5K5GB

Structure of human islet amyloid polypeptide in complex with an engineered binding protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
44
structure length
44
Chain Sequence
GGEIVYLPNLNPDQLCAFIHSIHDDPSQSANLLAEAKKLNDAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Islet amyloid polypeptide
publication title Structure of human islet amyloid polypeptide in complex with an engineered binding protein
rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 15
structure length 44
sequence length 44
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5k5gB00
3MHVA 4ASWA 2B87B 4KJMA 1JMBA 4HJGH 3ZDMA 4GODA 1SS1A 4NPEA 4ZMDA 4BXLA 1H0TA 5C39A 1EC5A 2B89A 1EDKA 2LR2A 1LP1B 1NVOA 4WWIA 4ASVA 5CBNA 1ZW0A 2LXCB 2KIKA 2M5AA 3MZWB 2K3RA 4JBZA 4ZNCA 4GOFA 4K3AA 2UWJE 1BDCA 4NPFX 2KZJA 2KS1B 2KZIA 2OTKE 5DJTB 1U7JA 1BDDA 1H0TB 2JWDA 4HB1A 2R44A 3PH0A 5CBOA 1JM0A 1DEEG 1FC2C 1X0TA 2QVAA 2ZAEB 3QWOC 5K5GB 1ZXGA 2B87A 4HKZH 2I8DA 2M0BA 3S1KA 4MN4C 1OVVA 4CPGA 1EDLA 3FXDA 3RGUA 1MFTA 1EDIA 2M5AB 5DJUB 4EYYQ 4IOIH 4K35A 2WMMA 3FXEA 1LP1A 4GOEA 2LXBA 1Q2NA 1U7MA 2P58A 1EDJA 2B88A 2KI7B 1OVRA 4NPDA 2KUBA 2Q1KA 1Y47A 2HR3A 5EFWB 1LT1A 2RKLA 1S3JA 1OVUA 2SPZA 2QRXA
chains in the Genus database with same CATH superfamily
1KILE 2YKPA 2FYUE 3NXSA 3VMAA 1ZLLA 1BE3J 2P1JA 1LTJA 5B5EH 4IFFA 3V2RA 1S1CX 2FBWC 1S4XA 3U1AA 1JMMA 3TF5A 4Y99B 1K04A 1N2DC 2I1JA 1IC2A 3AE8C 4U3FJ 1QL2A 5CBNA 5KLVK 3TGUD 1OW8A 4GT1A 4D6TJ 2WPRA 2Y0CA 2IFMA 5E79H 1ZR2A 2YO3A 3ITKA 2Z5HA 3HD7D 1K8AQ 1M8OB 3D6ZA 3TGUE 4LC1A 1EZVI 2R44A 1IZNB 3A5TA 5APVA 1N7SB 2O01N 2Q6QA 2QVAA 4RKUJ 3H32A 2PRRA 3P8MC 3JCUH 3PHLA 4C7NA 1Q7YQ 1Q86Q 3KQGA 5AW8B 4A7PA 1SVFA 4N6JA 1WRGA 1DD4A 3GF7A 3V2NA 2Y9ZA 1RE4A 1BE3D 4L75A 4OGQB 2IZ0A 3PP5A 2XZRA 3MHVA 3USSA 1N86A 1M57D 1FDMA 1NKNA 1AQ5A 2K37A 1BSHA 3KYQA 2W83C 2M8RA 1KV4A 1FZGA 3MGNA 3CWBG 3CMAP 1MV8A 3CC7P 1KQFB 4D6TD 2WSSH 1S9KE 1BE3E 1YBKA 1YTZT 2E74C 5AW3B 1L0NG 1ZW0A 1SQVG 1YQ3C 4DZOA 2AEJA 2GUSA 3A3YB 3RL0B 3AE5C 4U3FE 1NO4A 3A0HH 4D6TE 2KXPB 2QIWA 5KLVJ 2K9JB 1SQBJ 4L73A 1L0LG 3BCCJ 2BEQD 1LTIC 3VP8A 1H8AA 1RF0A 1EZVD 2JWDA 1M56D 2ZAEB 3RL0g 3SFEC 1OVVA 2WWWA 1KYOI 1GK6A 3ABVC 1EZVE 1GU5A 3L72G 1MFZA 1GD2E 1FAVA 1U7MA 1N73B 1PPJE 4IL6H 5APWA 3TDKA 5AVXB 1CI6A 1DEBA 3TNUA 2ZT9C 3GLMA 5AW7B 1NOHA 1M90Q 2CK3H 4H0LD 2MJZA 1NH4A 2QJYC 1CSBA 3JC22 2G3AA 1GL2A 1SQVK 4BWNA 1QGKB 1CW5A 3EFGA 1OFCX 3U59A 1JTHA 2FFDC 5KJ7C 1PZQA 1PP9G 3MUDC 1L0LK 3B71A 1SQBD 3P7KA 3BCCD 1AVOA 1Q81Q 2WVRA 4EIJA 1VF5C 1K05A 4GOFA 1H89A 1RF1C 2HYNA 2R5BA 4PV1D 3OA7A 4NPFX 2WQYC 3L71G 3JSVC 1YI2P 2E75D 1SQBE 3WUTA 1W5CE 2A45H 2IYPA 1GU4A 2A06E 1QVFO 3BCCE 1HVVA 1FC2C 5H2FH 1ZXGA 2GM4A 5AW2B 5AVVB 5AVQB 4R4LA 2OARA 1DX7A 3FXDA 1MFTA 3G6EP 1IK9A 1NTMD 3GMAA 2YXQB 1VQMP 1OZHA 3T97B 4IFMA 2NZ2A 1NTZD 1G2CB 3O6QA 4TLFA 2NPSA 1K9MQ 1BGYG 4H44D 2KNCA 4Z1MH 1KILC 3V5BA 2HFED 3L70G 2K1AA 3CWBJ 1NTZE 4KJMA 1P84H 2H8PD 2KP8A 3TSIA 1SS1A 3CL3D 3L74G 1J1DB 2D2CB 2KLVA 5KKZB 1SQVJ 1NVOA 4ZKUA 5APQA 3HE4B 2LKMA 2QM8A 5AVUB 4AUWA 2WPQA 1GK4A 