5K5GB

Structure of human islet amyloid polypeptide in complex with an engineered binding protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
44
structure length
44
Chain Sequence
GGEIVYLPNLNPDQLCAFIHSIHDDPSQSANLLAEAKKLNDAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human islet amyloid polypeptide in complex with an engineered binding protein
rcsb
source organism Homo sapiens
molecule tags Hormone
molecule keywords Islet amyloid polypeptide
total genus 15
structure length 44
sequence length 44
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5k5gB00
3ZDMA 5EFWB 1LP1B 3MHVA 2ZAEB 2Q1KA 2HR3A 1EC5A 2LXBA 1EDLA 4GOFA 3RGUA 1U7MA 1BDCA 4GODA 1OVVA 2M5AA 2M5AB 1EDJA 2B88A 1ZW0A 2LR2A 4NPEA 2OTKE 5CBOA 4NPFX 3QWOC 4ZNCA 2KUBA 2KZIA 2P58A 2R44A 3MZWB 1H0TA 2KS1B 1LP1A 4ASWA 1ZXGA 2SPZA 4NPDA 5DJUB 5DJTB 3FXDA 1U7JA 2QRXA 4EYYQ 1BDDA 2B87A 1S3JA 5CBNA 2K3RA 1EDIA 2KZJA 1FC2C 3FXEA 5C39A 4GOEA 2WMMA 4JBZA 1OVUA 3PH0A 1X0TA 2KIKA 4KJMA 4HB1A 1H0TB 2UWJE 1JMBA 4IOIH 3S1KA 2B89A 1EDKA 1JM0A 2LXCB 1Q2NA 4BXLA 1OVRA 4WWIA 1MFTA 1SS1A 1LT1A 4CPGA 1NVOA 2M0BA 1Y47A 2QVAA 4K3AA 4ZMDA 1DEEG 2I8DA 2B87B 2JWDA 5K5GB 4ASVA 4HJGH 4HKZH 2RKLA 4MN4C 2KI7B 4K35A
chains in the Genus database with same CATH superfamily
2ZT9D 2ZXXA 3ZDMA 1KQSO 1G2CA 5B5EH 4O9BA 4PD4H 4YXDC 4C7RA 2WPRA 2WQYC 1ZR2A 1LP1B 4OWFA 3Q1MA 1NTZK 3PJSK 5AW8B 3RK3B 1VF5C 2Q3IA 2HPCB 1FZCC 1OW8A 2ZAEB 1ZN5A 3A7OA 4L74A 1NTKJ 2IPPA 1JTHB 2KLUA 4XE5B 4A7PA 3CC4P 3CC2P 1DD3A 1IFNA 1JY3N 2KNCA 2O01J 2AXTE 4WB4A 3WUUA 1M7LA 2IZ1A 3GHGB 1KB9E 2E76D 2K1AA 3M06A 1JY3O 3MD0A 2H43A 3CD6P 2C9NY 1KN7A 1BGYE 1BDCA 3E7KA 2OQQA 1ZMEC 1K04A 5AVWB 1QL2A 1ZOYC 3IFMA 2YXRB 3H1JE 3K5BA 4WY4D 3RL0B 1VF5D 4BRYA 4DZOA 5BU8B 3BVHA 1PP9J 5AVVB 1SP4A 1FE6A 3EFGA 3CCMP 2BCCJ 1P84D 3GG2A 1PGJA 3U59A 3KXDA 2LR2A 3MGNA 4B86A 1VQ8P 2BCCG 1PPJE 2WTYA 3QWOC 2L5GB 3PP5A 1JCDA 4RESB 2KUBA 1CI6A 3GHGC 1KV4A 1SQXK 1HH0A 1HUCA 2IFMA 5H2FH 1LT9C 1GU4A 4I6MC 3L71J 2AEFA 2AXTH 2KOGA 4R4MA 4DT0A 3Q5RA 2Y0DA 3MZWB 2GUSA 3RK3D 1E79H 3V2NA 3R4YA 4LGDE 3HE4B 5KLIB 2FYZA 1NTKE 1QVFO 2G8YA 4NPDA 4U3FD 2ZXEB 5DJUB 2A06G 1AVYA 4AUWA 1K9MQ 1GDTA 3AE5C 3A0BH 4PV1D 4WBAA 5KJ7C 3HD7B 3IAOA 4DJGA 1M56D 2FY8A 3H6PA 2WSFJ 1CZQA 1JO5A 3L36A 2B87A 1GD2E 5CCHA 1JCCA 4H0LC 1NWQA 1KFMA 1JY2O 1IC2A 1NU1K 2P2UA 2PFXA 2P7JA 1NJIQ 1LT9B 2BCCE 2A06D 3HTKB 2OTLP 1GW3A 1RE4A 2ZT9C 1FC2C 3FXEA 1ZRTD 2Q5UA 3BCCD 2A45H 2WMMA 1K05A 2XU6A 3A0BE 1N73B 3CCVP 3HUSB 2WPSA 3H1LJ 2W6JH 3MUDA 4IL6E 4JBZA 3USSA 1BCCD 3CXHE 3WUVA 1MV8A 3VYIA 2R3SA 5AW9B 2FBWC 5CCHC 3V4QA 1NU1D 4H0LD 3PRJA 3D6ZA 1H8AA 3D70A 3V2QA 3VOPA 3NTNA 3N7NA 5KKZB 1FZCA 1P84E 3AE7C 5H2FE 1Q81Q 5B66H 1URQD 2QJYC 1SQXE 2UWJE 2ZVOB 5AVYB 3AEAC 2B89A 3CCQP 4UB6E 3B5NC 3GMAA 4R4LA 4U3FJ 3SWKA 4BXLA 2FYUG 2C9LY 1OVRA 2R5DA 3LW5H 4JYCA 3RK3E 3N4XA 1EXJA 4Y28J 1LT1A 1L0LJ 2E75D 2FFDC 4CPGA 3L73G 1N2DC 1U57A 1NTKD 3VTPC 4RJTA 4RKUJ 1GW4A 1Q82Q 2Y9ZA 1NVOA 2FYNC 2V7QJ 2M8RA 2YKQA 2YMKA 1Z56A 3CXHH 4AYCA 3WUTA 1S2EA 3NXSA 3CMAP 1JMMA 1R5LA 2XKMA 4EI2A 