5K5GB

Structure of human islet amyloid polypeptide in complex with an engineered binding protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
44
structure length
44
Chain Sequence
GGEIVYLPNLNPDQLCAFIHSIHDDPSQSANLLAEAKKLNDAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone
molecule keywords Islet amyloid polypeptide
publication title Structure of human islet amyloid polypeptide in complex with an engineered binding protein
rcsb
source organism Homo sapiens
total genus 15
structure length 44
sequence length 44
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5k5gB00
1LT1A 1JMBA 3MZWB 1LP1A 4HB1A 2B87B 4EYYQ 4GOEA 1FC2C 4K3AA 3RGUA 1H0TA 5DJUB 4CPGA 2JWDA 1EDJA 4BXLA 2LXCB 3PH0A 1DEEG 4ZMDA 1BDCA 3MHVA 1S3JA 1ZW0A 2Q1KA 2UWJE 4HJGH 4MN4C 2M5AA 2QVAA 4GOFA 2ZAEB 3ZDMA 3FXDA 1Q2NA 2SPZA 5CBOA 2I8DA 2B87A 1U7JA 2KZJA 4ZNCA 4HKZH 2M0BA 3S1KA 4NPEA 5CBNA 2KUBA 3FXEA 4ASVA 2LXBA 4KJMA 2P58A 2B88A 2QRXA 2HR3A 5C39A 1MFTA 1JM0A 1LP1B 2K3RA 1OVVA 3QWOC 1U7MA 2KI7B 2RKLA 1H0TB 4NPDA 1EDLA 2B89A 1EDKA 4GODA 4ASWA 4IOIH 1NVOA 1ZXGA 5K5GB 1BDDA 1OVRA 4JBZA 1EDIA 2WMMA 4NPFX 1Y47A 1OVUA 2M5AB 4K35A 2KIKA 1X0TA 1EC5A 4WWIA 2LR2A 2KZIA 5DJTB 2R44A 2OTKE 2KS1B 1SS1A 5EFWB
chains in the Genus database with same CATH superfamily
1FDMA 1MUUA 4PV1C 2FXPA 2WTYA 3SFDC 1JMMA 4EIJA 2JWDA 2GUSA 1KILA 3TGUG 2HFED 2B9BA 2YXQB 2A06D 4N3YB 1JNMA 4Y99C 1IFNA 4PD4E 1HBWA 4W80A 1FZCC 3L71E 3CXHH 1HF9A 2XZRA 4YXDC 1IFDA 1FZBA 2YNYA 1U7JA 4WBAA 3H1KE 1YIJP 1ZMEC 1KB9E 1KYOE 1SQXK 1JY3P 1VQMP 2Q7CA 1FZCA 2O01N 2V4HA 3I56P 2HPCB 1RF1C 2QIWA 3AE2C 2WITA 3NTNA 3AECC 1H0TB 5KLIC 2IBZG 3V2QA 4D6TG 2K9JA 1Z56A 3O8ZA 3H1HG 2WT7A 3NFQA 4BRYA 4UB6E 1X22A 4WY4C 4DT0A 4RKUJ 1QX8A 1S2EA 4Y28J 2FYUE 3VMZA 4EI2A 1RH5B 3C9IA 1M1JC 1NO4A 1YJ9P 3AEAC 2P7JA 2R3CA 2G3AA 4R4LA 1U57A 3F89A 2KSEA 4IFFA 1RE3C 3TDKA 1SQQK 1NU1D 3VMYA 3HRNA 1EQ7A 1LTAC 3JC22 2HODB 1SQQG 3P8CD 2A06E 1GZLA 2OYHB 3S9OA 3GG2A 2FYZA 4ZNCA 3CC7P 2BCCG 3MUDA 1FU1A 3NMDA 4GKGA 1NAFA 1AFOA 1OW7A 1RE3A 1VL2A 3NXSA 1NTKJ 1H89A 2FFDC 1L4AB 1RQVA 2WZ7A 4H13C 2O3JA 1NTZJ 1PPJD 1BCCG 2QM7A 1IFMA 1LTGC 1NYHA 3M9HA 1SQBD 1M57D 3H1LG 1LWUC 3CX5H 1MZ9A 1CI6A 3H32A 2E5YA 4IL6X 2FFDA 2BEQD 3Q3DA 3OW2O 2OTKE 2KS1B 2R5DA 1JMBA 3O6QA 1AVOA 1FC2C 1SQPD 3G71P 1URQC 3WU2H 5B5EH 1LWUA 1JCCA 3L71G 4L74A 1L4AD 5KAIH 1P84H 3L36A 2M3EA 2IFMA 2QVAA 2E75C 3CL3D 3H1KG 3D71A 4Z1MH 1QVGO 3CCMP 1N2DC 1OW8A 4OH8B 1URQA 2H88C 3AEFC 1ZP0C 2YO3A 1SQBJ 3MIWA 2Y0EA 3GHGB 1E5WA 2C0XA 1S5LX 3P8CE 4RO0A 3A0HE 5GTIH 2W6BA 1VPCA 4QMAA 2KK7A 2IBZI 3E1IA 3H1JD 1N8RQ 5AW3B 2E74D 2R5BA 1FDOA 1SQXD 3Q2YA 5APSA 5BU5A 1OIPA 4B86A 1YTZT 1K8AQ 1IFJA 5AW9B 1EDIA 1PPJE 2FYUG 1G1JA 3AE3C 3A0BE 1HGVA 1VF5C 2G8YA 2IDBA 3M0AA 1SQBE 3K5BA 2A45H 5KJ7D 5E79H 1EDJA 1QGKB 2P10A 3GF7A 1Q7YQ 3KQGA 3MD0A 3GLMA 1ZW0A 3TK1A 2A06G 1FZCB 1JY2N 2Z5IA 1SQPE 1KILD 5CCGD 1M56D 1K73Q 3H1JJ 2KLUA 1SQXJ 2K9JB 1W2EA 1AA0A 3R4YA 4DOJA 1JY2O 2WT7B 5H2FH 4BRYB 4PV1D 3V5BA 3R2PA 4BWNA 1VQ7P 1AV1A 4L76A 3VOPA 3AEBC 4AQRD 2JO1A 1R5SA 1HVVA 3KDPB 1JM0A 