3CCRP 1D7MA 2KK7A 3TK1A 4PJ0H 3HUSB 1JO5A 1KC8Q 2HPCA 1L0LJ 3C1LA 4DJGA 2VRSA 1JY3N 4N78D 2AEFA 5B66E 2AXTH 1GL2D 2UWJE 1Y8AA 3H1JG 5DJTB 5AW4B 3VMYA 4DT0A 1U7JA 1NJIQ 3CXHI 5CBOA 2H7HA 3KZIE 1FZCB 1SFCA 3R2PA 1NYHA 2HLOA 2ZFCA 1N7LA 3HD7C 4EI2A 4N78E 5KAIE 3L72J 4IOIH 1JY2O 4I7ZB 1HGVA 3N4XA 1SQPJ 1WMKA 3RBXA 2LXBA 1IK7A 3RK2D 3AE3C 2JO1A 5TISE 2W6JH 3H1LG 4IL6X 1NTKD 2RKLA 1HTLC 1OVUA 3A0BH 2OGUA 1OWAA 2B9BA 2Z4EA 3L36A 2PP6A 1KQSO 1PP9J 1N8RQ 5AVRB 1NTKE 3NTNA 2NPSD 1SQVE 2BCCD 2YO2A 2CPSA 1QLED 3M91A 4ZNCA 4JBZA 1WT6A 1YQ4C 4PD4D 3L71J 3CX5H 2ZYDA 2OYHC 3SFDC 3HTKA 1BDDA 3CXHD 2W6BA 4GDOA 1JM0A 2R32A 3QWOC 2IPPA 1SQPD 2WSEH 4PD4H 3S1KA 1LTJC 2M5AB 5DJUB 3CXHE 1BGYJ 1EDJA 2ZVOB 2P7JA 1SQPE 3L70J 3H6PA 1OW6A 1R5SA 2KUBA 4H13D 2ZYAA 2RN0A 1XTGB 2R3CA 3AEFC 1NWQA 2M3BA 1KN7A 3U1CA 2QRXA 1CI6B 1SFCD 2YMYA 2A45G 4HJGH 1VDFA 3L74J 1L2PA 2E74B 1BSNA 2YKQA 4H0LC 1QEXA 2IDBA 5CJ0A 1KFMA 4I7ZC 2WITA 2L5GB 1PP9E 2LXCB 2YXRB 3GHGA 1J1EB 1U57A 3GF3A 3H1JJ 1JUNA 1KD1Q 2Q7CA 1L4AA 3VP9A 1RE4C 2OTKE 4OWFA 3PH0A 1SQQK 1QX8A 3F5HA 1IFMA 4PV1C 3FX0A 1SQXD 1AVYA 2M0BA 4HYTB 2E75C 3L70D 3PJSK 1FZEA 2P10A 4I1LA 3Q1MA 2ZT9B 4JYCA 1HWTC 3B5NA 3F89A 3H1LJ 2N1TA 2QJYB 1SQXE 1M1JA 5E79E 2Q5UA 2NRGA 3G71P 1Y47A 3L70E 3Q5SA 2JP3A 4I6MC 3AEDC 5KTBA 3G9RA 1T2KD 5CCHA 2FFDB 3QH9A 4R4MA 3BASA 4H44C 1KB9I 3D71A 1RF0C 2W90A 3JCUE 1S9KD 4UB8E 1LP1B 1VF5B 2HODA 2QEXP 1YJ9P 1RQUA 3B8EB 1RF1B 2Y0DA 2WSFJ 4ZKPA 1Y9BA 2IBZG 4U3FD 2O01J 1G1JA 3H1JE 1RE3A 1X22A 2Q9IA 2IFNA 3RK3D 2AXCA 2KS1B 1DH3A 2RH0A 2ZVNB 2BEZF 1GMJA 1ZMEC 2FYNC 1GL2C 4EOTA 5CMZA 4YPCA 2OYIA 4XA4A 1J2JB 3RGUA 3RK3E 1SQQJ 1KILB 1J1EC 1LJ2A 1PFIA 3B4SA 3AE2C 2E76D 4GOEA 1X8YA 1ZRTD 3HE5A 2P58A 1URQD 1JY2P 1PPJD 1L4AD 4LLHA 1KTMA 2FXPA 3H1LE 2M3EA 5GTIE 2HR3A 1NHLA 4WY4A 2B87B 1KB9D 1ZRTE 2WPSA 1YJNP 2FKWB 4NPEA 1EXIA 2MKVA 4TT3H 1LT9A 2WSCH 1R5LA 1A02F 5AW0B 2XU6A 4W80A 3SWYA 2LR2A 4LGDE 3B5ND 2J58A 2IX7C 2N1TD 1MZ9A 1L0NK 1KB9E 4DOJA 1FE6A 1USEA 4L74A 1X9VA 2RMZA 2NPSC 5CCHD 2ITAA 2N9BA 1YITP 3HD7B 4BRYB 1VQKP 3Q3DA 1M1KQ 3Q5PA 1K73Q 5KLVD 1H0TB 1JCCA 1PV3A 1SQQD 3CCVP 2A06D 3CPWO 1FDOA 3AE1C 2Y0EA 1PIXA 1NU1G 3M0AA 1DIPA 1SLQA 3C8VA 3H1IG 1EDIA 3CMEP 4UB6E 5KLVE 2FYUG 3AEBC 1SQQE 3S4RA 1H88A 2KSEA 1XTCC 2O3JA 2WT7B 3KHUA 1S72P 1KYOD 5GTHE 3LW5H 4Y28J 5AVTB 4ASWA 1USDA 4H13C 4JPZB 2IBZI 3VYIA 3R4YA 3AECC 3MP7B 3G4SP 4BXLA 2H89C 2C0XA 1N7SA 1SFCC 2B89A 3CCUP 1OX3A 1KYOE 3MD0A 1S5LE 1JB0J 3TGUG 1T3JA 2R5DA 2P67A 3CI9A 1PGJA 3MZWB 3WU2E 2OYHB 3L35A 3I5CA 2C0WA 3GW6A 3K5BA 3H1HG 3G3ZA 4WY4D 1NU1K 3SSUA 3L73G 1L0NJ 1GW4A 3HRNA 2KZJA 3CD6P 1LTJB 2FYUK 2ZYGA 2JWAA 3A7OA 2QE7H 2JEEA 3A2AA 5AW5B 1Q82Q 1JY3O 2WTYA 5B66H 3H1KG 4EYYQ 3CCLP 1EXJA 1HBWA 5AVZB 3KZIH 3S9OA 1OVRA 4B86A 2Q1KA 4H0LB 1LT1A 2OQQA 1VQ5P 2C9LY 1VQOP 2K9JA 3H32B 2IBZD 2QJKB 5APSA 3CWBD 2QJPC 2ZXEB 4C7NB 1T2KC 4D6TG 2K9YA 5KAFE 1EDKA 1PL5A 1W2EA 1JY2N 1LWUA 2H88C 1ZP0C 1L0ND 1SQVD 1HF9A 2IBZE 3CWBE 3AE7C 4GKGA 4K3AA 1BCCG 1N73A 4PV1B 3H25A 1VQ7P 2OTJP 3E1IA 1L0LD 2WPVB 2E75B 1L0NE 1EZVG 3KPEA 1VL2A 3CC4P 3CLQA 