1N2DC

Ternary complex of mlc1p bound to iq2 and iq3 of myo2p, a class v myosin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
48
structure length
48
Chain Sequence
QISQAIKYLQNNIKGFIIRQRVNDEMKVNCATLLQAAYRGHSIRANVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myosin Light Chain
publication title Structure of the light chain-binding domain of myosin V.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 22
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2002-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n2dC00
1EQ7A 2GUVA 1KFMA 1T8ZA 1KFNA 2GUSA 1JCCA 2IX7C 1N2DC 3H6PA 1JCDA
chains in the Genus database with same CATH superfamily
1HVVA 1ZP0C 1VQ7P 1R8EA 3TGUG 1T3JA 5CJ0A 2PAJA 1DEBA 2NPSC 1BDDA 1N73C 3GF7A 2N9YB 1DIPA 2YNYA 2B87A 1FDMA 1PV3A 4W7YA 3O6QA 1P84I 3NFQA 4D6TD 2FFDB 2Y9ZA 1GL2C 3MTUE 3L73J 2N1TD 3WUTA 1SQBG 2KLUA 1SQVK 1S5LE 1BE3G 1NTMG 1SQQE 2KUBA 2ITAA 5KJ7A 3H32B 3CLQA 1AQ5A 3D71A 2NPSD 1NKZB 3L74E 2CK3H 1NYHA 1BSHA 3TYYA 2O1JA 4D6TE 2P7JA 2V7QJ 1S9KD 4UB6E 4IFFA 1T8ZA 4XE5B 5AW9B 2YKQA 2WPSA 1GL2D 3IFMA 1WMKA 1Q2NA 3GLMA 1E5WA 2Y9YA 2BCCJ 3PP5A 4RJTA 1OW6A 1PPJG 1JY2O 3MZWB 1FZEA 3P8CE 1OZHA 3M91A 3L72J 4OWFA 3II6A 3KZIH 5APQA 1GK4A 2FYUK 3G9RA 2PP6A 4ZNCA 3MGNA 3CWBG 3FWNA 2YXQB 2G3AA 1NTMD 3HUSC 1K73Q 2QE7H 2MJZA 3EFGA 1JCDA 4GOFA 3CMAP 2C9NY 4EIJA 3A7OA 1EQ7A 2WSFH 5KLVK 1P84D 3CCVP 2WQYC 4L76A 3M0DA 5AVZB 1FDOA 3H1LJ 1M1JA 3HE5B 2A45H 4NPDA 1EC5A 3K5BA 3FXDA 4DZOA 1NTME 1L0LK 1RF1C 4R4LA 1S72P 1A02F 4LLHA 1X0TA 1T3UA 4EOTA 1P84E 3IN6A 3AE2C 3NTNA 3V5BA 1FAVA 1KQLA 1SQXG 4RKUJ 2P58A 2W83C 2Q3EA 4C7NB 3A0BE 3O8ZA 4A7PA 3CWBD 1RHZB 2XV5A 4BRYA 1T2KC 1J2JB 4WY4D 1ZN5A 5GTHE 4PV1B 2Z5IA 1PPJE 1PP9J 1PFIA 1NOHA 1LTBC 4UB8H 2ZXXA 1J1EB 2WZ7A 1AFOA 2H43A 