5BVZA 3H1LE 1DD4A 4I7ZC 2HYNA 4JQ0D 3W67A 2Z4EA 3RL0g 4ZMDA 2JO1A 1DX7A 2E5YA 2WVRA 2OYIA 1L0ND 3P8MC 2JWDA 2O01N 4PV1C 5KJ7D 2YNYA 1QL1A 1BCCJ 1SQXG 3A0HE 1E5WA 4Y99C 1T3UA 1IFPA 5K5GB 3JCUH 4OGQB 2I1KA 5AW5B 4ASVA 2ZYAA 5GTIH 2QM8A 1KFNA 4XFJA 2RKLA 1H88A 1HJBA 1SQQG 4UB8H 3T97A 1MFZA 2FYNB 3BASA 3QH9A 4WY4A 3TYYA 2QA4P 1MZ9A 4PJ0H 1FJPA 5EFWB 1Y9BA 1BCCE 1W2BO 3FWNA 4KT0J 4N6JA 3L72E 3KYQA 1PP9G 1URQA 1IK7A 1LNQA 2KS1A 3VMZA 3G4SP 1EXIA 1KB9H 1LJ2A 2L91A 2OARA 1T2KD 4UB6H 2K88A 2Q1KA 1SLQA 4W7ZA 1N7SB 1EC5A 2FKWB 2N9YB 3HD7D 5AW6B 1YITP 4GOFA 3OW2O 1HF9A 3B8EB 3RGUA 5E79E 2YKPA 4Y99B 5KAFE 3L37A 4H44B 1KORA 4KHXA 1S5LX 1OW6A 3H1IG 3ABVC 2KLVA 1FOSF 2FYUE 2YIUB 1KB9D 3V2PA 2PP6A 1VQOP 3RBZA 5CCGA 4OVNF 1EDJA 2B88A 1AFOA 1VQ4P 1YQ4C 2E42A 1KYOH 1T3JA 1KILD 1LWUB 1OWAA 1PP9E 1ZW0A 1NTMJ 2OTKE 2YKOA 1SQQK 3CX5I 1SVFA 2K9JA 2FYUJ 2V7QH 3FGAD 3H1KJ 3JC22 4NPFX 5APQA 1GL2A 1OXZA 1SQVK 2KZIA 2WSCJ 2LKMA 2MJZA 3H1JD 1IFDA 3H1LD 1KB9I 4H0LB 5L8RJ 3EQ2A 2N1TC 2R44A 4OGQD 1S4XA 5AVRB 1PFIA 2KS1B 1SQBE 1FOSE 3L71G 1IFJA 1LTGC 1PIXA 2M3BA 4I1LA 1L0NK 2IX7C 3M0DC 1KILC 1PPJD 5AW2B 5KLVE 1H89A 1P84H 2YO3A 1SQPK 1IJDB 2H7HA 1BE3G 4GT1A 5B5EE 1IFMA 1NGMB 1N7LA 3LIDA 3T97B 3H1LG 3NFQA 3H32A 5KLVK 3I55P 5KLIC 5APSA 4QMAA 2E75B 4EYYQ 1N8RQ 3RK2C 2WT7B 4D6TD 4IFMA 4U7JA 2KB7P 2OYIB 4DOJA 1VQLP 1HGVA 2WSSH 1SQVE 1NHLA 1VQKP 2P10A 3H1ID 2Q7CA 5AW1B 1HWTC 1SQQE 2E5TA 2WT7A 1EZVE 2BEQD 1WT6A 1R8EA 3SSUA 3H32B 2W6AA 2M3EA 3PH0A 1Q90D 2KSJA 4RO0A 3H1KD 5CJ4A 4WY4C 1ZRTE 2FYUD 2H89C 1RQVA 5CHXA 1GMJA 2CPBA 3MIWA 2O3JA 1FDIA 2POHA 4PV1B 2QJKB 3A5TA 1DEBA 1VQ9P 2KK7A 1KMIZ 1KQGB 3E1IA 1KZUB 1MUUA 1KILE 1PP9D 2JWAA 2YXQB 1HGZA 3CXHD 4WVZA 4IOIH 1PGPA 2D2CC 2HG5D 2Z5IA 3AE9C 1JM0A 1GL2B 1NAFA 1YBKA 4YTPC 3CX5H 2C0WA 1KYOI 1NU1G 2K9JB 1JB0J 1R5SA 3KZIH 4U3FG 3B5ND 4U3FE 4WWIA 5AW7B 1MFTA 1LWUA 1VL2A 1SS1A 2R3CA 3RBXA 3SWFA 3G6EP 3KHUA 4W80A 5KTBA 1SQBG 2PGDA 1L0NG 3A3YB 1YJWP 5KJ7A 2YMYA 1L2PA 1FS0E 4IFFA 1KD1Q 3HUSA 3L73J 2W83C 4GIFA 1N73A 3JCUE 4XA4A 1CW5A 1T6AA 3SFDC 3TGUJ 2KXPB 1JNMA 2ZT9B 1RQUA 1GU5A 1J1DC 3M91A 1WRGA 1QX8A 2XDJA 3I5CA 4IL6X 3RL0C 3R2PA 5BU5A 2D2CB 3IN6A 1TU3F 1CSBA 3NMDA 5M1BA 4D6TE 1DH3A 1PV3A 2B9BA 1N7SA 1NTKG 1ZV8A 2B87B 2I8DA 2XNDH 3L70D 3P8CD 5APUA 1AVOA 3TGUE 2J59M 5B66E 4YXWH 2GM4A 1USEA 1VQ6P 1URQB 2AEMA 1LTJC 2XNXA 3H1IE 3M9HA 1OIPA 3VMAA 2WSFH 4MN4C 1L0NE 1N73C 1AJYA 1IZNB 2IYOA 5GTHE 3BCCJ 5CJ0A 2O1JA 4WY4B 3RL0D 1RF1C 4IL6H 3G9RA 3CCLP 1IO4A 1Q86Q 2OYHC 3MHVA 3CC7P 1YJNP 2ZYGA 1RE4C 3IF4A 1S5LH 2NRGA 3WMM0 3CCUP 3V2RA 2HR3A 2WSEH 1NU1J 2FXMA 1EDLA 3Q2YA 1PGQA 3WU2E 4EDFA 1AA0A 2IDBA 3HD7C 4GDOA 4LLHA 5AVSB 1U7MA 3S4RA 1BGYG 3VMYA 5AVTB 3Q3DA 2HFED 2PAJA 3L71E 1S9KD 3L73D 3CCEP 2R32A 3TGUG 4W7YA 4L73A 1GZLA 2IBZI 3C9IA 3ITKA 3GW6A 4AQRD 2Y0CA 4EOTA 2JJLA 2Y9YA 3M9BA 2A45G 5GTHH 4NPEA 1NTKK 5E79H 1PPJG 1L0LD 3EFFK 5AW4B 3C1LA 1NTZJ 3HUSC 2K9YA 2P67A 2IBZE 5AW3B 2BEZF 2KNCB 1BGYJ 1KC8Q 2P58A 1MKMA 1PGOA 3AE4C 3V4WA 2HPCA 1W5CE 1OX3A 4PD4I 1Q7YQ 3L70E 1LP1A 1S5LE 4ZKUA 3CWBG 1FZCB 5KLVG 3VN0A 1ZXGA 