5K5GB

Structure of human islet amyloid polypeptide in complex with an engineered binding protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
44
structure length
44
Chain Sequence
GGEIVYLPNLNPDQLCAFIHSIHDDPSQSANLLAEAKKLNDAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Islet amyloid polypeptide
publication title Structure of human islet amyloid polypeptide in complex with an engineered binding protein
rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 15
structure length 44
sequence length 44
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5k5gB00
1LT1A 2UWJE 4HJGH 1X0TA 5EFWB 2HR3A 2I8DA 2KI7B 4ZNCA 4KJMA 2LXBA 5K5GB 1Y47A 1U7MA 1EDIA 2KZJA 1OVVA 1JM0A 1DEEG 1SS1A 4ASWA 3ZDMA 5C39A 1U7JA 1BDDA 1FC2C 2KIKA 3MHVA 5CBNA 1OVUA 4HKZH 5DJTB 1JMBA 2SPZA 1NVOA 4IOIH 4NPFX 4GODA 4MN4C 3FXDA 2LXCB 1EDKA 4JBZA 1H0TB 3QWOC 3MZWB 2RKLA 1H0TA 5CBOA 2LR2A 2M0BA 2JWDA 3PH0A 1EDLA 1OVRA 4GOEA 2R44A 2KUBA 1MFTA 1BDCA 3RGUA 4CPGA 2B88A 4HB1A 2K3RA 4ASVA 2B87B 4NPEA 5DJUB 2B87A 2M5AB 4GOFA 2M5AA 2KZIA 3S1KA 3FXEA 2Q1KA 2P58A 1LP1B 2OTKE 1ZXGA 4K35A 2QRXA 2WMMA 1LP1A 2KS1B 4K3AA 1ZW0A 2ZAEB 4EYYQ 1S3JA 4NPDA 1EDJA 4BXLA 1EC5A 2QVAA 4WWIA 4ZMDA 1Q2NA 2B89A
chains in the Genus database with same CATH superfamily
3HE4A 3MP7B 3CX5I 4IL6H 5AW6B 1X0TA 3CLQA 3KHUA 2CPBA 2YO2A 5H2FH 1IC2A 2GUVA 2QJPB 1FU1A 3RK3E 1FAVA 1K8AQ 2QM8A 3WMM0 3IFMA 1YQ4C 2PRRA 3A3YB 3H1KJ 1L4AD 3RK2C 3AE3C 1L0LG 2KP8A 2QJPC 3GLMA 2OYOA 2KNCA 2O01H 3L71J 3QWOC 5APUA 1NTMJ 3MIWA 2FBWC 2IZ0A 2A45I 2FFDB 1NJIQ 3KQGA 5AVYB 3BATA 4OVNF 2B87B 1VQNP 5KJ7D 5AVZB 3I56P 1SQXE 5AW3B 3D71A 1FS0E 1NTMD 5APXA 3W67A 1QX8A 2O01J 2FFDC 4N6JA 2YKOA 3E1IA 1L0LK 4EYYQ 3H1JE 2N1TC 3KZIH 1Q90D 4BXLA 3L74J 5APVA 3TGUE 2Y0CA 4N3YB 3N4XA 3H25A 2AEMA 1CI6A 1FZCA 2R3CA 3CX5E 5KTBA 1N73B 3Q1MA 2KYVA 2A45G 1NU1J 3CXHI 1KFNA 3CC7P 1KV4A 2HFED 2WTYA 2IBZD 4M3LA 4PV1D 1RE4A 4DZOA 4WY4B 1SFCD 1H89A 1N73C 4ZKUA 1KQSO 3CCVP 1E5WA 3AE8C 2WSSH 1SQPG 3GHGA 4W7ZA 1J2JB 1SVFA 2J58A 5KLVD 1FDIA 3MUDC 1RQVA 3G9RA 2H88C 3OA7A 1GU4A 3RBZA 4OH8B 2HPCB 5CCHD 4DJGA 5BU8B 3V5BA 2P58A 2P7JA 1M1JB 2K1AA 5AVRB 1GL2D 2E76D 3A0HH 2QJYC 1SQXJ 4H44D 4JYBA 4WWIA 1S2EA 1L2PA 4UB6E 3AE5C 2H8PD 4HJGH 2HR3A 1M1JC 2I8DA 4IFFA 3L37A 1VQ6P 1WT6A 3BCCJ 2JEEA 3A5TA 3I5CA 2HYNA 4ZNCA 1PZQA 2WVRA 5KLIB 1RF0C 3WUVA 1SP4A 1P84I 3CL3D 1JM0A 1U7JA 3RK3B 1JCDA 1JOCA 3CXHE 4ZKPA 5CBNA 1VF5C 1NTZE 1NTZK 3CCJP 2WT7A 3EFGA 5KLIC 2OYHB 4JBZA 3CCLP 3UIAA 1N86A 1OMIA 1RE3C 2WPSA 2Z5HA 3NFQA 1GK4A 1ZRTE 3RK3C 4AQRD 3H1HG 1DD4A 1SQQG 2M3EA 1NTKG 2Q6QA 1T2KD 2OYHC 1QL1A 4H13C 3HRNA 4C46A 3HE5B 1PPJE 2WITA 1LP1B 3E1RA 1BCCE 1SQBG 2QA4P 4GDOA 1ZW0A 3WUTA 2ZYGA 3RL0B 3CC4P 3SSUA 4XA4A 1EXJA 2N1TA 3HE4B 2P10A 1Q2NA 1SQVE 1UIXA 2AEFA 3M9BA 5APWA 1SQVK 2XV5A 1NTKK 3RL0C 2FKWB 1IFNA 2QJKB 4JF7A 3M91A 1KILD 3SWFA 1HWTC 1PP9E 3L70J 1LTSC 2W6BA 3LIEA 4BRYA 1P84E 1SQBE 1SQBK 3U59A 4JPZB 4GKGA 2KNCB 4NPFX 1USDA 1N73A 3WU2E 1M1KQ 2QJKC 1J1DC 5AVXB 2AEJA 3L75G 2Y9ZA 2ZXXA 1VQ7P 2NPSA 1OVRA 4GOEA 2DW3A 1SQPD 1GDTA 3K5BA 