1N2DC

Ternary complex of mlc1p bound to iq2 and iq3 of myo2p, a class v myosin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
48
structure length
48
Chain Sequence
b'QISQAIKYLQNNIKGFIIRQRVNDEMKVNCATLLQAAYRGHSIRANVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myosin Light Chain
publication title Structure of the light chain-binding domain of myosin V.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 22
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2002-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n2dC00
1JCDA 2IX7C 1N2DC 1EQ7A 2GUSA 1T8ZA 1KFMA 1KFNA 3H6PA 1JCCA 2GUVA
chains in the Genus database with same CATH superfamily
3L72G 1U7MA 1GTWA 1GL2C 1PL5A 3H1HD 3HTKB 5AW4B 2Q6QA 5M1BA 3WU2H 1N8RQ 2O01N 2FYUK 2D2CC 1NHLA 3E1RA 2Q7CA 2B87A 5AW0B 5AW1B 3EWKA 1Q90D 4TT3H 1OXZA 2JDIH 3PH0A 3AEBC 2GUSA 1S72P 2O1JA 3L70J 1NTKE 5EFWB 1L0LJ 2ZVOB 1JY3P 2K9JB 1DH3A 1UIIA 1SQXK 3TF5A 1HBWA 1ZN5A 2Z5HA 1OFCX 3VP8A 1PZQA 1VPCA 3ITKA 1IZNB 1VQ5P 1J1EB 3WMM0 3VMZA 3M06A 2XKMA 2J5UA 2WPSA 2LXCB 5CJ4A 1ZRTE 2E76C 3AE5C 1ZW0A 1RQUA 1KYOH 1JB0J 2A45H 1L0NK 3O6QA 1M1JC 1FZCA 1OIPA 2HODA 5L8RJ 4ZNCA 1YHQP 1W2EA 1JO5A 4WBAA 4IFFA 2Q1KA 2MJZA 3RK3D 5GTIH 2M5AA 2OYHA 2WSEH 2FXMA 3H25A 1E5WA 3AE4C 5AW7B 1NU1E 2R44A 4L73A 2SPZA 3GLMA 3H1ID 3WUVA 1KYOI 2A45I 1USDA 1AJYA 2B9BA 2JKVA 1VQOP 1JNMA 3A0HH 5KAFH 1BCCD 3L71D 1MKMA 3GW6A 1BDCA 3RL0g 1M7LA 4I7ZB 1CI6A 1J1DB 2J59M 5KTBA 4BRYA 1LWUA 1IK9A 3MP7B 1E79H 4EDFA 3L73J 1HTLC 1ZV8A 2YMYA 2ZAEB 1DD3A 1T3UA 2HR3A 1SFCB 1KORA 5E79H 3VMAA 1AVOA 1NTZD 1LTTC 2JO1A 1RQVA 2KP8A 1NH4A 1JCDA 1LT9C 4XFJA 1KD1Q 1KQSO 4H0LC 1AA0A 2CK3H 4NPFX 1R5SA 1SQPK 1OWAA 4OWFA 3G71P 2KB7P 5B5EE 2Q3EA 1K04A 3IN6A 4PV1D 5KLIC 2L91A 2QJKB 1DIPA 3CWBD 2FYUD 4OGQD 3KQGA 2E74B 4ZKPA 1G1JA 3S4RA 3U1CA 2YIUC 2KOGA 5KJ7A 1AVYA 4I6MC 3G4SP 4N78E 3H1JG 4DZOA 1GK4A 3A0BE 1XTCC 3BCCE 2KZJA 3H32B 3KHUA 4WVZA 1GL2A 1SQXD 3L74G 3H1IJ 3M91A 1EZVG 1SLQA 1GL2D 1SQVK 4UB6H 5KLVJ 1H0TA 1HGVA 1RF1C 1QL2A 2WT7A 2D2CD 1DD4A 1Y8AA 1RF0C 3FXEA 2H89C 1L0ND 2WSCH 3HD7C 3TSIA 4N3YB 1MV8A 1L0LE 3EQ2A 1MFTA 4W7ZA 4AUWA 4QMAA 4K35A 3I5CA 3SFDC 2AXTE 1FZEA 3H1LJ 1PPJE 1RE4C 3FXDA 1BE3D 1URQB 3D70A 1NGMB 1AQTA 1T2KC 1M1JA 1VQKP 1PFIA 1SQBJ 4RO0A 5TJHA 2IBZD 3L73G 5DJUB 2W6BA 4HJGH 1VF5B 1KB9E 2FXPA 3CI9A 2CPBA 2G8YA 2LR2A 2B89A 3CWBJ 3V4QA 3L75E 5AVZB 5AVWB 3BATA 1PP9E 1QX8A 2IYPA 5B5EH 1IFMA 4JQ0D 1SQXJ 2H43A 2V7QH 1X79B 3GHGB 1YIJP 3M9HA 2AXCA 1DEBA 2WQYC 4C7NA 1NTME 1QEXA 1OVVA 3AE7C 1SQPD 3Q5SA 1FZCB 1IJDB 2HODB 1HWTC 3OAKA 5APXA 2QA4P 2YKOA 1IFDA 1GDTA 2P1JA 3H1IG 1T3JA 3B8EB 2M5AB 4GDOA 1LT9A 2PP6A 3RL0B 3P32A 2BEQD 2P2UA 2XNXA 4RKUJ 4WY4B 3CCMP 4R4MA 4H0LD 3TGUD 4U7JA 3A5TA 2JJLA 3RBXA 2A06D 2WSFH 2LKMA 3JC22 3HE4B 4N78D 1KZUB 1U7JA 2WPQA 1SQVD 1IFNA 3Q3DA 3B71A 3BCCD 4ZKUA 3M0DC 2B88A 1KILB 3S1KA 1CI6B 3MUDC 3F89A 1T8ZA 2PFXA 1LTJC 2AXTH 3AECC 4BRYB 1LWUB 1ZR4A 1KFMA 4JYBA 3H1LG 3GF7A 1YYCA 3LW5J 1FOSE 5AVXB 5AW8B 1KN7A 1Q86Q 1RF1A 1SQQK 1VL2A 3V2PA 5KLVE 4OVNF 2N1TB 1KB9H 3HUSA 4H44B 3V2RA 1VQ7P 1RF0A 2KK7A 4B86A 1SVFA 1L2PA 4JBZA 3CWBG 3HD7A 2FYUG 2JEEA 1NKNA 2I8DA 1Q2NA 3HD7D 4DOJA 1KILE 4PJ0E 3RBZA 2KYVA 3F5HA 2KLUA 4JYCA 1JEKA 2IYOA 1S9KD 1VQPP 5CCGD 2OTLP 4DT0A 3NTNA 1KV4A 1SQXG 3NXSA 1RE4A 1X8YA 1VQLP 1HJ0A 2PAJA 2MKVA 2ZFCA 1Y9BA 1VQ8P 1KB9I 2LXBA 1L4AD 3IFMA 4Y99C 4OH8B 1KB9D 4ASWA 2YKQA 1T2KD 2FYNC 3C1LA 1ZOYC 2HPCB 1LP1B 3FGAD 1N73B 2OGUA 2WZ7A 3VYIA 3D71A 3CCRP 3IAOA 1GW4A 1FAVA 1L0NG 3CC4P 2HLOA 4XE5B 1SQVJ 1NAFA 4EIJA 4AQRD 2KS1B 1QGKB 1LTAC 3C8VA 3CC7P 1YI2P 3FWNA 2RN0A 3LIDA 3VOPA 3JCUH 1BE3G 3L36A 5AW3B 1FZBA 3B5ND 1EDLA 3FWLA 2IBZG 1JTHB 2O1KA 4D6TD 2E76B 2NPSB 1NTKK 3H1JJ 1M1JB 1S1CX 1PGJA 2Z4EA 2YKPA 1N7SB 3G6EP 1A02F 2ZT9D 1BGYE 3L72E 1M56D 