1S9KE 2K3RA 2XDJA 3RL0C 1AJYA 5KLIB 2KI7B 1YITP 3ABVC 2P2UA 3FX0A 3MGNA 2WMMA 1Y47A 5GTHH 3H1JE 3FWLA 1CZQA 4L75A 1N7SA 3RK3B 1NTKK 1GTWA 1SQXE 2WQYC 4PD4I 2RH0A 1SFCA 3MZWB 1NTZK 1YHQP 3VYIA 1XTGB 1USDA 2JEEA 2Y9ZA 4IL6E 1PGPA 3WU2E 1FZAA 3L73D 3M06A 2KLVA 1SP4A 1NKNA 2QEXP 1FAVA 1QEXA 1KYOI 4OWFA 2CK3H 2SPZA 2Q6QA 3SWKA 3CCSP 3RK3D 2AEFA 1BSNA 1KB9D 3SSUA 1KILE 3FXEA 1CI6B 3V2NA 3H32B 1SQVJ 1Y9BA 2HR3A 3PLNA 1S1CX 3BVHA 1JY3N 3S4RA 3O6QB 2WSEH 1S5LE 2PRRA 1PFIA 2RKLA 1BGYD 2GUVA 1YBKA 4JYCA 5KLVD 3GHGC 1PPJG 1LWUB 3EFFK 3L73J 1ZXGA 1SQBG 1TU3F 3A2AA 3AE6C 4JF7A 1YJNP 1LTIC 3TNUA 1DX7A 3MTUE 1AVYA 2WWWA 1S72P 2M8RA 1JY3O 5M1BA 2D2CC 1VDFA 2P1JA 1LP1A 5AW5B 1H88A 1KMIZ 3RGUA 1URQB 5AVYB 3Q1MA 3GHGA 1X79B 1K9MQ 1SQPG 3CMEP 1NJIQ 2AXTH 2Q1KA 1MKMA 1J1DB 2M5AA 1HJ0A 1LTSC 1L2PA 1VQNP 3L73E 2WSCH 2JP3A 2E76C 3CCUP 1NTMK 1BGYJ 5KLVJ 4PJ0H 2KYVA 3G6EP 1PZQA 2DW3A 4LC1A 3U59A 1JCDA 2XNXA 3KXDA 5H2FE 1URQD 3JSVC 1IJDB 3C1LA 3RK3E 3JCUH 3CCQP 3P7KA 2KNCA 2B89A 1FZEA 2E75D 3H1JG 3HE4A 1EXIA 1SQXG 3AEEC 1BDDA 4JBZA 1R5LA 1DIPA 5GTHE 5AVWB 3B8EB 1OVUA 3SWYA 1ZR2A 1VF5B 2KB7P 3L72D 1BGYE 3F5HA 1IFPA 5KLVE 2JJLA 2CPBA 2V7QJ 1LT1A 1JTHA 4GOEA 4LLHA 2ZYAA 2O01H 4CPGA 2NRGA 2KP8A 1KFMA 5B66E 2L91A 5APYA 2E42A 1NTKD 3CCVP 3RK3C 4MN4C 2POHA 1QLED 1KD1Q 1NTZD 3U1AA 1Q2NA 1KORA 2AEMA 2WSFJ 1HH0A 5CBOA 3CXHD 1JOCA 3A3YB 3CCLP 3MUDC 2NZ2A 1KZUB 5AVZB 1VF5D 2AEJA 1FZFA 1VQ5P 2KUBA 1GK4A 4RJTA 2OTLP 1HJBA 2LXBA 2IPPA 1N7SB 3L72J 1SFCB 5AW2B 3RL0B 3KHUA 3CMAP 5KAFH 2LKMA 4EDFA 3IR9A 4JPZB 2QSIA 3CC4P 3N4XA 3L70D 4GODA 5CJ4A 1NVOA 4JQ0D 3AE4C 1SQVK 4N78D 2YXRB 3I55P 2N9BA 2WPVB 3II6A 1EZVD 1IC2A 2ZXEB 1Q81Q 4U3FD 1RF0A 1PGJA 3BASA 3L72E 2PFXA 3G4SP 4IFDK 2O1JA 2Q3IA 3RL0D 2NPSC 3L73G 3ZDMA 3CI9A 1OXZA 4I1LA 2B87A 3W67A 3USSA 2N9YB 1NTKE 3PHLA 1NOHA 4PJ0E 2ZT9C 4TT3H 3L70J 1NTZE 5APVA 1SLQA 2YMKA 1J1DC 2NPSA 4YXWH 3CXHE 1M90Q 3TNUB 2OYIA 1NTMD 3HE5A 4H0LC 4LGDE 1MFTA 1LP1B 3BCCJ 3JCUE 4U3FJ 1S9KD 5APQA 3CPWO 5KLVK 3IN6A 3HD7B 4XE5B 3M9QA 1BGYG 5AVSB 5KTBA 5KLVG 1VQ8P 4OGQB 3CX5D 3M0DA 2MJZA 1UIIA 2M5AB 3HTKA 2H89C 2D2CB 2L5GB 5CCHC 3L70E 3GF3A 5TISH 3A7OA 4IFMA 5AVQB 1OZHA 3RK2B 3H6PA 4N78E 3EQ2A 4L73A 1RY3A 1Q86Q 4ZMDA 5APXA 1S3JA 1MV8A 2K9YA 3WUVA 1VQLP 1P84D 1EZVE 4RESB 1VQPP 5CCHA 4U3FE 1W2BO 1NTMJ 4H44C 2PAJA 2E76B 1PP9D 2RN0A 2N1TC 4DCKA 5L8RJ 3VTPC 2QG4A 3AE5C 4HKZH 1ZOYC 3WMM0 1ZLLA 4KT0J 2KNCB 3LIDA 3HE4B 1M8OB 2D2CD 3ITKA 1PIXA 2MKVA 3B4SA 1N86A 4ZKUA 1IZNB 2QJYB 3KZIH 3H1ID 1VQOP 1N73C 1EXJA 2C9LY 2ZVOB 2JR8A 1T8ZA 2JKVA 2HG5D 4HYTB 2N1TA 1JTHB 4JYBA 1DD4A 1OVVA 2K88A 3B5NC 1LNQA 3WUTA 2FYNC 3N7NA 1VQKP 1KC8Q 2YMYA 1LTJC 2JWAA 1NTME 1N7SC 2QJKC 1BE3J 1N73A 5AVTB 2E76D 3PJSK 4PD4H 2KIKA 2BEZF 1SFCC 1A02J 4GT1A 2R44A 1GW3A 2I1JA 5EFWB 2R3SA 3BRTB 3L72G 1PP9J 3CWBD 5CHXA 2E5TA 2W83C 3B5NA 1T2KC 1ZR4A 3W68A 3CX5E 1YI2P 2LXCB 3E1RA 1GD2E 1DEEG 1LTJA 3LW5H 1J1EB 1DH3A 1SQVD 1WMKA 1KYOH 2WPSA 3H1IJ 4R4MA 2ZVNB 1Q82Q 1NTKG 2PP6A 4TLFA 2ZYDA 5AW7B 1YJWP 1IO4A 1NTZG 5AW6B 5B5EE 2M0BA 4N6JA 2KXPB 1BE3E 5KAIE 1P84E 2WPQA 