2PP6A

Crystal structure of the atp-binding sugar transporter-like protein from salmonella typhimurium
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
88
Chain Sequence
SNAMADLFDGMKRRMDALIAERFGMKVNINGTDCIVVESDFLAGKNVVVFSGNVIPRRGDRVVLRGSEFTVTRIRRFNGKPQLTLEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Gifsy-2 prophage ATP-binding sugar transporter-like protein
publication title Crystal structure of the ATP-binding sugar transporter-like protein from Salmonella typhimurium.
rcsb
source organism Salmonella typhimurium lt2
total genus 18
structure length 88
sequence length 96
ec nomenclature
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13856 Gifsy-2 ATP-binding sugar transporter from pro-phage
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2pp6A01
2.40.10.210 Mainly Beta Beta Barrel Thrombin, subunit H Phage tail proteins (gpFII-like) 2pp6A02
1SFCD 3TSIA 3RK2B 2N1TB 2NPSB 5KJ7C 5CCGC 1N7SD 1URQB 4WY4B 3RK3D 3HD7B 2N1TC 3RL0D 2NPSC 1SFCB 1URQA 3B5NA 1URQC 3B5NC 4WY4C 2HFED 3M0DC 2YMYA 3KYQA 1N7SB 1KILD 3HD7C 1SFCC 3RK3B 1XTGB 3RL0B 5KJ7A 5CCGA 2KOGA 1N7SC 3RK3C 1KILB 3RK2C 2N1TA 2NPSA 5CCHD 3RL0C 4W7ZA 2XDJA 3PP5A 4WY4A 4JF7A 1KILC 1T3JA 1JTHB 3HTKB 3HD7A 1SFCA 4W80A 1N7SA 2M8RA 1L4AD 3P8CE 2H8PD 3B5ND 1HVVA 2HG5D 1GL2D 1KILA 3VOPA 1L4AB 4N78E 5KJ7D 5CCGD 3B5NB 1JTHA 3RK2D 4LGDE 1GL2B 1L4AA 1L4AC 2N1TD 2NPSD 1NHLA 5CCHA 1URQD 5CCHC 4WY4D 4OH8B 2WZ7A 2PP6A 1GL2A 1GL2C 4W7YA 3HD7D
chains in the Genus database with same CATH superfamily
1GW3A 2PGDA 1IK9A 5APSA 3BCCJ 1TABE 2W8ZA 4IS5A 3RXRA 1WRGA 1V2TT 2V3OH 3M06A 3A8CA 4Y99B 3OW2O 4HGCA 1LWUA 1L0LG 1NRQH 3RXBA 1ZMNA 2QSIA 5KAFE 1G3DA 1O31A 1GI1A 2IBZI 1RS0A 1BTXA 1K22H 2QJPC 1HAXB 3G4SP 1VCQA 1BITA 3ATLA 1L0NJ 5AVQB 2BMGB 3ENSB 3T28A 2ZYDA 1DWDH 1GI4A 2N1TC 2SGQE 5DJTB 1KZUB 1HTLC 2FI5E 4AFUA 3M5MA 3PMAB 3STIA 1Z1JA 2Y0EA 2JWDA 1KLJH 1NFYA 1NZQH 3ITIA 1Z8GA 1WDIA 3PWCA 1ELFA 2CPSA 2BX4A 1EZQA 2GT7A 3LGUA 3VB6A 1O2QA 2QG4A 1UMAH 3V6IA 2E76B 2ZP0H 3NPSA 4ZKRU 5KLIC 1KXBA 1K1IA 3LKWA 3M9HA 3AASA 2QF4A 1O3NA 1W0ZU 2QF0A 4Z0KA 2VWOA 1SGNE 1KTTB 1G9IE 4UFGH 3UUZA 4TPIZ 1ESAA 1UTKA 1C1PA 1VQ7P 4BAOB 1CGIE 1GBFA 4KT0J 2FYNC 3MHVA 4FUBA 3EA8A 3RP2A 2QJYC 2K9YA 2GCTB 3RC4A 3A0HE 1ARBA 1CHOF 1S5SA 5APWA 3PO1C 3CCEP 3S9AA 1H8AA 3UNSA 1ZV8A 2KX4A 5IK2D 4WJG2 1MZ9A 1QIXB 2J98A 4E7NA 1SQQE 1YWUA 3SU5A 3H1HD 2ZU4A 1PFIA 1MTNC 4P02A 4ZKNU 1FAVA 1SFCA 3KYFA 5L6NH 1O2XA 3OJAB 2G3AA 3HK3B 1ZXGA 2Z9JA 3FP8E 1HAGE 4A7IB 5ESTE 1WV7H 2R44A 1CZQA 2WV9A 5EQSA 1GBMA 4W80A 1BSNA 2YNYA 3TH2H 1C2GA 1TX8A 1ZRKA 3SV2H 5HM9A 2Q6FA 1L4AD 2C93B 3P8MC 1NTMK 1RY3A 1BGYD 1V2MT 3BIVH 5CMZA 1ZTJA 2CN0H 1TNLA 2JKHA 1OHHD 1UTQA 3A8BA 2POHA 1E0FD 1HJ9A 1LTJA 2O8LA 1AVYA 2W6JD 4TY7A 5EJ1A 1Z6EA 1D4PB 1UIIA 2SGFE 3SUEA 1TU3F 1QL2A 4ABEA 1BBRK 1JB0J 5IYTA 1QBNA 2FFDB 2JP3A 3IAOA 1EDIA 2BCCJ 1WQSA 2ZFRH 3BN9A 1QY6A 1SGYE 2GMTB 1GBDA 5C3NA 1THRH 1YJ9P 1IOEA 5DJUB 2WZQA 1ZJDA 3TIUA 2FKWB 5DP3A 1X8YA 2BDBA 1GHBF 2QE7D 3BF6H 4Y7AA 1RQUA 1ZW0A 4EIJA 2OGUA 2J5UA 2P1JA 1GD2E 3CWBD 2K88A 1NU1D 1C5YB 2H7HA 1ZSJA 4YPCA 1BIOA 1QA7A 1G2CA 1QB9A 3F1SB 3GISB 4BXSA 1S3JA 2PKSC 1P05A 3HD7D 4GOFA 1MQ6A 1C5QA 2P59A 1HAYB 4AFZA 3RK2B 3HE4A 3EE0B 3TK9A 1TGSZ 2AXTE 1BCCG 2A06E 5DN6D 4PD4D 3NZIA 5C2ZA 1XKBC 2BLOA 5EJLA 2ZIQH 3CCVP 4JK6A 4Z1MD 1PP9G 1F5RA 3CCMP 3QWCH 5K5GB 1PPJG 2ZDKA 2RA3A 1KB9H 3Q5RA 1K1LA 3T26A 1PZQA 2E74C 5AW6B 4B1TA 1HLTH 1EXIA 3E1XB 4FOUC 1V2UT 1WU1A 5JBCS 3B5NC 4M9FA 4OS2A 3AVZA 2YMYA 2I6SA 3EAJA 4D76A 2ODYB 4BAKB 4H42U 5HXFA 2SGEE 1N2DC 4RESB 1BDAA 4I33A 3ZVFA 3ZYDA 1O32A 3CMAP 5C1UA 5B6OA 3UQVA 1EASA 1L0LK 4ABDA 3RL0g 3SGAE 2Z4EA 1P2QA 1Y5AT 1AKSB 1B5GH 1GDQA 1NO4A 1GBKA 4NA7A 3OE7D 3RXHA 3MUDA 2JETC 5GDSH 2A31A 4IMQA 1KORA 1N8RQ 4I8JA 1GJ6A 4O97A 1QGKB 3VXEH 1HIAA 2FY8A 1EDLA 3SNCA 2YMSD 2NPSA 4WMFA 1NTKJ 3CL3D 3PLKA 1BZXE 4I8KA 3OAKA 1QA0A 2V3HH 3FANA 1NU7B 3GW6A 4KTUA 1SQVJ 2A06D 4JPZB 1DT2A 3BTDE 3Q3XA 1SQQK 2ZYGA 1V2JT 4AYVB 1C5LH 4I32A 1HAPH 3RXIA 4IW4E 1A0HB 3FZDA 4X2WA 1G32B 1Q3XA 3LGTA 1O2NA 4LK4A 1FBMA 1TQ7B 3L35A 1MV8A 1K05A 4OVNF 5C5NA 1MKXK 5GTIE 1ACBE 2PKAA 1Y59T 1IQHA 3RXKA 2E74D 4R0IA 1YCPK 1PGOA 3DUXH 1P03A 2ASUB 4VGCB 1PQ8A 3B5ND 3C27B 3VG8A 2QA4P 1RJXB 2ZFPH 3Q3KA 4I8GA 5DP5A 3ZYEA 3PRJA 5FBIA 5KLVJ 1ANBA 2JO1A 2HYNA 3L74D 4FU7A 1H8ED 4WXVA 3L70J 1ZRTD 1Q2WA 1OWAA 5H2FE 1K1JA 1O5GH 1SGEE 1UVOA 1IQMA 2FXMA 2SNVA 1FY8E 1AA0A 4CRCA 3U9AH 3KHUA 1YTZT 1LP1B 5ESBA 4WMDA 3UWIA 2PUXB 3I77A 1F0RA 5CBOA 2FFDA 2VVUA 1TB6H 3A84A 1IQGA 5DGJA 1V2NT 4WY4D 3QTVH 3STJA 4TY6A 4GUXA 1P09A 5JBBS 3N7NA 3L72J 1CT0E 2A2QH 1IC2A 1XVMA 2OC0A 2YKOA 3SJ9A 1PIXA 1V2PT 2QXHA 1K2I1 3TSIA 2W6AA 4O9BA 1C2FA 1SHHB 3RXMA 2OQUA 1YPHC 4X2XA 1VGCB 2H5CA 1AVOA 3HE5A 3CP7A 1FIZA 1LVBA 1NAYA 2QXGA 1ZRBA 2AGEX 1LWUC 2G00A 3RXPA 5C0TA 3SOSA 1KMHB 2JJ2D 2P93A 5JB8S 3A8AA 5A0CA 1GL1A 4AFSA 4U3FJ 3UREA 2GZ7A 1CI6A 2PTNA 3E3TA 1G2LA 4PD4H 1SQPJ 3W68A 1CHGA 1C1MA 4MVNA 2NRGA 2GA1A 3D71A 7GCHG 4UB6H 1GJ9B 1EPTB 2FMJA 1A1RA 1NWQA 4D6TG 2P10A 1LHDH 1OW7A 1O2WA 1IK7A 2ODPA 3V5BA 1TPAE 3KN2A 3TNSA 1NT1A 2WV5A 5AW3B 4IOIH 3RK3B 5AVRB 2VVVA 4FU9A 3V2QA 3ZVCA 1Q7YQ 1AI8H 1V2WT 1IHTH 1DM4B 2ZPRA 1S2EA 1ANEA 1J1DB 3K9XB 4I7YH 3L75J 3WUTA 1F0UA 2IBZG 2FYRA 1J17T 1BE3J 2GJGA 4ISNA 4X6PA 3U1CA 1W8BH 2ZJSE 1CQQA 2RA0A 2BEZF 1UCYH 2GP9B 3H1JE 1SQBE 1LPKB 2ZGBH 1AKSA 1M1JA 5AW8B 3ATMA 1QHRB 2J58A 4RT1A 1IQLA 1C5ZB 1HBTH 2WINI 2KAIA 6CHAB 1EX3A 1OP0A 4K1TA 4HH2A 1JCCA 3QN7A 3OEHD 1GGDB 2WPQA 1N73A 1ZR4A 1BTYA 1DLKB 1XMNB 4ZNCA 2BY7X 3RXOA 1HB0B 3RC6A 1GI6A 3FXDA 1HGTH 1GBCA 1NC6A 4I1LA 2FXPA 3QWOC 5KECA 3U8RH 4A1TA 4XFQA 5HIZA 2EI6A 3ZZ6A 4EYYQ 2D2CB 1EXJA 1ELGA 4YXDC 1OVVA 1QR3E 4D9RA 2HPQH 4PV1C 3LW5J 1ZR2A 3W67A 1GL2D 1EDJA 1TBZH 2AEMA 1VF5C 2BD5A 3AE6C 2OYIA 1GDTA 1TOMH 1UVSH 1SQXD 1GJBB 1KILA 4ACBA 2D26C 3E1RA 3BTHE 2BDCA 1GK6A 3CS7A 2GCHG 3TGUD 3EA7A 5AF9H 3FKSD 1YYY1 5K0HA 3H1JD 1P2OA 2BEQD 1SQBD 1RF1B 1NFWA 1JBUH 2WPDD 3K6ZA 2V3MA 4H6SB 1GHAF 1PFXC 2BCCG 1KYOE 1TGCA 4GCHF 4BWNA 4O9VA 1W3CA 1NHLA 3BRVB 3RMMH 5EW2H 4ISIH 2B0FA 1FI8A 3BCCD 5TCAA 5LPFA 4RN6A 1EATA 1LTTC 2A5AA 2BOHB 3CXHI 1C9PA 2M3BA 2LKMA 3CCSP 1GG6B 2DE9A 2WPMS 1SFCD 3CC4P 1PPGE 1ZTLA 8ESTE 2O8TA 1Q81Q 5E0JA 3NKKA 2STBE 1L0ND 2V4HA 4BRYB 4FUEA 1YF4A 4ZCNA 1BMAA 1ZSKA 3RLWH 5A2MH 4R8TB 3U69H 1UTLM 1EC5A 3A5TA 2HPCB 2YNAA 2PTCE 3UR6A 1OW6A 5EJZA 3FP6E 3KQBA 1O39A 1HPGA 4Y99C 2UWJE 2C8WB 2R3YA 1XKAC 1S6LA 1LGHB 3GLMA 2FP7B 3GYLB 1AUTC 1AWFH 1Y3XA 1L0LJ 1NTPA 1QEXA 1IQFA 5B6LA 3RUOA 3FO8D 2FLBH 1KY9A 3KCGH 1RRKA 2WPVB 4HB1A 2TGPZ 1EPTA 1KYOD 3CCUP 3MNBA 2UUYA 1O2OA 1EZUC 3SJKA 5GXPA 1AN1E 3RXEA 1TMBH 2GUSA 4NPFX 5EFWB 1SHYA 1UK4A 2E76C 2YKQA 4H0LC 3M3SA 1SGQE 2Y0CA 1JIRA 2N1TA 1G3CA 2CHAB 2H43A 3GY3A 1W0JD 7KMEH 3L73G 1SQBK 3F9FA 4W7ZA 1PQ7A 2CXVA 4MQAA 1CBWB 2FBWC 2VIQA 1TX7A 2M0BA 2KP8A 1IQJA 1VDFA 1C5RA 4X8TH 1SQRA 2GCTC 3MD0A 3E8LA 1GU5A 2OQ5A 5JYIA 3IF4A 2QF5A 2GX4A 2HVXA 2ZGHA 3F6UH 3RU4T 3A7XA 3MU0A 3SN8A 2J4IA 2F9UA 1NH4A 2N9YB 2WPSA 3H1KG 3LIEA 2D8WA 5FBEA 1C5XB 3TJNA 1MQ5A 1NOHA 1T8MA 3P8FA 1UVPA 1LPGB 1YLCA 1P11E 5GCHF 3M3VA 3ELAH 1EOJA 4F4OC 2VH6A 6GCHG 1KQSO 4SGBE 2RKLA 5AVZB 1C1VH 1S84A 2BX3A 1IAUA 4X1RU 1L1JA 2BVSH 1OX3A 2ZECA 5EW1H 2F43B 1NFXA 3A88A 3VOPA 3D70A 1BRCE 3KF2A 1T2KD 2R2MB 2E75B 2O8UA 1KXDA 1O2UA 4RKUJ 4FUCA 1OSSA 2M2AA 1YPMH 1VJAU 3VP9A 4H0LD 1RH5B 3ZDMA 1AB9B 2NZ2A 4J1YA 1S83A 4HYTB 1FAKH 2NPSD 2FFDC 3URDA 2LP6A 5AW0B 1JMOH 1UTJA 1C1WH 1A2CH 1PL5A 4DG4A 1FE6A 1NTKE 2KS1B 1XTCC 3A2AA 1XUGA 4LC1A 2GMTC 2ODQA 4X1QU 4WXIA 1TWXB 3RU4E 4TT3H 1FZEA 2YXQB 3ZZ5A 3OTPA 2PP6A 1MD7A 3AE1C 1JY2N 3UWJH 4ABAA 4ZMDA 3VPKA 4F55A 3SU2A 4UONA 1S9KE 1FDMA 1VQKP 3E0NB 1NTZE 3TF5A 1JRSA 1GI2A 1RE4A 3QZRA 5AFYH 4X2YA 5HGGA 2TGDA 4JZEH 1GJ8B 1C1RA 1V2VT 1SGDE 3NFQA 3VTPC 2BXUH 1KXCA 4UE7H 2R9PA 3AEEC 1C2EA 1TA6A 1M7LA 1MKMA 4YM9A 3RL0D 3D49H 5EGMA 2P8OB 5APYA 2Z7FE 4I2LC 5HYOA 4BANB 4BXWA 2AIQA 1Y8TA 1CGHA 1SQOA 1QX8A 1O2HA 1HXEH 5AVVB 5CHBA 2ZF0H 3BVHA 1BCCJ 2R3SA 1G30B 1K8AQ 1S6FA 2BYAX 3U1IB 2EEKA 1O2GH 3O6QA 1PP9J 1YIJP 3L70E 2ZPSA 1YBKA 1V2ST 2AFQB 4HI3A 2Q9IA 4OGQD 1LT9A 1GCTB 2EI7A 1LHFH 4XSKU 3H32A 2KOGA 3ODFA 1P06A 3PMJA 1NTKD 3IWMA 4FXGH 3SFDC 1SGRE 3H1IG 2EY4C 3NTNA 2V7QJ 2CF8H 3LIWA 3W94A 1LQDB 1M56D 1GBLA 3DA9B 2XOKD 1SQVD 4C46A 4Y28J 5BRRE 2MJZA 3PP5A 3MO9A 4Z6AH 3LH1A 2Z9LA 1GBBA 3T27A 3RMNH 2GZ9A 4A92A 1S0RA 5KAIH 1MTVA 3MH4A 3M37A 3IITA 2H89C 1W7GH 4UDWH 3A82A 3D65E 3O8BA 3A87A 1FY3A 1ZMLA 2SGAA 3TDKA 3PV2A 3WW7A 2BLVA 2LELA 1OW8A 1MTUA 2P94A 3H1LE 4CPGA 1G36A 1RXPA 4YZUA 1NPMA 4TSFD 3RMOH 3LGYA 1T3UA 2KCYA 3P92A 5LPRA 1W13U 3URCA 1SGPE 4ASWA 2M8RA 4E7RG 1ZHMA 2A4OA 3N7DA 1WYKA 1CT4E 1NTMG 2ZCHP 2V6NA 4LZ1H 2CPBA 4C7NB 1O2ZA 5KLVD 1PYTC 3CD6P 1FN6A 1O5BB 1UW7A 4DGJA 2XNDH 2XKMA 3L70D 1V2RT 4Y8XA 1YPLH 3T97A 1SP4A 2OYIC 1QRXA 5JBTA 3SI3H 1H8HD 4VGCC 4DJZB 5AVTB 1OWHA 1Z7KA 1HYLA 1FY5A 3CCRP 1KILE 2M5AB 5B5EE 2DUCA 4NWLA 1QBOA 1TNJA 3F2FA 2B87B 3U8OH 2WVRA 2KIKA 2L5GB 2QEXP 1GI7B 2C8XB 2XC4A 4B74A 2IFMA 1ETRH 2XW9A 2OLGA 3MO6A 3IFMA 4Y0ZE 3R3GB 3L72D 3K5BA 2W3IA 2HNTE 2PFXA 5HMAA 4NZQA 3VYIA 1ELAA 3BEFB 3H1LD 