1SQQJ

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
59
structure length
59
Chain Sequence
PTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 18
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1sqqJ00
1P84I 3H1IJ 1L0LJ 1SQPJ 3L70J 3TGUJ 3H1KJ 1BGYJ 3L74J 1L0NJ 1SQBJ 3L75J 3BCCJ 4D6TJ 3L71J 1EZVI 1NTMJ 3L72J 3CXHI 1SQVJ 3H1JJ 2FYUJ 3H1LJ 3CX5I 4PD4I 1SQXJ 2BCCJ 1NTZJ 1KYOI 5KLVJ 3L73J 3H1HJ 1SQQJ 2IBZI 1KB9I 1BE3J 1NU1J 1NTKJ 3CWBJ 4U3FJ 1BCCJ 1PP9J
chains in the Genus database with same CATH superfamily
4DJGA 1MKMA 2QEXP 5CJ4A 5KJ7C 2WQYC 1S9KD 2NPSA 3L74G 3I5CA 4N6JA 2B87A 3VMYA 2Y0EA 3VOPA 3B71A 2M8RA 1YQ4C 3IN6A 4L73A 1EDLA 2B87B 1YBKA 1YTZT 1KQLA 1PGOA 2YMYA 1CI6A 3LW5H 2KLVA 4DT0A 4WY4C 1PPJD 3V6IA 1NTZE 3P8MC 1ZLLA 1LT9A 1CI6B 1RE4A 1S3JA 5E79E 3K5BA 2JEEA 1NTZG 1FZCA 3D71A 3RK3C 4RKUJ 1LT9B 2IBZD 2YKOA 1CSBA 5AVRB 4DOJA 1JTHA 2KZJA 3WUVA 1AVOA 2ZT9D 1FZCB 1QVGO 4JQ0D 2QG4A 2G3AA 1JY2N 3HE4A 3H6PA 1JTHB 3WU2E 4ZNCA 4L76A 2Z4EA 5GTHE 2FBWC 2JP3A 3AEGC 3USSA 1SQQK 1DD3A 3HE4B 1K05A 3GMAA 3FWLA 1N7SD 2W6AA 2O1KA 2Y9YA 1BSNA 1FOSE 2GM4A 3L70J 5KLVK 4I7ZC 5CCGC 2W6BA 4PD4H 1KTMA 1J1DC 2AEMA 1SFCD 1YI2P 3M0DC 1EC5A 1KFMA 2QJKB 3MUDC 1H88A 2XDJA 4I1LA 1VDFA 2XU6A 1HBWA 3U1CA 3G9RA 4H0LB 2AXCA 2R44A 1DEEG 3HE5B 5AVXB 2M5AA 2ZVOB 5E79H 1FC2C 4HKZH 2MKVA 5H2FE 3RK3E 1BGYJ 1TU3F 3GHGC 3V2NA 4R4LA 2M5AB 3AE6C 1PP9E 1QVFO 4UB6E 4B86A 2N1TD 1K04A 2OYHA 3V4WA 5BU8B 3OA7A 1PP9G 4OGQB 4QMAA 3MHVA 2XNXA 1NVOA 3C9IA 1S72P 2UWJE 3AEBC 3A2AA 2W90A 3V2PA 2K9YA 3FX0A 3HD7B 3BASA 1OMIA 1N86A 4JYBA 1BGYD 2OTKE 4WVZA 2WSFJ 4AUWA 2RH0A 3L70E 2QJPB 1GW3A 3W68A 3ZDMA 3H1HJ 1VQ9P 1SQQJ 5B5EH 2ZVNB 2JWAA 1QEXA 2B9BA 3KZIH 3L70G 1RF0A 4OVNF 1SQBD 1DEBA 2WSSH 1NH4A 1LT9C 4GT1A 4NPDA 2XKMA 5KLVJ 2E75B 1G2CA 3H25A 3CWBJ 5L8RJ 3TK1A 4I2LC 4HJGH 1VF5C 1URQD 4H13D 1G2CB 2KXPB 2NPSD 1NU1K 5H2FH 3CCMP 3RL0B 3AE2C 2FYNB 4XA4A 1SQQD 3L75E 1AQTA 2B89A 5AVYB 1H0TA 4UB6H 1SQVE 1R5SA 1RQUA 2H89C 3R2PA 3I56P 3RK2B 3L71D 1IK9A 4DZOA 2W83C 3L75G 1T3UA 2PAJA 2XV5A 1H0TB 5AVSB 5KLVD 1HJBA 1BCCD 3CWBD 5KJ7A 3BATA 2P10A 3M9BA 1LTSC 2WSEJ 4RJTA 3NFQA 1RE3C 2H7HA 2QA4P 4Y28J 2BCCD 2FY8A 3H1IE 1OWAA 3U59A 2BEQD 2QJKC 2HODB 4CPGA 2IX7C 2BEZF 1M56D 3CX5E 3H1HE 3H1IG 1LWUC 3MIWA 2KUBA 4H0LC 3KDPB 4IOIH 3SWKA 1UIXA 3PRJA 3H1HG 3OAKA 1EZVE 2E76C 3EQ2A 1EDJA 1ZRTD 2QSIA 3L72J 1W2BO 1KMIZ 1J2JB 1EZVG 3BRTB 3FXDA 2NRGA 4L75A 4OGQC 5APUA 3SSUA 3VP8A 3A0HE 1YTZI 3RK3B 1RHZB 3RGUA 2E74D 2FYZA 3HD7C 1KC8Q 2KIKA 2ZYAA 1Y47A 5APQA 2WWWA 5APTA 1NU1J 1T2KC 1A02F 1IFDA 1FZEA 3JCUE 2HFED 5KKZB 2QJPC 4EDFA 3WUUA 3L72D 1GU4A 1IO4A 1S4XA 3Q1MA 1HVVA 3L73D 1OFCX 2R32A 5AW8B 2D2CB 1MV8A 3B4SA 5APXA 4OH8B 3CX5H 3CI9A 1K8AQ 2LKMA 3AE1C 3FXEA 2WSCH 3M0DA 2IFMA 2Q9IA 1SS1A 3EFGA 1JNMA 1NTKD 3MUDA 