1SQQJ

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
59
structure length
59
Chain Sequence
PTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
total genus 18
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1sqqJ00
1P84I 3H1IJ 3L70J 1L0NJ 1BCCJ 3L72J 1SQXJ 4U3FJ 3TGUJ 1NTKJ 1SQBJ 1NTZJ 1BE3J 3H1KJ 1SQVJ 3L71J 1SQPJ 3L75J 5KLVJ 1KB9I 2FYUJ 3H1HJ 3BCCJ 3L73J 1SQQJ 4PD4I 2IBZI 3CXHI 3H1JJ 3H1LJ 1BGYJ 1NU1J 4D6TJ 1EZVI 2BCCJ 1KYOI 3CWBJ 1NTMJ 1L0LJ 3CX5I 3L74J 1PP9J
chains in the Genus database with same CATH superfamily
3W67A 3M9BA 1GL2C 5CCHA 1NTKJ 3HD7D 2WSFJ 5DJTB 1X22A 2QE7H 3CXHE 1BGYD 1GMJA 2P1JA 1BCCE 1FDMA 2ZXXA 1PGOA 2QJKB 3TGUG 4TLFA 3VP8A 3CC7P 2Y0CA 1IK9A 4JPZB 1NU1G 2KYVA 3EFFK 1SQQJ 2N1TC 2KS1B 2C9NY 4EYYQ 4PJ0H 1MFZA 1FS0E 1W5CE 5AW5B 5APTA 4OVNF 5CCGC 3NXSA 1NH4A 3BRTB 3V2QA 3CCQP 2LKMA 5APQA 1VF5B 1QVGO 2KZIA 2FFDB 1BGYG 1KQGB 1DX7A 4YTPC 3Q1MA 2A45I 3L70E 3M91A 5CCHD 2B87A 5TJHA 2JWAA 1OVVA 1KQSO 1M7LA 4LGDE 5K5GB 3GHGA 1KORA 2WPQA 1SP4A 3B5NB 1M1JB 2NPSC 1P84I 2H89C 3CCMP 1LT9A 1SQXD 2YIUB 3H1KD 3AE3C 4WB4A 3N7NA 4PJ0E 1MZ9A 3HTKA 5AVSB 2N9BA 1AVYA 2KP8A 1S5LH 1IZNB 1R8EA 2OYIB 2P2UA 3K5BA 3CX5D 1KILE 3D6YA 4ASWA 3VYIA 2WPVB 4I7ZB 2XNXA 4ZNCA 2H8PD 3H1LE 1QX8A 3L73D 2R5DA 1S72P 2RMZA 1URQA 3PLNA 3A7OA 5BVZA 2WSCH 4D6TD 2JP3A 5KKZB 2KIKA 3BATA 3M0AA 4WY4B 1L0ND 1SQXG 3H1KG 3WU2H 1EDKA 1JMBA 4KJMA 3G9RA 3BCCD 1Z56A 2FBWC 1NU1J 2G8YA 4RKUJ 1NHLA 1BCCD 3OW2O 3U1CA 1DD4A 3IAOA 3CLQA 3EFGA 1S5LE 4H13B 4BRYA 2E76D 3FXEA 4D6TG 1FZFA 3VMZA 4W7ZA 1NKNA 1LWUA 1EZVI 1FOSE 4WWIA 3WUUA 3W68A 1L0NG 3MUDA 1LTBC 1VL2A 2CPSA 2BASA 1SQPD 3II6A 3TNUB 4JYBA 3BCCG 3AEBC 2WPRA 2FY8A 4MN4C 3AE2C 3ITKA 1URQD 1T2KD 4RESB 3MP7B 3WU2E 4DCKA 1NWQA 1VQKP 1X8YA 4JF7A 3MTUE 1PZQA 3M0DA 3S1KA 1LP1A 2IBZE 1X9VA 5M1BA 1QVFO 4H44D 4Y28J 3P32A 3CL3D 2O01N 2ITAA 2QJKC 1SQPG 1HJ0A 2L5GB 1G1IA 3NMDA 3OA7A 4C7NA 2M0BA 5KLVE 2Y9YA 4JYCA 1YJNP 2RKLA 1L4AC 1MFTA 1KYOH 2Q1KA 4GKGA 1SQXJ 3H1KJ 1S1CX 5AVUB 1VF5C 1KC8Q 2FFDC 1FZBA 3AEDC 1HVVA 4U7JA 3OAKA 1KMIZ 3HTKB 1AA0A 2PGDA 3L73J 1S9KD 3RK2B 5CBNA 4HKZH 1OX3A 1X79B 2ZT9B 3H32A 3B5NC 1M1JC 3MD0A 2L91A 2IX7C 1L0NJ 1URQB 3EWKA 2C0XA 2YIUC 3CC2P 1BDCA 3BCCJ 4Z1MH 3AEAC 3AEEC 2QJPB 4PD4D 1KYOE 3HUSA 4XE5B 1N73A 2OYIC 2JKVA 1SS1A 1QL1A 2NZ2A 4N78D 2UWJE 1BCCJ 2O01H 1NTKD 2R5BA 1A02J 2NRGA 4I7ZC 1LTIC 3SWFA 3L74E 3AEGC 1YHQP 1OVUA 5KKZC 2Y9ZA 2XDJA 2B89A 2KOGA 3C1LA 1M56D 4WY4C 1BE3D 3IN6A 1PGPA 1HH0A 1SQPJ 1MUUA 3KPEA 2QIWA 3L4FA 3CWBE 4EOTA 2Y0DA 2IBZD 1U7JA 4W80A 2KNCA 1KQFB 3CX5I 1OW6A 4DOJA 3CPWO 1VQMP 3L70J 2V7QH 2PP6A 1NTKG 3BRVB 3V2PA 2E42A 3CCSP 1H89A 3RK3E 4H13C 3JC22 2E43A 3P8CE 4IL6X 5KLVD 5AW9B 2KK7A 3B4SA 3USSA 1NTZE 2QJYB 4DZOA 3TSIA 1HGZA 1LP1B 1BE3G 3GMAA 3V4QA 4H0LD 1JUNA 2P10A 5CMZA 1GK6A 