2H8PD 3L74J 1PGPA 5GTHH 2E75D 4H13D 4IL6E 4C46A 2P7JA 1X0TA 4U3FD 1VDFA 1BDDA 1IFIA 1J1EC 3AEFC 3MGNA 4HH2A 4GKGA 1AV1A 2FFDB 3QWOC 2Y9YA 1GW3A 2BCCD 3IR9A 4PJ0H 5APUA 3Q2YA 1FZAA 2WPRA 3KPEA 1H89A 3S9OA 1SQPG 1SQQD 2ZXXA 3M0DA 1H8AA 5DJTB 3MUDA 2YO3A 1KYOD 3Q1MA 1LTJA 1PGQA 4C7NB 1NU1K 3P7KA 3RL0D 3H1HJ 2FXOA 3PHLA 1IO4A 5K5GB 3A7OA 2OYIC 2RMZA 2QJYB 2ZVNB 3CXHE 1QL1A 5CCHC 3V5BA 1BSHA 3TGUG 2QSIA 3KXDA 2K9YA 3HE5A 2A06G 1K8AQ 3JSVC 2C0WA 3PJSK 3CMAP 1LJ2A 2OTKE 1SQVG 2KNCA 2I1JA 3VP9A 1J1DC 3A3YB 1KQLA 1EDIA 5KLIB 3H1KD 4BXLA 2HFED 3CX5E 2QVAA 1S5LE 2ZXEB 3W68A 4IFMA 1ZLLA 1SFCC 4YXWH 2N1TD 1KMIZ 3E7KA 4H44D 4U3FJ 1CW5A 5AVUB 1QVFO 3H6PA 3SFEC 1JUNA 3ZDMA 1VQMP 1RF1B 2BCCJ 4NPDA 3D6ZA 3IF4A 5KKZC 1TU3F 3HUSB 4IL6H 3AEDC 5TISE 2QJKC 2RH0A 1ZXGA 2P10A 4AYCA 1NTKD 4WWIA 3TYYA 1BCCJ 1XTGB 3L71J 5AW2B 1FBMA 4R4LA 5KAIE 5AVSB 2IFMA 3CCSP 3L70E 3KDPB 1QVGO 1NKZB 2FY8A 2H7HA 4PD4E 2YXRB 5CCGC 2QM8A 2QM7A 1WRGA 2WSEJ 2DW3A 2WWWA 1ZRTD 1J2JB 1NWQA 3SSUA 4YXDC 1BGYD 3RK2B 2IFNA 2XU6A 1L0LK 1L4AC 1NTZJ 3H1HG 4UB8E 3AE6C 3AE2C 1USEA 1GU4A 3AEGC 5BU8B 1JY2O 3CXHH 3L74E 3U1AA 1EZVE 2O01H 3KZIE 1EQ7A 1HJBA 4W7YA 2IZ0A 1NU1D 2B87B 1WT6A 1OVUA 4IL6X 2FYUJ 3GF3A 1EDJA 2ITAA 1URQC 5B66E 4D6TG 1N7SD 4LLHA 1YBKA 3VN0A 1K73Q 2KSEA 3VMXA 1YITP 1S5LH 5APTA 3CXHI 2K1AA 4GOFA 1VF5C 1GMJA 3B5NC 2W6JH 1FZGA 3W67A 2G3AA 1ZP0C 2OYIA 2XZRA 2R5BA 2KXPB 4U3FG 4GT1A 5APQA 5BVZA 3GMAA 1RY3A 5CCHA 4KT0J 3CL3D 1HGZA 3II6A 3O6QB 3FX0A 1NAYA 2ZT9C 3A0BH 5CCHD 3R4YA 4KHXA 3L73E 1YJ9P 3MHVA 2C9NY 1YTZI 1L0NJ 4ASVA 2E75C 3OJAB 3RK3B 4H13C 3OA7A 2BCCG 5BU5A 4EYYQ 1RHZB 1NTMK 4L76A 3GHGC 3CX5I 4GOEA 1SQQG 2OYHB 3A2AA 3BRTB 2W90A 2A45G 1JMBA 1BCCG 3L71G 3MD0A 1BE3J 1Y47A 5KAIH 1LTBC 1OW6A 3WU2E 2BEZF 1NO4A 1SFCA 2ZYAA 3I56P 2C0XA 2H88C 1LTJB 3GG2A 1VQ6P 4PD4H 4O9BA 3E1IA 1JY2N 1SFCD 3M0AA 2GUVA 2QJPC 1VQ4P 2WSCJ 1DEEG 3RL0C 2QE7H 4WY4C 5AVRB 3RK3E 2M3BA 4LC1A 2AEFA 1NTZG 2YO2A 2OYOA 3U59A 1AQ5A 3CCVP 1FDOA 1R8EA 3H1KG 3H1IE 1H88A 3KZIH 1LTGC 1UIXA 1KTMA 1QLED 2M8RA 2P58A 1P84I 1FU1A 2R5DA 3L70D 1KILC 1JOCA 2E74D 3EFGA 4PD4I 3HRNA 1L0LD 2E42A 4PD4D 5CHXA 1EXIA 2E43A 2FYZA 4PV1B 3V4WA 2E5TA 5KLVK 1WMKA 5CCGA 1SQPJ 4OGQB 3CC2P 1PPJD 1D7MA 1LTSC 2N1TC 2W83C 3TNUA 2FYNB 2Q9IA 1EZVI 1GU5A 1L4AA 4H44C 1NJIQ 3H1LE 2QIWA 1M57D 1NTKG 3K5BA 5APSA 3R2PA 2V7QJ 1YJWP 1OX3A 1GL2B 1K05A 3A0HE 2J58A 1SQBE 3TGUJ 5APWA 2JWAA 3C9IA 3OW2O 2GA1A 2D2CB 3L75D 1H0TB 1JMMA 2K3RA 1U57A 2WT7B 4L75A 5AVQB 5CBOA 1URQA 4L74A 1PP9D 4GIFA 3CCLP 2IPPA 3BCCJ 4MN4C 3CWBE 2FYUE 1SQBK 1LGHB 1PIXA 2XDJA 4Z1MH 2AEMA 1URQD 3LIEA 4I1LA 5CBNA 1BGYG 4Y28J 3V2QA 3AE1C 2WSSH 5E79E 1G2CA 1N73C 2KZIA 3B5NA 4HKZH 3CD6P 1NTMD 3P8MC 1SQXE 1R5LA 2ZJSE 1VF5D 2NRGA 4NPEA 3L73D 1Q82Q 1JY3O 2QEXP 1EC5A 2IDBA 2XV5A 3T97A 5CJ0A 2WSFJ 1NU1G 1HVVA 3AE3C 1N7LA 1DX7A 4N6JA 1HF9A 1JM0A 2YNYA 3N4XA 3CCEP 1L0NE 2ZYDA 3GHGA 1M90Q 1M8OB 4ZMDA 2YMKA 1KFNA 2Q3IA 2NPSC 1VQNP 1K9MQ 2Y0CA 1FS0E 1VQ9P 1N7SC 1BE3E 4JPZB 1A02J 3I55P 4UB6E 1M1KQ 1S3JA 1PV3A 1KQGB 2IBZE 2Y0DA 1Q81Q 2WMMA 4EI2A 2OYIB 3L75J 3AEEC 3PRJA 3SWYA 3BVHA 4WY4A 2AEJA 5CMZA 1LNQA 3NMDA 1MZ9A 3WUTA 1PP9J 4JF7A 4WY4D 3G9RA 2NZ2A 2XNDH 2FFDC 5KLVD 1YTZT 3HE4A 1IFJA 1KC8Q 4TLFA 5AW6B 3CCUP 2FBWC 1KILA 2Q5UA 1NTMJ 1LT9B 1N86A 4H0LB 1KILD 1LT1A 4RESB 2GM4A 2N9BA 4D6TJ 1G1IA 3PTZA 1MUUA 4I7ZC 3BCCG 4GODA 4I2LC 3WUUA 2PGDA 1JY3N 4BWNA 2QJYC 1HH0A 1SQPE 3SWFA 3N7NA 3V6IA 3NFQA 3H1LD 2N1TA 3MIWA 1KQFB 1EXJA 2YIUB 1GZLA 3Q5PA 1MFZA 2POHA 1SQBD 3SWKA 3VTPC 1FOSF 3AE8C 3L70G 2K37A 5KKZB 4YPCA 1L0LG 2HYNA 2WTYA 2JWDA 3TGUE 2O3JA 2ZYGA 2A06E 1SQQJ 2KIKA 4YTPC 1SQVE 5KJ7D 1PPJG 2E74C 1RE3C 5H2FE 3HD7B 3RGUA 2HPCA 1LP1A 1N73A 1EDKA 3BASA 1CZQA 3MTUE 1P84E 1FZFA 1Q7YQ 3HTKA 2V4HA 3HUSC 3TNUB 1L4AB 1NOHA 3G3ZA 4IFDK 2KS1A 2WPVB 