1NU1D 5C39A 5AVQB 4N78D 1KFNA 3N7NA 3H1JE 2KB7P 1SQXE 2H88C 1A02J 4PV1D 1NOHA 1LTIC 3L74D 2FYNC 4D6TJ 3MTUE 3KPEA 4LC1A 3S1KA 3H1JG 1W5CE 1SQXG 3LIDA 4JYCA 2FYUE 1SQPD 1AV1A 5AW0B 2AXTH 2ZAEB 5KTBA 3G4SP 5AW6B 3A0HH 1S5LX 3ABVC 4H44D 4XFJA 4TLFA 2FYUG 3TF5A 1IFMA 1GL2A 1ZV8A 3VMXA 2KYVA 3M06A 1X79B 1YJWP 3D70A 4D6TD 1M1JC 1XTGB 1H89A 3JCUH 1GL2B 3CCLP 3V2QA 2Q6QA 2LXBA 2IBZI 2YMKA 1AQ5A 1FZBA 2WSEH 3CD6P 3RL0D 4PD4E 3A0BE 3VYIA 4BWNA 1JCCA 1KB9E 1DD4A 2QIWA 2K88A 1VQ4P 5AW9B 2PP6A 4Y99B 2PRRA 1L0NE 4ZKUA 2M3BA 1YITP 3IAOA 2I1JA 1L0NG 4IFDK 2P67A 5AVZB 3VTPC 1S9KE 1E79H 1SQBK 2V7QJ 1KD1Q 3P8CE 1SLQA 4ZKPA 1NTMD 2YXQB 4K3AA 5K5GB 2GA1A 4IFFA 1VF5B 2NZ2A 5BVZA 2WMMA 5KKZC 3EFFK 4U3FJ 1M1KQ 1HH0A 1LTAC 3B5NA 1ZP0C 1PPJE 1GD2E 1HGVA 2W8ZA 2ZXXA 2Y0CA 3S4RA 1RQVA 4WY4D 2D2CC 3SFDC 3B5NB 1YJ9P 1RE3A 1PPJG 3VP9A 2ZYDA 3CPWO 2IBZE 1OZHA 1N7LA 4NPFX 5B5EE 2KOGA 1IC2A 2YKPA 3A0BH 1IK7A 2N1TC 1KYOI 2R5DA 4EYYQ 3KZIE 1KB9H 1EDIA 1KN7A 2QRXA 1T3JA 3L35A 4U3FD 1K9MQ 1LWUA 2IBZG 1RH5B 3CL3D 3HE5A 1P84D 1AA0A 4EIJA 3E1IA 3QWOC 5DJTB 2KSJA 3NTNA 3IF4A 3QH9A 4EOTA 1LWUB 3L4FA 3N4XA 1L0LK 3A3YB 5KAIH 2R5BA 2J5UA 3AE4C 1FBMA 2Y9ZA 1HWTC 2A06D 3TGUJ 3P32A 1OW8A 2E76B 2QE7H 1X0TA 1L4AA 1PIXA 4ASWA 4IFMA 5CHXA 2L91A 1KYOD 1VPCA 2QJYC 4EI2A 4ASVA 2FFDA 1GL2C 1L4AB 5CCGD 3HD7A 1SQBJ 2Q3EA 1IFPA 1X22A 4UB8E 5AVWB 4XE5B 3V5BA 1X9VA 2XZRA 1Z56A 1AFOA 2FFDB 4KHXA 3Q3DA 1FZGA 3SWFA 1GTWA 4JBZA 3TGUD 3RL0g 3WMM0 1JOCA 2IZ0A 4Y99C 1LNQA 3CCJP 2I8DA 3H1LD 2IZ1A 3CXHI 3CLQA 2PFXA 1BE3J 2M3EA 2OYIC 2V4HA 2RN0A 1MUUA 2M0BA 2KNCA 3H1KD 3MGNA 3S9OA 5AVUB 1ZMEC 1Q2NA 2ZFCA 2J59M 2CPBA 1S5LH 1SQVD 3L71J 4PJ0E 1FJPA 5CBNA 1PZQA 2KNCB 3GW6A 1BCCJ 2SPZA 1HTLC 2FKWB 1LTGC 1Y8AA 3L37A 3TSIA 5M1BA 1HUCA 5GTIE 3I55P 3KXDA 1NTKK 1FZAA 3CXHD 2BCCJ 2R3SA 1BGYE 1BE3D 2A45I 3E7KA 3D6YA 1GK4A 1L0LJ 3CMEP 1USEA 3TYYA 1WMKA 2YKQA 1PGJA 1BGYG 2IYPA 3B5NC 1SQPK 1SQBE 3KYQA 3V2RA 2FXPA 4UB8H 1VQKP 1VQ6P 4TT3H 1EXIA 2WZ7A 2HODA 1M1JA 2Q3IA 2RKLA 1NKZB 1PFIA 1SQBG 2POHA 1KILC 1EZVD 1M57D 1LTBC 2CPSA 3WUTA 1M1JB 1Q7YQ 2HYNA 1QL1A 1NJIQ 1L0LD 1VF5D 1SQQE 3RBXA 3BCCJ 3BRVB 2Q7CA 2E74C 1PGPA 5CCHC 2E43A 1QGKB 2ZT9B 3T97A 1NGMB 4PJ0H 3LW5J 1SQQG 2KK7A 2YIUB 1NYHA 2KZIA 1IFNA 1USDA 1LGHB 5DJUB 5KLVE 1PGQA 3CWBE 1JO5A 3T97B 1GW4A 3L73J 5KLVG 4GIFA 5GTIH 3CC4P 2AXTE 1L4AC 1IZNB 4Z1MH 3VN0A 2BCCE 3CCEP 3CWBG 2L5GB 1N7SB 1KZUB 2WPQA 1FS0E 3BCCD 2FFDC 2RMZA 3VMZA 2YNYA 2BCCG 1JY3O 4MN4C 1NTKJ 3HUSA 2A45G 3G6EP 1NTMK 1IJDB 4K35A 4H0LD 3OW2O 3SWYA 1CW5A 1PV3A 1VL2A 3L74J 3GF7A 3HUSB 2E5YA 2E5TA 1Q82Q 1KILE 2B88A 2IDBA 2E76D 1ZOYC 1H8AA 1SQPJ 3NXSA 3TDKA 1Q90D 2K3RA 3AEFC 2AEFA 2WSFH 2ITAA 2N1TA 3CXHH 3M91A 2C9LY 1JM0A 1OVUA 3AE5C 1GMJA 4OGQD 1M90Q 3JC22 3AEAC 5KAFE 2JKVA 2N1TB 5AVTB 1N73A 2HPCA 3AEDC 1S2EA 4R4MA 