1JB0J 1BE3G 1ZR2A 3H1LJ 3MUDA 3FWNA 3HUSC 1RF1C 3V2NA 2O1KA 3B5NA 1T8ZA 2WSCH 2M3BA 3H1IG 1YJ9P 1YQ3C 2KB7P 4N78D 5KKZC 4H0LD 4D6TJ 5CHXA 3IAOA 3CI9A 1HGVA 3H1LD 4LC1A 4NPDA 3H1KG 3MD0A 1PGQA 2ZT9D 5E79E 3VMAA 2GA1A 1ZP0C 3L35A 4DCKA 2I1KA 1FOSE 1LT1A 3BRVB 1RQUA 1OZHA 2KSJA 5CCGC 2BCCE 4XE5B 1CI6B 1FZCB 2FYZA 3RBXA 2E42A 3CWBG 1BGYJ 3L71G 4D6TD 2WSCJ 4R4MA 1GU5A 4U3FG 4Y99C 4LLHA 2FXOA 3CCQP 1EZVG 2YMYA 1NGMB 5AVVB 1S9KD 1ZV8A 3Q5RA 1KYOH 3VMZA 2R3SA 1FZCC 1BGYD 1FC2C 1MZ9A 2ZJSE 1N7LA 1YTZT 1YITP 3FX0A 1S5LX 4EDFA 1NO4A 1R8EA 4L76A 3H1KE 2SPZA 3HD7D 3V2RA 3MZWB 4IL6E 5AW8B 3GHGB 5CBOA 1RE3A 2M0BA 1RE4C 2JWDA 2KSEA 1DX7A 5H2FE 2IPPA 1NTME 1URQA 1S72P 2KLVA 3Q5SA 4ASVA 5KAIH 3AEEC 1SQQD 1LWUA 1HUCA 1JMMA 3S4RA 1KN7A 2OTKE 1KB9H 1PGJA 1NU1G 3TSIA 2OARA 4RO0A 1IZNB 2K9YA 1G2CA 3L36A 3ITKA 2KLUA 2C0WA 4GT1A 2H43A 1YJWP 5GTHH 1GK6A 2IDBA 3L74E 1HH0A 1VQOP 4A7PA 3KXDA 1Y47A 3BVHA 1M90Q 3CD6P 1FDMA 1Q86Q 1OW7A 1AFOA 2FYUJ 3EQ2A 3KPEA 4YXDC 1OFCX 1NU1E 1IK9A 3LW5H 3RK2B 1VQ5P 1NU1K 1JTHA 3KZIE 2WT7B 4AYCA 1LJ2A 1SLQA 1L0NJ 4MN4C 3FXDA 1KB9D 2JR8A 4I1LA 2FYUD 1SQXG 1VDFA 1PGPA 4PJ0E 3L75D 3B4SA 1WRGA 1D7MA 2B88A 1L0ND 1NHLA 3H1JG 3HUSA 1RF1A 3LW5J 2XNDH 1E79H 2ZXEB 3TGUG 5AVQB 1GW3A 1USEA 2E74C 3SFEC 1FBMA 3H1ID 5AW2B 2A06D 1H88A 2KS1A 2OTJP 2FXMA 2N1TB 2W90A 1K04A 2NRGA 1R5LA 2QG4A 1J1EB 3V4QA 2M8RA 1N7SA 1SQXK 1S4XA 3V2PA 5CCGA 3GF7A 3GG2A 3L72D 2O01N 1DD3A 2MJZA 1M56D 1MUUA 4WY4D 3E7KA 1JUNA 3BCCE 3AEBC 4U3FD 1ZOYC 3N7NA 4BRYB 1J1EC 3A7OA 1FZGA 1BSNA 3AE2C 2ZVNB 3AE9C 4PJ0H 1U57A 1JCCA 4WB4A 2H7HA 2JJLA 3A0HE 2RMZA 1AVOA 1K73Q 3V4WA 1TU3F 2YKQA 3SFDC 2NPSB 5CJ0A 2E75B 2JWAA 2WWWA 1L4AC 3S9OA 1BDCA 2BEZF 1OX3A 5KLVJ 2Z4EA 3VN0A 3B5NB 4NPEA 3L73J 1GTWA 2Y0DA 2M5AA 1GMJA 2NPSC 2E75C 2G8YA 4TLFA 3IF4A 1YBKA 5L8RJ 3H32A 3L70G 4PD4H 2CPSA 2WSFH 4C7NA 1NYHA 2QJYB 1KQGB 3RL0g 5KJ7C 3B5NC 1Z56A 3L73D 1NWQA 1FJPA 4DOJA 2N9YB 3RK3D 1YI2P 1JEKA 2AXCA 1NTZG 1DIPA 1PIXA 5AW7B 4RESB 1SS1A 4ASWA 3VP8A 2WSFJ 3AEDC 1BDDA 5KAFH 1FZBA 3L70E 1VF5B 2XDJA 3M9QA 3CCSP 3CPWO 1T6AA 2Q5UA 1JY2P 4Z1MH 2LXCB 3AE4C 1KMIZ 2WSEH 1L0LJ 2Q3EA 4PD4D 2O3JA 3P8CE 2PP6A 3GMAA 1PPJG 1URQB 1K05A 1KTMA 1BCCG 1SFCC 4N78E 2KK7A 2J5UA 3RL0D 2LKMA 1KYOI 1LWUB 1GW4A 2WPQA 3H1LE 1AJYA 1L0LD 4H13B 1SQVG 3PRJA 3H1JD 3V2QA 2QRXA 1URQC 3TGUD 3W68A 1G2CB 2D2CB 1LTBC 3G4SP 2WSEJ 1HVVA 3JSVC 1OW8A 4D6TE 1LWUC 3CX5D 1HJ0A 3LIDA 1PP9G 4IFMA 1N2DC 5B66E 2D2CC 5AW5B 1R5SA 1BGYE 4RJTA 1LT9C 3AE1C 2W27A 1KB9I 1DEEG 4WVZA 3QH9A 4W7YA 3BASA 2WPRA 1JTHB 3MHVA 2ZFCA 1Q7YQ 1JMBA 1JY3P 2MKVA 1J1DB 3O6QA 1EDKA 3G71P 2PGDA 1YJNP 1HGZA 3TNUA 3CCMP 3U1AA 4UB8H 2YMKA 2R44A 1SQPJ 5APQA 1MFZA 2Q7CA 1L4AA 4C7RA 2QSIA 3II6A 4HB1A 1KQFB 3HUSB 1RF1B 2FYNB 3WUUA 1KYOE 1LTJB 2E43A 2W8ZA 1LGHB 3VP9A 2Q1KA 2BCCG 5KKZB 1ZXGA 1NOHA 1DH3A 2KS1B 3IN6A 2Z5IA 4K3AA 5B66H 2V4HA 1X9VA 5KJ7A 1W2EA 4ZMDA 1AV1A 1N7SB 2FYNC 4XFJA 1ZN5A 5M1BA 1LTJC 5AW0B 2UWJE 2Q9IA 2XU6A 2RH0A 2BASA 2R5DA 3G3ZA 4KJMA 4Y99B 5KAIE 1IFDA 1IFIA 1EDIA 2K9JA 2KZJA 2XNXA 3TF5A 5APTA 1N7SC 1NTZD 1VQKP 1KQLA 2AXTH 1KB9E 