4MDSA 1H88A 1XUJA 1UK2A 2Q6GA 1YCPM 1IFPA 3BTFE 1DWEH 3ZZ7A 3Q3YA 1EZVE 1C2LA 1W0KD 1NTZK 5F53A 3RGUA 2Q5UA 4GKGA 3SUFA 5PTPA 5C20A 2ANKH 3D23A 2A45G 1SQPD 2IX7C 4UFDH 4RT0A 3UB0A 2L91A 1OKXA 2ZKSA 2V35A 4UD9H 3MO3A 4AB9A 1BB0B 1VGCC 3DSPA 1O2JA 2O3JA 3L71E 3V3MA 2K1QA 1EKBB 4XA4A 2Y9ZA 1PYTD 4AZ2B 3PRDA 1FY4A 2H88C 3LU9B 4LXBH 4Q7YA 2H9HA 1V2QT 2BOKA 1OPHB 3W1EA 1QL9A 4WVPE 4ABBA 3M0DC 3VMXA 4EOTA 1FUJA 1KILD 2SPZA 2AIPA 2Z9GA 2ZT9D 2IZ1A 2A2XH 1OVRA 4GODA 4BTIB 2G55A 2QA9E 1QRZA 1BE3D 4INHA 1KB9D 1AE5A 1P3EA 1SLXB 2QC2A 4B76A 3H1HE 3ATKA 1EPTC 1VCPA 1GI9B 3AW1A 1KYNA 4IN1A 1D3DB 2UWOA 3PRBA 4Q2KA 3RK3C 2QIWA 2HALA 1MKWK 3SJIA 5H4IB 3PROA 2YO3A 3RLYH 1OWDA 1O3IA 4QMAA 4Q7ZA 1FONA 1DITH 1J1DC 2FX6A 2NU1E 4D6TJ 2HRVA 2ZQ2A 1U7MA 3LGIA 3GF7A 1A4WH 3M7QA 1WOFA 4YXWH 1Z8RA 2ZXXA 2I1KA 2HVYB 1EZVD 2D1JA 1BGYE 1GL0E 2H9EH 3QO6A 1P2MA 1SQQG 4GIFA 3F9GA 4MPWA 1OWJA 4H13C 3L33A 3E90B 7LPRA 4AGJA 5E79H 1SLQA 3L71D 1BMNH 1E38B 2AEIH 3Q2YA 2KSEA 3AEFC 3G9RA 1DY9A 1O2TA 2BZ6H 2ULLA 3PLPA 1O34A 1DLEA 3EE7A 3ATIA 2BDAA 3B8JA 4NG9H 3P8CE 2F9BH 1GGDC 1K1NA 3NK8A 3QK1A 2ZU1A 5HIYA 1JXPA 1SBWA 4LZ4B 2A4RA 1GW4A 5TJHA 2OCVB 3SNEA 3AE4C 5GIBA 4NIVA 1WSSH 1DEEG 3VEQB 3CWBE 1NU1E 2D2CC 1MZDA 4C7NA 2QV1A 3LONA 4O03A 3SO3A 4KTCA 3EFFK 1FDOA 2ZFFH 3ZZ9A 3DD2H 1AIXH 1BHXB 1O3BA 1TGTA 4DZOA 4H44B 1K9OE 1QBVH 2PR3A 5DP6A 1AZZA 1O35A 3RXUA 1AJYA 2N1TD 4PD4E 4R4LA 1Y8AA 2M5AA 4ABIA 1H9LB 4CH2B 3F0OA 4UFEH 4UB6E 3GG2A 1RF1C 1CO7E 1NRRH 3BATA 3ATWA 2PAJA 4I8HA 3CS0A 5M1BA 4XOJA 1S5LH 1HAIH 2G81E 3MOCA 1F5KU 1SI5H 3MH5A 5LGOA 4B86A 3TJVA 3ZIAD 1EXFA 4H13D 4LLHA 1IJDB 5T3HA 1RE4C 3P8CD 2OBQA 1PGJA 3AEAC 1YY3A 3TJOA 3KPEA 4IFMA 1URQB 3BG4B 1GG6C 4L76A 4MG3A 3GY2A 3MU8A 3JCUH 2W7SA 2ZHDA 1G3BA 1UCYE 5EODA 4MNXA 1P2KA 2BVRH 4YLQH 2QN5T 3KL6A 4FVBA 2IPHA 4X6OA 2FX4A 1TYNA 2DE8A 1C1OA 1H8DH 3SNAA 1A0LA 1M1KQ 4THNH 5A8XA 2R32A 5CHAB 3UQOA 1HGZA 1N7SB 1DEBA 2DW3A 1OFCX 4K69A 1QLED 1UHBB 1WUNH 1BMLA 2OUAA 3BTME 3D6YA 5FHTA 5DPAA 1SGFG 1YITP 1LT9C 2E42A 1FJSA 2M3EA 2GD4B 4CRAA 4OWFA 1X0TA 1C1TA 3F3BA 1X22A 1KIGH 3BRTB 1EQ7A 1AY6H 5APUA 8KME2 4CRDA 2A7CA 3A7ZA 1GBIA 1P3CA 2A5IA 3MNCA 1HAVB 1T31A 2GTBA 2ZDVH 3PMHB 5AW9B 1OMIA 1J14A 1Y3YA 2ZPQA 5FX6A 3AE2C 3ZVGA 3TGIE 5SGAE 1SQTA 3OEED 1O2PA 4DY7B 2NU3E 2EA3A 2Y5FA 1UVTH 4LOYH 2Z94A 1FXYA 3PV5A 5E2OA 4ZKSU 1JOCA 1L2PA 1BRBE 1NAFA 1CBWC 3PHLA 3ZZ3A 3L4FA 1LKBA 1QZ8A 1VQNP 1VKYA 3L74E 3UNQA 5DO4H 1ZRTE 2K1AA 3L73J 3GYMA 1QTFA 3O8ZA 1YI2P 3HKIB 3UNRA 2OTKE 3PTZA 2BXTH 4L74A 1P2NA 2EC9H 1VCWA 5C0UA 1BT7A 2FLRH 2SNWA 3VB3A 1N8OB 2G5NA 4MPXA 1AQ5A 2ZDAH 4JYTA 1SLVB 3LW5H 3OTJE 1BBRH 3JZ1B 1MD8A 1BCCE 1ZOYC 3RBXA 2K3RA 5CE1A 3E16B 3ZZ4A 1VQ9P 1NU1K 2QXJA 3H1KJ 2CGAA 4JYVH 3L37A 1V6DA 1J1EB 1GMHG 2GCHF 3F9HA 1HAOH 4BNRA 1HWTC 1O3DA 3RXFA 5EPNA 1P12E 1GBJA 3SU4A 1W10U 3BV9B 1SOZA 1C5UA 1DIPA 2R3CA 1D3TB 3Q76A 2QYIA 4OS1A 2WSCH 4Q80A 2O1JA 1O3CA 3RXLA 3T2NA 1AUJA 2XZRA 1A46H 2HWLB 1EP6A 1SGTA 4IFDK 3JZ2B 1AB9C 3FN8A 3Q5SA 2Y5HA 1ETSH 3MNXA 1RD3B 2CK3D 3F2GA 1QQUA 5GTHH 4YESB 1DD3A 1Z1IA 1VQLP 1OOKB 5AW5B 3MIWA 2BM2A 1DFPA 1TIOA 5GNDA 3WUUA 2QY0B 1QVFO 4XBCA 3ODDA 3G71P 4B2CA 1O3EA 1LVMA 4RJTA 3HUSB 1E5WA 3BTKE 4ZH8A 1UCYK 3SWYA 2QCYA 4D7FA 1BCCD 5EXMA 6LPRA 2Q6DA 3CENA 1URQA 3CXHH 1DVAH 1GBTA 3CX5I 1BDDA 2TPIZ 2HFED 3QDZB 5EU8A 1L0ZA 1CGJE 4XRNA 4AYYB 1AQTA 3P70B 2AEFA 1AVXA 2ILNA 1H0TB 2C9LY 2JR8A 1O2YA 2P8OC 4C7RA 2GUVA 3F89A 2FIRH 2QXIA 2VIPA 1CA8B 3LDXH 1DXWA 2Z5HA 2V7QD 3N7EA 3RXCA 1C4Y2 1YPHE 3FFGA 4GVUA 3AW0A 2VU8E 3AE8C 3KGPA 1Q2NA 3MU1A 1FJKA 4MNWA 5AVWB 4K3AA 1DANH 2FOFA 2FYUE 1A0JA 1GI0A 1YPKH 3K2UA 1A7SA 3NXPA 3VMYA 5F03A 3WU2H 1GCTC 1QRWA 4RKJB 4ZKOU 1SOTA 2H1UA 3P6ZB 1SQBG 1CW5A 2ANYA 1J15A 3PLBA 4RSPA 3ZZDA 4DOQA 3FWNA 3RXDA 3AE5C 3JC22 5AW1B 1PQAA 2KYVA 1MBQA 1JTHB 1AV1A 2NWNA 3MU4A 2J97A 2JKVA 2BDYA 4NPEA 5BU5A 1SFIA 5AW2B 3M9BA 4DJGA 1GWAA 3H1IJ 5APQA 4DT4A 3PM3A 4YLUA 1YHQP 3GHGB 1SQXE 1BQYA 2LR2A 1YCPH 3A81A 3USSA 2Q6QA 1ZN5A 1YBWA 3MHWU 1FN8A 3II6A 1S6HA 3SBKA 2A45B 1NY22 4FUDA 3TGUE 4FUFA 1TAWA 2JIZD 1B0EA 2WPJS 3AE9C 1ELVA 2KCAA 1GHYH 6GCHF 2FOMB 1BJVA 1FOSF 3F68H 3G01A 4K1EA 2FOBA 2JDIH 2VRSA 3BASA 2XRCA 2QJPB 4NA9H 1DY8A 4CBNA 1OWIA 2GVFA 4NFFA 3I78A 5FAHA 1O3HA 1OX1A 1L4AB 1IFJA 4X6MA 3BCCE 1LTGC 1IQEA 1ZTKA 3FAOA 3TJUA 1F0SA 2FYUD 4XFJA 1KQLA 3VN0A 4OGYA 3RM2H 1JY2P 1LO6A 3LJOA 1GCDA 1NTMJ 1C9TA 1O3PB 2GKVE 1NVOA 1O38A 1TPPA 1MU8B 3MMGA 1EAUA 1PPZA 1DDJA 1L0NE 1OYQA 1T7CA 1SB1H 8LPRA 3TYYA 3CCLP 1QL7A 4WBAA 4E06H 4ZHLU 4N3YB 3UIAA 1K1MA 1W5CE 4HJGH 5APVA 4OH8B 1LTIC 2HR3A 1DS2E 4K35A 1QJ6B 4GOEA 1SMFE 5A8ZA 1MFZA 3WUVA 1C5NH 2FYQA 4WH6A 4ASUD 4BOHA 2A4QA 3MU5A 1TRNA 4P00A 1KDQB 3SQHE 2F9PA 5T1VA 3CC7P 4CH8B 1P0SH 2WPIS 4XE4A 4AFQA 4ZMAH 2WSEJ 4UB8H 1LHEH 1O5FH 3SU3A 1KQFB 1D6WA 2A45I 2CK3H 1GJ7B 3B9FH 2ZGJA 4JZ1A 4TT3D 1MTNB 2Z9IA 2CJIA 2H6MA 4PJ0E 3RMLH 2O9QA 4CREA 3P8GA 1ELBA 2ITAA 2WSCJ 3HD7B 1ZPZA 1JY2O 3H7TA 2PFEA 4JZDH 1W2KH 1OS8A 3MZWB 1LP1A 3A7YA 3BEIB 4MN4C 5KAIE 2Q7CA 1AFQB 1TQ0B 4CHAB 3SORA 2ZZUH 2FOAA 3DCLA 2J34A 4F49A 1S4XA 1YPEH 2GZ8A 2G51A 2XC5A 2W3KA 2ZGCA 3H6PA 4U30A 1P84D 2GT8A 1J8AA 1LCYA 5DJ7A 3GICB 4IL6H 1UTPA 2VIWA 3TPIZ 1JUNA 1H8IH 1O3AA 2FOHA 2A0QB 2J9NA 3M5OA 4NZLA 1VQPP 5IDKA 3EFGA 4D6TD 2PGBB 3MFJA 4FVDA 5A09A 1EUFA 2Y82A 4TYDA 4DVAU 2V7QH 3SWKA 2FYUK 4PV1D 3EWKA 1SS1A 3UTUH 1JM0A 3KZIH 1KD1Q 1GI3A 3LC3A 2XDJA 2ZQ1A 2EQNA 4AOQA 3O8RA 2R0KA 1VF5D 2IBZD 2W27A 1EB2A 3M0DA 1EZSC 1ZZZA 2GDEH 4Y6DA 1KTSB 2BLWA 1ANDA 1V3XA 3TH4H 1YP9A 4RKOB 3SJOA 3WY8A 2Z9KA 3BTEE 1J2JB 2HODB 3G3ZA 1VITG 2BD3A 2YMSB 1Y3VA 3KQEA 2BCCE 5GWZA 3PV4A 4JYBA 2OTJP 4CRFA 1DWBH 4D9QA 1SC8U 1ZLLA 1OWEA 2PKSB 1SQXK 2VGCB 4X0WU 3PYHA 1N6YA 1O3OA 1HRTH 2HOBA 1OP8A 4JBZA 1U7JA 3HGNA 5J4SA 2H8PD 3PWBA 4PD4I 1OVUA 1RFNA 1YJWP 1SQQJ 2K9JB 1IQKA 2BZAA 5L2YH 1BJUA 3L6PA 3GY4A 3OU0A 3UY9A 2WQYC 1A5HA 1HF9A 4NIYA 2FTMA 2W90A 2LNCA 3P17H 2E74B 1O36A 2F83A 1ABIH 4NA8A 3I29A 1FZBA 5E0GA 2RDEA 1ELEE 2ZTZA 2BTCE 1FDIA 4IL6X 1SLWB 3B5NB 1G1JA 1PPHE 2FO9A 1RIWB 3PTBA 4IBLH 4KELA 1YLNA 2IPQX 1KLIH 1BMMH 1F5LA 2FM2A 2HLOA 1A61H 1ARCA 2XNDD 3QH9A 1L4AA 3E0PB 1UO6A 2QJKB 1ESTA 1ANCA 5APTA 1VR1H 2JWAA 1L0NK 2VIDA 1O0DH 1FDPA 2OTVA 1FU1A 2KXPB 2TBSA 4H44C 1E79D 1ZSLA 2EI8A 1O2KA 4KP0A 1P9UA 2BCCD 2TRMA 2BASA 5J4QA 2FOCA 1KN7A 2C4FH 7ESTE 2KLUA 3CC2P 2W26A 1W2BO 3V4QA 1UVUH 2BD4A 8GCHG 1NTZG 5CCGC 1HUTH 5FPSA 1Z8IB 2KNCB 4WY4B 1ZHRA 2M5TA 3SHCH 1DUEA 1ID5H 5FX5A 2E76D 1F7ZA 4QT8C 2THFB 2FPZA 1O3LA 5BU8B 1M90Q 1FAXA 1GMCG 2ZFSA 2BQ7B 5AVYB 5CMXH 4KTSA 3GOVB 2P67A 2UUJB 1URQC 1RF1A 4BAQB 2Y7ZA 4X1NU 3NRLA 1AZ8A 3SNBA 1LTBC 1SQVE 1NROH 3RXAA 3KIDU 1KFNA 1FX0B 2BD2A 2OD3B 5C1YA 4AX9H 3A8DA 1C1UH 1FY1A 3RM0H 3P8NA 2CMYA 3UIRA 1LHGH 3TH3H 5AW4B 4ISLA 5E79E 3SU6A 1SGCA 5TISH 2ALVA 1FZGA 1KC8Q 5CHAC 1N7SC 1G37A 1O30A 1P2JA 2IOTA 3DSOA 3A85A 3CI9A 1FOSE 1V2KT 1D7MA 2BD7A 3U59A 3HGPA 2R2WU 2RH0A 3KXDA 1P84H 3RK2C 4BAHB 3G6EP 1M57D 5ETXA 3MGNA 4BRYA 2AGGX 2W83C 1O3MA 2BDIA 2B7DH 2KCOA 1FPCH 1TMUH 2HPCA 1ZJKA 3S0NA 4AB8A 3LJJA 5EOKA 2F3CE 1MU6B 1TNIA 5KLVE 3VB7A 2KSJA 1EAXA 1GJCB 3VMZA 1XX9A 1AVWA 2FS9A 1OYTH 4I7ZB 3N99A 1RGQA 1H9HE 2HPPH 2FZZA 2E5TA 1GHXH 2WYGA 1T6AA 3C8VA 3V0XA 3R2PA 1C1SA 2FWWA 3H1LG 1D6RA 4WMEA 4YXWD 4KJMA 2RDLA 2Z3EA 4OS6A 1C5PA 2V0BA 4X8VH 1FPHH 2Q3IA 1L4DA 1DWCH 2HG5D 3A3YB 1LWUB 2C8ZB 3V2RA 5C39A 5AHGH 3O8CA 2W5EA 4XBDA 1M9UA 4K3JA 1VQ8P 2Z3DA 3L72E 3EA9A 3TVJB 1ZOMA 2XCNA 3MQKC 1XM1A 5G4BA 4HKZH 3KEEA 2WWWA 1PPEE 5FCRA 2K9JA 1N8OC 1T32A 3MP7B 1EP5A 2FESH 2D2DA 4IFFA 2A32A 2IJD1 3NMDA 3KNXA 4JMYA 2E5YA 2WYJA 1TA2A 2WPHS 3JCUE 1NRNH 3RK2D 4M7GA 1GL2B 1C5OH 2XU6A 2BHGA 1M8OB 4U3FE 1C2DA 2Z5IA 1ETTH 1UTMA 2P7JA 1GTWA 3HPTB 3LGVA 2PWXA 1SQPE 3PTNA 1SSXA 1SGFA 1OP2A 3V2PA 2B5TB 1C4U2 2WPRA 1EAIA 3O8DA 2J95A 2JH5D 3SV7A 1W2EA 4GDOA 3MTUE 2UWPA 1NYHA 1LNQA 2RCEA 5JPMH 1YQ4C 1A3EH 1YLDA 3M5NA 4A1XA 1E79H 5KJ7C 5AVDA 3EQ2A 2YKPA 1EZVG 4NWKA 1MAXA 3GY5A 1SVPA 4KHXA 3L75E 3TLOA 1HJAB 1PJPA 1JMBA 1BE3E 2AMPA 1KB9E 1HBWA 1R5SA 3I55P 1N1LA 4WWIA 1NO9H 1Z71A 3LH3A 3SZEA 4EDFA 3WWFA 1SFCB 1YJNP 1LPZB 4B75A 5KTBA 1DD4A 4HTCH 1O2MA 2KNCA 3L71G 1OXGA 3KQ5A 1NTKK 1WT6A 1O2RA 1MTSA 1TGBA 2PLXA 5T6GA 3KYQA 3V2NA 3HUSC 1THSH 1QL8A 1X7AC 2OC8A 5T6DA 1SQVK 1JWTA 1YTZI 3ZVEA 2KS1A 1P2IA 2AH4X 3SZNA 4YOGA 1BUIA 3PMBB 4ABJA 1HDTH 1MCTA 4DIHH 4U3FD 1HJBA 1LT1A 1LTJB 3M7TA 1BRUP 1GJ4H 3H1HG 2PSXA 2GM4A 1EFRD 2AERH 3L3TA 1K1PA 2WHXA 1BMFD 1IFDA 4INKA 1QURH 5FL7D 2XWBI 9ESTA 1YPJH 4JYCA 4MLFB 5I46H 2VWMA 2C8YB 2H2ZA 5E8EH 2BY5X 2VINA 3R4YA 1WTGH 2ZCLP 3SUDA 1TBQH 3H1ID 4X1PU 1VITH 3GCTG 3CPWO 4IC5A 4JYUH 4ISHH 3KHVA 3L75D 4XE5B 1BGYG 2J94A 2ZCKP 3GCHB 2XBVA 2C0WA 5KLVK 2Y0DA 3MI4A 5T6FA 1KXEA 1VPCA 1FMGA 1HFDA 1DX7A 2YMKA 3TU7H 4Y11E 1HJ8A 1YKTA 1EJMA 1G2CB 1VZQH 1CVWH 2UUFB 4FUIA 5AVXB 2QGRA 1QL1A 3N4XA 3KDPB 1O3JA 1SQBJ 1ELCA 1USEA 1AE8H 1W0YH 5A0BA 3HE4B 1E1QD 4AQRD 3RK3E 3GHGC 3VGCB 4FU8A 4A5TS 3SI4H 1NU9A 2KFWA 2TGTA 4K60A 5GTHE 4OS7A 3M61U 1O5CB 1FNIA 1NTMD 3E6PH 1U6QA 4TPYA 3VB5A 3CWBG 1NU1G 3S9BA 1P10A 3F2HA 3TNTA 3M0AA 1GPZA 2XTTB 2PSYA 1GMHF 5GPIB 1ZLRA 4HG6A 1O2SA 1IO4A 3FVFB 3FX0A 2YOLA 1L4AC 6CHAC 