1N2DC

Ternary complex of mlc1p bound to iq2 and iq3 of myo2p, a class v myosin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
48
structure length
48
Chain Sequence
QISQAIKYLQNNIKGFIIRQRVNDEMKVNCATLLQAAYRGHSIRANVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the light chain-binding domain of myosin V.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
molecule keywords Myosin Light Chain
total genus 22
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2002-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n2dC00
2GUVA 1T8ZA 3H6PA 1KFMA 1EQ7A 2IX7C 1KFNA 1JCDA 1JCCA 2GUSA 1N2DC
chains in the Genus database with same CATH superfamily
3AEEC 3B8EB 3AE1C 3CCLP 1R5LA 1JMBA 3B5NC 2E76C 1OIPA 3CC7P 1SQPK 2JO1A 2A06E 5CCHD 3CWBE 1SQVK 3L71J 1HVVA 1OVUA 3G3ZA 4OVNF 3FXEA 4H44B 2YXRB 3D6YA 1VQNP 2QJYC 3HRNA 1HH0A 2P1JA 1DD4A 2AXCA 1MUUA 2KNCA 4L74A 2B88A 1PGOA 1SQBD 2YMYA 3OAKA 1RE4A 2N1TA 3HUSA 3SWYA 3TK1A 3HUSC 2M3EA 1WMKA 2J5UA 5APQA 3L72E 3L74G 1KQFB 3WU2E 1GTWA 1N73A 1SQVE 3L73D 2GUVA 5AVXB 1L0NJ 2XKMA 3IAOA 3II6A 4JF7A 3VMXA 1FZGA 2H88C 2QJYB 2ZAEB 3MTUE 4AQRD 4L75A 1BDCA 2M3BA 1HUCA 2N1TB 1G1JA 1SQXJ 4WY4C 3FGAD 1JY2O 2Y9ZA 1EZVE 1NTMD 3KPEA 1SQBK 5AVYB 1BCCJ 3RBZA 5KKZB 1LT9B 4MN4C 1N7SC 3H1IJ 1DD3A 2M5AB 1FDIA 1SFCB 1SFCA 4QMAA 2NPSB 5CHXA 1JMMA 1KQGB 1YI2P 1PPJD 3L74E 1LTGC 3L72G 1GU4A 3O8ZA 4PJ0E 3MHVA 5APTA 3ABVC 5B66E 1GK4A 3EQ2A 1LTJA 1LTJB 1YBKA 2XNXA 1T3JA 1NKZB 2QRXA 2R3SA 1S4XA 2FYUK 4NPDA 3V4WA 5B5EH 5KLVD 1NO4A 1PGQA 4JQ0D 1N7SB 2FYUE 1EZVG 4XFJA 4H44D 2ZYGA 3I55P 4DOJA 2WTYA 1MZ9A 2WITA 4DCKA 2O01J 1X8YA 1WRGA 1CW5A 1L0LK 1FC2C 2NRGA 4EDFA 2H43A 1BCCD 2V7QJ 1LT9A 1GL2C 1L4AB 1M1JC 2KSJA 2XNDH 3CWBJ 2W83C 3FX0A 3RK3D 3RL0D 2OTJP 2FXPA 3P32A 1N7SA 3GG2A 1JM0A 4JYCA 5CCGA 3HTKB 3Q3DA 1J1DB 1AQTA 2FFDA 1X79B 1J1EC 4JPZB 5TJHA 1PIXA 3Q5SA 1L0ND 4PV1C 2J59M 1EQ7A 2K88A 3BCCE 2OTKE 2PP6A 2QSIA 5E79E 5E79H 2K1AA 3G9RA 3HUSB 3RL0C 4ASVA 2OTLP 1IFMA 1L0LD 1L0LJ 3H1KE 5AW1B 1SVFA 3ZDMA 2RH0A 1RF1C 1GW3A 1KB9E 1Y47A 4GIFA 1URQA 1X9VA 1W2EA 2D2CB 3ITKA 4YTPC 1SQQG 1JB0J 3NTNA 4N6JA 1RY3A 5K5GB 2Q3IA 2W6JH 1H0TB 1LP1B 1L0NK 3L70D 1YJ9P 2FXOA 1KTMA 1S5LE 3CX5H 3KDPB 2KSEA 3L35A 3G71P 1RE3C 3AE5C 1EDLA 2FYZA 3O6QA 2QJPB 3L71D 1FU1A 1NTZJ 1OW7A 3M06A 1JY3O 3CCUP 3E1IA 4Y28J 2W8ZA 1FJKA 1PGPA 1ZOYC 2DW3A 3A0BE 3H1HG 3TGUJ 2KS1B 3EFFK 1JCCA 4JBZA 4U3FD 4OGQC 1VQ8P 3PP5A 1HGVA 3LW5H 4C46A 2G8YA 2CPBA 3L36A 1N7SD 1BE3D 2W6AA 3KZIE 5CCGD 2OYIA 1KYOI 1M57D 2BEQD 1SP4A 2KNCB 3GLMA 2P67A 3L74J 5AW0B 5GTHH 4PJ0H 3L70E 3H1LJ 4WY4D 2PGDA 3UIAA 2E75D 2RKLA 3AEFC 1Q2NA 1BSNA 2BCCE 3HE5B 1NU1J 4C7NA 1ZRTD 4C7NB 2KI7B 1H88A 1UIXA 1P84E 2MJZA 3L75J 3U59A 1YQ3C 3LIEA 4O9BA 4I7ZC 3CXHD 1URQD 1NTKG 1PP9G 3H1KD 3HD7B 4XA4A 1SQVG 1RF0C 3E1RA 1LTIC 1MKMA 4GKGA 2AEMA 4WWIA 4CPGA 5CJ4A 3AE3C 3CCJP 1NGMB 1PFIA 3R2PA 1FJPA 2ZVOB 5TISE 1IK9A 2Q5UA 1KZUB 2WVRA 4GDOA 1QVGO 1BGYD 1R5SA 1IC2A 2PFXA 1KILD 1N86A 2OYOA 1N73B 4L73A 3L70G 1QL2A 4OH8B 1E5WA 3RK3E 1J1EB 1LTTC 3BCCJ 4KJMA 1S5LH 2A45G 1SQQD 2E76B 1YYCA 2YO3A 2L5GB 2QM7A 3FWNA 3A3YB 4I1LA 1S2EA 1G1IA 3TNUA 1FZCA 1IFDA 2LKMA 1P84I 4OGQD 1NTKE 1PP9E 4Y99B 5KLVE 3TYYA 2I8DA 2K9JA 1JTHB 1FDMA 2RMZA 1Q7YQ 1OVRA 3B71A 1HJBA 2A45I 2R5DA 1DEBA 3M0DA 4IFDK 1FAVA 1JEKA 3GMAA 1FZEA 4I2LC 1M8OB 2K9YA 1FDOA 2ZXEB 1VDFA 2GUSA 1KYOE 3HE4B 5CBOA 1PPJE 4IFFA 5KAFH 1LGHB 4LGDE 2YKOA 2KP8A 1T3UA 3EFGA 1JY3N 1U7MA 1RF0A 2JWDA 2IBZI 3KYQA 2H89C 1LT9C 1UIIA 2BEZF 2WQYC 3H1JD 4JYBA 2QIWA 2ZT9C 4LLHA 3CLQA 1T2KD 1EZVD 1AVOA 1VL2A 1BGYG 1W5CE 4H13B 1KYOD 1L4AA 1OWAA 3KZIH 2KB7P 2HODB 3H1JG 1N2DC 2HODA 5KLVG 2WPRA 3P8CD 2BASA 3H6PA 4EI2A 1VQ4P 5AW2B 2G3AA 3G4SP 4HJGH 5KJ7A 1SQVD 1YJNP 3H1KG 3L72D 1KMIZ 5H2FE 2XZRA 2LXBA 1IZNB 3IFMA 4L76A 5APSA 5APXA 