2IBZI 3KYQA 2GM4A 2FYUE 4HKZH 2PFXA 1QEXA 1NTMG 3TDKA 4GODA 1PGOA 2QM7A 3Q3DA 5GTHE 1OXZA 1KD1Q 2R32A 1L0NE 4OGQB 1H0TA 2LR2A 3PH0A 2JKVA 2Y9YA 2OQQA 1SFCA 2BEQD 1PPJD 1VQ8P 3CC2P 2M5AB 2A06E 3H1HJ 2OYIC 1SQQJ 1NTKJ 1FZEA 2YIUB 4OGQC 3FXEA 1RY3A 3L74G 1Q82Q 3H32B 4C7NB 3AEAC 1SQVD 2Q3IA 2YXRB 3VTPC 4IL6X 1M8OB 2IBZG 1LNQA 1NTMK 3IR9A 2IYPA 3L72E 3H1HD 2YO3A 3CCUP 2B89A 1ZMEC 3VYIA 5TISH 1NTKD 1PL5A 4TT3H 2YIUC 5EFWB 2CK3H 3RK2D 2OGUA 3R2PA 1GL2A 1VQ9P 2KI7B 2XKMA 5K5GB 2HODB 1SQBD 3JCUH 5APSA 1LT9A 2KXPB 5C39A 2RN0A 1A02F 4PD4I 3SWKA 2KIKA 1AVYA 3NXSA 1GD2E 2IBZE 1WMKA 1X79B 1S5LH 2RKLA 2JDIH 3TYYA 1X22A 2K37A 2C9LY 3L75J 1MFTA 3NMDA 4I7ZB 3RGUA 2R5BA 1IFJA 3D6YA 2K3RA 1QGKB 4YPCA 5B5EH 2N1TD 3HTKA 5GTIH 5KLVE 3TK1A 1BE3J 5KLVK 1FZAA 1OWAA 3L73E 2V7QH 3O8ZA 5AW9B 3F5HA 2E74B 2WMMA 3H1IJ 4I7ZC 1FJKA 2BCCD 2E5TA 3BCCG 3NTNA 1BE3D 3A0BH 4EI2A 1LTJA 2C9NY 3H6PA 1YTZI 3L72J 2OTLP 3I55P 3B71A 1OW6A 2V7QJ 3CWBJ 2C0XA 3M9HA 5TJHA 1OVVA 1G1JA 4U3FJ 3ZDMA 1JO5A 2NPSD 3H1KD 1VL2A 2E75D 5AVWB 5AVTB 1GZLA 4PD4E 3O6QB 3B5ND 4YXWH 3CWBD 3TNUB 3L71D 3VOPA 2VRSA 1KILA 1MKMA 3B8EB 1EDLA 1VQPP 1L4AB 1EZVD 2KUBA 1L0LE 1QVFO 4B86A 2IZ1A 1QLED 2IFNA 1CSBA 2OYIA 2Y0EA 3C1LA 5KAFE 3T97A 1VQ4P 3M0AA 3R4YA 5CMZA 2K88A 3L74D 5AVSB 2J59M 1LTAC 3P8MC 3P7KA 1BSHA 1RH5B 2P67A 3GF3A 3OAKA 3CMEP 5AW4B 1T3UA 3L4FA 3AE6C 1IFMA 1VF5D 2K9JB 1QL2A 1NU1D 2GUSA 2FY8A 2ZYAA 4BWNA 1FOSF 3FWLA 1KILE 3EFFK 1URQD 4WY4C 5DJTB 3FGAD 1JY2N 1CW5A 5BVZA 4L73A 2E5YA 1H0TB 2HODA 3U1CA 3H1LG 1NAYA 4PV1B 4H13D 4JYCA 1SFCB 2I1JA 3CX5H 2D2CD 4WBAA 3HD7A 1SQPE 5DJUB 1SQPK 2FXPA 4D6TG 1ZR4A 1RHZB 3ABVC 4PV1C 3D6ZA 1LTGC 3H1JJ 2QIWA 4W80A 4K35A 2N9BA 4I6MC 1LTIC 2YXQB 3TGUJ 2L5GB 1SQXD 3CCEP 1HF9A 3AE7C 1Y8AA 1BGYG 1KFMA 4UB8E 3MGNA 4I2LC 3BCCD 4KHXA 1IO4A 1GL2B 2HLOA 1N8RQ 2E76B 1K9MQ 4HYTB 3CCRP 4H44B 2A45H 1LT9B 1FE6A 2G3AA 5CCHC 2IX7C 3P32A 1NKZB 4LGDE 1FDOA 4Y28J 2W6AA 1S9KE 1JY2O 3V6IA 2L91A 1GL2C 3D70A 1JY3N 3PJSK 2E76C 4RKUJ 1AQTA 4H44C 2WPVB 3JC22 3C9IA 1PFIA 1VQLP 4O9BA 4UB6H 1NH4A 2HG5D 1HTLC 1VPCA 1S1CX 3USSA 1IJDB 3AEFC 1YIJP 1M7LA 4EOTA 3HTKB 2FFDA 2ZYDA 2W6JH 2B87A 2YKPA 3PHLA 1N7SD 1T3JA 2AXTE 2KZIA 3S1KA 5CCGD 3H1HE 3M0DC 1SQQE 3CXHH 4IFDK 1NTKE 1SQQK 1W5CE 1QVGO 1A02J 1EDJA 1NAFA 2QVAA 2IYOA 5AVUB 1HBWA 4R4LA 1DEBA 4KT0J 1KORA 1H8AA 4EIJA 2FYUG 1Y9BA 2PAJA 3CMAP 1T2KC 2LXBA 4YTPC 5AW1B 1HJBA 3L70D 1M57D 1G1IA 4OWFA 4OGQD 1NTZJ 2WZ7A 1L0NG 1JY3O 1EZVI 1OVUA 3G6EP 3C8VA 4WY4A 3P8CD 1KILB 1CZQA 3CXHD 3M06A 5TISE 1IFPA 1JNMA 2A06G 1VQMP 4JQ0D 2H89C 2QEXP 3MTUE 1FZFA 2NZ2A 4CPGA 3KDPB 2FYUK 2P1JA 3AECC 3L75E 3Q5PA 1ZRTD 3JCUE 2ZVOB 5APYA 2OYIB 3L72G 1BCCJ 1KILC 4U7JA 2HPCA 3A2AA 1IK7A 3T97B 1L0NK 1YYCA 4HH2A 1P84H 1BE3E 1M1JA 1OIPA 1ZLLA 4QMAA 2ZAEB 1SQVJ 1S3JA 3Q2YA 3WU2H 3H1IE 2JO1A 3PLNA 1S5LE 4DT0A 1BCCD 1RF0A 3SWYA 3AEGC 1LTTC 2O1JA 3OW2O 4H0LB 1UIIA 3VMXA 5B5EE 4GIFA 5GTIE 1PP9J 2ZT9B 1W2BO 1U7MA 3OJAB 1SQBJ 4L74A 5CCHA 3CWBE 2XZRA 3L71E 4H0LC 1YHQP 4U3FE 1NVOA 4IOIH 1PP9D 1EZVE 2KOGA 2ZT9C 1P84D 4AUWA 1EQ7A 5E79H 3VMYA 5CJ4A 2OYHA 5KLVG 3A0BE 3GHGC 1XTGB 5BU5A 2ITAA 4L75A 1AA0A 3L73G 1EXIA 2E74D 2YNYA 1MV8A 2QE7H 1X8YA 3HD7B 1KYOD 2WQYC 1KC8Q 3EWKA 2B9BA 1Q81Q 3BRTB 1PV3A 2W83C 4GOFA 2POHA 1AQ5A 3GW6A 1XTCC 1KZUB 3HE5A 2IFMA 3PTZA 2JP3A 1LP1A 1NKNA 3F89A 3M0DA 3HD7C 2P2UA 2BCCJ 1EC5A 3PP5A