1IZNB 1O2LA 1Q90D 2Z6BD 3HATH 3A7TA 5CHXA 3D62A 2XXLA 1W11U 3C1LA 3CXHE 2B9BA 1KYOI 1VQMP 1N86A 1Q86Q 2OYHB 4GPGA 2PRRA 1SQPK 3D6ZA 3SV6A 4F48B 1GL2A 1IFNA 4W7YA 4HZHA 2LXBA 1GBEA 1TE0A 2K37A 1L0LE 1C2KA 1AFEH 4H0LB 1LDTT 4UFFH 4K8YA 1HIAB 2ZHWH 4ZXXH 3NUMA 2NPSB 2BY9X 3GS9A 4B2BA 1SPJA 2BB4A 5FPTA 1QVGO 3MYWA 2TIOA 1FC2C 2ZYAA 3UAIC 5DP7A 1GHVH 1TOCB 2ZU5A 4OS4A 4I6MC 4DCKA 3RK3D 4K1SA 3WMM0 1JY3N 4MPVA 1C5TA 5C1XA 4OGXA 1SGIB 2R0LA 2VVCA 3WU2E 3ITKA 3BSQA 2B87A 1XUIA 3B71A 2FI4E 4GT1A 3MH6A 2ZWLH 3OFND 2PKAB 3FOAA 3HD7C 1EOLA 1JNMA 3PLNA 3PH0A 3ESTA 3M3TA 1LHCH 4B6FA 1GI5A 2HLDD 3A89A 1LKAA 3RL0B 2ESTE 4ZKPA 1GHWH 3MNSA 1EZXC 1AQ7A 2O8WA 5DKMA 4CR5A 1SVFA 3VB4A 1AFQC 1IHSH 1MTWA 4U2WA 4Y7BA 1MKWH 3CXHD 2AHME 4PROA 2A06G 1EJAA 4CHAC 1GZLA 1E35B 1N6XA 1K0HA 2BDGA 1YQ3C 3B8EB 2JH6D 3RBZA 3QGNB 2O01H 3CX5H 1BTPA 3DFLA 1D3PB 1L0LD 5B66H 3PB1E 4OGQB 1BTZA 2K0QA 2XYAA 3CLQA 7GCHF 1NJIQ 2ZTXA 1C5WB 2D2CD 1GI8B 2NU4E 1DICA 1MBMA 1FZFA 2P95A 4GHQA 2IZ0A 2W6BA 4ZHMU 1DPOA 4JZFH 4YTAA 2WV4A 2GV7A 1TLDA 2F4LA 5TCCA 3HK6B 3K65B 3NCLA 1K28D 3H5CB 4NIXA 4L73A 3SWFA 1TGNA 3IN6A 1T8ZA 3GDUA 1G3EA 1SQQD 2H9TH 2R3UA 4Y71A 2CV3A 3RC5A 3L74G 2SFAA 4ZXYH 2OXSA 1A3BH 2YMSC 1LVYA 3HE5B 4IN2A 2VIOA 1A5GH 4U7JA 1C2JA 1WTHD 1XXFA 3F5HA 4OM9A 1E34B 3MH7A 2UUKB 2VGCC 1DUAA 4MTBA 4N6JA 1S5LX 5K7RA 2HGTH 1LTAC 2P3UB 5L30H 1T4UH 1CI6B 4BXLA 1TNGA 1WBGB 2CHAC 2AMQA 3S69A 3AAUA 5EQRA 1CSOE 5EXNA 2WSSH 1J9CH 4UB8E 5EIYA 3DT0H 5B5EH 1X79B 4Q4LA 1C5SA 1GMDG 1NESE 3C9IA 2B88A 1AO5A 1ESBA 1XXDA 1IFMA 1RHZB 2JDID 3OAAD 3V7TA 3UFAA 4YOJA 5JDUB 2FODA 4UEHH 5CCHA 1F0TA 2ALPA 2L74A 5DP8A 1RIWC 2A4GA 3LC5A 2QVAA 3M7UA 4JK5A 4EI2A 3Q5PA 2AS9A 2ZO3H 1T8NA 2QJKC 3WWBA 2OTLP 2KZJA 4XD7D 1D3QB 3M36A 1DX5M 1ZYOA 4X2VA 2WUCA 2OQQA 2J59M 3SFEC 2OYHA 1KMIZ 1PP9E 4IL6E 2OINA 4AC9A 2OC7A 1PPJE 1KTMA 5E2PA 3HRNA 2IJOB 3BIUH 4I31A 3M91A 1M1JB 2KLVA 2WSEH 2ZU2A 5CBNA 3P8OA 3F9EA 1T8LA 1O33A 2RMZA 2KAIB 3A0BH 5HKKD 2E75C 3KZIE 1N73B 1H89A 2G52A 1THPB 1IQIA 2ZI2H 4WY4C 5KKZB 1NGMB 2FI3E 2KZIA 3AE7C 1PQ5A 1FJPA 2BD8A 2YNBA 1CA0B 1Z56A 1NTZJ 1P01A 1DSTA 2E43A 1ELTA 1JIMA 3T25A 2K8IA 1EJNA 2VH0A 4Q63A 2A45H 1TMTH 1A5IA 2YXRB 3PJSK 2PHBA 1HAZB 2YIUB 5CCGA 4MNYA 1EAWA 1UK3A 5KAFH 4A7PA 1ZMJA 3OX7U 1C2MA 3VFEA 4Y76A 2OYIB 2ANMH 1KILB 3TNUB 1CHOG 3RXGA 2I1JA 1KQGB 2ZT9B 1WCZA 2KCPA 1FIWA 4KKDA 2BQWB 1Y5UT 9LPRA 5DP4A 2FYUG 5EXLA 1K04A 1PP9D 1VQ4P 2W6ID 1PPJD 3SHAH 4ZUHA 2KUBA 3P32A 3HTKB 3BG8A 3U1JB 3A7OA 1ZP0C 3U1AA 3JSVC 2VWLA 2W6JH 1DSUA 1ZMEC 1MFTA 2ZDLA 1A02J 1L2EA 5C94A 1VITF 1BHXF 2ZFTA 3SV9A 1N7SA 1O3GA 5DSFA 1B0FA 3SGBE 3I5CA 5DP9A 4ZROA 1EDKA 1SQXG 1UHBA 3DFJA 2O01J 3AE3C 2E75D 1EB1H 4XBBA 3GMAA 4A1VA 4I7ZC 2C90B 2ZEBA 2P16A 2ZC9H 2KZ4A 3A0HH 2WTYA 2XBWA 2JJLA 3TGUG 3ABVC 1JEKA 1J16A 1MABB 2QE7H 3H1JG 3V4WA 2F9NA 4Y79A 5F8TA 3AEDC 3U8TH 5CDFE 4B2AA 3OA7A 1RF0A 3LIDA 5C17A 1SG8B 4ASVA 2G8TA 1HAVA 1DOJA 1KFMA 1L4ZA 3H1LJ 4MNVA 1HJ0A 4N78E 4Y8ZA 1S72P 4B73A 2NU2E 3SU0A 1W12U 3BCCG 1MKXH 4IGDA 1NKZB 1T4VH 4AGKA 1GHBG 1KSNA 2OP9A 1FZCB 4B71A 3Q3DA 4YOIA 3RXVA 3VXFH 2AYWA 1G2MA 2F9OA 1KB9I 4Z1MH 1COWD 1S85A 3EYDA 1L0NG 1S0QA 2L6OA 5EQQA 5JBAS 3QTOH 2GGVB 4Y10E 2WZ7A 4L75A 4K8BA 3BTWE 5AFZH 2WMMA 1GL2C 1WXRA 1C5MD 3H7OA 4HFPB 1C2HA 1MUUA 1OIPA 1BTHH 3RXQA 1YPGH 2SGPE 2N1TB 2FS8A 1VQOP 5TISE 1Y3WA 3ZV8A 2FOEA 4Y0YE 4OS5A 2IFNA 1EZVI 1C1QA 2GV6A 8GCHF 1H4WA 3AECC 1C2IA 4WH8A 1AMHA 1E37B 1MAYA 3E91A 1P84E 4RO0A 1TALA 1GMCF 1JOUB 2FOGA 3Q1MA 3IG6B 5KLIB 2Y80A 1Y5BT 4H13B 4CRBA 5L2ZH 2ZA5A 4D6TE 3EGKH 1PPCE 3KQDA 1HGVA 1GMJA 4FUJA 1HJAC 2PV9B 4FUGA 2R5BA 4N78D 5APXA 4J2YB 3EQ0H 2WUBA 2ZNKH 2Q1KA 3DSGA 4AG1A 5JB9S 1VQ5P 2SGDE 1SFCC 1ELDE 1R5LA 2FYNB 4NSVA 1AU8A 4WWYA 4WB4A 4ESTE 2QJYB 1XTGB 2IBZE 1BA8B 2BY8X 1HNEE 2AXTH 2XC0A 3PO1B 2VJ1A 5KJ7A 1ABJH 1JCDA 2AXCA 1TNHA 1FZAA 3F0PA 2VIVA 3S7KB 1D9IA 1MH0A 2ZVOB 1HV7A 1P02A 1MMJN 2ZVNB 4ZAEA 3L71J 1INCA 3E1IA 1Z6JH 3SW2B 5LPEA 2G5VA 2P58A 1RE3A 1A02F 2LXCB 3A80A 4B6EA 1WAYB 3BTQE 1SLUB 1LTJC 1NRPH 3FP7E 3NWUA 2O8MA 1B7XB 3TNUA 2BLQA 3HUSA 2F91A 1TFXA 1T3JA 1KXFA 2A7JA 2ZG0H 2Y81A 1NBME 3H1HJ 1Q82Q 1GVZA 3ZVDA 1X9VA 2LPRA 2OARA 4WF8A 3FZZA 2AGIX 4DOJA 1T8OA 2XBYA 1C1NA 2P3TB 3HTKA 3DHKH 4DURA 3T29A 1SR5C 1GBAA 1O5AB 4X8SH 1H0TA 2WSFH 2ZAEB 5FXLA 3TK6A 3GCHC 1BDCA 1GJAB 4GAWA 4U32A 1HVVA 3N7OA 2TGAA 3V12A 3AEGC 4YT6H 1UJ1A 1BGYJ 1TRYA 2P3FH 1NFUA 3UOUA 1WMKA 2ZHFH 1MUEB 1TPOA 3CCQP 1W14U 1NS3A 2WT7B 3AAVA 3VGCC 4AYCA 2ZTYA 3TGKE 1Y9BA 2JJ1D 2P2UA 2IYOA 2KI7B 1MZAA 2H5DA 4RI0A 3AK5A 3SJ8A 1LJ2A 1DH3A 1V2OT 1JTHA 5GTIH 4LGDE 1O2VA 2A1DB 4I8LA 4KGAA 4ZKUA 5CJ4A 1ZPBA 1ZGVA 1BOQA 3VP8A 1OXZA 4GLYA 3O6QB 3U98H 1G1IA 1V2LT 5CCHC 3GHGA 1ZHPA 4JCNA 1LT9B 1AVGH 1NBMD 4A6LA 1FZCA 2WITA 2Y5GA 3TGJE 3S7HB 3H32B 4GSOA 3CWBJ 2G8YA 1NU1J 2HNTF 1QJ7B 3LOXA 2YO2A 2G4TA 5CJ0A 1FV9A 5H2FH 1T2KC 2FTLE 1U57A 2G4UA 2OYHC 3OY6U 2VNTA 2C0XA 4K2YA 3FGAD 1P8VC 4MPUA 4NSYA 3MUDC 1TRMA 2XCFA 5KGOA 3CCJP 4R4MA 4SGAE 3ZZ8A 4ISOA 2Y6TA 2NPSC 1Y47A 5EPYA 5A0AE 5AVUB 2A5KA 2BD9A 2BDHA 5FPYA 2Q3EA 2XNXA 1E36B 1TNKA 2ZXEB 1IQNA 5DK1A 1NTKG 2MKVA 2JETB 1S81A 2QRXA 2C9NY 1QFKH 2VBCA 3HKJB 2I8DA 2Y9YA 4AN7A 1GBHA 1SQVG 2FXRA 4NGAH 3P7KA 2ZDNA 3R0FA 3GY7A 3AEBC 1F92A 2FEQH 2PGQB 1FS0E 5A8YA 3B23B 1VL2A 2J92A 1YM0A 1NRSH 3CMEP 3UR9A 3T97B 4BTUB 3L73E 1L1NA 1QB6A 1N7LA 1UIXA 1KDQA 2ZFQH 5CCHD 2KK7A 3RL0C 2QM7A 1PPBH 1W7XH 4Q7XA 2XWAA 1AD8H 1GJ5H 1UTNA 4NPDA 1O5DH 3BG4C 1NM6A 2B89A 3T5FH 1BTWA 3T62A 1GVLA 1K1OA 3HD7A 1LQEA 3GY6A 1KXAA 2ZHQH 3SGQE 1HXFH 3GCTF 4XDEA 3SQEE 3C1KA 1YC0A 2QM8A 1P57B 5KLVG 3GCNA 2J38A 3H1KE 1HUCA 4OGQC 1LTOA 1YYCA 3M9QA 2GDDA 2RG3A 1MCVA 3FXEA 5E0HA 3L70G 1AHTH 4Y8YA 3RXSA 3ZV9A 3B4SA 2A7HA 2NU0E 4FETA 3S9OA 2B9LA 1LMWB 1LVOA 5GJ4B 1QJ1B 2ZDMA 3SYJA 1USDA 1H9IE 2BY6X 1TX6A 3H25A 2RN0A 4ABGA 5BVZA 2HLCA 4H44D 3GDSA 4M3LA 3UOPA 3QLPH 3CNRA 4CR9A 3ZVAA 2JH0D 1ZR0A 2IPPA 3QX5H 1RF0C 1FZZA 3KQGA 1CE5A 4DT0A 2QF3A 4NIWA 3GF3A 1JRTA 4U01A 1GJDB 3TK5A 3L72G 1FLEE 2ANWA 3H09A 2J2UA 5DG6A 5CCGD 1FQ3A 3L73D 2KM0A 1HH0A 1OZHA 3L74J 1O3KA 1SQAA 4ZHAA 1GHAG 3P95A 1K73Q 1EQ9A 4E05H 3SUGA 2I6QA 1BRAA 2WSFJ 3A7WA 4GCHG 2IYPA 1RTFB 5LH8A 1BCUH 1HAHH 2FDAA 2ZFCA 2FYZA 2WT7A 5AW7B 4O3TA 3NXSA 2HODA 4K5ZA 2O1KA 1RTKA 1URQD 1RTLA 2UWLA 4U3FG 1QQ4A 2AEJA 3OYPA 5C67A 1ZPCA 4DW2U 1F2SE 1QCPA 1VJ9U 2O01N 4JQ0D 3TK1A 1JY3P 1S5LE 1SQPG 2VB0A 3KYGA 2BVXH 1K21H 1O3FA 1SL3A 3H1KD 2OC1A 3OY5U 3QUMP 5C5OA 3A7VA 1VQ6P 2QIQA 3BTGE 1XUFA 5AVSB 4TLFA 3S4RA 3LT3A 1IFIA 4TWYA 1P04A 1N7SD 2IN2A 4GHTA 4YO9A 3K6YA 4IMZA 4YT7H 3RU4D 4X6NA 1XUKA 4DT7B 1O37A 4PJ0H 4ABHA 3L75G 1KYOH 5I25A 3QZQA 3CX5E 1QB1A 2AMDA 1H1BA 2KR7A 2VWNA 1BE3G 1K9MQ 4H6TA 4X8UH 1S9KD 5B66E 5BPEA 1NTZD 3B5NA 3FWLA 3M35A 1J1EC 1M1JC 2C3SA 4IC6A 1HCGA 3SU1A 1KLTA 4WVZA 4TWWA 1QGFA 3Q00A 4BTTB 3EDXB 2KB7P 1GVKB 3UPEA 4D7GA 3U28C 3E7KA 1BTUA 4FUHA 3VMAA 2CF9H 1N73C 1GHZA 3IR9A 2PUQH 1JMMA 2ZU3A 1O2IA 4O3UA 3TITA 5KEDA 1JY3O 5KKZC 3H1IE 1TBRH 4H4FA 3A86A 1AGJA 4DIIH 3MTYA 1CA0C 5TJXA 2J98B 3SV8A 3GDVA 3I56P 5F6MA 2OYOA 1NKNA 2N9BA 1RQVA 1P9SA 2XV5A 1RE3C 1L1GA 1Q31A 2YIUC 4NFEA 3OSYA 4WY4A 3ZZAA 4INLA 1UTOA 3ZZCA 4JF7A 4X1SU 1GK4A 2OBOA 3QGJA 1KILC 1ZGIA 1LTSC 2ZT9C 2FXOA 2JEEA 1E1RD 1OWKA 4JZIA 3BTTE 2Q1JA 4ACAA 4AG2A 4D8NA 5ABWA 1PGPA 5HM2A 2WPKS 2F9VA 1PV3A 1S1CX 3SSUA 1DXPA 4PV1B 3CX5D 1YGCH 1DE7H 1Z8JB 2PW8H 3Q77A 5F8ZA 2XNIA 1SFQB 1GU4A 3LGWA 1NTME 1VF5B 2FYUJ 4ABFA 4BAMB 5GCHG 2HNTC 5EG4A 1XUHA 2ZHEH 3RXJA 1AFOA 4WY3A 2OK5A 1CU1A 2IDBA 3GCOA 3MWIU 2B8OH 2BQ6B 3S9CA 2QAAA 1BSHA 2ZGXH 4YTPC 3V13A 1BBRE 3KQCA 2STAE 4AORA 4I86A 1CT2E 2WPLS 3LPRA 1QNJA 2XBXA 1C4V2 2W7UA 1PPFE 5KJ7D 1GDUA 5F8XA 1SQXJ 2Y7XA 3BEUA 2Z3CA 2RFKC 3L36A 3SNDA 1WQVH 1TPSA 1ORFA 5FCKA 1NN6A 1S82A 1SKYE 3TGUJ 4NCYA 1GMDF 1AWHB 1PGQA 1XVOA 3A83A 1CSBA 1JO5A 3H1JJ 5L8RJ 4ASHA 3A0BE 3RDZA 6ESTA 3W95A 1TONA 3ZZBA 1GDNA 2R5DA 1R8EA 1P84I 3S1KA 1C5VA 1O5EH 3ZVBA 4DCDA 3GY8A 4CRGA 3RXTA 1KV4A 2WSSD 1FZCC 3M5LA 4CBOA 1Y3UA 4AUWA
chains in the Genus database with same CATH topology