3P8CE 2W6AA 2W27A 3L72D 1ZR2A 3L75G 3H1JE 4M3LA 3KYQA 1OVRA 1PP9G 3TDKA 1OMIA 1FDIA 3AE9C 2I1KA 2K9JA 3LW5H 3H1KJ 1IFPA 2IZ1A 1JTHA 3L37A 1JY2P 2NPSA 1S9KE 3AEAC 2R3CA 3RK2C 5AVTB 1NTMG 2E76D 2NPSD 3D6YA 1N7SA 2IBZI 3CCJP 2KI7B 1OW8A 3VMYA 3QH9A 1G2CB 2RKLA 3MZWB 2KLVA 1FDMA 3BRVB 3B5NB 2PRRA 3EFFK 2JR8A 1FC2C 4K3AA 1W2BO 1BSNA 1N2DC 3L4FA 3CX5H 1X9VA 3CPWO 2K88A 1YQ4C 1ZMEC 4HYTB 3T97B 3CXHD 4W80A 2ZT9B 3H1HE 5AW9B 2FFDA 1NTKJ 1W5CE 2JP3A 2E75B 2R3SA 4H13B 1S2EA 2E5YA 3M9QA 1FE6A 4WB4A 2W8ZA 2CPSA 1T6AA 3USSA 2BASA 3PP5A 4DJGA 5APYA 5TISH 4DCKA 3CLQA 3CX5D 4D6TE 1BGYJ 5H2FH 3V2NA 3L72J 3O8ZA 2VRSA 2IX7C 2Z5IA 2M0BA 2QJPB 1FZCC 2OTJP 1LTIC 1P84H 5KLVG 1AFOA 3RK3C 1SS1A 4A7PA 4HB1A 2OQQA 2OARA 4XA4A 4U3FE 3JCUE 1S5LX 2OYHC 2N9YB 1NU1J 3L35A 1IK7A 3M9BA 2WVRA 4IOIH 1YQ3C 2C9LY 4UB8H 1NYHA 4EOTA 1GK6A 2BCCE 4KJMA 3HE5B 1FJKA 1RE3A 1SQQE 2KNCB 4LGDE 1KYOE 2FKWB 1P84D 1RH5B 5APVA 1BCCE 3L71E 2WITA 5GTHE 3PLNA 2O01J 3TK1A 3H32A 1LWUC 1SQBG 4C7RA 2R32A 3ABVC 5B66H 2YXQB 2QRXA 1JCCA 3P8CD 1YJNP 2HG5D 3H1JD 3B4SA 3CCQP 5GTIE 1S4XA 2L5GB 3CMEP 5AW5B 3Q5RA 4Y99B 3L74D 1SP4A 1EZVD 4CPGA 1NTZE 2P67A 4PV1C 1GD2E 1OW7A 5KAFE 3UIAA 3H1KE 2M3EA 4OGQC 1NVOA 2KUBA 5AVYB 5AVVB 1OZHA 1NTZK 1PGOA 1IC2A 2QG4A 1Z56A 4RJTA 3RK2D 5KJ7C 1FJPA 5C39A 1CSBA 1HUCA 2Y0EA 2UWJE 2KSJA 1X22A 2Y9ZA
chains in the Genus database with same CATH topology
2XU6A 1KILA 2Q5UA 3A5TA 1GTWA 1GL2C 2JJLA 1L0LK 1L4AC 1LT9B 1N86A 3HTKB 5AW4B 2WSFH 2LKMA 1KILD 3HE4B 4N78D 2FYUK 1KZUB 1NHLA 4RESB 2Q7CA 2WPQA 2GM4A 2N9BA 1IFNA 1GU4A 5AW0B 1G1IA 5BU8B 1JY2O 1MUUA 5AW1B 4I2LC 4ZKUA 3M0DC 3U1AA 1KILB 1JY3N 1OXZA 1CI6B 2O01H 1EQ7A 2GUSA 1T8ZA 1HJBA 4W7YA 1LTJC 2O1JA 1HH0A 3SWFA 3N7NA 3NFQA 1LWUB 1ZR4A 1KFMA 4JYBA 1JY3P 1YYCA 2N1TA 1WT6A 3MIWA 1SQXK 1DH3A 1HBWA 1GZLA 1ZN5A 2Z5HA 3VP8A 1FOSE 1MFZA 1VPCA 5AVXB 1URQC 5AW8B 1N7SD 1J1EB 2POHA 3WMM0 3VMZA 3M06A 1RF1A 4LLHA 1SQQK 3VTPC 1FOSF 2XKMA 3V2PA 3VN0A 2WPSA 2N1TB 3HUSA 5CJ4A 3VMXA 2HYNA 5APTA 3V2RA 2WTYA 2A45H 1RF0A 4B86A 1SVFA 1L0NK 3B5NC 3HD7A 1M1JC 1FZGA 2JEEA 1FZCA 2HODA 1NKNA 2OYIA 3HD7D 2XZRA 4DOJA 2R5BA 1W2EA 4GT1A 2KYVA 5APQA 5BVZA 1JO5A 4WBAA 4IFFA 4JYCA 1RY3A 5CCHA 5KJ7D 1S9KD 3CL3D 2MJZA 1RE3C 5CCGD 1HGZA 3II6A 3RK3D 3HD7B 3NTNA 2OYHA 5CCHD 4KHXA 2WSEH 2HPCA 1N73A 2C9NY 1YTZI 3NXSA 1RE4A 1X8YA 2FXMA 1E5WA 5AW7B 2PAJA 3OJAB 3RK3B 3OA7A 2ZFCA 5BU5A 1NTMK 3BASA 1L4AD 3IFMA 1CZQA 3MTUE 3GHGC 4Y99C 4OH8B 1T2KD 2YKQA 1FZFA 2OYHB 2A45I 3A2AA 3HTKA 2HPCB 3HUSC 3TNUB 1N73B 2WZ7A 3VYIA 1L4AB 3BRTB 1JNMA 2A45G 1NOHA 3G3ZA 4IFDK 3MD0A 3P8CE 2W6AA 1GW4A 2W27A 1FAVA 1ZR2A 1M7LA 1LTBC 1CI6A 1J1DB 2J59M 4M3LA 3KYQA 2HLOA 1NO4A 1SFCA 4XE5B 5KTBA 2C0XA 1LTJB 1LWUA 1NAFA 1IK9A 4AQRD 4EIJA 4O9BA 3E1IA 1JY2N 1SFCD 3M0AA 2GUVA 2I1KA 1LTAC 3LW5H 1HTLC 1ZV8A 2YMYA 3LIDA 1T3UA 1JTHA 3L37A 3VOPA 3RL0C 1SFCB 1JY2P 3L36A 2NPSA 1S9KE 5AW3B 4WY4C 5AVRB 2M3BA 2R3CA 4LC1A 3RK2C 5AVTB 1FZBA 2YO2A 1LTTC 2NPSD 1N7SA 3U59A 2KP8A 1NH4A 3B5ND 1AQ5A 1JCDA 3VMYA 1LT9C 1G2CB 2O1KA 1JTHB 2NPSB 2KLVA 1NTKK 1H88A 1FDMA 1LTGC 1SQPK 1OWAA 3B5NB 3BRVB 1M1JB 2M8RA 2KB7P 2R5DA 1FU1A 2Z4EA 2YKPA 1N7SB 1KILC 1JOCA 3EFGA 1N2DC 3L4FA 1A02F 3HRNA 2E42A 1X9VA 5CHXA 2H8PD 2E43A 3KQGA 4HYTB 4W80A 4ZKPA 2FYZA 1G1JA 3U1CA 3V4WA 4C46A 2KOGA 5KJ7A 2P7JA 4I6MC 5AW9B 5KLVK 2FFDA 5CCGA 1VDFA 4N78E 1IFIA 4DZOA 1GK4A 1J1EC 3MGNA 1XTCC 3H32B 1LTSC 3M9QA 4HH2A 2N1TC 4WB4A 1GL2A 3TNUA 4GKGA 2Q9IA 1GU5A 1L4AA 2CPSA 2FFDB 1GW3A 3IR9A 2BASA 3M91A 1SLQA 3PP5A 1GL2D 5APYA 1SQVK 5APUA 1HGVA 1FZAA 2WPRA 3KPEA 1H89A 1RF1C 5APSA 1QL2A 2WT7A 3M0DA 3R2PA 3CLQA 1H8AA 3MUDA 1GL2B 2J58A 3V2NA 2YO3A 1LTJA 5APWA 3C9IA 3O8ZA 2VRSA 2IX7C 4C7NB 2Z5IA 1NU1K 3P7KA 1RF0C 3RL0D 2WSCH 3HD7C 3TSIA 1IO4A 4N3YB 1JMMA 1FZCC 1MV8A 2WT7B 5AVQB 3A7OA 2OYIC 