chains in the Genus database with same CATH topology
1LT1A 2UWJE 4HJGH 1X0TA 5EFWB 2HR3A 2I8DA 2KI7B 4ZNCA 4KJMA 2LXBA 5K5GB 1Y47A 1U7MA 1EDIA 2KZJA 1OVVA 1JM0A 1DEEG 1SS1A 4ASWA 3ZDMA 5C39A 1U7JA 1BDDA 1FC2C 2KIKA 3MHVA 5CBNA 1OVUA 4HKZH 5DJTB 1JMBA 2SPZA 1NVOA 4IOIH 4NPFX 4GODA 4MN4C 3FXDA 2LXCB 1EDKA 4JBZA 1H0TB 3QWOC 3MZWB 2RKLA 1H0TA 5CBOA 2LR2A 2M0BA 2JWDA 3PH0A 1EDLA 1OVRA 4GOEA 2R44A 2KUBA 1MFTA 1BDCA 3RGUA 4CPGA 2B88A 4HB1A 2K3RA 4ASVA 2B87B 4NPEA 5DJUB 2B87A 2M5AB 4GOFA 2M5AA 2KZIA 3S1KA 3FXEA 2Q1KA 2P58A 1LP1B 2OTKE 1ZXGA 4K35A 2QRXA 2WMMA 1LP1A 2KS1B 4K3AA 1ZW0A 2ZAEB 4EYYQ 1S3JA 4NPDA 1EDJA 4BXLA 1EC5A 2QVAA 4WWIA 4ZMDA 1Q2NA 2B89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LT1 A;  2UWJ E;  4HJG H;  1X0T A;  5EFW B;  2HR3 A;  2I8D A;  2KI7 B;  4ZNC A;  4KJM A;  2LXB A;  5K5G B;  1Y47 A;  1U7M A;  1EDI A;  2KZJ A;  1OVV A;  1JM0 A;  1DEE G;  1SS1 A;  4ASW A;  3ZDM A;  5C39 A;  1U7J A;  1BDD A;  1FC2 C;  2KIK A;  3MHV A;  5CBN A;  1OVU A;  4HKZ H;  5DJT B;  1JMB A;  2SPZ A;  1NVO A;  4IOI H;  4NPF X;  4GOD A;  4MN4 C;  3FXD A;  2LXC B;  1EDK A;  4JBZ A;  1H0T B;  3QWO C;  3MZW B;  2RKL A;  1H0T A;  5CBO A;  2LR2 A;  2M0B A;  2JWD A;  3PH0 A;  1EDL A;  1OVR A;  4GOE A;  2R44 A;  2KUB A;  1MFT A;  1BDC A;  3RGU A;  4CPG A;  2B88 A;  4HB1 A;  2K3R A;  4ASV A;  2B87 B;  4NPE A;  5DJU B;  2B87 A;  2M5A B;  4GOF A;  2M5A A;  2KZI A;  3S1K A;  3FXE A;  2Q1K A;  2P58 A;  1LP1 B;  2OTK E;  1ZXG A;  4K35 A;  2QRX A;  2WMM A;  1LP1 A;  2KS1 B;  4K3A A;  1ZW0 A;  2ZAE B;  4EYY Q;  1S3J A;  4NPD A;  1EDJ A;  4BXL A;  1EC5 A;  2QVA A;  4WWI A;  4ZMD A;  1Q2N A;  2B89 A; 
#chains in the Genus database with same CATH topology
 3HE4 A;  3MP7 B;  3CX5 I;  4IL6 H;  5AW6 B;  1X0T A;  3CLQ A;  3KHU A;  2CPB A;  2YO2 A;  5H2F H;  1IC2 A;  2GUV A;  2QJP B;  1FU1 A;  3RK3 E;  1FAV A;  1K8A Q;  2QM8 A;  3WMM 0;  3IFM A;  1YQ4 C;  2PRR A;  3A3Y B;  3H1K J;  1L4A D;  3RK2 C;  3AE3 C;  1L0L G;  2KP8 A;  2QJP C;  3GLM A;  2OYO A;  2KNC A;  2O01 H;  3L71 J;  3QWO C;  5APU A;  1NTM J;  3MIW A;  2FBW C;  2IZ0 A;  2A45 I;  2FFD B;  1NJI Q;  3KQG A;  5AVY B;  3BAT A;  4OVN F;  2B87 B;  1VQN P;  5KJ7 D;  5AVZ B;  3I56 P;  1SQX E;  5AW3 B;  3D71 A;  1FS0 E;  1NTM D;  5APX A;  3W67 A;  1QX8 A;  2O01 J;  2FFD C;  4N6J A;  2YKO A;  3E1I A;  1L0L K;  4EYY Q;  3H1J E;  2N1T C;  3KZI H;  1Q90 D;  4BXL A;  3L74 J;  5APV A;  3TGU E;  2Y0C A;  4N3Y B;  3N4X A;  3H25 A;  2AEM A;  1CI6 A;  1FZC A;  2R3C A;  3CX5 E;  5KTB A;  1N73 B;  3Q1M A;  2KYV A;  2A45 G;  1NU1 J;  3CXH I;  1KFN A;  3CC7 P;  1KV4 A;  2HFE D;  2WTY A;  2IBZ D;  4M3L A;  4PV1 D;  1RE4 A;  4DZO A;  4WY4 B;  1SFC D;  1H89 A;  1N73 C;  4ZKU A;  1KQS O;  3CCV P;  1E5W A;  3AE8 C;  2WSS H;  1SQP G;  