3IR9A 5AW5B 5H2FH 2YIUB 1HBWA 2B9BA 3CI9A 1S5LX 4R4LA 2POHA 1SQQE 1ZP0C 1USEA 2E43A 1VF5B 2L91A 3F5HA 3NFQA 3V6IA 5C39A 4M3LA 4DT0A 4EYYQ 2OYHB 5KLVK 3AE6C 1KILE 1KB9H 1BGYE 1R8EA 1M1JB 1RE3A 4UB6E 2FYNB 2FKWB 2FY8A 3AEGC 3C8VA 1YTZT 1ZRTE 2HPCA 1MFZA 1NJIQ 2BCCD 3P8MC 5CMZA 3H1HE 3RK2D 1H0TA 4U3FG 4IL6H 1YITP 1LP1A 3A0HH 3L73G 2YNYA 3M9QA 2PRRA 3I5CA 3MUDC 3M91A 3A0HE 3BVHA 1LT1A 1RF1A 1LTBC 1P84D 2OYHC 3TF5A 1MFTA 3PTZA 1SQBG 3L72J 3QH9A 2C9LY 1AV1A 3BATA 1SQVJ 3AE8C 2J58A 2YKQA 1QL1A 3GF7A 2D2CC 5EFWB 1AJYA 2KZIA 5BU5A 2IX7C 2FXMA 2BCCG 2OGUA 1FBMA 2WSSH 4H0LD 4PD4H 4H13D 2ZJSE 4B86A 2GM4A 4KHXA 4C7RA 2OYIB 3HTKA 2FFDB 1EC5A 3V5BA 1KORA 1RF1B 4U3FE 3AE2C 3MZWB 3AE7C 2YKPA 1CSBA 1EDJA 2P58A 3W68A 4UB8H 3HD7A 3RK3B 3P7KA 3S4RA 1OFCX 1RQUA 1PZQA 3PH0A 3QWOC 5KAIH 3CCMP 1KC8Q 3EWKA 3JCUE 2IYOA 1WT6A 2ZT9B 1LWUC 1SQPJ 1HJ0A 5CCGC 3T97A 1KILC 3RL0g 3A2AA 3N4XA 5APUA 3H1HD 1XTGB 2W6BA 1RH5B 3RGUA 1VQMP 1L0NE 3PJSK 5AW7B 3SWFA 1CI6B 1KB9D 3VMZA 3B4SA 4ZKUA 3D6ZA 1SFCC 3M9HA 5AW6B 2NPSC 3PLNA 2IYPA 2B89A 3VP9A 3B5NB 2K3RA 2NPSD 2Z4EA 2QVAA 3LIDA 1IJDB 3B5ND 2WWWA 1LWUB 1GMJA 1NH4A 1NTZE 1NYHA 1DEEG 3CL3D 5B5EE 1USDA 5M1BA 2IZ1A 1X22A 1BGYJ 1PPJG 3HE5A 3USSA 1H8AA 1OZHA 4N78D 4UB6H 1HWTC 2O3JA 3PHLA 1L0LG 1L2PA 1YQ4C 5KLIB 3M0DC 2O1JA 2FYNC 2W27A 1KFNA 3H1HJ 1OW8A 1QGKB 1N73C 5APVA 3WMM0 3P8CE 3HD7D 2VRSA 1VQ7P 1NAFA 3WUTA 3SWKA 3WU2H 4DJGA 1FE6A 2HYNA 2M0BA 4IFMA 3VMAA 1KD1Q 1URQC 4I6MC 1YJWP 3LW5J 2E76D 3CMEP 2HLOA 2KS1A 3H1JE 1LTAC 3S1KA 1M1KQ 1VQLP 4WY4B 1J1DC 1U7JA 4GODA 2MKVA 2IZ0A 3L75E 2R3CA 1NTZG 4DZOA 2V7QH 2JDIH 3N7NA 1HF9A 2HG5D 3TSIA 1T8ZA 1K05A 1E79H 3L74D 1QEXA 3TGUG 1YHQP 5DJTB 2K37A 2Z5IA 3F89A 3Q5PA 4AUWA 1L4AD 2N1TD 2QE7H 1LJ2A 2P7JA 3SSUA 4U3FJ 2IBZE 2A45H 1DX7A 3CX5E 2AXTH 4HKZH 2IPPA 1PP9D 1NTKD 1OXZA 1KB9I 2I1JA 3GHGC 3PRJA 1H89A 1AA0A 1PGJA 3U1AA 4AYCA 3CCQP 1SQXK 2HR3A 2Q6QA 4HB1A 3Q5RA 4W80A 1IFIA 2Z5HA 2QJPC 1K8AQ 3L75G 2ZFCA 1K73Q 5BU8B 3L73E 4RO0A 2JKVA 1LTJC 2KIKA 2SPZA 3VP8A 1NTMG 2WSCH 3VOPA 3AE9C 3MGNA 1S1CX 2XU6A 1NOHA 1BE3G 1FZBA 4RESB 1CZQA 1SQBE 2H7HA 2UWJE 3OJAB 1FS0E 2R44A 2WPVB 2IBZG 3O6QB 4ASWA 2WT7B 1JO5A 1SQQK 3TNUB 1FZCB 1VF5C 3CXHE 4GT1A 4YPCA 1GD2E 3TDKA 1ZN5A 5CJ0A 3KHUA 3L71G 1FZAA 1A02J 1KV4A 3RL0B 1AVYA 1N8RQ 4ZKPA 1YIJP 1EXJA 1IO4A 2E42A 2LXCB 2CK3H 3CWBD 4OWFA 2H8PD 1FOSE 1LTSC 4I7ZB 4PV1B 2OYHA 1QVFO 2ZT9D 2LR2A 4D6TG 3G6EP 2ZXXA 1BE3E 1NU1E 2KYVA 5AVUB 2IDBA 1SS1A 2B87B 2Q1KA 2WPSA 3BASA 5AW8B 1FZCC 1GZLA 1MV8A 1Q81Q 3WUUA 2QA4P 3AEDC 3M9BA 1SQXE 2ZYAA 3VTPC 1JY3P 3A5TA 1VQKP 1L0NG 2R32A 1X0TA 2OQQA 4GOEA 3L71E 1GW4A 1M1JA 1SLQA 2E5TA 2Y9YA 3IF4A 2W90A 1ZR4A 1SFCD 2OARA 4H0LB 3CCVP 3V2QA 2HPCB 1CI6A 4WBAA 1JY2N 2M8RA 3L4FA 1YTZI 1BCCG 2YIUC 4WB4A 5AVTB 1TU3F 3AE4C 1VF5D 3VMYA 4D6TE 3V4QA 5KJ7C 5AVVB 1NTMK 4OGQB 2AXTE 1GK6A 1KQLA 1S72P 2N9YB 5AVQB 5AW9B 1DIPA 1SQPD 1L0LE 1S9KE 1PL5A 5GTIE 3CPWO 3FWLA 3T97B 1AQ5A 1ZW0A 1NVOA 1IFJA 3M0AA 4K3AA 3BCCD 5L8RJ 3RK2B 5GTIH 5KKZC 2QG4A 1KILA 1NU1D 1KILB 2FYUJ 2IFNA 3GHGA 1KQSO 1KFMA 2JP3A 3CXHI 3E7KA 2C0WA 1K04A 1P84H 2JWAA 3H1LG 3H1IG 2CPSA 2Q9IA 2RN0A 3JSVC 4IL6X 1Q86Q 2IFMA 1BCCE 2JJLA 3HD7C 4H13C 5TISH 3V2RA 1GDTA 4N3YB 3A7OA 1Y8AA 2Q3EA 2YXQB 4WY4A 4BRYA 1QLED 3TGUE 2QEXP 4U7JA 2FYUD 3NXSA 3H32A 3H32B 1NU1K 2E75C 5CCHA 4WVZA 4EOTA 4HH2A 3S9OA 1A02F 4LC1A 3V2NA 1Q82Q 1S3JA 2V4HA 2E5YA 2N9BA 2WMMA 1J2JB 3HE4A 1PV3A 2WSEH 2WSFH 2ZYDA 5KJ7D 3AEAC 4IOIH 4BWNA 1DH3A 1GU5A 1IFPA 2R5BA 5AW3B 1BSHA 1M7LA 3R4YA 3H1LE 4RKUJ 3OW2O 3CX5I 2I1KA 2KLUA 3FXDA 3VYIA 1ZMEC 2A06G 3C9IA 4ZNCA 1RHZB 1ZLLA 2ZVNB 3CWBG 4YXWH 1AFOA 1RQVA 2PAJA 2WZ7A 2O1KA 2XV5A 1SQQJ 5AVSB 2HFED 1JCDA 1EDIA 1Y9BA 1NTME 2JR8A 4H0LC 2WSEJ 2WSFJ 4HYTB 1KYOH 2O01N 2P10A 5B66H 3CX5D 4NPEA 1FZFA 2C9NY 2E74C 2IBZD 