2A 2LKMA 4Y99B 4W80A 3GHGC 2XV5A 2FXMA 2YKQA 2L5GB 3U1CA 1NKNA 2J58A 3HE5B 1PFIA 3HE4A 1SVFA 3E1IA 3O8ZA 2HYNA 3MD0A 3RK2C 2A45I 1N7SA 2O01H 1FZAA 1LT9A 1LWUB 3M06A 2WSFH 1GL2B 2XNXA 2N1TD 2P2UA 5BVZA 5APTA 1T8ZA 3B5NC 3CL3D 1DH3A 1M1JB 2C9NY 2O1JA 1N2DC 3VN0A 2QM8A 2XKMA 2WWWA 5AW6B 1GTWA 3KQGA 2OYHA 1JMMA 3LIDA 2P67A 3IR9A 1H8AA 2R5BA 5AW9B 1MFZA 2M8RA 3NFQA 1GW3A 3RL0B 1G1JA 1N73C 3V2RA 3NTNA 3HE5A 1NTMK 2XU6A 1JO5A 3M0DA 2FFDB 1JUNA 1SP4A 1LTSC 3V4QA 1EQ7A 1RE3C 1FJPA 1LWUA 1J1DB 1GL2A 2CPBA 1YTZT 3M9BA 2I1JA 4N6JA 1XTGB 1YYCA 1CZQA 1SQVK 2N1TC 2C9LY 1M1JA 5CMZA 5APUA 1HBWA 3R2PA 5AVVB 2HODB 1OWAA 2YO3A 3HTKB 3P8CE 5AVTB 3B5NB 3L4FA 5AW3B 2A45H 5CJ4A 1X9VA 2KP8A 3HD7B 3UIAA 2H43A 2FFDA 1XTCC 3U1AA 2HFED 3P7KA 1N73B 5KJ7D 3HRNA 1AFOA 3RK3D 2WPQA 3OAKA 1FOSE 2XZRA 1FZBA 3VMYA 1HWTC 1ZV8A 1QL1A 3TYYA 1GZLA 1Z56A 1X79B 2HODA 3HTKA 2OYHC 3A3YB 3B5NA 1IO4A 1N7LA 2N1TB 1NTZK 3MUDA 3V2QA 3II6A 4JF7A 1T2KC 3HD7A 2CPSA 4M3LA 5CHXA 1S9KD 1JY2P 1IJDB 1N73A 4EIJA 5CJ0A 4AUWA 3VOPA 1URQD 3G3ZA 2WPSA 1CI6B 3M91A 1ZN5A 5CCGC 3RK3C 1RE3A 3H6PA 3N7NA 2E42A 3VP9A 1M1JC 4IFDK 4LC1A 4N78D 1KQLA 3NXSA 2KOGA 1SFCD 5AVSB 4WBAA 2YKPA 5AVXB 2R5DA 5AW5B 1GU4A 2IPPA 2NPSD 2N1TA 1RE4A 3VYIA 2FFDC 2OYHB 1J1EC 3TSIA 3SWFA 2W27A 3V4WA 2GM4A 1J1DC 1GK6A 5AW0B 3KYQA 2FYUK 3BATA 3LW5H 1JY2N 1KZUB 3M0AA 3MGNA 1CW5A 2Z5HA 1CI6A 1HGVA 2W6BA 4DZOA 4C7RA 1NKZB 5AW7B 2I1KA 3RK3B 4O9BA 3WMM0 2OYIB 1M7LA 5APWA 2NPSC 4HH2A 2MJZA 3HD7C 1GDTA 1FZGA 1ZLLA 1FOSF 3M9QA 3CI9A 2QM7A 2POHA 1J1EB 1RF1B 1NAFA 2OARA 1LGHB 4W7ZA 2R32A 3PP5A 5KJ7A 5CCGA 1L0LK 4JYCA 2OYIA 1URQB 4WY4D 1LTAC 1LTJC 1RE4C 2C0WA 4AYCA 1WT6A 1J2JB 1N7SD 5AVQB 1JY3P 3EQ2A 5AW4B 1SFCB 5APQA 1FZFA 2NPSB 1VPCA 3CLQA 1RF1A 1S9KE 2IX7C 1DX7A 3I5CA 1MUUA 1FDMA 1NWQA 1AQ5A 2FYZA 2IFMA 3A2AA 3BASA 2Q3IA 3L35A 1URQA 4KHXA 3BVHA 1FU1A 1HH0A 5APSA 1L0NK 2ZXEB 4N78E 2WZ7A 3SWYA 2WSEH 1KILD 4IFFA 3NMDA 2Q5UA 4B86A 5CCHD 1RF0C 1SFCA 2W6AA 3L37A 1JY3N 1LTJB 1WRGA 3N4XA 2NPSA 5AW8B 4GT1A 2JJLA 1L4AD 1H88A 2WPRA 2JEEA 2IFNA 1IFNA 4DOJA 1GU5A 1FZCC 3A5TA 3V2PA 3OA7A 2M3BA 3IFMA 2Q7CA 3P8CD 5KJ7C 3M9HA 4I6MC 3C9IA 2H7HA 3VP8A 2OYIC 2XDJA 1OXZA 1A02J 1NOHA 3U59A 1FAVA 3A7OA 3MIWA 2VRSA 1HUCA 1LTJA 3P8MC 1JY2O 3KPEA 4IFMA 3RK2D 2P7JA 1SQQK 3LIEA 4WY4B 1RF1C 1NTKK 2PP6A 2PAJA 2WT7B 3KDPB 3B5ND 3OJAB 4GKGA 4I1LA 4W7YA 5AVUB 3TK1A 1ZR2A 4LLHA 1FZCB 4XE5B 1URQC 3H32B 2YKOA 3L36A 3MTUE 1E5WA 2HPCB 2GUSA 1GK4A 5AW2B 1IC2A 1SFCC 1JCCA 1LTTC 1JTHB 1H89A 1IFJA 1LTIC 4WY4A 1JNMA 1KFNA 5AVWB 3BRVB 1RF0A 5BU8B 1SQXK 5APYA 2HLOA 2WT7A 1NO4A 1KILB 1JCDA 1GD2E 1NU1K 4HYTB 4OH8B 2H8PD 2O1KA 1FZCA 2Z5IA 3H32A 3P32A 4ZKPA 1L4AB 1FJKA 1X8YA 5AVZB 1IK9A 2KLVA 3BRTB 2HPCA 1SQBK 1IFDA 5KTBA 1SQPK 2BASA 2R3CA 1IFIA 2A45G 1JTHA 5KLVK 2WTYA 3HUSB 4N3YB 1RY3A 4JYBA 4AQRD 1LTBC 1HGZA 1LTGC 1KILA 3GHGB 5AVYB 5CCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPS D;  2N1T A;  2NPS A;  3B5N C;  1L4A D;  3RK2 B;  1L4A A;  2HG5 D;  3TSI A;  1T3J A;  3KYQ A;  2M8R A;  3RL0 B;  5KJ7 C;  2XDJ A;  4WY4 C;  2YMY A;  1GL2 D;  1GL2 A;  1N7S C;  5CCG D;  3RK3 B;  1XTG B;  3RK2 D;  2N1T C;  2NPS C;  4WY4 B;  3HD7 C;  2PP6 A;  4LGD E;  3P8C E;  3HTK B;  3RL0 D;  1HVV A;  3B5N D;  3B5N B;  4W7Y A;  1URQ C;  3HD7 B;  2HFE D;  3M0D C;  4W7Z A;  5KJ7 D;  1KIL C;  3RK3 D;  3PP5 A;  5KJ7 A;  1SFC C;  5CCG A;  5CCH C;  1GL2 C;  1JTH B;  1URQ B;  1NHL A;  4WY4 D;  4WY4 A;  1L4A C;  1N7S B;  1N7S D;  1KIL B;  1SFC B;  3B5N A;  2N1T B;  2NPS B;  4OH8 B;  2H8P D;  3HD7 D;  4JF7 A;  3RL0 C;  3HD7 A;  1L4A B;  4W80 A;  3VOP A;  1URQ D;  1JTH A;  1URQ A;  5CCG C;  3RK3 C;  3RK2 C;  4N78 E;  2WZ7 A;  1N7S A;  1KIL D;  2KOG A;  1SFC D;  1KIL A;  5CCH D;  1GL2 B;  2N1T D;  1SFC A;  5CCH A; 
#chains in the Genus database with same CATH topology
 2P16 A;  1FZZ A;  2WSC H;  1BGY E;  1NFU A;  1CSB A;  2ZFC A;  2KZ4 A;  3UNS A;  3L71 G;  1NBM D;  3GY4 A;  2ZDA H;  1AVG H;  3MU8 A;  1HGT H;  5B66 E;  1L4A A;  2VU8 E;  4P00 A;  2ZQ1 A;  8KME 2;  1MBQ A;  4J1Y A;  1SG8 B;  4HKZ H;  3EFG A;  1BZX E;  1NU7 B;  5H4I B;  1C1M A;  1TA6 A;  4PD4 I;  3A89 A;  3GIC B;  1T2K D;  4KTU A;  1S6H A;  1OPH B;  4JK6 A;  4DJG A;  1E35 B;  4KT0 J;  1QCP A;  3HUS A;  2YMS D;  2V35 A;  1S4X A;  1ZME C;  1J14 A;  2WPJ S;  1TX7 A;  3FWL A;  5T3H A;  1D4P B;  3TVJ B;  1TMU H;  3TH4 H;  4GIF A;  1Y8A A;  3PMB B;  5CCG D;  3UAI C;  4Y10 E;  3QLP H;  3S9O A;  5TCA A;  1GI2 A;  2WIT A;  2J4I A;  3GDU A;  3SHC H;  5DP3 A;  5C39 A;  2BZA A;  4PV1 B;  1ZJD A;  4DIH H;  1C9P A;  3B8J A;  1LCY A;  2KNC B;  4DII H;  3Q5S A;  1GMJ A;  3DHK H;  3ZZ6 A;  4OGY A;  3L75 G;  4LGD E;  1AHT H;  1WQS A;  4NFE A;  2BD4 A;  3RXF A;  1ZYO A;  3RL0 D;  1O2X A;  4DCK A;  5EOK A;  3L72 D;  1NTZ D;  3TNU A;  4Y99 C;  2W26 A;  5JYI A;  3PO1 C;  1YPL H;  2FPZ A;  2OXS A;  4X1Q U;  2BVS H;  4K3A A;  9EST A;  3RLW H;  4HG6 A;  5A0B A;  1G2C B;  3BIV H;  5BU5 A;  3IF4 A;  1YPE H;  4X2X A;  3M0D C;  1BMF D;  1UIX A;  2GD4 B;  4U2W A;  1PP9 G;  5EJZ A;  4RES B;  1BBR K;  1L1G A;  2E5T A;  1HXF H;  1TAL A;  1DE7 H;  2SGD E;  3BEI B;  2PKA A;  3F2H A;  4M7G A;  3RXK A;  2FWW A;  3LC3 A;  3LU9 B;  1GWA A;  1TB6 H;  1BCC D;  2ZFT A;  5CHA C;  1AZZ A;  3VMA A;  1THR H;  5FCR A;  2C0X A;  1SQX E;  1OP0 A;  2GZ7 A;  1TGB A;  3CX5 D;  1XVM A;  3A83 A;  4PD4 H;  2GUV A;  2BB4 A;  1ESB A;  4I32 A;  3L71 D;  1N7S B;  1RTF B;  5APX A;  3E90 B;  8GCH F;  1NU1 E;  2AGI X;  4U3F J;  1E0F D;  3MH4 A;  1COW D;  4DW2 U;  1CHO G;  3JZ2 B;  4FU8 A;  3CEN A;  2TIO A;  2QCY A;  1ZSJ A;  4JMY A;  1QBO A;  2VB0 A;  3MNB A;  3U28 C;  1AWH B;  5CDF E;  3MNS A;  4Y71 A;  1SS1 A;  2XBY A;  2NZ2 A;  1K9M Q;  1F5R A;  1TFX A;  1FBM A;  2YO2 A;  3KN2 A;  3AE1 C;  