1YIJP 2P58A 3HD7D 2KS1B 1T2KD 3O6QB 1N73B 2HPCB 3L72E 1OVRA 1G1IA 1M8OB 3II6A 2C0WA 2ZYGA 3G3ZA 2OGUA 1DX7A 2WT7A 3CCVP 1HGZA 3L72G 4PD4D 1AJYA 3R4YA 2A45H 2Z5HA 2W27A 1EXJA 2O01J 2WT7B 2HG5D 5EFWB 2QJYB 2E75D 1NTKE 1NU1E 4L74A 1MFZA 4N78E 1NWQA 2QVAA 4GDOA 4W7ZA 2LXCB 1NTZD 4GKGA 3H32A 3AE8C 2N9YB 1KQGB 4KT0J 4I6MC 1NTKG 1JY2P 1NU1G 1ZN5A 4OWFA 1URQA 1VQ7P 3H32B 2ZT9C 1NTMJ 1OIPA 1SQPE 1M7LA 3P8CD 2YIUC 4JF7A 4W80A 1JMMA 2OYIA 1URQB 3CC7P 4H13B 1LTTC 2KP8A 3RK2D 2LR2A 3LIEA 1NO4A 2C0XA 2NPSB 2JDIH 3Q5PA 4IL6X 1SQPG 4YXDC 2HR3A 4WBAA 2OYIB 1U57A 5KAFH 1U7MA 5KAIE 2Z5IA 1JUNA 1MZ9A 5AW1B 1J1EB 3E1RA 5AW2B 1N7SC 1FDOA 4D6TE 2KLUA 1ZXGA 3PH0A 2O01N 1SQVK 5KJ7D 1EDKA 1FDMA 3IFMA 4GOEA 2BASA 2FXOA 2WVRA 2P2UA 3CMAP 3UIAA 4D6TG 1EQ7A 1OVVA 3HRNA 1KORA 1KQFB 2WPVB 1SFCC 1OXZA 3VMAA 1N2DC 1PP9J 1P84I 4BXLA 1KV4A 5APVA 5BU5A 3HUSC 3D6ZA 3AEEC 1PL5A 2IFNA 1BDCA 1SVFA 3C8VA 4JPZB 1VQNP 4M3LA 2CK3H 3AE3C 1MFTA 2FXMA 1KILA 1JMBA 3Q5SA 1OW7A 1G1JA 3RK3D 5CBOA 1Q81Q 1KILB 1NTME 1LJ2A 4ZMDA 3M9HA 1FJKA 3EWKA 5AW7B 1PP9D 2Y0DA 1S5LE 2O1JA 3A7OA 1RY3A 3PTZA 5CCHA 4HYTB 1FU1A 1NTMG 1N73C 4AQRD 2ZJSE 5AVVB 3FGAD 5TISE 1N8RQ 2OTLP 2GUVA 2H43A 2E74B 3IR9A 1JB0J 3PLNA 4WB4A 2JWDA 1ZW0A 1JY3P 3MZWB 4YPCA 1DH3A 2J58A 3H1LJ 3F89A 2K9JA 1VQ8P 2D2CD 4LLHA 1T6AA 2DW3A 3M0AA 4C7NA 3L70D 5KLIC 3H1KJ 2K9JB 3L75J 4C7RA 4U3FE 3ITKA 1SQVJ 5APSA 1R8EA 1P84E 1NAYA 3HTKA 1K73Q 4C7NB 4IL6E 2O01H 1ZR4A 1YHQP 1HJ0A 4BRYA 1OX3A 4U3FG 2OYOA 5CMZA 2YO2A 3FWNA 3WU2H 1NHLA 3NMDA 1FZFA 2OYHB 5GTHH 1URQC 3HTKB 4H13C 3M9QA 2P7JA 2A06E 4PV1B 2NPSC 4BRYB 5CJ0A 3F5HA 1NKNA 2O3JA 2QM8A 3A5TA 1JEKA 3AECC 3H1IJ 1SQXK 2A06G 3AE7C 1KYOE 1J1EC 4DCKA 3L75D 1VQMP 3CX5I 1JY2O 1LTJA 2KSEA 1S1CX 1JY3N 3AE9C 3CCRP 2WSCJ 4H44B 2OTJP 1GL2D 2OARA 5TISH 2FYUK 1YQ3C 1LTJB 3SFEC 1EZVI 1RE4C 3GF3A 1YYCA 3TGUE 2IPPA 2V7QH 1IFJA 2WTYA 2QM7A 3H1LE 4HB1A 1FZCC 4WWIA 3H1ID 1GU5A 1LT1A 5AW3B 3B8EB 3TGUG 2YXRB 3JSVC 1XTCC 1VQ5P 3H1LG 3H1KE 3CX5D 3H1HD 1OW6A 2R3CA 2MJZA 3PP5A 1VQPP 2I1KA 4GOFA 2GUSA 1P84H 1R5LA 1IFIA 4IL6H 3RBZA 3H1KG 3PJSK 1RF1A 2E42A 1SQVG 1L0NK 2KI7B 1U7JA 4O9BA 3CXHE 4N3YB 1RF1B 3MP7B 1NTZK 1WT6A 4W7YA 1BSHA 3PHLA 4AYCA 1BE3E 3GG2A 3Q2YA 1D7MA 1KYOH 2N9BA 3P7KA 1QL2A 3L71E 2OQQA 1BE3G 1L2PA 2PGDA 1QLED 1BCCE 1LP1A 1N7SA 3B5ND 3W67A 3H1JJ 3KQGA 3L71G 1SQXJ 4WY4A 5B66E 1VQOP 2HLOA 5APYA 4YXWH 3L36A 1BCCG 1FDIA 1LP1B 1KQSO 4WY4B 2ZXEB 1KILD 1YJNP 5AW4B 3O8ZA 3Q5RA 3C1LA 2FYUJ 1L0LE 1DIPA 4KJMA 1SFCA 2JO1A 5AW5B 2IYOA 1WRGA 2H8PD 3CCSP 3OJAB 2OYHC 1W2EA 4U7JA 4YTPC 1VQLP 4PV1C 1L0LG 1SFCB 3CCUP 2JR8A 2K37A 1Q86Q 3H1JD 1SQXD 5CCHD 3BVHA 1UIIA 1AVYA 1ZRTE 4C46A 1GDTA 2WPRA 2C9NY 2XNDH 4GODA 1CZQA 4A7PA 1FAVA 1JCDA 2FYUD 4H44C 4PD4I 4LGDE 3TNUA 1L4AD 3BCCE 1KB9I 1ZR2A 1BDDA 1LTJC 1Y9BA 2JJLA 2AEJA 2KS1A 1T8ZA 1FE6A 2YO3A 5CCGA 2K1AA 4RESB 3O6QA 3KHUA 1L0NJ 2E75C 2W6JH 1SP4A 3TNUB 2WITA 3BCCG 1RF0C 2G8YA 2VRSA 1QX8A 1E5WA 1NTZJ 4I7ZB 3G71P 1HF9A 4HH2A 1GK6A 2P1JA 1J1DB 5B66H 3U1AA 3L73E 3RL0C 3GLMA 1X8YA 5APWA 1FOSF 3MD0A 3L73G 3CC2P 3RK2C 4NPEA 1KB9D 3CCQP 4RO0A 3GHGA 2Q1KA 1NAFA 1L0ND 5KLIB 1GZLA 3GHGB 5TJHA 3L74E 1RF1C 2Q5UA 3V4QA 2WPSA