1VQOP 3OA7A 3JC22 2K9JB 4UB8E 2KUBA 1GL2A 4A7PA 4R4MA 4K35A 3CD6P 1W2BO 1D7MA 4D6TJ 1KN7A 1NHLA 1VPCA 1EZVI 1IK7A 1NWQA 3AEBC 3H1KJ 2JEEA 3NMDA 4TT3H 3RK2C 3L75D 4PV1D 2AEFA 3WUVA 5APWA 5GTHE 5AVZB 1LWUA 1LNQA 2QM8A 2OYIC 2KOGA 5KLIC 3VN0A 5CBNA 5KLVJ 2Y0CA 1NTZK 2E74B 2KK7A 1IFNA 3H1JJ 2C0XA 2O01H 3H1LD 4TLFA 4XE5B 4BXLA 1VQ6P 4W7YA 3RK3C 1GL2B 1L4AC 1NU1G 2FBWC 3W67A 1U57A 1N7LA 3I56P 4RJTA 5AW4B 4Y99C 2A06D 3SFEC 1G2CB 3H25A 1SQXG 4N78E 1JUNA 3TGUD 3D70A 1Q90D 2KLVA 1NKNA 1T6AA 2M5AA 3BRVB 1EXIA 4GOFA 3CC2P 2AEJA 1NTZD 4Z1MH 3L37A 4W7ZA 4IL6E 5AVRB 1VQPP 1JOCA 3CMAP 2E75B 1ZR2A 3CC4P 2NZ2A 1SQPE 1GL2D 2WT7A 3L70J 3MIWA 1Z56A 2FYUG 5BVZA 1T2KC 3CXHH 1HGZA 1NTKJ 1PP9J 2D2CD 3RBXA 2BCCJ 1M56D 3Q1MA 3MUDA 3A0BH 1FOSF 2YO2A 2B87A 3L73J 3GHGB 1RE4C 2N1TC 2XDJA 4NPFX 3V2PA 1OVVA 1S9KD 2QJKB 2YMKA 3K5BA 1EDKA 1ZV8A 3H1ID 1BDDA 2Y0EA 3MP7B 3CCRP 1SQBJ 2KXPB 4PD4E 3CCSP 3Q2YA 2FFDC 1NTKK 1OX3A 5KAFE 4YXDC 1NTMJ 5CCHC 1ZXGA 4PD4D 4D6TD 3CCEP 1OW6A 5DJUB 3H1IE 1SQXD 3BCCG 1VQ5P 1JTHA 2KZJA 3KQGA 3GF3A 2GA1A 1JY2P 1URQB 1SQPG 5KAIE 3IN6A 3JCUH 3AECC 2E74D 3C1LA 4EIJA 4KT0J 2NPSA 2Y0DA 3U1CA 3D71A 1K9MQ 2QJKC 3B5NA 3BRTB 3KXDA 4PD4I 1NAYA 3SFDC 4ZMDA 2P2UA 2Q7CA 1XTCC 5APYA 1HTLC 4BRYB 1VQ9P 1M90Q 3MD0A 4H44C 1G2CA 1JNMA 5KTBA 2ITAA 3GW6A 5AVWB 1BE3J 1QX8A 2WPQA 1OMIA 2WSCJ
chains in the Genus database with same CATH topology
3B8EB 3B5NC 1SQPK 5CCHD 1SQVK 1HVVA 3G3ZA 3HRNA 1HH0A 2P1JA 1MUUA 2YMYA 3OAKA 1RE4A 2N1TA 3HUSA 3SWYA 3TK1A 3HUSC 5APQA 1GTWA 1N73A 2GUVA 5AVXB 2XKMA 3II6A 4JF7A 3VMXA 1FZGA 3MTUE 4AQRD 2M3BA 1HUCA 2N1TB 1G1JA 4WY4C 1JY2O 3KPEA 1SQBK 5AVYB 1LT9B 1N7SC 1SFCB 1SFCA 2NPSB 5CHXA 1JMMA 1GU4A 1LTGC 3O8ZA 5APTA 1GK4A 3EQ2A 1LTJA 1LTJB 2XNXA 1T3JA 1NKZB 2FYUK 3V4WA 1NO4A 1N7SB 4DOJA 2WTYA 1MZ9A 2WITA 1CW5A 1X8YA 1WRGA 1L0LK 2H43A 1LT9A 1GL2C 1L4AB 1M1JC 2KSJA 3RK3D 1GD2E 3RL0D 3P32A 5CCGA 1N7SA 4JYCA 3HTKB 2FFDA 1J1DB 1X79B 1J1EC 2J59M 1EQ7A 2PP6A 3HUSB 3RL0C 1IFMA 5AW1B 1SVFA 1RF1C 1GW3A 4GIFA 1URQA 1X9VA 1W2EA 3NTNA 4N6JA 1RY3A 2Q3IA 1L0NK 3KDPB 3L35A 1RE3C 2FYZA 1FU1A 3M06A 1JY3O 3E1IA 1FJKA 1JCCA 3PP5A 1HGVA 3LW5H 4C46A 2CPBA 3L36A 1N7SD 2W6AA 5CCGD 2OYIA 5AW0B 1SP4A 2P67A 4WY4D 3UIAA 3HE5B 4C7NA 4C7NB 1H88A 2MJZA 3U59A 3LIEA 4O9BA 5APSA 1URQD 3HD7B 4XA4A 4GKGA 1RF0C 1A02F 1LTIC 1PFIA 5CJ4A 3R2PA 1FJPA 1IK9A 2Q5UA 1KZUB 1IC2A 1N73B 1KILD 1N86A 4OH8B 1QL2A 1E5WA 1J1EB 1LTTC 2A45G 1YYCA 2YO3A 2L5GB 2QM7A 4I1LA 3A3YB 1G1IA 3TNUA 1FZCA 1IFDA 2LKMA 4Y99B 3TYYA 1FDMA 1JTHB 1HJBA 2A45I 2R5DA 1DEBA 3M0DA 4IFDK 1FAVA 1FZEA 4I2LC 2ZXEB 1VDFA 2GUSA 3HE4B 4IFFA 1LGHB 4LGDE 2YKOA 2KP8A 1T3UA 3EFGA 1JY3N 1RF0A 3KYQA 1LT9C 4JYBA 1T2KD 4LLHA 3CLQA 1L4AA 1OWAA 2KB7P 2HODB 1N2DC 2HODA 2WPRA 3P8CD 2BASA 3H6PA 5AW2B 2XZRA 2Q7CA 3IFMA 5APXA 5AW5B 3IR9A 1HBWA 3CI9A 2POHA 2E43A 3NFQA 2OYHB 4M3LA 5KLVK 1M1JB 1RE3A 2FKWB 1YTZT 2HPCA 1MFZA 3P8MC 5CMZA 3RK2D 2YNYA 3M9QA 3I5CA 3BVHA 3M91A 1RF1A 1LTBC 2OYHC 2C9LY 3BATA 2J58A 2YKQA 1QL1A 5BU5A 2IX7C 2FXMA 1FBMA 4B86A 2GM4A 4KHXA 4C7RA 2OYIB 3HTKA 2FFDB 3V5BA 1RF1B 2YKPA 1CSBA 3RK3B 3HD7A 3P7KA 1WT6A 1LWUC 5CCGC 3T97A 1KILC 3A2AA 3N4XA 5APUA 1XTGB 2W6BA 5AW7B 3SWFA 1CI6B 3VMZA 4ZKUA 1SFCC 3M9HA 5AW6B 2NPSC 3VP9A 3B5NB 2NPSD 2Z4EA 3LIDA 1IJDB 3B5ND 2WWWA 1LWUB 1NH4A 3CL3D 3HE5A 4N78D 1HWTC 3M0DC 2O1JA 2W27A 1KFNA 1N73C 5APVA 3WMM0 3P8CE 3HD7D 2VRSA 1NAFA 2HYNA 4IFMA 1URQC 4I6MC 2HLOA 1LTAC 4WY4B 1J1DC 2R3CA 4DZOA 3N7NA 2HG5D 3TSIA 1T8ZA 4AUWA 2Z5IA 1L4AD 2N1TD 2P7JA 2A45H 1DX7A 1H89A 2IPPA 3GHGC 1OXZA 2I1JA 3U1AA 4AYCA 1SQXK 4W80A 1IFIA 2Z5HA 2ZFCA 5BU8B 3VOPA 1LTJC 3VP8A 2WSCH 3MGNA 2XU6A 1NOHA 1FZBA 4RESB 1CZQA 2H7HA 3OJAB 2WT7B 1JO5A 1SQQK 3TNUB 1FZCB 4GT1A 1ZN5A 5CJ0A 1A02J 1FZAA 3RL0B 2E42A 1IO4A 4ZKPA 2H8PD 1FOSE 1LTSC 2OYHA 2KYVA 