3GHG A;  4W7Z A;  1J2J B;  1SVF A;  2J58 A;  5KLV D;  1FDI A;  3MUD C;  1RQV A;  3G9R A;  2H88 C;  3OA7 A;  1GU4 A;  3RBZ A;  4OH8 B;  2HPC B;  5CCH D;  4DJG A;  5BU8 B;  3V5B A;  2P58 A;  2P7J A;  1M1J B;  2K1A A;  5AVR B;  1GL2 D;  2E76 D;  3A0H H;  2QJY C;  1SQX J;  4H44 D;  4JYB A;  4WWI A;  1S2E A;  1L2P A;  4UB6 E;  3AE5 C;  2H8P D;  4HJG H;  2HR3 A;  1M1J C;  2I8D A;  4IFF A;  3L37 A;  1VQ6 P;  1WT6 A;  3BCC J;  2JEE A;  3A5T A;  3I5C A;  2HYN A;  4ZNC A;  1PZQ A;  2WVR A;  5KLI B;  1RF0 C;  3WUV A;  1SP4 A;  1P84 I;  3CL3 D;  1JM0 A;  1U7J A;  3RK3 B;  1JCD A;  1JOC A;  3CXH E;  4ZKP A;  5CBN A;  1VF5 C;  1NTZ E;  1NTZ K;  3CCJ P;  2WT7 A;  3EFG A;  5KLI C;  2OYH B;  4JBZ A;  3CCL P;  3UIA A;  1N86 A;  1OMI A;  1RE3 C;  2WPS A;  2Z5H A;  3NFQ A;  1GK4 A;  1ZRT E;  3RK3 C;  4AQR D;  3H1H G;  1DD4 A;  1SQQ G;  2M3E A;  1NTK G;  2Q6Q A;  1T2K D;  2OYH C;  1QL1 A;  4H13 C;  3HRN A;  4C46 A;  3HE5 B;  1PPJ E;  2WIT A;  1LP1 B;  3E1R A;  1BCC E;  1SQB G;  2QA4 P;  4GDO A;  1ZW0 A;  3WUT A;  2ZYG A;  3RL0 B;  3CC4 P;  3SSU A;  4XA4 A;  1EXJ A;  2N1T A;  3HE4 B;  2P10 A;  1Q2N A;  1SQV E;  1UIX A;  2AEF A;  3M9B A;  5APW A;  1SQV K;  2XV5 A;  1NTK K;  3RL0 C;  2FKW B;  1IFN A;  2QJK B;  4JF7 A;  3M91 A;  1KIL D;  3SWF A;  1HWT C;  1PP9 E;  3L70 J;  1LTS C;  2W6B A;  3LIE A;  4BRY A;  1P84 E;  1SQB E;  1SQB K;  3U59 A;  4JPZ B;  4GKG A;  2KNC B;  4NPF X;  1USD A;  1N73 A;  3WU2 E;  1M1K Q;  2QJK C;  1J1D C;  5AVX B;  2AEJ A;  3L75 G;  2Y9Z A;  2ZXX A;  1VQ7 P;  2NPS A;  1OVR A;  4GOE A;  2DW3 A;  1SQP D;  1GDT A;  3K5B A;  1JB0 J;  1BE3 G;  1ZR2 A;  3H1L J;  3MUD A;  3FWN A;  3HUS C;  1RF1 C;  3V2N A;  2O1K A;  3B5N A;  1T8Z A;  2WSC H;  2M3B A;  3H1I G;  1YJ9 P;  1YQ3 C;  2KB7 P;  4N78 D;  5KKZ C;  4H0L D;  4D6T J;  5CHX A;  3IAO A;  3CI9 A;  1HGV A;  3H1L D;  4LC1 A;  4NPD A;  3H1K G;  3MD0 A;  1PGQ A;  2ZT9 D;  5E79 E;  3VMA A;  2GA1 A;  1ZP0 C;  3L35 A;  4DCK A;  2I1K A;  1FOS E;  1LT1 A;  3BRV B;  1RQU A;  1OZH A;  2KSJ A;  5CCG C;  2BCC E;  4XE5 B;  1CI6 B;  1FZC B;  2FYZ A;  3RBX A;  2E42 A;  3CWB G;  1BGY J;  3L71 G;  4D6T D;  2WSC J;  4R4M A;  1GU5 A;  4U3F G;  4Y99 C;  4LLH A;  2FXO A;  3CCQ P;  1EZV G;  2YMY A;  1NGM B;  5AVV B;  1S9K D;  1ZV8 A;  3Q5R A;  1KYO H;  3VMZ A;  2R3S A;  1FZC C;  1BGY D;  1FC2 C;  1MZ9 A;  2ZJS E;  1N7L A;  1YTZ T;  1YIT P;  3FX0 A;  1S5L X;  4EDF A;  1NO4 A;  1R8E A;  4L76 A;  3H1K E;  2SPZ A;  3HD7 D;  3V2R A;  3MZW B;  4IL6 E;  5AW8 B;  3GHG B;  5CBO A;  1RE3 A;  2M0B A;  1RE4 C;  2JWD A;  2KSE A;  1DX7 A;  5H2F E;  2IPP A;  1NTM E;  1URQ A;  1S72 P;  2KLV A;  3Q5S A;  4ASV A;  5KAI H;  3AEE C;  1SQQ D;  1LWU A;  1HUC A;  1JMM A;  3S4R A;  1KN7 A;  2OTK E;  1KB9 H;  1PGJ A;  1NU1 G;  3TSI A;  2OAR A;  4RO0 A;  1IZN B;  2K9Y A;  1G2C A;  3L36 A;  3ITK A;  2KLU A;  2C0W A;  4GT1 A;  2H43 A;  1YJW P;  5GTH H;  1GK6 A;  2IDB A;  3L74 E;  1HH0 A;  1VQO P;  4A7P A;  3KXD A;  1Y47 A;  3BVH A;  1M90 Q;  3CD6 P;  1FDM A;  1Q86 Q;  1OW7 A;  1AFO A;  2FYU J;  3EQ2 A;  