1JIR A;  4DT4 A;  6GCH G;  1V3X A;  1GBE A;  3ZVD A;  2XV5 A;  2V3H H;  5KLV E;  1EB1 H;  2VWL A;  4ISO A;  2VGC B;  3U1C A;  1NKN A;  1PFI A;  3SU3 A;  3LH1 A;  4JYU H;  4ZRO A;  3Q00 A;  2HYN A;  1P2J A;  4K1T A;  1MTN B;  2GGV B;  5HIZ A;  3A7V A;  1Q31 A;  3RU4 T;  1GL2 B;  1ZMJ A;  2PTC E;  3A85 A;  1HF9 A;  5BVZ A;  5APT A;  1EST A;  1VIT G;  2JJ1 D;  3L73 G;  3FZD A;  1O5C B;  4IC6 A;  1Y9B A;  1OHH D;  1A7S A;  1TX6 A;  3D23 A;  3UQO A;  1MKX H;  3CX5 I;  2ZCL P;  4ABD A;  5AW6 B;  1C5R A;  2LP6 A;  2A0Q B;  3TLO A;  3JC2 2;  2B9B A;  1KOR A;  1GCT B;  3FP7 E;  1IAU A;  5A8Z A;  1O3D A;  5AW9 B;  1MFZ A;  2M8R A;  1GPZ A;  1VJA U;  1GW3 A;  1PP9 D;  1N73 C;  1OWD A;  2FX4 A;  2SNW A;  3DFJ A;  2A5K A;  5AFZ H;  3T29 A;  3NTN A;  1PV3 A;  1H8D H;  4Y0Y E;  4ZHL U;  2XU6 A;  1JO5 A;  2EQN A;  3M0D A;  3SNE A;  2STA E;  2XCF A;  5F8T A;  1RE3 C;  1WV7 H;  1YJ9 P;  3D65 E;  2WIN I;  1ELT A;  4WY3 A;  5HM9 A;  3S0N A;  1W11 U;  4NSV A;  3ZVG A;  1T8N A;  2I1J A;  3ATL A;  3QDZ B;  2R2M B;  5EJL A;  1XTG B;  1KC8 Q;  1BIO A;  1QQ4 A;  2KAI B;  3SJK A;  1SQV K;  3FXE A;  5A0C A;  4GLY A;  4ZXX H;  1LP1 B;  2C8X B;  3KYF A;  5APU A;  1HBW A;  2BQ7 B;  2TGT A;  1QNJ A;  1JMO H;  1GBD A;  1F0U A;  2HOD B;  3P8C E;  2GDD A;  3N7D A;  2BOH B;  4RN6 A;  3RDZ A;  5AW3 B;  3L4F A;  1MQ5 A;  1X7A C;  1P11 E;  1O33 A;  3OAA D;  5C20 A;  3AEE C;  3JSV C;  3O8B A;  4SGA E;  1C1P A;  2I8D A;  4RKU J;  5JPM H;  1DXW A;  1H8H D;  1OSS A;  2UWL A;  5GND A;  3SOS A;  2QV1 A;  2ANW A;  2FFD A;  1GI9 B;  4CBO A;  2FY8 A;  1XTC C;  3L70 E;  1TYN A;  3MO9 A;  4X1S U;  1WYK A;  2FXP A;  2BXU H;  2PWX A;  1TPA E;  3SU4 A;  1XM1 A;  3FP6 E;  1QRZ A;  1YIT P;  3EGK H;  3GY6 A;  3LGU A;  2O01 N;  2BVR H;  1O38 A;  1P9U A;  5EOD A;  4I7Z B;  1JEK A;  1V2K T;  1O3N A;  2ZEC A;  1OVV A;  2QE7 D;  5C67 A;  1PPE E;  2Y9Y A;  3OX7 U;  2ZFS A;  3L73 D;  3V0X A;  4KTS A;  3CWB E;  2ZGC A;  4ABG A;  5L2Z H;  4H13 D;  1QL1 A;  3GCH C;  3U1I B;  2ZT9 B;  1JBU H;  3LGW A;  1AB9 C;  2J94 A;  4B74 A;  1Z56 A;  1C1T A;  2R2W U;  4GHT A;  2W8Z A;  2EA3 A;  3HTK A;  3A7T A;  3A3Y B;  3LIW A;  1AKS B;  2J34 A;  2RMZ A;  1N7L A;  4ISI H;  5L30 H;  2FP7 B;  3RM2 H;  4FUG A;  1SR5 C;  3II6 A;  1VQP P;  1T2K C;  2PTN A;  1GI6 A;  3HAT H;  3PV4 A;  3DD2 H;  5B5E H;  1PPF E;  1U57 A;  3PTB A;  1IJD B;  2WV5 A;  2MKV A;  3H1L G;  1N73 A;  4TLF A;  5ABW A;  2NWN A;  1GJ8 B;  1UTL M;  1VQ8 P;  1DIC A;  3NXP A;  1WBG B;  1UVP A;  1GBM A;  5HMA A;  1ZN5 A;  5CCG C;  4K60 A;  1RE3 A;  2E42 A;  2LPR A;  3RXA A;  2ZU4 A;  4Q7Z A;  4IFD K;  3LJO A;  3ELA H;  3NXS A;  3QK1 A;  2KOG A;  2E74 C;  2F9B H;  2ZU2 A;  2YKP A;  2WMM A;  3SI3 H;  2FOF A;  4CR5 A;  1TAB E;  1GU4 A;  2IPP A;  1OX3 A;  2HR3 A;  1VQK P;  2ZTZ A;  1GBA A;  2QC2 A;  3A7W A;  4YXD C;  4BNR A;  3SUE A;  1O3A A;  1RQU A;  4MPX A;  2ZGH A;  2G5N A;  5C3N A;  4RT0 A;  3A0H E;  1DVA H;  4XE4 A;  2W27 A;  2GM4 A;  1J1D C;  1EZQ A;  5AVD A;  3T28 A;  2ZAE B;  3ODD A;  1CBW B;  4THN H;  1NTM E;  3M0A A;  2Z3C A;  3FFG A;  1C2E A;  2R9P A;  4K8B A;  3V7T A;  5HGG A;  1HJA B;  2ZDV H;  3TJV A;  1TX8 A;  1J15 A;  1BE3 E;  1ZOY C;  1W12 U;  2PKS B;  2LXB A;  3VXE H;  1YLN A;  4EI2 A;  1SLW B;  4ZNC A;  2BHG A;  4O3T A;  1N6X A;  1Q81 Q;  1OWH A;  1U7J A;  2C8Z B;  4FU7 A;  1GG6 B;  4YES B;  5JBC S;  1OYT H;  3SFD C;  1UO6 A;  5L6N H;  1L0L E;  3O6Q A;  1ARC A;  1MAY A;  3VB6 A;  2A2X H;  1SQT A;  3WMM 0;  4AGJ A;  2Y5G A;  4NFF A;  2QF0 A;  3L74 J;  3IG6 B;  2HVY B;  2PGD A;  2MJZ A;  2KIK A;  1MU8 B;  1TBQ H;  1SQX D;  1DFP A;  3PV2 A;  1Y3Y A;  7GCH F;  2XW9 A;  1YCP K;  1G3E A;  3HGP A;  2YNB A;  1GDT A;  3SUF A;  3ZZ8 A;  2OQU A;  3MNX A;  1ZLL A;  2P59 A;  1ZHP A;  2F91 A;  1VQL P;  1NN6 A;  3H1L D;  1O3B A;  5DPA A;  2QM7 A;  1AFQ C;  2POH A;  1O3F A;  2WPH S;  1VQ5 P;  1J1E B;  2ZU3 A;  1GI0 A;  2WSF J;  1SKY E;  2OAR A;  2RA3 A;  1DXP A;  1HB0 B;  1Q7Y Q;  3A7Y A;  2AMD A;  2Q1K A;  3RK3 E;  3BIU H;  1HNE E;  4O3U A;  1HUT H;  3R3G B;  2R32 A;  3PP5 A;  5KJ7 A;  1D6R A;  1W7G H;  5CCG A;  1VR1 H;  1D3T B;  1GHA G;  1L0L K;  1YJW P;  2OYI A;  1URQ B;  4WY4 D;  5KLV D;  4A7P A;  1RE4 C;  1GGD B;  2JET C;  2C0W A;  1P9S A;  4Q7Y A;  3W95 A;  4AYC A;  2P3F H;  3BG8 A;  2I6Q A;  2XC4 A;  3K2U A;  3KQC A;  1KTS B;  2B8O H;  4UFG H;  1ZPB A;  1TNG A;  1C5M D;  1JY3 P;  3VB5 A;  2QN5 T;  5AW4 B;  1TRY A;  5C1U A;  2AGG X;  4UB6 E;  5APQ A;  3S4R A;  1TNK A;  2XTT B;  3AAU A;  3URD A;  1P84 E;  4KP0 A;  1BBR H;  4A1T A;  1GJ6 A;  2QVA A;  2XND D;  3HKJ B;  4UB8 H;  2BCC J;  4E7R G;  2P58 A;  1RF1 A;  3EDX B;  2ZDN A;  4MPU A;  5FX5 A;  3GY2 A;  5KEC A;  3GCT G;  3SZN A;  1Y47 A;  2Z3D A;  3IN6 A;  4ZHA A;  1HIA A;  4WMD A;  2H89 C;  1L2E A;  5GIB A;  1JWT A;  2IFM A;  4H42 U;  1ZPZ A;  3QUM P;  2W7U A;  1BRU P;  1PGO A;  4KHX A;  1S5S A;  3BVH A;  2K8I A;  4BAM B;  1IQG A;  5APS A;  4Z6A H;  1L0N K;  1HRT H;  2FTM A;  2Q6D A;  1O3P B;  2PSX A;  3A86 A;  1FON A;  4MNY A;  6EST A;  4D6T J;  4ZKN U;  1OKX A;  2FZZ A;  2K88 A;  2WPI S;  4AYY B;  1C5S A;  3AE5 C;  2GP9 B;  1SFC A;  3L37 A;  3SNA A;  1LTJ B;  3N4X A;  3CXH H;  1ORF A;  2WPK S;  1UCY E;  3RC4 A;  5AW8 B;  4GT1 A;  3BCC E;  3RXE A;  2ZA5 A;  2XWB I;  1L4A D;  2OUA A;  4RKJ B;  1O3H A;  1IQM A;  1AE5 A;  2WPR A;  1LPZ B;  2OBQ A;  4ISN A;  4DOJ A;  1Q82 Q;  1GU5 A;  1IFN A;  1AQT A;  2FYU E;  3UWJ H;  3RXO A;  4CRA A;  3ZZD A;  3CC7 P;  1BCU H;  2K9J A;  2EI6 A;  2IDB A;  1O35 A;  1V2V T;  3M36 A;  3E1X B;  1OX1 A;  4QT8 C;  1G2M A;  1GMC G;  1O2I A;  1ZGV A;  3P8C D;  1EJA A;  1K04 A;  4O97 A;  2ZHW H;  1FPH H;  3ATI A;  1EDL A;  2BOK A;  1SGI B;  1O3K A;  5GCH G;  2NRG