5AVUB 5AW8B 1FZCC 2WPSA 3BASA 1GZLA 1MV8A 3M9BA 3VTPC 3A5TA 1JY3P 2R32A 1GW4A 1M1JA 1SLQA 1ZR4A 1H8AA 1SFCD 2OARA 3V2QA 2HPCB 1CI6A 4WBAA 1JY2N 2M8RA 3L4FA 1YTZI 4WB4A 5AVTB 3VMYA 3V4QA 5KJ7C 5AVVB 1NTMK 1GK6A 1KQLA 5AVQB 5AW9B 1S9KE 1AQ5A 1IFJA 3M0AA 3RK2B 1KILA 2IFNA 1KILB 3GHGA 1KFMA 2C0WA 2CPSA 2Q9IA 2IFMA 2JJLA 3HD7C 1GDTA 3V2RA 4N3YB 3A7OA 4WY4A 3NXSA 3H32A 3H32B 1NU1K 5CCHA 4EOTA 4HH2A 4LC1A 3V2NA 2N9BA 1J2JB 3HE4A 2WSEH 2WSFH 1DH3A 5KJ7D 1GU5A 5AW3B 2R5BA 1M7LA 2I1KA 3VYIA 3C9IA 1ZLLA 1AFOA 2PAJA 2WZ7A 2O1KA 2XV5A 5AVSB 2HFED 1JCDA 4HYTB 1FZFA 2C9NY 3OA7A 1GL2A 1NHLA 1VPCA 1NWQA 2JEEA 3NMDA 3RK2C 5APWA 5AVZB 1LWUA 2QM8A 2OYIC 2KOGA 3VN0A 1NTZK 4XE5B 5KJ7A 1IFNA 2C0XA 2O01H 4W7YA 3RK3C 1GL2B 1L4AC 1N7LA 5AW4B 4Y99C 1G2CB 1JUNA 4N78E 2KLVA 1NKNA 3BRVB 3L37A 4W7ZA 5AVRB 1JOCA 1ZR2A 1GL2D 2WT7A 3MIWA 1Z56A 5BVZA 1T2KC 1HGZA 3MUDA 1FOSF 2YO2A 3GHGB 1RE4C 2N1TC 2XDJA 3V2PA 1S9KD 1ZV8A 2FFDC 1NTKK 5CCHC 1JTHA 3KQGA 1JY2P 1URQB 3U1CA 4EIJA 2NPSA 3B5NA 3BRTB 2P2UA 1XTCC 5APYA 1HTLC 3MD0A 1JNMA 1G2CA 5KTBA 5AVWB 2WPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GUV A;  1T8Z A;  3H6P A;  1KFM A;  1EQ7 A;  2IX7 C;  1KFN A;  1JCD A;  1JCC A;  2GUS A;  1N2D C; 
#chains in the Genus database with same CATH topology
 3AEE C;  3B8E B;  3AE1 C;  3CCL P;  1R5L A;  1JMB A;  3B5N C;  2E76 C;  1OIP A;  3CC7 P;  1SQP K;  2JO1 A;  2A06 E;  5CCH D;  3CWB E;  1SQV K;  3L71 J;  1HVV A;  1OVU A;  3G3Z A;  4OVN F;  3FXE A;  4H44 B;  2YXR B;  3D6Y A;  1VQN P;  2QJY C;  3HRN A;  1HH0 A;  2P1J A;  1DD4 A;  2AXC A;  1MUU A;  2KNC A;  4L74 A;  2B88 A;  1PGO A;  1SQB D;  2YMY A;  3OAK A;  1RE4 A;  2N1T A;  3HUS A;  3SWY A;  3TK1 A;  3HUS C;  2M3E A;  1WMK A;  2J5U A;  5APQ A;  3L72 E;  3L74 G;  1KQF B;  3WU2 E;  1GTW A;  1N73 A;  1SQV E;  3L73 D;  2GUV A;  5AVX B;  1L0N J;  2XKM A;  3IAO A;  3II6 A;  4JF7 A;  3VMX A;  1FZG A;  2H88 C;  2QJY B;  2ZAE B;  3MTU E;  4AQR D;  4L75 A;  1BDC A;  2M3B A;  1HUC A;  2N1T B;  1G1J A;  1SQX J;  4WY4 C;  3FGA D;  1JY2 O;  2Y9Z A;  1EZV E;  1NTM D;  3KPE A;  1SQB K;  5AVY B;  1BCC J;  3RBZ A;  5KKZ B;  1LT9 B;  4MN4 C;  1N7S C;  3H1I J;  1DD3 A;  2M5A B;  1FDI A;  1SFC B;  1SFC A;  4QMA A;  2NPS B;  5CHX A;  1JMM A;  1KQG B;  1YI2 P;  1PPJ D;  3L74 E;  1LTG C;  3L72 G;  1GU4 A;  3O8Z A;  4PJ0 E;  3MHV A;  5APT A;  3ABV C;  5B66 E;  1GK4 A;  3EQ2 A;  1LTJ A;  1LTJ B;  1YBK A;  2XNX A;  1T3J A;  1NKZ B;  2QRX A;  2R3S A;  1S4X A;  2FYU K;  4NPD A;  3V4W A;  5B5E H;  5KLV D;  1NO4 A;  1PGQ A;  4JQ0 D;  1N7S B;  2FYU E;  1EZV G;  4XFJ A;  4H44 D;  2ZYG A;  3I55 P;  4DOJ A;  2WTY A;  1MZ9 A;  2WIT A;  4DCK A;  2O01 J;  1X8Y A;  1WRG A;  1CW5 A;  1L0L K;  1FC2 C;  2NRG A;  4EDF A;  2H43 A;  1BCC D;  2V7Q J;  1LT9 A;  1GL2 C;  1L4A B;  1M1J C;  2KSJ A;  2XND H;  3CWB J;  2W83 C;  3FX0 A;  3RK3 D;  3RL0 D;  2OTJ P;  2FXP A;  3P32 A;  1N7S A;  3GG2 A;  1JM0 A;  4JYC A;  5CCG A;  3HTK B;  3Q3D A;  1J1D B;  1AQT A;  2FFD A;  1X79 B;  1J1E C;  4JPZ B;  5TJH A;  1PIX A;  3Q5S A;  1L0N D;  4PV1 C;  2J59 M;  1EQ7 A;  2K88 A;  3BCC E;  2OTK E;  2PP6 A;  2QSI A;  5E79 E;  5E79 H;  2K1A A;  3G9R A;  3HUS B;  3RL0 C;  4ASV A;  2OTL P;  1IFM A;  1L0L D;  1L0L J;  3H1K E;  5AW1 B;  1SVF A;  3ZDM A;  2RH0 A;  1RF1 C;  1GW3 A;  1KB9 E;  1Y47 A;  4GIF A;  1URQ A;  1X9V A;  1W2E A;  2D2C B;  3ITK A;  4YTP C;  1SQQ G;  1JB0 J;  3NTN A;  4N6J A;  1RY3 A;  5K5G B;  2Q3I A;  2W6J H;  1H0T B;  1LP1 B;  1L0N K;  3L70 D;  1YJ9 P;  2FXO A;  1KTM A;  1S5L E;  3CX5 H;  3KDP B;  2KSE A;  3L35 A;  3G71 P;  1RE3 C;  3AE5 C;  1EDL A;  2FYZ A;  3O6Q A;  2QJP B;  3L71 D;  1FU1 A;  1NTZ J;  1OW7 A;  3M06 A;  1JY3 O;  3CCU P;  3E1I A;  4Y28 J;  2W8Z A;  1FJK A;  1PGP A;  1ZOY C;  2DW3 A;  