1LTIC 1URQA 3EQ2A 4GIFA 1AFOA 2IPPA 3RK3C 1SQBK 1LGHB 2XDJA 1QL1A 5CCHC 4W7ZA 1URQD 2OARA 3LIEA 4I1LA 4AUWA 4XA4A 3V5BA 3V2QA 3I5CA 2OYHC 1G2CA 1FZEA 1N73C 1RE4C 3L35A 1URQB 3HE5A 2C0WA 3B5NA 3M9BA 1T2KC 1M1JA 3P8MC 1PFIA 2C9LY 2I1JA 3VP9A 4EOTA 1J1DC 3A3YB 1GK6A 1KQLA 1JY3O 2W6BA 3HE5B 2XV5A 3T97A 1FJKA 5CJ0A 1RE3A 2HFED 3CI9A 1HVVA 2CPBA 1N7LA 4LGDE 1DX7A 2ZXEB 4N6JA 2FKWB 4IFMA 1ZLLA 1SFCC 5APVA 2YNYA 3N4XA 2WITA 3V4QA 2N1TD 3TK1A 3H32A 1LWUC 5AVZB 4C7RA 2R32A 5AVWB 3GHGA 3BATA 1CW5A 5AVUB 1JCCA 3P8CD 2HG5D 1KFNA 2Q3IA 3H6PA 2NPSC 1JUNA 1IFMA 2H43A 1X79B 2L5GB 5AW5B 3GHGB 4Y99B 3M9HA 1RF1B 1N7SC 1DEBA 1A02J 1SP4A 3HUSB 4C7NA 4AYCA 2P67A 1GD2E 3TYYA 1FZCB 1XTGB 1IJDB 2HODB 1HWTC 3OAKA 5APXA 3UIAA 2OYIB 5AW2B 1FBMA 3SWYA 5AVYB 3BVHA 4WY4A 5CMZA 5AVVB 2YKOA 5AVSB 2IFMA 1IFDA 3NMDA 1MZ9A 1NTZK 4JF7A 3KDPB 1GDTA 2P1JA 4WY4D 1IC2A 1T3JA 3B8EB 1NKZB 1Z56A 2H7HA 3RK2D 5KJ7C 1FJPA 1LT9A 2FFDC 2PP6A 5CCGC 1CSBA 3RL0B 2QM8A 1HUCA 1YTZT 2QM7A 1WRGA 3HE4A 3P32A 2P2UA 2XNXA 1IFJA 2KSJA 2WWWA 4WY4B 1J2JB 1NWQA 3RK2B 5AW6B 2IFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JCD A;  2IX7 C;  1N2D C;  1EQ7 A;  2GUS A;  1T8Z A;  1KFM A;  1KFN A;  3H6P A;  1JCC A;  2GUV A; 
#chains in the Genus database with same CATH topology
 3L72 G;  1U7M A;  1GTW A;  1GL2 C;  1PL5 A;  3H1H D;  3HTK B;  5AW4 B;  2Q6Q A;  5M1B A;  3WU2 H;  1N8R Q;  2O01 N;  2FYU K;  2D2C C;  1NHL A;  3E1R A;  2Q7C A;  2B87 A;  5AW0 B;  5AW1 B;  3EWK A;  1Q90 D;  4TT3 H;  1OXZ A;  2JDI H;  3PH0 A;  3AEB C;  2GUS A;  1S72 P;  2O1J A;  3L70 J;  1NTK E;  5EFW B;  1L0L J;  2ZVO B;  1JY3 P;  2K9J B;  1DH3 A;  1UII A;  1SQX K;  3TF5 A;  1HBW A;  1ZN5 A;  2Z5H A;  1OFC X;  3VP8 A;  1PZQ A;  1VPC A;  3ITK A;  1IZN B;  1VQ5 P;  1J1E B;  3WMM 0;  3VMZ A;  3M06 A;  2XKM A;  2J5U A;  2WPS A;  2LXC B;  5CJ4 A;  1ZRT E;  2E76 C;  3AE5 C;  1ZW0 A;  1RQU A;  1KYO H;  1JB0 J;  2A45 H;  1L0N K;  3O6Q A;  1M1J C;  1FZC A;  1OIP A;  2HOD A;  5L8R J;  4ZNC A;  1YHQ P;  1W2E A;  1JO5 A;  4WBA A;  4IFF A;  2Q1K A;  2MJZ A;  3RK3 D;  5GTI H;  2M5A A;  2OYH A;  2WSE H;  2FXM A;  3H25 A;  1E5W A;  3AE4 C;  5AW7 B;  1NU1 E;  2R44 A;  4L73 A;  2SPZ A;  3GLM A;  3H1I D;  3WUV A;  1KYO I;  2A45 I;  1USD A;  1AJY A;  2B9B A;  2JKV A;  1VQO P;  1JNM A;  3A0H H;  5KAF H;  1BCC D;  3L71 D;  1MKM A;  3GW6 A;  1BDC A;  3RL0 g;  1M7L A;  4I7Z B;  1CI6 A;  1J1D B;  2J59 M;  5KTB A;  4BRY A;  1LWU A;  1IK9 A;  3MP7 B;  1E79 H;  4EDF A;  3L73 J;  1HTL C;  1ZV8 A;  2YMY A;  2ZAE B;  1DD3 A;  1T3U A;  2HR3 A;  1SFC B;  1KOR A;  5E79 H;  3VMA A;  1AVO A;  1NTZ D;  1LTT C;  2JO1 A;  1RQV A;  2KP8 A;  1NH4 A;  1JCD A;  1LT9 C;  4XFJ A;  1KD1 Q;  1KQS O;  4H0L C;  1AA0 A;  2CK3 H;  4NPF X;  1R5S A;  1SQP K;  1OWA A;  4OWF A;  3G71 P;  2KB7 P;  5B5E E;  2Q3E A;  1K04 A;  3IN6 A;  4PV1 D;  5KLI C;  2L91 A;  2QJK B;  1DIP A;  3CWB D;  2FYU D;  4OGQ D;  3KQG A;  2E74 B;  4ZKP A;  1G1J A;  3S4R A;  3U1C A;  2YIU C;  2KOG A;  5KJ7 A;  1AVY A;  4I6M C;  3G4S P;  4N78 E;  3H1J G;  4DZO A;  1GK4 A;  3A0B E;  1XTC C;  3BCC E;  2KZJ A;  3H32 B;  3KHU A;  4WVZ A;  1GL2 A;  1SQX D;  3L74 G;  3H1I J;  3M91 A;  1EZV G;  1SLQ A;  1GL2 D;  1SQV K;  4UB6 H;  5KLV J;  1H0T A;  1HGV A;  1RF1 C;  1QL2 A;  2WT7 A;  2D2C D;  1DD4 A;  1Y8A A;  1RF0 C;  3FXE A;  2H89 C;  1L0N D;  2WSC H;  3HD7 C;  3TSI A;  4N3Y B;  1MV8 A;  1L0L E;  3EQ2 A;  1MFT A;  4W7Z A;  4AUW A;  4QMA A;  4K35 A;  3I5C A;  3SFD C;  2AXT E;  1FZE A;  3H1L J;  1PPJ E;  1RE4 C;  3FXD A;  1BE3 D;  1URQ B;  3D70 A;  1NGM B;  1AQT A;  1T2K C;  1M1J A;  1VQK P;  1PFI A;  1SQB J;  4RO0 A;  5TJH A;  2IBZ D;  3L73 G;  5DJU B;  2W6B A;  4HJG H;  1VF5 B;  1KB9 E;  2FXP A;  3CI9 A;  2CPB A;  2G8Y A;  2LR2 A;  2B89 A;  