1G2CB 2CPSA 2CK3H 2SPZA 3L74D 1FDOA 3L75D 5DJTB 3PTZA 1BE3E 1S72P 3H1JJ 2K37A 1M57D 1FZBA 2WITA 3FXDA 2Q9IA 1M1JC 1SQBD 1BSHA 1DIPA 2KSEA 1U7JA 3G3ZA 1YHQP 2RMZA 1KILA 1NAYA 1SFCC 2QRXA 2I1JA 1VQ7P 3TSIA 1M1KQ 2QJYB 1BCCG 1SQXJ 2QJPC 1T2KC 5KLVD 3I56P 1AV1A 2K3RA 4LC1A 1LT9A 3HTKA 1JY3P 3U1AA 4TLFA 1SQVG 3H1HD 1EDIA 2KZJA 1LTIC 1W2EA 1GL2C 1NO4A 2E74B 2WPQA 2O01H 2G3AA 1LWUC 1WMKA 2ZJSE 3LIEA 3PLNA 4GOEA 5C39A 1NTZE 3S9OA 4D6TJ 3TNUB 2AXCA 2NZ2A 3HD7A 3IR9A 2ZFCA 3MP7B 4N78E 1OZHA 1X0TA 2P1JA 4PD4E 1UIXA 1ZR4A 2ITAA 3MUDC 1SQQD 1A02J 3KZIE 2KIKA 1EZVD 1FU1A 1L0LG 3AEEC 4UB8E 4L76A 1SQVD 3H1HG 5APYA 2Z5HA 3HE4A 5TJHA 5TISH 4HB1A 4I2LC 1VPCA 4OGQC 2OYHA 3H1KE 1USDA 2QJPB 3OAKA 3U1CA 1OMIA 2JR8A 2WPVB 1X22A 4YPCA 2E76C 4H13D 3S1KA 1XTCC 3AEGC 1NTME 1EDKA 3II6A 2IBZD 3JSVC 3L75J 2LXCB 1CI6B 5CMZA 1AQTA 1ZLLA 1KYOE 3F5HA 1J1EB 1X9VA 1LTSC 3W68A 3P7KA 3AE6C 1FJKA 1SQPG 1QEXA 2WZ7A 3HE5A 1LGHB 3L74E 1NOHA 3SWYA 2A45I 4ZKPA 1XTGB 1FZEA 3CXHI 4HYTB 1YJ9P 4BRYB 3Q5PA 2YO2A 3E1RA 5AW0B 3FX0A 3VMXA 2FXPA 3WU2H 5KAFH 1FDMA 1Y47A 2QVAA 1JY2P 1P84I 2W8ZA 3OJAB 3PHLA 3RK2D 3CWBJ 2Q3EA 1X79B 2NPSA 2E76B 4K3AA 3GHGA 1KQFB 3Q5SA 1NTMG 1VDFA 2J5UA 2OYIC 3CCJP 2W6BA 1JTHA 1SQPJ 4H44C 1FZAA 2J58A 4H13C 3HRNA 1K8AQ 3GF3A 1A02F 5CCGD 4Z1MH 2IFNA 1VF5B 5KKZC 2WSCH 2JKVA 1NTZD 3H1IJ 3M0AA 1RF0A 3AEDC 1BGYD 1N86A 2XZRA 2JDIH 3AE1C 1YYCA 3A0HH 2GA1A 1LTJB 1BE3J 2FYUK 2GUVA 1GTWA 1YTZT 3AE3C 3L35A 1RF1A 1JOCA 1T8ZA 2IBZG 2LXBA 1VQNP 1HBWA 1VQ5P 2HLOA 4D6TG 1NTZG 2D2CD 2KYVA 2IYPA 3AE8C 1LTBC 2BCCD 4C7NA 3BRTB 1SQBJ 3SFEC 3H25A 4DCKA 4GODA 1OVVA 1SFCB 5APVA 5AVZB 3D6YA 2HODB 2MKVA 2ZVNB 1KYOD 1L4AB 1N7SC 1NKZB 2RN0A 2V4HA 4HH2A 1OW7A 1M90Q 3LW5J 3KQGA 3D71A 2M5AA 2M5AB 1RF0C 2ZYDA 1M1JB 1RY3A 5CCHD 5KLVJ 5AVUB 3CPWO 1SQPE 2DW3A 3BATA 3H1KG 3L71D 2HODA 1S9KE 3L73E 1JEKA 2N1TB 3CX5E 1SFCA 3VP8A 3L4FA 5CBOA 2C0XA 2OTJP 4M3LA 2RH0A 1AQ5A 1KTMA 2JEEA 3CLQA 4BWNA 1QVGO 2IZ0A 4ZNCA 2FXOA 1K73Q 1RE3A 3O6QB 1PL5A 1RHZB 1N7SD 3P8CE 1X8YA 2BASA 3B71A 1UIIA 3KPEA 5KAIE 3TGUD 2NPSC 3V5BA 1RF1B 1SQQJ 3AECC 1NTMK 4JPZB 1H0TA 3M0DA 1LTJA 1SQVJ 2H88C 4ASWA 1YTZI 1L0LE 2E75C 4H13B 1FZFA 2VRSA 1LTTC 2QSIA 3CMEP 3L70J 4L75A 2W90A 4OH8B 2A06E 2OGUA 3AEBC 1LTAC 3C8VA 1HVVA 2QG4A 3CI9A 2AEJA 3GF7A 5APTA 5AVQB 2Q6QA 1D7MA 1SQBK 1L0NJ 5AVXB 5GTIE 1FAVA 2XV5A 1BDDA 1OFCX 2PRRA 1S3JA 3B5NA 3BCCE 1VQPP 1YQ3C 1SFCD 1FZGA 2FFDB 5CBNA 1FBMA 3V6IA 2NPSB 1ZP0C 2W27A 3RK3C 1YI2P 5TISE 2FFDA 1NKNA 3B5NB 3L70G 3RK2B 4TT3H 1NU1E 3CWBE 5APXA 2E43A 3A2AA 1SQXD 1G1IA 2H8PD 1EQ7A 3OA7A 1OVUA 3L72G 3VP9A 3MTUE 3HE5B 3F89A 2WSEJ 1QLED 4KJMA 1S1CX 3L72J 3TDKA 3CCRP 1URQC 4JF7A 1SQPD 1HJ0A 4N78D 3BCCG 1H0TB 1G1JA 2QIWA 3CX5D 3TF5A 3G71P 1JMBA 3BRVB 2JP3A 4I7ZB 3CL3D 2R5BA 1GK6A 2E74D 1JY2N 3O6QA 1Q2NA 1JUNA 2QEXP 2OYHB 1PZQA 4IFDK 2KP8A 4EIJA 1EZVG 3AEFC 3L75G 1VQMP 2O1KA 2Y0EA 3L75E 3M9QA 1J1DB 1BE3D 2N1TA 3CCSP 1NYHA 4N3YB 1NTMD 3O8ZA 3B4SA 3GLMA 3TK1A 1M1JA 5APWA 2OYOA 1GK4A 1QGKB 3TNUA 2NPSD 1J1EC 2M0BA 2E74C 1L4AA 1L4AD 3L74J 4GKGA 4JYBA 2YIUC 1Y8AA 1EZVI 3FWLA 1NH4A 1IFIA 4C7NB 3AE2C 4C46A 1M8OB 3H1HE 3P32A 1RE3C 2N1TD 1KQLA 5KAIH 1DEEG 2QE7H 1J2JB 3H1JG 1BSNA 1YIJP 2N9BA 3KDPB 1GL2D 1KILB 2QJKC 1RH5B 1HTLC 4PD4D 4PJ0E 3UIAA 3L72D 1L4AC 2WWWA 3H1HJ 2QM7A 4H44D 3CWBD 4HJGH 3EWKA 4HKZH 1L0LK 2KI7B 4K35A 3L74G 5CCGC 1IK9A
