2PP6A

Crystal structure of the atp-binding sugar transporter-like protein from salmonella typhimurium
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
88
Chain Sequence
SNAMADLFDGMKRRMDALIAERFGMKVNINGTDCIVVESDFLAGKNVVVFSGNVIPRRGDRVVLRGSEFTVTRIRRFNGKPQLTLEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gifsy-2 prophage ATP-binding sugar transporter-like protein
publication title Crystal structure of the ATP-binding sugar transporter-like protein from Salmonella typhimurium.
rcsb
source organism Salmonella typhimurium lt2
molecule tags Transport protein
total genus 18
structure length 88
sequence length 96
ec nomenclature
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13856 Gifsy-2 ATP-binding sugar transporter from pro-phage
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2pp6A01
2.40.10.210 Mainly Beta Beta Barrel Thrombin, subunit H Phage tail proteins (gpFII-like) 2pp6A02
3PP5A 3B5NB 3VOPA 2HG5D 2N1TB 2HFED 1SFCD 1URQD 1L4AD 1KILA 1JTHB 2YMYA 1SFCC 1URQC 2PP6A 1SFCA 1URQA 1L4AC 1L4AA 4LGDE 1N7SB 4W80A 4JF7A 3P8CE 3M0DC 4WY4B 1XTGB 3HTKB 4W7YA 1HVVA 3KYQA 3RL0D 2NPSD 3RL0C 2NPSC 2NPSA 3B5ND 1GL2B 3RK3B 2N1TD 4OH8B 3B5NC 3B5NA 2XDJA 2N1TC 2N1TA 5KJ7D 3TSIA 1GL2D 3RK3D 1NHLA 1T3JA 1N7SD 1JTHA 3RK2B 5KJ7C 5KJ7A 1GL2C 4WY4D 3HD7B 2M8RA 1N7SC 1N7SA 4W7ZA 4WY4C 4WY4A 1KILB 1SFCB 1URQB 1L4AB 2WZ7A 5CCGD 5CCHD 4N78E 1KILD 3RK3C 1GL2A 5CCGC 5CCGA 5CCHC 5CCHA 1KILC 3RK2D 2KOGA 3RL0B 2NPSB 3HD7D 3RK2C 3HD7C 3HD7A 2H8PD
chains in the Genus database with same CATH superfamily
1USDA 3BTWE 2NZ2A 1SQBG 2JKVA 1S81A 3B5NB 5JPMH 5C94A 1LVBA 1JY3P 1N1LA 4I6MC 3N4XA 2P93A 4X8VH 1N8OC 3T27A 1FN8A 1T6AA 1FZFA 2XKMA 1M56D 2XBXA 1ZTJA 1QEXA 4JBZA 3VB3A 3CI9A 3K5BA 3CCEP 4X6MA 4DT4A 1ZMLA 4B73A 1C4V2 1NFUA 4UB6E 1L4AC 1T8OA 4R0IA 2IDBA 4LGDE 1DITH 1FOSF 1A4WH 1ZRKA 2QJKB 3M5NA 4B2AA 3A88A 3ZVFA 2NRGA 2W27A 3T97A 1O2WA 2OXSA 3MUDA 3F2FA 3U1CA 4OGQB 3AEFC 4K3JA 2G51A 1O36A 2IOTA 3RXRA 5GDSH 4C7RA 3OEED 3KYQA 3A86A 1KMHB 1O2RA 2PV9B 1C1OA 3EE7A 4D9RA 1P3EA 3H1KE 4U30A 3HE4A 3NPSA 1GD2E 2IBZD 1TU3F 3UTUH 3F9FA 3QDZB 2V7QH 3A81A 3OW2O 1FIZA 1O32A 5EJ1A 1CBWB 3SU4A 3R4YA 3OAAD 3F68H 2WQYC 2E74C 2FYUJ 2HLDD 3LDXH 2WVRA 4H42U 1M1KQ 3H1JJ 2W6BA 5AW7B 2Q6GA 1V2LT 4U32A 1YLNA 2VVCA 1YC0A 4X1NU 1MCVA 1FZCA 2YNAA 2YMSC 2P10A 1QL1A 2YNYA 1KV4A 5ABWA 2AEJA 4F55A 1GI4A 1RTFB 1TALA 2WV9A 2O3JA 4Y79A 2LP6A 2ZPQA 5KLIC 1KYNA 3D65E 1E35B 2E76D 2A1DB 3PO1B 1YPHC 1C5RA 2FFDA 2ZCLP 1GK4A 3K9XB 3P8MC 1RE4A 3JZ2B 1NU1K 1UTPA 1UVPA 2AXCA 4JYCA 1OP2A 3M0AA 1THRH 3M3VA 4SGAE 2BX3A 1C2FA 1FLEE 3L37A 2G8YA 1FY4A 1LT9B 1ANEA 1FC2C 3LH3A 1EZVI 1URQB 1BJVA 3PWBA 4Y8XA 1BOQA 1YPKH 1ESAA 4EI2A 1G2MA 1VF5D 1TX8A 3I56P 2D2DA 3U8OH 2BTCE 4ASHA 1AB9B 1EATA 4RSPA 5TISH 6CHAC 1KTTB 3P8GA 1C2MA 1TNKA 2FYUE 2A4GA 2G5VA 3FVFB 2W7UA 3H1JE 1C5ZB 1RJXB 1SQTA 1EX3A 5KLVK 1ZPZA 1GHZA 4C7NA 2QF4A 5GTIE 2XBYA 4NG9H 5KECA 4YXDC 1FAXA 2XWAA 4AB9A 2D2CB 3GLMA 2TGAA 5GIBA 3OFND 3M37A 3USSA 4K5ZA 4MTBA 3PYHA 2H8PD 1VQKP 3UNSA 3F6UH 3EQ2A 1SGDE 1NGMB 1VDFA 1PJPA 2B9LA 1TBQH 2ZHEH 1RF1C 5CHXA 1HAVB 3CX5E 2VINA 4U3FE 2ZC9H 1VITF 4B6EA 2CPSA 3E7KA 1LQDB 2QC2A 2V3HH 1W5CE 1GHBG 5F03A 3M36A 1MZAA 2WUCA 2GT7A 1MABB 1AVOA 3W68A 2WPLS 1TONA 1Z1IA 3HUSB 5EXNA 1IFJA 3C1LA 1TYNA 3R3GB 5JBAS 1HAVA 3HE5A 2G5NA 2CXVA 2IFMA 1M1JA 1HYLA 4Y76A 1X22A 2I8DA 1SQPD 3RXVA 3CC2P 1GG6B 1SG8B 3QO6A 4K1EA 3L36A 1GDTA 1HJ8A 2VRSA 1AZZA 1K1PA 2C8YB 2LPRA 3GY4A 3ZZBA 3RXCA 1UTKA 1S1CX 1GU4A 1NKNA 2WSCJ 4XDEA 3EE0B 4CR5A 5LH8A 1BT7A 1SC8U 3KPEA 4LK4A 2RMZA 1JEKA 1LO6A 1YP9A 1D3DB 3HRNA 3KQGA 2M5AB 4JQ0D 1SGTA 2WPRA 5AF9H 3KDPB 1ELTA 3SI3H 3ZVEA 2PLXA 2N1TD 2W6AA 3P32A 2IFNA 3AE5C 1NT1A 1SFQB 2BX4A 4MDSA 5DP3A 1GZLA 4ZH8A 2A0QB 5BRRE 1Y3WA 1FZBA 1BA8B 5FL7D 2ZZUH 1UVTH 2HPCA 2WT7A 1VR1H 2WV4A 1SQBJ 1MFTA 1AVGH 4RJTA 1RD3B 3UWJH 2ZT9D 2CHAB 1IQEA 2BY9X 1PYTD 4NA7A 1RTLA 3PLKA 4XRNA 3DFJA 1FJPA 2FOFA 1SQQD 2QXJA 1XUHA 3P8OA 1EAXA 1TNGA 1GJ8B 1TOCB 1BDCA 1BRBE 5FBEA 4JK5A 4X8UH 3LGVA 2Y0CA 2Q6QA 1LQEA 1T8LA 3G01A 2P3UB 1XX9A 3BTME 3Q77A 4L73A 4GSOA 1EZQA 2KLUA 5FX6A 1L0LK 1AWFH 1YPEH 4HZHA 3U8TH 2OBOA 1SB1H 2ZVNB 1G9IE 3TJUA 3PHLA 2A7CA 3FFGA 2PRRA 1FNIA 2KYVA 3ZIAD 1BMAA 4OGYA 1HDTH 1XM1A 1GL2A 2AEMA 5DK1A 1PQ7A 2CPBA 1MTWA 4NA9H 4NSYA 3Q2YA 1DWEH 1EB2A 2Y5FA 2ZDVH 3NKKA 5B5EE 5AVZB 3SUGA 3RDZA 1L1GA 1KIGH 3PRDA 4BRYA 1EDIA 1HJAB 1ID5H 5IDKA 4MNYA 4ZKRU 2STBE 4JK6A 5FCRA 2IYPA 1CGHA 5L8RJ 2J58A 2VIPA 3LIWA 4WVZA 2KNCA 2A2QH 4Y6DA 2I6SA 1G3DA 2W7SA 4F48B 3QWOC 4KJMA 3SGBE 4AG1A 3M5LA 1TGSZ 1M90Q 1E79H 1E34B 1ELEE 4NSVA 4Q2KA 3WWFA 1FX0B 4BAOB 3D70A 2BY8X 1NFYA 3H25A 1AUTC 3KYGA 1LGHB 2D26C 2GMTB 2ZGBH 1OOKB 5AHGH 2W8ZA 3H09A 4HYTB 1UCYK 2GCTC 5APUA 1JMMA 1DICA 3FZZA 3TH2H 3RC5A 4KKDA 4W80A 3RXKA 4A6LA 3PTZA 2P67A 2GKVE 5EQRA 1YTZI 1S82A 4WY4B 1YQ3C 1WQVH 2JH6D 1B0FA 5IK2D 4CRBA 4YPCA 4JZ1A 4J1YA 3BTFE 4UONA 1BE3G 4AGJA 3TNUB 1J1DB 1P09A 1VL2A 2ILNA 1JCDA 1E36B 3A0HE 1H1BA 1K2I1 1YITP 1ZJKA 3F9GA 4H0LB 2E42A 1HWTC 4UFGH 4BTIB 1FY5A 5EGMA 1KXEA 3CXHD 1MMJN 3RMOH 4I1LA 2B9BA 1K0HA 4DIHH 1MV8A 1NRPH 1CU1A 1VITH 4IOIH 3W67A 3OYPA 1HAZB 2J92A 5JBCS 1OWAA 1R5LA 1CA0C 1VCPA 2GV7A 1HGVA 4JYVH 4IL6E 1T2KC 4OH8B 4AFUA 4DG4A 2QE7D 3EDXB 3MU4A 1XUKA 3CCVP 3B5NC 3E1IA 5KAFH 3UUZA 2VWLA 2TGTA 1S5LX 2KX4A 3Q3KA 1GJBB 1P2QA 1HAIH 1KC8Q 3H1IG 3SJIA 2G3AA 2RDLA 1PPJG 3VG8A 3B23B 2A2XH 1V2JT 2KZIA 4C46A 1MQ6A 2AGIX 1C5UA 5KJ7A 4HFPB 4Q80A 1MD7A 3M7TA 1MAYA 1WCZA 3GY8A 3U28C 3ZZ4A 3BTKE 4X2YA 4NCYA 2ANMH 5KEDA 3HD7B 2HNTC 2W6JH 1C5QA 2QJKC 2PSYA 3ZZDA 1GJ7B 1WMKA 4PJ0H 1QB9A 3AW0A 2C0XA 3L74D 4FUBA 3MU8A 2WITA 5E8EH 1C9PA 2IPHA 3IN6A 4OGQC 1M9UA 1S6FA 1N7LA 3SU6A 3ZVDA 4NWLA 1JIMA 1F5LA 4MQAA 1IFDA 1D3PB 2H1UA 2VJ1A 3V5BA 1D3TB 1P03A 2WSSH 1W12U 3CMEP 1JOCA 2OTLP 1PPFE 5APQA 1YJWP 1QL8A 2VU8E 2BY7X 4L75A 1OWJA 1GJ6A 2OYHA 1SQPE 2AIPA 2FOBA 2H5DA 5C5OA 2WPHS 2CJIA 4H13D 4ZKPA 1NRQH 1P11E 1LKBA 1CBWC 1QRZA 4ZMAH 4CRGA 1NTZG 4H44D 3MH6A 1GVZA 3Q1MA 1LVMA 2QXHA 2SFAA 2WYGA 1PPJD 1B0EA 1GI3A 1UTLM 2IYOA 1C5PA 1COWD 1EQ7A 2OYOA 1EP6A 3PMAB 4ABHA 3SO3A 2RN0A 3CC7P 1TB6H 1Z8RA 1O3GA 2R9PA 2BDAA 3SFDC 1HJ0A 3RL0B 1TNLA 2R5BA 2FYRA 2HWLB 1O2XA 3F9HA 1FQ3A 1QR3E 2TBSA 1JUNA 2FOCA 1C5WB 5C1UA 1W14U 5CDFE 2GJGA 1T32A 4YT6H 3PO1C 5EW1H 3PP5A 1O3EA 3N7NA 1Z56A 1HTLC 3FWNA 1A5GH 3AE7C 3WMM0 3K65B 3L72G 1OXZA 3MI4A 2NU3E 4YXWH 1GBCA 4CR9A 5FCKA 3OY6U 1ZHRA 1PIXA 3UQOA 1JB0J 1SQQE 4D8NA 4KHXA 1JTHB 1LT9C 1QIXB 3E8LA 1URQC 3V0XA 1NTZD 2J95A 1L4AA 1W0ZU 2KFWA 2SGQE 3FAOA 3RU4D 1AA0A 1KLJH 1GBMA 1MTSA 1VKYA 1AB9C 4AFSA 5AVUB 1L0ZA 1V2MT 2F9OA 1NTMD 2FTLE 4OGXA 4RT0A 3ATMA 2OTKE 1BB0B 2FS8A 2A06D 3SV2H 2H88C 5EQQA 2ZU4A 5H2FH 4INLA 3TK6A 5A2MH 1LP1A 2ZYDA 1BCUH 1S3JA 4A7PA 1OVRA 1IQKA 1H8AA 2FX6A 1HAYB 2WSFJ 4ZNCA 4WMFA 4AYYB 1SBWA 2D2CC 2YO3A 4PD4D 3SHCH 1NTKD 2IBZI 2XNDH 1AE8H 1O31A 3A82A 4ISIH 1GCTB 3SNDA 2XV5A 1QCPA 4HJGH 3IFMA 3CS7A 3VB4A 3ZV8A 1KYOD 1BRUP 3Q5PA 5KLIB 1GJAB 4WF8A 1SQXD 1KSNA 2OK5A 9LPRA 3A83A 4BXSA 4DW2U 4R4LA 1UHBB 1Y3YA 2AIQA 1LVOA 2FI5E 2KR7A 1YBWA 3T62A 3TDKA 1UW7A 4X6OA 3QK1A 3V13A 2OC7A 2PFXA 3AE1C 1BUIA 1QBVH 2JDID 4NWKA 1EXFA 1GBJA 3ABVC 4X1SU 1PPEE 3HUSC 3O8RA 3NFQA 4ESTE 2THFB 2UWPA 2W6ID 5TCAA 3FZDA 1SOZA 3LW5H 1BTUA 3NMDA 1N6XA 1AVYA 1GG6C 2GT8A 1KTSB 2W90A 5FPYA 4YLQH 1K9OE 1AJYA 3HK6B 1S72P 1D7MA 1ZSJA 2QN5T 3OSYA 4ABJA 3DT0H 1FIWA 1D3QB 3KZIE 1A02F 1BE3J 1TPSA 1RXPA 1IFPA 1C1QA 1SQVG 4X2WA 4O97A 3LIDA 3QTVH 1MCTA 1QRWA 1JMBA 5AVXB 1JRSA 1NM6A 1P2NA 3VGCB 1P8VC 3L71G 4ASWA 1EJAA 4H6TA 2BY5X 3UOPA 1T8ZA 2O9QA 1ZP0C 2RDEA 3B8EB 5CJ4A 1A7SA 4DVAU 3V2QA 3Q3YA 2BD4A 2CHAC 1Q90D 2B87A 2J5UA 1XKBC 2K1QA 1LJ2A 3H1IJ 2E5TA 4AX9H 1SFIA 3RXQA 5E0JA 4ZKUA 2E75D 3VN0A 1KDQB 2ALVA 3AASA 2Y5GA 3KHUA 3VOPA 1RF1A 3H1KD 4YTAA 3O8BA 2H89C 1KY9A 1CW5A 3CP7A 1D9IA 3T25A 3MO6A 3SUEA 2GCHF 1WYKA 1LTJA 1QLED 3AEEC 3NXSA 5B6LA 1KD1Q 2KCPA 1Y5BT 2PWXA 1GHWH 4MPVA 1BE3E 2MJZA 1OWIA 5IYTA 3L74E 1F0RA 1JY3N 4MPXA 5AW4B 1C1MA 1SGQE 3G3ZA 1ZGIA 1C2DA 3MU1A 3RXIA 3KGPA 1QZ8A 1GWAA 2A4OA 3BV9B 1ZJDA 2BLQA 3Q00A 1W2BO 2BLWA 1NTZJ 2J34A 4J2YB 3SJ8A 1ELGA 3SU2A 1A46H 4FUJA 1UIXA 1JIRA 1MQ5A 5GPIB 1YCPK 1ANCA 3DSPA 3E0NB 1Y3UA 1E37B 3F2GA 1P04A 1NO9H 3ZVAA 4WH8A 2QF5A 2YKPA 3H1IE 1QX8A 1PPJE 1KQFB 4HKZH 1P06A 1TOMH 2D1JA 1HUTH 3MGNA 4HB1A 3UREA 4AUWA 4PROA 4H0LD 1S9KD 1YI2P 1O5CB 1U6QA 3UAIC 1BCCG 1SLUB 3M9QA 1HAOH 2XDJA 2FPZA 1N73B 4XBCA 5F53A 4D7FA 1O5GH 5KJ7D 3LU9B 3I29A 2ZFPH 2HALA 1H89A 2J97A 1DM4B 2GMTC 5B6OA 1O38A 1UVUH 2FXOA 3L72J 3RMLH 2P16A 1JY3O 3QH9A 3CCJP 1MBQA 5E79H 2KCYA 2PTNA 1H8HD 4NIXA 3GY6A 4K8YA 3H1JD 4WVPE 2HVYB 1CT2E 1THSH 1V2ST 2IZ1A 4W7ZA 4WY4C 1EJMA 1OWEA 1UVSH 1IJDB 4MG3A 1GDUA 1UCYH 2QXGA 1CA8B 3GCNA 3S69A 1GHXH 5HM2A 3W1EA 1J1DC 1NTZE 3O6QB 2Z3CA 1O2JA 2A5IA 1GMHF 1FBMA 2G8TA 3RU4E 1N6YA 1SFCB 1Y8AA 1S5LE 1GMJA 2VIQA 1XUJA 4GCHG 1NTME 1S83A 5CBOA 2GVFA 1BRAA 3CX5D 6LPRA 1GBAA 3TGUG 4X2VA 4UB8E 2LNCA 2VBCA 4R8TB 5DGJA 3MTUE 1GGDB 3RLYH 1W0JD 5CCHC 1X7AC 2ALPA 2WTYA 1FXYA 4GAWA 2AXTE 3O6QA 5AW9B 1AUJA 4UB6H 1M8OB 1H9HE 2EA3A 4Y71A 2RKLA 1KZUB 1TPPA 4PD4E 2Z6BD 1WT6A 1NTKE 2P7JA 3UNQA 1G1IA 2BVSH 