3CWB J;  3V4Q A;  3L75 E;  5AVZ B;  5AVW B;  3BAT A;  1PP9 E;  1QX8 A;  2IYP A;  5B5E H;  1IFM A;  4JQ0 D;  1SQX J;  2H43 A;  2V7Q H;  1X79 B;  3GHG B;  1YIJ P;  3M9H A;  2AXC A;  1DEB A;  2WQY C;  4C7N A;  1NTM E;  1QEX A;  1OVV A;  3AE7 C;  1SQP D;  3Q5S A;  1FZC B;  1IJD B;  2HOD B;  1HWT C;  3OAK A;  5APX A;  2QA4 P;  2YKO A;  1IFD A;  1GDT A;  2P1J A;  3H1I G;  1T3J A;  3B8E B;  2M5A B;  4GDO A;  1LT9 A;  2PP6 A;  3RL0 B;  3P32 A;  2BEQ D;  2P2U A;  2XNX A;  4RKU J;  4WY4 B;  3CCM P;  4R4M A;  4H0L D;  3TGU D;  4U7J A;  3A5T A;  2JJL A;  3RBX A;  2A06 D;  2WSF H;  2LKM A;  3JC2 2;  3HE4 B;  4N78 D;  1KZU B;  1U7J A;  2WPQ A;  1SQV D;  1IFN A;  3Q3D A;  3B71 A;  3BCC D;  4ZKU A;  3M0D C;  2B88 A;  1KIL B;  3S1K A;  1CI6 B;  3MUD C;  3F89 A;  1T8Z A;  2PFX A;  1LTJ C;  2AXT H;  3AEC C;  4BRY B;  1LWU B;  1ZR4 A;  1KFM A;  4JYB A;  3H1L G;  3GF7 A;  1YYC A;  3LW5 J;  1FOS E;  5AVX B;  5AW8 B;  1KN7 A;  1Q86 Q;  1RF1 A;  1SQQ K;  1VL2 A;  3V2P A;  5KLV E;  4OVN F;  2N1T B;  1KB9 H;  3HUS A;  4H44 B;  3V2R A;  1VQ7 P;  1RF0 A;  2KK7 A;  4B86 A;  1SVF A;  1L2P A;  4JBZ A;  3CWB G;  3HD7 A;  2FYU G;  2JEE A;  1NKN A;  2I8D A;  1Q2N A;  3HD7 D;  4DOJ A;  1KIL E;  4PJ0 E;  3RBZ A;  2KYV A;  3F5H A;  2KLU A;  4JYC A;  1JEK A;  2IYO A;  1S9K D;  1VQP P;  5CCG D;  2OTL P;  4DT0 A;  3NTN A;  1KV4 A;  1SQX G;  3NXS A;  1RE4 A;  1X8Y A;  1VQL P;  1HJ0 A;  2PAJ A;  2MKV A;  2ZFC A;  1Y9B A;  1VQ8 P;  1KB9 I;  2LXB A;  1L4A D;  3IFM A;  4Y99 C;  4OH8 B;  1KB9 D;  4ASW A;  2YKQ A;  1T2K D;  2FYN C;  3C1L A;  1ZOY C;  2HPC B;  1LP1 B;  3FGA D;  1N73 B;  2OGU A;  2WZ7 A;  3VYI A;  3D71 A;  3CCR P;  3IAO A;  1GW4 A;  1FAV A;  1L0N G;  3CC4 P;  2HLO A;  4XE5 B;  1SQV J;  1NAF A;  4EIJ A;  4AQR D;  2KS1 B;  1QGK B;  1LTA C;  3C8V A;  3CC7 P;  1YI2 P;  3FWN A;  2RN0 A;  3LID A;  3VOP A;  3JCU H;  1BE3 G;  3L36 A;  5AW3 B;  1FZB A;  3B5N D;  1EDL A;  3FWL A;  2IBZ G;  1JTH B;  2O1K A;  4D6T D;  2E76 B;  2NPS B;  1NTK K;  3H1J J;  1M1J B;  1S1C X;  1PGJ A;  2Z4E A;  2YKP A;  1N7S B;  3G6E P;  1A02 F;  2ZT9 D;  1BGY E;  3L72 E;  1M56 D;  2H8P D;  3L74 J;  1PGP A;  5GTH H;  2E75 D;  4H13 D;  4IL6 E;  4C46 A;  2P7J A;  1X0T A;  4U3F D;  1VDF A;  1BDD A;  1IFI A;  1J1E C;  3AEF C;  3MGN A;  4HH2 A;  4GKG A;  1AV1 A;  2FFD B;  3QWO C;  2Y9Y A;  1GW3 A;  2BCC D;  3IR9 A;  4PJ0 H;  5APU A;  3Q2Y A;  1FZA A;  2WPR A;  3KPE A;  1H89 A;  3S9O A;  1SQP G;  1SQQ D;  2ZXX A;  3M0D A;  1H8A A;  5DJT B;  3MUD A;  2YO3 A;  1KYO D;  3Q1M A;  1LTJ A;  1PGQ A;  4C7N B;  1NU1 K;  3P7K A;  3RL0 D;  3H1H J;  2FXO A;  3PHL A;  1IO4 A;  5K5G B;  3A7O A;  2OYI C;  2RMZ A;  2QJY B;  2ZVN B;  3CXH E;  1QL1 A;  5CCH C;  3V5B A;  1BSH A;  3TGU G;  2QSI A;  3KXD A;  2K9Y A;  3HE5 A;  2A06 G;  1K8A Q;  3JSV C;  2C0W A;  3PJS K;  3CMA P;  1LJ2 A;  2OTK E;  1SQV G;  2KNC A;  2I1J A;  3VP9 A;  1J1D C;  3A3Y B;  1KQL A;  1EDI A;  5KLI B;  3H1K D;  4BXL A;  2HFE D;  3CX5 E;  2QVA A;  1S5L E;  2ZXE B;  3W68 A;  4IFM A;  1ZLL A;  1SFC C;  4YXW H;  2N1T D;  1KMI Z;  3E7K A;  4H44 D;  4U3F J;  1CW5 A;  5AVU B;  1QVF O;  3H6P A;  3SFE C;  1JUN A;  3ZDM A;  1VQM P;  1RF1 B;  2BCC J;  4NPD A;  3D6Z A;  3IF4 A;  5KKZ C;  1TU3 F;  3HUS B;  4IL6 H;  3AED C;  5TIS E;  2QJK C;  2RH0 A;  1ZXG A;  2P10 A;  4AYC A;  1NTK D;  4WWI A;  3TYY A;  1BCC J;  1XTG B;  3L71 J;  5AW2 B;  1FBM A;  4R4L A;  5KAI E;  5AVS B;  2IFM A;  3CCS P;  3L70 E;  3KDP B;  1QVG O;  1NKZ B;  2FY8 A;  2H7H A;  4PD4 E;  2YXR B;  5CCG C;  2QM8 A;  2QM7 A;  1WRG A;  2WSE J;  2DW3 A;  2WWW A;  1ZRT D;  1J2J B;  1NWQ A;  3SSU A;  4YXD C;  1BGY D;  3RK2 B;  2IFN A;  2XU6 A;  1L0L K;  1L4A C;  1NTZ J;  3H1H G;  4UB8 E;  3AE6 C;  3AE2 C;  1USE A;  1GU4 A;  3AEG C;  