1MFZA 1GW3A 1IK9A 5APSA 1S9KE 1FDMA 1WRGA 1RE4A 2J59M 3M06A 2OYHA 4Y99B 1LWUA 3HRNA 3M91A 1M1JB 2KLVA 2WSEH 2A45I 3NFQA 3VTPC 5AVQB 1M7LA 3HD7B 2N1TC 3RL0D 1JY2O 1KZUB 1HTLC 5APYA 1N73B 1H89A 4I2LC 4WY4C 5AVVB 3BVHA 2CPSA 2Q7CA 1FJPA 1Z56A 2E43A 3H6PA 3M9HA 2Q9IA 2A45H 1LT9A 1JUNA 5CCGA 3H32A 2KOGA 3EFGA 2OYIB 3NTNA 1KILB 3TNUB 2I1JA 2FYUK 5APWA 4C46A 1H8AA 1ZV8A 1MZ9A 2XDJA 2MJZA 3PP5A 2W27A 3M0DA 1PFIA 3P32A 3HTKB 3A7OA 3U1AA 1FAVA 1SFCA 1J2JB 2HODB 3G3ZA 3OJAB 1A02J 4JYBA 1T3UA 1CZQA 4W80A 1N7SA 1ZLLA 2YNYA 3I5CA 1SQXK 2M8RA 1L4AD 3P8MC 1NTMK 1RY3A 5CMZA 2H8PD 2CPBA 4C7NB 2WTYA 2JJLA 2POHA 1LTJA 2XKMA 3V4WA 3OA7A 1RF0A 3LIDA 1SP4A 3T97A 2OYIC 1QL2A 5AVTB 2FFDB 1KFMA 4N78E 1FZBA 3B5NB 1G1JA 1NKZB 2FKWB 2HLOA 2L5GB 1X8YA 1FZCB 1L4AA 2IFMA 3IFMA 4EIJA 2P1JA 1GD2E 5APTA 1L0NK 2H7HA 1FU1A 1G2CA 2WZ7A 1GL2C 3VYIA 3HD7D 1H88A 2BASA 1MUUA 3RK2B 3HE4A 2N1TB 3V4QA 1NTZK 2Q5UA 4GKGA 5CCGC 2IFNA 2A45G 4WY4B 2IX7C 5BU8B 5AW6B 5AVYB 4XA4A 2P67A 1URQC 1RF1A 3B5NC 1HGVA 3M0DC 2YMYA 2R5BA 4N78D 1LTBC 5APXA 1KILD 3VMXA 4EOTA 1KFNA 1SFCC 1N2DC 4RESB 4WB4A 1XTGB 1L0LK 5AW4B 5KJ7A 1FZGA 1JCDA 2Z4EA 1FZAA 1NO4A 1N7SC 3MUDA 3CI9A 1FOSE 3RK3C 3U59A 3E1IA 3RK2C 2YO3A 1RE3A 1A02F 2NPSA 1J1DC 3CL3D 3MGNA 3OAKA 1LTJC 2I1KA 2HPCA 3TNUA 3HUSA 1SQQK 1T3JA 4GIFA 2KSJA 3VMZA 1X9VA 2OARA 1SLQA 1FBMA 3L35A 1MV8A 4DOJA 3R2PA 3HTKA 3P8CE 2WSFH 3B5ND 2Q3IA 1HVVA 2HG5D 3A3YB 1LWUB 1GW4A 3V2RA 2HYNA 4C7NA 1OWAA 2WWWA 2WT7B 2FXMA 4AYCA 2P2UA 4IFFA 3NMDA 1YTZT 4DZOA 1DH3A 1JTHA 3RK2D 4LGDE 1GL2B 2XU6A 2FFDA 4ZKUA 5CJ4A 2N1TD 2Z5IA 3VP8A 1OXZA 2P7JA 1GTWA 1G1IA 5CCHC 1RF1C 3GHGA 4WY4D 3BATA 1LT9B 2PAJA 1FZCA 2WITA 3V2PA 3N7NA 3H32B 2WPRA 1IC2A 2YKOA 4B86A 1W2EA 3TSIA 2W6AA 4O9BA 3MTUE 2YO2A 4LLHA 1IJDB 3HE5A 5CJ0A 1T2KC 1RE4C 2OYHC 3P8CD 2C0XA 5KJ7C 1LWUC 3EQ2A 2YKPA 3KPEA 4IFMA 1URQB 4KHXA 1CI6A 1HBWA 2NPSC 1SFCB 5KTBA 5AVUB 2XNXA 1NTKK 1WT6A 2R32A 2ZXEB 1NWQA 3KYQA 1HGZA 1N7SB 3V2NA 3HUSC 3V5BA 1DEBA 2C9NY 5AW3B 3RK3B 1SQVK 5AVRB 1YTZI 3V2QA 3P7KA 1J1DB 1LT9C 1HJBA 2E42A 1LTJB 3BRTB 1EQ7A 2GM4A 5APUA 3U1CA 1IFDA 1N7LA 5CCHD 3RL0C 2QM7A 4JYCA 1M1JA 5AW8B 5AW9B 2J58A 3HD7A 4XE5B 4HH2A 1JCCA 2WPQA 2C0WA 2QM8A 5KLVK 1ZR4A 1N73A 1JOCA 1VPCA 1NAFA 1HUCA 1DX7A 1YYCA 3M9QA 3L4FA 1G2CB 5AVXB 4I1LA 1QL1A 3N4XA 3KDPB 3O8ZA 3HE4B 4AQRD 3GHGC 5BVZA 1ZR2A 1AQ5A 4M3LA 1GL2D 3LW5H 2IPPA 2OYIA 1GDTA 1RF0C 1KILA 3KQGA 1GK6A 1NU1K 5CCGD 3L37A 1J1EB 1HH0A 1RF1B 3M0AA 1HWTC 1IO4A 1L4AC 2ZFCA 2FYZA 1NHLA 2R3CA 5AW7B 2WT7A 3BRVB 5CHXA 3NXSA 2HODA 2O1KA 2WSCH 2O1JA 1URQD 1N86A 2OYHB 2XZRA 1SQPK 1LTTC 1GL2A 3TK1A 1JY3P 1IFNA 4IFDK 4W7YA 2M3BA 2LKMA 1SFCD 5AVSB 5AW5B 3MIWA 2NPSB 1IFIA 1N7SD 3A5TA 4I6MC 3RK3D 2HPCB 3WMM0 1JY3N 3HUSB 1E5WA 4Y99C 3SWYA 1S9KD 1LGHB 1URQA 3B5NA 1J1EC 1M1JC 2HFED 4GT1A 2KB7P 3HD7C 1JNMA 2C9LY 4C7RA 2GUVA 1N73C 3IR9A 1JMMA 3RL0B 1JY3O 4ZKPA 2Z5HA 1SVFA 2GUSA 1GZLA 1FJKA 5AVWB 2YKQA 3B8EB 1NKNA 2N9BA 2XV5A 2N1TA 2O01H 1RE3C 3VMYA 2H43A 1SQBK 4W7ZA 1CW5A 4WY4A 3CLQA 4JF7A 5AW1B 1GK4A 2KP8A 1VDFA 1KILC 2KYVA 1JTHB 1LTSC 2JEEA 3MD0A 1FZFA 2W6BA 1GU5A 5BU5A 5AW2B 3M9BA 5APQA 3GHGB 1NH4A 3SWFA 2WPSA 1GU4A 1ZN5A 3LIEA 1T8ZA 3II6A 1NOHA 1AFOA 3HE5B 1FOSF 5AVZB 2VRSA 3BASA 4N6JA 1LTAC 1CI6B 3VOPA 1L4AB 1IFJA 1T2KD 1LTGC 5KJ7D 1KQLA 3VN0A 1JY2P 1X79B 3L36A 3C9IA 3VP9A 1CSBA 1IFMA 4HYTB 1JO5A 2NPSD 2FFDC 5AW0B 3TYYA 2R5DA 4WBAA 4N3YB 5CCHA 1XTCC 3A2AA 4LC1A 3UIAA 5APVA 1FZEA 1LTIC 4OH8B 2PP6A 1FZCC 1JY2N 4AUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFC D;  3TSI A;  3RK2 B;  2N1T B;  2NPS B;  5KJ7 C;  5CCG C;  1N7S D;  1URQ B;  4WY4 B;  3RK3 D;  3HD7 B;  2N1T C;  3RL0 D;  2NPS C;  1SFC B;  1URQ A;  3B5N A;  1URQ C;  3B5N C;  4WY4 C;  2HFE D;  3M0D C;  2YMY A;  3KYQ A;  1N7S B;  1KIL D;  3HD7 C;  1SFC C;  3RK3 B;  1XTG B;  3RL0 B;  5KJ7 A;  5CCG A;  2KOG A;  1N7S C;  3RK3 C;  1KIL B;  3RK2 C;  2N1T A;  2NPS A;  5CCH D;  3RL0 C;  4W7Z A;  2XDJ A;  3PP5 A;  4WY4 A;  4JF7 A;  1KIL C;  1T3J A;  1JTH B;  3HTK B;  3HD7 A;  1SFC A;  4W80 A;  1N7S A;  2M8R A;  1L4A D;  3P8C E;  2H8P D;  3B5N D;  1HVV A;  2HG5 D;  1GL2 D;  1KIL A;  3VOP A;  1L4A B;  4N78 E;  5KJ7 D;  5CCG D;  3B5N B;  1JTH A;  3RK2 D;  4LGD E;  1GL2 B;  1L4A A;  1L4A C;  2N1T D;  2NPS D;  1NHL A;  5CCH A;  1URQ D;  5CCH C;  4WY4 D;  4OH8 B;  2WZ7 A;  2PP6 A;  1GL2 A;  1GL2 C;  4W7Y A;  3HD7 D; 
#chains in the Genus database with same CATH topology
 1GW3 A;  2PGD A;  1IK9 A;  5APS A;  3BCC J;  1TAB E;  2W8Z A;  4IS5 A;  3RXR A;  1WRG A;  1V2T T;  2V3O H;  3M06 A;  3A8C A;  4Y99 B;  3OW2 O;  4HGC A;  1LWU A;  1L0L G;  1NRQ H;  3RXB A;  1ZMN A;  2QSI A;  5KAF E;  1G3D A;  1O31 A;  1GI1 A;  2IBZ I;  1RS0 A;  1BTX A;  1K22 H;  2QJP C;  1HAX B;  3G4S P;  1VCQ A;  1BIT A;  3ATL A;  1L0N J;  5AVQ B;  2BMG B;  3ENS B;  3T28 A;  2ZYD A;  1DWD H;  1GI4 A;  2N1T C;  2SGQ E;  5DJT B;  1KZU B;  1HTL C;  2FI5 E;  4AFU A;  3M5M A;  3PMA B;  3STI A;  1Z1J A;  2Y0E A;  2JWD A;  1KLJ H;  1NFY A;  1NZQ H;  3ITI A;  1Z8G A;  1WDI A;  3PWC A;  1ELF A;  2CPS A;  2BX4 A;  1EZQ A;  2GT7 A;  3LGU A;  3VB6 A;  1O2Q A;  2QG4 A;  1UMA H;  3V6I A;  2E76 B;  2ZP0 H;  3NPS A;  4ZKR U;  5KLI C;  1KXB A;  1K1I A;  3LKW A;  3M9H A;  3AAS A;  2QF4 A;  1O3N A;  1W0Z U;  2QF0 A;  4Z0K A;  2VWO A;  1SGN E;  1KTT B;  1G9I E;  4UFG H;  3UUZ A;  4TPI Z;  1ESA A;  1UTK A;  1C1P A;  1VQ7 P;  4BAO B;  1CGI E;  1GBF A;  4KT0 J;  2FYN C;  3MHV A;  4FUB A;  3EA8 A;  3RP2 A;  2QJY C;  2K9Y A;  2GCT B;  3RC4 A;  3A0H E;  1ARB A;  1CHO F;  1S5S A;  5APW A;  3PO1 C;  3CCE P;  3S9A A;  1H8A A;  3UNS A;  1ZV8 A;  2KX4 A;  5IK2 D;  4WJG 2;  1MZ9 A;  1QIX B;  2J98 A;  4E7N A;  1SQQ E;  1YWU A;  3SU5 A;  3H1H D;  2ZU4 A;  1PFI A;  1MTN C;  4P02 A;  4ZKN U;  1FAV A;  1SFC A;  3KYF A;  5L6N H;  1O2X A;  3OJA B;  2G3A A;  3HK3 B;  1ZXG A;  2Z9J A;  3FP8 E;  1HAG E;  4A7I B;  5EST E;  1WV7 H;  2R44 A;  1CZQ A;  2WV9 A;  5EQS A;  1GBM A;  4W80 A;  1BSN A;  2YNY A;  3TH2 H;  1C2G A;  1TX8 A;  1ZRK A;  3SV2 H;  5HM9 A;  2Q6F A;  1L4A D;  2C93 B;  3P8M C;  1NTM K;  1RY3 A;  1BGY D;  1V2M T;  3BIV H;  5CMZ A;  1ZTJ A;  2CN0 H;  1TNL A;  2JKH A;  1OHH D;  1UTQ A;  3A8B A;  2POH A;  1E0F D;  1HJ9 A;  1LTJ A;  2O8L A;  1AVY A;  2W6J D;  4TY7 A;  5EJ1 A;  1Z6E A;  1D4P B;  1UII A;  2SGF E;  3SUE A;  1TU3 F;  1QL2 A;  4ABE A;  1BBR K;  1JB0 J;  5IYT A;  1QBN A;  2FFD B;  2JP3 A;  3IAO A;  1EDI A;  2BCC J;  1WQS A;  2ZFR H;  3BN9 A;  1QY6 A;  1SGY E;  2GMT B;  1GBD A;  5C3N A;  1THR H;  1YJ9 P;  1IOE A;  5DJU B;  2WZQ A;  1ZJD A;  3TIU A;  2FKW B;  5DP3 A;  1X8Y A;  2BDB A;  1GHB F;  2QE7 D;  3BF6 H;  4Y7A A;  1RQU A;  1ZW0 A;  4EIJ A;  2OGU A;  2J5U A;  2P1J A;  1GD2 E;  3CWB D;  2K88 A;  1NU1 D;  1C5Y B;  2H7H A;  1ZSJ A;  4YPC A;  1BIO A;  1QA7 A;  1G2C A;  1QB9 A;  3F1S B;  3GIS B;  4BXS A;  1S3J A;  2PKS C;  1P05 A;  3HD7 D;  4GOF A;  1MQ6 A;  1C5Q A;  2P59 A;  1HAY B;  4AFZ A;  3RK2 B;  3HE4 A;  3EE0 B;  3TK9 A;  1TGS Z;  2AXT E;  1BCC G;  2A06 E;  5DN6 D;  4PD4 D;  3NZI A;  5C2Z A;  1XKB C;  2BLO A;  5EJL A;  2ZIQ H;  3CCV P;  4JK6 A;  4Z1M D;  1PP9 G;  1F5R A;  3CCM P;  3QWC H;  5K5G B;  1PPJ G;  2ZDK A;  2RA3 A;  1KB9 H;  3Q5R A;  1K1L A;  3T26 A;  1PZQ A;  2E74 C;  5AW6 B;  4B1T A;  1HLT H;  1EXI A;  3E1X B;  4FOU C;  1V2U T;  1WU1 A;  5JBC S;  3B5N C;  4M9F A;  4OS2 A;  3AVZ A;  2YMY A;  2I6S A;  3EAJ A;  4D76 A;  2ODY B;  4BAK B;  4H42 U;  5HXF A;  2SGE E;  1N2D C;  4RES B;  1BDA A;  4I33 A;  3ZVF A;  3ZYD A;  1O32 A;  3CMA P;  5C1U A;  5B6O A;  3UQV A;  1EAS A;  1L0L K;  4ABD A;  3RL0 g;  3SGA E;  2Z4E A;  1P2Q A;  1Y5A T;  1AKS B;  1B5G H;  1GDQ A;  1NO4 A;  1GBK A;  4NA7 A;  3OE7 D;  3RXH A;  3MUD A;  2JET C;  5GDS H;  2A31 A;  4IMQ A;  1KOR A;  1N8R Q;  4I8J A;  1GJ6 A;  4O97 A;  1QGK B;  3VXE H;  1HIA A;  2FY8 A;  1EDL A;  3SNC A;  2YMS D;  2NPS A;  4WMF A;  1NTK J;  3CL3 D;  3PLK A;  1BZX E;  4I8K A;  3OAK A;  1QA0 A;  2V3H H;  3FAN A;  1NU7 B;  3GW6 A;  4KTU A;  1SQV J;  2A06 D;  4JPZ B;  1DT2 A;  3BTD E;  3Q3X A;  1SQQ K;  2ZYG A;  1V2J T;  4AYV B;  1C5L H;  4I32 A;  1HAP H;  3RXI A;  4IW4 E;  1A0H B;  3FZD A;  4X2W A;  1G32 B;  1Q3X A;  3LGT A;  1O2N A;  4LK4 A;  1FBM A;  1TQ7 B;  3L35 A;  1MV8 A;  1K05 A;  4OVN F;  5C5N A;  1MKX K;  5GTI E;  1ACB E;  2PKA A;  1Y59 T;  1IQH A;  3RXK A;  2E74 D;  4R0I A;  1YCP K;  1PGO A;  3DUX H;  1P03 A;  2ASU B;  4VGC B;  1PQ8 A;  3B5N D;  3C27 B;  3VG8 A;  2QA4 P;  1RJX B;  2ZFP H;  3Q3K A;  4I8G A;  5DP5 A;  3ZYE A;  3PRJ A;  5FBI A;  5KLV J;  1ANB A;  2JO1 A;  2HYN A;  3L74 D;  4FU7 A;  1H8E D;  4WXV A;  3L70 J;  1ZRT D;  1Q2W A;  1OWA A;  5H2F E;  1K1J A;  1O5G H;  1SGE E;  1UVO A;  1IQM A;  2FXM A;  2SNV A;  1FY8 E;  1AA0 A;  4CRC A;  3U9A H;  3KHU A;  1YTZ T;  1LP1 B;  5ESB A;  4WMD A;  3UWI A;  2PUX B;  3I77 A;  1F0R A;  5CBO A;  2FFD A;  2VVU A;  1TB6 H;  3A84 A;  1IQG A;  5DGJ A;  1V2N T;  4WY4 D;  3QTV H;  3STJ A;  4TY6 A;  4GUX A;  1P09 A;  5JBB S;  3N7N A;  3L72 J;  1CT0 E;  2A2Q H;  1IC2 A;  1XVM A;  2OC0 A;  2YKO A;  3SJ9 A;  1PIX A;  1V2P T;  2QXH A;  1K2I 1;  3TSI A;  2W6A A;  4O9B A;  1C2F A;  1SHH B;  3RXM A;  2OQU A;  1YPH C;  4X2X A;  1VGC B;  2H5C A;  1AVO A;  3HE5 A;  3CP7 A;  1FIZ A;  1LVB A;  1NAY A;  2QXG A;  1ZRB A;  2AGE X;  1LWU C;  2G00 A;  3RXP A;  5C0T A;  3SOS A;  1KMH B;  2JJ2 D;  2P93 A;  5JB8 S;  3A8A A;  5A0C A;  1GL1 A;  4AFS A;  4U3F J;  3URE A;  2GZ7 A;  1CI6 A;  2PTN A;  3E3T A;  1G2L A;  4PD4 H;  1SQP J;  3W68 A;  1CHG A;  1C1M A;  4MVN A;  2NRG A;  2GA1 A;  3D71 A;  7GCH G;  4UB6 H;  1GJ9 B;  1EPT B;  2FMJ A;  1A1R A;  1NWQ A;  4D6T G;  2P10 A;  1LHD H;  1OW7 A;  1O2W A;  1IK7 A;  2ODP A;  3V5B A;  1TPA E;  3KN2 A;  3TNS A;  1NT1 A;  2WV5 A;  5AW3 B;  4IOI H;  3RK3 B;  5AVR B;  2VVV A;  4FU9 A;  3V2Q A;  3ZVC A;  1Q7Y Q;  1AI8 H;  1V2W T;  1IHT H;  1DM4 B;  2ZPR A;  1S2E A;  1ANE A;  1J1D B;  3K9X B;  4I7Y H;  3L75 J;  3WUT A;  1F0U A;  2IBZ G;  2FYR A;  1J17 T;  1BE3 J;  2GJG A;  4ISN A;  4X6P A;  3U1C A;  1W8B H;  2ZJS E;  1CQQ A;  2RA0 A;  2BEZ F;  1UCY H;  2GP9 B;  3H1J E;  1SQB E;  1LPK B;  2ZGB H;  1AKS A;  1M1J A;  5AW8 B;  3ATM A;  1QHR B;  2J58 A;  4RT1 A;  1IQL A;  1C5Z