1SQPK 3VB6A 1ACBE 1LPKB 4ABIA 1TGCA 2BQ7B 1FN6A 4M9FA 3BRTB 1ZGVA 3HD7C 3MNCA 1SQXE 1ZOYC 3GYLB 5A09A 1DXWA 3VP8A 4CRCA 4AQRD 1IZNB 3OTJE 2GP9B 2E43A 5BPEA 5JBTA 2POHA 1DWBH 3SQHE 2HG5D 1DD3A 1NKZB 5E2OA 4XOJA 1YYCA 3CLQA 5DPAA 5L30H 4BTTB 1GHVH 2KS1A 1UIIA 1L4AD 5T6DA 5LPRA 1L0NG 2QV1A 1ZZZA 1SKYE 1Z1JA 2M3EA 4OM9A 3TIUA 3E91A 5KTBA 3DSGA 2ZIQH 4NZQA 2RCEA 2GTBA 3PJSK 3QTOH 4YO9A 4O3TA 3NZIA 4IFMA 5E0GA 3VB7A 2ANYA 1G32B 1SP4A 3LIEA 6GCHF 5AFYH 1SQVJ 3L73D 1G37A 2WPIS 1SQQK 1YWUA 5AW1B 3SNEA 3A0BE 1G36A 4O03A 5EU8A 2WPKS 2ZHFH 1KLTA 2VWOA 3L71J 3RL0C 3C8VA 3CXHI 1VQMP 4GKGA 1EZXC 1KFMA 2E74D 3V4WA 1JBUH 1EOJA 1DT2A 3A3YB 1TNHA 1NYHA 4AGKA 3JCUH 4E7RG 2V35A 1A2CH 4IL6X 3C27B 3B5NA 2YMSD 4NZLA 1AKSB 1ZYOA 2UWOA 2WSEJ 1LTOA 4A7IB 1Z8IB 2R0KA 5APTA 1UTMA 1Y5AT 1QB1A 2FM2A 2A45I 1C1VH 4OS4A 1R8EA 8GCHF 5DSFA 3W95A 3AE3C 1KN7A 1OHHD 2J98B 2G81E 3BEFB 4ZXXH 1A3EH 1XUFA 5GTIH 4Y8YA 1AU8A 2PGDA 1KB9E 5APYA 4D7GA 1GW3A 4OWFA 1O3DA 1SQRA 1SQBD 1OYTH 3V3MA 3P8CD 1RTKA 1S6HA 3SZNA 4UFDH 3GISB 2IZ0A 3F9EA 2WINI 1XVMA 2FXMA 3QX5H 2J98A 2PKAB 5E0HA 3TJNA 1NRSH 3L71E 2P3TB 4KP0A 1AFQB 1C5XB 3SORA 2IX7C 5FPSA 2B5TB 2EQNA 1GCTC 1XMNB 1QVGO 4LZ4B 4X2XA 2G52A 2ZU3A 2M0BA 1IK7A 1RE3C 1CO7E 1QQ4A 4Y28J 1MTUA 1A0JA 2BCCG 2ZGHA 1K9MQ 2EI8A 2QG4A 3A7XA 2OBQA 7KMEH 4MNXA 1KILC 4I8GA 3DUXH 5HM9A 3FGAD 2PGBB 4RKJB 5A8XA 1BCCJ 1HBTH 3RM0H 2K1AA 1S84A 3WU2E 3I5CA 5FHTA 1EKBB 2UWLA 2QJPB 2Z5IA 5CE1A 1KXFA 4TT3D 2OC0A 5JB8S 1S9KE 2H2ZA 3QN7A 2MKVA 1BIOA 1NN6A 2QCYA 3PRBA 1JY2N 2L91A 2V7QJ 1W11U 7GCHF 2F3CE 1C5YB 1NZQH 4ACBA 2P58A 2Q3IA 1TNJA 1LPGB 1Y9BA 5DJ7A 5PTPA 1PPHE 4B2CA 3DA9B 3L35A 1G3EA 3LC5A 1ELBA 3M3TA 3RP2A 4ABGA 3A5TA 1HXFH 2R3SA 1LT9A 3F5HA 1LHCH 4BXLA 2P2UA 5I25A 2OD3B 1URQA 2HODB 3A7OA 1BHXF 1RIWB 2CV3A 2FIRH 3M5MA 3BG4B 2CK3H 2ZJSE 3ATWA 1YM0A 3RXLA 1N7SB 3FX0A 4CBOA 3ZVCA 1GI5A 2Z4EA 2ZECA 2RFKC 1J9CH 4L76A 2Q1KA 1EAWA 1O34A 1TE0A 3A7YA 2VIOA 4FUGA 3SI4H 1P2OA 2IJD1 1PV3A 3H7TA 3GY2A 3URCA 3ZV9A 1SVPA 3NUMA 4N78D 1WSSH 3VGCC 1BTXA 1PFIA 1PFXC 3TGUJ 3ATLA 3HTKB 3RXGA 5CMXH 3M91A 1AGJA 1IFIA 2LELA 1HIAB 3QGNB 2GZ8A 1CHOG 1F7ZA 1BCCE 1YF4A 4TY7A 1GVLA 1NU9A 4AYVB 1X8YA 3CS0A 4I32A 1YKTA 1C5NH 3BTHE 5C2ZA 5AVDA 3MH7A 2BASA 4P02A 1RGQA 3L73J 2G00A 4U7JA 2ZHDA 1L1NA 1LHFH 4BAKB 1KYOI 3CWBG 1LPZB 5CHAB 1WQSA 5T6GA 3M06A 1H9LB 5DG6A 3MH4A 1UJ1A 4OS2A 1GPZA 2ZQ1A 1GDQA 2AEIH 3V2NA 2Y9YA 3RU4T 3Q5RA 2ZDMA 1XKAC 1GMCF 1MKMA 3RC4A 2P94A 1VITG 3A8BA 5EG4A 1O3FA 1GBFA 1E79D 3E6PH 2FTMA 3LPRA 1MUEB 4TWWA 2C0WA 4BAQB 5B5EH 2QGRA 1NAYA 1L0NJ 3HUSA 3KQCA 1G3CA 3BTEE 3H32B 3S4RA 2A7HA 5EJZA 1HRTH 1MU8B 5A8YA 1ANBA 3TK9A 4EIJA 1FV9A 3UPEA 1GBIA 3MHVA 1UVOA 2FOHA 4PV1B 4GOEA 2HPQH 2O8TA 4K1SA 2AGGX 1PP9G 1P57B 1CVWH 2GV6A 4GPGA 1T8MA 4KGAA 3GF7A 3QLPH 5BVZA 1OZHA 2AMPA 1X79B 1A0LA 1GI1A 1HH0A 5J4SA 4Q7YA 3U1JB 3G6EP 2J4IA 2V4HA 3ZZ3A 2OUAA 1HJ9A 2TPIZ 1GHAF 3L73E 2M5AA 4CBNA 2R2MB 1ZW0A 1DX5M 4ABEA 1BMMH 2BD5A 3TJVA 1IQHA 1A3BH 2CN0H 1P84D 4R4MA 3HGPA 4H4FA 2LKMA 1H8IH 1YCPH 3FXDA 1WAYB 1N73C 3GY5A 3MMGA 2XOKD 1AWHB 1YCPM 1MTVA 3BTGE 1OKXA 1VJ9U 3AECC 3RXHA 1NTMK 2H5CA 1JXPA 5A0CA 2XBWA 1IOEA 3BTDE 2Z94A 5LGOA 3S0NA 1XUIA 3FOAA 1RQVA 5BU5A 1OWKA 4JZDH 1L0NE 3CCRP 4AN7A 3A0HH 4RKOB 3I55P 2AFQB 2YKOA 4IN1A 2HYNA 3GCHB 1D6WA 2KSJA 4NFEA 3S7HB 1NTKK 1VQOP 2WPJS 1BDAA 1ZHMA 2TRMA 1YQ4C 1YPHE 3FP6E 1LTSC 2FY8A 4M3LA 3SWFA 3BIVH 1WV7H 1OVVA 1PGJA 1O2ZA 1JM0A 2N9YB 1JY2P 2EI6A 4TSFD 4B75A 4WB4A 4EDFA 1SFCC 2PP6A 1SQXK 1AI8H 1V2VT 1O5BB 4I8KA 3URDA 1CI6B 1SQBE 5KKZB 1ELDE 1LTAC 3P8CE 4ISOA 4X0WU 1ESTA 3ZVBA 1GGDC 1YJ9P 2ZTXA 1O3LA 3EFGA 3AAUA 5EQSA 3MNSA 3TK5A 2YIUB 4XFJA 3QZQA 4ZUHA 2SGFE 1O3OA 3FN8A 2XRCA 2BCCJ 2D8WA 3P17H 4GUXA 4WXVA 1V2TT 2BMGB 4P00A 1IQLA 1ORFA 1E0FD 2BB4A 1PGPA 1NU1G 2ODPA 3L6PA 4K1TA 1T2KD 1YPMH 4Y0YE 1O30A 3B5ND 2B0FA 2FESH 3M35A 4BWNA 1Y59T 4X1PU 1QVFO 3HKIB 5JYIA 4D6TG 2QA9E 1BRCE 2XC5A 3PV5A 3D62A 2ZU5A 4Z1MH 1SR5C 4JZEH 3RXUA 3S9AA 2GX4A 1R5SA 1TBRH 2R32A 2BLOA 2OINA 4IBLH 4D9QA 1CE5A 2KIKA 2UUYA 1S5SA 1NAFA 1HXEH 2ZXEB 2BD8A 3SV9A 3P7KA 1VQ4P 1ZXGA 2V3OH 3AW1A 1F92A 2BY6X 2PUXB 4MVNA 5KLVG 2GD4B 4K8BA 3V12A 3VMYA 1J15A 5KGOA 2F9BH 1LHGH 4OGQD 2RH0A 2ZWLH 2BHGA 1ZLLA 1INCA 2AMDA 1TX6A 1SMFE 2SGPE 3TITA 1J1EC 4WY4A 1FZEA 1DWDH 2IPQX 5CHBA 4DT0A 4ASUD 3AVZA 3RXSA 1C2EA 1M7LA 1XVOA 2BDIA 2XWBI 1C9TA 3TNUA 2M5TA 5JDUB 5HMAA 2BCCE 2HR3A 5T1VA 3KHVA 2YKQA 4E06H 3CD6P 4RKUJ 2K88A 3GDSA 1G3BA 1SQAA 1TPOA 1E1QD 1GJ5H 4D6TD 4N78E 1X9VA 1NU7B 3CX5I 5APSA 1IK9A 3RXDA 2ITAA 1NRNH 1TRMA 1UTQA 1H4WA 1T3UA 2PAJA 2YXRB 2ZDLA 1HAXB 3FANA 3P95A 1SLQA 1AO5A 5CCHA 2M2AA 3A8AA 5APXA 3GDVA 5JB9S 3CCSP 3GYMA 1G30B 1G2LA 5H4IB 1BE3D 1H0TB 1GCDA 2EY4C 3I78A 3ATKA 2YO2A 3H1HG 3WUTA 1ZLRA 2ZQ2A 2KOGA 3CWBJ 1P9SA 2VGCB 5KLVD 2R3CA 2NPSB 5B66H 2PKSB 3HPTB 2G4UA 8LPRA 2BOKA 5GNDA 4JYUH 4RESB 3MUDC 2ZGXH 4NIVA 1VJAU 1S0RA 3SGQE 2XU6A 3HD7A 1AFEH 1EAUA 1KMIZ 1F2SE 1JOUB 3SJOA 1KXBA 1RQUA 2Z5HA 2ZVOB 1BTPA 4CPGA 3ZYEA 2K9YA 4IC6A 1SHYA 1J16A 2O01N 1IHSH 2R0LA 1URQD 5DP5A 2YXQB 3H1ID 4NIWA 1BGYG 1UTNA 1GJDB 3UOUA 1Y47A 1EZVG 3GMAA 3C1KA 3KNXA 5F8ZA 1TLDA 5AW6B 4CRFA 1PP9J 2A4RA 3LOXA 3ZZ5A 1DD4A 3QZRA 1AFQC 1MZ9A 1K1OA 5C0TA 3UR9A 2L5GB 1FJKA 1JMOH 1KTMA 3ZZAA 1SGRE 1RF0A 1NY22 2BZAA 2Q7CA 2KCOA 3M0DC 3P6ZB 5HIZA 1AHTH 2FYUK 2XNXA 1EFRD 1K28D 3TLOA 3GF3A 4E7NA 2D2CD 2ZP0H 2HRVA 3AE4C 5AVRB 2OQUA 4X1QU 3CWBE 1O5FH 2W3KA 4JYTA 2QJPC 1IQIA 2FFDC 3SU5A 1BTHH 1O2HA 2FLRH 2NU4E 3BEIB 2ZFTA 1P84E 3M61U 1LT1A 3MO9A 2ZGCA 3BTTE 3QWCH 4WMDA 3RK3B 1L0LG 3MP7B 2BD3A 2PTCE 5EODA 3Q5SA 4NPDA 3KZIH 1OWHA 2PGQB 2WSFH 5EXMA 2UUFB 2J2UA 2JO1A 1EZVD 4Y0ZE 2ZFQH 3S9CA 5KAFE 4YLUA 1V2UT 4B74A 3AK5A 1FS0E 1BSHA 1A0HB 3EA9A 3U9AH 1DANH 1W2KH 1TNIA 2Y7ZA 1JTHA 3RK2B 2PR3A 2BDCA 1RIWC 2QM8A 1P2KA 1ANDA 3BG4C 1PQ8A 1OMIA 1N7SC 2OARA 3CXHH 5AW2B 4ISHH 4MLFB 3WW7A 2K9JB 3L70G 2OTJP 2PUQH 2KI7B 1SPJA 1QY6A 2A7JA 1D6RA 4OS5A 4BANB 4D76A 3JSVC 1SGYE 2BLVA 1TAWA 4GLYA 2IJOB 3E1XB 3L72D 1HGTH 2QE7H 3SUFA 4F4OC 3L75G 3M7QA 4U01A 5DP7A 2NU2E 1KILB 3N7EA 4XE4A 2LXBA 1YPGH 1SGPE 1RS0A 5GTHE 1LTTC 2K9JA 2H43A 4ZAEA 2A45H 5DN6D 1CT0E 1LDTT 1A5HA 3BTQE 1L4DA 1RY3A 1RE3A 1NU1J 4IW4E 3U1AA 1OFCX 1GBBA 3LC3A 3ZZ6A 1YGCH 5J4QA 3QUMP 2AMQA 5CHAC 1ARCA 3U8RH 4WY3A 5ESBA 1HAGE 4BAHB 1UHBA 2V6NA 3RXAA 1C2KA 1TA6A 2KAIB 1GI7B 4BXWA 4D6TJ 2WMMA 4HH2A 2ZDNA 3LT3A 2O1JA 3H7OA 1ZOMA 2WPVB 1SGEE 1C5SA 2M3BA 5C3NA 8ESTE 3G71P 1BDDA 2BXUH 3B9FH 3RXPA 3LJOA 2L6OA 1O37A 4FVDA 2OC1A 3LGIA 5KLVJ 4UE7H 4PV1C 2HNTE 3T28A 3ZZ9A 1FJSA 3MYWA 1ETSH 1OYQA 2XC0A 3CPWO 4LXBH 1P9UA 3VB5A 2W83C 5AVWB 1L4ZA 1MKXK 1NFXA 1C1SA 3GY3A 3SQEE 4EYYQ 3OU0A 2ZTZA 3RMNH 4XE5B 3GG2A 2BVRH 1YIJP 5DP6A 3MU0A 4BOHA 2OGUA 3N99A 1BJUA 3H5CB 2FBWC 3NRLA 1OP8A 1TGNA 3SZEA 2FEQH 4ABAA 1NU1E 1O2YA 2BD9A 3LW5J 3VMXA 1DE7H 1Z6JH 3A7WA 3F0PA 4RN6A 4W7YA 3V6IA 1FI8A 1EZSC 2WWWA 1HVVA 2FOGA 1FDPA 2G4TA 1M57D 1W13U 2SGEE 2ZCKP 5AW0B 1AIXH 4D6TE 3SWKA 5GCHG 1PPGE 1SQBK 1DLKB 1KB9D 1QQUA 3Q3XA 3S7KB 3SGAE 4AYCA 1S85A 3BF6H 3H1HJ 4A5TS 2J59M 2R5DA 3TK1A 3AE2C 3VMAA 2Q9IA 1SQVD 1FPHH 1NS3A 1VF5B 5T6FA 1EDLA 1S5LH 1KDQA 3GCHC 3UR6A 3GHGB 2QYIA 3AAVA 4Y7BA 2FO9A 5KLVE 3L71D 1DFPA 1O2GH 2P8OB 1AD8H 1LVYA 2TGDA 4IMQA 2NU1E 2RA3A 4AFQA 1GJ9B 1V2PT 1GMDG 1V3XA 2ZPSA 5AW3B 3II6A 3KEEA 1NTPA 1AN1E 3VXEH 1ZRTD 1QBOA 3SNBA 2AXTH 3GCTG 1GL2C 2KB7P 1P02A 2C8ZB 3MU5A 4AB8A 3A84A 3A7TA 3U69H 1BGYJ 4WY4D 1E38B 2M8RA 2A5KA 5KKZC 2C8XB 2FDAA 4L74A 2BDBA 2C9NY 2Y0EA 1ZSLA 5C67A 5I46H 1IFNA 3AE8C 5KAIE 1KYOH 1N86A 1TABE 1NO4A 2YIUC 2VNTA 1GDNA 5GXPA 5GWZA 2XZRA 1JWTA 3L33A 1V2OT 1YPLH 2P59A 1UK3A 4K60A 1NFWA 4XFQA 3ESTA 2VIWA 1LCYA 5FX5A 4XBBA 1ETRH 4TPIZ 3TNSA 3TGIE 2GZ9A 3F1SB 4ZKSU 1Q81Q 1EXJA 3JZ1B 3OE7D 3UWIA 3H1HE 1LWUB 2O01H 1KQSO 5CCHD 2JDIH 4YTPC 1EUFA 2XNIA 4NGAH 3OJAB 4LZ1H 1H88A 3WUUA 4CREA 3SV8A 5EIYA 3SHAH 1P84I 4I7ZB 1V2WT 1YLCA 3KN2A 4AOQA 5LPFA 1N73A 1L0LJ 4UFEH 1PZQA 1TBZH 5M1BA 1AMHA 1OS8A 4U3FG 1CT4E 3HD7D 3FWLA 2KP8A 1H9IE 2HOBA 1ESBA 1AQTA 1U7JA 4ZHAA 2ZHQH 1ELFA 3A0BH 2OYIB 2TIOA 4Y8ZA 5F6MA 2WZ7A 2Y0DA 1WU1A 3SUDA 1EZVE 3CCQP 2O8LA 2QJYC 4RT1A 3VFEA 1BCCD 3V2RA 2BD7A 5K5GB 1QA7A 3H1LG 2N1TB 2CGAA 3IAOA 3L70J 1OW8A 1ELVA 3EA8A 4IFDK 2Q3EA 1EP5A 1P10A 3H6PA 3ITIA 4B1TA 2BD2A 5DKMA 2V7QD 2YNBA 4NIYA 1SFCA 3E1RA 3L75J 1ZMEC 2JJ1D 1GMHG 4FU8A 2ZT9B 1S0QA 1VQ6P 1DS2E 3PV2A 1EQ9A 1EZUC 1FY1A 4WXIA 4CH8B 3L72E 1LTGC 3FP8E 3FO8D 1OIPA 4K2YA 3EFFK 4JCNA 3A85A 2PSXA 3MNBA 1C5VA 1GI2A 1C1PA 2QIQA 3P8NA 3RL0D 1PPBH 1ZMJA 2AYWA 1PPZA 2ZFSA 5SGAE 3WWBA 2VGCC 2Y6TA 1K8AQ 2XTTB 5A8ZA 2NPSC 2PKSC 2OCVB 5EXLA 1SGFG 1W7GH 2BEQD 1Q3XA 5AVVB 2H9EH 1RH5B 3TGUD 1WBGB 2Z9LA 2AHME 4HG6A 4WWYA 1CQQA 3R2PA 1WRGA 3UY9A 2BYAX 4JZFH 4KTSA 1TRNA 3KQ5A 5AVTB 1ELCA 1FZGA 1A5IA 2ZA5A 4X8SH 1GI0A 1O3CA 1C5MD 8KME2 2VVVA 1J1EB 4THNH 3TSIA 1C4U2 3RK3D 1BTYA 2Z7FE 3RXJA 1EOLA 1Q2WA 3D6ZA 2KM0A 4GDOA 1Y3XA 3TJOA 4ISLA 1NJIQ 1GTWA 3WU2H 2QEXP 4A92A 1CGJE 4INHA 1CSOE 2KZ4A 1A02J 3BN9A 3TGKE 4DIIH 1BQYA 3T29A 1DWCH 3SV7A 1HB0B 2LXCB 1SQOA 6GCHG 3RC6A 1FDIA 5FXLA 1UCYE 2ODYB 2QY0B 3RLWH 1QFKH 2CF9H 1L0ND 3ZDMA 4X6PA 3B8JA 3D49H 3A8DA 2IBZG 1O3BA 4O9VA 1TRYA 3GW6A 1AQ7A 