A;  2QIQ A;  1V2O T;  1FAV A;  4ISH H;  4MLF B;  3MIW A;  3L74 G;  4YPC A;  2QRX A;  1HUC A;  4YXW H;  5GTI H;  1DWE H;  2O3J A;  4FU9 A;  2FOC A;  4JYV H;  1RRK A;  4IFM A;  5GWZ A;  3RK2 D;  1TA2 A;  1U7M A;  3RGU A;  3A8D A;  4JZI A;  1O2Z A;  1C5P A;  1P01 A;  4BAH B;  1BRC E;  4INL A;  2PP6 A;  1HLT H;  2ODP A;  4KTC A;  2BEZ F;  1EPT C;  2PAJ A;  4H6S B;  1E37 B;  3B5N D;  3IIT A;  3CCR P;  1G30 B;  4OVN F;  4GKG A;  4MPW A;  1DLE A;  1SGD E;  5KAI E;  3TK1 A;  3KEE A;  1CA0 B;  4TYD A;  5E2P A;  4XE5 B;  2W3I A;  1ZHR A;  3ZVC A;  2IOT A;  1MMJ N;  4NIW A;  3AEF C;  1ZW0 A;  1H0T A;  2Z9J A;  1N8O C;  1SGY E;  1E5W A;  4TWW A;  3PTZ A;  2K37 A;  2E5Y A;  2XCN A;  3OW2 O;  1C5X B;  1SQP J;  1FY1 A;  1O3G A;  1ZRT E;  2AS9 A;  1QHR B;  4Y11 E;  1WDI A;  1JCC A;  1AVO A;  1JTH B;  1H89 A;  1ELB A;  1T4U H;  1KDQ A;  2QF3 A;  3F9H A;  2PGB B;  1MZD A;  3JCU H;  2Y0D A;  5AVW B;  3BRV B;  3ZIA D;  5APY A;  4I7Y H;  1TPP A;  1YQ3 C;  2VH6 A;  1O5F H;  1CT2 E;  3H1K E;  1RD3 B;  1JCD A;  3M37 A;  3AEB C;  3E1R A;  1ABI H;  3GCO A;  4ACA A;  1CHG A;  1F92 A;  3ATW A;  3K6Z A;  3UNQ A;  5A2M H;  3H1I E;  3MNC A;  5CHA B;  1QEX A;  1BT7 A;  4HZH A;  2BDA A;  1EP5 A;  3S7H B;  2EI7 A;  3H32 A;  1LVM A;  1K05 A;  3P32 A;  2BLQ A;  4X2V A;  3SU5 A;  4CHA B;  3WUV A;  1TGC A;  1X8Y A;  1P2N A;  1IK9 A;  1NO9 H;  1EOJ A;  3MHW U;  4NCY A;  1ZGI A;  3SV2 H;  3RXU A;  3F68 H;  4TT3 D;  1EZV E;  1SQP K;  2G55 A;  4DVA U;  3UQV A;  2A45 G;  1NTM D;  1T8L A;  1OXG A;  1GJC B;  2H9T H;  2M5A B;  4NGA H;  4ACB A;  4N3Y B;  1TMB H;  5HIY A;  4OGQ B;  5KAF H;  3M5L A;  3EE7 A;  2UUJ B;  5FX6 A;  3WW7 A;  1HGZ A;  2A45 B;  1ACB E;  1LTG C;  1KIG H;  2FYN C;  1KIL A;  1Z8J B;  1YBK A;  2BVX H;  2KCY A;  5AVY B;  3E8L A;  5KLI B;  3BF6 H;  4OS6 A;  3SU2 A;  4OS1 A;  1HAP H;  2YXQ B;  1O32 A;  5CHB A;  1DUA A;  2AFQ B;  3CMA P;  1OWJ A;  3GF3 A;  2FEQ H;  1L0Z A;  3C8V A;  1FUJ A;  1DX5 M;  3PLN A;  2VWO A;  4E05 H;  2HGT H;  1EPT A;  1KTM A;  2W7S A;  2AGE X;  1VGC C;  1DEE G;  2KLU A;  3B8E B;  2Q9I A;  1ELA A;  1O3L A;  2W3K A;  1DDJ A;  3GY3 A;  2QA4 P;  1BMM H;  1V2T T;  3MU0 A;  2UWO A;  3PRO A;  4NSY A;  1HJ0 A;  1EX3 A;  2J59 M;  1MKX K;  2SGF E;  5HM2 A;  2OTL P;  4BAQ B;  1O31 A;  3I56 P;  3L72 J;  1NTZ J;  4U32 A;  3AED C;  2ZNK H;  2BY7 X;  3TNS A;  2SGP E;  1N86 A;  3T97 B;  2JP3 A;  4WY4 C;  1MAX A;  1YTZ I;  1T3U A;  4ZKU A;  5GXP A;  3BSQ A;  2A2Q H;  1QVG O;  1THS H;  1SGP E;  1UK4 A;  1NYH A;  3GHG A;  1LT9 C;  3VTP C;  2A5I A;  2OC7 A;  2PW8 H;  2V0B A;  1RHZ B;  4MVN A;  4GCH G;  1SQQ E;  1A0L A;  1NTK E;  2FOE A;  3SQH E;  2VIV A;  2BD5 A;  1TPO A;  1W10 U;  5DJU B;  1UHB A;  1S81 A;  2ZEB A;  4NA7 A;  5E0G A;  3L71 J;  2H1U A;  2ZP0 H;  4H0L D;  3NK8 A;  1HVV A;  3OE7 D;  2EI8 A;  3MFJ A;  1KYO E;  1LTO A;  3BTE E;  5T6D A;  1P3E A;  2OBO A;  3H7O A;  2WSE J;  3HPT B;  3TGU E;  1F0R A;  4GAW A;  3MHV A;  2PHB A;  2ZVN B;  2Y7X A;  5TCC A;  3RMM H;  3BTD E;  1EAI A;  1GVZ A;  1GJA B;  4X0W U;  4BXW A;  5GTH E;  2G4U A;  5APV A;  1ZR4 A;  3GY5 A;  4HB1 A;  5B5E E;  3HKI B;  2Z4E A;  2B88 A;  1O0D H;  1K2I 1;  4NIX A;  4XSK U;  3VMX A;  5ESB A;  1TLD A;  2IZ1 A;  4UDW H;  1HJB A;  4DJZ B;  1KXF A;  1C1S A;  3A8B A;  1L4A C;  2BDC A;  2VVV A;  2FBW C;  4K8Y A;  1W0J D;  3VB7 A;  2FOG A;  1WOF A;  5DP7 A;  1BMA A;  5L2Y H;  1QX8 A;  3RBZ A;  4C7N A;  4NPE A;  4ABA A;  3Q3K A;  4IOI H;  1GVL A;  1PGJ A;  3F3B A;  2ALV A;  4I8K A;  1DEB A;  1KB9 H;  2OQQ A;  1R8E A;  1KXE A;  1AB9 B;  3HUS C;  1AMH A;  4RO0 A;  1FY8 E;  4WME A;  4L73 A;  1KLI H;  5EQR A;  4ZHM U;  1SC8 U;  3SWK A;  1QJ7 B;  2FYU D;  3W68 A;  1OZH A;  2R0L A;  2ZGB H;  2YKQ A;  2CJI A;  1PP9 J;  1MFT A;  1EZU C;  2FOA A;  5J4Q A;  1LKA A;  2ODY B;  1IQJ A;  3HE4 A;  4ZKS U;  4YT7 H;  1O3I A;  1P02 A;  3RK2 C;  2A45 I;  1XKA C;  2M2A A;  1DY9 A;  2YMS B;  4IS5 A;  1LT9 A;  1LWU B;  4JBZ A;  1J9C H;  5LH8 A;  3P6Z B;  1LPG B;  2WSF H;  1SPJ A;  1SQR A;  1IOE A;  2XNX A;  1HAZ B;  1P06 A;  3U69 H;  5CBO A;  2P2U A;  1ZSL A;  2AIP A;  3PLB A;  3KNX A;  3SO3 A;  3DFL A;  4YM9 A;  2BY8 X;  3B5N C;  2BX4 A;  1DOJ A;  3FKS D;  4DG4 A;  2K1A A;  3DUX H;  1DH3 A;  1K22 H;  1FXY A;  2ZHQ H;  3MUD C;  4Y8X A;  3MQK C;  1S85 A;  3F0P A;  4K2Y A;  2RG3 A;  3VN0 A;  4D9R A;  2QM8 A;  2XKM A;  2WWW A;  4X6P A;  3QWO C;  2AEJ A;  3ZZ3 A;  3LID A;  2R5B A;  3HK6 B;  3NFQ A;  1LNQ A;  3RL0 B;  1SGE E;  3V2R A;  1KMH B;  3OTP A;  3ZZ9 A;  3HE5 A;  1RFN A;  2OTJ P;  1SGT A;  4CBN A;  1LTS C;  1TWX B;  2ZPQ A;  1E1Q D;  3MP7 B;  1J1D B;  1BCC G;  1UVT H;  2V7Q D;  1N8R Q;  4Y8Z A;  1GI8 B;  2JDI H;  2CV3 A;  1YTZ T;  3M9B A;  3MOC A;  3WWB A;  3Q3X A;  1LHC H;  1E34 B;  1KXC A;  4N6J A;  3U1J B;  3QO6 A;  1IQE A;  1TNJ A;  2N1T C;  5C17 A;  1M1J A;  3L73 J;  2W6J D;  1M57 D;  1YPH E;  4MNX A;  5B6O A;  2H2Z A;  4U30 A;  1VCP A;  2R3S A;  2R3Y A;  5T6G A;  5AVV B;  3PMJ A;  2IJD 1;  1QB6 A;  1H9H E;  2O8M A;  1H1B A;  2A45 H;  5CJ4 A;  1PQ8 A;  1OW6 A;  2V4H A;  2GT7 A;  3M3S A;  2ZFF H;  2NU2 E;  3BG4 B;  3ZZC A;  2KP8 A;  3UIA A;  1CU1 A;  1V2P T;  1EUF A;  1BBR E;  1O2J A;  2GCT C;  3P70 B;  1V2U T;  5EU8 A;  1KD1 Q;  3P8F A;  3SV8 A;  3AEA C;  2SPZ A;  4UB8 E;  3NWU A;  5KJ7 D;  1ZML A;  3HRN A;  2BDG A;  1VF5 C;  1LVB A;  3IAO A;  4F55 A;  4RI0 A;  5AF9 H;  2J98 B;  2KR7 A;  3OAK A;  1W8B H;  3QZR A;  1SGQ E;  4FUJ A;  3USS A;  1O30 A;  1BTH H;  2E74 D;  2GA1 A;  1BA8 B;  2ZWL H;  3FAO A;  5A09 A;  2PRR A;  3UTU H;  1KYN A;  1TGN A;  1X79 B;  1O3O A;  4MQA A;  1ZXG A;  3B5N A;  1GHX H;  4AN7 A;  1GJ9 B;  2QJP C;  3MUD A;  1ZRB A;  2JET B;  3H1H E;  1YP9 A;  1DD3 A;  3BTF E;  2PSY