3A0B E;  3H1H G;  3TGU J;  2KS1 B;  3EFF K;  1JCC A;  4JBZ A;  4U3F D;  4OGQ C;  1VQ8 P;  3PP5 A;  1HGV A;  3LW5 H;  4C46 A;  2G8Y A;  2CPB A;  3L36 A;  1N7S D;  1BE3 D;  2W6A A;  3KZI E;  5CCG D;  2OYI A;  1KYO I;  1M57 D;  2BEQ D;  1SP4 A;  2KNC B;  3GLM A;  2P67 A;  3L74 J;  5AW0 B;  5GTH H;  4PJ0 H;  3L70 E;  3H1L J;  4WY4 D;  2PGD A;  3UIA A;  2E75 D;  2RKL A;  3AEF C;  1Q2N A;  1BSN A;  2BCC E;  3HE5 B;  1NU1 J;  4C7N A;  1ZRT D;  4C7N B;  2KI7 B;  1H88 A;  1UIX A;  1P84 E;  2MJZ A;  3L75 J;  3U59 A;  1YQ3 C;  3LIE A;  4O9B A;  4I7Z C;  3CXH D;  1URQ D;  1NTK G;  1PP9 G;  3H1K D;  3HD7 B;  4XA4 A;  1SQV G;  1RF0 C;  3E1R A;  1LTI C;  1MKM A;  4GKG A;  2AEM A;  4WWI A;  4CPG A;  5CJ4 A;  3AE3 C;  3CCJ P;  1NGM B;  1PFI A;  3R2P A;  1FJP A;  2ZVO B;  5TIS E;  1IK9 A;  2Q5U A;  1KZU B;  2WVR A;  4GDO A;  1QVG O;  1BGY D;  1R5S A;  1IC2 A;  2PFX A;  1KIL D;  1N86 A;  2OYO A;  1N73 B;  4L73 A;  3L70 G;  1QL2 A;  4OH8 B;  1E5W A;  3RK3 E;  1J1E B;  1LTT C;  3BCC J;  4KJM A;  1S5L H;  2A45 G;  1SQQ D;  2E76 B;  1YYC A;  2YO3 A;  2L5G B;  2QM7 A;  3FWN A;  3A3Y B;  4I1L A;  1S2E A;  1G1I A;  3TNU A;  1FZC A;  1IFD A;  2LKM A;  1P84 I;  4OGQ D;  1NTK E;  1PP9 E;  4Y99 B;  5KLV E;  3TYY A;  2I8D A;  2K9J A;  1JTH B;  1FDM A;  2RMZ A;  1Q7Y Q;  1OVR A;  3B71 A;  1HJB A;  2A45 I;  2R5D A;  1DEB A;  3M0D A;  4IFD K;  1FAV A;  1JEK A;  3GMA A;  1FZE A;  4I2L C;  1M8O B;  2K9Y A;  1FDO A;  2ZXE B;  1VDF A;  2GUS A;  1KYO E;  3HE4 B;  5CBO A;  1PPJ E;  4IFF A;  5KAF H;  1LGH B;  4LGD E;  2YKO A;  2KP8 A;  1T3U A;  3EFG A;  1JY3 N;  1U7M A;  1RF0 A;  2JWD A;  2IBZ I;  3KYQ A;  2H89 C;  1LT9 C;  1UII A;  2BEZ F;  2WQY C;  3H1J D;  4JYB A;  2QIW A;  2ZT9 C;  4LLH A;  3CLQ A;  1T2K D;  1EZV D;  1AVO A;  1VL2 A;  1BGY G;  1W5C E;  4H13 B;  1KYO D;  1L4A A;  1OWA A;  3KZI H;  2KB7 P;  2HOD B;  3H1J G;  1N2D C;  2HOD A;  5KLV G;  2WPR A;  3P8C D;  2BAS A;  3H6P A;  4EI2 A;  1VQ4 P;  5AW2 B;  2G3A A;  3G4S P;  4HJG H;  5KJ7 A;  1SQV D;  1YJN P;  3H1K G;  3L72 D;  1KMI Z;  5H2F E;  2XZR A;  2LXB A;  1IZN B;  3IFM A;  4L76 A;  5APS A;  5APX A;  3IR9 A;  5AW5 B;  5H2F H;  2YIU B;  1HBW A;  2B9B A;  3CI9 A;  1S5L X;  4R4L A;  2POH A;  1SQQ E;  1ZP0 C;  1USE A;  2E43 A;  1VF5 B;  2L91 A;  3F5H A;  3NFQ A;  3V6I A;  5C39 A;  4M3L A;  4DT0 A;  4EYY Q;  2OYH B;  5KLV K;  3AE6 C;  1KIL E;  1KB9 H;  1BGY E;  1R8E A;  1M1J B;  1RE3 A;  4UB6 E;  2FYN B;  2FKW B;  2FY8 A;  3AEG C;  3C8V A;  1YTZ T;  1ZRT E;  2HPC A;  1MFZ A;  1NJI Q;  2BCC D;  3P8M C;  5CMZ A;  3H1H E;  3RK2 D;  1H0T A;  4U3F G;  4IL6 H;  1YIT P;  1LP1 A;  3A0H H;  3L73 G;  2YNY A;  3M9Q A;  2PRR A;  3I5C A;  3MUD C;  3M91 A;  3A0H E;  3BVH A;  1LT1 A;  1RF1 A;  1LTB C;  1P84 D;  2OYH C;  3TF5 A;  1MFT A;  3PTZ A;  1SQB G;  3L72 J;  3QH9 A;  2C9L Y;  1AV1 A;  3BAT A;  1SQV J;  3AE8 C;  2J58 A;  2YKQ A;  1QL1 A;  3GF7 A;  2D2C C;  5EFW B;  1AJY A;  2KZI A;  5BU5 A;  2IX7 C;  2FXM A;  2BCC G;  2OGU A;  1FBM A;  2WSS H;  4H0L D;  4PD4 H;  4H13 D;  2ZJS E;  4B86 A;  2GM4 A;  4KHX A;  4C7R A;  2OYI B;  3HTK A;  2FFD B;  1EC5 A;  3V5B A;  1KOR A;  1RF1 B;  4U3F E;  3AE2 C;  3MZW B;  3AE7 C;  2YKP A;  1CSB A;  1EDJ A;  2P58 A;  3W68 A;  4UB8 H;  3HD7 A;  3RK3 B;  3P7K A;  3S4R A;  1OFC X;  1RQU A;  1PZQ A;  3PH0 A;  3QWO C;  5KAI H;  3CCM P;  1KC8 Q;  3EWK A;  3JCU E;  2IYO A;  1WT6 A;  2ZT9 B;  1LWU C;  1SQP J;  1HJ0 A;  5CCG C;  3T97 A;  1KIL C;  3RL0 g;  3A2A A;  3N4X A;  5APU A;  3H1H D;  1XTG B;  2W6B A;  1RH5 B;  3RGU A;  1VQM P;  1L0N E;  3PJS K;  5AW7 B;  3SWF A;  1CI6 B;  1KB9 D;  3VMZ A;  3B4S A;  4ZKU A;  3D6Z A;  1SFC C;  3M9H A;  5AW6 B;  2NPS C;  3PLN A;  2IYP A;  2B89 A;  3VP9 A;  3B5N B;  2K3R A;  2NPS D;  2Z4E A;  