1H88A 2IBZG 1BSHA 2A06D 2YKPA 2E75D 3L72E 2HYNA 1FZEA 1K8AQ 3Q5PA 2ZVOB 5CJ0A 3HD7A 1AFOA 3KQGA 1YJWP 1A02F 4W7YA 1RQUA 5KLVG 5B66H 1LTGC 5KAIH 1NKZB 1SVFA 1M57D 1CSBA 1N2DC 2RH0A 2FYUE 5AVXB 3GW6A 4RJTA 2C0WA 2QSIA 4L76A 5H2FH 1PL5A 2A06G 4O9BA 1G2CB 2E5YA 4LC1A 2Q6QA 5AVRB 2Y0EA 1YYCA 5AVWB 2Q7CA 3A0BH 2B9BA 1SQBD 3HE5B 2JEEA 3WMM0 3H1HE 2R3SA 2W6JH 2ZYDA 3AE9C 1N7SD 2G3AA 1VQ5P 1K73Q 3R4YA 2HLOA 1LT9C 1NTZK 1J1DB 1JY2N 1SFCA 1YTZI 1Q81Q 2JR8A 2WSSH 1Y9BA 2OYOA 1JM0A 5B66E 4JQ0D 3HUSB 5KAIE 1N73B 2WSCJ 1Q2NA 2FXMA 1N8RQ 2BCCD 2WSEH 3RK2C 3M9HA 2HODA 2ZT9C 4M3LA 1SQBG 5AW4B 5H2FE 1URQC 1BE3J 1QGKB 1JO5A 3HE4A 2E75B 2YMKA 2QJPC 3A0BE 1ZLLA 1L4AB 1PPJE 5APXA 4ZMDA 2FYUK 3VTPC 5C39A 1S4XA 3P8MC 3L75D 4I2LC 3V4WA 5APUA 4HJGH 3PHLA 2KNCB 2BCCG 5KLIB 1LTJB 3T97B 1T6AA 1PFIA 5KLVJ 1SFCD 3B71A 4AYCA 1S3JA 1RE3A 1DD3A 2IDBA 3U59A 2KXPB 1IJDB 4PD4I 3H1IE 1JMMA 3VP9A 4IOIH 2K9YA 2K9JA 1MV8A 1Q7YQ 2XKMA 2LXCB 3L75G 1FJPA 2FYUD 1NO4A 3H1JE 1BSNA 3AE7C 2CPBA 4ZKPA 1NJIQ 1NOHA 2H7HA 1K04A 3SWYA 4R4LA 3AE8C 2BEZF 2HPCA 1JB0J 2C9LY 3M0DC 3HD7B 2A45H 2D2CD 3SWKA 2K88A 2QJYC 2IFNA 4OGQD 4IFMA 1JTHA 1X0TA 3H1HD 3TF5A 1FZCA 2IBZI 3RBZA 2OARA 1ZN5A 1IK7A 3GLMA 1IFIA 3G3ZA 2IYPA 2IZ1A 4OWFA 1SQBJ 3AECC 4GOEA 5APYA 2WSFH 4GOFA 3CXHD 3V6IA 1PGJA 4BXLA 1Q82Q 3O6QA 1MKMA 4GT1A 2PFXA 3D70A 3H1HG 2M3BA 3L73G 2HR3A 3CCLP 2YXRB 2BCCJ 2QVAA 5AVYB 3C9IA 3PJSK 3L71E 1KILA 2XV5A 1AJYA 5L8RJ 1GL2D 1JOCA 2HODB 1RF1A 4XA4A 3GF7A 1L0LE 2ZFCA 3IFMA 2AXCA 1NGMB 2WTYA 1VPCA 2LR2A 2QA4P 3L70D 1J1DC 1BCCG 3HE4B 1KFMA 2O01J 1H0TA 2NPSA 1Q90D 1HTLC 2GUSA 5DJUB 3L75J 1KFNA 1HUCA 3HUSC 1N73C 1AV1A 1KD1Q 3H6PA 4OH8B 3SFDC 1VDFA 3VMYA 3L72J 1SQQE 4YPCA 3G4SP 2FXPA 3TK1A 3E1IA 2E75C 1M90Q 3Q2YA 1EC5A 3L70G 1HF9A 2B87B 1KILD 2WITA 3G71P 3LW5J 3KZIH 3GHGB 2YO3A 3CI9A 2IYOA 1VQ6P 2FYUJ 5CBOA 2K9JB 1CW5A 3H1LD 1NAYA 2KSEA 1FDIA 1PP9E 5KLIC 1LT9B 2PRRA 1LTJC 2W6AA 2E76B 2NPSD 1ZP0C 2KLUA 3I5CA 1NTMK 1L0LK 3H1HJ 2FKWB 3A2AA 2CK3H 1OIPA 1EZVE 2OTJP 2BEQD 2WT7A 1JTHB 3H25A 2OTLP 1FZCB 2LXBA 1FBMA 1KQLA 2POHA 3H1LG 4WBAA 2WMMA 2Q5UA 3KHUA 1OW8A 3KZIE 1IC2A 3KDPB 3HD7C 1YQ4C 1SQQK 4NPDA 3Q5SA 2JO1A 4H44B 3IF4A 3V2RA 4WVZA 3NTNA 1DEEG 3LIEA 3A5TA 5BU5A 5CHXA 3TGUE 3G6EP 4BRYB 1VQ8P 2O1KA 3NFQA 1IFJA 1USDA 3M06A 1LWUB 3ZDMA 2P7JA 4Y99C 1NU1E 2IFMA 1VQOP 2GM4A 2M8RA 1QEXA 2J58A 4N3YB 1ZV8A 3V2NA 2YKOA 1RF1B 3QWOC 3OJAB 1RF0A 3V5BA 2SPZA 4GDOA 1ZRTE 1FJKA 1ZW0A 1BGYE 4PV1D 4EI2A 1H0TB 1LTTC 2FFDA 5E79H 2M3EA 1JCCA 1T3UA 5CCHC 5AVVB 5AVQB 1OWAA 2MKVA 1N7SA 3CXHI 4IL6H 1PP9D 1HGVA 1KB9H 2AEMA 4QMAA 2YXQB 3F89A 2KLVA 1ZR2A 3CX5H 4C7NB 3CMAP 1RE4A 4JBZA 3MGNA 1UIXA 3H1LJ 1JCDA 2Q3IA 5TISH 1S2EA 2P67A 3VMXA 5AW2B 4U3FE 5CJ4A 5AW7B 1NU1K 2FXOA 3RL0D 2AEFA 1J2JB 2E74D 2GA1A 1VF5D 1PP9G 1FE6A 1KYOD 1JY3N 1SQXE 