5BU8 B;  1JY2 O;  3CXH H;  3L74 E;  3U1A A;  1EZV E;  2O01 H;  3KZI E;  1EQ7 A;  1HJB A;  4W7Y A;  2IZ0 A;  1NU1 D;  2B87 B;  1WT6 A;  1OVU A;  4IL6 X;  2FYU J;  3GF3 A;  1EDJ A;  2ITA A;  1URQ C;  5B66 E;  4D6T G;  1N7S D;  4LLH A;  1YBK A;  3VN0 A;  1K73 Q;  2KSE A;  3VMX A;  1YIT P;  1S5L H;  5APT A;  3CXH I;  2K1A A;  4GOF A;  1VF5 C;  1GMJ A;  3B5N C;  2W6J H;  1FZG A;  3W67 A;  2G3A A;  1ZP0 C;  2OYI A;  2XZR A;  2R5B A;  2KXP B;  4U3F G;  4GT1 A;  5APQ A;  5BVZ A;  3GMA A;  1RY3 A;  5CCH A;  4KT0 J;  3CL3 D;  1HGZ A;  3II6 A;  3O6Q B;  3FX0 A;  1NAY A;  2ZT9 C;  3A0B H;  5CCH D;  3R4Y A;  4KHX A;  3L73 E;  1YJ9 P;  3MHV A;  2C9N Y;  1YTZ I;  1L0N J;  4ASV A;  2E75 C;  3OJA B;  3RK3 B;  4H13 C;  3OA7 A;  2BCC G;  5BU5 A;  4EYY Q;  1RHZ B;  1NTM K;  4L76 A;  3GHG C;  3CX5 I;  4GOE A;  1SQQ G;  2OYH B;  3A2A A;  3BRT B;  2W90 A;  2A45 G;  1JMB A;  1BCC G;  3L71 G;  3MD0 A;  1BE3 J;  1Y47 A;  5KAI H;  1LTB C;  1OW6 A;  3WU2 E;  2BEZ F;  1NO4 A;  1SFC A;  2ZYA A;  3I56 P;  2C0X A;  2H88 C;  1LTJ B;  3GG2 A;  1VQ6 P;  4PD4 H;  4O9B A;  3E1I A;  1JY2 N;  1SFC D;  3M0A A;  2GUV A;  2QJP C;  1VQ4 P;  2WSC J;  1DEE G;  3RL0 C;  2QE7 H;  4WY4 C;  5AVR B;  3RK3 E;  2M3B A;  4LC1 A;  2AEF A;  1NTZ G;  2YO2 A;  2OYO A;  3U59 A;  1AQ5 A;  3CCV P;  1FDO A;  1R8E A;  3H1K G;  3H1I E;  1H88 A;  3KZI H;  1LTG C;  1UIX A;  1KTM A;  1QLE D;  2M8R A;  2P58 A;  1P84 I;  1FU1 A;  2R5D A;  3L70 D;  1KIL C;  1JOC A;  2E74 D;  3EFG A;  4PD4 I;  3HRN A;  1L0L D;  2E42 A;  4PD4 D;  5CHX A;  1EXI A;  2E43 A;  2FYZ A;  4PV1 B;  3V4W A;  2E5T A;  5KLV K;  1WMK A;  5CCG A;  1SQP J;  4OGQ B;  3CC2 P;  1PPJ D;  1D7M A;  1LTS C;  2N1T C;  2W83 C;  3TNU A;  2FYN B;  2Q9I A;  1EZV I;  1GU5 A;  1L4A A;  4H44 C;  1NJI Q;  3H1L E;  2QIW A;  1M57 D;  1NTK G;  3K5B A;  5APS A;  3R2P A;  2V7Q J;  1YJW P;  1OX3 A;  1GL2 B;  1K05 A;  3A0H E;  2J58 A;  1SQB E;  3TGU J;  5APW A;  2JWA A;  3C9I A;  3OW2 O;  2GA1 A;  2D2C B;  3L75 D;  1H0T B;  1JMM A;  2K3R A;  1U57 A;  2WT7 B;  4L75 A;  5AVQ B;  5CBO A;  1URQ A;  4L74 A;  1PP9 D;  4GIF A;  3CCL P;  2IPP A;  3BCC J;  4MN4 C;  3CWB E;  2FYU E;  1SQB K;  1LGH B;  1PIX A;  2XDJ A;  4Z1M H;  2AEM A;  1URQ D;  3LIE A;  4I1L A;  5CBN A;  1BGY G;  4Y28 J;  3V2Q A;  3AE1 C;  2WSS H;  5E79 E;  1G2C A;  1N73 C;  2KZI A;  3B5N A;  4HKZ H;  3CD6 P;  1NTM D;  3P8M C;  1SQX E;  1R5L A;  2ZJS E;  1VF5 D;  2NRG A;  4NPE A;  3L73 D;  1Q82 Q;  1JY3 O;  2QEX P;  1EC5 A;  2IDB A;  2XV5 A;  3T97 A;  5CJ0 A;  2WSF J;  1NU1 G;  1HVV A;  3AE3 C;  1N7L A;  1DX7 A;  4N6J A;  1HF9 A;  1JM0 A;  2YNY A;  3N4X A;  3CCE P;  1L0N E;  2ZYD A;  3GHG A;  1M90 Q;  1M8O B;  4ZMD A;  2YMK A;  1KFN A;  2Q3I A;  2NPS C;  1VQN P;  1K9M Q;  2Y0C A;  1FS0 E;  1VQ9 P;  1N7S C;  1BE3 E;  4JPZ B;  1A02 J;  3I55 P;  4UB6 E;  1M1K Q;  1S3J A;  1PV3 A;  1KQG B;  2IBZ E;  2Y0D A;  1Q81 Q;  2WMM A;  4EI2 A;  2OYI B;  3L75 J;  3AEE C;  3PRJ A;  3SWY A;  3BVH A;  4WY4 A;  2AEJ A;  5CMZ A;  1LNQ A;  3NMD A;  1MZ9 A;  3WUT A;  1PP9 J;  4JF7 A;  4WY4 D;  3G9R A;  2NZ2 A;  2XND H;  2FFD C;  5KLV D;  1YTZ T;  3HE4 A;  1IFJ A;  1KC8 Q;  4TLF A;  5AW6 B;  3CCU P;  2FBW C;  1KIL A;  2Q5U A;  1NTM J;  1LT9 B;  1N86 A;  4H0L B;  1KIL D;  1LT1 A;  4RES B;  2GM4 A;  2N9B A;  4D6T J;  1G1I A;  3PTZ A;  1MUU A;  4I7Z C;  3BCC G;  4GOD A;  4I2L C;  3WUU A;  2PGD A;  1JY3 N;  4BWN A;  2QJY C;  1HH0 A;  1SQP E;  3SWF A;  3N7N A;  3V6I A;  3NFQ A;  3H1L D;  2N1T A;  3MIW A;  1KQF B;  1EXJ A;  2YIU B;  1GZL A;  3Q5P A;  1MFZ A;  2POH A;  1SQB D;  3SWK A;  3VTP C;  1FOS F;  3AE8 C;  3L70 G;  2K37 A;  5KKZ B;  4YPC A;  1L0L G;  2HYN A;  2WTY A;  2JWD A;  3TGU E;  2O3J A;  2ZYG A;  2A06 E;  1SQQ J;  2KIK A;  4YTP C;  1SQV E;  5KJ7 