1X8YA 1GL2A 1KB9I 2Y9YA 1PP9E 1RHZB 1DD3A 2OARA 4UB6H 1RE4C 1L0NJ 2IFNA 4WVZA 3CWBJ 3QWOC 1U7MA 1GDTA 3H1IE 4C7NA 2K1AA 2FY8A 4I7ZB 5GTIE 4ASWA 1IFIA 2YKQA 3PP5A 1OVRA 2YKPA 3L70G 1RE4A 1X0TA 4WWIA 2Z5HA 1OMIA 2R32A 4HB1A 2B87B 1IK9A 5TISE 4AUWA 3HD7C 2K37A 3TYYA 2KSJA 1EZVG 4OGQC 5APWA 3CD6P 1BDCA 4U3FG 3MHVA 1L0NE 1JUNA 1KTMA 2IZ1A 1YQ3C 3UIAA 1KN7A 2NPSB 3V4QA 3CWBE 4GOFA 2RMZA 5E79E 2OYIB 3HE5B 2KZJA 1SQVE 3HD7A 3RK2C 3T97B 1HWTC 1KV4A 4EOTA 3M9BA 2ZT9B 1LT9C 4ASVA 1NAYA 3HUSB 2P58A 2QRXA 3HTKB 5CMZA 3L37A 1NGMB 4H0LB 4AYCA 2H7HA 2QE7H 1CSBA 3P8MC 3C8VA 1NHLA 1NTMG 3L75D 1QVFO 3GMAA 3OA7A 2NPSD 1LT9A 5CCGA 2Q3EA 2QJYC 4NPFX 4W7ZA 3L35A 4DZOA 1GMJA 5AVUB 5APUA 1GW4A 2XV5A 1UIXA 1PL5A 2ZT9D 3L4FA 1K05A 1AQTA 2QJPB 3AE8C 3A5TA 3QH9A 1FZGA 3BATA 4H0LD 1KQGB 4YTPC 1IK7A 2FYUJ 3TF5A 3A0HH 2J59M 2WVRA 4H44B 1BE3G 1LTTC 1PGOA 3CXHI 4O9BA 3EWKA 2N1TB 1QL1A 3KPEA 3L75J 2Y0CA 2O1KA 1J1EC 2WSEJ 3U1CA 2QM8A 1PP9G 2IYPA 1BSHA 1NKZB 5CCHD 2GA1A 4XFJA 3VN0A 3LIEA 1OX3A 3L74D 1N73B 1M7LA 2E43A 2YIUC 1W5CE 1FE6A 3E7KA 1HUCA 1PGQA 3H1IG 2PGDA 1G2CA 3A0BH 1LGHB 1YTZI 1RF1A 2P67A 4YPCA 3B5NB 1OFCX 2FYNB 1EDLA 2XU6A 5AVRB 1LTJB 5KKZC 4H44D 3VMAA 1NWQA 3Q5RA 2Z4EA 1KQFB 3VP9A 2QJKB 1L0LD 1SVFA 3IAOA 2N1TD 3L75E 1NH4A 4WY4A 2FXMA 1L0NK 4XA4A 1EZVI 2W90A 3CCJP 2C0WA 4GIFA 1RF0C 3H25A 4I7ZC 1L0NG 2J5UA 2KOGA 2WSCJ 1M1JA 5AW0B 2A45G 1YYCA 3CWBG 1GL2B 4I2LC 2HLOA 5CJ0A 3V4WA 3L74J 1OW6A 4HJGH 4C7RA 1SQVG 2ZAEB 3B5ND 3FXDA 2W6JH 3Q5SA 3BCCD 2WSSH 2YKOA 4GDOA 1N7LA 1HGZA 1N7SD 3SWFA 2Q9IA 4C7NB 1SFCD 2AXTE 5CBNA 4OVNF 1XTCC 2I1KA 1FOSF 1L0LJ 2OTJP 2HYNA 2ZXXA 3VMXA 4KHXA 4ZKPA 2B88A 2OYIC 2FXOA 5TJHA 1T2KD 2ZFCA 1NU1J 3I5CA 1GL2D 4M3LA 2QA4P 1K04A 3L74E 1EDKA 2JDIH 2IYOA 2O01J 1CW5A 1M1KQ 1FDIA 5BVZA 3M0DC 3HUSC 4IL6H 1PV3A 3CX5I 4UB8H 2E74B 3P32A 2ITAA 5DJTB 3T97A 1SS1A 3TGUD 4A7PA 4K3AA 2Q5UA 1L0LE 1ZV8A 3PH0A 1ZRTD 3HUSA 1LJ2A 1NU1E 4HH2A 1P84I 1G1IA 2FBWC 2QJPC 3PTZA 1VQ9P 2IX7C 3OJAB 1S5LH 4NPEA 1SQPJ 1LT9B 1BE3D 1JB0J 1KILB 3BCCE 2H8PD 1ZN5A 1FOSE 2FYUK 2M3BA 3HD7D 1X9VA 1KQSO 4C46A 3Q5PA 1Q90D 4OGQD 5AW8B 1JO5A 3TGUJ 2IBZD 4D6TD 3BRVB 3H1HD 4NPDA 1A02F 4PV1B 3L75G 3AEGC 4IOIH 1OWAA 5K5GB 2OQQA 4Y99B 3RK2D 1DEBA 4K35A 1VQ4P 5KAFE 2HPCA 2A45I 4DJGA 4EYYQ 1H0TA 3TSIA 2OYOA 1D7MA 3B71A 3CCEP 2IZ0A 1E79H 4WB4A 1SQQD 3D6YA 3SFEC 3TGUE 1L0ND 5AVVB 3FGAD 1FJPA 1G2CB 1ZRTE 2I8DA 4D6TJ 2BCCD 2OYHC 2FKWB 3AE9C 1KFNA 1KQLA 3RBZA 1RF1B 3H1HJ 3S1KA 1GL2C 5AW1B 2YO2A 1KB9H 3AE1C 3V6IA 2J58A 1GU4A 1QL2A 1T6AA 4KJMA 1YQ4C 3AEDC 3CCRP 1GK6A 2YIUB 1LTBC 1BCCD 2HODA 2BASA 1FS0E 4WY4B 1L4AC 3L74G 5C39A 2OYHA 2CPSA 2W27A 1Y8AA 3H1LD 3G3ZA 3EFGA 1R8EA 1M1JB 1S4XA 2C9NY 5KKZB 1RQUA 3D6ZA 2WPRA 3WUUA 2AXCA 1SQQJ 5B66H 1L0LK 2IBZE 4UB8E 4D6TE 1JEKA 3IF4A 3H1HE 2Y0DA 2LR2A 1L4AA 1L0LG 1NU1K 4PD4D 3OAKA 4W7YA 2BCCJ 1JY2P 1NU1G 3L71D 4U7JA 5DJUB 1J2JB 3FWNA 4BXLA 1USEA 1T3UA 1WRGA 2W6AA 4WY4D 1VQ6P 3H1KD 2E74C 3RBXA 2UWJE 3AE7C 1BCCJ 2V7QH 3MP7B 1FJKA 1KYOD 3CC2P 2XKMA 5BU8B 3V2RA 2KS1A 2FFDB 4H13B 3BCCG 3H1LJ 1AQ5A 2ZJSE 3M91A 1SQQE 2ZYGA 5KJ7C 1SQBK 1FBMA 3CLQA 2BCCE 2WSFH 3KYQA 4I6MC 1GU5A 1MFZA 2OGUA 2XNDH 3VP8A 3L71J 3D70A 3GW6A 2VRSA 3RL0g 5KJ7A 1KILC 5CCGC 2H43A 2FYUD 1HTLC 1SQPK 1BCCE 5AW4B 5AVXB 2W8ZA 3KZIE 1WT6A 1T3JA 3H1KJ 3V2PA 3LW5J 5APTA 4H13D 2GM4A 3PRJA 1EC5A 3H1LE 3IFMA 2KZIA 1H8AA 2E75B 3G9RA