1N7SD 1NU1J 1DEEG 5K5GB 1FZBA 4U7JA 3H1IJ 2PGDA 2HG5D 3LIDA 3NFQA 3AE9C 3EQ2A 1L0LE 1RY3A 3E7KA 2OYIB 3L72D 2YKOA 5APTA 4DCKA 4W7ZA 1YHQP 1ZOYC 4H44B 5AVWB 3GHGC 2FYZA 1AFOA 2E76C 4OGQD 1T8ZA 1DD3A 3CXHH 1L4AC 3L72E 1YIJP 1LNQA 4ZMDA 3AE4C 1EC5A 3CCJP 1YYCA 2JKVA 1T6AA 2WZ7A 3P32A 1PP9D 2V7QH 2POHA 2W8ZA 1SQBG 4YXDC 1AQTA 3H1HJ 3BRTB 3RL0D 3BCCG 3TNUB 1FZAA 1LGHB 3T97A 3L73J 5AW1B 3B5NC 3V6IA 2Y9YA 1G2CA 1S5LX 1FU1A 3M9QA 2N1TC 2FYNB 1GL2B 1M1JC 1VQ9P 2I1KA 2QJKC 3L71D 1KQGB 2PFXA 1FOSF 1JTHB 2JR8A 2XNXA 5CCHC 2BASA 5APUA 1X0TA 3H1KJ 4CPGA 1FBMA 1URQA 2O1KA 1AV1A 3H1IE 2YNYA 1NTMG 1JNMA 1IO4A 2OYOA 3L71E 1NTZG 3KXDA 4KHXA 4XE5B 1OIPA 3WMM0 2K88A 5KLIB 1FS0E 1AJYA 5APXA 3RK2B 3HE4A 1IFNA 4KT0J 1BGYD 5B5EE 1VQ8P 2E42A 1W2BO 5EFWB 5CCGA 2JJLA 3HUSA 1E5WA 2XKMA 1RE3C 1SQBK 2FXOA 1JMBA 2Q3EA 1GDTA 1A02J 1BGYE 4L76A 3H1HD 5C39A 3L74D 3VOPA 3L73D 1VQPP 3BATA 1FZCA 2J5UA 3O6QB 2OYIC 2NPSB 2C9NY 1GW3A 3AEGC 5TJHA 3IR9A 4JYBA 4N3YB 2KNCB 2ZJSE 1BCCJ 1LTAC 2FXMA 3M0DA 3UIAA 2YIUC 1G1IA 1QL1A 3H1HE 3L74E 2ZXXA 1JCDA 3L73E 4UB8H 3D6YA 3H1KD 3H1JD 1NTMK 2AEMA 1NTZK 1IFIA 3CCEP 2WSCJ 4WY4C 3W67A 3FWLA 3CCMP 4MN4C 4C7RA 4OVNF 1UIXA 3H1KE 1LT9C 1NKZB 2N9YB 4W7YA 4XFJA 3WUUA 3N7NA 1JY3P 3I56P 2HPCB 2DW3A 1Q2NA 3TYYA 1RH5B 3CC2P 1IFDA 5AVSB 1FZFA 2IYOA 4H13B 4NPDA 1HGZA 3PTZA 2CPBA 3H1LD 4HH2A 3W68A 3LIEA 1NTKG 1SFCB 2H43A 2A45I 3ZDMA 3MIWA 3A0HE 1BCCD 2D2CD 2YMKA 5GTIH 5KLIC 3M9BA 3RK2C 2BCCG 2M5AA 1LTSC 3PLNA 3L4FA 1NGMB 1ZR4A 5CJ4A 5CCGD 3LW5J 1LWUB 1BCCE 4Y99C 2G8YA 2W6AA 4WB4A 1BDCA 1HUCA 1KB9H 1P84I 1VQNP 4IL6E 1SQPG 2WSFH 2KYVA 1NTMJ 4O9BA 1VQ4P 2I8DA 3AEAC 1NTZJ 1OXZA 5APYA 3NMDA 1VQLP 1NTKK 3IAOA 1N7SC 3L75G 3V4WA 2O01H 3FXEA 3M9HA 1CZQA 4IFDK 3CCQP 3VMXA 3KDPB 1LTBC 1FJKA 3HTKB 2QJPB 1MKMA 3O8ZA 1MUUA 3AEEC 4UB6H 1S3JA 1ZN5A 1KZUB 2XNDH 4RESB 2QG4A 2XDJA 1VPCA 4OGQC 1YJWP 1KFNA 2KB7P 1FDIA 5GTHH 3Q2YA 5L8RJ 2KIKA 3GG2A 3I55P 1GTWA 2FY8A 2PAJA 3Q5RA 5H2FE 2K3RA 1JEKA 1SQPK 4OH8B 1OMIA 1UIIA 3E1RA 2KSJA 1E79H 3RK3B 3RL0C 1PGPA 4AQRD 1KYOH 3V4QA 1FJPA 2KZIA 1S5LH 4HB1A 1P84D 1EQ7A 3WU2H 1PGOA 2JDIH 2FFDA 1SQXG 1QVGO 5AW9B 4WVZA 5KJ7A 3MUDA 1EDLA 1TU3F 1NTME 3GHGB 2WMMA 1IFJA 2E76B 1LP1A 1P84E 4JQ0D 1LWUC 1URQB 5BVZA 1RF1A 2B88A 3IN6A 2IZ1A 1L4AB 5BU5A 1NTKJ 4M3LA 3CX5I 2QA4P 1N73C 3FGAD 3V2QA 3EFFK 3VTPC 2E74D 4GODA 1KMIZ 2KS1A 4PJ0E 1M7LA 3P8CD 3VN0A 4GIFA 1R8EA 4PD4I 1BE3G 2AXTE 3SWFA 1S2EA 3B5NB 2BCCJ 2E5TA 5KAIH 1VQ6P 4WWIA 2N1TB 1PGQA 1M1JB 2KLUA 3M06A 2WSEJ 4U3FG 1KILA 3P8CE 1SQXK 5KAFH 3AE6C 5TISH 1NAFA 3IF4A 2V4HA 4WBAA 1YTZI 2W27A 2Z5IA 1RQVA 4YXWH 3WUVA 3OJAB 1Z56A 1AA0A 2B87A 4HKZH 1X79B 2HODB 2P2UA 2V7QJ 3L75J 3IFMA 3BVHA 4C46A 4EDFA 2E5YA 3II6A 2L91A 3A0BE 1Q90D 2ZT9D 2OTLP 4QMAA 1PPJG 3RBZA 4JF7A 2KI7B 2QM7A 3RK3C 3C9IA 3CX5D 2FYUJ 2QSIA 1KORA 2KOGA 3L37A 2J59M 5CHXA 5KJ7D 3EWKA 3HD7A 4BRYA 1RHZB 1H0TA 1HJBA 3CX5E 2XV5A 5M1BA 2YIUB 4I2LC 5AVYB 3OAKA 3D70A 3HE5B 4RJTA 1VF5D 2R3SA 4ASVA 1URQC 2BCCE 2GA1A 4RO0A 1J1DC 1IFPA 2D2CC 5KKZC 3VMZA 3V2PA 1JOCA 3CCSP 3MTUE 4PD4E 4WY4B 5BU8B 3TGUJ 1HJ0A 3L75D 2WT7A 1FOSE 5KLVG 1NAYA 3PRJA 1SQXJ 5CCGC 3HUSC 1SQQG 1LT9B 1HH0A 2GUVA 2A06G 1OW7A 3FWNA 1T3UA 2Q3IA 2O1JA 1NU1D 1GZLA 3H1ID 3L75E 4K35A 1KILD 1FZCC 2FYUD 3OW2O 4YTPC 2E43A 1ZV8A 1IJDB 1KQLA 1LTTC 3SWKA 1SP4A 4AYCA 1LTGC 3M0DC 2OYHA 1NU1E 3BRVB 5AW6B 2SPZA