2QVA A;  3LID A;  1IJD B;  3B5N D;  2WWW A;  1LWU B;  1GMJ A;  1NH4 A;  1NTZ E;  1NYH A;  1DEE G;  3CL3 D;  5B5E E;  1USD A;  5M1B A;  2IZ1 A;  1X22 A;  1BGY J;  1PPJ G;  3HE5 A;  3USS A;  1H8A A;  1OZH A;  4N78 D;  4UB6 H;  1HWT C;  2O3J A;  3PHL A;  1L0L G;  1L2P A;  1YQ4 C;  5KLI B;  3M0D C;  2O1J A;  2FYN C;  2W27 A;  1KFN A;  3H1H J;  1OW8 A;  1QGK B;  1N73 C;  5APV A;  3WMM 0;  3P8C E;  3HD7 D;  2VRS A;  1VQ7 P;  1NAF A;  3WUT A;  3SWK A;  3WU2 H;  4DJG A;  1FE6 A;  2HYN A;  2M0B A;  4IFM A;  3VMA A;  1KD1 Q;  1URQ C;  4I6M C;  1YJW P;  3LW5 J;  2E76 D;  3CME P;  2HLO A;  2KS1 A;  3H1J E;  1LTA C;  3S1K A;  1M1K Q;  1VQL P;  4WY4 B;  1J1D C;  1U7J A;  4GOD A;  2MKV A;  2IZ0 A;  3L75 E;  2R3C A;  1NTZ G;  4DZO A;  2V7Q H;  2JDI H;  3N7N A;  1HF9 A;  2HG5 D;  3TSI A;  1T8Z A;  1K05 A;  1E79 H;  3L74 D;  1QEX A;  3TGU G;  1YHQ P;  5DJT B;  2K37 A;  2Z5I A;  3F89 A;  3Q5P A;  4AUW A;  1L4A D;  2N1T D;  2QE7 H;  1LJ2 A;  2P7J A;  3SSU A;  4U3F J;  2IBZ E;  2A45 H;  1DX7 A;  3CX5 E;  2AXT H;  4HKZ H;  2IPP A;  1PP9 D;  1NTK D;  1OXZ A;  1KB9 I;  2I1J A;  3GHG C;  3PRJ A;  1H89 A;  1AA0 A;  1PGJ A;  3U1A A;  4AYC A;  3CCQ P;  1SQX K;  2HR3 A;  2Q6Q A;  4HB1 A;  3Q5R A;  4W80 A;  1IFI A;  2Z5H A;  2QJP C;  1K8A Q;  3L75 G;  2ZFC A;  1K73 Q;  5BU8 B;  3L73 E;  4RO0 A;  2JKV A;  1LTJ C;  2KIK A;  2SPZ A;  3VP8 A;  1NTM G;  2WSC H;  3VOP A;  3AE9 C;  3MGN A;  1S1C X;  2XU6 A;  1NOH A;  1BE3 G;  1FZB A;  4RES B;  1CZQ A;  1SQB E;  2H7H A;  2UWJ E;  3OJA B;  1FS0 E;  2R44 A;  2WPV B;  2IBZ G;  3O6Q B;  4ASW A;  2WT7 B;  1JO5 A;  1SQQ K;  3TNU B;  1FZC B;  1VF5 C;  3CXH E;  4GT1 A;  4YPC A;  1GD2 E;  3TDK A;  1ZN5 A;  5CJ0 A;  3KHU A;  3L71 G;  1FZA A;  1A02 J;  1KV4 A;  3RL0 B;  1AVY A;  1N8R Q;  4ZKP A;  1YIJ P;  1EXJ A;  1IO4 A;  2E42 A;  2LXC B;  2CK3 H;  3CWB D;  4OWF A;  2H8P D;  1FOS E;  1LTS C;  4I7Z B;  4PV1 B;  2OYH A;  1QVF O;  2ZT9 D;  2LR2 A;  4D6T G;  3G6E P;  2ZXX A;  1BE3 E;  1NU1 E;  2KYV A;  5AVU B;  2IDB A;  1SS1 A;  2B87 B;  2Q1K A;  2WPS A;  3BAS A;  5AW8 B;  1FZC C;  1GZL A;  1MV8 A;  1Q81 Q;  3WUU A;  2QA4 P;  3AED C;  3M9B A;  1SQX E;  2ZYA A;  3VTP C;  1JY3 P;  3A5T A;  1VQK P;  1L0N G;  2R32 A;  1X0T A;  2OQQ A;  4GOE A;  3L71 E;  1GW4 A;  1M1J A;  1SLQ A;  2E5T A;  2Y9Y A;  3IF4 A;  2W90 A;  1ZR4 A;  1SFC D;  2OAR A;  4H0L B;  3CCV P;  3V2Q A;  2HPC B;  1CI6 A;  4WBA A;  1JY2 N;  2M8R A;  3L4F A;  1YTZ I;  1BCC G;  2YIU C;  4WB4 A;  5AVT B;  1TU3 F;  3AE4 C;  1VF5 D;  3VMY A;  4D6T E;  3V4Q A;  5KJ7 C;  5AVV B;  1NTM K;  4OGQ B;  2AXT E;  1GK6 A;  1KQL A;  1S72 P;  2N9Y B;  5AVQ B;  5AW9 B;  1DIP A;  1SQP D;  1L0L E;  1S9K E;  1PL5 A;  5GTI E;  3CPW O;  3FWL A;  3T97 B;  1AQ5 A;  1ZW0 A;  1NVO A;  1IFJ A;  3M0A A;  4K3A A;  3BCC D;  5L8R J;  3RK2 B;  5GTI H;  5KKZ C;  2QG4 A;  1KIL A;  1NU1 D;  1KIL B;  2FYU J;  2IFN A;  3GHG A;  1KQS O;  1KFM A;  2JP3 A;  3CXH I;  3E7K A;  2C0W A;  1K04 A;  1P84 H;  2JWA A;  3H1L G;  3H1I G;  2CPS A;  2Q9I A;  2RN0 A;  3JSV C;  4IL6 X;  1Q86 Q;  2IFM A;  1BCC E;  2JJL A;  3HD7 C;  4H13 C;  5TIS H;  3V2R A;  1GDT A;  4N3Y B;  3A7O A;  1Y8A A;  2Q3E A;  2YXQ B;  4WY4 A;  4BRY A;  1QLE D;  3TGU E;  2QEX P;  4U7J A;  2FYU D;  3NXS A;  3H32 A;  3H32 B;  1NU1 K;  2E75 C;  5CCH A;  4WVZ A;  4EOT A;  4HH2 A;  3S9O A;  1A02 F;  4LC1 A;  3V2N A;  1Q82 Q;  1S3J A;  2V4H A;  2E5Y A;  2N9B A;  2WMM A;  1J2J B;  3HE4 A;  1PV3 A;  2WSE H;  2WSF H;  2ZYD A;  5KJ7 D;  3AEA C;  4IOI H;  4BWN A;  1DH3 A;  1GU5 A;  1IFP A;  2R5B A;  5AW3 B;  1BSH A;  1M7L A;  3R4Y A;  3H1L E;  4RKU J;  3OW2 O;  3CX5 I;  2I1K A;  2KLU A;  3FXD A;  3VYI A;  1ZME C;  2A06 G;  3C9I A;  4ZNC A;  1RHZ B;  1ZLL A;  2ZVN B;  3CWB G;  4YXW H;  1AFO A;  1RQV