chains in the Genus database with same CATH topology
1LT1A 1JMBA 3MZWB 1LP1A 4HB1A 2B87B 4EYYQ 4GOEA 1FC2C 4K3AA 3RGUA 1H0TA 5DJUB 4CPGA 2JWDA 1EDJA 4BXLA 2LXCB 3PH0A 1DEEG 4ZMDA 1BDCA 3MHVA 1S3JA 1ZW0A 2Q1KA 2UWJE 4HJGH 4MN4C 2M5AA 2QVAA 4GOFA 2ZAEB 3ZDMA 3FXDA 1Q2NA 2SPZA 5CBOA 2I8DA 2B87A 1U7JA 2KZJA 4ZNCA 4HKZH 2M0BA 3S1KA 4NPEA 5CBNA 2KUBA 3FXEA 4ASVA 2LXBA 4KJMA 2P58A 2B88A 2QRXA 2HR3A 5C39A 1MFTA 1JM0A 1LP1B 2K3RA 1OVVA 3QWOC 1U7MA 2KI7B 2RKLA 1H0TB 4NPDA 1EDLA 2B89A 1EDKA 4GODA 4ASWA 4IOIH 1NVOA 1ZXGA 5K5GB 1BDDA 1OVRA 4JBZA 1EDIA 2WMMA 4NPFX 1Y47A 1OVUA 2M5AB 4K35A 2KIKA 1X0TA 1EC5A 4WWIA 2LR2A 2KZIA 5DJTB 2R44A 2OTKE 2KS1B 1SS1A 5EFWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LT1 A;  1JMB A;  3MZW B;  1LP1 A;  4HB1 A;  2B87 B;  4EYY Q;  4GOE A;  1FC2 C;  4K3A A;  3RGU A;  1H0T A;  5DJU B;  4CPG A;  2JWD A;  1EDJ A;  4BXL A;  2LXC B;  3PH0 A;  1DEE G;  4ZMD A;  1BDC A;  3MHV A;  1S3J A;  1ZW0 A;  2Q1K A;  2UWJ E;  4HJG H;  4MN4 C;  2M5A A;  2QVA A;  4GOF A;  2ZAE B;  3ZDM A;  3FXD A;  1Q2N A;  2SPZ A;  5CBO A;  2I8D A;  2B87 A;  1U7J A;  2KZJ A;  4ZNC A;  4HKZ H;  2M0B A;  3S1K A;  4NPE A;  5CBN A;  2KUB A;  3FXE A;  4ASV A;  2LXB A;  4KJM A;  2P58 A;  2B88 A;  2QRX A;  2HR3 A;  5C39 A;  1MFT A;  1JM0 A;  1LP1 B;  2K3R A;  1OVV A;  3QWO C;  1U7M A;  2KI7 B;  2RKL A;  1H0T B;  4NPD A;  1EDL A;  2B89 A;  1EDK A;  4GOD A;  4ASW A;  4IOI H;  1NVO A;  1ZXG A;  5K5G B;  1BDD A;  1OVR A;  4JBZ A;  1EDI A;  2WMM A;  4NPF X;  1Y47 A;  1OVU A;  2M5A B;  4K35 A;  2KIK A;  1X0T A;  1EC5 A;  4WWI A;  2LR2 A;  2KZI A;  5DJT B;  2R44 A;  2OTK E;  2KS1 B;  1SS1 A;  5EFW B; 
#chains in the Genus database with same CATH topology
 1FDM A;  1MUU A;  4PV1 C;  2FXP A;  2WTY A;  3SFD C;  1JMM A;  4EIJ A;  2JWD A;  2GUS A;  1KIL A;  3TGU G;  2HFE D;  2B9B A;  2YXQ B;  2A06 D;  4N3Y B;  1JNM A;  4Y99 C;  1IFN A;  4PD4 E;  1HBW A;  4W80 A;  1FZC C;  3L71 E;  3CXH H;  1HF9 A;  2XZR A;  4YXD C;  1IFD A;  1FZB A;  2YNY A;  1U7J A;  4WBA A;  3H1K E;  1YIJ P;  1ZME C;  1KB9 E;  1KYO E;  1SQX K;  1JY3 P;  1VQM P;  2Q7C A;  1FZC A;  2O01 N;  2V4H A;  3I56 P;  2HPC B;  1RF1 C;  2QIW A;  3AE2 C;  2WIT A;  3NTN A;  3AEC C;  1H0T B;  5KLI C;  2IBZ G;  3V2Q A;  4D6T G;  2K9J A;  1Z56 A;  3O8Z A;  3H1H G;  2WT7 A;  3NFQ A;  4BRY A;  4UB6 E;  1X22 A;  4WY4 C;  4DT0 A;  4RKU J;  1QX8 A;  1S2E A;  4Y28 J;  2FYU E;  3VMZ A;  4EI2 A;  1RH5 B;  3C9I A;  1M1J C;  1NO4 A;  1YJ9 P;  3AEA C;  2P7J A;  2R3C A;  2G3A A;  4R4L A;  1U57 A;  3F89 A;  2KSE A;  4IFF A;  1RE3 C;  3TDK A;  1SQQ K;  1NU1 D;  3VMY A;  3HRN A;  1EQ7 A;  1LTA C;  3JC2 2;  2HOD B;  1SQQ G;  3P8C D;  2A06 E;  1GZL A;  2OYH B;  3S9O A;  3GG2 A;  2FYZ A;  4ZNC A;  3CC7 P;  2BCC G;  3MUD A;  1FU1 