chains in the Genus database with same CATH topology
1P84I 3H1IJ 1L0LJ 1SQPJ 3L70J 3TGUJ 3H1KJ 1BGYJ 3L74J 1L0NJ 1SQBJ 3L75J 3BCCJ 4D6TJ 3L71J 1EZVI 1NTMJ 3L72J 3CXHI 1SQVJ 3H1JJ 2FYUJ 3H1LJ 3CX5I 4PD4I 1SQXJ 2BCCJ 1NTZJ 1KYOI 5KLVJ 3L73J 3H1HJ 1SQQJ 2IBZI 1KB9I 1BE3J 1NU1J 1NTKJ 3CWBJ 4U3FJ 1BCCJ 1PP9J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P84 I;  3H1I J;  1L0L J;  1SQP J;  3L70 J;  3TGU J;  3H1K J;  1BGY J;  3L74 J;  1L0N J;  1SQB J;  3L75 J;  3BCC J;  4D6T J;  3L71 J;  1EZV I;  1NTM J;  3L72 J;  3CXH I;  1SQV J;  3H1J J;  2FYU J;  3H1L J;  3CX5 I;  4PD4 I;  1SQX J;  2BCC J;  1NTZ J;  1KYO I;  5KLV J;  3L73 J;  3H1H J;  1SQQ J;  2IBZ I;  1KB9 I;  1BE3 J;  1NU1 J;  1NTK J;  3CWB J;  4U3F J;  1BCC J;  1PP9 J; 
#chains in the Genus database with same CATH topology
 4DJG A;  1MKM A;  2QEX P;  5CJ4 A;  5KJ7 C;  2WQY C;  1S9K D;  2NPS A;  3L74 G;  3I5C A;  4N6J A;  2B87 A;  3VMY A;  2Y0E A;  3VOP A;  3B71 A;  2M8R A;  1YQ4 C;  3IN6 A;  4L73 A;  1EDL A;  2B87 B;  1YBK A;  1YTZ T;  1KQL A;  1PGO A;  2YMY A;  1CI6 A;  3LW5 H;  2KLV A;  4DT0 A;  4WY4 C;  1PPJ D;  3V6I A;  1NTZ E;  3P8M C;  1ZLL A;  1LT9 A;  1CI6 B;  1RE4 A;  1S3J A;  5E79 E;  3K5B A;  2JEE A;  1NTZ G;  1FZC A;  3D71 A;  3RK3 C;  4RKU J;  1LT9 B;  2IBZ D;  2YKO A;  1CSB A;  5AVR B;  4DOJ A;  1JTH A;  2KZJ A;  3WUV A;  1AVO A;  2ZT9 D;  1FZC B;  1QVG O;  4JQ0 D;  2QG4 A;  2G3A A;  1JY2 N;  3HE4 A;  3H6P A;  1JTH B;  3WU2 E;  4ZNC A;  4L76 A;  2Z4E A;  5GTH E;  2FBW C;  2JP3 A;  3AEG C;  3USS A;  1SQQ K;  1DD3 A;  3HE4 B;  1K05 A;  3GMA A;  3FWL A;  1N7S D;  2W6A A;  2O1K A;  2Y9Y A;  1BSN A;  1FOS E;  2GM4 A;  3L70 J;  5KLV K;  4I7Z C;  5CCG C;  2W6B A;  4PD4 H;  1KTM A;  1J1D C;  2AEM A;  1SFC D;  1YI2 P;  3M0D C;  1EC5 A;  1KFM A;  2QJK B;  3MUD C;  1H88 A;  2XDJ A;  4I1L A;  1VDF A;  2XU6 A;  1HBW A;  3U1C A;  3G9R A;  4H0L B;  2AXC A;  2R44 A;  1DEE G;  3HE5 B;  5AVX B;  2M5A A;  2ZVO B;  5E79 H;  1FC2 C;  4HKZ H;  2MKV A;  5H2F E;  3RK3 E;  1BGY J;  1TU3 F;  3GHG C;  3V2N A;  4R4L A;  2M5A B;  3AE6 C;  1PP9 E;  1QVF O;  4UB6 E;  4B86 A;  2N1T D;  1K04 A;  2OYH A;  3V4W A;  5BU8 B;  3OA7 A;  1PP9 G;  4OGQ B;  4QMA A;  3MHV A;  2XNX A;  1NVO A;  3C9I A;  1S72 P;  2UWJ E;  3AEB C;  3A2A A;  2W90 A;  3V2P A;  2K9Y A;  3FX0 A;  3HD7 B;  3BAS A;  1OMI A;  1N86 A;  4JYB A;  1BGY D;  2OTK E;  4WVZ A;  2WSF J;  4AUW A;  2RH0 A;  3L70 