B;  1HBT H;  2WIN I;  2KAI A;  6CHA B;  1EX3 A;  1OP0 A;  4K1T A;  4HH2 A;  1JCC A;  3QN7 A;  3OEH D;  1GGD B;  2WPQ A;  1N73 A;  1ZR4 A;  1BTY A;  1DLK B;  1XMN B;  4ZNC A;  2BY7 X;  3RXO A;  1HB0 B;  3RC6 A;  1GI6 A;  3FXD A;  1HGT H;  1GBC A;  1NC6 A;  4I1L A;  2FXP A;  3QWO C;  5KEC A;  3U8R H;  4A1T A;  4XFQ A;  5HIZ A;  2EI6 A;  3ZZ6 A;  4EYY Q;  2D2C B;  1EXJ A;  1ELG A;  4YXD C;  1OVV A;  1QR3 E;  4D9R A;  2HPQ H;  4PV1 C;  3LW5 J;  1ZR2 A;  3W67 A;  1GL2 D;  1EDJ A;  1TBZ H;  2AEM A;  1VF5 C;  2BD5 A;  3AE6 C;  2OYI A;  1GDT A;  1TOM H;  1UVS H;  1SQX D;  1GJB B;  1KIL A;  4ACB A;  2D26 C;  3E1R A;  3BTH E;  2BDC A;  1GK6 A;  3CS7 A;  2GCH G;  3TGU D;  3EA7 A;  5AF9 H;  3FKS D;  1YYY 1;  5K0H A;  3H1J D;  1P2O A;  2BEQ D;  1SQB D;  1RF1 B;  1NFW A;  1JBU H;  2WPD D;  3K6Z A;  2V3M A;  4H6S B;  1GHA F;  1PFX C;  2BCC G;  1KYO E;  1TGC A;  4GCH F;  4BWN A;  4O9V A;  1W3C A;  1NHL A;  3BRV B;  3RMM H;  5EW2 H;  4ISI H;  2B0F A;  1FI8 A;  3BCC D;  5TCA A;  5LPF A;  4RN6 A;  1EAT A;  1LTT C;  2A5A A;  2BOH B;  3CXH I;  1C9P A;  2M3B A;  2LKM A;  3CCS P;  1GG6 B;  2DE9 A;  2WPM S;  1SFC D;  3CC4 P;  1PPG E;  1ZTL A;  8EST E;  2O8T A;  1Q81 Q;  5E0J A;  3NKK A;  2STB E;  1L0N D;  2V4H A;  4BRY B;  4FUE A;  1YF4 A;  4ZCN A;  1BMA A;  1ZSK A;  3RLW H;  5A2M H;  4R8T B;  3U69 H;  1UTL M;  1EC5 A;  3A5T A;  2HPC B;  2YNA A;  2PTC E;  3UR6 A;  1OW6 A;  5EJZ A;  3FP6 E;  3KQB A;  1O39 A;  1HPG A;  4Y99 C;  2UWJ E;  2C8W B;  2R3Y A;  1XKA C;  1S6L A;  1LGH B;  3GLM A;  2FP7 B;  3GYL B;  1AUT C;  1AWF H;  1Y3X A;  1L0L J;  1NTP A;  1QEX A;  1IQF A;  5B6L A;  3RUO A;  3FO8 D;  2FLB H;  1KY9 A;  3KCG H;  1RRK A;  2WPV B;  4HB1 A;  2TGP Z;  1EPT A;  1KYO D;  3CCU P;  3MNB A;  2UUY A;  1O2O A;  1EZU C;  3SJK A;  5GXP A;  1AN1 E;  3RXE A;  1TMB H;  2GUS A;  4NPF X;  5EFW B;  1SHY A;  1UK4 A;  2E76 C;  2YKQ A;  4H0L C;  3M3S A;  1SGQ E;  2Y0C A;  1JIR A;  2N1T A;  1G3C A;  2CHA B;  2H43 A;  3GY3 A;  1W0J D;  7KME H;  3L73 G;  1SQB K;  3F9F A;  4W7Z A;  1PQ7 A;  2CXV A;  4MQA A;  1CBW B;  2FBW C;  2VIQ A;  1TX7 A;  2M0B A;  2KP8 A;  1IQJ A;  1VDF A;  1C5R A;  4X8T H;  1SQR A;  2GCT C;  3MD0 A;  3E8L A;  1GU5 A;  2OQ5 A;  5JYI A;  3IF4 A;  2QF5 A;  2GX4 A;  2HVX A;  2ZGH A;  3F6U H;  3RU4 T;  3A7X A;  3MU0 A;  3SN8 A;  2J4I A;  2F9U A;  1NH4 A;  2N9Y B;  2WPS A;  3H1K G;  3LIE A;  2D8W A;  5FBE A;  1C5X B;  3TJN A;  1MQ5 A;  1NOH A;  1T8M A;  3P8F A;  1UVP A;  1LPG B;  1YLC A;  1P11 E;  5GCH F;  3M3V A;  3ELA H;  1EOJ A;  4F4O C;  2VH6 A;  6GCH G;  1KQS O;  4SGB E;  2RKL A;  5AVZ B;  1C1V H;  1S84 A;  2BX3 A;  1IAU A;  4X1R U;  1L1J A;  2BVS H;  1OX3 A;  2ZEC A;  5EW1 H;  2F43 B;  1NFX A;  3A88 A;  3VOP A;  3D70 A;  1BRC E;  3KF2 A;  1T2K D;  2R2M B;  2E75 B;  2O8U A;  1KXD A;  1O2U A;  4RKU J;  4FUC A;  1OSS A;  2M2A A;  1YPM H;  1VJA U;  3VP9 A;  4H0L D;  1RH5 B;  3ZDM A;  1AB9 B;  2NZ2 A;  4J1Y A;  1S83 A;  4HYT B;  1FAK H;  2NPS D;  2FFD C;  3URD A;  2LP6 A;  5AW0 B;  1JMO H;  1UTJ A;  1C1W H;  1A2C H;  1PL5 A;  4DG4 A;  1FE6 A;  1NTK E;  2KS1 B;  1XTC C;  3A2A A;  1XUG A;  4LC1 A;  2GMT C;  2ODQ A;  4X1Q U;  4WXI A;  1TWX B;  3RU4 E;  4TT3 H;  1FZE A;  2YXQ B;  3ZZ5 A;  3OTP A;  2PP6 A;  1MD7 A;  3AE1 C;  1JY2 N;  3UWJ H;  4ABA A;  4ZMD A;  3VPK A;  4F55 A;  3SU2 A;  4UON A;  1S9K E;  1FDM A;  1VQK P;  3E0N B;  1NTZ E;  3TF5 A;  1JRS A;  1GI2 A;  1RE4 A;  3QZR A;  5AFY H;  4X2Y A;  5HGG A;  2TGD A;  4JZE H;  1GJ8 B;  1C1R A;  1V2V T;  1SGD E;  3NFQ A;  3VTP C;  2BXU H;  1KXC A;  4UE7 H;  2R9P A;  3AEE C;  1C2E A;  1TA6 A;  1M7L A;  1MKM A;  4YM9 A;  3RL0 D;  3D49 H;  5EGM A;  2P8O B;  5APY A;  2Z7F E;  4I2L C;  5HYO A;  4BAN B;  4BXW A;  2AIQ A;  1Y8T A;  1CGH A;  1SQO A;  1QX8 A;  1O2H A;  1HXE H;  5AVV B;  5CHB A;  2ZF0 H;  3BVH A;  1BCC J;  2R3S A;  1G30 B;  1K8A Q;  1S6F A;  2BYA X;  3U1I B;  2EEK A;  1O2G H;  3O6Q A;  1PP9 J;  1YIJ P;  3L70 E;  2ZPS A;  1YBK A;  1V2S T;  2AFQ B;  4HI3 A;  2Q9I A;  4OGQ D;  1LT9 A;  1GCT B;  2EI7 A;  1LHF H;  4XSK U;  3H32 A;  2KOG A;  3ODF A;  1P06 A;  3PMJ A;  1NTK D;  3IWM A;  4FXG H;  3SFD C;  1SGR E;  3H1I G;  2EY4 C;  3NTN A;  2V7Q J;  2CF8 H;  3LIW A;  3W94 A;  1LQD B;  1M56 D;  1GBL A;  3DA9 B;  2XOK D;  1SQV D;  4C46 A;  4Y28 J;  5BRR E;  2MJZ A;  3PP5 A;  3MO9 A;  4Z6A H;  3LH1 A;  2Z9L A;  1GBB A;  3T27 A;  3RMN H;  2GZ9 A;  4A92 A;  1S0R A;  5KAI H;  1MTV A;  3MH4 A;  3M37 A;  3IIT A;  2H89 C;  1W7G H;  4UDW H;  3A82 A;  3D65 E;  3O8B A;  3A87 A;  1FY3 A;  1ZML A;  2SGA A;  3TDK A;  3PV2 A;  3WW7 A;  2BLV A;  2LEL A;  1OW8 A;  1MTU A;  2P94 A;  3H1L E;  4CPG A;  1G36 A;  1RXP A;  4YZU A;  1NPM A;  4TSF D;  3RMO H;  3LGY A;  1T3U A;  2KCY A;  3P92 A;  5LPR A;  1W13 U;  3URC A;  1SGP E;  4ASW A;  2M8R A;  4E7R G;  1ZHM A;  2A4O A;  3N7D A;  1WYK A;  1CT4 E;  1NTM G;  2ZCH P;  2V6N A;  4LZ1 H;  2CPB A;  4C7N B;  1O2Z A;  5KLV D;  1PYT C;  3CD6 P;  1FN6 A;  1O5B B;  1UW7 A;  4DGJ A;  2XND H;  2XKM A;  3L70 D;  1V2R T;  4Y8X A;  1YPL H;  3T97 A;  1SP4 A;  2OYI C;  1QRX A;  5JBT A;  3SI3 H;  1H8H D;  4VGC C;  4DJZ B;  5AVT B;  1OWH A;  1Z7K A;  1HYL A;  1FY5 A;  3CCR P;  1KIL E;  2M5A B;  5B5E E;  2DUC A;  4NWL A;  1QBO A;  1TNJ A;  3F2F A;  2B87 B;  3U8O H;  2WVR A;  2KIK A;  2L5G B;  2QEX P;  1GI7 B;  2C8X B;  2XC4 A;  4B74 A;  2IFM A;  1ETR H;  2XW9 A;  2OLG A;  3MO6 A;  3IFM A;  4Y0Z E;  3R3G B;  3L72 D;  3K5B A;  2W3I A;  2HNT E;  2PFX A;  5HMA A;  4NZQ A;  3VYI A;  1ELA A;  3BEF B;  3H1L D;  4MDS A;  1H88 A;  1XUJ A;  1UK2 A;  2Q6G A;  1YCP M;  1IFP A;  3BTF E;  1DWE H;  3ZZ7 A;  3Q3Y A;  1EZV E;  1C2L A;  1W0K D;  1NTZ K;  5F53 A;  3RGU A;  2Q5U A;  4GKG A;  3SUF A;  5PTP A;  5C20 A;  2ANK H;  3D23 A;  2A45 G;  1SQP D;  2IX7 C;  4UFD H;  4RT0 A;  3UB0 A;  2L91 A;  1OKX A;  2ZKS A;  2V35 A;  4UD9 H;  3MO3 A;  4AB9 A;  1BB0 B;  1VGC C;  3DSP A;  1O2J A;  2O3J A;  3L71 E;  3V3M A;  2K1Q A;  1EKB B;  4XA4 A;  2Y9Z A;  1PYT D;  4AZ2 B;  3PRD A;  1FY4 A;  2H88 C;  3LU9 B;  4LXB H;  4Q7Y A;  2H9H A;  1V2Q T;  2BOK A;  1OPH B;  3W1E A;  1QL9 A;  4WVP E;  4ABB A;  3M0D C;  3VMX A;  4EOT A;  1FUJ A;  1KIL D;  2SPZ A;  2AIP A;  2Z9G A;  2ZT9 D;  2IZ1 A;  2A2X H;  1OVR A;  4GOD A;  4BTI B;  2G55 A;  2QA9 E;  1QRZ A;  1BE3 D;  4INH A;  1KB9 D;  1AE5 A;  1P3E A;  1SLX B;  2QC2 A;  4B76 A;  3H1H E;  3ATK A;  1EPT C;  1VCP A;  1GI9 B;  3AW1 A;  1KYN A;  4IN1 A;  1D3D B;  2UWO A;  3PRB A;  4Q2K A;  3RK3 C;  2QIW A;  2HAL A;  1MKW K;  3SJI A;  5H4I B;  3PRO A;  2YO3 A;  3RLY H;  1OWD A;  1O3I A;  4QMA A;  4Q7Z A;  1FON A;  1DIT H;  1J1D C;  2FX6 A;  2NU1 E;  4D6T J;  2HRV A;  2ZQ2 A;  1U7M A;  3LGI A;  3GF7 A;  1A4W H;  3M7Q A;  1WOF A;  4YXW H;  1Z8R A;  2ZXX A;  2I1K A;  2HVY B;  1EZV D;  2D1J A;  1BGY E;  1GL0 E;  2H9E H;  3QO6 A;  1P2M A;  1SQQ G;  4GIF A;  3F9G A;  4MPW A;  1OWJ A;  4H13 C;  3L33 A;  3E90 B;  7LPR A;  4AGJ A;  5E79 H;  1SLQ A;  3L71 D;  1BMN H;  1E38 B;  2AEI H;  3Q2Y A;  2KSE A;  3AEF C;  3G9R A;  1DY9 A;  1O2T A;  2BZ6 H;  2ULL A;  3PLP A;  1O34 A;  1DLE A;  3EE7 A;  3ATI A;  2BDA A;  3B8J A;  4NG9 H;  3P8C E;  2F9B H;  1GGD C;  1K1N A;  3NK8 A;  3QK1 A;  2ZU1 A;  5HIY A;  1JXP A;  1SBW A;  4LZ4 B;  2A4R A;  1GW4 A;  5TJH A;  2OCV B;  3SNE A;  3AE4 C;  5GIB A;  4NIV A;  1WSS H;  1DEE G;  3VEQ B;  3CWB E;  1NU1 E;  2D2C C;  1MZD A;  4C7N A;  2QV1 A;  3LON A;  4O03 A;  3SO3 A;  4KTC A;  3EFF K;  1FDO A;  2ZFF H;  3ZZ9 A;  3DD2 H;  1AIX H;  1BHX B;  1O3B A;  1TGT A;  4DZO A;  4H44 B;  1K9O E;  1QBV H;  2PR3 A;  5DP6 A;  1AZZ A;  1O35 A;  3RXU A;  1AJY A;  2N1T D;  4PD4 E;  4R4L A;  1Y8A A;  2M5A A;  4ABI A;  1H9L B;  4CH2 B;  3F0O A;  4UFE H;  4UB6 E;  3GG2 A;  1RF1 C;  1CO7 E;  1NRR H;  3BAT A;  3ATW A;  2PAJ A;  4I8H A;  3CS0 A;  5M1B A;  4XOJ A;  1S5L H;  1HAI H;  2G81 E;  3MOC A;  1F5K U;  1SI5 H;  3MH5 A;  5LGO A;  4B86 A;  3TJV A;  3ZIA D;  1EXF A;  4H13 D;  4LLH A;  1IJD B;  5T3H A;  1RE4 C;  3P8C D;  2OBQ A;  1PGJ A;  3AEA C;  1YY3 A;  3TJO A;  3KPE A;  4IFM A;  1URQ B;  3BG4 B;  1GG6 C;  4L76 A;  4MG3 A;  3GY2 A;  3MU8 A;  3JCU H;  2W7S A;  2ZHD A;  1G3B A;  1UCY E;  5EOD A;  4MNX A;  1P2K A;  2BVR H;  4YLQ H;  2QN5 T;  3KL6 A;  4FVB A;  2IPH A;  4X6O A;  2FX4 A;  1TYN A;  2DE8 A;  1C1O A;  1H8D H;  3SNA A;  1A0L A;  1M1K Q;  4THN H;  5A8X A;  2R32 A;  5CHA B;  3UQO A;  1HGZ A;  1N7S B;  1DEB A;  2DW3 A;  1OFC X;  4K69 A;  1QLE D;  1UHB B;  1WUN H;  1BML A;  2OUA A;  3BTM E;  3D6Y A;  5FHT A;  5DPA A;  1SGF G;  1YIT P;  1LT9 C;  2E42 A;  1FJS A;  2M3E A;  2GD4 B;  4CRA A;  4OWF A;  1X0T A;  1C1T A;  3F3B A;  1X22 A;  1KIG H;  3BRT B;  1EQ7 A;  1AY6 H;  5APU A;  8KME 2;  4CRD A;  2A7C A;  3A7Z A;  1GBI A;  1P3C A;  2A5I A;  3MNC A;  1HAV B;  1T31 A;  2GTB A;  2ZDV H;  3PMH B;  5AW9 B;  1OMI A;  1J14 A;  1Y3Y A;  2ZPQ A;  5FX6 A;  3AE2 C;  3ZVG A;  3TGI E;  5SGA E;  1SQT A;  3OEE D;  1O2P A;  4DY7 B;  2NU3 E;  2EA3 A;  2Y5F A;  1UVT H;  4LOY H;  2Z94 A;  1FXY A;  3PV5 A;  5E2O A;  4ZKS U;  1JOC A;  1L2P A;  1BRB E;  1NAF A;  1CBW