A;  2PAJ A;  2WZ7 A;  2O1K A;  2XV5 A;  1SQQ J;  5AVS B;  2HFE D;  1JCD A;  1EDI A;  1Y9B A;  1NTM E;  2JR8 A;  4H0L C;  2WSE J;  2WSF J;  4HYT B;  1KYO H;  2O01 N;  2P10 A;  5B66 H;  3CX5 D;  4NPE A;  1FZF A;  2C9N Y;  2E74 C;  2IBZ D;  1VQO P;  3OA7 A;  3JC2 2;  2K9J B;  4UB8 E;  2KUB A;  1GL2 A;  4A7P A;  4R4M A;  4K35 A;  3CD6 P;  1W2B O;  1D7M A;  4D6T J;  1KN7 A;  1NHL A;  1VPC A;  1EZV I;  1IK7 A;  1NWQ A;  3AEB C;  3H1K J;  2JEE A;  3NMD A;  4TT3 H;  3RK2 C;  3L75 D;  4PV1 D;  2AEF A;  3WUV A;  5APW A;  5GTH E;  5AVZ B;  1LWU A;  1LNQ A;  2QM8 A;  2OYI C;  2KOG A;  5KLI C;  3VN0 A;  5CBN A;  5KLV J;  2Y0C A;  1NTZ K;  2E74 B;  2KK7 A;  1IFN A;  3H1J J;  2C0X A;  2O01 H;  3H1L D;  4TLF A;  4XE5 B;  4BXL A;  1VQ6 P;  4W7Y A;  3RK3 C;  1GL2 B;  1L4A C;  1NU1 G;  2FBW C;  3W67 A;  1U57 A;  1N7L A;  3I56 P;  4RJT A;  5AW4 B;  4Y99 C;  2A06 D;  3SFE C;  1G2C B;  3H25 A;  1SQX G;  4N78 E;  1JUN A;  3TGU D;  3D70 A;  1Q90 D;  2KLV A;  1NKN A;  1T6A A;  2M5A A;  3BRV B;  1EXI A;  4GOF A;  3CC2 P;  2AEJ A;  1NTZ D;  4Z1M H;  3L37 A;  4W7Z A;  4IL6 E;  5AVR B;  1VQP P;  1JOC A;  3CMA P;  2E75 B;  1ZR2 A;  3CC4 P;  2NZ2 A;  1SQP E;  1GL2 D;  2WT7 A;  3L70 J;  3MIW A;  1Z56 A;  2FYU G;  5BVZ A;  1T2K C;  3CXH H;  1HGZ A;  1NTK J;  1PP9 J;  2D2C D;  3RBX A;  2BCC J;  1M56 D;  3Q1M A;  3MUD A;  3A0B H;  1FOS F;  2YO2 A;  2B87 A;  3L73 J;  3GHG B;  1RE4 C;  2N1T C;  2XDJ A;  4NPF X;  3V2P A;  1OVV A;  1S9K D;  2QJK B;  2YMK A;  3K5B A;  1EDK A;  1ZV8 A;  3H1I D;  1BDD A;  2Y0E A;  3MP7 B;  3CCR P;  1SQB J;  2KXP B;  4PD4 E;  3CCS P;  3Q2Y A;  2FFD C;  1NTK K;  1OX3 A;  5KAF E;  4YXD C;  1NTM J;  5CCH C;  1ZXG A;  4PD4 D;  4D6T D;  3CCE P;  1OW6 A;  5DJU B;  3H1I E;  1SQX D;  3BCC G;  1VQ5 P;  1JTH A;  2KZJ A;  3KQG A;  3GF3 A;  2GA1 A;  1JY2 P;  1URQ B;  1SQP G;  5KAI E;  3IN6 A;  3JCU H;  3AEC C;  2E74 D;  3C1L A;  4EIJ A;  4KT0 J;  2NPS A;  2Y0D A;  3U1C A;  3D71 A;  1K9M Q;  2QJK C;  3B5N A;  3BRT B;  3KXD A;  4PD4 I;  1NAY A;  3SFD C;  4ZMD A;  2P2U A;  2Q7C A;  1XTC C;  5APY A;  1HTL C;  4BRY B;  1VQ9 P;  1M90 Q;  3MD0 A;  4H44 C;  1G2C A;  1JNM A;  5KTB A;  2ITA A;  3GW6 A;  5AVW B;  1BE3 J;  1QX8 A;  2WPQ A;  1OMI A;  2WSC J; 
#chains in the Genus database with same CATH homology
 3B8E B;  3B5N C;  1SQP K;  5CCH D;  1SQV K;  1HVV A;  3G3Z A;  3HRN A;  1HH0 A;  2P1J A;  1MUU A;  2YMY A;  3OAK A;  1RE4 A;  2N1T A;  3HUS A;  3SWY A;  3TK1 A;  3HUS C;  5APQ A;  1GTW A;  1N73 A;  2GUV A;  5AVX B;  2XKM A;  3II6 A;  4JF7 A;  3VMX A;  1FZG A;  3MTU E;  4AQR D;  2M3B A;  1HUC A;  2N1T B;  1G1J A;  4WY4 C;  1JY2 O;  3KPE A;  1SQB K;  5AVY B;  1LT9 B;  1N7S C;  1SFC B;  1SFC A;  2NPS B;  5CHX A;  1JMM A;  1GU4 A;  1LTG C;  3O8Z A;  5APT A;  1GK4 A;  3EQ2 A;  1LTJ A;  1LTJ B;  2XNX A;  1T3J A;  1NKZ B;  2FYU K;  3V4W A;  1NO4 A;  1N7S B;  4DOJ A;  2WTY A;  1MZ9 A;  2WIT A;  1CW5 A;  1X8Y A;  1WRG A;  1L0L K;  2H43 A;  1LT9 A;  1GL2 C;  1L4A B;  1M1J C;  2KSJ A;  3RK3 D;  1GD2 E;  3RL0 D;  3P32 A;  5CCG A;  1N7S A;  4JYC A;  3HTK B;  2FFD A;  1J1D B;  1X79 B;  1J1E C;  2J59 M;  1EQ7 A;  2PP6 A;  3HUS B;  3RL0 C;  1IFM A;  5AW1 B;  1SVF A;  1RF1 C;  1GW3 A;  4GIF A;  1URQ A;  1X9V A;  1W2E A;  3NTN A;  4N6J A;  1RY3 A;  2Q3I A;  1L0N K;  3KDP B;  3L35 A;  1RE3 C;  2FYZ A;  1FU1 A;  3M06 A;  1JY3 O;  3E1I A;  1FJK A;  1JCC A;  3PP5 A;  1HGV A;  3LW5 H;  4C46 A;  2CPB A;  3L36 A;  1N7S D;  2W6A A;  5CCG D;  2OYI A;  5AW0 B;  1SP4 A;  2P67 A;  4WY4 D;  3UIA A;  3HE5 B;  4C7N A;  4C7N B;  1H88 A;  2MJZ A;  3U59 A;  3LIE A;  4O9B A;  5APS A;  1URQ D;  3HD7 B;  4XA4 A;  4GKG A;  1RF0 C;  1A02 F;  1LTI C;  1PFI A;  5CJ4 A;  3R2P A;  1FJP A;  1IK9 A;  2Q5U A;  1KZU B;  1IC2 A;  1N73 