2WPVB 3W67A 3L75G 5GTIH 3VN0A 1RH5B 3TDKA 4HYTB 1YI2P 3PTZA 3H25A 3CWBE 4DOJA 3HE5A 1X8YA 2WPRA 2YIUB 3CPWO 3AE8C 3U1AA 3CCSP 2WSCJ 1T2KD 1RE4A 2ZVNB 4PD4I 2LXCB 2IBZI 2RH0A 3VMYA 1LTJB 2JWDA 3T97B 4AQRD 2OARA 3CI9A 2E74B 1NTZJ 1IK9A 2QEXP 3TK1A 3CCUP 1VL2A 1LT9C 1LWUA 1SQXE 1NU1J 1YTZI 1JY3N 2IBZG 3E1IA 2XU6A 3H1IG 4HH2A 1NWQA 2QIWA 1GW4A 1YJ9P 1OX3A 1EZVG 2KSEA 3AEEC 4IL6H 3L71G 1IFPA 3BCCJ 2KNCB 1L4AC 2WSSH 1OW8A 1DX7A 1CI6B 3A0HH 1Y9BA 1JTHB 1PIXA 3TNUB 4QMAA 5CMZA 1URQB 1AVYA 2OQQA 2R44A 2JDIH 4CPGA 4PJ0H 2O1KA 5CJ4A 2I8DA 3IF4A 3M06A 4WY4A 1NAYA 1OFCX 4AUWA 2C0WA 2ZT9C 1L4AD 3KDPB 3OW2O 1OIPA 1N7SA 1VF5C 4ZKUA 1GU5A 3MP7B 4PD4E 1BCCG 3E1RA 1SQVG 1W2BO 5CCHC 5AW7B 3A5TA 2KS1A 3RBZA 3M0AA 1K04A 1KILA 2Q5UA 2KXPB 3C9IA 3L70J 1G1JA 1KB9H 1HJ0A 1YIJP 2JP3A 1RE3C 2QSIA 4MN4C 3H1HG 4WWIA 4RESB 1CI6A 1NH4A 1OVRA 5CCGD 3NXSA 3L71E 3AE5C 1JCCA 1YJNP 1BGYG 3MUDC 2FFDC 5CCHD 1NTKJ 1GZLA 4JQ0D 3H1JG 1USEA 3CX5H 2QM8A 4Y99B 4Y28J 2XNDH 2B87B 3Q2YA 4ASWA 2C9LY 3L4FA 1RQUA 2FYUG 1HJBA 3O6QB 3H6PA 3C8VA 1KN7A 3JCUE 2I1JA 5H2FH 1SVFA 2QG4A 3CXHD 5AW2B 2KB7P 1Z56A 1KQGB 3GHGB 3Q5RA 5KLVG 1Y8AA 5B5EH 2V7QH 4M3LA 1H8AA 3H1HD 2O01N 2HLOA 3BASA 3LIEA 1BCCE 1ZR2A 3AE4C 1SQVE 5KTBA 2LXBA 3N7NA 3BVHA 3B5NA 1L0LG 2M3EA 3HTKB 3HD7C 3VMXA 2AXTE 1VQ4P 1PZQA 1IJDB 3AE7C 3I5CA 1M1KQ 2FY8A 4EI2A 5KAFE 1NHLA 3V4WA 3Q3DA 3H1HE 4B86A 2P1JA 3RGUA 4H44B 1SQQD 1LTSC 3MD0A 2P10A 3CCLP 1ZOYC 2XKMA 3L74D 4IOIH 1PGOA 1M57D 1FZAA 2HODA 3FGAD 1JUNA 3HD7D 3WUUA 5CHXA 2KIKA 3H1JE 2IPPA 3M9QA 2R32A 1AVOA 3WU2H 2MKVA 2JKVA 4H13B 3GHGA 1OXZA 5E79H 2BASA 5CBNA 2FYUE 1JY3O 3G6EP 1JY2P 2RN0A 1SFCA 4KT0J 3U1CA 1QLED 2OYIA 1M1JB 1FZCA 2NZ2A 2QJYB 4K35A 3P8CD 1M7LA 3R4YA 3H1KJ 5AVUB 4IFMA 5KLVE 3RK3B 3HTKA 1L0NJ 3G4SP 5M1BA 3PRJA 1AQTA 3R2PA 