1ZPBA 2R44A 1J8AA 1O2SA 4FVBA 2F9NA 1KILD 3L4FA 3FKSD 4NFFA 3T97B 3OX7U 5DO4H 3IF4A 1OPHB 1WDIA 3RK3C 5CCGC 4K3AA 1QHRB 4AZ2B 1BZXE 1MZDA 4I8HA 1V2KT 2VH0A 1GL1A 2Y80A 1NOHA 3BG8A 1C5LH 1AKSA 1VGCB 1KFNA 1Q2NA 2V3MA 4X8TH 3O8CA 3HE4B 5C1XA 4NPFX 5C1YA 3ZZCA 1SQVE 3RK2C 3LKWA 3UFAA 5DJUB 3VP9A 3G4SP 4OS1A 1OX1A 1PPCE 5BU8B 2HGTH 4O9BA 1EB1H 2ZFCA 8GCHG 1S4XA 4TYDA 5DP4A 3CX5H 2GUSA 1SS1A 1B7XB 3PV4A 1THPB 2JR8A 2OC8A 1LNQA 1FZCB 1BBRE 4YOJA 1ZRTE 2TGPZ 2GDDA 4XA4A 2ZDAH 2C3SA 1HJBA 2KXPB 1GBTA 3PTBA 3ZYDA 2ZPRA 1MKWK 1TX7A 1CSBA 3K2UA 2PKAA 4DGJA 3EAJA 2BOHB 4Z0KA 1IQGA 1FZZA 5CMZA 3SWYA 1YHQP 1O2IA 4ZHMU 2A45B 1O0DH 1LMWB 1DPOA 1ZTLA 1ZR0A 1Y3VA 3P8FA 1MBMA 1P2MA 3A2AA 2KCAA 3TH4H 1SSXA 2FFDB 3ZZ8A 3DD2H 3M0DA 2B89A 3T26A 1J14A 2BQWB 1O5DH 5DP8A 3UB0A 2GUVA 2ZYGA 1XTGB 3PLPA 3F89A 3LGUA 4NA8A 1C2IA 1P2IA 1V2QT 4KTCA 4BNRA 4CHAB 1W0KD 1C1TA 1Z6EA 2P3FH 2XYAA 3E90B 3EYDA 3KQBA 3BATA 1GBLA 4WWIA 2ZNKH 2SNVA 3IR9A 1HAHH 1SGCA 4U3FJ 2HLOA 2A31A 1K73Q 1P2JA 2BVXH 1P05A 1GU5A 4H13B 2BCCD 3G9RA 1AY6H 3JCUE 2WPMS 1ZTKA 1F5KU 1AQ5A 2ZF0H 3MH5A 3NK8A 1VQLP 5ESTE 3CMAP 1B5GH 1RRKA 4H44B 3EGKH 2C93B 7GCHG 4C7NB 1V6DA 2DUCA 3W94A 1VQ8P 1BMNH 3SNCA 2ZI2H 1YYY1 1O39A 1W3CA 5HIYA 2ANKH 3H1LJ 4XD7D 4Z6AH 3TH3H 2F9UA 2ZGJA 2HODA 2FS9A 4DOQA 4BAMB 1K21H 1N7SA 1UTOA 1CHOF 3A87A 3STJA 1JNMA 4PD4I 1SQPG 1EXIA 4QT8C 1JY2O 4DJGA 3SW2B 2E76C 1O2PA 3KQEA 1LTBC 2WV5A 3CC4P 1N2DC 1MTNB 2JH0D 1GHBF 2BXTH 3IITA 1K04A 1QGKB 3HTKA 1OW7A 3O8ZA 1MKXH 2WSCH 4B6FA 5EW2H 7ESTE 1HIAA 3GICB 4Q7ZA 1VQ7P 3K6YA 4YESB 4XSKU 4ABBA 1ZHPA 5HYOA 4MN4C 1PGQA 3K6ZA 1FDMA 1USEA 1S2EA 1P01A 1GK6A 3HE5B 1EC5A 2PHBA 1M1JB 3SN8A 5APWA 1VF5C 1QJ1B 1LTJC 2FYNB 2UWJE 3S9BA 3GHGC 2F83A 2P8OC 2JJLA 1OSSA 2VWNA 2XBVA 1H8ED 2AH4X 4FXGH 3A7ZA 3F3BA 4IN2A 4KTUA 3TGUE 1HF9A 3H1LE 5FAHA 4Z1MD 1GMCG 1O2QA 4CH2B 1SQQG 1SLWB 5G4BA 4RO0A 1VCWA 4DT7B 1U7MA 1TGTA 2Z9GA 3H32A 3TNTA 4GODA 1Q7YQ 2XC4A 2BDHA 3CCMP 2EI7A 3CWBD 3RK3E 1XUGA 1DXPA 3EA7A 1GBDA 3VPKA 4TLFA 3SU0A 2HPCB 1ELAA 1O5AB 1G2CB 2WT7B 2RA0A 1SI5H 1SFCD 4OVNF 5TISE 2NWNA 2O8MA 1TQ0B 1NTZK 1IC2A 3GY7A 4FETA 1F0TA 3SOSA 3AEBC 1HPGA 1OVUA 2JETB 1C1WH 1VQPP 1Z7KA 1QJ7B 4FUDA 1QB6A 3TF5A 4TT3H 1U57A 1LWUC 2JWDA 1Z71A 3E0PB 2K0QA 4UFFH 3RBZA 4TWYA 1SLVB 1G2CA 4TY6A 6ESTA 1GHAG 1GBEA 1JRTA 1C2HA 4I7ZC 4Y99B 2L74A 2ZKSA 5EJLA 2C9LY 4B86A 1PP9D 2LR2A 1D4PB 2QSIA 4FUFA 1S6LA 1O2VA 2J9NA 4DURA 1HUCA 2ZHWH 2AS9A 1IQJA 4H6SB 1KILE 2QVAA 2GZ7A 1KB9I 1OX3A 2QIWA 2Y9ZA 2W6JD 3CNRA 3HATH 2DE8A 2A4QA 3O8DA 1ZR2A 4IL6H 3R0FA 2K37A 3OAKA 2OYIC 3M9HA 1GL2B 2KLVA 4Y10E 1O3IA 4ISNA 3SBKA 2WPDD 3PWCA 2VIDA 2N1TC 1LHDH 2RG3A 2WSSD 2HNTF 2YMKA 1VQ9P 3ODFA 4BRYB 4CRDA 2BZ6H 2W26A 1DOJA 4NPEA 4ZROA 1E1RD 3RXEA 5HXFA 2FOEA 1O2UA 2BEZF 2OQ5A 2VVUA 1AV1A 2ZT9C 2KNCB 1AVWA 2F9PA 1CI6A 2FXRA 4B76A 3ZZ7A 1PYTC 4LLHA 5AVSB 3V4QA 1MAXA 2QAAA 3KQDA 3PMHB 3UQVA 3DSOA 1EPTC 2IBZE 1WUNH 2FYQA 2O8UA 1EASA 2E75B 2JH5D 2GM4A 1SGNE 3PMJA 2NU0E 4AC9A 1IQMA 4FUHA 3PB1E 4IMZA 5L2YH 3T2NA 5F8XA 1XTCC 1JCCA 2SNWA 1ARBA 3HK3B 1FOSE 1C2GA 1XXFA 2HPPH 4DY7B 3RXOA 4OS7A 2JP3A 2FOAA 3TPIZ 1AE5A 2AEFA 1Z8JB 5EPNA 3GS9A 1DEBA 2KK7A 4JZIA 4YXWD 2XCFA 1ZV8A 2KSEA 1BMFD 3D71A 3NCLA 1ZR4A 3WY8A 1IO4A 2QJYB 1NC6A 4ZKNU 1HAPH 1TIOA 1UTJA 2F91A 2OQQA 4KT0J 5ETXA 1T4VH 2A45G 4I2LC 3ENSB 4UD9H 4ASVA 1HBWA 1O2KA 3NWUA 3GDUA 1NU1D 1TWXB 3KF2A 2C4FH 1O2LA 3DCLA 1C2JA 1FAVA 3PTNA 2WPQA 1GL0E 1O33A 1X0TA 3L74G 1YY3A 1FMGA 2BDGA 3DFLA 1TQ7B 1O3JA 3LONA 1K22H 2B88A 3TYYA 3UIAA 2Y81A 3ITKA 2IN2A 3BSQA 3FXEA 1PL5A 1P84H 3BASA 4ZMDA 1SQPJ 1ZSKA 3KL6A 2FKWB 1NROH 1SQVK 4M7GA 4INKA 1OWDA 3VTPC 3AE6C 2XNDD 3RUOA 4Y11E 9ESTA 3SNAA 2H6MA 4IS5A 3TGJE 4Q7XA 3MFJA 1O3NA 2KZJA 2WZQA 5C20A 2HLCA 1E5WA 1C5TA 2ZCHP 1QBNA 1BBRK 1Q31A 1AVXA 1HLTH 1DUAA 1TMUH 2Q6FA 1YTZT 1W10U 3NTNA 3E3TA 3GCOA 2I1JA 1NWQA 1H0TA 4TPYA 1VGCC 1EDJA 4Q63A 2NPSA 3B71A 2OYHB 1OXGA 2QF3A 1W0YH 2R3UA 3A80A 3MHWU 1KXCA 4X6NA 2QRXA 2F43B 3MNXA 1FE6A 5C39A 2UUKB 4A1VA 1SQQJ 1UMAH 5GTHH 2OLGA 3PH0A 1K1JA 4VGCB 1FZCC 2ESTE 1FDOA 4I31A 3B4SA 4U2WA 4ABDA 3H1HD 1FUJA 2SGDE 2BM2A 1TGBA 4N3YB 2O1KA 1RFNA 1BTZA 1WOFA 3KIDU 4Q4LA 1N7SD 2K3RA 1PGOA 1P0SH 1W8BH 2DE9A 4JMYA 2QA4P 1JO5A 2Z3DA 1DLEA 2UUJB 1DX7A 2FMJA 1KQGB 3PLBA 3BEUA 1UK4A 4IGDA 1NTMG 1SL3A 2WHXA 3SSUA 2I6QA 1RE4C 3OA7A 1DSUA 3LGYA 5T3HA 2A06G 1N8OB 4ZKOU 1MKWH 3T5FH 4ABFA 4FU9A 1IQFA 5C5NA 1C1NA 1ABJH 1MUUA 3KYFA 1BGYD 4EOTA 2VB0A 2A32A 2ODQA 1QL9A 4I86A 4CHAC 1EDKA 5CBNA 1H8DH 1IAUA 1FU1A 2FX4A 4HI3A 1NTKG 1L4AB 1K1IA 1C5OH 1N8RQ 3EWKA 1F5RA 4F49A 5L6NH 1A1RA 4K69A 2STAE 5TCCA 1VPCA 2WPSA 1PP9E 5AW8B 5CCGA 1QL7A 3SJKA 3C9IA 4H13C 3ZVGA 1SQXG 1YLDA 2B7DH 5AFZH 3V7TA 2XW9A 4H44C 1L2PA 2QM7A 1LP1B 3NXPA 4GT1A 1FY3A 1NH4A 3M9BA 1UO6A 5F8TA 1SLXB 3WUVA 3CENA 4PJ0E 3N7DA 5EOKA 3HKJB 2ZDKA 1KLIH 1O2MA 5GJ4B 1O3HA 3UIRA 3AE9C 1QURH 5TJXA 4A1TA 1TMTH 5B66E 1L1JA 2G55A 1IFMA 1XXDA 1CHGA 2N9BA 4Y7AA 2E74B 4PV1D 1L0LD 3ELAH 1Z8GA 4MNVA 3BRVB 3LGTA 1SGFA 3KCGH 4O3UA 3A89A 4XBDA 4I7YH 2WYJA 5LPEA 1T31A 1BTWA 1MTNC 1DDJA 3BCCG 2JIZD 2HFED 4KELA 1PQ5A 2YMSB 1MU6B 4I8LA 1KILA 3TU7H 2PW8H 5DJTB 1GBHA 4FUIA 1V2RT 2JKHA 2QXIA 5FPTA 4YZUA 2E5YA 3FP7E 4JF7A 1IHTH 1K1NA 4X1RU 1Y8TA 2FLBH 3VMZA 1M1JC 3L70D 1HNEE 3E16B 3DHKH 3M7UA 2FYNC 1HFDA 4UDWH 1FZAA 4E05H 1Q86Q 5EPYA 4FOUC 3SU3A 3L75D 3OTPA 3VEQB 1BITA 2ZU1A 1DEEG 2KAIA 1O2TA 2ZFRH 3JC22 1NVOA 2Y5HA 1QRXA 3A7VA 1LTIC 1TA2A 2AGEX 5KAIH 3SYJA 1SGIB 1HGZA 2ZTYA 3EQ0H 3U59A 1NBMD 2C90B 4DCKA 2SGAA 2Z9JA 4YOGA 1K1LA 2HVXA 6CHAB 3BCCD 1DH3A 1L0NK 5TJHA 2ASUB 1DIPA 3PM3A 4HTCH 3CCUP 3H1KG 3S1KA 1CZQA 4QMAA 1QTFA 3RGUA 1GHYH 3L74J 3Q76A 1GL2D 2E76B 2ZYAA 3D23A 3D6YA 2EC9H 3RXFA 2ZEBA 4LOYH 2B87B 3N7OA 4OS6A 2JETC 2VH6A 2JWAA 2VWMA 3PMBB 5K0HA 4RI0A 4WBAA 1TFXA 1EAIA 3VYIA 1TMBH 2H7HA 1WTGH 5H2FE 1FPCH 2OP9A 5K7RA 2H9HA 1NESE 3RXBA 2ZFFH 1WTHD 3CXHE 5GCHF 5C0UA 2C8WB 2FWWA 2GA1A 3RL0g 1RF1B 5EFWB 1O3MA 3PLNA 2FODA 2W3IA 3F0OA 3CCLP 3LJJA 3MO3A 2Y7XA 4Y99C 1IQNA 3IWMA 2R2WU 1LTJB 2O8WA 3I77A 1P3CA 3MTYA 4GOFA 1MH0A 1KORA 1NRRH 5L2ZH 4MPWA 1TPAE 4N6JA 1QA0A 1YBKA 2DW3A 4UB8H 1GI6A 1A61H 4AG2A 2F4LA 1GMDF 3AEGC 2ZO3H 3U1IB 2GCHG 4AORA 3SJ9A 5AVYB 2XCNA 5C17A 3ODDA 3SV6A 3AEDC 2ANWA 3GCTF 3PROA 2ZU2A 4PD4H 5A0AE 1O2NA 3IG6B 3GHGA 3BIUH 4A1XA 1GJ4H 4ZXYH 1L2EA 3SU1A 1GJCB 2GGVB 3L3TA 1GBKA 1K1MA 5HKKD 5DP9A 1J2JB 2Z3EA 3AEAC 1KXDA 4ACAA 1W7XH 1ETTH 3U98H 2FYUG 1QL2A 3Q3DA 4ZCNA 4DZOA 1AZ8A 2FI4E 5JBBS 2ZAEB 3H1JG 1O2OA 1ABIH 2XXLA 2FI3E 3RMMH 2QF0A 4K35A 4B2BA 3LH1A 4B71A 4MNWA 1SVFA 1VQ5P 2E75C 4JPZB 1HJAC 1W2EA 4LC1A 1CGIE 4HGCA 1NTMJ 2J94A 1J17T 4FUEA 3F2HA 4GHQA 1VZQH 2SPZA 1BHXB 2KUBA 5E2PA 1GI9B 3M5OA 2V0BA 2YMYA 1O35A 2WUBA 4FUCA 4ZHLU 1WXRA 2PFEA 2CF8H 2JJ2D 1QGFA 1OW6A 1LWUA 4CRAA 4MPUA 1NTKJ 2BQ6B 3VXFH 1GW4A 1DY9A 3S9OA 4BTUB 4DJZB 1BGYE 5A0BA 1PQAA 1ZN5A 3RXTA 1QNJA 3ATIA 4AFZA 2NPSD 2FYUD 1RHZB 1LHEH 2Q1JA 4YM9A 1ZMNA 1F0SA 4GCHF 1SQXJ 4I8JA 1C1RA 3KXDA 1KQLA 1YPJH 2EEKA 3MWIU 1BSNA 4JYBA 3SFEC 2FXPA 1C2LA 4GIFA 1O5EH 2B8OH 1GI8B 2FOMB 4IC5A 4WH6A 3MQKC 2OYIA 4UEHH 2O01J 3CL3D 2BDYA 3PRJA 1HCGA 1K05A 1BMLA 1MD8A 2JEEA 2GDEH 3STIA 1V2NT 2Q6DA 3P92A 4H0LC 2N1TA 1EPTB 1EJNA 3OEHD 3BVHA 7LPRA 1Y5UT 3QGJA 1SOTA 1T7CA 1NHLA 1T3JA 4U3FD 2A06E 5KJ7C 1FY8E 3BCCJ 1AFOA 1C1UH 1OP0A 1NPMA 2P95A 4YT7H 1L0LE 2J38A 2Y82A 3MIWA 1GVKB 2W5EA 1KB9H 1FONA 1O3KA 1SHHB 1F0UA 4DCDA 3LGWA 2H9TH 2Q5UA 2FYZA 2CMYA 3HGNA 3OY5U 4FU7A 1EPTA 2AERH 2Z9KA 1FAKH 3TVJB 3L73G 1KXAA 1C4Y2 3H1LD 1DUEA 1QJ6B 5CJ0A 2F9VA 1O3AA 4WMEA 2KS1B 1P12E 1KYOE 2VIVA 3MZWB 2A5AA 2I1KA 3V2PA 2GCTB 5AVQB 4GHTA 3L70E 2ULLA 2OYHC 1Q82Q 5CCGD 1BBRH 2K8IA 2Z9IA 3RXMA 3UNRA 2FZZA 5FBIA 4YOIA 3MD0A 1DVAH 1ZPCA 3GOVB 2ZXXA 2YOLA 3MOCA 3L75E 1T8NA 3A8CA 4DOJA 2WSEH 4I33A 5E79E 2OTVA 4IFFA 4VGCC 1MFZA 1YJNP 1HV7A 3RK2D 2P1JA 3RBXA 5HGGA 3H1KJ 2CK3D 2R3YA 1NBME 1G1JA 1ZRBA 1DSTA 1RF0C 1VCQA 5AW5B 2FP7B 3M3SA 1LKAA 1UK2A 2ZG0H 2IPPA 3BCCE 1VQNP 4SGBE 1T4UH 4GVUA 4WJG2 3RM2H 3P70B 5APVA 1DY8A 1O3PB 1CA0B
chains in the Genus database with same CATH topology