E;  2QJP B;  1GW3 A;  3W68 A;  3ZDM A;  3H1H J;  1VQ9 P;  1SQQ J;  5B5E H;  2ZVN B;  2JWA A;  1QEX A;  2B9B A;  3KZI H;  3L70 G;  1RF0 A;  4OVN F;  1SQB D;  1DEB A;  2WSS H;  1NH4 A;  1LT9 C;  4GT1 A;  4NPD A;  2XKM A;  5KLV J;  2E75 B;  1G2C A;  3H25 A;  3CWB J;  5L8R J;  3TK1 A;  4I2L C;  4HJG H;  1VF5 C;  1URQ D;  4H13 D;  1G2C B;  2KXP B;  2NPS D;  1NU1 K;  5H2F H;  3CCM P;  3RL0 B;  3AE2 C;  2FYN B;  4XA4 A;  1SQQ D;  3L75 E;  1AQT A;  2B89 A;  5AVY B;  1H0T A;  4UB6 H;  1SQV E;  1R5S A;  1RQU A;  2H89 C;  3R2P A;  3I56 P;  3RK2 B;  3L71 D;  1IK9 A;  4DZO A;  2W83 C;  3L75 G;  1T3U A;  2PAJ A;  2XV5 A;  1H0T B;  5AVS B;  5KLV D;  1HJB A;  1BCC D;  3CWB D;  5KJ7 A;  3BAT A;  2P10 A;  3M9B A;  1LTS C;  2WSE J;  4RJT A;  3NFQ A;  1RE3 C;  2H7H A;  2QA4 P;  4Y28 J;  2BCC D;  2FY8 A;  3H1I E;  1OWA A;  3U59 A;  2BEQ D;  2QJK C;  2HOD B;  4CPG A;  2IX7 C;  2BEZ F;  1M56 D;  3CX5 E;  3H1H E;  3H1I G;  1LWU C;  3MIW A;  2KUB A;  4H0L C;  3KDP B;  4IOI H;  3SWK A;  1UIX A;  3PRJ A;  3H1H G;  3OAK A;  1EZV E;  2E76 C;  3EQ2 A;  1EDJ A;  1ZRT D;  2QSI A;  3L72 J;  1W2B O;  1KMI Z;  1J2J B;  1EZV G;  3BRT B;  3FXD A;  2NRG A;  4L75 A;  4OGQ C;  5APU A;  3SSU A;  3VP8 A;  3A0H E;  1YTZ I;  3RK3 B;  1RHZ B;  3RGU A;  2E74 D;  2FYZ A;  3HD7 C;  1KC8 Q;  2KIK A;  2ZYA A;  1Y47 A;  5APQ A;  2WWW A;  5APT A;  1NU1 J;  1T2K C;  1A02 F;  1IFD A;  1FZE A;  3JCU E;  2HFE D;  5KKZ B;  2QJP C;  4EDF A;  3WUU A;  3L72 D;  1GU4 A;  1IO4 A;  1S4X A;  3Q1M A;  1HVV A;  3L73 D;  1OFC X;  2R32 A;  5AW8 B;  2D2C B;  1MV8 A;  3B4S A;  5APX A;  4OH8 B;  3CX5 H;  3CI9 A;  1K8A Q;  2LKM A;  3AE1 C;  3FXE A;  2WSC H;  3M0D A;  2IFM A;  2Q9I A;  1SS1 A;  3EFG A;  1JNM A;  1NTK D;  3MUD A;  1NU1 D;  5C39 A;  5AVQ B;  4N78 D;  1KFN A;  3N7N A;  3H1J E;  2KB7 P;  1SQX E;  2H88 C;  1A02 J;  4PV1 D;  1NOH A;  1LTI C;  3L74 D;  2FYN C;  4D6T J;  3MTU E;  3KPE A;  4LC1 A;  3S1K A;  3H1J G;  1W5C E;  1SQX G;  3LID A;  4JYC A;  2FYU E;  1SQP D;  1AV1 A;  5AW0 B;  2AXT H;  2ZAE B;  5KTB A;  3G4S P;  5AW6 B;  3A0H H;  1S5L X;  3ABV C;  4H44 D;  4XFJ A;  4TLF A;  2FYU G;  3TF5 A;  1IFM A;  1GL2 A;  1ZV8 A;  3VMX A;  2KYV A;  3M06 A;  1X79 B;  1YJW P;  3D70 A;  4D6T D;  1M1J C;  1XTG B;  1H89 A;  3JCU H;  1GL2 B;  3CCL P;  3V2Q A;  2Q6Q A;  2LXB A;  2IBZ I;  2YMK A;  1AQ5 A;  1FZB A;  2WSE H;  3CD6 P;  3RL0 D;  4PD4 E;  3A0B E;  3VYI A;  4BWN A;  1JCC A;  1KB9 E;  1DD4 A;  2QIW A;  2K88 A;  1VQ4 P;  5AW9 B;  2PP6 A;  4Y99 B;  2PRR A;  1L0N E;  4ZKU A;  2M3B A;  1YIT P;  3IAO A;  2I1J A;  1L0N G;  4IFD K;  2P67 A;  5AVZ B;  3VTP C;  1S9K E;  1E79 H;  1SQB K;  2V7Q J;  1KD1 Q;  3P8C E;  1SLQ A;  4ZKP A;  1NTM D;  2YXQ B;  4K3A A;  5K5G B;  2GA1 A;  4IFF A;  1VF5 B;  2NZ2 A;  5BVZ A;  