chains in the Genus database with same CATH topology
3ZDMA 5EFWB 1LP1B 3MHVA 2ZAEB 2Q1KA 2HR3A 1EC5A 2LXBA 1EDLA 4GOFA 3RGUA 1U7MA 1BDCA 4GODA 1OVVA 2M5AA 2M5AB 1EDJA 2B88A 1ZW0A 2LR2A 4NPEA 2OTKE 5CBOA 4NPFX 3QWOC 4ZNCA 2KUBA 2KZIA 2P58A 2R44A 3MZWB 1H0TA 2KS1B 1LP1A 4ASWA 1ZXGA 2SPZA 4NPDA 5DJUB 5DJTB 3FXDA 1U7JA 2QRXA 4EYYQ 1BDDA 2B87A 1S3JA 5CBNA 2K3RA 1EDIA 2KZJA 1FC2C 3FXEA 5C39A 4GOEA 2WMMA 4JBZA 1OVUA 3PH0A 1X0TA 2KIKA 4KJMA 4HB1A 1H0TB 2UWJE 1JMBA 4IOIH 3S1KA 2B89A 1EDKA 1JM0A 2LXCB 1Q2NA 4BXLA 1OVRA 4WWIA 1MFTA 1SS1A 1LT1A 4CPGA 1NVOA 2M0BA 1Y47A 2QVAA 4K3AA 4ZMDA 1DEEG 2I8DA 2B87B 2JWDA 5K5GB 4ASVA 4HJGH 4HKZH 2RKLA 4MN4C 2KI7B 4K35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDM A;  5EFW B;  1LP1 B;  3MHV A;  2ZAE B;  2Q1K A;  2HR3 A;  1EC5 A;  2LXB A;  1EDL A;  4GOF A;  3RGU A;  1U7M A;  1BDC A;  4GOD A;  1OVV A;  2M5A A;  2M5A B;  1EDJ A;  2B88 A;  1ZW0 A;  2LR2 A;  4NPE A;  2OTK E;  5CBO A;  4NPF X;  3QWO C;  4ZNC A;  2KUB A;  2KZI A;  2P58 A;  2R44 A;  3MZW B;  1H0T A;  2KS1 B;  1LP1 A;  4ASW A;  1ZXG A;  2SPZ A;  4NPD A;  5DJU B;  5DJT B;  3FXD A;  1U7J A;  2QRX A;  4EYY Q;  1BDD A;  2B87 A;  1S3J A;  5CBN A;  2K3R A;  1EDI A;  2KZJ A;  1FC2 C;  3FXE A;  5C39 A;  4GOE A;  2WMM A;  4JBZ A;  1OVU A;  3PH0 A;  1X0T A;  2KIK A;  4KJM A;  4HB1 A;  1H0T B;  2UWJ E;  1JMB A;  4IOI H;  3S1K A;  2B89 A;  1EDK A;  1JM0 A;  2LXC B;  1Q2N A;  4BXL A;  1OVR A;  4WWI A;  1MFT A;  1SS1 A;  1LT1 A;  4CPG A;  1NVO A;  2M0B A;  1Y47 A;  2QVA A;  4K3A A;  4ZMD A;  1DEE G;  2I8D A;  2B87 B;  2JWD A;  5K5G B;  4ASV A;  4HJG H;  4HKZ H;  2RKL A;  4MN4 C;  2KI7 B;  4K35 A; 
#chains in the Genus database with same CATH topology
 2ZT9 D;  2ZXX A;  3ZDM A;  1KQS O;  1G2C A;  5B5E H;  4O9B A;  4PD4 H;  4YXD C;  4C7R A;  2WPR A;  2WQY C;  1ZR2 A;  1LP1 B;  4OWF A;  3Q1M A;  1NTZ K;  3PJS K;  5AW8 B;  3RK3 B;  1VF5 C;  2Q3I A;  2HPC B;  1FZC C;  1OW8 A;  2ZAE B;  1ZN5 A;  3A7O A;  4L74 A;  1NTK J;  2IPP A;  1JTH B;  2KLU A;  4XE5 B;  4A7P A;  3CC4 P;  3CC2 P;  1DD3 A;  1IFN A;  1JY3 N;  2KNC A;  2O01 J;  2AXT E;  4WB4 A;  3WUU A;  1M7L A;  2IZ1 A;  3GHG B;  1KB9 E;  2E76 D;  2K1A A;  3M06 A;  1JY3 O;  3MD0 A;  2H43 A;  3CD6 P;  2C9N Y;  1KN7 A;  1BGY E;  1BDC A;  3E7K A;  2OQQ A;  1ZME C;  1K04 A;  5AVW B;  1QL2 A;  1ZOY C;  3IFM A;  2YXR B;  3H1J E;  3K5B A;  4WY4 D;  3RL0 B;  1VF5 D;  4BRY A;  4DZO A;  5BU8 B;  3BVH A;  1PP9 J;  5AVV B;  1SP4 A;  1FE6 A;  3EFG A;  3CCM P;  2BCC J;  1P84 D;  3GG2 A;  1PGJ A;  3U59 A;  3KXD A;  2LR2 A;  3MGN A;  4B86 A;  1VQ8 P;  2BCC G;  1PPJ E;  2WTY A;  3QWO C;  2L5G B;  3PP5 A;  1JCD A;  4RES B;  2KUB A;  1CI6 A;  3GHG C;  1KV4 A;  1SQX K;  1HH0 A;  1HUC A;  2IFM A;  5H2F H;  1LT9 C;  1GU4 A;  4I6M C;  3L71 