C;  3PHL A;  3ZZ3 A;  3L4F A;  1LKB A;  1QZ8 A;  1VQN P;  1VKY A;  3L74 E;  3UNQ A;  5DO4 H;  1ZRT E;  2K1A A;  3L73 J;  3GYM A;  1QTF A;  3O8Z A;  1YI2 P;  3HKI B;  3UNR A;  2OTK E;  3PTZ A;  2BXT H;  4L74 A;  1P2N A;  2EC9 H;  1VCW A;  5C0U A;  1BT7 A;  2FLR H;  2SNW A;  3VB3 A;  1N8O B;  2G5N A;  4MPX A;  1AQ5 A;  2ZDA H;  4JYT A;  1SLV B;  3LW5 H;  3OTJ E;  1BBR H;  3JZ1 B;  1MD8 A;  1BCC E;  1ZOY C;  3RBX A;  2K3R A;  5CE1 A;  3E16 B;  3ZZ4 A;  1VQ9 P;  1NU1 K;  2QXJ A;  3H1K J;  2CGA A;  4JYV H;  3L37 A;  1V6D A;  1J1E B;  1GMH G;  2GCH F;  3F9H A;  1HAO H;  4BNR A;  1HWT C;  1O3D A;  3RXF A;  5EPN A;  1P12 E;  1GBJ A;  3SU4 A;  1W10 U;  3BV9 B;  1SOZ A;  1C5U A;  1DIP A;  2R3C A;  1D3T B;  3Q76 A;  2QYI A;  4OS1 A;  2WSC H;  4Q80 A;  2O1J A;  1O3C A;  3RXL A;  3T2N A;  1AUJ A;  2XZR A;  1A46 H;  2HWL B;  1EP6 A;  1SGT A;  4IFD K;  3JZ2 B;  1AB9 C;  3FN8 A;  3Q5S A;  2Y5H A;  1ETS H;  3MNX A;  1RD3 B;  2CK3 D;  3F2G A;  1QQU A;  5GTH H;  4YES B;  1DD3 A;  1Z1I A;  1VQL P;  1OOK B;  5AW5 B;  3MIW A;  2BM2 A;  1DFP A;  1TIO A;  5GND A;  3WUU A;  2QY0 B;  1QVF O;  4XBC A;  3ODD A;  3G71 P;  4B2C A;  1O3E A;  1LVM A;  4RJT A;  3HUS B;  1E5W A;  3BTK E;  4ZH8 A;  1UCY K;  3SWY A;  2QCY A;  4D7F A;  1BCC D;  5EXM A;  6LPR A;  2Q6D A;  3CEN A;  1URQ A;  3CXH H;  1DVA H;  1GBT A;  3CX5 I;  1BDD A;  2TPI Z;  2HFE D;  3QDZ B;  5EU8 A;  1L0Z A;  1CGJ E;  4XRN A;  4AYY B;  1AQT A;  3P70 B;  2AEF A;  1AVX A;  2ILN A;  1H0T B;  2C9L Y;  2JR8 A;  1O2Y A;  2P8O C;  4C7R A;  2GUV A;  3F89 A;  2FIR H;  2QXI A;  2VIP A;  1CA8 B;  3LDX H;  1DXW A;  2Z5H A;  2V7Q D;  3N7E A;  3RXC A;  1C4Y 2;  1YPH E;  3FFG A;  4GVU A;  3AW0 A;  2VU8 E;  3AE8 C;  3KGP A;  1Q2N A;  3MU1 A;  1FJK A;  4MNW A;  5AVW B;  4K3A A;  1DAN H;  2FOF A;  2FYU E;  1A0J A;  1GI0 A;  1YPK H;  3K2U A;  1A7S A;  3NXP A;  3VMY A;  5F03 A;  3WU2 H;  1GCT C;  1QRW A;  4RKJ B;  4ZKO U;  1SOT A;  2H1U A;  3P6Z B;  1SQB G;  1CW5 A;  2ANY A;  1J15 A;  3PLB A;  4RSP A;  3ZZD A;  4DOQ A;  3FWN A;  3RXD A;  3AE5 C;  3JC2 2;  5AW1 B;  1PQA A;  2KYV A;  1MBQ A;  1JTH B;  1AV1 A;  2NWN A;  3MU4 A;  2J97 A;  2JKV A;  2BDY A;  4NPE A;  5BU5 A;  1SFI A;  5AW2 B;  3M9B A;  4DJG A;  1GWA A;  3H1I J;  5APQ A;  4DT4 A;  3PM3 A;  4YLU A;  1YHQ P;  3GHG B;  1SQX E;  1BQY A;  2LR2 A;  1YCP H;  3A81 A;  3USS A;  2Q6Q A;  1ZN5 A;  1YBW A;  3MHW U;  1FN8 A;  3II6 A;  1S6H A;  3SBK A;  2A45 B;  1NY2 2;  4FUD A;  3TGU E;  4FUF A;  1TAW A;  2JIZ D;  1B0E A;  2WPJ S;  3AE9 C;  1ELV A;  2KCA A;  1GHY H;  6GCH F;  2FOM B;  1BJV A;  1FOS F;  3F68 H;  3G01 A;  4K1E A;  2FOB A;  2JDI H;  2VRS A;  3BAS A;  2XRC A;  2QJP B;  4NA9 H;  1DY8 A;  4CBN A;  1OWI A;  2GVF A;  4NFF A;  3I78 A;  5FAH A;  1O3H A;  1OX1 A;  1L4A B;  1IFJ A;  4X6M A;  3BCC E;  1LTG C;  1IQE A;  1ZTK A;  3FAO A;  3TJU A;  1F0S A;  2FYU D;  4XFJ A;  1KQL A;  3VN0 A;  4OGY A;  3RM2 H;  1JY2 P;  1LO6 A;  3LJO A;  1GCD A;  1NTM J;  1C9T A;  1O3P B;  2GKV E;  1NVO A;  1O38 A;  1TPP A;  1MU8 B;  3MMG A;  1EAU A;  1PPZ A;  1DDJ A;  1L0N E;  1OYQ A;  1T7C A;  1SB1 H;  8LPR A;  3TYY A;  3CCL P;  1QL7 A;  4WBA A;  4E06 H;  4ZHL U;  4N3Y B;  3UIA A;  1K1M A;  1W5C E;  4HJG H;  5APV A;  4OH8 B;  1LTI C;  2HR3 A;  1DS2 E;  4K35 A;  1QJ6 B;  4GOE A;  1SMF E;  5A8Z A;  1MFZ A;  3WUV A;  1C5N H;  2FYQ A;  4WH6 A;  4ASU D;  4BOH A;  2A4Q A;  3MU5 A;  1TRN A;  4P00 A;  1KDQ B;  3SQH E;  2F9P A;  5T1V A;  3CC7 P;  4CH8 B;  1P0S H;  2WPI S;  4XE4 A;  4AFQ A;  4ZMA H;  2WSE J;  4UB8 H;  1LHE H;  1O5F H;  3SU3 A;  1KQF B;  1D6W A;  2A45 I;  2CK3 H;  1GJ7 B;  3B9F H;  2ZGJ A;  4JZ1 A;  4TT3 D;  1MTN B;  2Z9I A;  2CJI A;  2H6M A;  4PJ0 E;  3RML H;  2O9Q A;  4CRE A;  3P8G A;  1ELB A;  2ITA A;  2WSC J;  3HD7 B;  1ZPZ A;  1JY2 O;  3H7T A;  2PFE A;  4JZD H;  1W2K H;  1OS8 A;  3MZW B;  1LP1 A;  3A7Y A;  3BEI B;  4MN4 C;  5KAI E;  2Q7C A;  1AFQ B;  1TQ0 B;  4CHA B;  3SOR A;  2ZZU H;  2FOA A;  3DCL A;  2J34 A;  4F49 A;  1S4X A;  1YPE H;  2GZ8 A;  2G51 A;  2XC5 A;  2W3K A;  2ZGC A;  3H6P A;  4U30 A;  1P84 D;  2GT8 A;  1J8A A;  1LCY A;  5DJ7 A;  3GIC B;  4IL6 H;  1UTP A;  2VIW A;  3TPI Z;  1JUN A;  1H8I H;  1O3A A;  2FOH A;  2A0Q B;  2J9N A;  3M5O A;  4NZL A;  1VQP P;  5IDK A;  3EFG A;  4D6T D;  2PGB B;  3MFJ A;  4FVD A;  5A09 A;  1EUF A;  2Y82 A;  4TYD A;  4DVA U;  2V7Q H;  3SWK A;  2FYU K;  4PV1 D;  3EWK A;  1SS1 A;  3UTU H;  1JM0 A;  3KZI H;  1KD1 Q;  1GI3 A;  3LC3 A;  2XDJ A;  2ZQ1 A;  2EQN A;  4AOQ A;  3O8R A;  2R0K A;  1VF5 D;  2IBZ D;  2W27 A;  1EB2 A;  3M0D A;  1EZS C;  1ZZZ A;  2GDE H;  4Y6D A;  1KTS B;  2BLW A;  1AND A;  1V3X A;  3TH4 H;  1YP9 A;  4RKO B;  3SJO A;  3WY8 A;  2Z9K A;  3BTE E;  1J2J B;  2HOD B;  3G3Z A;  1VIT G;  2BD3 A;  2YMS B;  1Y3V A;  3KQE A;  2BCC E;  5GWZ A;  3PV4 A;  4JYB A;  2OTJ P;  4CRF A;  1DWB H;  4D9Q A;  1SC8 U;  1ZLL A;  1OWE A;  2PKS B;  1SQX K;  2VGC B;  4X0W U;  3PYH A;  1N6Y A;  1O3O A;  1HRT H;  2HOB A;  1OP8 A;  4JBZ A;  1U7J A;  3HGN A;  5J4S A;  2H8P D;  3PWB A;  4PD4 I;  1OVU A;  1RFN A;  1YJW P;  1SQQ J;  2K9J B;  1IQK A;  2BZA A;  5L2Y H;  1BJU A;  3L6P A;  3GY4 A;  3OU0 A;  3UY9 A;  2WQY C;  1A5H A;  1HF9 A;  4NIY A;  2FTM A;  2W90 A;  2LNC A;  3P17 H;  2E74 B;  1O36 A;  2F83 A;  1ABI H;  4NA8 A;  3I29 A;  1FZB A;  5E0G A;  2RDE A;  1ELE E;  2ZTZ A;  2BTC E;  1FDI A;  4IL6 X;  1SLW B;  3B5N B;  1G1J A;  1PPH E;  2FO9 A;  1RIW B;  3PTB A;  4IBL H;  4KEL A;  1YLN A;  2IPQ X;  1KLI H;  1BMM H;  1F5L A;  2FM2 A;  2HLO A;  1A61 H;  1ARC A;  2XND D;  3QH9 A;  1L4A A;  3E0P B;  1UO6 A;  2QJK B;  1EST A;  1ANC A;  5APT A;  1VR1 H;  2JWA A;  1L0N K;  2VID A;  1O0D H;  1FDP A;  2OTV A;  1FU1 A;  2KXP B;  2TBS A;  4H44 C;  1E79 D;  1ZSL A;  2EI8 A;  1O2K A;  4KP0 A;  1P9U A;  2BCC D;  2TRM A;  2BAS A;  5J4Q A;  2FOC A;  1KN7 A;  2C4F H;  7EST E;  2KLU A;  3CC2 P;  2W26 A;  1W2B O;  3V4Q A;  1UVU H;  2BD4 A;  8GCH G;  1NTZ G;  5CCG C;  1HUT H;  5FPS A;  1Z8I B;  2KNC B;  4WY4 B;  1ZHR A;  2M5T A;  3SHC H;  1DUE A;  1ID5 H;  5FX5 A;  2E76 D;  1F7Z A;  4QT8 C;  2THF B;  2FPZ A;  1O3L A;  5BU8 B;  1M90 Q;  1FAX A;  1GMC G;  2ZFS A;  2BQ7 B;  5AVY B;  5CMX H;  4KTS A;  3GOV B;  2P67 A;  2UUJ B;  1URQ C;  1RF1 A;  4BAQ B;  2Y7Z A;  4X1N U;  3NRL A;  1AZ8 A;  3SNB A;  1LTB C;  1SQV E;  1NRO H;  3RXA A;  3KID U;  1KFN A;  1FX0 B;  2BD2 A;  2OD3 B;  5C1Y A;  4AX9 H;  3A8D A;  1C1U H;  1FY1 A;  3RM0 H;  3P8N A;  2CMY A;  3UIR A;  1LHG H;  3TH3 H;  5AW4 B;  4ISL A;  5E79 E;  3SU6 A;  1SGC A;  5TIS H;  2ALV A;  1FZG A;  1KC8 Q;  5CHA C;  1N7S C;  1G37 A;  1O30 A;  1P2J A;  2IOT A;  3DSO A;  3A85 A;  3CI9 A;  1FOS E;  1V2K T;  1D7M A;  2BD7 A;  3U59 A;  3HGP A;  2R2W U;  2RH0 A;  3KXD A;  1P84 H;  3RK2 C;  4BAH B;  3G6E P;  1M57 D;  5ETX A;  3MGN A;  4BRY A;  2AGG X;  2W83 C;  1O3M A;  2BDI A;  2B7D H;  2KCO A;  1FPC H;  1TMU H;  2HPC A;  1ZJK A;  3S0N A;  4AB8 A;  3LJJ A;  5EOK A;  2F3C E;  1MU6 B;  1TNI A;  5KLV E;  3VB7 A;  2KSJ A;  1EAX A;  1GJC B;  3VMZ A;  1XX9 A;  1AVW A;  2FS9 A;  1OYT H;  4I7Z B;  3N99 A;  1RGQ A;  1H9H E;  2HPP H;  2FZZ A;  2E5T A;  1GHX H;  2WYG A;  1T6A A;  3C8V A;  3V0X A;  3R2P A;  1C1S A;  2FWW A;  3H1L G;  1D6R A;  4WME A;  4YXW D;  4KJM A;  2RDL A;  2Z3E A;  4OS6 A;  1C5P A;  2V0B A;  4X8V H;  1FPH H;  2Q3I A;  1L4D A;  1DWC H;  2HG5 D;  3A3Y B;  1LWU B;  2C8Z B;  3V2R A;  5C39 A;  5AHG H;  3O8C A;  2W5E A;  4XBD A;  1M9U A;  4K3J A;  1VQ8 P;  2Z3D A;  3L72 E;  3EA9 A;  3TVJ B;  1ZOM A;  2XCN A;  3MQK C;  1XM1 A;  5G4B A;  4HKZ H;  3KEE A;  2WWW A;  1PPE E;  5FCR A;  2K9J A;  1N8O C;  1T32 A;  3MP7 B;  1EP5 A;  2FES H;  2D2D A;  4IFF A;  2A32 A;  2IJD 1;  3NMD A;  3KNX A;  4JMY A;  2E5Y A;  2WYJ A;  1TA2 A;  2WPH S;  3JCU E;  1NRN H;  3RK2 D;  4M7G A;  1GL2 B;  1C5O H;  2XU6 A;  2BHG A;  1M8O B;  4U3F E;  1C2D A;  2Z5I A;  1ETT H;  1UTM A;  2P7J A;  1GTW A;  3HPT B;  3LGV A;  2PWX A;  1SQP E;  3PTN A;  1SSX A;  1SGF A;  1OP2 A;  3V2P A;  2B5T B;  1C4U 2;  2WPR A;  1EAI A;  3O8D A;  2J95 A;  2JH5 D;  3SV7 A;  1W2E A;  4GDO A;  3MTU E;  2UWP A;  1NYH A;  1LNQ A;  2RCE A;  5JPM H;  1YQ4 C;  1A3E H;  1YLD A;  3M5N A;  4A1X A;  1E79 H;  5KJ7 C;  5AVD A;  3EQ2 A;  2YKP A;  1EZV G;  4NWK A;  1MAX A;  3GY5 A;  1SVP A;  4KHX A;  3L75 E;  3TLO A;  1HJA B;  1PJP A;  1JMB A;  1BE3 E;  2AMP A;  1KB9 E;  1HBW A;  1R5S A;  3I55 P;  1N1L A;  4WWI A;  1NO9 H;  1Z71 A;  3LH3 A;  3SZE A;  4EDF A;  3WWF A;  1SFC B;  1YJN P;  1LPZ B;  4B75 A;  5KTB A;  1DD4 A;  4HTC H;  1O2M A;  2KNC A;  3L71 G;  1OXG A;  3KQ5 A;  1NTK K;  1WT6 A;  1O2R A;  1MTS A;  1TGB A;  2PLX A;  5T6G A;  3KYQ A;  3V2N A;  3HUS C;  1THS H;  1QL8 A;  1X7A C;  2OC8 A;  5T6D A;  1SQV K;  1JWT A;  1YTZ I;  3ZVE A;  2KS1 A;  1P2I A;  2AH4 X;  3SZN A;  4YOG A;  1BUI A;  3PMB B;  4ABJ A;  1HDT H;  1MCT A;  4DIH H;  4U3F D;  1HJB A;  1LT1 A;  1LTJ B;  3M7T A;  1BRU P;  1GJ4 H;  3H1H G;  2PSX A;  2GM4 A;  1EFR D;  2AER H;  3L3T A;  1K1P A;  2WHX A;  1BMF D;  1IFD A;  4INK A;  1QUR H;  5FL7 D;  2XWB I;  9EST A;  1YPJ H;  