2WMM A;  5KKZ C;  3EFF K;  4U3F J;  1M1K Q;  1HH0 A;  1LTA C;  3B5N A;  1ZP0 C;  1PPJ E;  1GD2 E;  1HGV A;  2W8Z A;  2ZXX A;  2Y0C A;  3S4R A;  1RQV A;  4WY4 D;  2D2C C;  3SFD C;  3B5N B;  1YJ9 P;  1RE3 A;  1PPJ G;  3VP9 A;  2ZYD A;  3CPW O;  2IBZ E;  1OZH A;  1N7L A;  4NPF X;  5B5E E;  2KOG A;  1IC2 A;  2YKP A;  3A0B H;  1IK7 A;  2N1T C;  1KYO I;  2R5D A;  4EYY Q;  3KZI E;  1KB9 H;  1EDI A;  1KN7 A;  2QRX A;  1T3J A;  3L35 A;  4U3F D;  1K9M Q;  1LWU A;  2IBZ G;  1RH5 B;  3CL3 D;  3HE5 A;  1P84 D;  1AA0 A;  4EIJ A;  3E1I A;  3QWO C;  5DJT B;  2KSJ A;  3NTN A;  3IF4 A;  3QH9 A;  4EOT A;  1LWU B;  3L4F A;  3N4X A;  1L0L K;  3A3Y B;  5KAI H;  2R5B A;  2J5U A;  3AE4 C;  1FBM A;  2Y9Z A;  1HWT C;  2A06 D;  3TGU J;  3P32 A;  1OW8 A;  2E76 B;  2QE7 H;  1X0T A;  1L4A A;  1PIX A;  4ASW A;  4IFM A;  5CHX A;  2L91 A;  1KYO D;  1VPC A;  2QJY C;  4EI2 A;  4ASV A;  2FFD A;  1GL2 C;  1L4A B;  5CCG D;  3HD7 A;  1SQB J;  2Q3E A;  1IFP A;  1X22 A;  4UB8 E;  5AVW B;  4XE5 B;  3V5B A;  1X9V A;  2XZR A;  1Z56 A;  1AFO A;  2FFD B;  4KHX A;  3Q3D A;  1FZG A;  3SWF A;  1GTW A;  4JBZ A;  3TGU D;  3RL0 g;  3WMM 0;  1JOC A;  2IZ0 A;  4Y99 C;  1LNQ A;  3CCJ P;  2I8D A;  3H1L D;  2IZ1 A;  3CXH I;  3CLQ A;  2PFX A;  1BE3 J;  2M3E A;  2OYI C;  2V4H A;  2RN0 A;  1MUU A;  2M0B A;  2KNC A;  3H1K D;  3MGN A;  3S9O A;  5AVU B;  1ZME C;  1Q2N A;  2ZFC A;  2J59 M;  2CPB A;  1S5L H;  1SQV D;  3L71 J;  4PJ0 E;  1FJP A;  5CBN A;  1PZQ A;  2KNC B;  3GW6 A;  1BCC J;  2SPZ A;  1HTL C;  2FKW B;  1LTG C;  1Y8A A;  3L37 A;  3TSI A;  5M1B A;  1HUC A;  5GTI E;  3I55 P;  3KXD A;  1NTK K;  1FZA A;  3CXH D;  2BCC J;  2R3S A;  1BGY E;  1BE3 D;  2A45 I;  3E7K A;  3D6Y A;  1GK4 A;  1L0L J;  3CME P;  1USE A;  3TYY A;  1WMK A;  2YKQ A;  1PGJ A;  1BGY G;  2IYP A;  3B5N C;  1SQP K;  1SQB E;  3KYQ A;  3V2R A;  2FXP A;  4UB8 H;  1VQK P;  1VQ6 P;  4TT3 H;  1EXI A;  2WZ7 A;  2HOD A;  1M1J A;  2Q3I A;  2RKL A;  1NKZ B;  1PFI A;  1SQB G;  2POH A;  1KIL C;  1EZV D;  1M57 D;  1LTB C;  2CPS A;  3WUT A;  1M1J B;  1Q7Y Q;  2HYN A;  1QL1 A;  1NJI Q;  1L0L D;  1VF5 D;  1SQQ E;  3RBX A;  3BCC J;  3BRV B;  2Q7C A;  2E74 C;  1PGP A;  5CCH C;  2E43 A;  1QGK B;  2ZT9 B;  3T97 A;  1NGM B;  4PJ0 H;  3LW5 J;  1SQQ G;  2KK7 A;  2YIU B;  1NYH A;  2KZI A;  1IFN A;  1USD A;  1LGH B;  5DJU B;  5KLV E;  1PGQ A;  3CWB E;  1JO5 A;  3T97 B;  1GW4 A;  3L73 J;  5KLV G;  4GIF A;  5GTI H;  3CC4 P;  2AXT E;  1L4A C;  1IZN B;  4Z1M H;  3VN0 A;  2BCC E;  3CCE P;  3CWB G;  2L5G B;  1N7S B;  1KZU B;  2WPQ A;  1FS0 E;  3BCC D;  2FFD C;  2RMZ A;  3VMZ A;  2YNY A;  2BCC G;  1JY3 O;  4MN4 C;  1NTK J;  3HUS A;  2A45 G;  3G6E P;  1NTM K;  1IJD B;  4K35 A;  4H0L D;  3OW2 O;  3SWY A;  1CW5 A;  1PV3 A;  1VL2 A;  3L74 J;  3GF7 A;  3HUS B;  2E5Y