A;  1OW8 A;  3UUZ A;  1Z8G A;  3HD7 A;  1A3E H;  1ESA A;  1XUF A;  1GCD A;  2Y5H A;  3CXH E;  1J8A A;  3D62 A;  3F0O A;  4PJ0 H;  1NM6 A;  1N1L A;  1S9K D;  1JY2 P;  1VQ6 P;  4X8T H;  1C1V H;  1Z1I A;  4EIJ A;  2OGU A;  5M1B A;  5DN6 D;  3KXD A;  1CHO F;  4AUW A;  2PV9 B;  1EAU A;  3P8N A;  2WPS A;  1NRR H;  3M91 A;  4FOU C;  3RK3 C;  3H1J E;  1SQB G;  2ZXX A;  3CD6 P;  2OK5 A;  4U3F E;  1P12 E;  5LPE A;  2FX6 A;  3VB4 A;  1SFC D;  4Y79 A;  5AVX B;  1S1C X;  6GCH F;  2R5D A;  1GL0 E;  2FOH A;  4FUE A;  1SGN E;  2STB E;  3F6U H;  4B6F A;  2N1T A;  4H0L C;  1RIW B;  1C2L A;  1D3P B;  1SI5 H;  3QTV H;  5EXM A;  5GTI E;  1KLT A;  2KCO A;  2CK3 H;  2ZCH P;  2Z9I A;  3DT0 H;  1SQQ D;  4IBL H;  2C3S A;  4YLU A;  1LQD B;  1P2K A;  1GMD G;  2E75 C;  2FFD C;  2OYH B;  1NTK D;  3MU5 A;  1AV1 A;  4FVB A;  2YIU B;  1Y3U A;  3RXR A;  1SQX J;  5F8X A;  1S72 P;  3KQ5 A;  1GK6 A;  5AW0 B;  3KQB A;  4DY7 B;  2GMT C;  5HKK D;  1D6W A;  1KZU B;  2JH6 D;  4WMF A;  3W94 A;  1VIT F;  1CW5 A;  1AZ8 A;  2GZ8 A;  2ZPR A;  1GHY H;  1K1I A;  3H1L J;  2ZPS A;  4B2A A;  1CI6 A;  1KYO D;  3CCM P;  3SGA E;  2BLO A;  3PLK A;  1GBK A;  2W6B A;  3ENS B;  1F7Z A;  2C90 B;  1WXR A;  5DG6 A;  5EPN A;  1FJS A;  2IBZ E;  3E0P B;  5A8X A;  2HNT F;  2E76 B;  1DWC H;  2FIR H;  2P93 A;  2WPL S;  1SQV E;  4DT0 A;  3L6P A;  4B1T A;  4O9V A;  1JRT A;  2Y9Z A;  2QGR A;  5APW A;  4L76 A;  1ZP0 C;  1BDA A;  2ANY A;  3RLY H;  2NPS C;  4AFU A;  4XFJ A;  2ZFR H;  4K1E A;  3AE2 C;  1Z71 A;  3D6Y A;  4H13 B;  1O5A B;  2C8Y B;  1BML A;  2KZJ A;  3JCU E;  2FES H;  1KMI Z;  1YKT A;  3A7X A;  1FZG A;  1BGY G;  2CHA C;  1K28 D;  1PPJ E;  3ITI A;  2BXT H;  1EAS A;  2BDI A;  2W90 A;  4KJM A;  3ZV8 A;  2BX3 A;  4Q80 A;  3ODF A;  1NAF A;  5K0H A;  2QSI A;  2UWJ E;  6CHA C;  1LGH B;  3GOV B;  1Y8T A;  2A7J A;  3SU6 A;  4IL6 H;  1ETR H;  1SQB D;  2HAL A;  4X8U H;  3SV7 A;  2BDY A;  2A7H A;  1ELD E;  5CMX H;  3LH3 A;  4PRO A;  5AFY H;  4MN4 C;  3RC5 A;  3RXL A;  1EOL A;  1P8V C;  8LPR A;  4CR9 A;  2HWL B;  3EA9 A;  5I25 A;  5DP6 A;  3UNR A;  1J2J B;  3MO3 A;  1SFQ B;  1N7S D;  1L1J A;  1ABJ H;  4I31 A;  4VGC B;  5KAF E;  1HV7 A;  1TOM H;  2B87 A;  4B6E A;  1LKB A;  1UTQ A;  3SJO A;  3KF2 A;  3Q3Y A;  2XC5 A;  3NUM A;  5KKZ C;  3I78 A;  3AAS A;  3U8T H;  2AMP A;  1AVW A;  3FVF B;  4LOY H;  3RXG A;  5T6F A;  1MUU A;  3AW1 A;  2JH5 D;  2DW3 A;  1O3C A;  3CX5 H;  3VGC C;  4ISL A;  2Q3I A;  3KZI H;  2L74 A;  4EDF A;  2ZYG A;  4R0I A;  4FVD A;  3VB3 A;  2YOL A;  3LT3 A;  1HH0 A;  4CH8 B;  4DCD A;  3P17 H;  1O5D H;  4N78 E;  1TNI A;  4K5Z A;  2R3U A;  1PPZ A;  2SGA A;  1T8O A;  2WSE H;  1KIL D;  4ABJ A;  1RF0 C;  1IQL A;  4MPV A;  3T27 A;  1W0Y H;  4LK4 A;  2ZG0 H;  1GJ7 B;  3L3T A;  4K3J A;  1SQX G;  2NPS A;  1S82 A;  1BGY D;  1A1R A;  2JJL A;  1A0J A;  1DAN H;  1TQ0 B;  4FUH A;  3MH5 A;  4AGK A;  3QN7 A;  2ZC9 H;  1H88 A;  3GY8 A;  4K69 A;  2FXO A;  4U7J A;  1NU1 G;  3A5T A;  2KS1 B;  1ZTL A;  2G8T A;  2ILN A;  3IFM A;  1O2V A;  1UTO A;  3GIS B;  2Q7C A;  1YLD A;  1HJ9 A;  3B9F H;  1DIP A;  5KJ7 C;  1V6D A;  3EE0 B;  4NZQ A;  3G9R A;  1DSU A;  3JZ1 B;  2OYI C;  2NU1 E;  1OXZ A;  1LHD H;  2WSS D;  3T25 A;  1NOH A;  1V2L T;  1IQN A;  1V2Q T;  5CE1 A;  2FTL E;  1TMT H;  5KLV G;  1ZZZ A;  1BHX F;  2SFA A;  1WSS H;  1AUJ A;  2ZYA A;  9LPR A;  4CH2 B;  3Q1M A;  3SZE A;  2QJK C;  3KPE A;  3LGI A;  3O8D A;  1BTY A;  2DUC A;  1SGF G;  1QB9 A;  1SLV B;  3LIE A;  4WY4 B;  1QRX A;  3PRD A;  1RF1 C;  2ZDK A;  1PPC E;  3TK5 A;  2ZTX A;  2WT7 B;  3KDP B;  2B0F A;  1NS3 A;  2XC0 A;  3S7K B;  2J9N A;  1XMN B;  3SQE E;  2F9P A;  1AVY A;  1C2K A;  3DSP A;  5EW1 H;  2XBW A;  1FZC B;  1BHX B;  3OY5 U;  2KFW A;  3MI4 A;  3H25 A;  1HAX B;  1P57 B;  1TBR H;  3Q3D A;  3H1H D;  4X2Y A;  3MTU E;  1H4W A;  1LO6 A;  2P8O C;  3OU0 A;  1KB9 E;  2CN0 H;  1P03 A;  2GUS A;  3E7K A;  1C2G A;  1QA0 A;  1W14 U;  1YPG H;  2C4F H;  1IC2 A;  3ZYD A;  1SFC C;  1O36 A;  1LTT C;  3CPW O;  2A31 A;  5JBB S;  1IFJ A;  1JXP A;  1SOZ A;  1M8O B;  1IHT H;  1LTI C;  1NTM J;  5F03 A;  1JNM A;  1KFN A;  4NPD A;  1ZTK A;  4UFE H;  1RF0 A;  2A06 E;  1C5L H;  3H1J D;  4WWY A;  3O8C A;  1NO4 A;  5BPE A;  1NU1 D;  5TJX A;  3VFE A;  1EXJ A;  1QY6 A;  2K0Q A;  2AXT H;  2FS9 A;  1MKW H;  3WWF A;  2QIW A;  1GHA F;  4DUR A;  2H8P D;  1C2F A;  2CMY A;  4WXI A;  4NIY A;  1FY3 A;  2Z5I A;  2F83 A;  3CNR A;  4AX9 H;  4ZKP A;  1L4A B;  2VH0 A;  5FPT A;  1FJK A;  1E79 D;  1OOK B;  2KLV A;  5TIS E;  2QE7 H;  2HPC A;  2F9O A;  2D2C B;  1VIT H;  1G3B A;  4A1V A;  1H8E D;  3PMA B;  1YGC H;  3TDK A;  2R3C A;  2BAS A;  3BV9 B;  1GHB G;  1L0N E;  4NPF X;  2PLX A;  3WUU A;  3PRB A;  2BY6 X;  4OS4 A;  1O5B B;  1QJ1 B;  5C0U A;  2TRM A;  2WTY A;  5DP9 A;  1HAV A;  3HUS B;  3L70 G;  4EYY Q;  3CC4 P;  3WU2 E;  1CGH A;  3GCT F;  1NJI Q;  1O2T A;  4FUC A;  4X1P U;  1DUE A;  1PQ7 A;  1Z8R A;  5DP8 A;  1C1O A;  1K21 H;  1GJ4 H;  5CCH A;  2Y7Z A;  3RXM A;  2YXR B;  4X8V H;  2BCC E;  4YT6 H;  5B66 H;  3CWB G;  3K65 B;  1SQV D;  3R0F A;  3SUD A;  3RK2 B;  4XA4 A;  3CCL P;  4C46 A;  2HG5 D;  3GDS A;  3P8O A;  3MH6 A;  1FAK H;  1IZN B;  2FKW B;  2BD9 A;  3MTY A;  1JOC A;  5K5G B;  1CGI E;  3F1S B;  1FDP A;  1GHW H;  3TPI Z;  3UWI A;  3E16 B;  4JCN A;  2JR8 A;  3TNU B;  4BRY A;  1NRN H;  2P1J A;  2FLB H;  1JY3 O;  4K35 A;  4Q7X A;  5EGM A;  4D6T E;  2WQY C;  3SU1 A;  1PPJ D;  4X2W A;  3FAN A;  2VNT A;  1TRN A;  2YMY A;  1VQ7 P;  2G8Y A;  2OLG A;  1OS8 A;  1ANE A;  4LXB H;  1L2P A;  4ZAE A;  1N7S C;  1O3M A;  3TIT A;  1VZQ H;  2O8L A;  1HCG A;  1BOQ A;  2PKA B;  1SMF E;  3G6E P;  2WHX A;  4ASV A;  1GI7 B;  1GMC F;  3B23 B;  1C2D A;  3I29 A;  3P92 A;  1GMH G;  4FUF A;  3PMH B;  3SNC