chains in the Genus database with same CATH topology
3MHVA 4ASWA 2B87B 4KJMA 1JMBA 4HJGH 3ZDMA 4GODA 1SS1A 4NPEA 4ZMDA 4BXLA 1H0TA 5C39A 1EC5A 2B89A 1EDKA 2LR2A 1LP1B 1NVOA 4WWIA 4ASVA 5CBNA 1ZW0A 2LXCB 2KIKA 2M5AA 3MZWB 2K3RA 4JBZA 4ZNCA 4GOFA 4K3AA 2UWJE 1BDCA 4NPFX 2KZJA 2KS1B 2KZIA 2OTKE 5DJTB 1U7JA 1BDDA 1H0TB 2JWDA 4HB1A 2R44A 3PH0A 5CBOA 1JM0A 1DEEG 1FC2C 1X0TA 2QVAA 2ZAEB 3QWOC 5K5GB 1ZXGA 2B87A 4HKZH 2I8DA 2M0BA 3S1KA 4MN4C 1OVVA 4CPGA 1EDLA 3FXDA 3RGUA 1MFTA 1EDIA 2M5AB 5DJUB 4EYYQ 4IOIH 4K35A 2WMMA 3FXEA 1LP1A 4GOEA 2LXBA 1Q2NA 1U7MA 2P58A 1EDJA 2B88A 2KI7B 1OVRA 4NPDA 2KUBA 2Q1KA 1Y47A 2HR3A 5EFWB 1LT1A 2RKLA 1S3JA 1OVUA 2SPZA 2QRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHV A;  4ASW A;  2B87 B;  4KJM A;  1JMB A;  4HJG H;  3ZDM A;  4GOD A;  1SS1 A;  4NPE A;  4ZMD A;  4BXL A;  1H0T A;  5C39 A;  1EC5 A;  2B89 A;  1EDK A;  2LR2 A;  1LP1 B;  1NVO A;  4WWI A;  4ASV A;  5CBN A;  1ZW0 A;  2LXC B;  2KIK A;  2M5A A;  3MZW B;  2K3R A;  4JBZ A;  4ZNC A;  4GOF A;  4K3A A;  2UWJ E;  1BDC A;  4NPF X;  2KZJ A;  2KS1 B;  2KZI A;  2OTK E;  5DJT B;  1U7J A;  1BDD A;  1H0T B;  2JWD A;  4HB1 A;  2R44 A;  3PH0 A;  5CBO A;  1JM0 A;  1DEE G;  1FC2 C;  1X0T A;  2QVA A;  2ZAE B;  3QWO C;  5K5G B;  1ZXG A;  2B87 A;  4HKZ H;  2I8D A;  2M0B A;  3S1K A;  4MN4 C;  1OVV A;  4CPG A;  1EDL A;  3FXD A;  3RGU A;  1MFT A;  1EDI A;  2M5A B;  5DJU B;  4EYY Q;  4IOI H;  4K35 A;  2WMM A;  3FXE A;  1LP1 A;  4GOE A;  2LXB A;  1Q2N A;  1U7M A;  2P58 A;  1EDJ A;  2B88 A;  2KI7 B;  1OVR A;  4NPD A;  2KUB A;  2Q1K A;  1Y47 A;  2HR3 A;  5EFW B;  1LT1 A;  2RKL A;  1S3J A;  1OVU A;  2SPZ A;  2QRX A; 
#chains in the Genus database with same CATH topology
 1KIL E;  2YKP A;  2FYU E;  3NXS A;  3VMA A;  1ZLL A;  1BE3 J;  2P1J A;  1LTJ A;  5B5E H;  4IFF A;  3V2R A;  1S1C X;  2FBW C;  1S4X A;  3U1A A;  1JMM A;  3TF5 A;  4Y99 B;  1K04 A;  1N2D C;  2I1J A;  1IC2 A;  3AE8 C;  4U3F J;  1QL2 A;  5CBN A;  5KLV K;  3TGU D;  1OW8 A;  4GT1 A;  4D6T J;  2WPR A;  2Y0C A;  2IFM A;  5E79 H;  1ZR2 A;  2YO3 A;  3ITK A;  2Z5H A;  3HD7 D;  1K8A Q;  1M8O B;  3D6Z A;  3TGU E;  4LC1 A;  1EZV I;  2R44 A;  1IZN B;  3A5T A;  5APV A;  1N7S B;  2O01 N;  2Q6Q A;  2QVA A;  4RKU J;  3H32 A;  2PRR A;  3P8M C;  3JCU H;  3PHL A;  4C7N A;  1Q7Y Q;  1Q86 Q;  3KQG A;  5AW8 B;  4A7P A;  1SVF A;  4N6J A;  1WRG A;  1DD4 A;  3GF7 A;  3V2N A;  2Y9Z A;  1RE4 A;  1BE3 D;  4L75 A;  4OGQ B;  2IZ0 A;  3PP5 A;  2XZR A;  3MHV A;  3USS A;  1N86 A;  1M57 D;  1FDM A;  1NKN A;  1AQ5 A;  2K37 A;  1BSH A;  3KYQ A;  2W83 C;  2M8R A;  1KV4 A;  1FZG A;  3MGN A;  3CWB G;  3CMA P;  1MV8 A;  3CC7 P;  1KQF B;  4D6T D;  2WSS H;  1S9K E;  1BE3 E;  1YBK A;  1YTZ T;  2E74 C;  5AW3 B;  1L0N G;  1ZW0 A;  1SQV G;  1YQ3 C;  4DZO A;  2AEJ A;  2GUS A;  3A3Y B;  3RL0 B;  3AE5 C;  4U3F E;  1NO4 A;  3A0H H;  4D6T E;  2KXP B;  2QIW A;  5KLV J;  2K9J B;  1SQB J;  4L73 A;  1L0L G;  3BCC J;  2BEQ D;  1LTI C;  3VP8 A;  1H8A A;  1RF0 A;  1EZV D;  2JWD A;  1M56 D;  2ZAE B;  3RL0 g;  3SFE C;  1OVV A;  2WWW A;  1KYO I;  1GK6 A;  3ABV C;  1EZV E;  1GU5 A;  3L72 G;  1MFZ A;  1GD2 E;  1FAV A;  1U7M A;  1N73 B;  1PPJ E;  4IL6 H;  5APW A;  3TDK A;  5AVX B;  1CI6 A;  1DEB A;  3TNU A;  2ZT9 C;  3GLM A;  5AW7 B;  1NOH A;  1M90 Q;  2CK3 H;  4H0L D;  2MJZ A;  1NH4 A;  2QJY C;  1CSB A;  3JC2 2;  2G3A A;  1GL2 A;  1SQV K;  4BWN A;  1QGK B;  1CW5 A;  3EFG A;  1OFC X;  3U59 A;  1JTH A;  2FFD C;  5KJ7 C;  1PZQ A;  1PP9 G;  3MUD C;  1L0L K;  3B71 A;  1SQB D;  3P7K A;  3BCC D;  1AVO A;  1Q81 Q;  2WVR A;  4EIJ A;  1VF5 C;  1K05 A;  4GOF A;  1H89 A;  1RF1 C;  2HYN A;  2R5B A;  4PV1 D;  3OA7 A;  4NPF X;  2WQY C;  3L71 G;  3JSV C;  1YI2 P;  2E75 D;  1SQB E;  3WUT A;  1W5C E;  2A45 H;  2IYP A;  1GU4 A;  2A06 E;  1QVF O;  3BCC E;  1HVV A;  1FC2 C;  5H2F H;  1ZXG A;  2GM4 A;  5AW2 B;  5AVV B;  5AVQ B;  4R4L A;  2OAR A;  1DX7 A;  3FXD A;  1MFT A;  3G6E P;  1IK9 A;  1NTM D;  3GMA A;  2YXQ B;  1VQM P;  1OZH A;  3T97 B;  4IFM A;  2NZ2 A;  1NTZ D;  1G2C B;  3O6Q A;  4TLF A;  2NPS A;  1K9M Q;  1BGY G;  4H44 D;  2KNC A;  4Z1M H;  1KIL C;  3V5B A;  2HFE D;  3L70 G;  2K1A A;  3CWB J;  1NTZ E;  4KJM A;  1P84 H;  2H8P D;  2KP8 A;  3TSI A;  1SS1 A;  3CL3 D;  3L74 G;  1J1D B;  2D2C B;  2KLV A;  5KKZ B;  1SQV J;  1NVO A;  4ZKU A;  5APQ A;  3HE4 B;  2LKM A;  2QM8 A;  5AVU B;  4AUW A;  2WPQ A;  1GK4 A;  3CCR P;  1D7M A;  2KK7 A;  3TK1 A;  4PJ0 H;  3HUS B;  1JO5 A;  1KC8 Q;  2HPC A;  1L0L J;  3C1L A;  4DJG A;  2VRS A;  1JY3 N;  4N78 D;  2AEF A;  5B66 E;  2AXT H;  1GL2 D;  2UWJ E;  1Y8A A;  3H1J G;  5DJT B;  5AW4 B;  3VMY A;  4DT0 A;  1U7J A;  1NJI Q;  3CXH I;  5CBO A;  2H7H A;  3KZI E;  1FZC B;  1SFC A;  3R2P A;  1NYH A;  2HLO A;  2ZFC A;  1N7L A;  3HD7 C;  4EI2 A;  4N78 E;  5KAI E;  3L72 J;  4IOI H;  1JY2 O;  4I7Z B;  1HGV A;  3N4X A;  1SQP J;  1WMK A;  3RBX A;  2LXB A;  1IK7 A;  3RK2 D;  3AE3 C;  2JO1 A;  5TIS E;  2W6J H;  3H1L G;  4IL6 X;  1NTK D;  2RKL A;  1HTL C;  1OVU A;  3A0B H;  2OGU A;  1OWA A;  2B9B A;  2Z4E A;  3L36 A;  2PP6 A;  1KQS O;  1PP9 J;  1N8R Q;  5AVR B;  1NTK E;  3NTN A;  2NPS D;  1SQV E;  2BCC D;  2YO2 A;  2CPS A;  1QLE D;  3M91 A;  4ZNC A;  4JBZ A;  1WT6 A;  1YQ4 C;  4PD4 D;  3L71 J;  3CX5 H;  2ZYD A;  2OYH C;  3SFD C;  3HTK A;  1BDD A;  3CXH D;  2W6B A;  4GDO A;  1JM0 A;  2R32 A;  3QWO C;  2IPP A;  1SQP D;  2WSE H;  4PD4 H;  3S1K A;  1LTJ C;  2M5A B;  5DJU B;  3CXH E;  1BGY J;  1EDJ A;  2ZVO B;  2P7J A;  1SQP E;  3L70 J;  3H6P A;  1OW6 A;  1R5S A;  2KUB A;  4H13 D;  2ZYA A;  2RN0 A;  1XTG B;  2R3C A;  3AEF C;  1NWQ A;  2M3B A;  1KN7 A;  3U1C A;  2QRX A;  1CI6 B;  1SFC D;  2YMY A;  2A45 G;  4HJG H;  1VDF A;  3L74 J;  1L2P A;  2E74 B;  1BSN A;  2YKQ A;  4H0L C;  1QEX A;  2IDB A;  5CJ0 A;  1KFM A;  4I7Z C;  2WIT A;  2L5G B;  1PP9 E;  2LXC B;  2YXR B;  3GHG A;  