A;  2E5T A;  1Q82 Q;  1KIL E;  2B88 A;  2IDB A;  2E76 D;  1ZOY C;  1H8A A;  1SQP J;  3NXS A;  3TDK A;  1Q90 D;  2K3R A;  3AEF C;  2AEF A;  2WSF H;  2ITA A;  2N1T A;  3CXH H;  3M91 A;  2C9L Y;  1JM0 A;  1OVU A;  3AE5 C;  1GMJ A;  4OGQ D;  1M90 Q;  3JC2 2;  3AEA C;  5KAF E;  2JKV A;  2N1T B;  5AVT B;  1N73 A;  2HPC A;  3AED C;  1S2E A;  4R4M A;  1YIJ P;  2P58 A;  3HD7 D;  2KS1 B;  1T2K D;  3O6Q B;  1N73 B;  2HPC B;  3L72 E;  1OVR A;  1G1I A;  1M8O B;  3II6 A;  2C0W A;  2ZYG A;  3G3Z A;  2OGU A;  1DX7 A;  2WT7 A;  3CCV P;  1HGZ A;  3L72 G;  4PD4 D;  1AJY A;  3R4Y A;  2A45 H;  2Z5H A;  2W27 A;  1EXJ A;  2O01 J;  2WT7 B;  2HG5 D;  5EFW B;  2QJY B;  2E75 D;  1NTK E;  1NU1 E;  4L74 A;  1MFZ A;  4N78 E;  1NWQ A;  2QVA A;  4GDO A;  4W7Z A;  2LXC B;  1NTZ D;  4GKG A;  3H32 A;  3AE8 C;  2N9Y B;  1KQG B;  4KT0 J;  4I6M C;  1NTK G;  1JY2 P;  1NU1 G;  1ZN5 A;  4OWF A;  1URQ A;  1VQ7 P;  3H32 B;  2ZT9 C;  1NTM J;  1OIP A;  1SQP E;  1M7L A;  3P8C D;  2YIU C;  4JF7 A;  4W80 A;  1JMM A;  2OYI A;  1URQ B;  3CC7 P;  4H13 B;  1LTT C;  2KP8 A;  3RK2 D;  2LR2 A;  3LIE A;  1NO4 A;  2C0X A;  2NPS B;  2JDI H;  3Q5P A;  4IL6 X;  1SQP G;  4YXD C;  2HR3 A;  4WBA A;  2OYI B;  1U57 A;  5KAF H;  1U7M A;  5KAI E;  2Z5I A;  1JUN A;  1MZ9 A;  5AW1 B;  1J1E B;  3E1R A;  5AW2 B;  1N7S C;  1FDO A;  4D6T E;  2KLU A;  1ZXG A;  3PH0 A;  2O01 N;  1SQV K;  5KJ7 D;  1EDK A;  1FDM A;  3IFM A;  4GOE A;  2BAS A;  2FXO A;  2WVR A;  2P2U A;  3CMA P;  3UIA A;  4D6T G;  1EQ7 A;  1OVV A;  3HRN A;  1KOR A;  1KQF B;  2WPV B;  1SFC C;  1OXZ A;  3VMA A;  1N2D C;  1PP9 J;  1P84 I;  4BXL A;  1KV4 A;  5APV A;  5BU5 A;  3HUS C;  3D6Z A;  3AEE C;  1PL5 A;  2IFN A;  1BDC A;  1SVF A;  3C8V A;  4JPZ B;  1VQN P;  4M3L A;  2CK3 H;  3AE3 C;  1MFT A;  2FXM A;  1KIL A;  1JMB A;  3Q5S A;  1OW7 A;  1G1J A;  3RK3 D;  5CBO A;  1Q81 Q;  1KIL B;  1NTM E;  1LJ2 A;  4ZMD A;  3M9H A;  1FJK A;  3EWK A;  5AW7 B;  1PP9 D;  2Y0D A;  1S5L E;  2O1J A;  3A7O A;  1RY3 A;  3PTZ A;  5CCH A;  4HYT B;  1FU1 A;  1NTM G;  1N73 C;  4AQR D;  2ZJS E;  5AVV B;  3FGA D;  5TIS E;  1N8R Q;  2OTL P;  2GUV A;  2H43 A;  2E74 B;  3IR9 A;  1JB0 J;  3PLN A;  4WB4 A;  2JWD A;  1ZW0 A;  1JY3 P;  3MZW B;  4YPC A;  1DH3 A;  2J58 A;  3H1L J;  3F89 A;  2K9J A;  1VQ8 P;  2D2C D;  4LLH A;  1T6A A;  2DW3 A;  3M0A A;  4C7N A;  3L70 D;  5KLI C;  3H1K J;  2K9J B;  3L75 J;  4C7R A;  4U3F E;  3ITK A;  1SQV J;  5APS A;  1R8E A;  1P84 E;  1NAY A;  3HTK A;  1K73 Q;  4C7N B;  4IL6 E;  2O01 H;  1ZR4 A;  1YHQ P;  1HJ0 A;  4BRY A;  1OX3 A;  4U3F G;  2OYO A;  5CMZ A;  2YO2 A;  3FWN A;  3WU2 H;  1NHL A;  3NMD A;  1FZF A;  2OYH B;  5GTH H;  1URQ C;  3HTK B;  4H13 C;  3M9Q A;  2P7J A;  2A06 E;  4PV1 B;  2NPS C;  4BRY B;  5CJ0 A;  3F5H A;  1NKN A;  2O3J A;  2QM8 A;  3A5T A;  1JEK A;  3AEC C;  3H1I J;  1SQX K;  2A06 G;  3AE7 C;  1KYO E;  1J1E C;  4DCK A;  3L75 D;  1VQM P;  3CX5 I;  1JY2 O;  1LTJ A;  2KSE A;  1S1C X;  1JY3 N;  3AE9 C;  3CCR P;  2WSC J;  4H44 B;  2OTJ P;  1GL2 D;  2OAR A;  5TIS H;  2FYU K;  1YQ3 C;  1LTJ B;  3SFE C;  1EZV I;  1RE4 C;  3GF3 A;  1YYC A;  3TGU E;  2IPP A;  2V7Q H;  1IFJ A;  2WTY A;  2QM7 A;  3H1L E;  4HB1 A;  1FZC C;  4WWI A;  3H1I D;  1GU5 A;  1LT1 A;  5AW3 B;  3B8E B;  3TGU G;  2YXR B;  3JSV C;  1XTC C;  1VQ5 P;  3H1L G;  3H1K E;  3CX5 D;  3H1H D;  1OW6 A;  2R3C A;  2MJZ A;  3PP5 A;  1VQP P;  2I1K A;  4GOF A;  2GUS A;  1P84 H;  1R5L A;  1IFI A;  4IL6 H;  3RBZ A;  3H1K G;  3PJS K;  1RF1 A;  2E42 A;  1SQV G;  1L0N K;  2KI7 B;  1U7J A;  4O9B A;  3CXH E;  4N3Y B;  1RF1 B;  3MP7 B;  1NTZ K;  1WT6 A;  4W7Y A;  1BSH A;  3PHL A;  4AYC A;  1BE3 E;  3GG2 A;  3Q2Y A;  1D7M A;  1KYO H;  2N9B A;  3P7K A;  1QL2 A;  3L71 E;  2OQQ A;  1BE3 G;  1L2P A;  2PGD A;  1QLE D;  1BCC E;  1LP1 A;  1N7S A;  3B5N D;  3W67 A;  3H1J J;  3KQG A;  3L71 G;  1SQX J;  4WY4 A;  5B66 E;  1VQO P;  2HLO A;  5APY A;  4YXW H;  3L36 A;  1BCC G;  1FDI A;  1LP1 B;  1KQS O;  4WY4 B;  2ZXE B;  1KIL D;  1YJN P;  5AW4 B;  3O8Z A;  3Q5R A;  3C1L A;  2FYU J;  1L0L E;  1DIP A;  4KJM A;  1SFC A;  2JO1 A;  5AW5 B;  2IYO A;  1WRG A;  2H8P D;  3CCS P;  3OJA B;  2OYH C;  1W2E A;  4U7J A;  4YTP C;  1VQL P;  4PV1 C;  1L0L G;  1SFC B;  3CCU P;  2JR8 A;  2K37 A;  1Q86 Q;  3H1J D;  1SQX D;  5CCH D;  3BVH A;  1UII A;  1AVY A;  1ZRT E;  4C46 A;  1GDT A;  2WPR A;  2C9N Y;  2XND H;  4GOD A;  1CZQ A;  4A7P A;  1FAV A;  1JCD A;  2FYU D;  4H44 C;  4PD4 I;  4LGD E;  3TNU A;  1L4A D;  3BCC E;  1KB9 I;  1ZR2 A;  1BDD A;  1LTJ C;  1Y9B A;  2JJL A;  2AEJ A;  2KS1 A;  1T8Z A;  1FE6 A;  2YO3 A;  5CCG A;  2K1A A;  4RES B;  3O6Q A;  3KHU A;  1L0N J;  2E75 C;  2W6J H;  1SP4 A;  3TNU B;  2WIT A;  3BCC G;  1RF0 C;  2G8Y A;  2VRS A;  1QX8 A;  1E5W A;  1NTZ J;  4I7Z B;  3G71 P;  1HF9 A;  4HH2 A;  1GK6 A;  2P1J A;  1J1D B;  5B66 H;  3U1A A;  3L73 E;  3RL0 C;  3GLM A;  1X8Y A;  5APW A;  1FOS F;  3MD0 A;  3L73 G;  3CC2 P;  3RK2 C;  4NPE A;  1KB9 D;  3CCQ P;  4RO0 A;  3GHG A;  2Q1K A;  1NAF A;  1L0N D;  5KLI B;  1GZL A;  3GHG B;  5TJH A;  3L74 E;  1RF1 C;  2Q5U A;  3V4Q A;  2WPS A; 
#chains in the Genus database with same CATH homology
 1P84 I;  3H1I J;  1L0L J;  1SQP J;  3L70 J;  3TGU J;  3H1K J;  1BGY J;  3L74 J;  1L0N J;  1SQB J;  3L75 J;  3BCC J;  4D6T J;  3L71 J;  1EZV I;  1NTM J;  3L72 J;  3CXH I;  1SQV J;  3H1J J;  2FYU J;  3H1L J;  3CX5 I;  4PD4 I;  1SQX J;  2BCC J;  1NTZ J;  1KYO I;  5KLV J;  3L73 J;  3H1H J;  1SQQ J;  2IBZ I;  1KB9 I;  1BE3 J;  1NU1 J;  1NTK J;  3CWB J;  4U3F J;  1BCC J;  1PP9 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...