1OW7A 3H1KE 1NYHA 5KJ7A 3GHGC 2YO2A 3P7KA 1EQ7A 1KB9E 3H32B 1OMIA 2DW3A 1IFNA 3L74D 3CX5E 4ZKUA 2N9YB 2KI7B 3WUVA 2WVRA 4PV1B 3MZWB 3TGUD 1W2BO 3B5ND 2E76C 1J1EB 2WQYC 1SLQA 1OZHA 2OTKE 3WUTA 4D6TE 5TISE 1VQNP 5APVA 2M5AA 3CWBD 4H0LB 1L0NE 1WMKA 2IZ0A 2FYZA 5AW8B 1KTMA 2H88C 3FXDA 4NPFX 4IFDK 1AQ5A 4AUWA 3BCCE 3BASA 1FZCC 4CPGA 1QLED 1T2KC 1ZRTD 1G1JA 2ZYGA 1K9MQ 3RK3D 4KT0J 3TNUA 5AW1B 3L74G 2QG4A 5B5EH 2WWWA 1QL2A 3P8CD 2XNDH 5APWA 1FDOA 1NTZD 3R2PA 5KJ7D 4WY4D 1IO4A 2XZRA 4H44C 2I1JA 3CWBG 1SQXK 3RL0B 1N7LA 3F5HA 2E74B 1SQPE 3JCUH 1SQVE 3L72D 3CCEP 5GTHH 3I56P 2MJZA 4DT0A 3O8ZA 3TYYA 2OYHA 1LWUC 4YXWH 2HG5D 3MUDC 1NVOA 4H13D 1KILC 1CI6A 1OVRA 1PP9J 3UIAA 4XFJA 2KSJA 1NTZG 4U3FD 1N7SB 1GTWA 1RF1C 3AEFC 1FOSF 3CD6P 3KXDA 2W8ZA 3RGUA 5B5EE 4UB6H 1JNMA 4B86A 1L0NK 1JY3O 1S5LX 3MHVA 4BWNA 1YBKA 4L73A 1EDLA 3B8EB 3C8VA 5AW0B 3L72G 3CCUP 1USEA 2XU6A 2WZ7A 1BDDA 1U7MA 1GL2A 1KB9D 3FX0A 1Y47A 2PAJA 1JY2O 3JCUE 3PH0A 1JEKA 5GTHE 4PD4H 2FYNB 4HB1A 1L2PA 1IFMA 4U3FG 3RK3B 2JWDA 2O3JA 1P84H 2FYUG 4Y99B 5BU8B 1W2EA 2V4HA 3TDKA 3VMAA 3E1RA 4I6MC 1FZAA 4IFFA 1RHZB 4EDFA 3L74J 2OGUA 1DIPA 1YITP 2N1TA 5GTIH 1SQPK 2ZYAA 1SQVK 3LIDA 3FWLA 4UB6E 3TGUJ 2J5UA 5CCGA 1S9KE 3VOPA 3AE1C 1SFCB 1OXZA 1N86A 3IR9A 3CWBJ 3L35A 1ZXGA 1FU1A 1EXIA 2K37A 4TT3H 1PPJD 2I1KA 4N6JA 1ZR4A 2M5AB 2I8DA 4K35A 4L74A 4PD4E 1NTME 4UB8H 1BGYJ 3PTZA 1GW3A 4N78E 2Z4EA 1P84E 1JY3P 1NTKE 2R44A 3I55P 3RK2D 3MIWA 1Y8AA 2ZT9D 1SQVD 4PV1C 1EXJA 1NTZJ 1WT6A 1GU4A 2VRSA 1J1EC 1T3JA 2QEXP 2W6BA 5GTIE 2D2CB 1DEBA 2ZXEB 1KYOI 4OGQB 3H1ID 4H0LC 3N4XA 1GZLA 1PPJG 2N1TD 1JY2P 1BE3E 1LGHB 4I1LA 3VN0A 1DH3A 2JDIH 5CCGD 1PV3A 3H1JD 2GUVA 3SSUA 1NAFA 3L36A 2R3CA 2W90A 1IFDA 3D6ZA 1XTGB 1KZUB 1ZOYC 2V7QJ 2HFED 1R5SA 2OYHB 2OQQA 1SQVG 2KB7P 4U3FJ 4UB8E 1EDIA 1CI6B 1FZGA 3CCRP 3ABVC 2P58A 3H1IG 1RF0C 3Q3DA 1YTZT 3RL0C 2ZVNB 2E74C 4L75A 2IPPA 1D7MA 1K05A 3H1JG 2HPCB 2A06E 1E5WA 2R32A 3CCJP 3KYQA 1T8ZA 1NTKK 2E5TA 3D71A 3RBXA 1GL2B 5EFWB 1HWTC 1G2CA 3EQ2A 1N7SC 4A7PA 1RY3A 1LTSC 2K3RA 2W83C 3HE5A 1FC2C 1GD2E 1UIIA 4DJGA 3S4RA 4D6TJ 1AQTA 4K3AA 3GF3A 1R5LA 1RE4C 2WPSA 1YJ9P 2AXTH 3L71D 3Q5RA 3A3YB 1HBWA 2N1TB 3O6QB 1YI2P 1NTMD 1L0LD 3PRJA 5AVZB 3CCVP 1PIXA 5KAFH 1SQBE 1YQ3C 3A0HH 2FYNC 1P84D 1VQ9P 2O1JA 4HYTB 5AW6B 3RK3C 3AE5C 5KLVK 1RH5B 2Q3EA 1LJ2A 1KILB 1ZMEC 3S9OA 2A45G 4C7RA 5KJ7C 1GU5A 3M9QA 2KS1A 1XTCC 2Q9IA 3L71G 1VQ7P 1L4AA 1SQVJ 1KB9I 1SQQD 2YMYA 1M1KQ 2BCCE 1VQPP 1FAVA 3GG2A 2WSEJ 1NTMG 1L0LG 1SFCC 2NPSB 2AXTE 5KTBA 4AQRD 3H1IJ 1Q86Q 1LTJA 3T97A 2KUBA 1U57A 1YIJP 4LLHA 4RO0A 3LW5H 4EIJA 1GW4A 5KAFE 3H1JJ 3A0HE 1H8AA 3PP5A 1KV4A 2ZJSE 3E7KA 2Z5IA 3L75E 3B5NA 1M1JA 4ASVA 2Z5HA 3U1AA 1SQQG 1WRGA 3FGAD 1LTAC 2QM8A 3CMEP 3JSVC 3SFEC 1LNQA 2D2CC 2JJLA 1EZVD 1SQBK 4OGQC 2QRXA 3FWNA 2OYIA 3AE4C 1L4AD 1VQ4P 1GDTA 1M8OB 2J59M 5E79E 1VQLP 3QH9A 4R4MA 1RE3C 3CXHH 1E79H 1EDJA 2RN0A 2ZAEB 5AVTB 2OYHC 4C46A 3BVHA 4WY4A 2YKQA 4IL6E 5APSA 2AEJA 2WT7B 3RL0g 1CZQA 1LT1A 2KZJA 3HRNA 1EZVG 4GODA 1GK4A 1PGQA 1TU3F 3L37A 4YXDC 1AVOA 3CC4P 4KHXA 5AW3B 1HJBA 4NPEA 2QM7A 3AE6C 3L73E 3L71J 2H43A 2K1AA 1OFCX 4GIFA 4HH2A 2W27A 1NU1D 1IFPA 2B88A 2YNYA 1RQVA 1KN7A 1NTMJ 1L0LJ