1J1E B;  1U57 A;  3GF3 A;  3H1J J;  1JUN A;  1KD1 Q;  2Q7C A;  1L4A A;  3VP9 A;  1RE4 C;  2OTK E;  4OWF A;  3PH0 A;  1SQQ K;  1QX8 A;  3F5H A;  1IFM A;  4PV1 C;  3FX0 A;  1SQX D;  1AVY A;  2M0B A;  4HYT B;  2E75 C;  3L70 D;  3PJS K;  1FZE A;  2P10 A;  4I1L A;  3Q1M A;  2ZT9 B;  4JYC A;  1HWT C;  3B5N A;  3F89 A;  3H1L J;  2N1T A;  2QJY B;  1SQX E;  1M1J A;  5E79 E;  2Q5U A;  2NRG A;  3G71 P;  1Y47 A;  3L70 E;  3Q5S A;  2JP3 A;  4I6M C;  3AED C;  5KTB A;  3G9R A;  1T2K D;  5CCH A;  2FFD B;  3QH9 A;  4R4M A;  3BAS A;  4H44 C;  1KB9 I;  3D71 A;  1RF0 C;  2W90 A;  3JCU E;  1S9K D;  4UB8 E;  1LP1 B;  1VF5 B;  2HOD A;  2QEX P;  1YJ9 P;  1RQU A;  3B8E B;  1RF1 B;  2Y0D A;  2WSF J;  4ZKP A;  1Y9B A;  2IBZ G;  4U3F D;  2O01 J;  1G1J A;  3H1J E;  1RE3 A;  1X22 A;  2Q9I A;  2IFN A;  3RK3 D;  2AXC A;  2KS1 B;  1DH3 A;  2RH0 A;  2ZVN B;  2BEZ F;  1GMJ A;  1ZME C;  2FYN C;  1GL2 C;  4EOT A;  5CMZ A;  4YPC A;  2OYI A;  4XA4 A;  1J2J B;  3RGU A;  3RK3 E;  1SQQ J;  1KIL B;  1J1E C;  1LJ2 A;  1PFI A;  3B4S A;  3AE2 C;  2E76 D;  4GOE A;  1X8Y A;  1ZRT D;  3HE5 A;  2P58 A;  1URQ D;  1JY2 P;  1PPJ D;  1L4A D;  4LLH A;  1KTM A;  2FXP A;  3H1L E;  2M3E A;  5GTI E;  2HR3 A;  1NHL A;  4WY4 A;  2B87 B;  1KB9 D;  1ZRT E;  2WPS A;  1YJN P;  2FKW B;  4NPE A;  1EXI A;  2MKV A;  4TT3 H;  1LT9 A;  2WSC H;  1R5L A;  1A02 F;  5AW0 B;  2XU6 A;  4W80 A;  3SWY A;  2LR2 A;  4LGD E;  3B5N D;  2J58 A;  2IX7 C;  2N1T D;  1MZ9 A;  1L0N K;  1KB9 E;  4DOJ A;  1FE6 A;  1USE A;  4L74 A;  1X9V A;  2RMZ A;  2NPS C;  5CCH D;  2ITA A;  2N9B A;  1YIT P;  3HD7 B;  4BRY B;  1VQK P;  3Q3D A;  1M1K Q;  3Q5P A;  1K73 Q;  5KLV D;  1H0T B;  1JCC A;  1PV3 A;  1SQQ D;  3CCV P;  2A06 D;  3CPW O;  1FDO A;  3AE1 C;  2Y0E A;  1PIX A;  1NU1 G;  3M0A A;  1DIP A;  1SLQ A;  3C8V A;  3H1I G;  1EDI A;  3CME P;  4UB6 E;  5KLV E;  2FYU G;  3AEB C;  1SQQ E;  3S4R A;  1H88 A;  2KSE A;  1XTC C;  2O3J A;  2WT7 B;  3KHU A;  1S72 P;  1KYO D;  5GTH E;  3LW5 H;  4Y28 J;  5AVT B;  4ASW A;  1USD A;  4H13 C;  4JPZ B;  2IBZ I;  3VYI A;  3R4Y A;  3AEC C;  3MP7 B;  3G4S P;  4BXL A;  2H89 C;  2C0X A;  1N7S A;  1SFC C;  2B89 A;  3CCU P;  1OX3 A;  1KYO E;  3MD0 A;  1S5L E;  1JB0 J;  3TGU G;  1T3J A;  2R5D A;  2P67 A;  3CI9 A;  1PGJ A;  3MZW B;  3WU2 E;  2OYH B;  3L35 A;  3I5C A;  2C0W A;  3GW6 A;  3K5B A;  3H1H G;  3G3Z A;  4WY4 D;  1NU1 K;  3SSU A;  3L73 G;  1L0N J;  1GW4 A;  3HRN A;  2KZJ A;  3CD6 P;  1LTJ B;  2FYU K;  2ZYG A;  2JWA A;  3A7O A;  2QE7 H;  2JEE A;  3A2A A;  5AW5 B;  1Q82 Q;  1JY3 O;  2WTY A;  5B66 H;  3H1K G;  4EYY Q;  3CCL P;  1EXJ A;  1HBW A;  5AVZ B;  3KZI H;  3S9O A;  1OVR A;  4B86 A;  2Q1K A;  4H0L B;  1LT1 A;  2OQQ A;  1VQ5 P;  2C9L Y;  1VQO P;  2K9J A;  3H32 B;  2IBZ D;  2QJK B;  5APS A;  3CWB D;  2QJP C;  2ZXE B;  4C7N B;  1T2K C;  4D6T G;  2K9Y A;  5KAF E;  1EDK A;  1PL5 A;  1W2E A;  1JY2 N;  1LWU A;  2H88 C;  1ZP0 C;  1L0N D;  1SQV D;  1HF9 A;  2IBZ E;  3CWB E;  3AE7 C;  4GKG A;  4K3A A;  1BCC G;  1N73 A;  4PV1 B;  3H25 A;  1VQ7 P;  2OTJ P;  3E1I A;  1L0L