3H32A 3VN0A 2Z5HA 3B5NB 1JY3P 1RF1A 3VOPA 4I6MC 3N4XA 1CW5A 2HPCB 1G2CB 2WT7B 1FZFA 2XKMA 1SFCD 1URQD 1LTJA 3NXSA 3CI9A 1NTZK 1IC2A 5AW6B 2MJZA 1L4AC 1MZ9A 1JY3N 4LGDE 5AW4B 1FOSF 1LWUC 2L5GB 1FJKA 3G3ZA 1RF0A 2W27A 2Q7CA 3T97A 3M0DC 1G2CA 3MUDA 3U1CA 2FYUK 2XNXA 4Y99B 2C9LY 4B86A 4C7RA 3KYQA 1HUCA 5AVRB 3HE4A 2FFDC 1GD2E 2YKPA 1ZR2A 2OYIC 3OAKA 3M9HA 3MGNA 1GL2B 2KLVA 3RK3B 4AUWA 1S9KD 3M9QA 2WSFH 2W6BA 5AW7B 2XDJA 1N73B 2N1TC 5KJ7D 1FZCA 1QL1A 2YNYA 1H89A 1JTHA 3RK2B 1JY3O 2QM8A 1N7SC 2OARA 1CI6A 5AW2B 4LLHA 5AVSB 3V4QA 2FFDA 1GK4A 4W7ZA 4WY4C 3P8MC 1RE4A 1IJDB 1NU1K 2GM4A 4JYCA 3M0AA 1J1DC 1KILB 3L37A 1LT9B 1XTCC 1FBMA 1JCCA 1SFCB 1URQB 1LTTC 2H43A 1FOSE 2A45H 1RY3A 3MTUE 1RE3A 3U1AA 5CCHC 2WTYA 1DEBA 5AW9B 1ZV8A 1KZUB 1ZR4A 1IO4A 5KLVK 4C7NA 1WT6A 2P7JA 1G1IA 1SQPK 2A45G 4HH2A 4I2LC 2O1JA 1HBWA 2M3BA 3BRTB 3HD7C 1FAVA 2WPQA 2H8PD 3VP8A 4AQRD 3EQ2A 1VDFA 2E43A 2POHA 1RF1C 3TYYA 5CHXA 3UIAA 2HG5D 1NKZB 3BASA 3CLQA 1YYCA 2FKWB 1SQVK 2CPSA 1L4AD 3VTPC 5AVWB 5KTBA 4XE5B 3HUSB 1IFJA 3HE5A 2IFMA 1M1JA 4IFMA 1E5WA 3VMXA 1SP4A 3LIEA 1YTZT 3L36A 1GDTA 4W7YA 1SQQK 2VRSA 3NTNA 5AW1B 2I1JA 1HVVA 2WWWA 1NWQA 1GU4A 1NKNA 5AW0B 3KPEA 1SQBK 3RL0C 2NPSA 4GKGA 4AYCA 2OYHB 1KFMA 2J59M 2R5DA 3V4WA 3HRNA 3TK1A 3KQGA 3A3YB 2Q9IA 2WPRA 3KDPB 2N1TD 2W6AA 3P32A 2IFNA 1GZLA 3GHGB 3B5NA 1FZBA 1FZCC 2HPCA 2WT7A 5AW3B 3II6A 5APTA 4N3YB 2O1KA 1N7SD 2A45I 1GL2C 2KB7P 1JO5A 1FJPA 1DX7A 4WY4D 2M8RA 5APYA 2C9NY 1GW3A 1RE4C 3OA7A 1IFNA 3P8CD 1N86A 1NO4A 2XZRA 2FXMA 1MUUA 1L0LK 4EOTA 1FU1A 1L4AB 2IX7C 1LWUB 2O01H 5CCHD 2KYVA 3OJAB 1H88A 1RE3C 1VPCA 1GL2A 2WPSA 5AW8B 5CCGA 2CPBA 3C9IA 1KILC 2QM7A 5AVZB 1N73A 4GT1A 1NH4A 3M9BA 3I5CA 2Z5IA 3HD7D 2KP8A 1S9KE 2OYIB 2J58A 1JY2N 1IFMA 2WZ7A 2N9BA 3BRVB 2Q3IA 3V2RA 2N1TB 3L35A 2HFED 1LGHB 4IFDK 3H6PA 1KILA 3A5TA 1LT9A 4HYTB 2P2UA 1SFCA 1URQA 1JMMA 2HODB 3A7OA 5APUA 1N7SB 4W80A 4JF7A 2Z4EA 3VMZA 2P67A 1M1JC 1LTGC 1YTZI 4WY4B 4N78D 1FZAA 1PFIA 3HTKB 3M91A 3TNUB 1J1DB 1IFIA 3RL0D 1JCDA 2E42A 1HWTC 1X8YA 1LTIC 2NPSC 4I1LA 1HGZA 1MV8A 3U59A 2BASA 5AVVB 1OWAA 1HGVA 1WRGA 1L0NK 3R2PA 1T2KC 4OH8B 1DH3A 3B5NC 5AVTB 3E1IA 1FZGA 3M06A 1CZQA 1J1EB 3V2NA 3TSIA 1GL2D 3RK3D 4C46A 5KJ7A 2C0WA 4WBAA 3VYIA 2H7HA 3HD7B 3HUSA 1GTWA 3H32B 2C0XA 4EIJA 1RF1B 2WITA 1A02J 4Y99C 1N7LA 1LTJB 1IFDA 3V5BA 5BVZA 1X79B 1JOCA 1HH0A 4N6JA 5APQA 2OYHA 1KILD 3L4FA 4ZKPA 5AVYB 3RK3C 5CCGC 2LKMA 3GHGA 1EQ7A 1N73C 1NOHA 1KFNA 1NTMK 1J2JB 3HE4B 3RL0B 3RK2C 2R5BA 3VP9A 1QL2A 4DZOA 1JUNA 5BU8B 4O9BA 2ZFCA 5BU5A 3PP5A 2YKOA 2HYNA 3N7NA 1Z56A 1HTLC 2GUSA 1SVFA 2KSJA 3WMM0 1NTKK 1OXZA 1FZCB 1W2EA 4LC1A 4XA4A 1LTSC 4M3LA 3SWFA 1HJBA 4KHXA 1JTHB 1LT9C 1CSBA 1JY2P 2YMYA 4WB4A 1SFCC 1URQC 2PP6A 1SQXK 5CMZA 3SWYA 1L4AA 1CI6B 3A2AA 1LWUA 1LTAC 3P8CE 2FFDB 5AVUB 3M0DA 1GW4A 3EFGA 2GUVA 1XTGB 1ZN5A 2NPSD 1H8AA 1KQLA 2YO3A 3BATA 4JYBA 1T2KD 3IR9A 4GIFA 2XV5A 3B5ND 2OYIA 2HLOA 3IFMA 3CL3D 1GU5A 2JEEA 1AQ5A 4C7NB 2R32A 2N1TA 3BVHA 1NHLA 1NAFA 1T3JA 2ZXEB 5KJ7C 1AFOA 3P7KA 2HODA 3MIWA 3HUSC 3NFQA 3VMYA 1N7SA 2Q5UA 2FYZA 3LW5H 1JNMA 1ZLLA 3NMDA 1J1EC 1JY2O 4WY4A 1FZEA 1LTBC 1N2DC 5CJ0A 3HTKA 3O8ZA 1M7LA 2WSCH 3TNUA 2I1KA 3V2PA 2YKQA 1A02F 5AVQB 2OYHC 5CCGD 1FDMA 4N78E 1X9VA 1GK6A 3HE5B 5APSA 1IK9A 1M1JB 3MD0A 3LIDA 1T3UA 2PAJA 5APWA 1LTJC 1SLQA 5AVXB 4DOJA 5CCHA 5APXA 3GHGC 2WSEH 4IFFA 1MFZA 2JJLA 1T8ZA 3RK2D 2P1JA 2YO2A 2KOGA 3B8EB 5CJ4A 3V2QA 2R3CA 1G1JA 2NPSB 1RF0C 5AW5B 2IPPA 4RESB 5APVA 2XU6A 3HD7A 4ZKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PP5 A;  3B5N B;  3VOP A;  2HG5 D;  2N1T B;  2HFE D;  1SFC D;  1URQ D;  1L4A D;  1KIL A;  1JTH B;  2YMY A;  1SFC C;  1URQ C;  2PP6 A;  1SFC A;  1URQ A;  1L4A C;  1L4A A;  4LGD E;  1N7S B;  4W80 A;  4JF7 A;  3P8C E;  3M0D C;  4WY4 B;  1XTG B;  3HTK B;  4W7Y A;  1HVV A;  3KYQ A;  3RL0 D;  2NPS D;  3RL0 C;  2NPS C;  2NPS A;  3B5N D;  1GL2 B;  3RK3 B;  2N1T D;  4OH8 B;  3B5N C;  3B5N A;  2XDJ A;  2N1T C;  2N1T A;  5KJ7 D;  3TSI A;  1GL2 D;  3RK3 D;  1NHL A;  1T3J A;  1N7S D;  1JTH A;  3RK2 B;  5KJ7 C;  5KJ7 A;  1GL2 C;  4WY4 D;  3HD7 B;  2M8R A;  1N7S C;  1N7S A;  4W7Z A;  4WY4 C;  4WY4 A;  1KIL B;  1SFC B;  1URQ B;  1L4A B;  2WZ7 A;  5CCG D;  5CCH D;  4N78 E;  1KIL D;  3RK3 C;  1GL2 A;  5CCG C;  5CCG A;  5CCH C;  5CCH A;  1KIL C;  3RK2 D;  2KOG A;  3RL0 B;  2NPS B;  3HD7 D;  3RK2 C;  3HD7 C;  3HD7 A;  2H8P D; 
#chains in the Genus database with same CATH topology
 1USD A;  3BTW E;  2NZ2 A;  1SQB G;  2JKV A;  1S81 A;  3B5N B;  5JPM H;  5C94 A;  1LVB A;  1JY3 P;  1N1L A;  4I6M C;  3N4X A;  2P93 A;  4X8V H;  1N8O C;  3T27 A;  1FN8 A;  1T6A A;  1FZF A;  2XKM A;  1M56 D;  2XBX A;  1ZTJ A;  1QEX A;  4JBZ A;  3VB3 A;  3CI9 A;  3K5B A;  3CCE P;  4X6M A;  4DT4 A;  1ZML A;  4B73 A;  1C4V 2;  1NFU A;  4UB6 E;  1L4A C;  1T8O A;  4R0I A;  2IDB A;  4LGD E;  1DIT H;  1FOS F;  1A4W H;  1ZRK A;  2QJK B;  3M5N A;  4B2A A;  3A88 A;  3ZVF A;  2NRG A;  2W27 A;  3T97 A;  1O2W A;  2OXS A;  3MUD A;  3F2F A;  3U1C A;  4OGQ B;  3AEF C;  4K3J A;  2G51 A;  1O36 A;  2IOT A;  3RXR A;  5GDS H;  4C7R A;  3OEE D;  3KYQ A;  3A86 A;  1KMH B;  1O2R A;  2PV9 B;  1C1O A;  3EE7 A;  4D9R A;  1P3E A;  3H1K E;  4U30 A;  3HE4 A;  3NPS A;  1GD2 E;  2IBZ D;  1TU3 F;  3UTU H;  3F9F A;  3QDZ B;  2V7Q H;  3A81 A;  3OW2 O;  1FIZ A;  1O32 A;  5EJ1 A;  1CBW B;  3SU4 A;  3R4Y A;  3OAA D;  3F68 H;  2WQY C;  2E74 C;  2FYU J;  2HLD D;  3LDX H;  2WVR A;  4H42 U;  1M1K Q;  3H1J J;  2W6B A;  5AW7 B;  2Q6G A;  1V2L T;  4U32 A;  1YLN A;  2VVC A;  1YC0 A;  4X1N U;  1MCV A;  1FZC A;  2YNA A;  2YMS C;  2P10 A;  1QL1 A;  2YNY A;  1KV4 A;  5ABW A;  2AEJ A;  4F55 A;  1GI4 A;  1RTF B;  1TAL A;  2WV9 A;  2O3J A;  4Y79 A;  2LP6 A;  2ZPQ A;  5KLI C;  1KYN A;  3D65 E;  1E35 B;  2E76 D;  2A1D B;  3PO1 B;  1YPH C;  1C5R A;  2FFD A;  2ZCL P;  1GK4 A;  3K9X B;  3P8M C;  1RE4 A;  3JZ2 B;  1NU1 K;  1UTP A;  1UVP A;  2AXC A;  4JYC A;  1OP2 A;  3M0A A;  1THR H;  3M3V A;  4SGA E;  2BX3 A;  1C2F A;  1FLE E;  3L37 A;  2G8Y A;  1FY4 A;  1LT9 B;  1ANE A;  1FC2 C;  3LH3 A;  1EZV I;  1URQ B;  1BJV A;  3PWB A;  4Y8X A;  1BOQ A;  1YPK H;  1ESA A;  4EI2 A;  1G2M A;  1VF5 D;  1TX8 A;  3I56 P;  2D2D A;  3U8O H;  2BTC E;  4ASH A;  1AB9 B;  1EAT A;  4RSP A;  5TIS H;  6CHA C;  1KTT B;  3P8G A;  1C2M A;  1TNK A;  2FYU E;  2A4G A;  2G5V A;  3FVF B;  2W7U A;  3H1J E;  1C5Z B;  1RJX B;  1SQT A;  1EX3 A;  5KLV K;  1ZPZ A;  1GHZ A;  4C7N A;  2QF4 A;  5GTI E;  2XBY A;  4NG9 H;  5KEC A;  4YXD C;  1FAX A;  2XWA A;  4AB9 A;  2D2C B;  3GLM A;  2TGA A;  5GIB A;  3OFN D;  3M37 A;  3USS A;  4K5Z A;  4MTB A;  3PYH A;  2H8P D;  1VQK P;  3UNS A;  3F6U H;  3EQ2 A;  1SGD E;  1NGM B;  1VDF A;  1PJP A;  2B9L A;  1TBQ H;  2ZHE H;  1RF1 C;  5CHX A;  1HAV B;  3CX5 E;  2VIN A;  4U3F E;  2ZC9 H;  1VIT F;  4B6E A;  2CPS A;  3E7K A;  1LQD B;  2QC2 A;  2V3H H;  1W5C E;  1GHB G;  5F03 A;  3M36 A;  1MZA A;  2WUC A;  2GT7 A;  1MAB B;  1AVO A;  3W68 A;  2WPL S;  1TON A;  1Z1I A;  3HUS B;  5EXN A;  1IFJ A;  3C1L A;  1TYN A;  3R3G B;  5JBA S;  1HAV A;  3HE5 A;  2G5N A;  2CXV A;  2IFM A;  1M1J A;  1HYL A;  4Y76 A;  1X22 A;  2I8D A;  1SQP D;  3RXV A;  3CC2 P;  1GG6 B;  1SG8 B;  3QO6 A;  4K1E A;  3L36 A;  1GDT A;  1HJ8 A;  2VRS A;  1AZZ A;  1K1P A;  2C8Y B;  2LPR A;  3GY4 A;  3ZZB A;  3RXC A;  1UTK A;  1S1C X;  1GU4 A;  1NKN A;  2WSC J;  4XDE A;  3EE0 B;  4CR5 A;  5LH8 A;  1BT7 A;  1SC8 U;  3KPE A;  4LK4 A;  2RMZ A;  1JEK A;  1LO6 A;  1YP9 A;  1D3D B;  3HRN A;  3KQG A;  2M5A B;  4JQ0 D;  1SGT A;  2WPR A;  5AF9 H;  3KDP B;  1ELT A;  3SI3 H;  3ZVE A;  2PLX A;  2N1T D;  2W6A A;  3P32 A;  2IFN A;  3AE5 C;  1NT1 A;  1SFQ B;  2BX4 A;  4MDS A;  5DP3 A;  1GZL A;  4ZH8 A;  2A0Q B;  5BRR E;  1Y3W A;  1FZB A;  1BA8 B;  5FL7 D;  2ZZU H;  1UVT H;  2HPC A;  2WT7 A;  1VR1 H;  2WV4 A;  1SQB J;  1MFT A;  1AVG H;  4RJT A;  1RD3 B;  3UWJ H;  2ZT9 D;  2CHA B;  1IQE A;  2BY9 X;  1PYT D;  4NA7 A;  1RTL A;  3PLK A;  4XRN A;  3DFJ A;  1FJP A;  2FOF A;  1SQQ D;  2QXJ A;  1XUH A;  3P8O A;  1EAX A;  1TNG A;  1GJ8 B;  1TOC B;  1BDC A;  1BRB E;  5FBE A;  4JK5 A;  4X8U H;  3LGV A;  2Y0C A;  2Q6Q A;  1LQE A;  1T8L A;  3G01 A;  2P3U B;  1XX9 A;  3BTM E;  3Q77 A;  4L73 A;  4GSO A;  1EZQ A;  2KLU A;  5FX6 A;  1L0L K;  1AWF H;  1YPE H;  4HZH A;  3U8T H;  2OBO A;  1SB1 H;  2ZVN B;  1G9I E;  3TJU A;  3PHL A;  2A7C A;  3FFG A;  2PRR A;  1FNI A;  2KYV A;  3ZIA D;  1BMA A;  4OGY A;  1HDT H;  1XM1 A;  1GL2 A;  2AEM A;  5DK1 A;  1PQ7 A;  2CPB A;  1MTW A;  4NA9 H;  4NSY A;  3Q2Y A;  1DWE H;  1EB2 A;  2Y5F A;  2ZDV H;  3NKK A;  5B5E E;  5AVZ B;  3SUG A;  3RDZ A;  1L1G A;  1KIG H;  3PRD A;  4BRY A;  1EDI A;  1HJA B;  1ID5 H;  5IDK A;  4MNY A;  4ZKR U;  2STB E;  4JK6 A;  5FCR A;  2IYP A;  1CGH A;  5L8R J;  2J58 A;  2VIP A;  3LIW A;  4WVZ A;  2KNC A;  2A2Q H;  4Y6D A;  2I6S A;  1G3D A;  2W7S A;  4F48 B;  3QWO C;  4KJM A;  3SGB E;  4AG1 A;  3M5L A;  1TGS Z;  1M90 Q;  1E79 H;  1E34 B;  1ELE E;  4NSV A;  4Q2K A;  3WWF A;  1FX0 B;  4BAO B;  3D70 A;  2BY8 X;  1NFY A;  3H25 A;  1AUT C;  3KYG A;  1LGH B;  2D26 C;  2GMT B;  2ZGB H;  1OOK B;  5AHG H;  2W8Z A;  3H09 A;  4HYT B;  1UCY K;  2GCT C;  5APU A;  1JMM A;  1DIC A;  3FZZ A;  3TH2 H;  3RC5 A;  4KKD A;  4W80 A;  3RXK A;  4A6L A;  3PTZ A;  2P67 A;  2GKV E;  5EQR A;  1YTZ I;  1S82 A;  4WY4 B;  1YQ3 C;  1WQV H;  2JH6 D;  1B0F A;  5IK2 D;  4CRB A;  4YPC A;  4JZ1 A;  4J1Y A;  3BTF E;  4UON A;  1BE3 G;  4AGJ A;  3TNU B;  1J1D B;  1P09 A;  1VL2 A;  2ILN A;  1JCD A;  1E36 B;  3A0H E;  1H1B A;  1K2I 1;  1YIT P;  1ZJK A;  3F9G A;  4H0L B;  2E42 A;  1HWT C;  4UFG H;  4BTI B;  1FY5 A;  5EGM A;  1KXE A;  3CXH D;  1MMJ N;  3RMO H;  4I1L A;  2B9B A;  1K0H A;  4DIH H;  1MV8 A;  1NRP H;  1CU1 A;  1VIT H;  4IOI H;  3W67 A;  3OYP A;  1HAZ B;  2J92 A;  5JBC S;  1OWA A;  1R5L A;  1CA0 C;  1VCP A;  2GV7 A;  1HGV A;  4JYV H;  4IL6 E;  1T2K C;  4OH8 B;  4AFU A;  4DG4 A;  2QE7 D;  3EDX B;  3MU4 A;  1XUK A;  3CCV P;  3B5N C;  3E1I A;  5KAF H;  3UUZ A;  2VWL A;  2TGT A;  1S5L X;  2KX4 A;  3Q3K A;  1GJB B;  1P2Q A;  1HAI H;  1KC8 Q;  3H1I G;  3SJI A;  2G3A A;  2RDL A;  1PPJ G;  3VG8 A;  3B23 B;  2A2X H;  1V2J T;  2KZI A;  4C46 A;  1MQ6 A;  2AGI X;  1C5U A;  5KJ7 