chains in the Genus database with same CATH topology
1P84I 3H1IJ 3L70J 1L0NJ 1BCCJ 3L72J 1SQXJ 4U3FJ 3TGUJ 1NTKJ 1SQBJ 1NTZJ 1BE3J 3H1KJ 1SQVJ 3L71J 1SQPJ 3L75J 5KLVJ 1KB9I 2FYUJ 3H1HJ 3BCCJ 3L73J 1SQQJ 4PD4I 2IBZI 3CXHI 3H1JJ 3H1LJ 1BGYJ 1NU1J 4D6TJ 1EZVI 2BCCJ 1KYOI 3CWBJ 1NTMJ 1L0LJ 3CX5I 3L74J 1PP9J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P84 I;  3H1I J;  3L70 J;  1L0N J;  1BCC J;  3L72 J;  1SQX J;  4U3F J;  3TGU J;  1NTK J;  1SQB J;  1NTZ J;  1BE3 J;  3H1K J;  1SQV J;  3L71 J;  1SQP J;  3L75 J;  5KLV J;  1KB9 I;  2FYU J;  3H1H J;  3BCC J;  3L73 J;  1SQQ J;  4PD4 I;  2IBZ I;  3CXH I;  3H1J J;  3H1L J;  1BGY J;  1NU1 J;  4D6T J;  1EZV I;  2BCC J;  1KYO I;  3CWB J;  1NTM J;  1L0L J;  3CX5 I;  3L74 J;  1PP9 J; 
#chains in the Genus database with same CATH topology
 3W67 A;  3M9B A;  1GL2 C;  5CCH A;  1NTK J;  3HD7 D;  2WSF J;  5DJT B;  1X22 A;  2QE7 H;  3CXH E;  1BGY D;  1GMJ A;  2P1J A;  1BCC E;  1FDM A;  2ZXX A;  1PGO A;  2QJK B;  3TGU G;  4TLF A;  3VP8 A;  3CC7 P;  2Y0C A;  1IK9 A;  4JPZ B;  1NU1 G;  2KYV A;  3EFF K;  1SQQ J;  2N1T C;  2KS1 B;  2C9N Y;  4EYY Q;  4PJ0 H;  1MFZ A;  1FS0 E;  1W5C E;  5AW5 B;  5APT A;  4OVN F;  5CCG C;  3NXS A;  1NH4 A;  3BRT B;  3V2Q A;  3CCQ P;  2LKM A;  5APQ A;  1VF5 B;  1QVG O;  2KZI A;  2FFD B;  1BGY G;  1KQG B;  1DX7 A;  4YTP C;  3Q1M A;  2A45 I;  3L70 E;  3M91 A;  5CCH D;  2B87 A;  5TJH A;  2JWA A;  1OVV A;  1KQS O;  1M7L A;  4LGD E;  5K5G B;  3GHG A;  1KOR A;  2WPQ A;  1SP4 A;  3B5N B;  1M1J B;  2NPS C;  1P84 I;  2H89 C;  3CCM P;  1LT9 A;  1SQX D;  2YIU B;  3H1K D;  3AE3 C;  4WB4 A;  3N7N A;  4PJ0 E;  1MZ9 A;  3HTK A;  5AVS B;  2N9B A;  1AVY A;  2KP8 A;  1S5L H;  1IZN B;  1R8E A;  2OYI B;  2P2U A;  3K5B A;  3CX5 D;  1KIL E;  3D6Y A;  4ASW A;  3VYI A;  2WPV B;  4I7Z B;  2XNX A;  4ZNC A;  2H8P D;  3H1L E;  1QX8 A;  3L73 D;  2R5D A;  1S72 P;  2RMZ A;  1URQ A;  3PLN A;  3A7O A;  5BVZ A;  2WSC H;  4D6T D;  2JP3 A;  5KKZ B;  2KIK A;  3BAT A;  3M0A A;  4WY4 B;  1L0N D;  1SQX G;  3H1K G;  3WU2 H;  1EDK A;  1JMB A;  4KJM A;  3G9R A;  3BCC D;  1Z56 A;  2FBW C;  1NU1 J;  2G8Y A;  4RKU J;  1NHL A;  1BCC D;  3OW2 O;  3U1C A;  1DD4 A;  3IAO A;  3CLQ A;  3EFG A;  1S5L E;  4H13 B;  4BRY A;  2E76 D;  3FXE A;  4D6T G;  1FZF A;  3VMZ A;  4W7Z A;  1NKN A;  1LWU A;  1EZV I;  1FOS E;  4WWI A;  3WUU A;  3W68 A;  1L0N G;  3MUD A;  1LTB C;  1VL2 A;  2CPS A;  2BAS A;  