D;  1PPJ G;  2E74 C;  1RE3 C;  5H2F E;  3HD7 B;  3RGU A;  2HPC A;  1LP1 A;  1N73 A;  1EDK A;  3BAS A;  1CZQ A;  3MTU E;  1P84 E;  1FZF A;  1Q7Y Q;  3HTK A;  2V4H A;  3HUS C;  3TNU B;  1L4A B;  1NOH A;  3G3Z A;  4IFD K;  2KS1 A;  2WPV B;  3P8C E;  2W6A A;  2W27 A;  3L72 D;  1ZR2 A;  3L75 G;  3H1J E;  4M3L A;  3KYQ A;  1OVR A;  1PP9 G;  3TDK A;  1OMI A;  1FDI A;  3AE9 C;  2I1K A;  2K9J A;  3LW5 H;  3H1K J;  1IFP A;  2IZ1 A;  1JTH A;  3L37 A;  1JY2 P;  2NPS A;  1S9K E;  3AEA C;  2R3C A;  3RK2 C;  5AVT B;  1NTM G;  2E76 D;  2NPS D;  3D6Y A;  1N7S A;  2IBZ I;  3CCJ P;  2KI7 B;  1OW8 A;  3VMY A;  3QH9 A;  1G2C B;  2RKL A;  3MZW B;  2KLV A;  1FDM A;  3BRV B;  3B5N B;  2PRR A;  3EFF K;  2JR8 A;  1FC2 C;  4K3A A;  1W2B O;  1BSN A;  1N2D C;  3L4F A;  3CX5 H;  1X9V A;  3CPW O;  2K88 A;  1YQ4 C;  1ZME C;  4HYT B;  3T97 B;  3CXH D;  4W80 A;  2ZT9 B;  3H1H E;  5AW9 B;  2FFD A;  1NTK J;  1W5C E;  2JP3 A;  2E75 B;  2R3S A;  4H13 B;  1S2E A;  2E5Y A;  3M9Q A;  1FE6 A;  4WB4 A;  2W8Z A;  2CPS A;  1T6A A;  3USS A;  2BAS A;  3PP5 A;  4DJG A;  5APY A;  5TIS H;  4DCK A;  3CLQ A;  3CX5 D;  4D6T E;  1BGY J;  5H2F H;  3V2N A;  3L72 J;  3O8Z A;  2VRS A;  2IX7 C;  2Z5I A;  2M0B A;  2QJP B;  1FZC C;  2OTJ P;  1LTI C;  1P84 H;  5KLV G;  1AFO A;  3RK3 C;  1SS1 A;  4A7P A;  4HB1 A;  2OQQ A;  2OAR A;  4XA4 A;  4U3F E;  3JCU E;  1S5L X;  2OYH C;  2N9Y B;  1NU1 J;  3L35 A;  1IK7 A;  3M9B A;  2WVR A;  4IOI H;  1YQ3 C;  2C9L Y;  4UB8 H;  1NYH A;  4EOT A;  1GK6 A;  2BCC E;  4KJM A;  3HE5 B;  1FJK A;  1RE3 A;  1SQQ E;  2KNC B;  4LGD E;  1KYO E;  2FKW B;  1P84 D;  1RH5 B;  5APV A;  1BCC E;  3L71 E;  2WIT A;  5GTH E;  3PLN A;  2O01 J;  3TK1 A;  3H32 A;  1LWU C;  1SQB G;  4C7R A;  2R32 A;  3ABV C;  5B66 H;  2YXQ B;  2QRX A;  1JCC A;  3P8C D;  1YJN P;  2HG5 D;  3H1J D;  3B4S A;  3CCQ P;  5GTI E;  1S4X A;  2L5G B;  3CME P;  5AW5 B;  3Q5R A;  4Y99 B;  3L74 D;  1SP4 A;  1EZV D;  4CPG A;  1NTZ E;  2P67 A;  4PV1 C;  1GD2 E;  1OW7 A;  5KAF E;  3UIA A;  3H1K E;  2M3E A;  4OGQ C;  1NVO A;  2KUB A;  5AVY B;  5AVV B;  1OZH A;  1NTZ K;  1PGO A;  1IC2 A;  2QG4 A;  1Z56 A;  4RJT A;  3RK2 D;  5KJ7 C;  1FJP A;  5C39 A;  1CSB A;  1HUC A;  2Y0E A;  2UWJ E;  2KSJ A;  1X22 A;  2Y9Z A; 
#chains in the Genus database with same CATH homology
 2XU6 A;  1KIL A;  2Q5U A;  3A5T A;  1GTW A;  1GL2 C;  2JJL A;  1L0L K;  1L4A C;  1LT9 B;  1N86 A;  3HTK B;  5AW4 B;  2WSF H;  2LKM A;  1KIL D;  3HE4 B;  4N78 D;  2FYU K;  1KZU B;  1NHL A;  4RES B;  2Q7C A;  2WPQ A;  2GM4 A;  2N9B A;  1IFN A;  1GU4 A;  5AW0 B;  1G1I A;  5BU8 B;  1JY2 O;  1MUU A;  5AW1 B;  4I2L C;  4ZKU A;  3M0D C;  3U1A A;  1KIL B;  1JY3 N;  1OXZ A;  1CI6 B;  2O01 H;  1EQ7 A;  2GUS A;  1T8Z A;  1HJB A;  4W7Y A;  1LTJ C;  2O1J A;  1HH0 A;  3SWF A;  3N7N A;  3NFQ A;  1LWU B;  1ZR4 A;  1KFM A;  4JYB A;  1JY3 P;  1YYC A;  2N1T A;  1WT6 A;  3MIW A;  1SQX K;  1DH3 A;  1HBW A;  1GZL A;  1ZN5 A;  2Z5H A;  3VP8 A;  1FOS E;  1MFZ A;  1VPC A;  5AVX B;  1URQ C;  5AW8 B;  1N7S D;  1J1E B;  2POH A;  3WMM 0;  3VMZ A;  3M06 A;  1RF1 A;  4LLH A;  1SQQ K;  3VTP C;  1FOS F;  2XKM A;  3V2P A;  3VN0 A;  2WPS A;  2N1T B;  3HUS A;  5CJ4 A;  3VMX A;  2HYN A;  5APT A;  3V2R A;  2WTY A;  2A45 H;  1RF0 A;  4B86 A;  1SVF A;  1L0N K;  3B5N C;  3HD7 A;  1M1J C;  1FZG A;  2JEE A;  1FZC A;  2HOD A;  1NKN A;  2OYI A;  3HD7 D;  2XZR A;  4DOJ A;  2R5B A;  1W2E A;  4GT1 A;  2KYV A;  5APQ A;  5BVZ A;  1JO5 A;  4WBA A;  4IFF A;  4JYC A;  1RY3 A;  5CCH A;  5KJ7 D;  1S9K D;  3CL3 D;  2MJZ A;  1RE3 C;  5CCG D;  1HGZ A;  3II6 A;  3RK3 D;  3HD7 B;  3NTN A;  2OYH A;  5CCH D;  4KHX A;  2WSE H;  2HPC A;  1N73 A;  2C9N Y;  1YTZ I;  3NXS A;  1RE4 A;  1X8Y A;  2FXM A;  1E5W A;  5AW7 B;  2PAJ A;  3OJA B;  3RK3 B;  3OA7 