A;  4HFP B;  4Q80 A;  1MD7 A;  3M7T A;  1MAY A;  1WCZ A;  3GY8 A;  3U28 C;  3ZZ4 A;  3BTK E;  4X2Y A;  4NCY A;  2ANM H;  5KED A;  3HD7 B;  2HNT C;  2W6J H;  1C5Q A;  2QJK C;  2PSY A;  3ZZD A;  1GJ7 B;  1WMK A;  4PJ0 H;  1QB9 A;  3AW0 A;  2C0X A;  3L74 D;  4FUB A;  3MU8 A;  2WIT A;  5E8E H;  1C9P A;  2IPH A;  3IN6 A;  4OGQ C;  1M9U A;  1S6F A;  1N7L A;  3SU6 A;  3ZVD A;  4NWL A;  1JIM A;  1F5L A;  4MQA A;  1IFD A;  1D3P B;  2H1U A;  2VJ1 A;  3V5B A;  1D3T B;  1P03 A;  2WSS H;  1W12 U;  3CME P;  1JOC A;  2OTL P;  1PPF E;  5APQ A;  1YJW P;  1QL8 A;  2VU8 E;  2BY7 X;  4L75 A;  1OWJ A;  1GJ6 A;  2OYH A;  1SQP E;  2AIP A;  2FOB A;  2H5D A;  5C5O A;  2WPH S;  2CJI A;  4H13 D;  4ZKP A;  1NRQ H;  1P11 E;  1LKB A;  1CBW C;  1QRZ A;  4ZMA H;  4CRG A;  1NTZ G;  4H44 D;  3MH6 A;  1GVZ A;  3Q1M A;  1LVM A;  2QXH A;  2SFA A;  2WYG A;  1PPJ D;  1B0E A;  1GI3 A;  1UTL M;  2IYO A;  1C5P A;  1COW D;  1EQ7 A;  2OYO A;  1EP6 A;  3PMA B;  4ABH A;  3SO3 A;  2RN0 A;  3CC7 P;  1TB6 H;  1Z8R A;  1O3G A;  2R9P A;  2BDA A;  3SFD C;  1HJ0 A;  3RL0 B;  1TNL A;  2R5B A;  2FYR A;  2HWL B;  1O2X A;  3F9H A;  1FQ3 A;  1QR3 E;  2TBS A;  1JUN A;  2FOC A;  1C5W B;  5C1U A;  1W14 U;  5CDF E;  2GJG A;  1T32 A;  4YT6 H;  3PO1 C;  5EW1 H;  3PP5 A;  1O3E A;  3N7N A;  1Z56 A;  1HTL C;  3FWN A;  1A5G H;  3AE7 C;  3WMM 0;  3K65 B;  3L72 G;  1OXZ A;  3MI4 A;  2NU3 E;  4YXW H;  1GBC A;  4CR9 A;  5FCK A;  3OY6 U;  1ZHR A;  1PIX A;  3UQO A;  1JB0 J;  1SQQ E;  4D8N A;  4KHX A;  1JTH B;  1LT9 C;  1QIX B;  3E8L A;  1URQ C;  3V0X A;  1NTZ D;  2J95 A;  1L4A A;  1W0Z U;  2KFW A;  2SGQ E;  3FAO A;  3RU4 D;  1AA0 A;  1KLJ H;  1GBM A;  1MTS A;  1VKY A;  1AB9 C;  4AFS A;  5AVU B;  1L0Z A;  1V2M T;  2F9O A;  1NTM D;  2FTL E;  4OGX A;  4RT0 A;  3ATM A;  2OTK E;  1BB0 B;  2FS8 A;  2A06 D;  3SV2 H;  2H88 C;  5EQQ A;  2ZU4 A;  5H2F H;  4INL A;  3TK6 A;  5A2M H;  1LP1 A;  2ZYD A;  1BCU H;  1S3J A;  4A7P A;  1OVR A;  1IQK A;  1H8A A;  2FX6 A;  1HAY B;  2WSF J;  4ZNC A;  4WMF A;  4AYY B;  1SBW A;  2D2C C;  2YO3 A;  4PD4 D;  3SHC H;  1NTK D;  2IBZ I;  2XND H;  1AE8 H;  1O31 A;  3A82 A;  4ISI H;  1GCT B;  3SND A;  2XV5 A;  1QCP A;  4HJG H;  3IFM A;  3CS7 A;  3VB4 A;  3ZV8 A;  1KYO D;  1BRU P;  3Q5P A;  5KLI B;  1GJA B;  4WF8 A;  1SQX D;  1KSN A;  2OK5 A;  9LPR A;  3A83 A;  4BXS A;  4DW2 U;  4R4L A;  1UHB B;  1Y3Y A;  2AIQ A;  1LVO A;  2FI5 E;  2KR7 A;  1YBW A;  3T62 A;  3TDK A;  1UW7 A;  4X6O A;  3QK1 A;  3V13 A;  2OC7 A;  2PFX A;  3AE1 C;  1BUI A;  1QBV H;  2JDI D;  4NWK A;  1EXF A;  1GBJ A;  3ABV C;  4X1S U;  1PPE E;  3HUS C;  3O8R A;  3NFQ A;  4EST E;  2THF B;  2UWP A;  2W6I D;  5TCA A;  3FZD A;  1SOZ A;  3LW5 H;  1BTU A;  3NMD A;  1N6X A;  1AVY A;  1GG6 C;  2GT8 A;  1KTS B;  2W90 A;  5FPY A;  4YLQ H;  1K9O E;  1AJY A;  3HK6 B;  1S72 P;  1D7M A;  1ZSJ A;  2QN5 T;  3OSY A;  4ABJ A;  3DT0 H;  1FIW A;  1D3Q B;  3KZI E;  1A02 F;  1BE3 J;  1TPS A;  1RXP A;  1IFP A;  1C1Q A;  1SQV G;  4X2W A;  4O97 A;  3LID A;  3QTV H;  1MCT A;  1QRW A;  1JMB A;  5AVX B;  1JRS A;  1NM6 A;  1P2N A;  3VGC B;  1P8V C;  3L71 G;  4ASW A;  1EJA A;  4H6T A;  2BY5 X;  3UOP A;  1T8Z A;  2O9Q A;  1ZP0 C;  2RDE A;  3B8E B;  5CJ4 A;  1A7S A;  4DVA U;  3V2Q A;  3Q3Y A;  2BD4 A;  2CHA C;  1Q90 D;  2B87 A;  2J5U A;  1XKB C;  2K1Q A;  1LJ2 A;  3H1I J;  2E5T A;  4AX9 H;  1SFI A;  3RXQ A;  5E0J A;  4ZKU A;  2E75 D;  3VN0 A;  1KDQ B;  2ALV A;  3AAS A;  2Y5G A;  3KHU A;  3VOP A;  1RF1 A;  3H1K D;  4YTA A;  3O8B A;  2H89 C;  1KY9 A;  1CW5 A;  3CP7 A;  1D9I A;  3T25 A;  3MO6 A;  3SUE A;  2GCH F;  1WYK A;  1LTJ A;  1QLE D;  3AEE C;  3NXS A;  5B6L A;  1KD1 Q;  2KCP A;  1Y5B T;  2PWX A;  1GHW H;  4MPV A;  1BE3 E;  2MJZ A;  1OWI A;  5IYT A;  3L74 E;  1F0R A;  1JY3 N;  4MPX A;  5AW4 B;  1C1M A;  1SGQ E;  3G3Z A;  1ZGI A;  1C2D A;  3MU1 A;  3RXI A;  3KGP A;  1QZ8 A;  1GWA A;  2A4O A;  3BV9 B;  1ZJD A;  2BLQ A;  3Q00 A;  1W2B O;  2BLW A;  1NTZ J;  2J34 A;  4J2Y B;  3SJ8 A;  1ELG A;  3SU2 A;  1A46 H;  4FUJ A;  1UIX A;  1JIR A;  1MQ5 A;  5GPI B;  1YCP K;  1ANC A;  3DSP A;  3E0N B;  1Y3U A;  1E37 B;  3F2G A;  1P04 A;  1NO9 H;  3ZVA A;  4WH8 A;  2QF5 A;  2YKP A;  3H1I E;  1QX8 A;  1PPJ E;  1KQF B;  4HKZ H;  1P06 A;  1TOM H;  2D1J A;  1HUT H;  3MGN A;  4HB1 A;  3URE A;  4AUW A;  4PRO A;  4H0L D;  1S9K D;  1YI2 P;  1O5C B;  1U6Q A;  3UAI C;  1BCC G;  1SLU B;  3M9Q A;  1HAO H;  2XDJ A;  2FPZ A;  1N73 B;  4XBC A;  5F53 A;  4D7F A;  1O5G H;  5KJ7 D;  3LU9 B;  3I29 A;  2ZFP H;  2HAL A;  1H89 A;  2J97 A;  1DM4 B;  2GMT C;  5B6O A;  1O38 A;  1UVU H;  2FXO A;  3L72 J;  3RML H;  2P16 A;  1JY3 O;  3QH9 A;  3CCJ P;  1MBQ A;  5E79 H;  2KCY A;  2PTN A;  1H8H D;  4NIX A;  3GY6 A;  4K8Y A;  3H1J D;  4WVP E;  2HVY B;  1CT2 E;  1THS H;  1V2S T;  2IZ1 A;  4W7Z A;  4WY4 C;  1EJM A;  1OWE A;  1UVS H;  1IJD B;  4MG3 A;  1GDU A;  1UCY H;  2QXG A;  1CA8 B;  3GCN A;  3S69 A;  1GHX H;  5HM2 A;  3W1E A;  1J1D C;  1NTZ E;  3O6Q B;  2Z3C A;  1O2J A;  2A5I A;  1GMH F;  1FBM A;  2G8T A;  3RU4 E;  1N6Y A;  1SFC B;  1Y8A A;  1S5L E;  1GMJ A;  2VIQ A;  1XUJ A;  4GCH G;  1NTM E;  1S83 A;  5CBO A;  2GVF A;  1BRA A;  3CX5 D;  6LPR A;  1GBA A;  3TGU G;  4X2V A;  4UB8 E;  2LNC A;  2VBC A;  4R8T B;  5DGJ A;  3MTU E;  1GGD B;  3RLY H;  1W0J D;  5CCH C;  1X7A C;  2ALP A;  2WTY A;  1FXY A;  4GAW A;  2AXT E;  3O6Q A;  5AW9 B;  1AUJ A;  4UB6 H;  1M8O B;  1H9H E;  2EA3 A;  4Y71 A;  2RKL A;  1KZU B;  1TPP A;  4PD4 E;  2Z6B D;  1WT6 A;  1NTK E;  2P7J A;  3UNQ A;  1G1I A;  2BVS H;  1SQP K;  3VB6 A;  1ACB E;  1LPK B;  4ABI A;  1TGC A;  2BQ7 B;  1FN6 A;  4M9F A;  3BRT B;  1ZGV A;  3HD7 C;  3MNC A;  1SQX E;  1ZOY C;  3GYL B;  5A09 A;  1DXW A;  3VP8 A;  4CRC A;  4AQR D;  1IZN B;  3OTJ E;  2GP9 B;  2E43 A;  5BPE A;  5JBT A;  2POH A;  1DWB H;  3SQH E;  2HG5 D;  1DD3 A;  1NKZ B;  5E2O A;  4XOJ A;  1YYC A;  3CLQ A;  5DPA A;  5L30 H;  4BTT B;  1GHV H;  2KS1 A;  1UII A;  1L4A D;  5T6D A;  5LPR A;  1L0N G;  2QV1 A;  1ZZZ A;  1SKY E;  1Z1J A;  2M3E A;  4OM9 A;  3TIU A;  3E91 A;  5KTB A;  3DSG A;  2ZIQ H;  4NZQ A;  2RCE A;  2GTB A;  3PJS K;  3QTO H;  4YO9 A;  4O3T A;  3NZI A;  4IFM A;  5E0G A;  3VB7 A;  2ANY A;  1G32 B;  1SP4 A;  3LIE A;  6GCH F;  5AFY H;  1SQV J;  3L73 D;  1G37 A;  2WPI S;  1SQQ K;  1YWU A;  5AW1 B;  3SNE A;  3A0B E;  1G36 A;  4O03 A;  5EU8 A;  2WPK S;  2ZHF H;  1KLT A;  2VWO A;  3L71 J;  3RL0 C;  3C8V A;  3CXH I;  1VQM P;  4GKG A;  1EZX C;  1KFM A;  2E74 D;  3V4W A;  1JBU H;  1EOJ A;  1DT2 A;  3A3Y B;  1TNH A;  1NYH A;  4AGK A;  3JCU H;  4E7R G;  2V35 A;  1A2C H;  4IL6 X;  3C27 B;  3B5N A;  2YMS D;  4NZL A;  1AKS B;  1ZYO A;  2UWO A;  2WSE J;  1LTO A;  4A7I B;  1Z8I B;  2R0K A;  5APT A;  1UTM A;  1Y5A T;  1QB1 A;  2FM2 A;  2A45 I;  1C1V H;  4OS4 A;  1R8E A;  8GCH F;  5DSF A;  3W95 A;  3AE3 C;  1KN7 A;  1OHH D;  2J98 B;  2G81 E;  3BEF B;  4ZXX H;  1A3E H;  1XUF A;  5GTI H;  4Y8Y A;  1AU8 A;  2PGD A;  1KB9 E;  5APY A;  4D7G A;  1GW3 A;  4OWF A;  1O3D A;  1SQR A;  1SQB D;  1OYT H;  3V3M A;  3P8C D;  1RTK A;  1S6H A;  3SZN A;  4UFD H;  3GIS B;  2IZ0 A;  3F9E A;  2WIN I;  1XVM A;  2FXM A;  3QX5 H;  2J98 A;  2PKA B;  5E0H A;  3TJN A;  1NRS H;  3L71 E;  2P3T B;  4KP0 A;  1AFQ B;  1C5X B;  3SOR A;  2IX7 C;  5FPS A;  2B5T B;  2EQN A;  1GCT C;  1XMN B;  1QVG O;  4LZ4 B;  4X2X A;  2G52 A;  2ZU3 A;  2M0B A;  1IK7 A;  1RE3 C;  1CO7 E;  1QQ4 A;  4Y28 J;  1MTU A;  1A0J A;  2BCC G;  2ZGH A;  1K9M Q;  2EI8 A;  2QG4 A;  3A7X A;  2OBQ A;  7KME H;  4MNX A;  1KIL C;  4I8G A;  3DUX H;  5HM9 A;  3FGA D;  2PGB B;  4RKJ B;  5A8X A;  1BCC J;  1HBT H;  3RM0 H;  2K1A A;  1S84 A;  3WU2 E;  3I5C A;  5FHT A;  1EKB B;  2UWL A;  2QJP B;  2Z5I A;  5CE1 A;  1KXF A;  4TT3 D;  2OC0 A;  5JB8 S;  1S9K E;  2H2Z A;  3QN7 A;  2MKV A;  1BIO A;  1NN6 A;  2QCY A;  3PRB A;  1JY2 N;  2L91 A;  2V7Q J;  1W11 U;  7GCH F;  2F3C E;  1C5Y B;  1NZQ H;  4ACB A;  2P58 A;  2Q3I A;  1TNJ A;  1LPG B;  1Y9B A;  5DJ7 A;  5PTP A;  1PPH E;  4B2C A;  3DA9 B;  3L35 A;  1G3E A;  3LC5 A;  1ELB A;  3M3T A;  3RP2 A;  4ABG A;  3A5T A;  1HXF H;  2R3S A;  1LT9 A;  3F5H A;  1LHC H;  4BXL A;  2P2U A;  5I25 A;  2OD3 B;  1URQ A;  2HOD B;  3A7O A;  1BHX F;  1RIW B;  2CV3 A;  2FIR H;  3M5M A;  3BG4 B;  2CK3 H;  2ZJS E;  3ATW A;  1YM0 A;  3RXL A;  1N7S B;  3FX0 A;  4CBO A;  3ZVC A;  1GI5 A;  2Z4E A;  2ZEC A;  2RFK C;  1J9C H;  4L76 A;  2Q1K A;  1EAW A;  1O34 A;  1TE0 A;  3A7Y A;  2VIO A;  4FUG A;  3SI4 H;  1P2O A;  2IJD 1;  1PV3 A;  3H7T A;  3GY2 A;  3URC A;  3ZV9 A;  1SVP A;  3NUM A;  4N78 D;  1WSS H;  3VGC C;  1BTX A;  1PFI A;  1PFX C;  3TGU J;  3ATL A;  3HTK B;  3RXG A;  5CMX H;  3M91 A;  1AGJ A;  1IFI A;  2LEL A;  1HIA B;  3QGN B;  2GZ8 A;  1CHO G;  1F7Z A;  1BCC E;  1YF4 A;  4TY7 A;  1GVL A;  1NU9 A;  4AYV B;  1X8Y A;  3CS0 A;  4I32 A;  1YKT A;  1C5N H;  3BTH E;  5C2Z A;  5AVD A;  3MH7 A;  2BAS A;  4P02 A;  1RGQ A;  3L73 J;  2G00 A;  4U7J A;  2ZHD A;  1L1N A;  1LHF H;  4BAK B;  1KYO I;  3CWB G;  1LPZ B;  5CHA B;  1WQS A;  5T6G A;  3M06 A;  1H9L B;  5DG6 A;  3MH4 A;  1UJ1 A;  4OS2 A;  1GPZ A;  2ZQ1 A;  1GDQ A;  2AEI H;  