B;  1KIL D;  1N86 A;  4OH8 B;  1QL2 A;  1E5W A;  1J1E B;  1LTT C;  2A45 G;  1YYC A;  2YO3 A;  2L5G B;  2QM7 A;  4I1L A;  3A3Y B;  1G1I A;  3TNU A;  1FZC A;  1IFD A;  2LKM A;  4Y99 B;  3TYY A;  1FDM A;  1JTH B;  1HJB A;  2A45 I;  2R5D A;  1DEB A;  3M0D A;  4IFD K;  1FAV A;  1FZE A;  4I2L C;  2ZXE B;  1VDF A;  2GUS A;  3HE4 B;  4IFF A;  1LGH B;  4LGD E;  2YKO A;  2KP8 A;  1T3U A;  3EFG A;  1JY3 N;  1RF0 A;  3KYQ A;  1LT9 C;  4JYB A;  1T2K D;  4LLH A;  3CLQ A;  1L4A A;  1OWA A;  2KB7 P;  2HOD B;  1N2D C;  2HOD A;  2WPR A;  3P8C D;  2BAS A;  3H6P A;  5AW2 B;  2XZR A;  2Q7C A;  3IFM A;  5APX A;  5AW5 B;  3IR9 A;  1HBW A;  3CI9 A;  2POH A;  2E43 A;  3NFQ A;  2OYH B;  4M3L A;  5KLV K;  1M1J B;  1RE3 A;  2FKW B;  1YTZ T;  2HPC A;  1MFZ A;  3P8M C;  5CMZ A;  3RK2 D;  2YNY A;  3M9Q A;  3I5C A;  3BVH A;  3M91 A;  1RF1 A;  1LTB C;  2OYH C;  2C9L Y;  3BAT A;  2J58 A;  2YKQ A;  1QL1 A;  5BU5 A;  2IX7 C;  2FXM A;  1FBM A;  4B86 A;  2GM4 A;  4KHX A;  4C7R A;  2OYI B;  3HTK A;  2FFD B;  3V5B A;  1RF1 B;  2YKP A;  1CSB A;  3RK3 B;  3HD7 A;  3P7K A;  1WT6 A;  1LWU C;  5CCG C;  3T97 A;  1KIL C;  3A2A A;  3N4X A;  5APU A;  1XTG B;  2W6B A;  5AW7 B;  3SWF A;  1CI6 B;  3VMZ A;  4ZKU A;  1SFC C;  3M9H A;  5AW6 B;  2NPS C;  3VP9 A;  3B5N B;  2NPS D;  2Z4E A;  3LID A;  1IJD B;  3B5N D;  2WWW A;  1LWU B;  1NH4 A;  3CL3 D;  3HE5 A;  4N78 D;  1HWT C;  3M0D C;  2O1J A;  2W27 A;  1KFN A;  1N73 C;  5APV A;  3WMM 0;  3P8C E;  3HD7 D;  2VRS A;  1NAF A;  2HYN A;  4IFM A;  1URQ C;  4I6M C;  2HLO A;  1LTA C;  4WY4 B;  1J1D C;  2R3C A;  4DZO A;  3N7N A;  2HG5 D;  3TSI A;  1T8Z A;  4AUW A;  2Z5I A;  1L4A D;  2N1T D;  2P7J A;  2A45 H;  1DX7 A;  1H89 A;  2IPP A;  3GHG C;  1OXZ A;  2I1J A;  3U1A A;  4AYC A;  1SQX K;  4W80 A;  1IFI A;  2Z5H A;  2ZFC A;  5BU8 B;  3VOP A;  1LTJ C;  3VP8 A;  2WSC H;  3MGN A;  2XU6 A;  1NOH A;  1FZB A;  4RES B;  1CZQ A;  2H7H A;  3OJA B;  2WT7 B;  1JO5 A;  1SQQ K;  3TNU B;  1FZC B;  4GT1 A;  1ZN5 A;  5CJ0 A;  1A02 J;  1FZA A;  3RL0 B;  2E42 A;  1IO4 A;  4ZKP A;  2H8P D;  1FOS E;  1LTS C;  2OYH A;  2KYV A;  5AVU B;  5AW8 B;  1FZC C;  2WPS A;  3BAS A;  1GZL A;  1MV8 A;  3M9B A;  3VTP C;  3A5T A;  1JY3 P;  2R32 A;  1GW4 A;  1M1J A;  1SLQ A;  1ZR4 A;  1H8A A;  1SFC D;  2OAR A;  3V2Q A;  2HPC B;  1CI6 A;  4WBA A;  1JY2 N;  2M8R A;  3L4F A;  1YTZ I;  4WB4 A;  5AVT B;  3VMY A;  3V4Q A;  5KJ7 C;  5AVV B;  1NTM K;  1GK6 A;  1KQL A;  5AVQ B;  5AW9 B;  1S9K E;  1AQ5 A;  1IFJ A;  3M0A A;  3RK2 B;  1KIL A;  2IFN A;  1KIL B;  3GHG A;  1KFM A;  2C0W A;  2CPS A;  2Q9I A;  2IFM A;  2JJL A;  3HD7 C;  1GDT A;  3V2R A;  4N3Y B;  3A7O A;  4WY4 A;  3NXS A;  3H32 A;  3H32 B;  1NU1 K;  5CCH A;  4EOT A;  4HH2 A;  4LC1 A;  3V2N A;  2N9B A;  1J2J B;  3HE4 A;  2WSE H;  2WSF H;  1DH3 A;  5KJ7 D;  1GU5 A;  5AW3 B;  2R5B A;  1M7L A;  2I1K A;  3VYI A;  3C9I A;  1ZLL A;  1AFO A;  2PAJ A;  2WZ7 A;  2O1K A;  2XV5 A;  5AVS B;  2HFE D;  1JCD A;  4HYT B;  1FZF A;  2C9N Y;  3OA7 A;  1GL2 A;  1NHL A;  1VPC A;  1NWQ A;  2JEE A;  3NMD A;  3RK2 C;  5APW A;  5AVZ B;  1LWU A;  2QM8 A;  2OYI C;  2KOG A;  3VN0 A;  1NTZ K;  4XE5 B;  5KJ7 A;  1IFN A;  2C0X A;  2O01 H;  4W7Y A;  3RK3 C;  1GL2 B;  1L4A C;  1N7L A;  5AW4 B;  4Y99 C;  1G2C B;  1JUN A;  4N78 E;  2KLV A;  1NKN A;  3BRV B;  3L37 A;  4W7Z A;  5AVR B;  1JOC A;  1ZR2 A;  1GL2 D;  2WT7 A;  3MIW A;  1Z56 A;  5BVZ A;  1T2K C;  1HGZ A;  3MUD A;  1FOS F;  2YO2 A;  3GHG B;  1RE4 C;  2N1T C;  2XDJ A;  3V2P A;  1S9K D;  1ZV8 A;  2FFD C;  1NTK K;  5CCH C;  1JTH A;  3KQG A;  1JY2 P;  1URQ B;  3U1C A;  4EIJ A;  2NPS A;  3B5N A;  3BRT B;  2P2U A;  1XTC C;  5APY A;  1HTL C;  3MD0 A;  1JNM A;  1G2C A;  5KTB A;  5AVW B;  2WPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...