1SQP D;  3II6 A;  3TNU B;  4JYB A;  3BCC G;  3AEB C;  2WPR A;  2FY8 A;  4MN4 C;  3AE2 C;  3ITK A;  1URQ D;  1T2K D;  4RES B;  3MP7 B;  3WU2 E;  4DCK A;  1NWQ A;  1VQK P;  1X8Y A;  4JF7 A;  3MTU E;  1PZQ A;  3M0D A;  3S1K A;  1LP1 A;  2IBZ E;  1X9V A;  5M1B A;  1QVF O;  4H44 D;  4Y28 J;  3P32 A;  3CL3 D;  2O01 N;  2ITA A;  2QJK C;  1SQP G;  1HJ0 A;  2L5G B;  1G1I A;  3NMD A;  3OA7 A;  4C7N A;  2M0B A;  5KLV E;  2Y9Y A;  4JYC A;  1YJN P;  2RKL A;  1L4A C;  1MFT A;  1KYO H;  2Q1K A;  4GKG A;  1SQX J;  3H1K J;  1S1C X;  5AVU B;  1VF5 C;  1KC8 Q;  2FFD C;  1FZB A;  3AED C;  1HVV A;  4U7J A;  3OAK A;  1KMI Z;  3HTK B;  1AA0 A;  2PGD A;  3L73 J;  1S9K D;  3RK2 B;  5CBN A;  4HKZ H;  1OX3 A;  1X79 B;  2ZT9 B;  3H32 A;  3B5N C;  1M1J C;  3MD0 A;  2L91 A;  2IX7 C;  1L0N J;  1URQ B;  3EWK A;  2C0X A;  2YIU C;  3CC2 P;  1BDC A;  3BCC J;  4Z1M H;  3AEA C;  3AEE C;  2QJP B;  4PD4 D;  1KYO E;  3HUS A;  4XE5 B;  1N73 A;  2OYI C;  2JKV A;  1SS1 A;  1QL1 A;  2NZ2 A;  4N78 D;  2UWJ E;  1BCC J;  2O01 H;  1NTK D;  2R5B A;  1A02 J;  2NRG A;  4I7Z C;  1LTI C;  3SWF A;  3L74 E;  3AEG C;  1YHQ P;  1OVU A;  5KKZ C;  2Y9Z A;  2XDJ A;  2B89 A;  2KOG A;  3C1L A;  1M56 D;  4WY4 C;  1BE3 D;  3IN6 A;  1PGP A;  1HH0 A;  1SQP J;  1MUU A;  3KPE A;  2QIW A;  3L4F A;  3CWB E;  4EOT A;  2Y0D A;  2IBZ D;  1U7J A;  4W80 A;  2KNC A;  1KQF B;  3CX5 I;  1OW6 A;  4DOJ A;  3CPW O;  1VQM P;  3L70 J;  2V7Q H;  2PP6 A;  1NTK G;  3BRV B;  3V2P A;  2E42 A;  3CCS P;  1H89 A;  3RK3 E;  4H13 C;  3JC2 2;  2E43 A;  3P8C E;  4IL6 X;  5KLV D;  5AW9 B;  2KK7 A;  3B4S A;  3USS A;  1NTZ E;  2QJY B;  4DZO A;  3TSI A;  1HGZ A;  1LP1 B;  1BE3 G;  3GMA A;  3V4Q A;  4H0L D;  1JUN A;  2P10 A;  5CMZ A;  1GK6 A;  1H88 A;  2IBZ G;  1BSH A;  2A06 D;  2YKP A;  2E75 D;  3L72 E;  2HYN A;  1FZE A;  1K8A Q;  3Q5P A;  2ZVO B;  5CJ0 A;  3HD7 A;  1AFO A;  3KQG A;  1YJW P;  1A02 F;  4W7Y A;  1RQU A;  5KLV G;  5B66 H;  1LTG C;  5KAI H;  1NKZ B;  1SVF A;  1M57 D;  1CSB A;  1N2D C;  2RH0 A;  2FYU E;  5AVX B;  3GW6 A;  4RJT A;  2C0W A;  2QSI A;  4L76 A;  5H2F H;  1PL5 A;  2A06 G;  4O9B A;  1G2C B;  2E5Y A;  4LC1 A;  2Q6Q A;  5AVR B;  2Y0E A;  1YYC A;  5AVW B;  2Q7C A;  3A0B H;  2B9B A;  1SQB D;  3HE5 B;  2JEE A;  3WMM 0;  3H1H E;  2R3S A;  2W6J H;  2ZYD A;  3AE9 C;  1N7S D;  2G3A A;  1VQ5 P;  1K73 Q;  3R4Y A;  2HLO A;  1LT9 C;  1NTZ K;  1J1D B;  1JY2 N;  1SFC A;  1YTZ I;  1Q81 Q;  2JR8 A;  2WSS H;  1Y9B A;  2OYO A;  1JM0 A;  5B66 E;  4JQ0 D;  3HUS B;  5KAI E;  1N73 B;  2WSC J;  1Q2N A;  2FXM A;  1N8R Q;  2BCC D;  2WSE H;  3RK2 C;  3M9H A;  2HOD A;  2ZT9 C;  4M3L A;  1SQB G;  5AW4 B;  5H2F E;  1URQ C;  1BE3 J;  1QGK B;  1JO5 A;  3HE4 A;  2E75 B;  2YMK A;  2QJP C;  3A0B E;  1ZLL A;  1L4A B;  1PPJ E;  5APX A;  4ZMD A;  2FYU