A;  3NMD A;  4GKG A;  1NAF A;  1AFO A;  1OW7 A;  1RE3 A;  1VL2 A;  3NXS A;  1NTK J;  1H89 A;  2FFD C;  1L4A B;  1RQV A;  2WZ7 A;  4H13 C;  2O3J A;  1NTZ J;  1PPJ D;  1BCC G;  2QM7 A;  1IFM A;  1LTG C;  1NYH A;  3M9H A;  1SQB D;  1M57 D;  3H1L G;  1LWU C;  3CX5 H;  1MZ9 A;  1CI6 A;  3H32 A;  2E5Y A;  4IL6 X;  2FFD A;  2BEQ D;  3Q3D A;  3OW2 O;  2OTK E;  2KS1 B;  2R5D A;  1JMB A;  3O6Q A;  1AVO A;  1FC2 C;  1SQP D;  3G71 P;  1URQ C;  3WU2 H;  5B5E H;  1LWU A;  1JCC A;  3L71 G;  4L74 A;  1L4A D;  5KAI H;  1P84 H;  3L36 A;  2M3E A;  2IFM A;  2QVA A;  2E75 C;  3CL3 D;  3H1K G;  3D71 A;  4Z1M H;  1QVG O;  3CCM P;  1N2D C;  1OW8 A;  4OH8 B;  1URQ A;  2H88 C;  3AEF C;  1ZP0 C;  2YO3 A;  1SQB J;  3MIW A;  2Y0E A;  3GHG B;  1E5W A;  2C0X A;  1S5L X;  3P8C E;  4RO0 A;  3A0H E;  5GTI H;  2W6B A;  1VPC A;  4QMA A;  2KK7 A;  2IBZ I;  3E1I A;  3H1J D;  1N8R Q;  5AW3 B;  2E74 D;  2R5B A;  1FDO A;  1SQX D;  3Q2Y A;  5APS A;  5BU5 A;  1OIP A;  4B86 A;  1YTZ T;  1K8A Q;  1IFJ A;  5AW9 B;  1EDI A;  1PPJ E;  2FYU G;  1G1J A;  3AE3 C;  3A0B E;  1HGV A;  1VF5 C;  2G8Y A;  2IDB A;  3M0A A;  1SQB E;  3K5B A;  2A45 H;  5KJ7 D;  5E79 H;  1EDJ A;  1QGK B;  2P10 A;  3GF7 A;  1Q7Y Q;  3KQG A;  3MD0 A;  3GLM A;  1ZW0 A;  3TK1 A;  2A06 G;  1FZC B;  1JY2 N;  2Z5I A;  1SQP E;  1KIL D;  5CCG D;  1M56 D;  1K73 Q;  3H1J J;  2KLU A;  1SQX J;  2K9J B;  1W2E A;  1AA0 A;  3R4Y A;  4DOJ A;  1JY2 O;  2WT7 B;  5H2F H;  4BRY B;  4PV1 D;  3V5B A;  3R2P A;  4BWN A;  1VQ7 P;  1AV1 A;  4L76 A;  3VOP A;  3AEB C;  4AQR D;  2JO1 A;  1R5S A;  1HVV A;  3KDP B;  1JM0 A;  1S9K E;  2K3R A;  2XDJ A;  3RL0 C;  1AJY A;  5KLI B;  2KI7 B;  1YIT P;  3ABV C;  2P2U A;  3FX0 A;  3MGN A;  2WMM A;  1Y47 A;  5GTH H;  3H1J E;  3FWL A;  1CZQ A;  4L75 A;  1N7S A;  3RK3 B;  1NTK K;  1GTW A;  1SQX E;  2WQY C;  4PD4 I;  2RH0 A;  1SFC A;  3MZW B;  1NTZ K;  1YHQ P;  3VYI A;  1XTG B;  1USD A;  2JEE A;  2Y9Z A;  4IL6 E;  1PGP A;  3WU2 E;  1FZA A;  3L73 D;  3M06 A;  2KLV A;  1SP4 A;  1NKN A;  2QEX P;  1FAV A;  1QEX A;  1KYO I;  4OWF A;  2CK3 H;  2SPZ A;  2Q6Q A;  3SWK A;  3CCS P;  3RK3 D;  2AEF A;  1BSN A;  1KB9 D;  3SSU A;  1KIL E;  3FXE A;  1CI6 B;  3V2N A;  3H32 B;  1SQV J;  1Y9B A;  2HR3 A;  3PLN A;  1S1C X;  3BVH A;  1JY3 N;  3S4R A;  3O6Q B;  2WSE H;  1S5L E;  2PRR A;  1PFI A;  2RKL A;  1BGY D;  2GUV A;  1YBK A;  4JYC A;  5KLV D;  3GHG C;  1PPJ G;  1LWU B;  3EFF K;  3L73 J;  1ZXG A;  1SQB G;  1TU3 F;  3A2A A;  3AE6 C;  4JF7 A;  1YJN P;  1LTI C;  3TNU A;  1DX7 A;  3MTU E;  1AVY A;  2WWW A;  1S72 P;  2M8R A;  1JY3 O;  5M1B A;  2D2C C;  1VDF A;  2P1J A;  1LP1 A;  5AW5 B;  1H88 A;  1KMI Z;  3RGU A;  1URQ B;  5AVY B;  3Q1M A;  3GHG A;  1X79 B;  1K9M Q;  1SQP G;  3CME P;  1NJI Q;  2AXT H;  2Q1K A;  1MKM A;  1J1D B;  2M5A A;  1HJ0 A;  1LTS C;  1L2P A;  1VQN P;  3L73 E;  2WSC H;  2JP3 A;  2E76 C;  3CCU P;  1NTM K;  1BGY J;  5KLV J;  4PJ0 H;  2KYV A;  3G6E P;  1PZQ A;  2DW3 A;  4LC1 A;  3U59 A;  1JCD A;  2XNX A;  3KXD A;  5H2F E;  1URQ D;  3JSV C;  1IJD B;  3C1L A;  3RK3 E;  3JCU