A;  1G36 A;  5DP5 A;  1QBN A;  4TY7 A;  5GCH F;  4H4F A;  3ZZ7 A;  4Z1M D;  5EJ1 A;  4HJG H;  2B5T B;  1D7M A;  2QA9 E;  2FI4 E;  3CCE P;  4I2L C;  1EJM A;  1FDI A;  3BTM E;  1MTV A;  4NWL A;  3RU4 E;  2FO9 A;  1EXF A;  1GHV H;  3AAV A;  3CCQ P;  3AE8 C;  2WPD D;  3PWC A;  3A88 A;  4CRG A;  3A8A A;  2Q3E A;  2N9B A;  4OS5 A;  1T31 A;  4ABF A;  5CBN A;  1NH4 A;  3L70 D;  1C2H A;  1VDF A;  2TGD A;  1NTM G;  2OP9 A;  3V2N A;  1KIL C;  2F9N A;  2FYU J;  4PJ0 E;  4NWK A;  1SQA A;  1GL2 C;  4GDO A;  1BE3 G;  2XYA A;  1RTK A;  2RFK C;  1NHL A;  2AEM A;  2NU0 E;  1F0T A;  1BQY A;  1SLQ A;  5PTP A;  3SJ8 A;  2GCT B;  2KB7 P;  2KNC A;  3CWB D;  4BTT B;  5SGA E;  1MAB B;  1KQF B;  1G1I A;  4PD4 E;  2F9V A;  2KI7 B;  2YNA A;  3QZQ A;  3VEQ B;  3V5B A;  2KCA A;  2JKV A;  1L0L G;  5TJH A;  2F4L A;  4HGC A;  1HTL C;  3F9E A;  2QXJ A;  4EOT A;  3GDV A;  2GCH F;  5EQQ A;  1MV8 A;  1SFI A;  1GCT C;  1P3C A;  3KQE A;  2ASU B;  4ASU D;  5H2F H;  1KFM A;  2Z6B D;  3HD7 D;  1V2S T;  1IHS H;  3MU4 A;  1MZ9 A;  1P10 A;  1AJY A;  1JB0 J;  1G2C A;  2IYO A;  5LPR A;  2CF8 H;  1K0H A;  1SQP E;  3Q76 A;  3A84 A;  1GBI A;  4IL6 X;  1BTX A;  1MCT A;  2LKM A;  1O3E A;  2WZQ A;  3T26 A;  4Y99 B;  1EDJ A;  2J97 A;  3GHG C;  4MNV A;  3PO1 B;  2QAA A;  1TBZ H;  1XXF A;  1YWU A;  2QXH A;  5GJ4 B;  1ZSK A;  4NG9 H;  1NRO H;  3TU7 H;  3RXB A;  1CT0 E;  2PR3 A;  3O8Z A;  3MD0 A;  2WV4 A;  1N7S A;  1FQ3 A;  1FZA A;  3EA8 A;  1QVF O;  3LJJ A;  2BTC E;  2XND H;  3M06 A;  2H9H A;  2PUQ H;  4B75 A;  2V7Q J;  1V2J T;  4R4M A;  2N1T D;  1INC A;  1GDQ A;  1GL1 A;  5KED A;  3EQ0 H;  1OP2 A;  1A5H A;  1A3B H;  2ZJS E;  1TOC B;  1UJ1 A;  1JMB A;  7LPR A;  2OTV A;  3K9X B;  3CL3 D;  1OWE A;  3AE3 C;  1C2I A;  2O1J A;  1N2D C;  5C94 A;  1Z1J A;  1C4Y 2;  3AE4 C;  1BDD A;  1GTW A;  1BRA A;  2AER H;  1UTK A;  4OWF A;  2OYH A;  2C8W B;  3MO6 A;  4B71 A;  4JYT A;  1C5Q A;  1JMM A;  1XUH A;  2RDL A;  2P67 A;  1H8A A;  2O8U A;  4H0L B;  2ULL A;  1G1J A;  1DS2 E;  4MNW A;  4KKD A;  4I7Z C;  3G01 A;  2OYO A;  1BE3 D;  2FFD B;  1JUN A;  4ABB A;  3Q5P A;  3V4Q A;  1VF5 D;  2BY9 X;  1EQ7 A;  1A2C H;  3A82 A;  3STI A;  2GMT B;  3FN8 A;  1J16 A;  1GL2 A;  1XUJ A;  5E2O A;  1C4U 2;  1FNI A;  4BAO B;  1NT1 A;  1ELF A;  1L0L D;  4IL6 E;  1K1J A;  2HRV A;  1PL5 A;  4JZE H;  3PWB A;  4X8S H;  4AB9 A;  5FAH A;  2G00 A;  2VWN A;  1CZQ A;  2Y80 A;  4GOD A;  2C9L Y;  1GJD B;  3M7Q A;  2ZTY A;  4AG1 A;  2AYW A;  5E8E H;  1SOT A;  2F43 B;  1SLX B;  1OWA A;  1QLE D;  2YO3 A;  3HTK B;  1EDI A;  2A06 D;  3RMN H;  2FI3 E;  3L72 E;  1NTZ E;  4YLQ H;  2VWM A;  3H5C B;  3S9A A;  3VXF H;  2Q6Q A;  3BCC G;  3NRL A;  1X9V A;  1QR3 E;  2EY4 C;  3BN9 A;  4GCH F;  2VVC A;  1T32 A;  3TF5 A;  1O37 A;  1UTP A;  1MTU A;  2FYU G;  4JZ1 A;  5C5O A;  3U1A A;  2WV9 A;  2AEI H;  3GMA A;  3P7K A;  2BY5 X;  4Q2K A;  1N73 B;  5I46 H;  3UFA A;  2ODQ A;  1AFO A;  1HYL A;  3RK3 D;  5DK1 A;  4DOQ A;  1AY6 H;  1DWD H;  4GHQ A;  2HLC A;  2WPQ A;  1PQA A;  1BCC J;  3T5F H;  2QF5 A;  1FOS E;  2XZR A;  2KAI A;  1FZB A;  3VMY A;  1L0N D;  1HWT C;  1W0K D;  1YF4 A;  3F2G A;  3L71 E;  2BDB A;  6CHA B;  3TYY A;  1LP1 A;  1O2O A;  3KZI E;  1YYY 1;  1OFC X;  1WTH D;  3UR9 A;  3U98 H;  3URE A;  4ZMD A;  4IN1 A;  1PGP A;  4WVZ A;  1C5U A;  2HOD A;  2Y5F A;  2ZGJ A;  3AVZ A;  4WJG 2;  4E7N A;  1J17 T;  1IO4 A;  2Y0E A;  3KCG H;  1NTZ K;  2E75 D;  1QBV H;  2ZQ2 A;  1P84 D;  4RKO B;  1ZHM A;  1V2R T;  3UOP A;  3AW0 A;  1YHQ P;  1Q3X A;  1HJA C;  2CPS A;  1SQQ J;  5CHX A;  4BAN B;  1NTK J;  1P09 A;  1V2N T;  1OIP A;  3EFF K;  3VOP A;  2L6O A;  2CF9 H;  1Q2W A;  3G3Z A;  4E06 H;  5KKZ B;  3M5O A;  3SJI A;  3KHU A;  2HVX A;  4I8L A;  3H6P A;  1NRS H;  5JB8 S;  2IZ0 A;  1H8I H;  3VP9 A;  1M1J C;  2Z3E A;  3RXQ A;  3FGA D;  2ZF0 H;  2JWA A;  1P2O A;  1C2M A;  5AVS B;  4WBA A;  1S6F A;  3L75 E;  1AKS A;  4IMZ A;  1FIZ A;  1O2N A;  5AW5 B;  1YY3 A;  3O6Q B;  2NPS D;  1FV9 A;  2FYR A;  1E36 B;  1H9I E;  2XXL A;  3UOU A;  3GCH B;  5DP4 A;  1MKM A;  4L75 A;  1AU8 A;  3ZZB A;  1RJX B;  4TT3 H;  3BCC D;  3RML H;  2VIN A;  1NC6 A;  5FHT A;  1VQ4 P;  1UTN A;  2GV6 A;  3PYH A;  1J1E C;  3TSI A;  3H1K G;  3SWF A;  1WQV H;  3V4W A;  5C0T A;  3ZVF A;  1TON A;  3AE6 C;  1PP9 E;  2AH4 X;  2KUB A;  3H1I G;  1Q2N A;  1Z8I B;  3L33 A;  1VCW A;  3QGJ A;  3S9C A;  2Z5H A;  1P84 I;  3ZDM A;  1HGV A;  5F8Z A;  5DJT B;  4YOI A;  1DST A;  4AFQ A;  1SGC A;  1QIX B;  4K1S A;  4DZO A;  2WYG A;  1EZV G;  5G4B A;  1SQB J;  4AB8 A;  4AOQ A;  3W67 A;  1NKZ B;  2BEQ D;  5AW7 B;  2FLR H;  2GKV E;  2ZZU H;  2LR2 A;  4I8H A;  4BAK B;  3URC A;  1YPJ H;  2OYI B;  1BDC A;  2VID A;  1GI4 A;  3V13 A;  4I86 A;  4AFS A;  4JQ0 D;  1GJ5 H;  4AFZ A;  1JM0 A;  2E74 B;  3FX0 A;  3HD7 C;  4JPZ B;  1ZLR A;  2AIQ A;  2UUY A;  3ZVB A;  2I6S A;  1G2L A;  1U6Q A;  2ALP A;  1CT4 E;  4PD4 D;  1FOS F;  3CI9 A;  2QJK B;  1YI2 P;  4AOR A;  1TU3 F;  2O01 J;  4X6O A;  3RL0 g;  1S83 A;  3S69 A;  1BMN H;  2BLV A;  2AXT E;  3BTG E;  1RF1 B;  1XUI A;  5K7R A;  1FC2 C;  2SGE E;  4TPY A;  2BD7 A;  3HK3 B;  3Q77 A;  4SGB E;  3SYJ A;  1EAW A;  4W7Z A;  1S84 A;  3M7U A;  1C1N A;  4JZD H;  4R4L A;  1HIA B;  1LHF H;  1OYQ A;  3T2N A;  3CP7 A;  2WUC A;  5F53 A;  1ZRT D;  2H88 C;  4JYC A;  2OQ5 A;  3FOA A;  2ZFP H;  5GDS H;  2KK7 A;  3L73 E;  3PLP A;  1L4Z A;  4CRD A;  2GZ9 A;  1LTJ C;  4INH A;  2KM0 A;  1WT6 A;  5EXL A;  4D7F A;  2FDA A;  4UB6 H;  3EAJ A;  4D9Q A;  1O2R A;  1YLC A;  1SFC B;  3H1K D;  2Y81 A;  1SQQ G;  1FZF A;  4CRF A;  2HNT E;  1ZJK A;  1P04 A;  5DO4 H;  1NTK G;  1GBT A;  3H1I D;  1VPC A;  3CLQ A;  4Y7B A;  1BGY J;  1DLK B;  2P95 A;  1RGQ A;  2L91 A;  4H44 D;  5EST E;  1DX7 A;  2C93 B;  1DT2 A;  1MKW