3V2N A;  2Y9Y A;  3RU4 T;  3Q5R A;  2ZDM A;  1XKA C;  1GMC F;  1MKM A;  3RC4 A;  2P94 A;  1VIT G;  3A8B A;  5EG4 A;  1O3F A;  1GBF A;  1E79 D;  3E6P H;  2FTM A;  3LPR A;  1MUE B;  4TWW A;  2C0W A;  4BAQ B;  5B5E H;  2QGR A;  1NAY A;  1L0N J;  3HUS A;  3KQC A;  1G3C A;  3BTE E;  3H32 B;  3S4R A;  2A7H A;  5EJZ A;  1HRT H;  1MU8 B;  5A8Y A;  1ANB A;  3TK9 A;  4EIJ A;  1FV9 A;  3UPE A;  1GBI A;  3MHV A;  1UVO A;  2FOH A;  4PV1 B;  4GOE A;  2HPQ H;  2O8T A;  4K1S A;  2AGG X;  1PP9 G;  1P57 B;  1CVW H;  2GV6 A;  4GPG A;  1T8M A;  4KGA A;  3GF7 A;  3QLP H;  5BVZ A;  1OZH A;  2AMP A;  1X79 B;  1A0L A;  1GI1 A;  1HH0 A;  5J4S A;  4Q7Y A;  3U1J B;  3G6E P;  2J4I A;  2V4H A;  3ZZ3 A;  2OUA A;  1HJ9 A;  2TPI Z;  1GHA F;  3L73 E;  2M5A A;  4CBN A;  2R2M B;  1ZW0 A;  1DX5 M;  4ABE A;  1BMM H;  2BD5 A;  3TJV A;  1IQH A;  1A3B H;  2CN0 H;  1P84 D;  4R4M A;  3HGP A;  4H4F A;  2LKM A;  1H8I H;  1YCP H;  3FXD A;  1WAY B;  1N73 C;  3GY5 A;  3MMG A;  2XOK D;  1AWH B;  1YCP M;  1MTV A;  3BTG E;  1OKX A;  1VJ9 U;  3AEC C;  3RXH A;  1NTM K;  2H5C A;  1JXP A;  5A0C A;  2XBW A;  1IOE A;  3BTD E;  2Z94 A;  5LGO A;  3S0N A;  1XUI A;  3FOA A;  1RQV A;  5BU5 A;  1OWK A;  4JZD H;  1L0N E;  3CCR P;  4AN7 A;  3A0H H;  4RKO B;  3I55 P;  2AFQ B;  2YKO A;  4IN1 A;  2HYN A;  3GCH B;  1D6W A;  2KSJ A;  4NFE A;  3S7H B;  1NTK K;  1VQO P;  2WPJ S;  1BDA A;  1ZHM A;  2TRM A;  1YQ4 C;  1YPH E;  3FP6 E;  1LTS C;  2FY8 A;  4M3L A;  3SWF A;  3BIV H;  1WV7 H;  1OVV A;  1PGJ A;  1O2Z A;  1JM0 A;  2N9Y B;  1JY2 P;  2EI6 A;  4TSF D;  4B75 A;  4WB4 A;  4EDF A;  1SFC C;  2PP6 A;  1SQX K;  1AI8 H;  1V2V T;  1O5B B;  4I8K A;  3URD A;  1CI6 B;  1SQB E;  5KKZ B;  1ELD E;  1LTA C;  3P8C E;  4ISO A;  4X0W U;  1EST A;  3ZVB A;  1GGD C;  1YJ9 P;  2ZTX A;  1O3L A;  3EFG A;  3AAU A;  5EQS A;  3MNS A;  3TK5 A;  2YIU B;  4XFJ A;  3QZQ A;  4ZUH A;  2SGF E;  1O3O A;  3FN8 A;  2XRC A;  2BCC J;  2D8W A;  3P17 H;  4GUX A;  4WXV A;  1V2T T;  2BMG B;  4P00 A;  1IQL A;  1ORF A;  1E0F D;  2BB4 A;  1PGP A;  1NU1 G;  2ODP A;  3L6P A;  4K1T A;  1T2K D;  1YPM H;  4Y0Y E;  1O30 A;  3B5N D;  2B0F A;  2FES H;  3M35 A;  4BWN A;  1Y59 T;  4X1P U;  1QVF O;  3HKI B;  5JYI A;  4D6T G;  2QA9 E;  1BRC E;  2XC5 A;  3PV5 A;  3D62 A;  2ZU5 A;  4Z1M H;  1SR5 C;  4JZE H;  3RXU A;  3S9A A;  2GX4 A;  1R5S A;  1TBR H;  2R32 A;  2BLO A;  2OIN A;  4IBL H;  4D9Q A;  1CE5 A;  2KIK A;  2UUY A;  1S5S A;  1NAF A;  1HXE H;  2ZXE B;  2BD8 A;  3SV9 A;  3P7K A;  1VQ4 P;  1ZXG A;  2V3O H;  3AW1 A;  1F92 A;  2BY6 X;  2PUX B;  4MVN A;  5KLV G;  2GD4 B;  4K8B A;  3V12 A;  3VMY A;  1J15 A;  5KGO A;  2F9B H;  1LHG H;  4OGQ D;  2RH0 A;  2ZWL H;  2BHG A;  1ZLL A;  1INC A;  2AMD A;  1TX6 A;  1SMF E;  2SGP E;  3TIT A;  1J1E C;  4WY4 A;  1FZE A;  1DWD H;  2IPQ X;  5CHB A;  4DT0 A;  4ASU D;  3AVZ A;  3RXS A;  1C2E A;  1M7L A;  1XVO A;  2BDI A;  2XWB I;  1C9T A;  3TNU A;  2M5T A;  5JDU B;  5HMA A;  2BCC E;  2HR3 A;  5T1V A;  3KHV A;  2YKQ A;  4E06 H;  3CD6 P;  4RKU J;  2K88 A;  3GDS A;  1G3B A;  1SQA A;  1TPO A;  1E1Q D;  1GJ5 H;  4D6T D;  4N78 E;  1X9V A;  1NU7 B;  3CX5 I;  5APS A;  1IK9 A;  3RXD A;  2ITA A;  1NRN H;  1TRM A;  1UTQ A;  1H4W A;  1T3U A;  2PAJ A;  2YXR B;  2ZDL A;  1HAX B;  3FAN A;  3P95 A;  1SLQ A;  1AO5 A;  5CCH A;  2M2A A;  3A8A A;  5APX A;  3GDV A;  5JB9 S;  3CCS P;  3GYM A;  1G30 B;  1G2L A;  5H4I B;  1BE3 D;  1H0T B;  1GCD A;  2EY4 C;  3I78 A;  3ATK A;  2YO2 A;  3H1H G;  3WUT A;  1ZLR A;  2ZQ2 A;  2KOG A;  3CWB J;  1P9S A;  2VGC B;  5KLV D;  2R3C A;  2NPS B;  5B66 H;  2PKS B;  3HPT B;  2G4U A;  8LPR A;  2BOK A;  5GND A;  4JYU H;  4RES B;  3MUD C;  2ZGX H;  4NIV A;  1VJA U;  1S0R A;  3SGQ E;  2XU6 A;  3HD7 A;  1AFE H;  1EAU A;  1KMI Z;  1F2S E;  1JOU B;  3SJO A;  1KXB A;  1RQU A;  2Z5H A;  2ZVO B;  1BTP A;  4CPG A;  3ZYE A;  2K9Y A;  4IC6 A;  1SHY A;  1J16 A;  2O01 N;  1IHS H;  2R0L A;  1URQ D;  5DP5 A;  2YXQ B;  3H1I D;  4NIW A;  1BGY G;  1UTN A;  1GJD B;  3UOU A;  1Y47 A;  1EZV G;  3GMA A;  3C1K A;  3KNX A;  5F8Z A;  1TLD A;  5AW6 B;  4CRF A;  1PP9 J;  2A4R A;  3LOX A;  3ZZ5 A;  1DD4 A;  3QZR A;  1AFQ C;  1MZ9 A;  1K1O A;  5C0T A;  3UR9 A;  2L5G B;  1FJK A;  1JMO H;  1KTM A;  3ZZA A;  1SGR E;  1RF0 A;  1NY2 2;  2BZA A;  2Q7C A;  2KCO A;  3M0D C;  3P6Z B;  5HIZ A;  1AHT H;  2FYU K;  2XNX A;  1EFR D;  1K28 D;  3TLO A;  3GF3 A;  4E7N A;  2D2C D;  2ZP0 H;  2HRV A;  3AE4 C;  5AVR B;  2OQU A;  4X1Q U;  3CWB E;  1O5F H;  2W3K A;  4JYT A;  2QJP C;  1IQI A;  2FFD C;  3SU5 A;  1BTH H;  1O2H A;  2FLR H;  2NU4 E;  3BEI B;  2ZFT A;  1P84 E;  3M61 U;  1LT1 A;  3MO9 A;  2ZGC A;  3BTT E;  3QWC H;  4WMD A;  3RK3 B;  1L0L G;  3MP7 B;  2BD3 A;  2PTC E;  5EOD A;  3Q5S A;  4NPD A;  3KZI H;  1OWH A;  2PGQ B;  2WSF H;  5EXM A;  2UUF B;  2J2U A;  2JO1 A;  1EZV D;  4Y0Z E;  2ZFQ H;  3S9C A;  5KAF E;  4YLU A;  1V2U T;  4B74 A;  3AK5 A;  1FS0 E;  1BSH A;  1A0H B;  3EA9 A;  3U9A H;  1DAN H;  1W2K H;  1TNI A;  2Y7Z A;  1JTH A;  3RK2 B;  2PR3 A;  2BDC A;  1RIW C;  2QM8 A;  1P2K A;  1AND A;  3BG4 C;  1PQ8 A;  1OMI A;  1N7S C;  2OAR A;  3CXH H;  5AW2 B;  4ISH H;  4MLF B;  3WW7 A;  2K9J B;  3L70 G;  2OTJ P;  2PUQ H;  2KI7 B;  1SPJ A;  1QY6 A;  2A7J A;  1D6R A;  4OS5 A;  4BAN B;  4D76 A;  3JSV C;  1SGY E;  2BLV A;  1TAW A;  4GLY A;  2IJO B;  3E1X B;  3L72 D;  1HGT H;  2QE7 H;  3SUF A;  4F4O C;  3L75 G;  3M7Q A;  4U01 A;  5DP7 A;  2NU2 E;  1KIL B;  3N7E A;  4XE4 A;  2LXB A;  1YPG H;  1SGP E;  1RS0 A;  5GTH E;  1LTT C;  2K9J A;  2H43 A;  4ZAE A;  2A45 H;  5DN6 D;  1CT0 E;  1LDT T;  1A5H A;  3BTQ E;  1L4D A;  1RY3 A;  1RE3 A;  1NU1 J;  4IW4 E;  3U1A A;  1OFC X;  1GBB A;  3LC3 A;  3ZZ6 A;  1YGC H;  5J4Q A;  3QUM P;  2AMQ A;  5CHA C;  1ARC A;  3U8R H;  4WY3 A;  5ESB A;  1HAG E;  4BAH B;  1UHB A;  2V6N A;  3RXA A;  1C2K A;  1TA6 A;  2KAI B;  1GI7 B;  4BXW A;  4D6T J;  2WMM A;  4HH2 A;  2ZDN A;  3LT3 A;  2O1J A;  3H7O A;  1ZOM A;  2WPV B;  1SGE E;  1C5S A;  2M3B A;  5C3N A;  8EST E;  3G71 P;  1BDD A;  2BXU H;  3B9F H;  3RXP A;  3LJO A;  2L6O A;  1O37 A;  4FVD A;  2OC1 A;  3LGI A;  5KLV J;  4UE7 H;  4PV1 C;  2HNT E;  3T28 A;  3ZZ9 A;  1FJS A;  3MYW A;  1ETS H;  1OYQ A;  2XC0 A;  3CPW O;  4LXB H;  1P9U A;  3VB5 A;  2W83 C;  5AVW B;  1L4Z A;  1MKX K;  1NFX A;  1C1S A;  3GY3 A;  3SQE E;  4EYY Q;  3OU0 A;  2ZTZ A;  3RMN H;  4XE5 B;  3GG2 A;  2BVR H;  1YIJ P;  5DP6 A;  3MU0 A;  4BOH A;  2OGU A;  3N99 A;  1BJU A;  3H5C B;  2FBW C;  3NRL A;  1OP8 A;  1TGN A;  3SZE A;  2FEQ H;  4ABA A;  1NU1 E;  1O2Y A;  2BD9 A;  3LW5 J;  3VMX A;  1DE7 H;  1Z6J H;  3A7W A;  3F0P A;  4RN6 A;  4W7Y A;  3V6I A;  1FI8 A;  1EZS C;  2WWW A;  1HVV A;  2FOG A;  1FDP A;  2G4T A;  1M57 D;  1W13 U;  2SGE E;  2ZCK P;  5AW0 B;  1AIX H;  4D6T E;  3SWK A;  5GCH G;  1PPG E;  1SQB K;  1DLK B;  1KB9 D;  1QQU A;  3Q3X A;  3S7K B;  3SGA E;  4AYC A;  1S85 A;  3BF6 H;  3H1H J;  4A5T S;  2J59 M;  2R5D A;  3TK1 A;  3AE2 C;  3VMA A;  2Q9I A;  1SQV D;  1FPH H;  1NS3 A;  1VF5 B;  5T6F A;  1EDL A;  1S5L H;  1KDQ A;  3GCH C;  3UR6 A;  3GHG B;  2QYI A;  3AAV A;  4Y7B A;  2FO9 A;  5KLV E;  3L71 D;  1DFP A;  1O2G H;  2P8O B;  1AD8 H;  1LVY A;  2TGD A;  4IMQ A;  2NU1 E;  2RA3 A;  4AFQ A;  1GJ9 B;  1V2P T;  1GMD G;  1V3X A;  2ZPS A;  5AW3 B;  3II6 A;  3KEE A;  1NTP A;  1AN1 E;  3VXE H;  1ZRT D;  1QBO A;  3SNB A;  2AXT H;  3GCT G;  1GL2 C;  2KB7 P;  1P02 A;  2C8Z B;  3MU5 A;  4AB8 A;  3A84 A;  3A7T A;  3U69 H;  1BGY J;  4WY4 D;  1E38 B;  2M8R A;  2A5K A;  5KKZ C;  2C8X B;  2FDA A;  4L74 A;  2BDB A;  2C9N Y;  2Y0E A;  1ZSL A;  5C67 A;  5I46 H;  1IFN A;  3AE8 C;  5KAI E;  1KYO H;  1N86 A;  1TAB E;  1NO4 A;  2YIU C;  2VNT A;  1GDN A;  5GXP A;  5GWZ A;  2XZR A;  1JWT A;  3L33 A;  1V2O T;  1YPL H;  2P59 A;  1UK3 A;  4K60 A;  1NFW A;  4XFQ A;  3EST A;  2VIW A;  1LCY A;  5FX5 A;  4XBB A;  1ETR H;  4TPI Z;  3TNS A;  3TGI E;  2GZ9 A;  3F1S B;  4ZKS U;  1Q81 Q;  1EXJ A;  3JZ1 B;  3OE7 D;  3UWI A;  3H1H E;  1LWU B;  2O01 H;  1KQS O;  5CCH D;  2JDI H;  4YTP C;  1EUF A;  2XNI A;  4NGA H;  3OJA B;  4LZ1 H;  1H88 A;  3WUU A;  4CRE A;  3SV8 A;  5EIY A;  3SHA H;  1P84 I;  4I7Z B;  1V2W T;  1YLC A;  3KN2 A;  4AOQ A;  5LPF A;  1N73 A;  1L0L J;  4UFE H;  1PZQ A;  1TBZ H;  5M1B A;  1AMH A;  1OS8 A;  4U3F G;  1CT4 E;  3HD7 D;  3FWL A;  2KP8 A;  1H9I E;  2HOB A;  1ESB A;  1AQT A;  1U7J A;  4ZHA A;  2ZHQ H;  1ELF A;  3A0B H;  2OYI B;  2TIO A;  4Y8Z A;  5F6M A;  2WZ7 A;  2Y0D A;  1WU1 A;  3SUD A;  1EZV E;  3CCQ P;  2O8L A;  2QJY C;  4RT1 A;  3VFE A;  1BCC D;  3V2R A;  2BD7 A;  5K5G B;  1QA7 A;  3H1L G;  2N1T B;  2CGA A;  3IAO A;  3L70 J;  1OW8 A;  1ELV A;  3EA8 A;  4IFD K;  2Q3E A;  1EP5 A;  1P10 A;  3H6P A;  3ITI A;  4B1T A;  2BD2 A;  5DKM A;  2V7Q D;  2YNB A;  4NIY A;  1SFC A;  3E1R A;  3L75 J;  1ZME C;  2JJ1 D;  1GMH G;  4FU8 A;  2ZT9 B;  1S0Q A;  1VQ6 P;  1DS2 E;  3PV2 A;  1EQ9 A;  1EZU C;  1FY1 A;  4WXI A;  4CH8 B;  3L72 E;  1LTG C;  3FP8 E;  3FO8 D;  1OIP A;  4K2Y A;  3EFF K;  4JCN A;  3A85 A;  2PSX A;  3MNB A;  1C5V A;  1GI2 A;  1C1P A;  2QIQ A;  3P8N A;  3RL0 D;  1PPB H;  1ZMJ A;  2AYW A;  1PPZ A;  2ZFS A;  5SGA E;  3WWB A;  2VGC C;  2Y6T A;  1K8A Q;  2XTT B;  5A8Z A;  2NPS C;  2PKS C;  2OCV B;  5EXL A;  1SGF G;  1W7G H;  2BEQ D;  1Q3X A;  5AVV B;  2H9E H;  1RH5 B;  3TGU D;  1WBG B;  2Z9L A;  2AHM E;  4HG6 A;  4WWY A;  1CQQ A;  3R2P A;  1WRG A;  3UY9 A;  2BYA X;  4JZF H;  4KTS A;  1TRN A;  3KQ5 A;  5AVT B;  1ELC A;  1FZG A;  1A5I A;  2ZA5 A;  4X8S H;  1GI0 A;  1O3C A;  1C5M D;  8KME 2;  2VVV A;  1J1E B;  4THN H;  3TSI A;  1C4U 2;  3RK3 D;  1BTY A;  2Z7F E;  3RXJ A;  1EOL A;  1Q2W A;  3D6Z A;  2KM0 A;  4GDO A;  1Y3X A;  3TJO A;  4ISL A;  1NJI Q;  1GTW A;  3WU2 H;  2QEX P;  4A92 A;  1CGJ E;  4INH A;  1CSO E;  2KZ4 A;  1A02 J;  3BN9 A;  3TGK E;  4DII H;  1BQY A;  3T29 A;  1DWC H;  3SV7 A;  1HB0 B;  2LXC B;  1SQO A;  6GCH G;  3RC6 A;  1FDI A;  5FXL A;  1UCY E;  2ODY B;  2QY0 B;  3RLW H;  1QFK H;  2CF9 H;  1L0N D;  3ZDM A;  4X6P A;  3B8J A;  3D49 H;  3A8D A;  2IBZ G;  1O3B A;  4O9V A;  1TRY A;  3GW6 A;  1AQ7 A;  1ZPB A;  2R44 A;  1J8A A;  1O2S A;  4FVB A;  2F9N A;  1KIL D;  3L4F A;  3FKS D;  4NFF A;  3T97 B;  3OX7 U;  5DO4 H;  3IF4 A;  1OPH B;  1WDI A;  3RK3 C;  5CCG C;  4K3A A;  1QHR B;  4AZ2 B;  1BZX E;  1MZD A;  4I8H A;  1V2K T;  2VH0 A;  1GL1 A;  2Y80 A;  1NOH A;  3BG8 A;  1C5L H;  1AKS A;  1VGC B;  1KFN A;  1Q2N A;  2V3M A;  4X8T H;  3O8C A;  3HE4 B;  5C1X A;  4NPF X;  5C1Y A;  3ZZC A;  1SQV E;  3RK2 C;  3LKW A;  3UFA A;  5DJU B;  3VP9 A;  3G4S P;  4OS1 A;  1OX1 A;  1PPC E;  5BU8 B;  2HGT H;  4O9B A;  1EB1 H;  2ZFC A;  8GCH G;  1S4X A;  4TYD A;  5DP4 A;  3CX5 H;  2GUS A;  1SS1 A;  1B7X B;  3PV4 A;  1THP B;  2JR8 A;  2OC8 A;  1LNQ A;  1FZC B;  1BBR E;  4YOJ A;  1ZRT E;  2TGP Z;  2GDD A;  4XA4 A;  2ZDA H;  2C3S A;  1HJB A;  2KXP B;  1GBT A;  3PTB A;  3ZYD A;  2ZPR A;  1MKW K;  1TX7 A;  1CSB A;  3K2U A;  2PKA A;  4DGJ A;  3EAJ A;  2BOH B;  4Z0K A;  1IQG A;  1FZZ A;  5CMZ A;  3SWY A;  1YHQ P;  1O2I A;  4ZHM U;  2A45 B;  1O0D H;  1LMW B;  1DPO A;  1ZTL A;  1ZR0 A;  1Y3V A;  3P8F A;  1MBM A;  1P2M A;  3A2A A;  2KCA A;  3TH4 H;  1SSX A;  2FFD B;  3ZZ8 A;  3DD2 H;  3M0D A;  2B89 A;  3T26 A;  1J14 A;  2BQW B;  1O5D H;  5DP8 A;  3UB0 A;  2GUV A;  2ZYG A;  1XTG B;  3PLP A;  3F89 A;  3LGU A;  4NA8 A;  1C2I A;  1P2I A;  1V2Q T;  4KTC A;  4BNR A;  4CHA B;  1W0K D;  1C1T A;  1Z6E A;  2P3F H;  2XYA A;  3E90 B;  3EYD A;  3KQB A;  3BAT A;  1GBL A;  4WWI A;  2ZNK H;  2SNV A;  3IR9 A;  1HAH H;  1SGC A;  4U3F J;  2HLO A;  2A31 A;  1K73 Q;  1P2J A;  2BVX H;  1P05 A;  1GU5 A;  4H13 B;  2BCC D;  3G9R A;  1AY6 H;  3JCU E;  2WPM S;  1ZTK A;  1F5K U;  1AQ5 A;  2ZF0 H;  3MH5 A;  3NK8 A;  1VQL P;  5EST E;  3CMA P;  1B5G H;  1RRK A;  4H44 B;  3EGK H;  2C93 B;  7GCH G;  4C7N B;  1V6D A;  2DUC A;  3W94 A;  1VQ8 P;  1BMN H;  3SNC A;  2ZI2 H;  1YYY 1;  1O39 A;  1W3C A;  5HIY A;  2ANK H;  3H1L J;  4XD7 D;  4Z6A H;  3TH3 H;  2F9U A;  2ZGJ A;  2HOD A;  2FS9 A;  4DOQ A;  4BAM B;  1K21 H;  1N7S A;  1UTO A;  1CHO F;  3A87 A;  3STJ A;  1JNM A;  4PD4 I;  1SQP G;  1EXI A;  4QT8 C;  1JY2 O;  4DJG A;  3SW2 B;  2E76 C;  1O2P A;  3KQE A;  1LTB C;  2WV5 A;  3CC4 P;  1N2D C;  1MTN B;  2JH0 D;  1GHB F;  2BXT H;  3IIT A;  1K04 A;  1QGK B;  3HTK A;  1OW7 A;  3O8Z A;  1MKX H;  2WSC H;  4B6F A;  5EW2 H;  7EST E;  1HIA A;  3GIC B;  4Q7Z A;  1VQ7 P;  3K6Y A;  4YES B;  4XSK U;  4ABB A;  1ZHP A;  5HYO A;  4MN4 C;  1PGQ A;  3K6Z A;  1FDM A;  1USE A;  1S2E A;  1P01 A;  1GK6 A;  3HE5 B;  1EC5 A;  2PHB A;  1M1J B;  3SN8 A;  5APW A;  1VF5 C;  1QJ1 B;  1LTJ C;  2FYN B;  2UWJ E;  3S9B A;  3GHG C;  2F83 A;  2P8O C;  2JJL A;  1OSS A;  2VWN A;  2XBV A;  1H8E D;  2AH4 X;  4FXG H;  3A7Z A;  3F3B A;  4IN2 A;  4KTU A;  3TGU E;  1HF9 A;  3H1L E;  5FAH A;  4Z1M D;  1GMC G;  1O2Q A;  4CH2 B;  1SQQ G;  1SLW B;  5G4B A;  4RO0 A;  1VCW A;  4DT7 B;  1U7M A;  1TGT A;  2Z9G A;  3H32 A;  3TNT A;  4GOD A;  1Q7Y Q;  2XC4 A;  2BDH A;  3CCM P;  2EI7 A;  3CWB D;  3RK3 E;  1XUG A;  1DXP A;  3EA7 A;  1GBD A;  3VPK A;  4TLF A;  3SU0 A;  2HPC B;  1ELA A;  1O5A B;  1G2C B;  2WT7 B;  2RA0 A;  1SI5 H;  1SFC D;  4OVN F;  5TIS E;  2NWN A;  2O8M A;  1TQ0 B;  1NTZ K;  1IC2 A;  3GY7 A;  4FET A;  1F0T A;  3SOS A;  3AEB C;  1HPG A;  1OVU A;  2JET B;  1C1W H;  1VQP P;  1Z7K A;  1QJ7 B;  4FUD A;  1QB6 A;  3TF5 A;  4TT3 H;  1U57 A;  1LWU C;  2JWD A;  1Z71 A;  3E0P B;  2K0Q A;  4UFF H;  3RBZ A;  4TWY A;  1SLV B;  1G2C A;  4TY6 A;  6EST A;  1GHA G;  1GBE A;  1JRT A;  1C2H A;  4I7Z C;  4Y99 B;  2L74 A;  2ZKS A;  5EJL A;  2C9L Y;  4B86 A;  1PP9 D;  2LR2 A;  1D4P B;  2QSI A;  4FUF A;  1S6L A;  1O2V A;  2J9N A;  4DUR A;  1HUC A;  2ZHW H;  2AS9 A;  1IQJ A;  4H6S B;  1KIL E;  2QVA A;  2GZ7 A;  1KB9 I;  1OX3 A;  2QIW A;  2Y9Z A;  2W6J D;  3CNR A;  3HAT H;  2DE8 A;  2A4Q A;  3O8D A;  1ZR2 A;  4IL6 H;  3R0F A;  2K37 A;  3OAK A;  2OYI C;  3M9H A;  1GL2 B;  2KLV A;  4Y10 E;  1O3I A;  4ISN A;  3SBK A;  2WPD D;  3PWC A;  2VID A;  2N1T C;  1LHD H;  2RG3 A;  2WSS D;  2HNT F;  2YMK A;  1VQ9 P;  3ODF A;  4BRY B;  4CRD A;  2BZ6 H;  2W26 A;  1DOJ A;  4NPE A;  4ZRO A;  1E1R D;  3RXE A;  5HXF A;  2FOE A;  1O2U A;  2BEZ F;  2OQ5 A;  2VVU A;  1AV1 A;  2ZT9 C;  2KNC B;  1AVW A;  2F9P A;  1CI6 A;  2FXR A;  4B76 A;  3ZZ7 A;  1PYT C;  4LLH A;  5AVS B;  3V4Q A;  1MAX A;  2QAA A;  3KQD A;  3PMH B;  3UQV A;  3DSO A;  1EPT C;  2IBZ E;  1WUN H;  2FYQ A;  2O8U A;  1EAS A;  2E75 B;  2JH5 D;  2GM4 A;  1SGN E;  3PMJ A;  2NU0 E;  4AC9 A;  1IQM A;  4FUH A;  3PB1 E;  4IMZ A;  5L2Y H;  3T2N A;  5F8X A;  1XTC C;  1JCC A;  2SNW A;  1ARB A;  3HK3 B;  1FOS E;  1C2G A;  1XXF A;  2HPP H;  4DY7 B;  3RXO A;  4OS7 A;  2JP3 A;  2FOA A;  3TPI Z;  1AE5 A;  2AEF A;  1Z8J B;  5EPN A;  3GS9 A;  1DEB A;  2KK7 A;  4JZI A;  4YXW D;  2XCF A;  1ZV8 A;  2KSE A;  1BMF D;  3D71 A;  3NCL A;  1ZR4 A;  3WY8 A;  1IO4 A;  2QJY B;  1NC6 A;  4ZKN U;  1HAP H;  1TIO A;  1UTJ A;  2F91 A;  2OQQ A;  4KT0 J;  5ETX A;  1T4V H;  2A45 G;  4I2L C;  3ENS B;  4UD9 H;  4ASV A;  1HBW A;  1O2K A;  3NWU A;  3GDU A;  1NU1 D;  1TWX B;  3KF2 A;  2C4F H;  1O2L A;  3DCL A;  1C2J A;  1FAV A;  3PTN A;  2WPQ A;  1GL0 E;  1O33 A;  1X0T A;  3L74 G;  1YY3 A;  1FMG A;  2BDG A;  3DFL A;  1TQ7 B;  1O3J A;  3LON A;  1K22 H;  2B88 A;  3TYY A;  3UIA A;  2Y81 A;  3ITK A;  2IN2 A;  3BSQ A;  3FXE A;  1PL5 A;  1P84 H;  3BAS A;  4ZMD A;  1SQP J;  1ZSK A;  3KL6 A;  2FKW B;  1NRO H;  1SQV K;  4M7G A;  4INK A;  1OWD A;  3VTP C;  3AE6 C;  2XND D;  3RUO A;  4Y11 E;  9EST A;  3SNA A;  2H6M A;  4IS5 A;  3TGJ E;  4Q7X A;  3MFJ A;  1O3N A;  2KZJ A;  2WZQ A;  5C20 A;  2HLC A;  1E5W A;  1C5T A;  2ZCH P;  1QBN A;  1BBR K;  1Q31 A;  1AVX A;  1HLT H;  1DUA A;  1TMU H;  2Q6F A;  1YTZ T;  1W10 U;  3NTN A;  3E3T A;  3GCO A;  2I1J A;  1NWQ A;  1H0T A;  4TPY A;  1VGC C;  1EDJ A;  4Q63 A;  2NPS A;  3B71 A;  2OYH B;  1OXG A;  2QF3 A;  1W0Y H;  2R3U A;  3A80 A;  3MHW U;  1KXC A;  4X6N A;  2QRX A;  2F43 B;  3MNX A;  1FE6 A;  5C39 A;  2UUK B;  4A1V A;  1SQQ J;  1UMA H;  5GTH H;  2OLG A;  3PH0 A;  1K1J A;  4VGC B;  1FZC C;  2EST E;  1FDO A;  4I31 A;  3B4S A;  4U2W A;  4ABD A;  3H1H D;  1FUJ A;  2SGD E;  2BM2 A;  1TGB A;  4N3Y B;  2O1K A;  1RFN A;  1BTZ A;  1WOF A;  3KID U;  4Q4L A;  1N7S D;  2K3R A;  1PGO A;  1P0S H;  1W8B H;  2DE9 A;  4JMY A;  2QA4 P;  1JO5 A;  2Z3D A;  1DLE A;  2UUJ B;  1DX7 A;  2FMJ A;  1KQG B;  3PLB A;  3BEU A;  1UK4 A;  4IGD A;  1NTM G;  1SL3 A;  2WHX A;  3SSU A;  2I6Q A;  1RE4 C;  3OA7 A;  1DSU A;  3LGY A;  5T3H A;  2A06 G;  1N8O B;  4ZKO U;  1MKW H;  3T5F H;  4ABF A;  4FU9 A;  1IQF A;  5C5N A;  1C1N A;  1ABJ H;  1MUU A;  3KYF A;  1BGY D;  4EOT A;  2VB0 A;  2A32 A;  2ODQ A;  1QL9 A;  4I86 A;  4CHA C;  1EDK A;  5CBN A;  1H8D H;  1IAU A;  1FU1 A;  2FX4 A;  4HI3 A;  1NTK G;  1L4A B;  1K1I A;  1C5O H;  1N8R Q;  3EWK A;  1F5R A;  4F49 A;  5L6N H;  1A1R A;  4K69 A;  2STA E;  5TCC A;  1VPC A;  2WPS A;  1PP9 E;  5AW8 B;  5CCG A;  1QL7 A;  3SJK A;  3C9I A;  4H13 C;  3ZVG A;  1SQX G;  1YLD A;  2B7D H;  5AFZ H;  3V7T A;  2XW9 A;  4H44 C;  1L2P A;  2QM7 A;  1LP1 B;  3NXP A;  4GT1 A;  1FY3 A;  1NH4 A;  3M9B A;  1UO6 A;  5F8T A;  1SLX B;  3WUV A;  3CEN A;  4PJ0 E;  3N7D A;  5EOK A;  3HKJ B;  2ZDK A;  1KLI H;  1O2M A;  5GJ4 B;  1O3H A;  3UIR A;  3AE9 C;  1QUR H;  5TJX A;  4A1T A;  1TMT H;  5B66 E;  1L1J A;  2G55 A;  1IFM A;  1XXD A;  1CHG A;  2N9B A;  4Y7A A;  2E74 B;  4PV1 D;  1L0L D;  3ELA H;  1Z8G A;  4MNV A;  3BRV B;  3LGT A;  1SGF A;  3KCG H;  4O3U A;  3A89 A;  4XBD A;  4I7Y H;  2WYJ A;  5LPE A;  1T31 A;  1BTW A;  1MTN C;  1DDJ A;  3BCC G;  2JIZ D;  2HFE D;  4KEL A;  1PQ5 A;  2YMS B;  1MU6 B;  4I8L A;  1KIL A;  3TU7 H;  2PW8 H;  5DJT B;  1GBH A;  4FUI A;  1V2R T;  2JKH A;  2QXI A;  5FPT A;  4YZU A;  2E5Y A;  3FP7 E;  4JF7 A;  1IHT H;  1K1N A;  4X1R U;  1Y8T A;  2FLB H;  3VMZ A;  1M1J C;  3L70 D;  1HNE E;  3E16 B;  3DHK H;  3M7U A;  2FYN C;  1HFD A;  4UDW H;  1FZA A;  4E05 H;  1Q86 Q;  5EPY A;  4FOU C;  3SU3 A;  3L75 D;  3OTP A;  3VEQ B;  1BIT A;  2ZU1 A;  1DEE G;  2KAI A;  1O2T A;  2ZFR H;  3JC2 2;  1NVO A;  2Y5H A;  1QRX A;  3A7V A;  1LTI C;  1TA2 A;  2AGE X;  5KAI H;  3SYJ A;  1SGI B;  1HGZ A;  2ZTY A;  3EQ0 H;  3U59 A;  1NBM D;  2C90 B;  4DCK A;  2SGA A;  2Z9J A;  4YOG A;  1K1L A;  2HVX A;  6CHA B;  3BCC D;  1DH3 A;  1L0N K;  5TJH A;  2ASU B;  1DIP A;  3PM3 A;  4HTC H;  3CCU P;  3H1K G;  3S1K A;  1CZQ A;  4QMA A;  1QTF A;  3RGU A;  1GHY H;  3L74 J;  3Q76 A;  1GL2 D;  2E76 B;  2ZYA A;  3D23 A;  3D6Y A;  2EC9 H;  3RXF A;  2ZEB A;  4LOY H;  2B87 B;  3N7O A;  4OS6 A;  2JET C;  2VH6 A;  2JWA A;  2VWM A;  3PMB B;  5K0H A;  4RI0 A;  4WBA A;  1TFX A;  1EAI A;  3VYI A;  1TMB H;  2H7H A;  1WTG H;  5H2F E;  1FPC H;  2OP9 A;  5K7R A;  2H9H A;  1NES E;  3RXB A;  2ZFF H;  1WTH D;  3CXH E;  5GCH F;  5C0U A;  2C8W B;  2FWW A;  2GA1 A;  3RL0 g;  1RF1 B;  5EFW B;  1O3M A;  3PLN A;  2FOD A;  2W3I A;  3F0O A;  3CCL P;  3LJJ A;  3MO3 A;  2Y7X A;  4Y99 C;  1IQN A;  3IWM A;  2R2W U;  1LTJ B;  2O8W A;  3I77 A;  1P3C A;  3MTY A;  4GOF A;  1MH0 A;  1KOR A;  1NRR H;  5L2Z H;  4MPW A;  1TPA E;  4N6J A;  1QA0 A;  1YBK A;  2DW3 A;  4UB8 H;  1GI6 A;  1A61 H;  4AG2 A;  2F4L A;  1GMD F;  3AEG C;  2ZO3 H;  3U1I B;  2GCH G;  4AOR A;  3SJ9 A;  5AVY B;  2XCN A;  5C17 A;  3ODD A;  3SV6 A;  3AED C;  2ANW A;  3GCT F;  3PRO A;  2ZU2 A;  4PD4 H;  5A0A E;  1O2N A;  3IG6 B;  3GHG A;  3BIU H;  4A1X A;  1GJ4 H;  4ZXY H;  1L2E A;  3SU1 A;  1GJC B;  2GGV B;  3L3T A;  1GBK A;  1K1M A;  5HKK D;  5DP9 A;  1J2J B;  2Z3E A;  3AEA C;  1KXD A;  4ACA A;  1W7X H;  1ETT H;  3U98 H;  2FYU G;  1QL2 A;  3Q3D A;  4ZCN A;  4DZO A;  1AZ8 A;  2FI4 E;  5JBB S;  2ZAE B;  3H1J G;  1O2O A;  1ABI H;  2XXL A;  2FI3 E;  3RMM H;  2QF0 A;  4K35 A;  4B2B A;  3LH1 A;  4B71 A;  4MNW A;  1SVF A;  1VQ5 P;  2E75 C;  4JPZ B;  1HJA C;  1W2E A;  4LC1 A;  1CGI E;  4HGC A;  1NTM J;  2J94 A;  1J17 T;  4FUE A;  3F2H A;  4GHQ A;  1VZQ H;  2SPZ A;  1BHX B;  2KUB A;  5E2P A;  1GI9 B;  3M5O A;  2V0B A;  2YMY A;  1O35 A;  2WUB A;  4FUC A;  4ZHL U;  1WXR A;  2PFE A;  2CF8 H;  2JJ2 D;  1QGF A;  1OW6 A;  1LWU A;  4CRA A;  4MPU A;  1NTK J;  2BQ6 B;  3VXF H;  1GW4 A;  1DY9 A;  3S9O A;  4BTU B;  4DJZ B;  1BGY E;  5A0B A;  1PQA A;  1ZN5 A;  3RXT A;  1QNJ A;  3ATI A;  4AFZ A;  2NPS D;  2FYU D;  1RHZ B;  1LHE H;  2Q1J A;  4YM9 A;  1ZMN A;  1F0S A;  4GCH F;  1SQX J;  4I8J A;  1C1R A;  3KXD A;  1KQL A;  1YPJ H;  2EEK A;  3MWI U;  1BSN A;  4JYB A;  3SFE C;  2FXP A;  1C2L A;  4GIF A;  1O5E H;  2B8O H;  1GI8 B;  2FOM B;  4IC5 A;  4WH6 A;  3MQK C;  2OYI A;  4UEH H;  2O01 J;  3CL3 D;  2BDY A;  3PRJ A;  1HCG A;  1K05 A;  1BML A;  1MD8 A;  2JEE A;  2GDE H;  3STI A;  1V2N T;  2Q6D A;  3P92 A;  4H0L C;  2N1T A;  1EPT B;  1EJN A;  3OEH D;  3BVH A;  7LPR A;  1Y5U T;  3QGJ A;  1SOT A;  1T7C A;  1NHL A;  1T3J A;  4U3F D;  2A06 E;  5KJ7 C;  1FY8 E;  3BCC J;  1AFO A;  1C1U H;  1OP0 A;  1NPM A;  2P95 A;  4YT7 H;  1L0L E;  2J38 A;  2Y82 A;  3MIW A;  1GVK B;  2W5E A;  1KB9 H;  1FON A;  1O3K A;  1SHH B;  1F0U A;  4DCD A;  3LGW A;  2H9T H;  2Q5U A;  2FYZ A;  2CMY A;  3HGN A;  3OY5 U;  4FU7 A;  1EPT A;  2AER H;  2Z9K A;  1FAK H;  3TVJ B;  3L73 G;  1KXA A;  1C4Y 2;  3H1L D;  1DUE A;  1QJ6 B;  5CJ0 A;  2F9V A;  1O3A A;  4WME A;  2KS1 B;  1P12 E;  1KYO E;  2VIV A;  3MZW B;  2A5A A;  2I1K A;  3V2P A;  2GCT B;  5AVQ B;  4GHT A;  3L70 E;  2ULL A;  2OYH C;  1Q82 Q;  5CCG D;  1BBR H;  2K8I A;  2Z9I A;  3RXM A;  3UNR A;  2FZZ A;  5FBI A;  4YOI A;  3MD0 A;  1DVA H;  1ZPC A;  3GOV B;  2ZXX A;  2YOL A;  3MOC A;  3L75 E;  1T8N A;  3A8C A;  4DOJ A;  2WSE H;  4I33 A;  5E79 E;  2OTV A;  4IFF A;  4VGC C;  1MFZ A;  1YJN P;  1HV7 A;  3RK2 D;  2P1J A;  3RBX A;  5HGG A;  3H1K J;  2CK3 D;  2R3Y A;  1NBM E;  1G1J A;  1ZRB A;  1DST A;  1RF0 C;  1VCQ A;  5AW5 B;  2FP7 B;  3M3S A;  1LKA A;  1UK2 A;  2ZG0 H;  2IPP A;  3BCC E;  1VQN P;  4SGB E;  1T4U H;  4GVU A;  4WJG 2;  3RM2 H;  3P70 B;  5APV A;  1DY8 A;  1O3P B;  1CA0 B; 
#chains in the Genus database with same CATH homology
 3H32 A;  3VN0 A;  2Z5H A;  3B5N B;  1JY3 P;  1RF1 A;  3VOP A;  4I6M C;  3N4X A;  1CW5 A;  2HPC B;  1G2C B;  2WT7 B;  1FZF A;  2XKM A;  1SFC D;  1URQ D;  1LTJ A;  3NXS A;  3CI9 A;  1NTZ K;  1IC2 A;  5AW6 B;  2MJZ A;  1L4A C;  1MZ9 A;  1JY3 N;  4LGD E;  5AW4 B;  1FOS F;  1LWU C;  2L5G B;  1FJK A;  3G3Z A;  1RF0 A;  2W27 A;  2Q7C A;  3T97 A;  3M0D C;  1G2C A;  3MUD A;  3U1C A;  2FYU K;  2XNX A;  4Y99 B;  2C9L Y;  4B86 A;  4C7R A;  3KYQ A;  1HUC A;  5AVR B;  3HE4 A;  2FFD C;  1GD2 E;  2YKP A;  1ZR2 A;  2OYI C;  3OAK A;  3M9H A;  3MGN A;  1GL2 B;  2KLV A;  3RK3 B;  4AUW A;  1S9K D;  3M9Q A;  2WSF H;  2W6B A;  5AW7 B;  2XDJ A;  1N73 B;  2N1T C;  5KJ7 D;  1FZC A;  1QL1 A;  2YNY A;  1H89 A;  1JTH A;  3RK2 B;  1JY3 O;  2QM8 A;  1N7S C;  2OAR A;  1CI6 A;  5AW2 B;  4LLH A;  5AVS B;  3V4Q A;  2FFD A;  1GK4 A;  4W7Z A;  4WY4 C;  3P8M C;  1RE4 A;  1IJD B;  1NU1 K;  2GM4 A;  4JYC A;  3M0A A;  1J1D C;  1KIL B;  3L37 A;  1LT9 B;  1XTC C;  1FBM A;  1JCC A;  1SFC B;  1URQ B;  1LTT C;  2H43 A;  1FOS E;  2A45 H;  1RY3 A;  3MTU E;  1RE3 A;  3U1A A;  5CCH C;  2WTY A;  1DEB A;  5AW9 B;  1ZV8 A;  1KZU B;  1ZR4 A;  1IO4 A;  5KLV K;  4C7N A;  1WT6 A;  2P7J A;  1G1I A;  1SQP K;  2A45 G;  4HH2 A;  4I2L C;  2O1J A;  1HBW A;  2M3B A;  3BRT B;  3HD7 C;  1FAV A;  2WPQ A;  2H8P D;  3VP8 A;  4AQR D;  3EQ2 A;  1VDF A;  2E43 A;  2POH A;  1RF1 C;  3TYY A;  5CHX A;  3UIA A;  2HG5 D;  1NKZ B;  3BAS A;  3CLQ A;  1YYC A;  2FKW B;  1SQV K;  2CPS A;  1L4A D;  3VTP C;  5AVW B;  5KTB A;  4XE5 B;  3HUS B;  1IFJ A;  3HE5 A;  2IFM A;  1M1J A;  4IFM A;  1E5W A;  3VMX A;  1SP4 A;  3LIE A;  1YTZ T;  3L36 A;  1GDT A;  4W7Y A;  1SQQ K;  2VRS A;  3NTN A;  5AW1 B;  2I1J A;  1HVV A;  2WWW A;  1NWQ A;  1GU4 A;  1NKN A;  5AW0 B;  3KPE A;  1SQB K;  3RL0 C;  2NPS A;  4GKG A;  4AYC A;  2OYH B;  1KFM A;  2J59 M;  2R5D A;  3V4W A;  3HRN A;  3TK1 A;  3KQG A;  3A3Y B;  2Q9I A;  2WPR A;  3KDP B;  2N1T D;  2W6A A;  3P32 A;  2IFN A;  1GZL A;  3GHG B;  3B5N A;  1FZB A;  1FZC C;  2HPC A;  2WT7 A;  5AW3 B;  3II6 A;  5APT A;  4N3Y B;  2O1K A;  1N7S D;  2A45 I;  1GL2 C;  2KB7 P;  1JO5 A;  1FJP A;  1DX7 A;  4WY4 D;  2M8R A;  5APY A;  2C9N Y;  1GW3 A;  1RE4 C;  3OA7 A;  1IFN A;  3P8C D;  1N86 A;  1NO4 A;  2XZR A;  2FXM A;  1MUU A;  1L0L K;  4EOT A;  1FU1 A;  1L4A B;  2IX7 C;  1LWU B;  2O01 H;  5CCH D;  2KYV A;  3OJA B;  1H88 A;  1RE3 C;  1VPC A;  1GL2 A;  2WPS A;  5AW8 B;  5CCG A;  2CPB A;  3C9I A;  1KIL C;  2QM7 A;  5AVZ B;  1N73 A;  4GT1 A;  1NH4 A;  3M9B A;  3I5C A;  2Z5I A;  3HD7 D;  2KP8 A;  1S9K E;  2OYI B;  2J58 A;  1JY2 N;  1IFM A;  2WZ7 A;  2N9B A;  3BRV B;  2Q3I A;  3V2R A;  2N1T B;  3L35 A;  2HFE D;  1LGH B;  4IFD K;  3H6P A;  1KIL A;  3A5T A;  1LT9 A;  4HYT B;  2P2U A;  1SFC A;  1URQ A;  1JMM A;  2HOD B;  3A7O A;  5APU A;  1N7S B;  4W80 A;  4JF7 A;  2Z4E A;  3VMZ A;  2P67 A;  1M1J C;  1LTG C;  1YTZ I;  4WY4 B;  4N78 D;  1FZA A;  1PFI A;  3HTK B;  3M91 A;  3TNU B;  1J1D B;  1IFI A;  3RL0 D;  1JCD A;  2E42 A;  1HWT C;  1X8Y A;  1LTI C;  2NPS C;  4I1L A;  1HGZ A;  1MV8 A;  3U59 A;  2BAS A;  5AVV B;  1OWA A;  1HGV A;  1WRG A;  1L0N K;  3R2P A;  1T2K C;  4OH8 B;  1DH3 A;  3B5N C;  5AVT B;  3E1I A;  1FZG A;  3M06 A;  1CZQ A;  1J1E B;  3V2N A;  3TSI A;  1GL2 D;  3RK3 D;  4C46 A;  5KJ7 A;  2C0W A;  4WBA A;  3VYI A;  2H7H A;  3HD7 B;  3HUS A;  1GTW A;  3H32 B;  2C0X A;  4EIJ A;  1RF1 B;  2WIT A;  1A02 J;  4Y99 C;  1N7L A;  1LTJ B;  1IFD A;  3V5B A;  5BVZ A;  1X79 B;  1JOC A;  1HH0 A;  4N6J A;  5APQ A;  2OYH A;  1KIL D;  3L4F A;  4ZKP A;  5AVY B;  3RK3 C;  5CCG C;  2LKM A;  3GHG A;  1EQ7 A;  1N73 C;  1NOH A;  1KFN A;  1NTM K;  1J2J B;  3HE4 B;  3RL0 B;  3RK2 C;  2R5B A;  3VP9 A;  1QL2 A;  4DZO A;  1JUN A;  5BU8 B;  4O9B A;  2ZFC A;  5BU5 A;  3PP5 A;  2YKO A;  2HYN A;  3N7N A;  1Z56 A;  1HTL C;  2GUS A;  1SVF A;  2KSJ A;  3WMM 0;  1NTK K;  1OXZ A;  1FZC B;  1W2E A;  4LC1 A;  4XA4 A;  1LTS C;  4M3L A;  3SWF A;  1HJB A;  4KHX A;  1JTH B;  1LT9 C;  1CSB A;  1JY2 P;  2YMY A;  4WB4 A;  1SFC C;  1URQ C;  2PP6 A;  1SQX K;  5CMZ A;  3SWY A;  1L4A A;  1CI6 B;  3A2A A;  1LWU A;  1LTA C;  3P8C E;  2FFD B;  5AVU B;  3M0D A;  1GW4 A;  3EFG A;  2GUV A;  1XTG B;  1ZN5 A;  2NPS D;  1H8A A;  1KQL A;  2YO3 A;  3BAT A;  4JYB A;  1T2K D;  3IR9 A;  4GIF A;  2XV5 A;  3B5N D;  2OYI A;  2HLO A;  3IFM A;  3CL3 D;  1GU5 A;  2JEE A;  1AQ5 A;  4C7N B;  2R32 A;  2N1T A;  3BVH A;  1NHL A;  1NAF A;  1T3J A;  2ZXE B;  5KJ7 C;  1AFO A;  3P7K A;  2HOD A;  3MIW A;  3HUS C;  3NFQ A;  3VMY A;  1N7S A;  2Q5U A;  2FYZ A;  3LW5 H;  1JNM A;  1ZLL A;  3NMD A;  1J1E C;  1JY2 O;  4WY4 A;  1FZE A;  1LTB C;  1N2D C;  5CJ0 A;  3HTK A;  3O8Z A;  1M7L A;  2WSC H;  3TNU A;  2I1K A;  3V2P A;  2YKQ A;  1A02 F;  5AVQ B;  2OYH C;  5CCG D;  1FDM A;  4N78 E;  1X9V A;  1GK6 A;  3HE5 B;  5APS A;  1IK9 A;  1M1J B;  3MD0 A;  3LID A;  1T3U A;  2PAJ A;  5APW A;  1LTJ C;  1SLQ A;  5AVX B;  4DOJ A;  5CCH A;  5APX A;  3GHG C;  2WSE H;  4IFF A;  1MFZ A;  2JJL A;  1T8Z A;  3RK2 D;  2P1J A;  2YO2 A;  2KOG A;  3B8E B;  5CJ4 A;  3V2Q A;  2R3C A;  1G1J A;  2NPS B;  1RF0 C;  5AW5 B;  2IPP A;  4RES B;  5APV A;  2XU6 A;  3HD7 A;  4ZKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...