J;  2AEF A;  2AXT H;  2KOG A;  4R4M A;  4DT0 A;  3Q5R A;  2Y0D A;  3MZW B;  2GUS A;  3RK3 D;  1E79 H;  3V2N A;  3R4Y A;  4LGD E;  3HE4 B;  5KLI B;  2FYZ A;  1NTK E;  1QVF O;  2G8Y A;  4NPD A;  4U3F D;  2ZXE B;  5DJU B;  2A06 G;  1AVY A;  4AUW A;  1K9M Q;  1GDT A;  3AE5 C;  3A0B H;  4PV1 D;  4WBA A;  5KJ7 C;  3HD7 B;  3IAO A;  4DJG A;  1M56 D;  2FY8 A;  3H6P A;  2WSF J;  1CZQ A;  1JO5 A;  3L36 A;  2B87 A;  1GD2 E;  5CCH A;  1JCC A;  4H0L C;  1NWQ A;  1KFM A;  1JY2 O;  1IC2 A;  1NU1 K;  2P2U A;  2PFX A;  2P7J A;  1NJI Q;  1LT9 B;  2BCC E;  2A06 D;  3HTK B;  2OTL P;  1GW3 A;  1RE4 A;  2ZT9 C;  1FC2 C;  3FXE A;  1ZRT D;  2Q5U A;  3BCC D;  2A45 H;  2WMM A;  1K05 A;  2XU6 A;  3A0B E;  1N73 B;  3CCV P;  3HUS B;  2WPS A;  3H1L J;  2W6J H;  3MUD A;  4IL6 E;  4JBZ A;  3USS A;  1BCC D;  3CXH E;  3WUV A;  1MV8 A;  3VYI A;  2R3S A;  5AW9 B;  2FBW C;  5CCH C;  3V4Q A;  1NU1 D;  4H0L D;  3PRJ A;  3D6Z A;  1H8A A;  3D70 A;  3V2Q A;  3VOP A;  3NTN A;  3N7N A;  5KKZ B;  1FZC A;  1P84 E;  3AE7 C;  5H2F E;  1Q81 Q;  5B66 H;  1URQ D;  2QJY C;  1SQX E;  2UWJ E;  2ZVO B;  5AVY B;  3AEA C;  2B89 A;  3CCQ P;  4UB6 E;  3B5N C;  3GMA A;  4R4L A;  4U3F J;  3SWK A;  4BXL A;  2FYU G;  2C9L Y;  1OVR A;  2R5D A;  3LW5 H;  4JYC A;  3RK3 E;  3N4X A;  1EXJ A;  4Y28 J;  1LT1 A;  1L0L J;  2E75 D;  2FFD C;  4CPG A;  3L73 G;  1N2D C;  1U57 A;  1NTK D;  3VTP C;  4RJT A;  4RKU J;  1GW4 A;  1Q82 Q;  2Y9Z A;  1NVO A;  2FYN C;  2V7Q J;  2M8R A;  2YKQ A;  2YMK A;  1Z56 A;  3CXH H;  4AYC A;  3WUT A;  1S2E A;  3NXS A;  3CMA P;  1JMM A;  1R5L A;  2XKM A;  4EI2 A;  5BVZ A;  3H1L E;  1DD4 A;  4I7Z C;  2HYN A;  4JQ0 D;  3W67 A;  2Z4E A;  3RL0 g;  4ZMD A;  2JO1 A;  1DX7 A;  2E5Y A;  2WVR A;  2OYI A;  1L0N D;  3P8M C;  2JWD A;  2O01 N;  4PV1 C;  5KJ7 D;  2YNY A;  1QL1 A;  1BCC J;  1SQX G;  3A0H E;  1E5W A;  4Y99 C;  1T3U A;  1IFP A;  5K5G B;  3JCU H;  4OGQ B;  2I1K A;  5AW5 B;  4ASV A;  2ZYA A;  5GTI H;  2QM8 A;  1KFN A;  4XFJ A;  2RKL A;  1H88 A;  1HJB A;  1SQQ G;  4UB8 H;  3T97 A;  1MFZ A;  2FYN B;  3BAS A;  3QH9 A;  4WY4 A;  3TYY A;  2QA4 P;  1MZ9 A;  4PJ0 H;  1FJP A;  5EFW B;  1Y9B A;  1BCC E;  1W2B O;  3FWN A;  4KT0 J;  4N6J A;  3L72 E;  3KYQ A;  1PP9 G;  1URQ A;  1IK7 A;  1LNQ A;  2KS1 A;  3VMZ A;  3G4S P;  1EXI A;  1KB9 H;  1LJ2 A;  2L91 A;  2OAR A;  1T2K D;  4UB6 H;  2K88 A;  2Q1K A;  1SLQ A;  4W7Z A;  1N7S B;  1EC5 A;  2FKW B;  2N9Y B;  3HD7 D;  5AW6 B;  1YIT P;  4GOF A;  3OW2 O;  1HF9 A;  3B8E B;  3RGU A;  5E79 E;  2YKP A;  4Y99 B;  5KAF E;  3L37 A;  4H44 B;  1KOR A;  4KHX A;  1S5L X;  1OW6 A;  3H1I G;  3ABV C;  2KLV A;  1FOS F;  2FYU E;  2YIU B;  1KB9 D;  3V2P A;  2PP6 A;  1VQO P;  3RBZ A;  5CCG A;  4OVN F;  1EDJ A;  2B88 A;  1AFO A;  1VQ4 P;  1YQ4 C;  2E42 A;  1KYO H;  1T3J A;  1KIL D;  1LWU B;  1OWA A;  1PP9 E;  1ZW0 A;  1NTM J;  2OTK E;  2YKO A;  1SQQ K;  3CX5 I;  1SVF A;  2K9J A;  2FYU J;  2V7Q H;  3FGA D;  3H1K J;  3JC2 2;  4NPF X;  5APQ A;  1GL2 A;  1OXZ A;  1SQV K;  2KZI A;  2WSC J;  2LKM A;  2MJZ A;  3H1J D;  1IFD A;  3H1L D;  