K;  4U01 A;  3I5C A;  3SJ9 A;  1S5L H;  1FDM A;  1PPB H;  1NWQ A;  1AQ5 A;  2A5A A;  2K9J B;  2FYZ A;  1SL3 A;  1AFQ B;  1EZV D;  4ASW A;  3L35 A;  1BTU A;  3TGU G;  1DD4 A;  1GBB A;  1URQ A;  4MDS A;  4XFQ A;  1FU1 A;  3WY8 A;  1DY8 A;  1CA8 B;  1O34 A;  3OY6 U;  2ZXE B;  3G71 P;  3SHA H;  1QJ6 B;  2WZ7 A;  1O5G H;  1O2P A;  4IFF A;  2ZHE H;  3NMD A;  4B86 A;  1MBM A;  5CCH D;  3EA7 A;  1UCY H;  1C5Y B;  1VQN P;  1BSH A;  1JY3 N;  2F3C E;  1WRG A;  2XWA A;  1LPK B;  1CGJ E;  1S3J A;  1HAO H;  1UTJ A;  3NPS A;  2IFN A;  1W2K H;  1CA0 C;  4GVU A;  1NES E;  1AD8 H;  1VQM P;  2M0B A;  3F9F A;  3Q2Y A;  5IYT A;  3BEU A;  2V6N A;  2N9Y B;  1IFP A;  1AND A;  1LVY A;  5FPY A;  1XVO A;  1O2Q A;  1GVK B;  1BRB E;  3V6I A;  5J4S A;  3UPE A;  5EW2 H;  1JIM A;  4DGJ A;  3M9H A;  4ZKR U;  1P0S H;  1AE8 H;  3C9I A;  3F2F A;  2H7H A;  1KTT B;  2Y82 A;  1Y3V A;  1KXA A;  1LHE H;  3SNB A;  2OCV B;  3PTN A;  1CQQ A;  1Z7K A;  2BQ6 B;  1A02 J;  1PZQ A;  1C5Z B;  1MD8 A;  1H0T B;  2EC9 H;  2A7C A;  1A0H B;  4JZF H;  1C1Q A;  1GMD F;  3U59 A;  3H1H J;  2GDE H;  3A7O A;  2QEX P;  1GBC A;  2D8W A;  1ELC A;  2VRS A;  2CGA A;  1ZOM A;  2G52 A;  2NU4 E;  1LTJ A;  4FUI A;  4OS7 A;  3P8M C;  3A0B H;  3AEC C;  1JY2 O;  2KZI A;  1KDQ B;  1EZV I;  1EFR D;  4R8T B;  1HXE H;  3N7E A;  2P7J A;  3GG2 A;  1C5N H;  4M9F A;  4CRC A;  1Y5A T;  5DKM A;  2Z9G A;  2ZDL A;  2RA0 A;  2ZHD A;  3A8C A;  2IJO B;  3RXP A;  1FPC H;  4CHA C;  3H1J J;  3H1L E;  1FMG A;  1NU1 J;  1RXP A;  5KAI H;  3KL6 A;  1VL2 A;  3OJA B;  4I1L A;  5AVU B;  2FXR A;  2GVF A;  4RT1 A;  1QQU A;  3RXD A;  2V7Q H;  4AG2 A;  4LLH A;  4RSP A;  4B2C A;  1FX0 B;  3H32 B;  3PB1 E;  2YKO A;  1GBF A;  3TGU D;  3L36 A;  5H2F E;  4L74 A;  8GCH G;  1SHY A;  3LGV A;  1TQ7 B;  1KQG B;  1VJ9 U;  4HI3 A;  4OGQ C;  2P94 A;  1LT1 A;  2LXC B;  3D6Z A;  1GK4 A;  2W6J H;  3RM0 H;  2VVU A;  1YM0 A;  4CRE A;  1V2W T;  4PV1 D;  5KLI C;  5A8Y A;  5KLV J;  2FI5 E;  3KID U;  3LGT A;  1H9L B;  1FN6 A;  2XOK D;  5T1V A;  3RXH A;  3ZZA A;  4ASH A;  4GSO A;  4UFF H;  1E1R D;  5BU8 B;  3LW5 J;  1SQX K;  2OC0 A;  3OYP A;  2UUF B;  1BSN A;  2GJG A;  1KIL B;  1A4W H;  1L4D A;  3A81 A;  4YOJ A;  5EG4 A;  3RXJ A;  3W1E A;  1NZQ H;  1GD2 E;  1NU1 K;  2LNC A;  3L75 D;  1PFX C;  5C1Y A;  4OH8 B;  2O1K A;  1UVU H;  1T7C A;  1O2U A;  4Q63 A;  1SQV J;  1SLU B;  4Z0K A;  1EPT B;  2AMQ A;  3F9G A;  5AVZ B;  3BRT B;  1SQO A;  1QA7 A;  2ZI2 H;  2ZYD A;  3GY7 A;  4XD7 D;  1FIW A;  5KGO A;  3RXI A;  1F5K U;  1G3C A;  2B89 A;  4OGX A;  1MTS A;  1JTH A;  2O8T A;  4XBD A;  2ANK H;  3N99 A;  4YZU A;  1KYO I;  1THP B;  5KLV K;  2WYJ A;  1N8O B;  1B0F A;  5DJ7 A;  5A0A E;  3GCN A;  1WU1 A;  1RY3 A;  4JYB A;  4AQR D;  2BMG B;  3EYD A;  1LTB C;  3OTJ E;  1XUG A;  1BTW A;  3TJU A;  2AHM E;  3LPR A;  1C5T A;  3TH2 H;  3GHG B;  4F49 A;  1TAW A;  2RCE A;  4Y7A A;  3GS9 A;  1AFE H;  1A02 F;  4OM9 A;  2BQW B;  1PPG E;  2H6M A;  5EXN A;  1NY2 2;  1P2I A;  5C2Z A;  5FXL A;  2D26 C;  1HAG E;  1IFM A;  3CC2 P;  3SV6 A;  1UHB B;  1O2G H;  3B71 A;  1GBJ A;  1O2M A;  1O2K A;  1UK2 A;  1T3J A;  1W2E A;  1FI8 A;  1QL2 A;  2FS8 A;  1W7X H;  3ZZ4 A;  1O3J A;  2XBV A;  1AIX H;  3RXS A;  1KN7 A;  1KXD A;  4GUX A;  1CE5 A;  1W13 U;  3H1H G;  5HXF A;  1EAX A;  3STJ A;  1NAY A;  2A4Q A;  1PPH E;  4B2B A;  2M5A A;  1NFW A;  4P02 A;  5IDK A;  1T6A A;  1DM4 B;  5AVR B;  1GL2 D;  1EQ9 A;  3E91 A;  3L70 J;  1QFK H;  3CS0 A;  2A1D B;  2G5V A;  4UD9 H;  5LPF A;  3TK9 A;  2E76 D;  2K9Y A;  2SGQ E;  1XUK A;  2KSJ A;  1N6Y A;  3EST A;  1TNH A;  1X0T A;  2QYI A;  3H1J G;  4D76 A;  4U3F G;  2UWP A;  1O2Y A;  3VMZ A;  2FYN B;  3BTW E;  4ZKO U;  3CWB J;  2QJY C;  1RQV A;  1GDN A;  3QX5 H;  4IW4 E;  4TSF D;  1G37 A;  4UE7 H;  1KYO H;  4H44 C;  3F5H A;  3RXC A;  2G81 E;  4TPI Z;  4C7N B;  1EZS C;  3SGQ E;  4XBB A;  2YNY A;  1K1N A;  3SFE C;  4JK5 A;  1ELG A;  1TE0 A;  5ETX A;  3P8G A;  3FZZ A;  1TIO A;  1VGC B;  1BB0 B;  3T97 A;  2KYV A;  4BTU B;  5GTH H;  5E79 H;  1K8A Q;  1O2S A;  1MQ6 A;  1EKB B;  1GBL A;  2FOM B;  2YMS C;  1D3D B;  1LWU C;  1WTG H;  2ZKS A;  2Z9L A;  5CCH C;  3BEF B;  1O39 A;  2FMJ A;  1AVX A;  1GBH A;  3HE4 B;  1GI5 A;  1SB1 H;  2G4T A;  3M3T A;  3C27 B;  3MZW B;  3ATM A;  2E43 A;  2M3E A;  5AW1 B;  1Y5B T;  2IBZ G;  2VBC A;  3GF7 A;  1LT9 B;  4Y8Y A;  3TNT A;  8EST E;  1SQV G;  4WWI A;  1GJB B;  4XRN A;  4ZH8 A;  3GYL B;  4ZMA H;  1SHH B;  5EQS A;  4YTP C;  3H09 A;  2THF B;  3RL0 C;  7KME H;  2D1J A;  3A7Z A;  3KHV A;  1GW4 A;  1PYT D;  1FZE A;  2CXV A;  4D8N A;  1FS0 E;  3QTO H;  2HPP H;  2ZU5 A;  4WB4 A;  4FUD A;  2RH0 A;  3CXH D;  3SOR A;  3SND A;  2F9U A;  1EZX C;  3OSY A;  3SGB E;  1W3C A;  3SV9 A;  3L74 E;  1ETS H;  4W80 A;  1PPJ G;  5JBT A;  2FXM A;  4I33 A;  2L5G B;  1Z6E A;  2AXC A;  1EB2 A;  2J58 A;  2G3A A;  3HE5 B;  3TIU A;  2JH0 D;  1A5G H;  2JIZ D;  4O03 A;  2ZT9 D;  2HLD D;  1SVF A;  3E1I A;  3PJS K;  5DGJ A;  1O2H A;  3HGN A;  1BE3 J;  5EPY A;  5FBI A;  4OS2 A;  4DT7 B;  2O01 H;  3MMG A;  3S9B A;  2WVR A;  4U3F D;  1LMW B;  3DSO A;  4D7G A;  1DWB H;  3TGJ E;  2PFX A;  1SVP A;  1K1P A;  2BD2 A;  4I8G A;  1K73 Q;  5C5N A;  1KSN A;  2Q6F A;  2A4R A;  1T8Z A;  4F4O C;  1GHB F;  3KYG A;  1L0L J;  3MWI U;  1YQ4 C;  4ABE A;  1M1J B;  1M90 Q;  2C9N Y;  1QUR H;  2QXG A;  4GOF A;  4WF8 A;  3G4S P;  1VKY A;  2BYA X;  4YXW D;  2HPQ H;  4X6N A;  3BG4 C;  3C1L A;  1ZRK A;  2VIQ A;  2TPI Z;  3KQG A;  2XBX A;  3PM3 A;  3AEG C;  3PHL A;  1TRM A;  2J92 A;  4INK A;  4CRB A;  1S5L X;  4ZXY H;  3IR9 A;  3M5M A;  2OIN A;  3A87 A;  2AEF A;  1E38 B;  5GPI B;  1EXI A;  3E6P H;  4TY6 A;  2Q6G A;  1NTM K;  1NGM B;  2O9Q A;  2NU3 E;  2BLW A;  3LC5 A;  3M3V A;  4YOG A;  2Z9K