D;  2WPV B;  2E75 B;  1L0N E;  1EZV G;  3KPE A;  1VL2 A;  3CC4 P;  3CLQ A;  1N7S D;  1NU1 J;  1DEE G;  5K5G B;  1FZB A;  4U7J A;  3H1I J;  2PGD A;  2HG5 D;  3LID A;  3NFQ A;  3AE9 C;  3EQ2 A;  1L0L E;  1RY3 A;  3E7K A;  2OYI B;  3L72 D;  2YKO A;  5APT A;  4DCK A;  4W7Z A;  1YHQ P;  1ZOY C;  4H44 B;  5AVW B;  3GHG C;  2FYZ A;  1AFO A;  2E76 C;  4OGQ D;  1T8Z A;  1DD3 A;  3CXH H;  1L4A C;  3L72 E;  1YIJ P;  1LNQ A;  4ZMD A;  3AE4 C;  1EC5 A;  3CCJ P;  1YYC A;  2JKV A;  1T6A A;  2WZ7 A;  3P32 A;  1PP9 D;  2V7Q H;  2POH A;  2W8Z A;  1SQB G;  4YXD C;  1AQT A;  3H1H J;  3BRT B;  3RL0 D;  3BCC G;  3TNU B;  1FZA A;  1LGH B;  3T97 A;  3L73 J;  5AW1 B;  3B5N C;  3V6I A;  2Y9Y A;  1G2C A;  1S5L X;  1FU1 A;  3M9Q A;  2N1T C;  2FYN B;  1GL2 B;  1M1J C;  1VQ9 P;  2I1K A;  2QJK C;  3L71 D;  1KQG B;  2PFX A;  1FOS F;  1JTH B;  2JR8 A;  2XNX A;  5CCH C;  2BAS A;  5APU A;  1X0T A;  3H1K J;  4CPG A;  1FBM A;  1URQ A;  2O1K A;  1AV1 A;  3H1I E;  2YNY A;  1NTM G;  1JNM A;  1IO4 A;  2OYO A;  3L71 E;  1NTZ G;  3KXD A;  4KHX A;  4XE5 B;  1OIP A;  3WMM 0;  2K88 A;  5KLI B;  1FS0 E;  1AJY A;  5APX A;  3RK2 B;  3HE4 A;  1IFN A;  4KT0 J;  1BGY D;  5B5E E;  1VQ8 P;  2E42 A;  1W2B O;  5EFW B;  5CCG A;  2JJL A;  3HUS A;  1E5W A;  2XKM A;  1RE3 C;  1SQB K;  2FXO A;  1JMB A;  2Q3E A;  1GDT A;  1A02 J;  1BGY E;  4L76 A;  3H1H D;  5C39 A;  3L74 D;  3VOP A;  3L73 D;  1VQP P;  3BAT A;  1FZC A;  2J5U A;  3O6Q B;  2OYI C;  2NPS B;  2C9N Y;  1GW3 A;  3AEG C;  5TJH A;  3IR9 A;  4JYB A;  4N3Y B;  2KNC B;  2ZJS E;  1BCC J;  1LTA C;  2FXM A;  3M0D A;  3UIA A;  2YIU C;  1G1I A;  1QL1 A;  3H1H E;  3L74 E;  2ZXX A;  1JCD A;  3L73 E;  4UB8 H;  3D6Y A;  3H1K D;  3H1J D;  1NTM K;  2AEM A;  1NTZ K;  1IFI A;  3CCE P;  2WSC J;  4WY4 C;  3W67 A;  3FWL A;  3CCM P;  4MN4 C;  4C7R A;  4OVN F;  1UIX A;  3H1K E;  1LT9 C;  1NKZ B;  2N9Y B;  4W7Y A;  4XFJ A;  3WUU A;  3N7N A;  1JY3 P;  3I56 P;  2HPC B;  2DW3 A;  1Q2N A;  3TYY A;  1RH5 B;  3CC2 P;  1IFD A;  5AVS B;  1FZF A;  2IYO A;  4H13 B;  4NPD A;  1HGZ A;  3PTZ A;  2CPB A;  3H1L D;  4HH2 A;  3W68 A;  3LIE A;  1NTK G;  1SFC B;  2H43 A;  2A45 I;  3ZDM A;  3MIW A;  3A0H E;  1BCC D;  2D2C D;  2YMK A;  5GTI H;  5KLI C;  3M9B A;  3RK2 C;  2BCC G;  2M5A A;  1LTS C;  3PLN A;  3L4F A;  1NGM B;  1ZR4 A;  5CJ4 A;  5CCG D;  3LW5 J;  1LWU B;  1BCC E;  4Y99 C;  2G8Y A;  2W6A A;  4WB4 A;  1BDC A;  1HUC A;  1KB9 H;  1P84 I;  1VQN P;  4IL6 E;  1SQP G;  2WSF H;  2KYV A;  1NTM J;  4O9B A;  1VQ4 P;  2I8D A;  3AEA C;  1NTZ J;  1OXZ A;  5APY A;  3NMD A;  1VQL P;  1NTK K;  3IAO A;  1N7S C;  3L75 G;  3V4W A;  2O01 H;  3FXE A;  3M9H A;  1CZQ A;  4IFD K;  3CCQ P;  3VMX A;  3KDP B;  1LTB C;  1FJK A;  3HTK B;  2QJP B;  1MKM A;  3O8Z A;  1MUU A;  3AEE C;  4UB6 H;  1S3J A;  1ZN5 A;  1KZU B;  2XND H;  4RES B;  2QG4 A;  2XDJ A;  1VPC A;  4OGQ C;  1YJW P;  1KFN A;  2KB7 P;  1FDI A;  5GTH H;  3Q2Y A;  5L8R J;  2KIK A;  3GG2 A;  3I55 P;  1GTW A;  2FY8 A;  2PAJ A;  3Q5R A;  5H2F E;  2K3R A;  1JEK A;  1SQP K;  4OH8 B;  1OMI A;  1UII A;  