K;  3VTP C;  5C39 A;  1S4X A;  3P8M C;  3L75 D;  4I2L C;  3V4W A;  5APU A;  4HJG H;  3PHL A;  2KNC B;  2BCC G;  5KLI B;  1LTJ B;  3T97 B;  1T6A A;  1PFI A;  5KLV J;  1SFC D;  3B71 A;  4AYC A;  1S3J A;  1RE3 A;  1DD3 A;  2IDB A;  3U59 A;  2KXP B;  1IJD B;  4PD4 I;  3H1I E;  1JMM A;  3VP9 A;  4IOI H;  2K9Y A;  2K9J A;  1MV8 A;  1Q7Y Q;  2XKM A;  2LXC B;  3L75 G;  1FJP A;  2FYU D;  1NO4 A;  3H1J E;  1BSN A;  3AE7 C;  2CPB A;  4ZKP A;  1NJI Q;  1NOH A;  2H7H A;  1K04 A;  3SWY A;  4R4L A;  3AE8 C;  2BEZ F;  2HPC A;  1JB0 J;  2C9L Y;  3M0D C;  3HD7 B;  2A45 H;  2D2C D;  3SWK A;  2K88 A;  2QJY C;  2IFN A;  4OGQ D;  4IFM A;  1JTH A;  1X0T A;  3H1H D;  3TF5 A;  1FZC A;  2IBZ I;  3RBZ A;  2OAR A;  1ZN5 A;  1IK7 A;  3GLM A;  1IFI A;  3G3Z A;  2IYP A;  2IZ1 A;  4OWF A;  1SQB J;  3AEC C;  4GOE A;  5APY A;  2WSF H;  4GOF A;  3CXH D;  3V6I A;  1PGJ A;  4BXL A;  1Q82 Q;  3O6Q A;  1MKM A;  4GT1 A;  2PFX A;  3D70 A;  3H1H G;  2M3B A;  3L73 G;  2HR3 A;  3CCL P;  2YXR B;  2BCC J;  2QVA A;  5AVY B;  3C9I A;  3PJS K;  3L71 E;  1KIL A;  2XV5 A;  1AJY A;  5L8R J;  1GL2 D;  1JOC A;  2HOD B;  1RF1 A;  4XA4 A;  3GF7 A;  1L0L E;  2ZFC A;  3IFM A;  2AXC A;  1NGM B;  2WTY A;  1VPC A;  2LR2 A;  2QA4 P;  3L70 D;  1J1D C;  1BCC G;  3HE4 B;  1KFM A;  2O01 J;  1H0T A;  2NPS A;  1Q90 D;  1HTL C;  2GUS A;  5DJU B;  3L75 J;  1KFN A;  1HUC A;  3HUS C;  1N73 C;  1AV1 A;  1KD1 Q;  3H6P A;  4OH8 B;  3SFD C;  1VDF A;  3VMY A;  3L72 J;  1SQQ E;  4YPC A;  3G4S P;  2FXP A;  3TK1 A;  3E1I A;  2E75 C;  1M90 Q;  3Q2Y A;  1EC5 A;  3L70 G;  1HF9 A;  2B87 B;  1KIL D;  2WIT A;  3G71 P;  3LW5 J;  3KZI H;  3GHG B;  2YO3 A;  3CI9 A;  2IYO A;  1VQ6 P;  2FYU J;  5CBO A;  2K9J B;  1CW5 A;  3H1L D;  1NAY A;  2KSE A;  1FDI A;  1PP9 E;  5KLI C;  1LT9 B;  2PRR A;  1LTJ C;  2W6A A;  2E76 B;  2NPS D;  1ZP0 C;  2KLU A;  3I5C A;  1NTM K;  1L0L K;  3H1H J;  2FKW B;  3A2A A;  2CK3 H;  1OIP A;  1EZV E;  2OTJ P;  2BEQ D;  2WT7 A;  1JTH B;  3H25 A;  2OTL P;  1FZC B;  2LXB A;  1FBM A;  1KQL A;  2POH A;  3H1L G;  4WBA A;  2WMM A;  2Q5U A;  3KHU A;  1OW8 A;  3KZI E;  1IC2 A;  3KDP B;  3HD7 C;  1YQ4 C;  1SQQ K;  4NPD A;  3Q5S A;  2JO1 A;  4H44 B;  3IF4 A;  3V2R A;  4WVZ A;  3NTN A;  1DEE G;  3LIE A;  3A5T A;  5BU5 A;  5CHX A;  3TGU E;  3G6E P;  4BRY B;  1VQ8 P;  2O1K A;  3NFQ A;  1IFJ A;  1USD A;  3M06 A;  1LWU B;  3ZDM A;  2P7J A;  4Y99 C;  1NU1 E;  2IFM A;  1VQO P;  2GM4 A;  2M8R A;  1QEX A;  2J58 A;  4N3Y B;  1ZV8 A;  3V2N A;  2YKO A;  1RF1 B;  3QWO C;  3OJA B;  1RF0 A;  3V5B A;  2SPZ A;  4GDO A;  1ZRT E;  1FJK A;  1ZW0 A;  1BGY E;  4PV1 D;  4EI2 A;  1H0T B;  1LTT C;  2FFD A;  5E79 H;  2M3E A;  1JCC A;  1T3U A;  5CCH C;  5AVV B;  5AVQ B;  1OWA A;  2MKV A;  1N7S A;  3CXH I;  4IL6 H;  1PP9 D;  1HGV A;  1KB9 H;  2AEM