3KPE A;  4YXD C;  1OFC X;  1NU1 E;  1IK9 A;  3LW5 H;  3RK2 B;  1VQ5 P;  1NU1 K;  1JTH A;  3KZI E;  2WT7 B;  4AYC A;  1LJ2 A;  1SLQ A;  1L0N J;  4MN4 C;  3FXD A;  1KB9 D;  2JR8 A;  4I1L A;  2FYU D;  1SQX G;  1VDF A;  1PGP A;  4PJ0 E;  3L75 D;  3B4S A;  1WRG A;  1D7M A;  2B88 A;  1L0N D;  1NHL A;  3H1J G;  3HUS A;  1RF1 A;  3LW5 J;  2XND H;  1E79 H;  2ZXE B;  3TGU G;  5AVQ B;  1GW3 A;  1USE A;  2E74 C;  3SFE C;  1FBM A;  3H1I D;  5AW2 B;  2A06 D;  1H88 A;  2KS1 A;  2OTJ P;  2FXM A;  2N1T B;  2W90 A;  1K04 A;  2NRG A;  1R5L A;  2QG4 A;  1J1E B;  3V4Q A;  2M8R A;  1N7S A;  1SQX K;  1S4X A;  3V2P A;  5CCG A;  3GF7 A;  3GG2 A;  3L72 D;  2O01 N;  1DD3 A;  2MJZ A;  1M56 D;  1MUU A;  4WY4 D;  3E7K A;  1JUN A;  3BCC E;  3AEB C;  4U3F D;  1ZOY C;  3N7N A;  4BRY B;  1J1E C;  3A7O A;  1FZG A;  1BSN A;  3AE2 C;  2ZVN B;  3AE9 C;  4PJ0 H;  1U57 A;  1JCC A;  4WB4 A;  2H7H A;  2JJL A;  3A0H E;  2RMZ A;  1AVO A;  1K73 Q;  3V4W A;  1TU3 F;  2YKQ A;  3SFD C;  2NPS B;  5CJ0 A;  2E75 B;  2JWA A;  2WWW A;  1L4A C;  3S9O A;  1BDC A;  2BEZ F;  1OX3 A;  5KLV J;  2Z4E A;  3VN0 A;  3B5N B;  4NPE A;  3L73 J;  1GTW A;  2Y0D A;  2M5A A;  1GMJ A;  2NPS C;  2E75 C;  2G8Y A;  4TLF A;  3IF4 A;  1YBK A;  5L8R J;  3H32 A;  3L70 G;  4PD4 H;  2CPS A;  2WSF H;  4C7N A;  1NYH A;  2QJY B;  1KQG B;  3RL0 g;  5KJ7 C;  3B5N C;  1Z56 A;  3L73 D;  1NWQ A;  1FJP A;  4DOJ A;  2N9Y B;  3RK3 D;  1YI2 P;  1JEK A;  2AXC A;  1NTZ G;  1DIP A;  1PIX A;  5AW7 B;  4RES B;  1SS1 A;  4ASW A;  3VP8 A;  2WSF J;  3AED C;  1BDD A;  5KAF H;  1FZB A;  3L70 E;  1VF5 B;  2XDJ A;  3M9Q A;  3CCS P;  3CPW O;  1T6A A;  2Q5U A;  1JY2 P;  4Z1M H;  2LXC B;  3AE4 C;  1KMI Z;  2WSE H;  1L0L J;  2Q3E A;  4PD4 D;  2O3J A;  3P8C E;  2PP6 A;  3GMA A;  1PPJ G;  1URQ B;  1K05 A;  1KTM A;  1BCC G;  1SFC C;  4N78 E;  2KK7 A;  2J5U A;  3RL0 D;  2LKM A;  1KYO I;  1LWU B;  1GW4 A;  2WPQ A;  3H1L E;  1AJY A;  1L0L D;  4H13 B;  1SQV G;  3PRJ A;  3H1J D;  3V2Q A;  2QRX A;  1URQ C;  3TGU D;  3W68 A;  1G2C B;  2D2C B;  1LTB C;  3G4S P;  2WSE J;  1HVV A;  3JSV C;  1OW8 A;  4D6T E;  1LWU C;  3CX5 D;  1HJ0 A;  3LID A;  1PP9 G;  4IFM A;  1N2D C;  5B66 E;  2D2C C;  5AW5 B;  1R5S A;  1BGY E;  4RJT A;  1LT9 C;  3AE1 C;  2W27 A;  1KB9 I;  1DEE G;  4WVZ A;  3QH9 A;  4W7Y A;  3BAS A;  2WPR A;  1JTH B;  3MHV A;  2ZFC A;  1Q7Y Q;  1JMB A;  1JY3 P;  2MKV A;  1J1D B;  3O6Q A;  1EDK A;  3G71 P;  2PGD A;  1YJN P;  1HGZ A;  3TNU A;  3CCM P;  3U1A A;  4UB8 H;  2YMK A;  2R44 A;  1SQP J;  5APQ A;  1MFZ A;  2Q7C A;  1L4A A;  4C7R A;  2QSI A;  3II6 A;  4HB1 A;  1KQF B;  3HUS B;  1RF1 B;  2FYN B;  3WUU A;  1KYO E;  1LTJ B;  2E43 A;  2W8Z A;  1LGH B;  3VP9 A;  2Q1K A;  2BCC G;  5KKZ B;  1ZXG A;  1NOH A;  1DH3 A;  2KS1 B;  3IN6 A;  2Z5I A;  4K3A A;  5B66 H;  2V4H A;  1X9V A;  5KJ7 A;  1W2E A;  4ZMD A;  1AV1 A;  1N7S B;  2FYN C;  4XFJ A;  1ZN5 A;  5M1B A;  1LTJ C;  5AW0 B;  2UWJ E;  2Q9I A;  2XU6 A;  2RH0 A;  2BAS A;  2R5D A;  3G3Z A;  4KJM A;  4Y99 B;  5KAI E;  1IFD A;  1IFI A;  1EDI A;  2K9J A;  2KZJ A;  2XNX