4JYC A;  4MLF B;  5I46 H;  2VWM A;  2C8Y B;  2H2Z A;  5E8E H;  2BY5 X;  2VIN A;  3R4Y A;  1WTG H;  2ZCL P;  3SUD A;  1TBQ H;  3H1I D;  4X1P U;  1VIT H;  3GCT G;  3CPW O;  4IC5 A;  4JYU H;  4ISH H;  3KHV A;  3L75 D;  4XE5 B;  1BGY G;  2J94 A;  2ZCK P;  3GCH B;  2XBV A;  2C0W A;  5KLV K;  2Y0D A;  3MI4 A;  5T6F A;  1KXE A;  1VPC A;  1FMG A;  1HFD A;  1DX7 A;  2YMK A;  3TU7 H;  4Y11 E;  1HJ8 A;  1YKT A;  1EJM A;  1G2C B;  1VZQ H;  1CVW H;  2UUF B;  4FUI A;  5AVX B;  2QGR A;  1QL1 A;  3N4X A;  3KDP B;  1O3J A;  1SQB J;  1ELC A;  1USE A;  1AE8 H;  1W0Y H;  5A0B A;  3HE4 B;  1E1Q D;  4AQR D;  3RK3 E;  3GHG C;  3VGC B;  4FU8 A;  4A5T S;  3SI4 H;  1NU9 A;  2KFW A;  2TGT A;  4K60 A;  5GTH E;  4OS7 A;  3M61 U;  1O5C B;  1FNI A;  1NTM D;  3E6P H;  1U6Q A;  4TPY A;  3VB5 A;  3CWB G;  1NU1 G;  3S9B A;  1P10 A;  3F2H A;  3TNT A;  3M0A A;  1GPZ A;  2XTT B;  2PSY A;  1GMH F;  5GPI B;  1ZLR A;  4HG6 A;  1O2S A;  1IO4 A;  3FVF B;  3FX0 A;  2YOL A;  1L4A C;  6CHA C;  1IZN B;  1O2L A;  1Q90 D;  2Z6B D;  3HAT H;  3A7T A;  5CHX A;  3D62 A;  2XXL A;  1W11 U;  3C1L A;  3CXH E;  2B9B A;  1KYO I;  1VQM P;  1N86 A;  1Q86 Q;  2OYH B;  4GPG A;  2PRR A;  1SQP K;  3D6Z A;  3SV6 A;  4F48 B;  1GL2 A;  1IFN A;  4W7Y A;  4HZH A;  2LXB A;  1GBE A;  1TE0 A;  2K37 A;  1L0L E;  1C2K A;  1AFE H;  4H0L B;  1LDT T;  4UFF H;  4K8Y A;  1HIA B;  2ZHW H;  4ZXX H;  3NUM A;  2NPS B;  2BY9 X;  3GS9 A;  4B2B A;  1SPJ A;  2BB4 A;  5FPT A;  1QVG O;  3MYW A;  2TIO A;  1FC2 C;  2ZYA A;  3UAI C;  5DP7 A;  1GHV H;  1TOC B;  2ZU5 A;  4OS4 A;  4I6M C;  4DCK A;  3RK3 D;  4K1S A;  3WMM 0;  1JY3 N;  4MPV A;  1C5T A;  5C1X A;  4OGX A;  1SGI B;  2R0L A;  2VVC A;  3WU2 E;  3ITK A;  3BSQ A;  2B87 A;  1XUI A;  3B71 A;  2FI4 E;  4GT1 A;  3MH6 A;  2ZWL H;  3OFN D;  2PKA B;  3FOA A;  3HD7 C;  1EOL A;  1JNM A;  3PLN A;  3PH0 A;  3EST A;  3M3T A;  1LHC H;  4B6F A;  1GI5 A;  2HLD D;  3A89 A;  1LKA A;  3RL0 B;  2EST E;  4ZKP A;  1GHW H;  3MNS A;  1EZX C;  1AQ7 A;  2O8W A;  5DKM A;  4CR5 A;  1SVF A;  3VB4 A;  1AFQ C;  1IHS H;  1MTW A;  4U2W A;  4Y7B A;  1MKW H;  3CXH D;  2AHM E;  4PRO A;  2A06 G;  1EJA A;  4CHA C;  1GZL A;  1E35 B;  1N6X A;  1K0H A;  2BDG A;  1YQ3 C;  3B8E B;  2JH6 D;  3RBZ A;  3QGN B;  2O01 H;  3CX5 H;  1BTP A;  3DFL A;  1D3P B;  1L0L D;  5B66 H;  3PB1 E;  4OGQ B;  1BTZ A;  2K0Q A;  2XYA A;  3CLQ A;  7GCH F;  1NJI Q;  2ZTX A;  1C5W B;  2D2C D;  1GI8 B;  2NU4 E;  1DIC A;  1MBM A;  1FZF A;  2P95 A;  4GHQ A;  2IZ0 A;  2W6B A;  4ZHM U;  1DPO A;  4JZF H;  4YTA A;  2WV4 A;  2GV7 A;  1TLD A;  2F4L A;  5TCC A;  3HK6 B;  3K65 B;  3NCL A;  1K28 D;  3H5C B;  4NIX A;  4L73 A;  3SWF A;  1TGN A;  3IN6 A;  1T8Z A;  3GDU A;  1G3E A;  1SQQ D;  2H9T H;  2R3U A;  4Y71 A;  2CV3 A;  3RC5 A;  3L74 G;  2SFA A;  4ZXY H;  2OXS A;  1A3B H;  2YMS C;  1LVY A;  3HE5 B;  4IN2 A;  2VIO A;  1A5G H;  4U7J A;  1C2J A;  1WTH D;  1XXF A;  3F5H A;  4OM9 A;  1E34 B;  3MH7 A;  2UUK B;  2VGC C;  1DUA A;  4MTB A;  4N6J A;  1S5L X;  5K7R A;  2HGT H;  1LTA C;  2P3U B;  5L30 H;  1T4U H;  1CI6 B;  4BXL A;  1TNG A;  1WBG B;  2CHA C;  2AMQ A;  3S69 A;  3AAU A;  5EQR A;  1CSO E;  5EXN A;  2WSS H;  1J9C H;  4UB8 E;  5EIY A;  3DT0 H;  5B5E H;  1X79 B;  4Q4L A;  1C5S A;  1GMD G;  1NES E;  3C9I A;  2B88 A;  1AO5 A;  1ESB A;  1XXD A;  1IFM A;  1RHZ B;  2JDI D;  3OAA D;  3V7T A;  3UFA A;  4YOJ A;  5JDU B;  2FOD A;  4UEH H;  5CCH A;  1F0T A;  2ALP A;  2L74 A;  5DP8 A;  1RIW C;  2A4G A;  3LC5 A;  2QVA A;  3M7U A;  4JK5 A;  4EI2 A;  3Q5P A;  2AS9 A;  2ZO3 H;  1T8N A;  2QJK C;  3WWB A;  2OTL P;  2KZJ A;  4XD7 D;  1D3Q B;  3M36 A;  1DX5 M;  1ZYO A;  4X2V A;  2WUC A;  2OQQ A;  2J59 M;  3SFE C;  2OYH A;  1KMI Z;  1PP9 E;  4IL6 E;  2OIN A;  4AC9 A;  2OC7 A;  1PPJ E;  1KTM A;  5E2P A;  3HRN A;  2IJO B;  3BIU H;  4I31 A;  3M91 A;  1M1J B;  2KLV A;  2WSE H;  2ZU2 A;  5CBN A;  3P8O A;  3F9E A;  1T8L A;  1O33 A;  2RMZ A;  2KAI B;  3A0B H;  5HKK D;  2E75 C;  3KZI E;  1N73 B;  1H89 A;  2G52 A;  1THP B;  1IQI A;  2ZI2 H;  4WY4 C;  5KKZ B;  1NGM B;  2FI3 E;  2KZI A;  3AE7 C;  1PQ5 A;  1FJP A;  2BD8 A;  2YNB A;  1CA0 B;  1Z56 A;  1NTZ J;  1P01 A;  1DST A;  2E43 A;  1ELT A;  1JIM A;  3T25 A;  2K8I A;  1EJN A;  2VH0 A;  4Q63 A;  2A45 H;  1TMT H;  1A5I A;  2YXR B;  3PJS K;  2PHB A;  1HAZ B;  2YIU B;  5CCG A;  4MNY A;  1EAW A;  1UK3 A;  5KAF H;  4A7P A;  1ZMJ A;  3OX7 U;  1C2M A;  3VFE A;  4Y76 A;  2OYI B;  2ANM H;  1KIL B;  3TNU B;  1CHO G;  3RXG A;  2I1J A;  1KQG B;  2ZT9 B;  1WCZ A;  2KCP A;  1FIW A;  4KKD A;  2BQW B;  1Y5U T;  9LPR A;  5DP4 A;  2FYU G;  5EXL A;  1K04 A;  1PP9 D;  1VQ4 P;  2W6I D;  1PPJ D;  3SHA H;  4ZUH A;  2KUB A;  3P32 A;  3HTK B;  3BG8 A;  3U1J B;  3A7O A;  1ZP0 C;  3U1A A;  3JSV C;  2VWL A;  2W6J H;  1DSU A;  1ZME C;  1MFT A;  2ZDL A;  1A02 J;  1L2E A;  5C94 A;  1VIT F;  1BHX F;  2ZFT A;  3SV9 A;  1N7S A;  1O3G A;  5DSF A;  1B0F A;  3SGB E;  3I5C A;  5DP9 A;  4ZRO A;  1EDK A;  1SQX G;  1UHB A;  3DFJ A;  2O01 J;  3AE3 C;  2E75 D;  1EB1 H;  4XBB A;  3GMA A;  4A1V A;  4I7Z C;  2C90 B;  2ZEB A;  2P16 A;  2ZC9 H;  2KZ4 A;  3A0H H;  2WTY A;  2XBW A;  2JJL A;  3TGU G;  3ABV C;  1JEK A;  1J16 A;  1MAB B;  2QE7 H;  3H1J G;  3V4W A;  2F9N A;  4Y79 A;  5F8T A;  3AED C;  3U8T H;  5CDF E;  4B2A A;  3OA7 A;  1RF0 A;  3LID A;  5C17 A;  1SG8 B;  4ASV A;  2G8T A;  1HAV A;  1DOJ A;  1KFM A;  1L4Z A;  3H1L J;  4MNV A;  1HJ0 A;  4N78 E;  4Y8Z A;  1S72 P;  4B73 A;  2NU2 E;  3SU0 A;  1W12 U;  3BCC G;  1MKX H;  4IGD A;  1NKZ B;  1T4V H;  4AGK A;  1GHB G;  1KSN A;  2OP9 A;  1FZC B;  4B71 A;  3Q3D A;  4YOI A;  3RXV A;  3VXF H;  2AYW A;  1G2M A;  2F9O A;  1KB9 I;  4Z1M H;  1COW D;  1S85 A;  3EYD A;  1L0N G;  1S0Q A;  2L6O A;  5EQQ A;  5JBA S;  3QTO H;  2GGV B;  4Y10 E;  2WZ7 A;  4L75 A;  4K8B A;  3BTW E;  5AFZ H;  2WMM A;  1GL2 C;  1WXR A;  1C5M D;  3H7O A;  4HFP B;  1C2H A;  1MUU A;  1OIP A;  1BTH H;  3RXQ A;  1YPG H;  2SGP E;  2N1T B;  2FS8 A;  1VQO P;  5TIS E;  1Y3W A;  3ZV8 A;  2FOE A;  4Y0Y E;  4OS5 A;  2IFN A;  1EZV I;  1C1Q A;  2GV6 A;  8GCH F;  1H4W A;  3AEC C;  1C2I A;  4WH8 A;  1AMH A;  1E37 B;  1MAY A;  3E91 A;  1P84 E;  4RO0 A;  1TAL A;  1GMC F;  1JOU B;  2FOG A;  3Q1M A;  3IG6 B;  5KLI B;  2Y80 A;  1Y5B T;  4H13 B;  4CRB A;  5L2Z H;  2ZA5 A;  4D6T E;  3EGK H;  1PPC E;  3KQD A;  1HGV A;  1GMJ A;  4FUJ A;  1HJA C;  2PV9 B;  4FUG A;  2R5B A;  4N78 D;  5APX A;  4J2Y B;  3EQ0 H;  2WUB A;  2ZNK H;  2Q1K A;  3DSG A;  4AG1 A;  5JB9 S;  1VQ5 P;  2SGD E;  1SFC C;  1ELD E;  1R5L A;  2FYN B;  4NSV A;  1AU8 A;  4WWY A;  4WB4 A;  4EST E;  2QJY B;  1XTG B;  2IBZ E;  1BA8 B;  2BY8 X;  1HNE E;  2AXT H;  2XC0 A;  3PO1 B;  2VJ1 A;  5KJ7 A;  1ABJ H;  1JCD A;  2AXC A;  1TNH A;  1FZA A;  3F0P A;  2VIV A;  3S7K B;  1D9I A;  1MH0 A;  2ZVO B;  1HV7 A;  1P02 A;  1MMJ N;  2ZVN B;  4ZAE A;  3L71 J;  1INC A;  3E1I A;  1Z6J H;  3SW2 B;  5LPE A;  2G5V A;  2P58 A;  1RE3 A;  1A02 F;  2LXC B;  3A80 A;  4B6E A;  1WAY B;  3BTQ E;  1SLU B;  1LTJ C;  1NRP H;  3FP7 E;  3NWU A;  2O8M A;  1B7X B;  3TNU A;  2BLQ A;  3HUS A;  2F91 A;  1TFX A;  1T3J A;  1KXF A;  2A7J A;  2ZG0 H;  2Y81 A;  1NBM E;  3H1H J;  1Q82 Q;  1GVZ A;  3ZVD A;  1X9V A;  2LPR A;  2OAR A;  4WF8 A;  3FZZ A;  2AGI X;  4DOJ A;  1T8O A;  2XBY A;  1C1N A;  2P3T B;  3HTK A;  3DHK H;  4DUR A;  3T29 A;  1SR5 C;  1GBA A;  1O5A B;  4X8S H;  1H0T A;  2WSF H;  2ZAE B;  5FXL A;  3TK6 A;  3GCH C;  1BDC A;  1GJA B;  4GAW A;  4U32 A;  1HVV A;  3N7O A;  2TGA A;  3V12 A;  3AEG C;  4YT6 H;  1UJ1 A;  1BGY J;  1TRY A;  2P3F H;  1NFU A;  3UOU A;  1WMK A;  2ZHF H;  1MUE B;  1TPO A;  3CCQ P;  1W14 U;  1NS3 A;  2WT7 B;  3AAV A;  3VGC C;  4AYC A;  2ZTY A;  3TGK E;  1Y9B A;  2JJ1 D;  2P2U A;  2IYO A;  2KI7 B;  1MZA A;  2H5D A;  4RI0 A;  3AK5 A;  3SJ8 A;  1LJ2 A;  1DH3 A;  1V2O T;  1JTH A;  5GTI H;  4LGD E;  1O2V A;  2A1D B;  4I8L A;  4KGA A;  4ZKU A;  5CJ4 A;  1ZPB A;  1ZGV A;  1BOQ A;  3VP8 A;  1OXZ A;  4GLY A;  3O6Q B;  3U98 H;  1G1I A;  1V2L T;  5CCH C;  3GHG A;  1ZHP A;  4JCN A;  1LT9 B;  1AVG H;  1NBM D;  4A6L A;  1FZC A;  2WIT A;  2Y5G A;  3TGJ E;  3S7H B;  3H32 B;  4GSO A;  3CWB J;  2G8Y A;  1NU1 J;  2HNT F;  1QJ7 B;  3LOX A;  2YO2 A;  2G4T A;  5CJ0 A;  1FV9 A;  5H2F H;  1T2K C;  2FTL E;  1U57 A;  2G4U A;  2OYH C;  3OY6 U;  2VNT A;  2C0X A;  4K2Y A;  3FGA D;  1P8V C;  4MPU A;  4NSY A;  3MUD C;  1TRM A;  2XCF A;  5KGO A;  3CCJ P;  4R4M A;  4SGA E;  3ZZ8 A;  4ISO A;  2Y6T A;  2NPS C;  1Y47 A;  5EPY A;  5A0A E;  5AVU B;  2A5K A;  2BD9 A;  2BDH A;  5FPY A;  2Q3E A;  2XNX A;  1E36 B;  1TNK A;  2ZXE B;  1IQN A;  5DK1 A;  1NTK G;  2MKV A;  2JET B;  1S81 A;  2QRX A;  2C9N Y;  1QFK H;  2VBC A;  3HKJ B;  2I8D A;  2Y9Y A;  4AN7 A;  1GBH A;  1SQV G;  2FXR A;  4NGA H;  3P7K A;  2ZDN A;  3R0F A;  3GY7 A;  3AEB C;  1F92 A;  2FEQ H;  2PGQ B;  1FS0 E;  5A8Y A;  3B23 B;  1VL2 A;  2J92 A;  1YM0 A;  1NRS H;  3CME P;  3UR9 A;  3T97 B;  4BTU B;  3L73 E;  1L1N A;  1QB6 A;  1N7L A;  1UIX A;  1KDQ A;  2ZFQ H;  5CCH D;  2KK7 A;  3RL0 C;  2QM7 A;  1PPB H;  1W7X H;  4Q7X A;  2XWA A;  1AD8 H;  1GJ5 H;  1UTN A;  4NPD A;  