A;  1KV4 A;  2P10 A;  4PV1 C;  3S1K A;  2TGP Z;  3UIR A;  1SP4 A;  5C1X A;  3TGI E;  1Y3W A;  3CCU P;  3SI4 H;  4GPG A;  1FJP A;  1LWU A;  7GCH G;  4Y6D A;  3CXH I;  1Q86 Q;  1FY4 A;  3D49 H;  7EST E;  2CPB A;  2IBZ D;  4XDE A;  3D71 A;  1WUN H;  1QB1 A;  1C1R A;  1VCQ A;  3ZVA A;  1XX9 A;  1W5C E;  1Y5U T;  3IWM A;  1YYC A;  5DSF A;  3UY9 A;  4CPG A;  1L0N J;  3AE9 C;  5CMZ A;  4XBC A;  3R2P A;  4Y28 J;  4ZCN A;  2WSS H;  3B5N B;  5AVT B;  2OTK E;  5BRR E;  2RDE A;  1IQH A;  3TGK E;  1B0E A;  3U8R H;  1C5W B;  1GMH F;  3TJO A;  2XNI A;  1NRQ H;  3K5B A;  3HD7 B;  2H43 A;  1Z6J H;  4TWY A;  2IYP A;  2VIW A;  3BTQ E;  1T8M A;  2HFE D;  5FCK A;  3RBX A;  4IMQ A;  2WSC J;  3CCS P;  4BWN A;  1UW7 A;  1G9I E;  1S5L E;  3SSU A;  1MU6 B;  1S0R A;  2B9L A;  3DCL A;  2QXI A;  4A7I B;  2A4O A;  2B7D H;  2H9E H;  4I8J A;  1ZV8 A;  1RIW C;  1P2Q A;  1P2M A;  2H5D A;  4FUB A;  3M5N A;  3WUT A;  1C4V 2;  1OWK A;  2VIO A;  1GZL A;  1NRP H;  1T4V H;  2RKL A;  4RJT A;  1LVO A;  2OYH C;  3GLM A;  2J2U A;  4HTC H;  3RC6 A;  5E0J A;  2YIU C;  2ITA A;  4Y76 A;  4GOE A;  2IBZ I;  2N1T B;  1C5V A;  4F48 B;  3V2Q A;  2VGC C;  1KXB A;  1S6L A;  4JF7 A;  3BTT E;  1W0Z U;  1NFY A;  1BIT A;  3ZYE A;  2ZVO B;  1GI1 A;  1QL8 A;  1OW7 A;  3BCC J;  1M56 D;  1OP8 A;  1ZTJ A;  1NTP A;  4M3L A;  2GV7 A;  1MTN C;  4NA8 A;  1QRW A;  1C5O H;  2D2C D;  3I77 A;  4MTB A;  1GHZ A;  1UMA H;  4WVP E;  5CJ0 A;  2VJ1 A;  2PUX B;  2LEL A;  2EST E;  2OC1 A;  3UR6 A;  3ZV9 A;  1YCP M;  1URQ D;  2J98 A;  3T62 A;  1IK7 A;  1RS0 A;  1CSO E;  2TBS A;  2E76 C;  3UB0 A;  1CI6 B;  1KY9 A;  3N7N A;  3OFN D;  1UTM A;  1YPK H;  2ANM H;  3CCV P;  1HAY B;  2R44 A;  3ITK A;  4LC1 A;  1KQL A;  4N78 D;  3SW2 B;  4X6M A;  1VF5 B;  4BXL A;  1AI8 H;  1DIT H;  2JJ2 D;  2V3M A;  3CCJ P;  2IN2 A;  1AN1 E;  2HOB A;  3FWN A;  4H13 C;  1YPH C;  5LGO A;  4LZ4 B;  1QL9 A;  2O8W A;  2A4G A;  2Q1J A;  1E79 H;  1TPS A;  1RE4 A;  3VYI A;  2BDH A;  4B76 A;  1WCZ A;  2KCP A;  6LPR A;  3NZI A;  1UCY K;  2A06 G;  3A0B E;  4NIV A;  4WXV A;  3P95 A;  1GI3 A;  1MH0 A;  2HNT C;  1FLE E;  1XXD A;  1YC0 A;  3ATK A;  2ZFQ H;  2QJP B;  3KYQ A;  4WH8 A;  2FYU K;  3BAT A;  2GX4 A;  2KSE A;  1JY2 N;  2QG4 A;  3LW5 H;  2IPQ X;  1SSX A;  3MGN A;  2DE8 A;  5JB9 S;  3NCL A;  2K1Q A;  3H7T A;  2GT8 A;  1BUI A;  5JBA S;  2FYQ A;  4QMA A;  1X22 A;  1JRS A;  1K1M A;  3DA9 B;  1A5I A;  1FY5 A;  3U8O H;  3CS7 A;  1IQF A;  1KLJ H;  2J5U A;  4C7R A;  4FXG H;  3TK6 A;  3LKW A;  3ABV C;  1ELE E;  1L0N G;  2Y0C A;  2I1K A;  1NBM E;  1VQ9 P;  2GCH G;  3RK3 B;  4O9B A;  2V3O H;  4VGC C;  1NU9 A;  1C1W H;  1PGQ A;  1EJN A;  1M7L A;  5F6M A;  3F89 A;  4HH2 A;  1HPG A;  2BD3 A;  1AUT C;  1PYT C;  2QY0 B;  1QGF A;  2BM2 A;  3V12 A;  4BXS A;  1LDT T;  1QZ8 A;  3BTH E;  4X1N U;  1UK3 A;  2BCC G;  3H1K J;  3M9Q A;  2B87 B;  2ZGX H;  4EST E;  5B6L A;  1P05 A;  5EFW B;  2P3T B;  3SUG A;  2W5E A;  4A1X A;  2E75 B;  2K3R A;  2H5C A;  4LZ1 H;  3H1I J;  4BTI B;  5EIY A;  1LJ2 A;  4ABI A;  1F5L A;  1ELV A;  1Y3X A;  4UFD H;  2ZT9 C;  1NFX A;  3TJN A;  1KB9 D;  3M7T A;  1WMK A;  1QGK B;  1VQO P;  3FXD A;  2OC8 A;  4Z1M H;  2ZO3 H;  4D6T G;  2Z7F E;  2PGQ B;  3L74 D;  1CO7 E;  2ZIQ H;  1YIJ P;  1LTA C;  4YO9 A;  1IQK A;  3AE7 C;  5AVQ B;  1B7X B;  3EQ2 A;  3RMO H;  1R5L A;  1WAY B;  4UON A;  2WPM S;  3U9A H;  1FDO A;  2R0K A;  1TNL A;  1IQI A;  2P3U B;  2NPS B;  1USE A;  1LQE A;  1LHG H;  3VPK A;  3MH7 A;  3ZZ5 A;  1HAI H;  4Y0Z E;  3RXT A;  1Q90 D;  1YBW A;  1S9K E;  2IX7 C;  3Q5R A;  1YPM H;  1A46 H;  1BTZ A;  1NVO A;  1C2J A;  3QH9 A;  4FET A;  2CHA B;  4IN2 A;  3ZVE A;  2BZ6 H;  1BCC E;  5IK2 D;  1SGR E;  3A2A A;  3BAS A;  1MUE B;  1M1K Q;  1FAX A;  1HBT H;  3CX5 E;  1TGT A;  3C1K A;  3LON A;  3N7O A;  4MG3 A;  1XKB C;  1D3Q B;  3RUO A;  1ZPC A;  3OEE D;  2D2D A;  1AQ7 A;  3KGP A;  3SWY A;  1RTL A;  1QL7 A;  5FBE A;  1D9I A;  2Q5U A;  2XRC A;  3QWC H;  1MZA A;  1DPO A;  2W6A A;  3CME P;  1KB9 I;  1CBW C;  1M9U A;  3FO8 D;  3LGY A;  1AA0 A;  2BCC D;  2WPV B;  1K1L A;  2PKS C;  2WUB A;  1QTF A;  2JDI D;  2JEE A;  1FZC C;  3V2P A;  3RP2 A;  1MCV A;  3R4Y A;  2UUK B;  4X1R U;  1EDK A;  3OA7 A;  1NPM A;  2M3B A;  1K9O E;  1ZR0 A;  2M5T A;  1OWI A;  1GG6 C;  3M35 A;  2FM2 A;  2ZHF H;  2QF4 A;  3PV5 A;  4I6M C;  1L1N A;  3FP8 E;  4J2Y B;  1AGJ A;  4AYV B;  3VP8 A;  4OGQ D;  2XDJ A;  2PFE A;  1UVO A;  4D6T D;  1SQP G;  2VIP A;  3TGU J;  1HFD A;  3VGC B;  1OMI A;  4AZ2 B;  1EC5 A;  4H6T A;  4XOJ A;  4WH6 A;  3NKK A;  4AC9 A;  3KQD A;  5AHG H;  3LDX H;  5E79 E;  1HDT H;  3I55 P;  1ANB A;  3A0H H;  1YCP H;  5E0H A;  4KEL A;  2W6I D;  1RH5 B;  1ARB A;  2ZU1 A;  1SQQ K;  1MTW A;  1NTK K;  2KS1 A;  3PH0 A;  4A6L A;  4BOH A;  1C1U H;  4NA9 H;  3SU0 A;  3V3M A;  3VG8 A;  1SBW A;  2ZCK P;  2D2C C;  1MD7 A;  1EP6 A;  3MYW A;  2JKH A;  3E3T A;  4ABH A;  4W7Y A;  1ZMN A;  1K1O A;  1Y59 T;  1AO5 A;  3L75 J;  2DE9 A;  4ZUH A;  3MU1 A;  1PIX A;  1ZR2 A;  3RU4 D;  4A5T S;  1URQ C;  1ETT H;  2ZDM A;  1GGD C;  1PJP A;  1O2W A;  4NZL A;  2JO1 A;  1USD A;  2QJY B;  1SQB E;  2Z94 A;  4YTA A;  4H44 B;  2HPC B;  1BTP A;  3RXV A;  3GW6 A;  1O2L A;  1ID5 H;  2W83 C;  5JDU B;  2YMK A;  3SN8 A;  5AW2 B;  1HAH H;  3BTK E;  1FE6 A;  2J38 A;  1OVR A;  1F0S A;  3K6Y A;  4UEH H;  2RN0 A;  5L8R J;  1S2E A;  2FOB A;  2G51 A;  3SBK A;  1TGS Z;  1HAV B;  4Q4L A;  4WY4 A;  1JOU B;  1CVW H;  3O8R A;  3AK5 A;  2HLO A;  2TGA A;  4HFP B;  1BJV A;  5FPS A;  1C9T A;  2WT7 A;  1F2S E;  2BD8 A;  3A80 A;  1SGF A;  3PRJ A;  1FN8 A;  2FOD A;  4IGD A;  4HYT B;  3M61 U;  3EWK A;  2IPH A;  1FZC A;  1S0Q A;  2GTB A;  1B5G H;  5TIS H;  4IC5 A;  2KXP B;  2KX4 A;  3QGN B;  1W2B O;  1UII A;  1AWF H;  3TH3 H;  1SQB K;  1V2M T;  1SQP D;  3L72 G;  1NTZ G;  1O5E H;  2CK3 D;  1IFD A;  5KTB A;  2SNV A;  1ANC A;  3B4S A;  2JWD A;  4B73 A;  1IFI A;  1EAT A;  4BRY B;  4KGA A;  4A92 A;  5HYO A;  2J95 A;  3WU2 H;  1GDU A;  2EEK A;  3OEH D;  5FL7 D;  2P8O B;  1YJN P;  1PQ5 A;  1KIL E;  1BJU A;  1OVU A;  2OD3 B;  1A61 H;  3DSG A;  1P84 H;  3GYM A;  2Y6T A;  3E0N B;  1G32 B;  1R5S A;  3LOX A;  2A32 A;  1HJ8 A;  1UVS H;  1G3D A;  3D70 A;  1KQS O; 