A;  3TF5 A;  5APT A;  1N7S C;  1NTZ D;  1VQK P;  1KQL A;  2AXT H;  1KB9 E;  2IBZ I;  3KYQ A;  2GM4 A;  2FYU E;  4HKZ H;  2PFX A;  1QEX A;  1NTM G;  3TDK A;  4GOD A;  1PGO A;  2QM7 A;  3Q3D A;  5GTH E;  1OXZ A;  1KD1 Q;  2R32 A;  1L0N E;  4OGQ B;  1H0T A;  2LR2 A;  3PH0 A;  2JKV A;  2Y9Y A;  2OQQ A;  1SFC A;  2BEQ D;  1PPJ D;  1VQ8 P;  3CC2 P;  2M5A B;  2A06 E;  3H1H J;  2OYI C;  1SQQ J;  1NTK J;  1FZE A;  2YIU B;  4OGQ C;  3FXE A;  1RY3 A;  3L74 G;  1Q82 Q;  3H32 B;  4C7N B;  3AEA C;  1SQV D;  2Q3I A;  2YXR B;  3VTP C;  4IL6 X;  1M8O B;  2IBZ G;  1LNQ A;  1NTM K;  3IR9 A;  2IYP A;  3L72 E;  3H1H D;  2YO3 A;  3CCU P;  2B89 A;  1ZME C;  3VYI A;  5TIS H;  1NTK D;  1PL5 A;  4TT3 H;  2YIU C;  5EFW B;  2CK3 H;  3RK2 D;  2OGU A;  3R2P A;  1GL2 A;  1VQ9 P;  2KI7 B;  2XKM A;  5K5G B;  2HOD B;  1SQB D;  3JCU H;  5APS A;  1LT9 A;  2KXP B;  5C39 A;  2RN0 A;  1A02 F;  4PD4 I;  3SWK A;  2KIK A;  1AVY A;  3NXS A;  1GD2 E;  2IBZ E;  1WMK A;  1X79 B;  1S5L H;  2RKL A;  2JDI H;  3TYY A;  1X22 A;  2K37 A;  2C9L Y;  3L75 J;  1MFT A;  3NMD A;  4I7Z B;  3RGU A;  2R5B A;  1IFJ A;  3D6Y A;  2K3R A;  1QGK B;  4YPC A;  5B5E H;  2N1T D;  3HTK A;  5GTI H;  5KLV E;  3TK1 A;  1BE3 J;  5KLV K;  1FZA A;  1OWA A;  3L73 E;  2V7Q H;  3O8Z A;  5AW9 B;  3F5H A;  2E74 B;  2WMM A;  3H1I J;  4I7Z C;  1FJK A;  2BCC D;  2E5T A;  3BCC G;  3NTN A;  1BE3 D;  3A0B H;  4EI2 A;  1LTJ A;  2C9N Y;  3H6P A;  1YTZ I;  3L72 J;  2OTL P;  3I55 P;  3B71 A;  1OW6 A;  2V7Q J;  3CWB J;  2C0X A;  3M9H A;  5TJH A;  1OVV A;  1G1J A;  4U3F J;  3ZDM A;  1JO5 A;  2NPS D;  3H1K D;  1VL2 A;  2E75 D;  5AVW B;  5AVT B;  1GZL A;  4PD4 E;  3O6Q B;  3B5N D;  4YXW H;  3CWB D;  3TNU B;  3L71 D;  3VOP A;  2VRS A;  1KIL A;  1MKM A;  3B8E B;  1EDL A;  1VQP P;  1L4A B;  1EZV D;  2KUB A;  1L0L E;  1QVF O;  4B86 A;  2IZ1 A;  1QLE D;  2IFN A;  1CSB A;  2OYI A;  2Y0E A;  3C1L A;  5KAF E;  3T97 A;  1VQ4 P;  3M0A A;  3R4Y A;  5CMZ A;  2K88 A;  3L74 D;  5AVS B;  2J59 M;  1LTA C;  3P8M C;  3P7K A;  1BSH A;  1RH5 B;  2P67 A;  3GF3 A;  3OAK A;  3CME P;  5AW4 B;  1T3U A;  3L4F A;  3AE6 C;  1IFM A;  1VF5 D;  2K9J B;  1QL2 A;  1NU1 D;  2GUS A;  2FY8 A;  2ZYA A;  4BWN A;  1FOS F;  3FWL A;  1KIL E;  3EFF K;  1URQ D;  4WY4 C;  5DJT B;  3FGA D;  1JY2 N;  1CW5 A;  5BVZ A;  4L73 A;  2E5Y A;  1H0T B;  2HOD A;  3U1C A;  3H1L G;  1NAY A;  4PV1 B;  4H13 D;  4JYC A;  1SFC B;  2I1J A;  3CX5 H;  2D2C D;  4WBA A;  3HD7 A;  1SQP E;  5DJU B;  1SQP K;  2FXP A;  4D6T G;  1ZR4 A;  1RHZ B;  3ABV C;  4PV1 C;  3D6Z A;  1LTG C;  3H1J J;  2QIW A;  4W80 A;  4K35 A;  2N9B A;  4I6M C;  1LTI C;  2YXQ B;  3TGU J;  2L5G B;  1SQX D;  3CCE P;  1HF9 A;  3AE7 C;  1Y8A A;  1BGY G;  1KFM A;  4UB8 E;  3MGN A;  4I2L C;  3BCC D;  4KHX A;  1IO4 A;  1GL2 B;  2HLO A;  1N8R Q;  2E76 B;  1K9M Q;  4HYT B;  3CCR P;  4H44 B;  2A45 H;  1LT9 B;  1FE6 A;  2G3A A;  5CCH C;  2IX7 C;  3P32 A;  1NKZ B;  4LGD E;  1FDO A;  4Y28 J;  2W6A A;  1S9K E;  1JY2 O;  3V6I A;  2L91 A;  1GL2 C;  3D70 A;  1JY3 N;  3PJS K;  2E76 C;  4RKU J;  1AQT A;  