A;  4QMA A;  2YXQ B;  3F89 A;  2KLV A;  1ZR2 A;  3CX5 H;  4C7N B;  3CMA P;  1RE4 A;  4JBZ A;  3MGN A;  1UIX A;  3H1L J;  1JCD A;  2Q3I A;  5TIS H;  1S2E A;  2P67 A;  3VMX A;  5AW2 B;  4U3F E;  5CJ4 A;  5AW7 B;  1NU1 K;  2FXO A;  3RL0 D;  2AEF A;  1J2J B;  2E74 D;  2GA1 A;  1VF5 D;  1PP9 G;  1FE6 A;  1KYO D;  1JY3 N;  1SQX E;  1OW7 A;  3H1K E;  1NYH A;  5KJ7 A;  3GHG C;  2YO2 A;  3P7K A;  1EQ7 A;  1KB9 E;  3H32 B;  1OMI A;  2DW3 A;  1IFN A;  3L74 D;  3CX5 E;  4ZKU A;  2N9Y B;  2KI7 B;  3WUV A;  2WVR A;  4PV1 B;  3MZW B;  3TGU D;  1W2B O;  3B5N D;  2E76 C;  1J1E B;  2WQY C;  1SLQ A;  1OZH A;  2OTK E;  3WUT A;  4D6T E;  5TIS E;  1VQN P;  5APV A;  2M5A A;  3CWB D;  4H0L B;  1L0N E;  1WMK A;  2IZ0 A;  2FYZ A;  5AW8 B;  1KTM A;  2H88 C;  3FXD A;  4NPF X;  4IFD K;  1AQ5 A;  4AUW A;  3BCC E;  3BAS A;  1FZC C;  4CPG A;  1QLE D;  1T2K C;  1ZRT D;  1G1J A;  2ZYG A;  1K9M Q;  3RK3 D;  4KT0 J;  3TNU A;  5AW1 B;  3L74 G;  2QG4 A;  5B5E H;  2WWW A;  1QL2 A;  3P8C D;  2XND H;  5APW A;  1FDO A;  1NTZ D;  3R2P A;  5KJ7 D;  4WY4 D;  1IO4 A;  2XZR A;  4H44 C;  2I1J A;  3CWB G;  1SQX K;  3RL0 B;  1N7L A;  3F5H A;  2E74 B;  1SQP E;  3JCU H;  1SQV E;  3L72 D;  3CCE P;  5GTH H;  3I56 P;  2MJZ A;  4DT0 A;  3O8Z A;  3TYY A;  2OYH A;  1LWU C;  4YXW H;  2HG5 D;  3MUD C;  1NVO A;  4H13 D;  1KIL C;  1CI6 A;  1OVR A;  1PP9 J;  3UIA A;  4XFJ A;  2KSJ A;  1NTZ G;  4U3F D;  1N7S B;  1GTW A;  1RF1 C;  3AEF C;  1FOS F;  3CD6 P;  3KXD A;  2W8Z A;  3RGU A;  5B5E E;  4UB6 H;  1JNM A;  4B86 A;  1L0N K;  1JY3 O;  1S5L X;  3MHV A;  4BWN A;  1YBK A;  4L73 A;  1EDL A;  3B8E B;  3C8V A;  5AW0 B;  3L72 G;  3CCU P;  1USE A;  2XU6 A;  2WZ7 A;  1BDD A;  1U7M A;  1GL2 A;  1KB9 D;  3FX0 A;  1Y47 A;  2PAJ A;  1JY2 O;  3JCU E;  3PH0 A;  1JEK A;  5GTH E;  4PD4 H;  2FYN B;  4HB1 A;  1L2P A;  1IFM A;  4U3F G;  3RK3 B;  2JWD A;  2O3J A;  1P84 H;  2FYU G;  4Y99 B;  5BU8 B;  1W2E A;  2V4H A;  3TDK A;  3VMA A;  3E1R A;  4I6M C;  1FZA A;  4IFF A;  1RHZ B;  4EDF A;  3L74 J;  2OGU A;  1DIP A;  1YIT P;  2N1T A;  5GTI H;  1SQP K;  2ZYA A;  1SQV K;  3LID A;  3FWL A;  4UB6 E;  3TGU J;  2J5U A;  5CCG A;  1S9K E;  3VOP A;  3AE1 C;  1SFC B;  1OXZ A;  1N86 A;  3IR9 A;  3CWB J;  3L35 A;  1ZXG A;  1FU1 A;  1EXI A;  2K37 A;  4TT3 H;  1PPJ D;  2I1K A;  4N6J A;  1ZR4 A;  2M5A B;  2I8D A;  4K35 A;  4L74 A;  4PD4 E;  1NTM E;  4UB8 H;  1BGY J;  3PTZ A;  1GW3 A;  4N78 E;  2Z4E A;  1P84 E;  1JY3 P;  1NTK E;  2R44 A;  3I55 P;  3RK2 D;  3MIW A;  1Y8A A;  2ZT9 D;  1SQV D;  4PV1 C;  1EXJ A;  1NTZ J;  1WT6 A;  1GU4 A;  2VRS A;  1J1E C;  1T3J A;  2QEX P;  2W6B A;  5GTI E;  2D2C B;  1DEB A;  2ZXE B;  1KYO I;  4OGQ B;  3H1I D;  4H0L C;  3N4X A;  1GZL A;  1PPJ G;  2N1T D;  1JY2 P;  1BE3 E;  1LGH B;  4I1L A;  3VN0 A;  1DH3 A;  