1KB9 I;  4H0L B;  5L8R J;  3EQ2 A;  2N1T C;  2R44 A;  4OGQ D;  1S4X A;  5AVR B;  1PFI A;  2KS1 B;  1SQB E;  1FOS E;  3L71 G;  1IFJ A;  1LTG C;  1PIX A;  2M3B A;  4I1L A;  1L0N K;  2IX7 C;  3M0D C;  1KIL C;  1PPJ D;  5AW2 B;  5KLV E;  1H89 A;  1P84 H;  2YO3 A;  1SQP K;  1IJD B;  2H7H A;  1BE3 G;  4GT1 A;  5B5E E;  1IFM A;  1NGM B;  1N7L A;  3LID A;  3T97 B;  3H1L G;  3NFQ A;  3H32 A;  5KLV K;  3I55 P;  5KLI C;  5APS A;  4QMA A;  2E75 B;  4EYY Q;  1N8R Q;  3RK2 C;  2WT7 B;  4D6T D;  4IFM A;  4U7J A;  2KB7 P;  2OYI B;  4DOJ A;  1VQL P;  1HGV A;  2WSS H;  1SQV E;  1NHL A;  1VQK P;  2P10 A;  3H1I D;  2Q7C A;  5AW1 B;  1HWT C;  1SQQ E;  2E5T A;  2WT7 A;  1EZV E;  2BEQ D;  1WT6 A;  1R8E A;  3SSU A;  3H32 B;  2W6A A;  2M3E A;  3PH0 A;  1Q90 D;  2KSJ A;  4RO0 A;  3H1K D;  5CJ4 A;  4WY4 C;  1ZRT E;  2FYU D;  2H89 C;  1RQV A;  5CHX A;  1GMJ A;  2CPB A;  3MIW A;  2O3J A;  1FDI A;  2POH A;  4PV1 B;  2QJK B;  3A5T A;  1DEB A;  1VQ9 P;  2KK7 A;  1KMI Z;  1KQG B;  3E1I A;  1KZU B;  1MUU A;  1KIL E;  1PP9 D;  2JWA A;  2YXQ B;  1HGZ A;  3CXH D;  4WVZ A;  4IOI H;  1PGP A;  2D2C C;  2HG5 D;  2Z5I A;  3AE9 C;  1JM0 A;  1GL2 B;  1NAF A;  1YBK A;  4YTP C;  3CX5 H;  2C0W A;  1KYO I;  1NU1 G;  2K9J B;  1JB0 J;  1R5S A;  3KZI H;  4U3F G;  3B5N D;  4U3F E;  4WWI A;  5AW7 B;  1MFT A;  1LWU A;  1VL2 A;  1SS1 A;  2R3C A;  3RBX A;  3SWF A;  3G6E P;  3KHU A;  4W80 A;  5KTB A;  1SQB G;  2PGD A;  1L0N G;  3A3Y B;  1YJW P;  5KJ7 A;  2YMY A;  1L2P A;  1FS0 E;  4IFF A;  1KD1 Q;  3HUS A;  3L73 J;  2W83 C;  4GIF A;  1N73 A;  3JCU E;  4XA4 A;  1CW5 A;  1T6A A;  3SFD C;  3TGU J;  2KXP B;  1JNM A;  2ZT9 B;  1RQU A;  1GU5 A;  1J1D C;  3M91 A;  1WRG A;  1QX8 A;  2XDJ A;  3I5C A;  4IL6 X;  3RL0 C;  3R2P A;  5BU5 A;  2D2C B;  3IN6 A;  1TU3 F;  1CSB A;  3NMD A;  5M1B A;  4D6T E;  1DH3 A;  1PV3 A;  2B9B A;  1N7S A;  1NTK G;  1ZV8 A;  2B87 B;  2I8D A;  2XND H;  3L70 D;  3P8C D;  5APU A;  1AVO A;  3TGU E;  2J59 M;  5B66 E;  4YXW H;  2GM4 A;  1USE A;  1VQ6 P;  1URQ B;  2AEM A;  1LTJ C;  2XNX A;  3H1I E;  3M9H A;  1OIP A;  3VMA A;  2WSF H;  4MN4 C;  1L0N E;  1N73 C;  1AJY A;  1IZN B;  2IYO A;  5GTH E;  3BCC J;  5CJ0 A;  2O1J A;  4WY4 B;  3RL0 D;  1RF1 C;  4IL6 H;  3G9R A;  3CCL P;  1IO4 A;  1Q86 Q;  2OYH C;  3MHV A;  3CC7 P;  1YJN P;  2ZYG A;  1RE4 C;  3IF4 A;  1S5L H;  2NRG A;  3WMM 0;  3CCU P;  3V2R A;  2HR3 A;  2WSE H;  1NU1 J;  2FXM A;  1EDL A;  3Q2Y A;  1PGQ A;  3WU2 E;  4EDF A;  1AA0 A;  2IDB A;  3HD7 C;  4GDO A;  4LLH A;  5AVS B;  1U7M A;  3S4R A;  1BGY G;  3VMY A;  5AVT B;  3Q3D A;  2HFE D;  2PAJ A;  3L71 E;  1S9K D;  3L73 D;  3CCE P;  2R32 A;  3TGU G;  4W7Y A;  4L73 A;  1GZL A;  2IBZ I;  3C9I A;  3ITK A;  3GW6 A;  4AQR D;  2Y0C A;  4EOT A;  2JJL A;  2Y9Y A;  3M9B A;  2A45 G;  5GTH H;  4NPE A;  1NTK K;  5E79 H;  1PPJ G;  1L0L D;  3EFF K;  5AW4 B;  3C1L A;  1NTZ J;  3HUS C;  2K9Y A;  2P67 A;  2IBZ E;  5AW3 B;  2BEZ F;  2KNC B;  1BGY J;  1KC8 Q;  2P58 A;  1MKM A;  1PGO A;  3AE4 C;  3V4W A;  2HPC A;  1W5C E;  1OX3 A;  4PD4 I;  1Q7Y Q;  3L70 