A;  2ZFC A;  5BU5 A;  1NTM K;  3BAS A;  1L4A D;  3IFM A;  1CZQ A;  3MTU E;  3GHG C;  4Y99 C;  4OH8 B;  1T2K D;  2YKQ A;  1FZF A;  2OYH B;  2A45 I;  3A2A A;  3HTK A;  2HPC B;  3HUS C;  3TNU B;  1N73 B;  2WZ7 A;  3VYI A;  1L4A B;  3BRT B;  1JNM A;  2A45 G;  1NOH A;  3G3Z A;  4IFD K;  3MD0 A;  3P8C E;  2W6A A;  1GW4 A;  2W27 A;  1FAV A;  1ZR2 A;  1M7L A;  1LTB C;  1CI6 A;  1J1D B;  2J59 M;  4M3L A;  3KYQ A;  2HLO A;  1NO4 A;  1SFC A;  4XE5 B;  5KTB A;  2C0X A;  1LTJ B;  1LWU A;  1NAF A;  1IK9 A;  4AQR D;  4EIJ A;  4O9B A;  3E1I A;  1JY2 N;  1SFC D;  3M0A A;  2GUV A;  2I1K A;  1LTA C;  3LW5 H;  1HTL C;  1ZV8 A;  2YMY A;  3LID A;  1T3U A;  1JTH A;  3L37 A;  3VOP A;  3RL0 C;  1SFC B;  1JY2 P;  3L36 A;  2NPS A;  1S9K E;  5AW3 B;  4WY4 C;  5AVR B;  2M3B A;  2R3C A;  4LC1 A;  3RK2 C;  5AVT B;  1FZB A;  2YO2 A;  1LTT C;  2NPS D;  1N7S A;  3U59 A;  2KP8 A;  1NH4 A;  3B5N D;  1AQ5 A;  1JCD A;  3VMY A;  1LT9 C;  1G2C B;  2O1K A;  1JTH B;  2NPS B;  2KLV A;  1NTK K;  1H88 A;  1FDM A;  1LTG C;  1SQP K;  1OWA A;  3B5N B;  3BRV B;  1M1J B;  2M8R A;  2KB7 P;  2R5D A;  1FU1 A;  2Z4E A;  2YKP A;  1N7S B;  1KIL C;  1JOC A;  3EFG A;  1N2D C;  3L4F A;  1A02 F;  3HRN A;  2E42 A;  1X9V A;  5CHX A;  2H8P D;  2E43 A;  3KQG A;  4HYT B;  4W80 A;  4ZKP A;  2FYZ A;  1G1J A;  3U1C A;  3V4W A;  4C46 A;  2KOG A;  5KJ7 A;  2P7J A;  4I6M C;  5AW9 B;  5KLV K;  2FFD A;  5CCG A;  1VDF A;  4N78 E;  1IFI A;  4DZO A;  1GK4 A;  1J1E C;  3MGN A;  1XTC C;  3H32 B;  1LTS C;  3M9Q A;  4HH2 A;  2N1T C;  4WB4 A;  1GL2 A;  3TNU A;  4GKG A;  2Q9I A;  1GU5 A;  1L4A A;  2CPS A;  2FFD B;  1GW3 A;  3IR9 A;  2BAS A;  3M91 A;  1SLQ A;  3PP5 A;  1GL2 D;  5APY A;  1SQV K;  5APU A;  1HGV A;  1FZA A;  2WPR A;  3KPE A;  1H89 A;  1RF1 C;  5APS A;  1QL2 A;  2WT7 A;  3M0D A;  3R2P A;  3CLQ A;  1H8A A;  3MUD A;  1GL2 B;  2J58 A;  3V2N A;  2YO3 A;  1LTJ A;  5APW A;  3C9I A;  3O8Z A;  2VRS A;  2IX7 C;  4C7N B;  2Z5I A;  1NU1 K;  3P7K A;  1RF0 C;  3RL0 D;  2WSC H;  3HD7 C;  3TSI A;  1IO4 A;  4N3Y B;  1JMM A;  1FZC C;  1MV8 A;  2WT7 B;  5AVQ B;  3A7O A;  2OYI C;  1LTI C;  1URQ A;  3EQ2 A;  4GIF A;  1AFO A;  2IPP A;  3RK3 C;  1SQB K;  1LGH B;  2XDJ A;  1QL1 A;  5CCH C;  4W7Z A;  1URQ D;  2OAR A;  3LIE A;  4I1L A;  4AUW A;  4XA4 A;  3V5B A;  3V2Q A;  3I5C A;  2OYH C;  1G2C A;  1FZE A;  1N73 C;  1RE4 C;  3L35 A;  1URQ B;  3HE5 A;  2C0W A;  3B5N A;  3M9B A;  1T2K C;  1M1J A;  3P8M C;  1PFI A;  2C9L Y;  2I1J A;  3VP9 A;  4EOT A;  1J1D C;  3A3Y B;  1GK6 A;  1KQL A;  1JY3 O;  2W6B A;  3HE5 B;  2XV5 A;  3T97 A;  1FJK A;  5CJ0 A;  1RE3 A;  2HFE D;  3CI9 A;  1HVV A;  2CPB A;  1N7L A;  4LGD E;  1DX7 A;  2ZXE B;  4N6J A;  2FKW B;  4IFM A;  1ZLL A;  1SFC C;  5APV A;  2YNY A;  3N4X A;  2WIT A;  3V4Q A;  2N1T D;  3TK1 A;  3H32 A;  1LWU C;  5AVZ B;  4C7R A;  2R32 A;  5AVW B;  3GHG A;  3BAT A;  1CW5 A;  5AVU B;  1JCC A;  3P8C D;  2HG5 D;  1KFN A;  2Q3I A;  3H6P A;  2NPS C;  1JUN A;  1IFM A;  2H43 A;  1X79 B;  2L5G B;  5AW5 B;  3GHG B;  4Y99 B;  3M9H A;  1RF1 B;  1N7S C;  1DEB A;  1A02 J;  1SP4 A;  3HUS B;  4C7N A;  4AYC A;  2P67 A;  1GD2 E;  3TYY A;  1FZC B;  1XTG B;  1IJD B;  2HOD B;  1HWT C;  3OAK A;  5APX A;  3UIA A;  2OYI B;  5AW2 B;  1FBM A;  3SWY A;  5AVY B;  3BVH A;  4WY4 A;  5CMZ A;  5AVV B;  2YKO A;  5AVS B;  2IFM A;  1IFD A;  3NMD A;  1MZ9 A;  1NTZ K;  4JF7 A;  3KDP B;  1GDT A;  2P1J A;  4WY4 D;  1IC2 A;  1T3J A;  3B8E B;  1NKZ B;  1Z56 A;  2H7H A;  3RK2 D;  5KJ7 C;  1FJP A;  1LT9 A;  2FFD C;  2PP6 A;  5CCG C;  1CSB A;  3RL0 B;  2QM8 A;  1HUC A;  1YTZ T;  2QM7 A;  1WRG A;  3HE4 A;  3P32 A;  2P2U A;  2XNX A;  1IFJ A;  2KSJ A;  2WWW A;  4WY4 B;  1J2J B;  1NWQ A;  3RK2 B;  5AW6 B;  2IFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...