1O5D H;  3BG4 C;  1NM6 A;  2B89 A;  3T5F H;  1BTW A;  3T62 A;  1GVL A;  1K1O A;  3HD7 A;  1LQE A;  3GY6 A;  1KXA A;  2ZHQ H;  3SGQ E;  1HXF H;  3GCT F;  4XDE A;  3SQE E;  3C1K A;  1YC0 A;  2QM8 A;  1P57 B;  5KLV G;  3GCN A;  2J38 A;  3H1K E;  1HUC A;  4OGQ C;  1LTO A;  1YYC A;  3M9Q A;  2GDD A;  2RG3 A;  1MCV A;  3FXE A;  5E0H A;  3L70 G;  1AHT H;  4Y8Y A;  3RXS A;  3ZV9 A;  3B4S A;  2A7H A;  2NU0 E;  4FET A;  3S9O A;  2B9L A;  1LMW B;  1LVO A;  5GJ4 B;  1QJ1 B;  2ZDM A;  3SYJ A;  1USD A;  1H9I E;  2BY6 X;  1TX6 A;  3H25 A;  2RN0 A;  4ABG A;  5BVZ A;  2HLC A;  4H44 D;  3GDS A;  4M3L A;  3UOP A;  3QLP H;  3CNR A;  4CR9 A;  3ZVA A;  2JH0 D;  1ZR0 A;  2IPP A;  3QX5 H;  1RF0 C;  1FZZ A;  3KQG A;  1CE5 A;  4DT0 A;  2QF3 A;  4NIW A;  3GF3 A;  1JRT A;  4U01 A;  1GJD B;  3TK5 A;  3L72 G;  1FLE E;  2ANW A;  3H09 A;  2J2U A;  5DG6 A;  5CCG D;  1FQ3 A;  3L73 D;  2KM0 A;  1HH0 A;  1OZH A;  3L74 J;  1O3K A;  1SQA A;  4ZHA A;  1GHA G;  3P95 A;  1K73 Q;  1EQ9 A;  4E05 H;  3SUG A;  2I6Q A;  1BRA A;  2WSF J;  3A7W A;  4GCH G;  2IYP A;  1RTF B;  5LH8 A;  1BCU H;  1HAH H;  2FDA A;  2ZFC A;  2FYZ A;  2WT7 A;  5AW7 B;  4O3T A;  3NXS A;  2HOD A;  4K5Z A;  2O1K A;  1RTK A;  1URQ D;  1RTL A;  2UWL A;  4U3F G;  1QQ4 A;  2AEJ A;  3OYP A;  5C67 A;  1ZPC A;  4DW2 U;  1F2S E;  1QCP A;  1VJ9 U;  2O01 N;  4JQ0 D;  3TK1 A;  1JY3 P;  1S5L E;  1SQP G;  2VB0 A;  3KYG A;  2BVX H;  1K21 H;  1O3F A;  1SL3 A;  3H1K D;  2OC1 A;  3OY5 U;  3QUM P;  5C5O A;  3A7V A;  1VQ6 P;  2QIQ A;  3BTG E;  1XUF A;  5AVS B;  4TLF A;  3S4R A;  3LT3 A;  1IFI A;  4TWY A;  1P04 A;  1N7S D;  2IN2 A;  4GHT A;  4YO9 A;  3K6Y A;  4IMZ A;  4YT7 H;  3RU4 D;  4X6N A;  1XUK A;  4DT7 B;  1O37 A;  4PJ0 H;  4ABH A;  3L75 G;  1KYO H;  5I25 A;  3QZQ A;  3CX5 E;  1QB1 A;  2AMD A;  1H1B A;  2KR7 A;  2VWN A;  1BE3 G;  1K9M Q;  4H6T A;  4X8U H;  1S9K D;  5B66 E;  5BPE A;  1NTZ D;  3B5N A;  3FWL A;  3M35 A;  1J1E C;  1M1J C;  2C3S A;  4IC6 A;  1HCG A;  3SU1 A;  1KLT A;  4WVZ A;  4TWW A;  1QGF A;  3Q00 A;  4BTT B;  3EDX B;  2KB7 P;  1GVK B;  3UPE A;  4D7G A;  3U28 C;  3E7K A;  1BTU A;  4FUH A;  3VMA A;  2CF9 H;  1N73 C;  1GHZ A;  3IR9 A;  2PUQ H;  1JMM A;  2ZU3 A;  1O2I A;  4O3U A;  3TIT A;  5KED A;  1JY3 O;  5KKZ C;  3H1I E;  1TBR H;  4H4F A;  3A86 A;  1AGJ A;  4DII H;  3MTY A;  1CA0 C;  5TJX A;  2J98 B;  3SV8 A;  3GDV A;  3I56 P;  5F6M A;  2OYO A;  1NKN A;  2N9B A;  1RQV A;  1P9S A;  2XV5 A;  1RE3 C;  1L1G A;  1Q31 A;  2YIU C;  4NFE A;  3OSY A;  4WY4 A;  3ZZA A;  4INL A;  1UTO A;  3ZZC A;  4JF7 A;  4X1S U;  1GK4 A;  2OBO A;  3QGJ A;  1KIL C;  1ZGI A;  1LTS C;  2ZT9 C;  2FXO A;  2JEE A;  1E1R D;  1OWK A;  4JZI A;  3BTT E;  2Q1J A;  4ACA A;  4AG2 A;  4D8N A;  5ABW A;  1PGP A;  5HM2 A;  2WPK S;  2F9V A;  1PV3 A;  1S1C X;  3SSU A;  1DXP A;  4PV1 B;  3CX5 D;  1YGC H;  1DE7 H;  1Z8J B;  2PW8 H;  3Q77 A;  5F8Z A;  2XNI A;  1SFQ B;  1GU4 A;  3LGW A;  1NTM E;  1VF5 B;  2FYU J;  4ABF A;  4BAM B;  5GCH G;  2HNT C;  5EG4 A;  1XUH A;  2ZHE H;  3RXJ A;  1AFO A;  4WY3 A;  2OK5 A;  1CU1 A;  2IDB A;  3GCO A;  3MWI U;  2B8O H;  2BQ6 B;  3S9C A;  2QAA A;  1BSH A;  2ZGX H;  4YTP C;  3V13 A;  1BBR E;  3KQC A;  2STA E;  4AOR A;  4I86 A;  1CT2 E;  2WPL S;  3LPR A;  1QNJ A;  2XBX A;  1C4V 2;  2W7U A;  1PPF E;  5KJ7 D;  1GDU A;  5F8X A;  1SQX J;  2Y7X A;  3BEU A;  2Z3C A;  2RFK C;  3L36 A;  3SND A;  1WQV H;  1TPS A;  1ORF A;  5FCK A;  1NN6 A;  1S82 A;  1SKY E;  3TGU J;  4NCY A;  1GMD F;  1AWH B;  1PGQ A;  1XVO A;  3A83 A;  1CSB A;  1JO5 A;  3H1J J;  5L8R J;  4ASH A;  3A0B E;  3RDZ A;  6EST A;  3W95 A;  1TON A;  3ZZB A;  1GDN A;  2R5D A;  1R8E A;  1P84 I;  3S1K A;  1C5V A;  1O5E H;  3ZVB A;  4DCD A;  3GY8 A;  4CRG A;  3RXT A;  1KV4 A;  2WSS D;  1FZC C;  3M5L A;  4CBO A;  1Y3U A;  4AUW A; 
#chains in the Genus database with same CATH homology
 1MFZ A;  1GW3 A;  1IK9 A;  5APS A;  1S9K E;  1FDM A;  1WRG A;  1RE4 A;  2J59 M;  3M06 A;  2OYH A;  4Y99 B;  1LWU A;  3HRN A;  3M91 A;  1M1J B;  2KLV A;  2WSE H;  2A45 I;  3NFQ A;  3VTP C;  5AVQ B;  1M7L A;  3HD7 B;  2N1T C;  3RL0 D;  1JY2 O;  1KZU B;  1HTL C;  5APY A;  1N73 B;  1H89 A;  4I2L C;  4WY4 C;  5AVV B;  3BVH A;  2CPS A;  2Q7C A;  1FJP A;  1Z56 A;  2E43 A;  3H6P A;  3M9H A;  2Q9I A;  2A45 H;  1LT9 A;  1JUN A;  5CCG A;  3H32 A;  2KOG A;  3EFG A;  2OYI B;  3NTN A;  1KIL B;  3TNU B;  2I1J A;  2FYU K;  5APW A;  4C46 A;  1H8A A;  1ZV8 A;  1MZ9 A;  2XDJ A;  2MJZ A;  3PP5 A;  2W27 A;  3M0D A;  1PFI A;  3P32 A;  3HTK B;  3A7O A;  3U1A A;  1FAV A;  1SFC A;  1J2J B;  2HOD B;  3G3Z A;  3OJA B;  1A02 J;  4JYB A;  1T3U A;  1CZQ A;  4W80 A;  1N7S A;  1ZLL A;  2YNY A;  3I5C A;  1SQX K;  2M8R A;  1L4A D;  3P8M C;  1NTM K;  1RY3 A;  5CMZ A;  2H8P D;  2CPB A;  4C7N B;  2WTY A;  2JJL A;  2POH A;  1LTJ A;  2XKM A;  3V4W A;  3OA7 A;  1RF0 A;  3LID A;  1SP4 A;  3T97 A;  2OYI C;  1QL2 A;  5AVT B;  2FFD B;  1KFM A;  4N78 E;  1FZB A;  3B5N B;  1G1J A;  1NKZ B;  2FKW B;  2HLO A;  2L5G B;  1X8Y A;  1FZC B;  1L4A A;  2IFM A;  3IFM A;  4EIJ A;  2P1J A;  1GD2 E;  5APT A;  1L0N K;  2H7H A;  1FU1 A;  1G2C A;  2WZ7 A;  1GL2 C;  3VYI A;  3HD7 D;  1H88 A;  2BAS A;  1MUU A;  3RK2 B;  3HE4 A;  2N1T B;  3V4Q A;  1NTZ K;  2Q5U A;  4GKG A;  5CCG C;  2IFN A;  2A45 G;  4WY4 B;  2IX7 C;  5BU8 B;  5AW6 B;  5AVY B;  4XA4 A;  2P67 A;  1URQ C;  1RF1 A;  3B5N C;  1HGV A;  3M0D C;  2YMY A;  2R5B A;  4N78 D;  1LTB C;  5APX A;  1KIL D;  3VMX A;  4EOT A;  1KFN A;  1SFC C;  1N2D C;  4RES B;  4WB4 A;  1XTG B;  1L0L K;  5AW4 B;  5KJ7 A;  1FZG A;  1JCD A;  2Z4E A;  1FZA A;  1NO4 A;  1N7S C;  3MUD A;  3CI9 A;  1FOS E;  3RK3 C;  3U59 A;  3E1I A;  3RK2 C;  2YO3 A;  1RE3 A;  1A02 F;  2NPS A;  1J1D C;  3CL3 D;  3MGN A;  3OAK A;  1LTJ C;  2I1K A;  2HPC A;  3TNU A;  3HUS A;  1SQQ K;  1T3J A;  4GIF A;  2KSJ A;  3VMZ A;  1X9V A;  2OAR A;  1SLQ A;  1FBM A;  3L35 A;  1MV8 A;  4DOJ A;  3R2P A;  3HTK A;  3P8C E;  2WSF H;  3B5N D;  2Q3I A;  1HVV A;  2HG5 D;  3A3Y B;  1LWU B;  1GW4 A;  3V2R A;  2HYN A;  4C7N A;  1OWA A;  2WWW A;  2WT7 B;  2FXM A;  4AYC A;  2P2U A;  4IFF A;  3NMD A;  1YTZ T;  4DZO A;  1DH3 A;  1JTH A;  3RK2 D;  4LGD E;  1GL2 B;  2XU6 A;  2FFD A;  4ZKU A;  5CJ4 A;  2N1T D;  2Z5I A;  3VP8 A;  1OXZ A;  2P7J A;  1GTW A;  1G1I A;  5CCH C;  1RF1 C;  3GHG A;  4WY4 D;  3BAT A;  1LT9 B;  2PAJ A;  1FZC A;  2WIT A;  3V2P A;  3N7N A;  3H32 B;  2WPR A;  1IC2 A;  2YKO A;  4B86 A;  1W2E A;  3TSI A;  2W6A A;  4O9B A;  3MTU E;  2YO2 A;  4LLH A;  1IJD B;  3HE5 A;  5CJ0 A;  1T2K C;  1RE4 C;  2OYH C;  3P8C D;  2C0X A;  5KJ7 C;  1LWU C;  3EQ2 A;  2YKP A;  3KPE A;  4IFM A;  1URQ B;  4KHX A;  1CI6 A;  1HBW A;  2NPS C;  1SFC B;  5KTB A;  5AVU B;  2XNX A;  1NTK K;  1WT6 A;  2R32 A;  2ZXE B;  1NWQ A;  3KYQ A;  1HGZ A;  1N7S B;  3V2N A;  3HUS C;  3V5B A;  1DEB A;  2C9N Y;  5AW3 B;  3RK3 B;  1SQV K;  5AVR B;  1YTZ I;  3V2Q A;  3P7K A;  1J1D B;  1LT9 C;  1HJB A;  2E42 A;  1LTJ B;  3BRT B;  1EQ7 A;  2GM4 A;  5APU A;  3U1C A;  1IFD A;  1N7L A;  5CCH D;  3RL0 C;  2QM7 A;  4JYC A;  1M1J A;  5AW8 B;  5AW9 B;  2J58 A;  3HD7 A;  4XE5 B;  4HH2 A;  1JCC A;  2WPQ A;  2C0W A;  2QM8 A;  5KLV K;  1ZR4 A;  1N73 A;  1JOC A;  1VPC A;  1NAF A;  1HUC A;  1DX7 A;  1YYC A;  3M9Q A;  3L4F A;  1G2C B;  5AVX B;  4I1L A;  1QL1 A;  3N4X A;  3KDP B;  3O8Z A;  3HE4 B;  4AQR D;  3GHG C;  5BVZ A;  1ZR2 A;  1AQ5 A;  4M3L A;  1GL2 D;  3LW5 H;  2IPP A;  2OYI A;  1GDT A;  1RF0 C;  1KIL A;  3KQG A;  1GK6 A;  1NU1 K;  5CCG D;  3L37 A;  1J1E B;  1HH0 A;  1RF1 B;  3M0A A;  1HWT C;  1IO4 A;  1L4A C;  2ZFC A;  2FYZ A;  1NHL A;  2R3C A;  5AW7 B;  2WT7 A;  3BRV B;  5CHX A;  3NXS A;  2HOD A;  2O1K A;  2WSC H;  2O1J A;  1URQ D;  1N86 A;  2OYH B;  2XZR A;  1SQP K;  1LTT C;  1GL2 A;  3TK1 A;  1JY3 P;  1IFN A;  4IFD K;  4W7Y A;  2M3B A;  2LKM A;  1SFC D;  5AVS B;  5AW5 B;  3MIW A;  2NPS B;  1IFI A;  1N7S D;  3A5T A;  4I6M C;  3RK3 D;  2HPC B;  3WMM 0;  1JY3 N;  3HUS B;  1E5W A;  4Y99 C;  3SWY A;  1S9K D;  1LGH B;  1URQ A;  3B5N A;  1J1E C;  1M1J C;  2HFE D;  4GT1 A;  2KB7 P;  3HD7 C;  1JNM A;  2C9L Y;  4C7R A;  2GUV A;  1N73 C;  3IR9 A;  1JMM A;  3RL0 B;  1JY3 O;  4ZKP A;  2Z5H A;  1SVF A;  2GUS A;  1GZL A;  1FJK A;  5AVW B;  2YKQ A;  3B8E B;  1NKN A;  2N9B A;  2XV5 A;  2N1T A;  2O01 H;  1RE3 C;  3VMY A;  2H43 A;  1SQB K;  4W7Z A;  1CW5 A;  4WY4 A;  3CLQ A;  4JF7 A;  5AW1 B;  1GK4 A;  2KP8 A;  1VDF A;  1KIL C;  2KYV A;  1JTH B;  1LTS C;  2JEE A;  3MD0 A;  1FZF A;  2W6B A;  1GU5 A;  5BU5 A;  5AW2 B;  3M9B A;  5APQ A;  3GHG B;  1NH4 A;  3SWF A;  2WPS A;  1GU4 A;  1ZN5 A;  3LIE A;  1T8Z A;  3II6 A;  1NOH A;  1AFO A;  3HE5 B;  1FOS F;  5AVZ B;  2VRS A;  3BAS A;  4N6J A;  1LTA C;  1CI6 B;  3VOP A;  1L4A B;  1IFJ A;  1T2K D;  1LTG C;  5KJ7 D;  1KQL A;  3VN0 A;  1JY2 P;  1X79 B;  3L36 A;  3C9I A;  3VP9 A;  1CSB A;  1IFM A;  4HYT B;  1JO5 A;  2NPS D;  2FFD C;  5AW0 B;  3TYY A;  2R5D A;  4WBA A;  4N3Y B;  5CCH A;  1XTC C;  3A2A A;  4LC1 A;  3UIA A;  5APV A;  1FZE A;  1LTI C;  4OH8 B;  2PP6 A;  1FZC C;  1JY2 N;  4AUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...