E;  1LP1 A;  1S5L E;  4ZKU A;  3CWB G;  1FZC B;  5KLV G;  3VN0 A;  1ZXG A;  1G2C B;  2CPS A;  2CK3 H;  2SPZ A;  3L74 D;  1FDO A;  3L75 D;  5DJT B;  3PTZ A;  1BE3 E;  1S72 P;  3H1J J;  2K37 A;  1M57 D;  1FZB A;  2WIT A;  3FXD A;  2Q9I A;  1M1J C;  1SQB D;  1BSH A;  1DIP A;  2KSE A;  1U7J A;  3G3Z A;  1YHQ P;  2RMZ A;  1KIL A;  1NAY A;  1SFC C;  2QRX A;  2I1J A;  1VQ7 P;  3TSI A;  1M1K Q;  2QJY B;  1BCC G;  1SQX J;  2QJP C;  1T2K C;  5KLV D;  3I56 P;  1AV1 A;  2K3R A;  4LC1 A;  1LT9 A;  3HTK A;  1JY3 P;  3U1A A;  4TLF A;  1SQV G;  3H1H D;  1EDI A;  2KZJ A;  1LTI C;  1W2E A;  1GL2 C;  1NO4 A;  2E74 B;  2WPQ A;  2O01 H;  2G3A A;  1LWU C;  1WMK A;  2ZJS E;  3LIE A;  3PLN A;  4GOE A;  5C39 A;  1NTZ E;  3S9O A;  4D6T J;  3TNU B;  2AXC A;  2NZ2 A;  3HD7 A;  3IR9 A;  2ZFC A;  3MP7 B;  4N78 E;  1OZH A;  1X0T A;  2P1J A;  4PD4 E;  1UIX A;  1ZR4 A;  2ITA A;  3MUD C;  1SQQ D;  1A02 J;  3KZI E;  2KIK A;  1EZV D;  1FU1 A;  1L0L G;  3AEE C;  4UB8 E;  4L76 A;  1SQV D;  3H1H G;  5APY A;  2Z5H A;  3HE4 A;  5TJH A;  5TIS H;  4HB1 A;  4I2L C;  1VPC A;  4OGQ C;  2OYH A;  3H1K E;  1USD A;  2QJP B;  3OAK A;  3U1C A;  1OMI A;  2JR8 A;  2WPV B;  1X22 A;  4YPC A;  2E76 C;  4H13 D;  3S1K A;  1XTC C;  3AEG C;  1NTM E;  1EDK A;  3II6 A;  2IBZ D;  3JSV C;  3L75 J;  2LXC B;  1CI6 B;  5CMZ A;  1AQT A;  1ZLL A;  1KYO E;  3F5H A;  1J1E B;  1X9V A;  1LTS C;  3W68 A;  3P7K A;  3AE6 C;  1FJK A;  1SQP G;  1QEX A;  2WZ7 A;  3HE5 A;  1LGH B;  3L74 E;  1NOH A;  3SWY A;  2A45 I;  4ZKP A;  1XTG B;  1FZE A;  3CXH I;  4HYT B;  1YJ9 P;  4BRY B;  3Q5P A;  2YO2 A;  3E1R A;  5AW0 B;  3FX0 A;  3VMX A;  2FXP A;  3WU2 H;  5KAF H;  1FDM A;  1Y47 A;  2QVA A;  1JY2 P;  1P84 I;  2W8Z A;  3OJA B;  3PHL A;  3RK2 D;  3CWB J;  2Q3E A;  1X79 B;  2NPS A;  2E76 B;  4K3A A;  3GHG A;  1KQF B;  3Q5S A;  1NTM G;  1VDF A;  2J5U A;  2OYI C;  3CCJ P;  2W6B A;  1JTH A;  1SQP J;  4H44 C;  1FZA A;  2J58 A;  4H13 C;  3HRN A;  1K8A Q;  3GF3 A;  1A02 F;  5CCG D;  4Z1M H;  2IFN A;  1VF5 B;  5KKZ C;  2WSC H;  2JKV A;  1NTZ D;  3H1I J;  3M0A A;  1RF0 A;  3AED C;  1BGY D;  1N86 A;  2XZR A;  2JDI H;  3AE1 C;  1YYC A;  3A0H H;  2GA1 A;  1LTJ B;  1BE3 J;  2FYU K;  2GUV A;  1GTW A;  1YTZ T;  3AE3 C;  3L35 A;  1RF1 A;  1JOC A;  1T8Z A;  2IBZ G;  2LXB A;  1VQN P;  1HBW A;  1VQ5 P;  2HLO A;  4D6T G;  1NTZ G;  2D2C D;  2KYV A;  2IYP A;  3AE8 C;  1LTB C;  2BCC D;  4C7N A;  3BRT B;  1SQB J;  3SFE C;  3H25 A;  4DCK A;  4GOD A;  1OVV A;  1SFC B;  5APV A;  5AVZ B;  3D6Y A;  2HOD B;  2MKV A;  2ZVN B;  1KYO D;  1L4A B;  1N7S C;  1NKZ B;  2RN0 A;  2V4H A;  4HH2 A;  1OW7 A;  1M90 Q;  3LW5 J;  3KQG A;  3D71 A;  2M5A A;  2M5A B;  1RF0 C;  2ZYD A;  1M1J B;  1RY3 A;  5CCH D;  5KLV J;  5AVU B;  3CPW O;  1SQP E;  2DW3 A;  3BAT A;  3H1K G;  3L71 D;  2HOD A;  1S9K E;  3L73 E;  1JEK A;  2N1T B;  3CX5 E;  1SFC A;  3VP8 A;  3L4F A;  5CBO A;  2C0X A;  2OTJ P;  4M3L A;  2RH0 A;  1AQ5 A;  1KTM A;  2JEE A;  3CLQ A;  4BWN A;  1QVG O;  2IZ0 A;  4ZNC A;  2FXO A;  1K73 Q;  1RE3 A;  3O6Q B;  1PL5 A;  1RHZ B;  