3E1R A;  2KSJ A;  1E79 H;  3RK3 B;  3RL0 C;  1PGP A;  4AQR D;  1KYO H;  3V4Q A;  1FJP A;  2KZI A;  1S5L H;  4HB1 A;  1P84 D;  1EQ7 A;  3WU2 H;  1PGO A;  2JDI H;  2FFD A;  1SQX G;  1QVG O;  5AW9 B;  4WVZ A;  5KJ7 A;  3MUD A;  1EDL A;  1TU3 F;  1NTM E;  3GHG B;  2WMM A;  1IFJ A;  2E76 B;  1LP1 A;  1P84 E;  4JQ0 D;  1LWU C;  1URQ B;  5BVZ A;  1RF1 A;  2B88 A;  3IN6 A;  2IZ1 A;  1L4A B;  5BU5 A;  1NTK J;  4M3L A;  3CX5 I;  2QA4 P;  1N73 C;  3FGA D;  3V2Q A;  3EFF K;  3VTP C;  2E74 D;  4GOD A;  1KMI Z;  2KS1 A;  4PJ0 E;  1M7L A;  3P8C D;  3VN0 A;  4GIF A;  1R8E A;  4PD4 I;  1BE3 G;  2AXT E;  3SWF A;  1S2E A;  3B5N B;  2BCC J;  2E5T A;  5KAI H;  1VQ6 P;  4WWI A;  2N1T B;  1PGQ A;  1M1J B;  2KLU A;  3M06 A;  2WSE J;  4U3F G;  1KIL A;  3P8C E;  1SQX K;  5KAF H;  3AE6 C;  5TIS H;  1NAF A;  3IF4 A;  2V4H A;  4WBA A;  1YTZ I;  2W27 A;  2Z5I A;  1RQV A;  4YXW H;  3WUV A;  3OJA B;  1Z56 A;  1AA0 A;  2B87 A;  4HKZ H;  1X79 B;  2HOD B;  2P2U A;  2V7Q J;  3L75 J;  3IFM A;  3BVH A;  4C46 A;  4EDF A;  2E5Y A;  3II6 A;  2L91 A;  3A0B E;  1Q90 D;  2ZT9 D;  2OTL P;  4QMA A;  1PPJ G;  3RBZ A;  4JF7 A;  2KI7 B;  2QM7 A;  3RK3 C;  3C9I A;  3CX5 D;  2FYU J;  2QSI A;  1KOR A;  2KOG A;  3L37 A;  2J59 M;  5CHX A;  5KJ7 D;  3EWK A;  3HD7 A;  4BRY A;  1RHZ B;  1H0T A;  1HJB A;  3CX5 E;  2XV5 A;  5M1B A;  2YIU B;  4I2L C;  5AVY B;  3OAK A;  3D70 A;  3HE5 B;  4RJT A;  1VF5 D;  2R3S A;  4ASV A;  1URQ C;  2BCC E;  2GA1 A;  4RO0 A;  1J1D C;  1IFP A;  2D2C C;  5KKZ C;  3VMZ A;  3V2P A;  1JOC A;  3CCS P;  3MTU E;  4PD4 E;  4WY4 B;  5BU8 B;  3TGU J;  1HJ0 A;  3L75 D;  2WT7 A;  1FOS E;  5KLV G;  1NAY A;  3PRJ A;  1SQX J;  5CCG C;  3HUS C;  1SQQ G;  1LT9 B;  1HH0 A;  2GUV A;  2A06 G;  1OW7 A;  3FWN A;  1T3U A;  2Q3I A;  2O1J A;  1NU1 D;  1GZL A;  3H1I D;  3L75 E;  4K35 A;  1KIL D;  1FZC C;  2FYU D;  3OW2 O;  4YTP C;  2E43 A;  1ZV8 A;  1IJD B;  1KQL A;  1LTT C;  3SWK A;  1SP4 A;  4AYC A;  1LTG C;  3M0D C;  2OYH A;  1NU1 E;  3BRV B;  5AW6 B;  2SPZ A; 
#chains in the Genus database with same CATH homology
 3MHV A;  4ASW A;  2B87 B;  4KJM A;  1JMB A;  4HJG H;  3ZDM A;  4GOD A;  1SS1 A;  4NPE A;  4ZMD A;  4BXL A;  1H0T A;  5C39 A;  1EC5 A;  2B89 A;  1EDK A;  2LR2 A;  1LP1 B;  1NVO A;  4WWI A;  4ASV A;  5CBN A;  1ZW0 A;  2LXC B;  2KIK A;  2M5A A;  3MZW B;  2K3R A;  4JBZ A;  4ZNC A;  4GOF A;  4K3A A;  2UWJ E;  1BDC A;  4NPF X;  2KZJ A;  2KS1 B;  2KZI A;  2OTK E;  5DJT B;  1U7J A;  1BDD A;  1H0T B;  2JWD A;  4HB1 A;  2R44 A;  3PH0 A;  5CBO A;  1JM0 A;  1DEE G;  1FC2 C;  1X0T A;  2QVA A;  2ZAE B;  3QWO C;  5K5G B;  1ZXG A;  2B87 A;  4HKZ H;  2I8D A;  2M0B A;  3S1K A;  4MN4 C;  1OVV A;  4CPG A;  1EDL A;  3FXD A;  3RGU A;  1MFT A;  1EDI A;  2M5A B;  5DJU B;  4EYY Q;  4IOI H;  4K35 A;  2WMM A;  3FXE A;  1LP1 A;  4GOE A;  2LXB A;  1Q2N A;  1U7M A;  2P58 A;  1EDJ A;  2B88 A;  2KI7 B;  1OVR A;  4NPD A;  2KUB A;  2Q1K A;  1Y47 A;  2HR3 A;  5EFW B;  1LT1 A;  2RKL A;  1S3J A;  1OVU A;  2SPZ A;  2QRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...