H;  3CCQ P;  3P7K A;  2KNC A;  2B89 A;  1FZE A;  2E75 D;  3H1J G;  3HE4 A;  1EXI A;  1SQX G;  3AEE C;  1BDD A;  4JBZ A;  1R5L A;  1DIP A;  5GTH E;  5AVW B;  3B8E B;  1OVU A;  3SWY A;  1ZR2 A;  1VF5 B;  2KB7 P;  3L72 D;  1BGY E;  3F5H A;  1IFP A;  5KLV E;  2JJL A;  2CPB A;  2V7Q J;  1LT1 A;  1JTH A;  4GOE A;  4LLH A;  2ZYA A;  2O01 H;  4CPG A;  2NRG A;  2KP8 A;  1KFM A;  5B66 E;  2L91 A;  5APY A;  2E42 A;  1NTK D;  3CCV P;  3RK3 C;  4MN4 C;  2POH A;  1QLE D;  1KD1 Q;  1NTZ D;  3U1A A;  1Q2N A;  1KOR A;  2AEM A;  2WSF J;  1HH0 A;  5CBO A;  3CXH D;  1JOC A;  3A3Y B;  3CCL P;  3MUD C;  2NZ2 A;  1KZU B;  5AVZ B;  1VF5 D;  2AEJ A;  1FZF A;  1VQ5 P;  2KUB A;  1GK4 A;  4RJT A;  2OTL P;  1HJB A;  2LXB A;  2IPP A;  1N7S B;  3L72 J;  1SFC B;  5AW2 B;  3RL0 B;  3KHU A;  3CMA P;  5KAF H;  2LKM A;  4EDF A;  3IR9 A;  4JPZ B;  2QSI A;  3CC4 P;  3N4X A;  3L70 D;  4GOD A;  5CJ4 A;  1NVO A;  4JQ0 D;  3AE4 C;  1SQV K;  4N78 D;  2YXR B;  3I55 P;  2N9B A;  2WPV B;  3II6 A;  1EZV D;  1IC2 A;  2ZXE B;  1Q81 Q;  4U3F D;  1RF0 A;  1PGJ A;  3BAS A;  3L72 E;  2PFX A;  3G4S P;  4IFD K;  2O1J A;  2Q3I A;  3RL0 D;  2NPS C;  3L73 G;  3ZDM A;  3CI9 A;  1OXZ A;  4I1L A;  2B87 A;  3W67 A;  3USS A;  2N9Y B;  1NTK E;  3PHL A;  1NOH A;  4PJ0 E;  2ZT9 C;  4TT3 H;  3L70 J;  1NTZ E;  5APV A;  1SLQ A;  2YMK A;  1J1D C;  2NPS A;  4YXW H;  3CXH E;  1M90 Q;  3TNU B;  2OYI A;  1NTM D;  3HE5 A;  4H0L C;  4LGD E;  1MFT A;  1LP1 B;  3BCC J;  3JCU E;  4U3F J;  1S9K D;  5APQ A;  3CPW O;  5KLV K;  3IN6 A;  3HD7 B;  4XE5 B;  3M9Q A;  1BGY G;  5AVS B;  5KTB A;  5KLV G;  1VQ8 P;  4OGQ B;  3CX5 D;  3M0D A;  2MJZ A;  1UII A;  2M5A B;  3HTK A;  2H89 C;  2D2C B;  2L5G B;  5CCH C;  3L70 E;  3GF3 A;  5TIS H;  3A7O A;  4IFM A;  5AVQ B;  1OZH A;  3RK2 B;  3H6P A;  4N78 E;  3EQ2 A;  4L73 A;  1RY3 A;  1Q86 Q;  4ZMD A;  5APX A;  1S3J A;  1MV8 A;  2K9Y A;  3WUV A;  1VQL P;  1P84 D;  1EZV E;  4RES B;  1VQP P;  5CCH A;  4U3F E;  1W2B O;  1NTM J;  4H44 C;  2PAJ A;  2E76 B;  1PP9 D;  2RN0 A;  2N1T C;  4DCK A;  5L8R J;  3VTP C;  2QG4 A;  3AE5 C;  4HKZ H;  1ZOY C;  3WMM 0;  1ZLL A;  4KT0 J;  2KNC B;  3LID A;  3HE4 B;  1M8O B;  2D2C D;  3ITK A;  1PIX A;  2MKV A;  3B4S A;  1N86 A;  4ZKU A;  1IZN B;  2QJY B;  3KZI H;  3H1I D;  1VQO P;  1N73 C;  1EXJ A;  2C9L Y;  2ZVO B;  2JR8 A;  1T8Z A;  2JKV A;  2HG5 D;  4HYT B;  2N1T A;  1JTH B;  4JYB A;  1DD4 A;  1OVV A;  2K88 A;  3B5N C;  1LNQ A;  3WUT A;  2FYN C;  3N7N A;  1VQK P;  1KC8 Q;  2YMY A;  1LTJ C;  2JWA A;  1NTM E;  1N7S C;  2QJK C;  1BE3 J;  1N73 A;  5AVT B;  2E76 D;  3PJS K;  4PD4 H;  2KIK A;  2BEZ F;  1SFC C;  1A02 J;  4GT1 A;  2R44 A;  1GW3 A;  2I1J A;  5EFW B;  2R3S A;  3BRT B;  3L72 G;  1PP9 J;  3CWB D;  5CHX A;  2E5T A;  2W83 C;  3B5N A;  1T2K C;  1ZR4 A;  3W68 A;  3CX5 E;  1YI2 P;  2LXC B;  3E1R A;  1GD2 E;  1DEE G;  1LTJ A;  3LW5 H;  1J1E B;  1DH3 A;  1SQV D;  1WMK A;  1KYO H;  2WPS A;  3H1I J;  4R4M A;  2ZVN B;  1Q82 Q;  1NTK G;  2PP6 A;  4TLF A;  2ZYD A;  5AW7 B;  1YJW P;  1IO4 A;  1NTZ G;  5AW6 B;  5B5E E;  