2JDI H;  5CCG D;  1PV3 A;  3H1J D;  2GUV A;  3SSU A;  1NAF A;  3L36 A;  2R3C A;  2W90 A;  1IFD A;  3D6Z A;  1XTG B;  1KZU B;  1ZOY C;  2V7Q J;  2HFE D;  1R5S A;  2OYH B;  2OQQ A;  1SQV G;  2KB7 P;  4U3F J;  4UB8 E;  1EDI A;  1CI6 B;  1FZG A;  3CCR P;  3ABV C;  2P58 A;  3H1I G;  1RF0 C;  3Q3D A;  1YTZ T;  3RL0 C;  2ZVN B;  2E74 C;  4L75 A;  2IPP A;  1D7M A;  1K05 A;  3H1J G;  2HPC B;  2A06 E;  1E5W A;  2R32 A;  3CCJ P;  3KYQ A;  1T8Z A;  1NTK K;  2E5T A;  3D71 A;  3RBX A;  1GL2 B;  5EFW B;  1HWT C;  1G2C A;  3EQ2 A;  1N7S C;  4A7P A;  1RY3 A;  1LTS C;  2K3R A;  2W83 C;  3HE5 A;  1FC2 C;  1GD2 E;  1UII A;  4DJG A;  3S4R A;  4D6T J;  1AQT A;  4K3A A;  3GF3 A;  1R5L A;  1RE4 C;  2WPS A;  1YJ9 P;  2AXT H;  3L71 D;  3Q5R A;  3A3Y B;  1HBW A;  2N1T B;  3O6Q B;  1YI2 P;  1NTM D;  1L0L D;  3PRJ A;  5AVZ B;  3CCV P;  1PIX A;  5KAF H;  1SQB E;  1YQ3 C;  3A0H H;  2FYN C;  1P84 D;  1VQ9 P;  2O1J A;  4HYT B;  5AW6 B;  3RK3 C;  3AE5 C;  5KLV K;  1RH5 B;  2Q3E A;  1LJ2 A;  1KIL B;  1ZME C;  3S9O A;  2A45 G;  4C7R A;  5KJ7 C;  1GU5 A;  3M9Q A;  2KS1 A;  1XTC C;  2Q9I A;  3L71 G;  1VQ7 P;  1L4A A;  1SQV J;  1KB9 I;  1SQQ D;  2YMY A;  1M1K Q;  2BCC E;  1VQP P;  1FAV A;  3GG2 A;  2WSE J;  1NTM G;  1L0L G;  1SFC C;  2NPS B;  2AXT E;  5KTB A;  4AQR D;  3H1I J;  1Q86 Q;  1LTJ A;  3T97 A;  2KUB A;  1U57 A;  1YIJ P;  4LLH A;  4RO0 A;  3LW5 H;  4EIJ A;  1GW4 A;  5KAF E;  3H1J J;  3A0H E;  1H8A A;  3PP5 A;  1KV4 A;  2ZJS E;  3E7K A;  2Z5I A;  3L75 E;  3B5N A;  1M1J A;  4ASV A;  2Z5H A;  3U1A A;  1SQQ G;  1WRG A;  3FGA D;  1LTA C;  2QM8 A;  3CME P;  3JSV C;  3SFE C;  1LNQ A;  2D2C C;  2JJL A;  1EZV D;  1SQB K;  4OGQ C;  2QRX A;  3FWN A;  2OYI A;  3AE4 C;  1L4A D;  1VQ4 P;  1GDT A;  1M8O B;  2J59 M;  5E79 E;  1VQL P;  3QH9 A;  4R4M A;  1RE3 C;  3CXH H;  1E79 H;  1EDJ A;  2RN0 A;  2ZAE B;  5AVT B;  2OYH C;  4C46 A;  3BVH A;  4WY4 A;  2YKQ A;  4IL6 E;  5APS A;  2AEJ A;  2WT7 B;  3RL0 g;  1CZQ A;  1LT1 A;  2KZJ A;  3HRN A;  1EZV G;  4GOD A;  1GK4 A;  1PGQ A;  1TU3 F;  3L37 A;  4YXD C;  1AVO A;  3CC4 P;  4KHX A;  5AW3 B;  1HJB A;  4NPE A;  2QM7 A;  3AE6 C;  3L73 E;  3L71 J;  2H43 A;  2K1A A;  1OFC X;  4GIF A;  4HH2 A;  2W27 A;  1NU1 D;  1IFP A;  2B88 A;  2YNY A;  1RQV A;  1KN7 A;  1NTM J;  1L0L J; 
#chains in the Genus database with same CATH homology
 1P84 I;  3H1I J;  3L70 J;  1L0N J;  1BCC J;  3L72 J;  1SQX J;  4U3F J;  3TGU J;  1NTK J;  1SQB J;  1NTZ J;  1BE3 J;  3H1K J;  1SQV J;  3L71 J;  1SQP J;  3L75 J;  5KLV J;  1KB9 I;  2FYU J;  3H1H J;  3BCC J;  3L73 J;  1SQQ J;  4PD4 I;  2IBZ I;  3CXH I;  3H1J J;  3H1L J;  1BGY J;  1NU1 J;  4D6T J;  1EZV I;  2BCC J;  1KYO I;  3CWB J;  1NTM J;  1L0L J;  3CX5 I;  3L74 J;  1PP9 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...