#chains in the Genus database with same CATH homology
 2WSC H;  1A02 F;  1CSB A;  2ZFC A;  3RK2 B;  4XA4 A;  1L4A A;  1IFM A;  4C46 A;  2HG5 D;  2Q9I A;  3B8E B;  2FKW B;  1T3J A;  1W2E A;  1QL2 A;  1JOC A;  3EFG A;  1T2K D;  2J59 M;  3TNU B;  2P1J A;  1JY3 O;  3HUS A;  1N86 A;  4WY4 C;  2YMY A;  1YTZ I;  1T3U A;  4ZKU A;  5AVR B;  1GL2 D;  1N7S C;  3GHG A;  4GIF A;  1LT9 C;  3VTP C;  5CCG D;  2KSJ A;  2WIT A;  3VMZ A;  4LGD E;  4I2L C;  1HVV A;  3RL0 D;  4C7N B;  3TNU A;  4Y99 C;  2YNY A;  2N9B A;  3T97 A;  2KYV A;  1G2C B;  5BU5 A;  1NH4 A;  3M0D C;  4RES B;  1VDF A;  5APV A;  1ZR4 A;  3V2N A;  1KIL C;  1LWU C;  2Z4E A;  5CCH C;  1GL2 C;  3VMX A;  1NHL A;  2C0X A;  1HJB A;  3HE4 B;  1SLQ A;  2GUV A;  2KB7 P;  2E43 A;  1L4A C;  1N7S B;  5AW1 B;  5APX A;  1G1I A;  1LT9 B;  3V5B A;  1HTL C;  4EOT A;  1MV8 A;  4C7N A;  1KFM A;  1DEB A;  3HD7 D;  3RL0 C;  1MZ9 A;  1GW4 A;  1FZE A;  3HUS C;  1G2C A;  4WB4 A;  1FBM A;  2YO2 A;  2LKM A;  4Y99 B;  4W80 A;  3GHG C;  2XV5 A;  2FXM A;  2YKQ A;  2L5G B;  3U1C A;  1NKN A;  2J58 A;  3HE5 B;  1PFI A;  3HE4 A;  1SVF A;  3E1I A;  3O8Z A;  2HYN A;  3MD0 A;  3RK2 C;  2A45 I;  1N7S A;  2O01 H;  1FZA A;  1LT9 A;  1LWU B;  3M06 A;  2WSF H;  1GL2 B;  2XNX A;  2N1T D;  2P2U A;  5BVZ A;  5APT A;  1T8Z A;  3B5N C;  3CL3 D;  1DH3 A;  1M1J B;  2C9N Y;  2O1J A;  1N2D C;  3VN0 A;  2QM8 A;  2XKM A;  2WWW A;  5AW6 B;  1GTW A;  3KQG A;  2OYH A;  1JMM A;  3LID A;  2P67 A;  3IR9 A;  1H8A A;  2R5B A;  5AW9 B;  1MFZ A;  2M8R A;  3NFQ A;  1GW3 A;  3RL0 B;  1G1J A;  1N73 C;  3V2R A;  3NTN A;  3HE5 A;  1NTM K;  2XU6 A;  1JO5 A;  3M0D A;  2FFD B;  1JUN A;  1SP4 A;  1LTS C;  3V4Q A;  1EQ7 A;  1RE3 C;  1FJP A;  1LWU A;  1J1D B;  1GL2 A;  2CPB A;  1YTZ T;  3M9B A;  2I1J A;  4N6J A;  1XTG B;  1YYC A;  1CZQ A;  1SQV K;  2N1T C;  2C9L Y;  1M1J A;  5CMZ A;  5APU A;  1HBW A;  3R2P A;  5AVV B;  2HOD B;  1OWA A;  2YO3 A;  3HTK B;  3P8C E;  5AVT B;  3B5N B;  3L4F A;  5AW3 B;  2A45 H;  5CJ4 A;  1X9V A;  2KP8 A;  3HD7 B;  3UIA A;  2H43 A;  2FFD A;  1XTC C;  3U1A A;  2HFE D;  3P7K A;  1N73 B;  5KJ7 D;  3HRN A;  1AFO A;  3RK3 D;  2WPQ A;  3OAK A;  1FOS E;  2XZR A;  1FZB A;  3VMY A;  1HWT C;  1ZV8 A;  1QL1 A;  3TYY A;  1GZL A;  1Z56 A;  1X79 B;  2HOD A;  3HTK A;  2OYH C;  3A3Y B;  3B5N A;  1IO4 A;  1N7L A;  2N1T B;  1NTZ K;  3MUD A;  3V2Q A;  3II6 A;  4JF7 A;  1T2K C;  3HD7 A;  2CPS A;  4M3L A;  5CHX A;  1S9K D;  1JY2 P;  1IJD B;  1N73 A;  4EIJ A;  5CJ0 A;  4AUW A;  3VOP A;  1URQ D;  3G3Z A;  2WPS A;  1CI6 B;  3M91 A;  1ZN5 A;  5CCG C;  3RK3 C;  1RE3 A;  3H6P A;  3N7N A;  2E42 A;  3VP9 A;  1M1J C;  4IFD K;  4LC1 A;  4N78 D;  1KQL A;  3NXS A;  2KOG A;  1SFC D;  5AVS B;  4WBA A;  2YKP A;  5AVX B;  2R5D A;  5AW5 B;  1GU4 A;  2IPP A;  2NPS D;  2N1T A;  1RE4 A;  3VYI A;  2FFD C;  2OYH B;  1J1E C;  3TSI A;  3SWF A;  2W27 A;  3V4W A;  2GM4 A;  1J1D C;  1GK6 A;  5AW0 B;  3KYQ A;  2FYU K;  3BAT A;  3LW5 H;  1JY2 N;  1KZU B;  3M0A A;  3MGN A;  1CW5 A;  2Z5H A;  1CI6 A;  1HGV A;  2W6B A;  4DZO A;  4C7R A;  1NKZ B;  5AW7 B;  2I1K A;  3RK3 B;  4O9B A;  3WMM 0;  2OYI B;  1M7L A;  5APW A;  2NPS C;  4HH2 A;  2MJZ A;  3HD7 C;  1GDT A;  1FZG A;  1ZLL A;  1FOS F;  3M9Q A;  3CI9 A;  2QM7 A;  2POH A;  1J1E B;  1RF1 B;  1NAF A;  2OAR A;  1LGH B;  4W7Z A;  2R32 A;  3PP5 A;  5KJ7 A;  5CCG A;  1L0L K;  4JYC A;  2OYI A;  1URQ B;  4WY4 D;  1LTA C;  1LTJ C;  1RE4 C;  2C0W A;  4AYC A;  1WT6 A;  1J2J B;  1N7S D;  5AVQ B;  1JY3 P;  3EQ2 A;  5AW4 B;  1SFC B;  5APQ A;  1FZF A;  2NPS B;  1VPC A;  3CLQ A;  1RF1 A;  1S9K E;  2IX7 C;  1DX7 A;  3I5C A;  1MUU A;  1FDM A;  1NWQ A;  1AQ5 A;  2FYZ A;  2IFM A;  3A2A A;  3BAS A;  2Q3I A;  3L35 A;  1URQ A;  4KHX A;  3BVH A;  1FU1 A;  1HH0 A;  5APS A;  1L0N K;  2ZXE B;  4N78 E;  2WZ7 A;  3SWY A;  2WSE H;  1KIL D;  4IFF A;  3NMD A;  2Q5U A;  4B86 A;  5CCH D;  1RF0 C;  1SFC A;  2W6A A;  3L37 A;  1JY3 N;  1LTJ B;  1WRG A;  3N4X A;  2NPS A;  5AW8 B;  4GT1 A;  2JJL A;  1L4A D;  1H88 A;  2WPR A;  2JEE A;  2IFN A;  1IFN A;  4DOJ A;  1GU5 A;  1FZC C;  3A5T A;  3V2P A;  3OA7 A;  2M3B A;  3IFM A;  2Q7C A;  3P8C D;  5KJ7 C;  3M9H A;  4I6M C;  3C9I A;  2H7H A;  3VP8 A;  2OYI C;  2XDJ A;  1OXZ A;  1A02 J;  1NOH A;  3U59 A;  1FAV A;  3A7O A;  3MIW A;  2VRS A;  1HUC A;  1LTJ A;  3P8M C;  1JY2 O;  3KPE A;  4IFM A;  3RK2 D;  2P7J A;  1SQQ K;  3LIE A;  4WY4 B;  1RF1 C;  1NTK K;  2PP6 A;  2PAJ A;  2WT7 B;  3KDP B;  3B5N D;  3OJA B;  4GKG A;  4I1L A;  4W7Y A;  5AVU B;  3TK1 A;  1ZR2 A;  4LLH A;  1FZC B;  4XE5 B;  1URQ C;  3H32 B;  2YKO A;  3L36 A;  3MTU E;  1E5W A;  2HPC B;  2GUS A;  1GK4 A;  5AW2 B;  1IC2 A;  1SFC C;  1JCC A;  1LTT C;  1JTH B;  1H89 A;  1IFJ A;  1LTI C;  4WY4 A;  1JNM A;  1KFN A;  5AVW B;  3BRV B;  1RF0 A;  5BU8 B;  1SQX K;  5APY A;  2HLO A;  2WT7 A;  1NO4 A;  1KIL B;  1JCD A;  1GD2 E;  1NU1 K;  4HYT B;  4OH8 B;  2H8P D;  2O1K A;  1FZC A;  2Z5I A;  3H32 A;  3P32 A;  4ZKP A;  1L4A B;  1FJK A;  1X8Y A;  5AVZ B;  1IK9 A;  2KLV A;  3BRT B;  2HPC A;  1SQB K;  1IFD A;  5KTB A;  1SQP K;  2BAS A;  2R3C A;  1IFI A;  2A45 G;  1JTH A;  5KLV K;  2WTY A;  3HUS B;  4N3Y B;  1RY3 A;  4JYB A;  4AQR D;  1LTB C;  1HGZ A;  1LTG C;  1KIL A;  3GHG B;  5AVY B;  5CCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...