4H44 C;  2WPV B;  3JC2 2;  3C9I A;  1PFI A;  1VQL P;  4O9B A;  4UB6 H;  1NH4 A;  2HG5 D;  1HTL C;  1VPC A;  1S1C X;  3USS A;  1IJD B;  3AEF C;  1YIJ P;  1M7L A;  4EOT A;  3HTK B;  2FFD A;  2ZYD A;  2W6J H;  2B87 A;  2YKP A;  3PHL A;  1N7S D;  1T3J A;  2AXT E;  2KZI A;  3S1K A;  5CCG D;  3H1H E;  3M0D C;  1SQQ E;  3CXH H;  4IFD K;  1NTK E;  1SQQ K;  1W5C E;  1QVG O;  1A02 J;  1EDJ A;  1NAF A;  2QVA A;  2IYO A;  5AVU B;  1HBW A;  4R4L A;  1DEB A;  4KT0 J;  1KOR A;  1H8A A;  4EIJ A;  2FYU G;  1Y9B A;  2PAJ A;  3CMA P;  1T2K C;  2LXB A;  4YTP C;  5AW1 B;  1HJB A;  3L70 D;  1M57 D;  1G1I A;  4OWF A;  4OGQ D;  1NTZ J;  2WZ7 A;  1L0N G;  1JY3 O;  1EZV I;  1OVU A;  3G6E P;  3C8V A;  4WY4 A;  3P8C D;  1KIL B;  1CZQ A;  3CXH D;  3M06 A;  5TIS E;  1IFP A;  1JNM A;  2A06 G;  1VQM P;  4JQ0 D;  2H89 C;  2QEX P;  3MTU E;  1FZF A;  2NZ2 A;  4CPG A;  3KDP B;  2FYU K;  2P1J A;  3AEC C;  3L75 E;  3Q5P A;  1ZRT D;  3JCU E;  2ZVO B;  5APY A;  2OYI B;  3L72 G;  1BCC J;  1KIL C;  4U7J A;  2HPC A;  3A2A A;  1IK7 A;  3T97 B;  1L0N K;  1YYC A;  4HH2 A;  1P84 H;  1BE3 E;  1M1J A;  1OIP A;  1ZLL A;  4QMA A;  2ZAE B;  1SQV J;  1S3J A;  3Q2Y A;  3WU2 H;  3H1I E;  2JO1 A;  3PLN A;  1S5L E;  4DT0 A;  1BCC D;  1RF0 A;  3SWY A;  3AEG C;  1LTT C;  2O1J A;  3OW2 O;  4H0L B;  1UII A;  3VMX A;  5B5E E;  4GIF A;  5GTI E;  1PP9 J;  2ZT9 B;  1W2B O;  1U7M A;  3OJA B;  1SQB J;  4L74 A;  5CCH A;  3CWB E;  2XZR A;  3L71 E;  4H0L C;  1YHQ P;  4U3F E;  1NVO A;  4IOI H;  1PP9 D;  1EZV E;  2KOG A;  2ZT9 C;  1P84 D;  4AUW A;  1EQ7 A;  5E79 H;  3VMY A;  5CJ4 A;  2OYH A;  5KLV G;  3A0B E;  3GHG C;  1XTG B;  5BU5 A;  2ITA A;  4L75 A;  1AA0 A;  3L73 G;  1EXI A;  2E74 D;  2YNY A;  1MV8 A;  2QE7 H;  1X8Y A;  3HD7 B;  1KYO D;  2WQY C;  1KC8 Q;  3EWK A;  2B9B A;  1Q81 Q;  3BRT B;  1PV3 A;  2W83 C;  4GOF A;  2POH A;  1AQ5 A;  3GW6 A;  1XTC C;  1KZU B;  3HE5 A;  2IFM A;  3PTZ A;  2JP3 A;  1LP1 A;  1NKN A;  3F89 A;  3M0D A;  3HD7 C;  2P2U A;  2BCC J;  1EC5 A;  3PP5 A; 
#chains in the Genus database with same CATH homology
 1LT1 A;  2UWJ E;  4HJG H;  1X0T A;  5EFW B;  2HR3 A;  2I8D A;  2KI7 B;  4ZNC A;  4KJM A;  2LXB A;  5K5G B;  1Y47 A;  1U7M A;  1EDI A;  2KZJ A;  1OVV A;  1JM0 A;  1DEE G;  1SS1 A;  4ASW A;  3ZDM A;  5C39 A;  1U7J A;  1BDD A;  1FC2 C;  2KIK A;  3MHV A;  5CBN A;  1OVU A;  4HKZ H;  5DJT B;  1JMB A;  2SPZ A;  1NVO A;  4IOI H;  4NPF X;  4GOD A;  4MN4 C;  3FXD A;  2LXC B;  1EDK A;  4JBZ A;  1H0T B;  3QWO C;  3MZW B;  2RKL A;  1H0T A;  5CBO A;  2LR2 A;  2M0B A;  2JWD A;  3PH0 A;  1EDL A;  1OVR A;  4GOE A;  2R44 A;  2KUB A;  1MFT A;  1BDC A;  3RGU A;  4CPG A;  2B88 A;  4HB1 A;  2K3R A;  4ASV A;  2B87 B;  4NPE A;  5DJU B;  2B87 A;  2M5A B;  4GOF A;  2M5A A;  2KZI A;  3S1K A;  3FXE A;  2Q1K A;  2P58 A;  1LP1 B;  2OTK E;  1ZXG A;  4K35 A;  2QRX A;  2WMM A;  1LP1 A;  2KS1 B;  4K3A A;  1ZW0 A;  2ZAE B;  4EYY Q;  1S3J A;  4NPD A;  1EDJ A;  4BXL A;  1EC5 A;  2QVA A;  4WWI A;  4ZMD A;  1Q2N A;  2B89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...