2M0B A;  4N6J A;  2KXP B;  1BE3 E;  5KAI E;  1P84 E;  2WPQ A;  1X8Y A;  1GL2 A;  1KB9 I;  2Y9Y A;  1PP9 E;  1RHZ B;  1DD3 A;  2OAR A;  4UB6 H;  1RE4 C;  1L0N J;  2IFN A;  4WVZ A;  3CWB J;  3QWO C;  1U7M A;  1GDT A;  3H1I E;  4C7N A;  2K1A A;  2FY8 A;  4I7Z B;  5GTI E;  4ASW A;  1IFI A;  2YKQ A;  3PP5 A;  1OVR A;  2YKP A;  3L70 G;  1RE4 A;  1X0T A;  4WWI A;  2Z5H A;  1OMI A;  2R32 A;  4HB1 A;  2B87 B;  1IK9 A;  5TIS E;  4AUW A;  3HD7 C;  2K37 A;  3TYY A;  2KSJ A;  1EZV G;  4OGQ C;  5APW A;  3CD6 P;  1BDC A;  4U3F G;  3MHV A;  1L0N E;  1JUN A;  1KTM A;  2IZ1 A;  1YQ3 C;  3UIA A;  1KN7 A;  2NPS B;  3V4Q A;  3CWB E;  4GOF A;  2RMZ A;  5E79 E;  2OYI B;  3HE5 B;  2KZJ A;  1SQV E;  3HD7 A;  3RK2 C;  3T97 B;  1HWT C;  1KV4 A;  4EOT A;  3M9B A;  2ZT9 B;  1LT9 C;  4ASV A;  1NAY A;  3HUS B;  2P58 A;  2QRX A;  3HTK B;  5CMZ A;  3L37 A;  1NGM B;  4H0L B;  4AYC A;  2H7H A;  2QE7 H;  1CSB A;  3P8M C;  3C8V A;  1NHL A;  1NTM G;  3L75 D;  1QVF O;  3GMA A;  3OA7 A;  2NPS D;  1LT9 A;  5CCG A;  2Q3E A;  2QJY C;  4NPF X;  4W7Z A;  3L35 A;  4DZO A;  1GMJ A;  5AVU B;  5APU A;  1GW4 A;  2XV5 A;  1UIX A;  1PL5 A;  2ZT9 D;  3L4F A;  1K05 A;  1AQT A;  2QJP B;  3AE8 C;  3A5T A;  3QH9 A;  1FZG A;  3BAT A;  4H0L D;  1KQG B;  4YTP C;  1IK7 A;  2FYU J;  3TF5 A;  3A0H H;  2J59 M;  2WVR A;  4H44 B;  1BE3 G;  1LTT C;  1PGO A;  3CXH I;  4O9B A;  3EWK A;  2N1T B;  1QL1 A;  3KPE A;  3L75 J;  2Y0C A;  2O1K A;  1J1E C;  2WSE J;  3U1C A;  2QM8 A;  1PP9 G;  2IYP A;  1BSH A;  1NKZ B;  5CCH D;  2GA1 A;  4XFJ A;  3VN0 A;  3LIE A;  1OX3 A;  3L74 D;  1N73 B;  1M7L A;  2E43 A;  2YIU C;  1W5C E;  1FE6 A;  3E7K A;  1HUC A;  1PGQ A;  3H1I G;  2PGD A;  1G2C A;  3A0B H;  1LGH B;  1YTZ I;  1RF1 A;  2P67 A;  4YPC A;  3B5N B;  1OFC X;  2FYN B;  1EDL A;  2XU6 A;  5AVR B;  1LTJ B;  5KKZ C;  4H44 D;  3VMA A;  1NWQ A;  3Q5R A;  2Z4E A;  1KQF B;  3VP9 A;  2QJK B;  1L0L D;  1SVF A;  3IAO A;  2N1T D;  3L75 E;  1NH4 A;  4WY4 A;  2FXM A;  1L0N K;  4XA4 A;  1EZV I;  2W90 A;  3CCJ P;  2C0W A;  4GIF A;  1RF0 C;  3H25 A;  4I7Z C;  1L0N G;  2J5U A;  2KOG A;  2WSC J;  1M1J A;  5AW0 B;  2A45 G;  1YYC A;  3CWB G;  1GL2 B;  4I2L C;  2HLO A;  5CJ0 A;  3V4W A;  3L74 J;  1OW6 A;  4HJG H;  4C7R A;  1SQV G;  2ZAE B;  3B5N D;  3FXD A;  2W6J H;  3Q5S A;  3BCC D;  2WSS H;  2YKO A;  4GDO A;  1N7L A;  1HGZ A;  1N7S D;  3SWF A;  2Q9I A;  4C7N B;  1SFC D;  2AXT E;  5CBN A;  4OVN F;  1XTC C;  2I1K A;  1FOS F;  1L0L J;  2OTJ P;  2HYN A;  2ZXX A;  3VMX A;  4KHX A;  4ZKP A;  2B88 A;  2OYI C;  2FXO A;  5TJH A;  1T2K D;  2ZFC A;  1NU1 J;  3I5C A;  1GL2 D;  4M3L A;  2QA4 P;  1K04 A;  3L74 E;  1EDK A;  2JDI H;  2IYO A;  2O01 J;  1CW5 A;  1M1K Q;  1FDI A;  5BVZ A;  3M0D C;  3HUS C;  4IL6 H;  1PV3 A;  3CX5 I;  4UB8 H;  2E74 B;  3P32 A;  2ITA A;  5DJT B;  3T97 A;  1SS1 A;  3TGU D;  4A7P A;  4K3A A;  2Q5U A;  1L0L E;  1ZV8 A;  3PH0 A;  1ZRT D;  3HUS A;  1LJ2 A;  1NU1 E;  4HH2 A;  1P84 I;  1G1I A;  2FBW C;  2QJP C;  3PTZ A;  1VQ9 P;  2IX7 C;  3OJA B;  1S5L H;  4NPE A;  1SQP J;  1LT9 B;  1BE3 D;  