1N7S D;  3P8C E;  1X8Y A;  2BAS A;  3B71 A;  1UII A;  3KPE A;  5KAI E;  3TGU D;  2NPS C;  3V5B A;  1RF1 B;  1SQQ J;  3AEC C;  1NTM K;  4JPZ B;  1H0T A;  3M0D A;  1LTJ A;  1SQV J;  2H88 C;  4ASW A;  1YTZ I;  1L0L E;  2E75 C;  4H13 B;  1FZF A;  2VRS A;  1LTT C;  2QSI A;  3CME P;  3L70 J;  4L75 A;  2W90 A;  4OH8 B;  2A06 E;  2OGU A;  3AEB C;  1LTA C;  3C8V A;  1HVV A;  2QG4 A;  3CI9 A;  2AEJ A;  3GF7 A;  5APT A;  5AVQ B;  2Q6Q A;  1D7M A;  1SQB K;  1L0N J;  5AVX B;  5GTI E;  1FAV A;  2XV5 A;  1BDD A;  1OFC X;  2PRR A;  1S3J A;  3B5N A;  3BCC E;  1VQP P;  1YQ3 C;  1SFC D;  1FZG A;  2FFD B;  5CBN A;  1FBM A;  3V6I A;  2NPS B;  1ZP0 C;  2W27 A;  3RK3 C;  1YI2 P;  5TIS E;  2FFD A;  1NKN A;  3B5N B;  3L70 G;  3RK2 B;  4TT3 H;  1NU1 E;  3CWB E;  5APX A;  2E43 A;  3A2A A;  1SQX D;  1G1I A;  2H8P D;  1EQ7 A;  3OA7 A;  1OVU A;  3L72 G;  3VP9 A;  3MTU E;  3HE5 B;  3F89 A;  2WSE J;  1QLE D;  4KJM A;  1S1C X;  3L72 J;  3TDK A;  3CCR P;  1URQ C;  4JF7 A;  1SQP D;  1HJ0 A;  4N78 D;  3BCC G;  1H0T B;  1G1J A;  2QIW A;  3CX5 D;  3TF5 A;  3G71 P;  1JMB A;  3BRV B;  2JP3 A;  4I7Z B;  3CL3 D;  2R5B A;  1GK6 A;  2E74 D;  1JY2 N;  3O6Q A;  1Q2N A;  1JUN A;  2QEX P;  2OYH B;  1PZQ A;  4IFD K;  2KP8 A;  4EIJ A;  1EZV G;  3AEF C;  3L75 G;  1VQM P;  2O1K A;  2Y0E A;  3L75 E;  3M9Q A;  1J1D B;  1BE3 D;  2N1T A;  3CCS P;  1NYH A;  4N3Y B;  1NTM D;  3O8Z A;  3B4S A;  3GLM A;  3TK1 A;  1M1J A;  5APW A;  2OYO A;  1GK4 A;  1QGK B;  3TNU A;  2NPS D;  1J1E C;  2M0B A;  2E74 C;  1L4A A;  1L4A D;  3L74 J;  4GKG A;  4JYB A;  2YIU C;  1Y8A A;  1EZV I;  3FWL A;  1NH4 A;  1IFI A;  4C7N B;  3AE2 C;  4C46 A;  1M8O B;  3H1H E;  3P32 A;  1RE3 C;  2N1T D;  1KQL A;  5KAI H;  1DEE G;  2QE7 H;  1J2J B;  3H1J G;  1BSN A;  1YIJ P;  2N9B A;  3KDP B;  1GL2 D;  1KIL B;  2QJK C;  1RH5 B;  1HTL C;  4PD4 D;  4PJ0 E;  3UIA A;  3L72 D;  1L4A C;  2WWW A;  3H1H J;  2QM7 A;  4H44 D;  3CWB D;  4HJG H;  3EWK A;  4HKZ H;  1L0L K;  2KI7 B;  4K35 A;  3L74 G;  5CCG C;  1IK9 A; 
#chains in the Genus database with same CATH homology
 3ZDM A;  5EFW B;  1LP1 B;  3MHV A;  2ZAE B;  2Q1K A;  2HR3 A;  1EC5 A;  2LXB A;  1EDL A;  4GOF A;  3RGU A;  1U7M A;  1BDC A;  4GOD A;  1OVV A;  2M5A A;  2M5A B;  1EDJ A;  2B88 A;  1ZW0 A;  2LR2 A;  4NPE A;  2OTK E;  5CBO A;  4NPF X;  3QWO C;  4ZNC A;  2KUB A;  2KZI A;  2P58 A;  2R44 A;  3MZW B;  1H0T A;  2KS1 B;  1LP1 A;  4ASW A;  1ZXG A;  2SPZ A;  4NPD A;  5DJU B;  5DJT B;  3FXD A;  1U7J A;  2QRX A;  4EYY Q;  1BDD A;  2B87 A;  1S3J A;  5CBN A;  2K3R A;  1EDI A;  2KZJ A;  1FC2 C;  3FXE A;  5C39 A;  4GOE A;  2WMM A;  4JBZ A;  1OVU A;  3PH0 A;  1X0T A;  2KIK A;  4KJM A;  4HB1 A;  1H0T B;  2UWJ E;  1JMB A;  4IOI H;  3S1K A;  2B89 A;  1EDK A;  1JM0 A;  2LXC B;  1Q2N A;  4BXL A;  1OVR A;  4WWI A;  1MFT A;  1SS1 A;  1LT1 A;  4CPG A;  1NVO A;  2M0B A;  1Y47 A;  2QVA A;  4K3A A;  4ZMD A;  1DEE G;  2I8D A;  2B87 B;  2JWD A;  5K5G B;  4ASV A;  4HJG H;  4HKZ H;  2RKL A;  4MN4 C;  2KI7 B;  4K35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...