1JB0 J;  1KIL B;  3BCC E;  2H8P D;  1ZN5 A;  1FOS E;  2FYU K;  2M3B A;  3HD7 D;  1X9V A;  1KQS O;  4C46 A;  3Q5P A;  1Q90 D;  4OGQ D;  5AW8 B;  1JO5 A;  3TGU J;  2IBZ D;  4D6T D;  3BRV B;  3H1H D;  4NPD A;  1A02 F;  4PV1 B;  3L75 G;  3AEG C;  4IOI H;  1OWA A;  5K5G B;  2OQQ A;  4Y99 B;  3RK2 D;  1DEB A;  4K35 A;  1VQ4 P;  5KAF E;  2HPC A;  2A45 I;  4DJG A;  4EYY Q;  1H0T A;  3TSI A;  2OYO A;  1D7M A;  3B71 A;  3CCE P;  2IZ0 A;  1E79 H;  4WB4 A;  1SQQ D;  3D6Y A;  3SFE C;  3TGU E;  1L0N D;  5AVV B;  3FGA D;  1FJP A;  1G2C B;  1ZRT E;  2I8D A;  4D6T J;  2BCC D;  2OYH C;  2FKW B;  3AE9 C;  1KFN A;  1KQL A;  3RBZ A;  1RF1 B;  3H1H J;  3S1K A;  1GL2 C;  5AW1 B;  2YO2 A;  1KB9 H;  3AE1 C;  3V6I A;  2J58 A;  1GU4 A;  1QL2 A;  1T6A A;  4KJM A;  1YQ4 C;  3AED C;  3CCR P;  1GK6 A;  2YIU B;  1LTB C;  1BCC D;  2HOD A;  2BAS A;  1FS0 E;  4WY4 B;  1L4A C;  3L74 G;  5C39 A;  2OYH A;  2CPS A;  2W27 A;  1Y8A A;  3H1L D;  3G3Z A;  3EFG A;  1R8E A;  1M1J B;  1S4X A;  2C9N Y;  5KKZ B;  1RQU A;  3D6Z A;  2WPR A;  3WUU A;  2AXC A;  1SQQ J;  5B66 H;  1L0L K;  2IBZ E;  4UB8 E;  4D6T E;  1JEK A;  3IF4 A;  3H1H E;  2Y0D A;  2LR2 A;  1L4A A;  1L0L G;  1NU1 K;  4PD4 D;  3OAK A;  4W7Y A;  2BCC J;  1JY2 P;  1NU1 G;  3L71 D;  4U7J A;  5DJU B;  1J2J B;  3FWN A;  4BXL A;  1USE A;  1T3U A;  1WRG A;  2W6A A;  4WY4 D;  1VQ6 P;  3H1K D;  2E74 C;  3RBX A;  2UWJ E;  3AE7 C;  1BCC J;  2V7Q H;  3MP7 B;  1FJK A;  1KYO D;  3CC2 P;  2XKM A;  5BU8 B;  3V2R A;  2KS1 A;  2FFD B;  4H13 B;  3BCC G;  3H1L J;  1AQ5 A;  2ZJS E;  3M91 A;  1SQQ E;  2ZYG A;  5KJ7 C;  1SQB K;  1FBM A;  3CLQ A;  2BCC E;  2WSF H;  3KYQ A;  4I6M C;  1GU5 A;  1MFZ A;  2OGU A;  2XND H;  3VP8 A;  3L71 J;  3D70 A;  3GW6 A;  2VRS A;  3RL0 g;  5KJ7 A;  1KIL C;  5CCG C;  2H43 A;  2FYU D;  1HTL C;  1SQP K;  1BCC E;  5AW4 B;  5AVX B;  2W8Z A;  3KZI E;  1WT6 A;  1T3J A;  3H1K J;  3V2P A;  3LW5 J;  5APT A;  4H13 D;  2GM4 A;  3PRJ A;  1EC5 A;  3H1L E;  3IFM A;  2KZI A;  1H8A A;  2E75 B;  3G9R A; 
#chains in the Genus database with same CATH homology
 1LT1 A;  1JMB A;  3MZW B;  1LP1 A;  4HB1 A;  2B87 B;  4EYY Q;  4GOE A;  1FC2 C;  4K3A A;  3RGU A;  1H0T A;  5DJU B;  4CPG A;  2JWD A;  1EDJ A;  4BXL A;  2LXC B;  3PH0 A;  1DEE G;  4ZMD A;  1BDC A;  3MHV A;  1S3J A;  1ZW0 A;  2Q1K A;  2UWJ E;  4HJG H;  4MN4 C;  2M5A A;  2QVA A;  4GOF A;  2ZAE B;  3ZDM A;  3FXD A;  1Q2N A;  2SPZ A;  5CBO A;  2I8D A;  2B87 A;  1U7J A;  2KZJ A;  4ZNC A;  4HKZ H;  2M0B A;  3S1K A;  4NPE A;  5CBN A;  2KUB A;  3FXE A;  4ASV A;  2LXB A;  4KJM A;  2P58 A;  2B88 A;  2QRX A;  2HR3 A;  5C39 A;  1MFT A;  1JM0 A;  1LP1 B;  2K3R A;  1OVV A;  3QWO C;  1U7M A;  2KI7 B;  2RKL A;  1H0T B;  4NPD A;  1EDL A;  2B89 A;  1EDK A;  4GOD A;  4ASW A;  4IOI H;  1NVO A;  1ZXG A;  5K5G B;  1BDD A;  1OVR A;  4JBZ A;  1EDI A;  2WMM A;  4NPF X;  1Y47 A;  1OVU A;  2M5A B;  4K35 A;  2KIK A;  1X0T A;  1EC5 A;  4WWI A;  2LR2 A;  2KZI A;  5DJT B;  2R44 A;  2OTK E;  2KS1 B;  1SS1 A;  5EFW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...