2VRSA 3TGUD 3KXDA 1KYOH 3LIDA 3FXEA 1K05A 2IZ0A 4PV1C 2P2UA 1U57A 2Y0EA 2KZIA 3B71A 4UB8E 2ZVOB 1A02J 1MKMA 3Q1MA 4C7RA 1X22A 1KFNA 2LKMA 1LNQA 2E5TA 1J1EC 1CZQA 1RF0A 2J59M 4U3FJ 4BRYB 2IFMA 4KJMA 1YJWP 1SQBD 3TGUE 1NTZK 1BE3D 1MV8A 1WT6A 3M9BA 1NU1K 2FKWB 2B88A 2L5GB 4PV1D 1VQ5P 1TU3F 2WSCH 2H88C 2W8ZA 4NPFX 1S2EA 2JO1A 1LTJC 2XDJA 2POHA 2M0BA 1SQBE 1K9MQ 1N73B 2C0XA 1BE3E 1VQPP 1JM0A 4Z1MH 1ZW0A 5KAIE 2E74C 1MFTA 1RQVA 1SQPJ 5B66E 3V2QA 1PPJD 2K88A 1KORA 1CSBA 1X79B 2P67A 4C46A 1FZFA 3RL0g 3ITKA 2HR3A 1S5LH 3I56P 4GKGA 4W7ZA 1WRGA 1W5CE 5DJUB 4GOEA 1KMIZ 2OYHA 3CX5I 1GW3A 1LWUB 2K1AA 4GT1A 3G71P 1PGPA 2E74D 1LP1A 1S3JA 4AYCA 3AE3C 1YHQP 1OMIA 2AEJA 2KLVA 2N1TA 5KKZB 3RK2B 4I7ZB 1N7LA 3I55P 1LTTC 4TT3H 3L73G 2NPSA 2FYZA 5APSA 3V6IA 1N73A 1URQC 4H0LB 2K9JA 4TLFA 3RL0B 1SQXD 2ZFCA 5L8RJ 3G3ZA 1GL2A 1MFZA 3HUSB 1MZ9A 1ZRTD 4DT0A 2CPBA 2O3JA 2WTYA 1ZR4A 2K3RA 3VOPA 3PLNA 3VYIA 4HKZH 4O9BA 1YBKA 3RBXA 3AECC 1EZVI 1EDKA 3SSUA 1MUUA 1KTMA 1FOSE 2BCCG 1M8OB 3CCEP 3SFDC 2D2CB 1URQD 1W2EA 4WY4B 1NTKK 1FZGA 3L75D 1SQQJ 1KILE 3PJSK 1RF1B 1ZRTE 2K37A 1FS0E 2GUSA 3L72G 3B8EB 2R5DA 1X9VA 3L74J 1QGKB 1P84H 3UIAA 1N7SB 2E5YA 4D6TJ 3N4XA 1UIIA 2FYNB 1S4XA 3VP9A 2Q1KA 3D70A 2KS1B 2PGDA 2W27A 3A0BH 1JEKA 3GG2A 2A06G 2GA1A 4KHXA 1KILB 2FXOA 3L75E 1GTWA 2H7HA 3CMEP 1DH3A 5GTHH 2WT7A 1SP4A 3L35A 3VTPC 3H1LG 2QJKB 4DJGA 4Y99C 3HUSA 4N78E 5TISH 2WPQA 2QJPB 1VQLP 2BEZF 1KYOI 2UWJE 3VMZA 3D6YA 4L74A 2BCCD 3JC22 4PD4D 3TGUJ 2M5AA 2BEQD 1U7MA 1BDCA 2IBZD 1FJPA 2IX7C 2DW3A 2E75B 3H1ID 5AVVB 4JYBA 3FX0A 1DD3A 2Q7CA 3CD6P 1EZVD 4I6MC 4OGQC 5KJ7C 1RF1A 3AEAC 5AVRB 1NVOA 3E7KA 1HGVA 2BCCE 1YITP 2WITA 1JOCA 1BSNA 1SQBJ 1L2PA 1BE3J 3CCQP 1NTMJ 1PP9G 3L71D 2A06D 5AW6B 2H89C 2IBZE 3S9OA 4IL6X 3H1IE 4GIFA 1JO5A 2A45I 1YQ3C 3OJAB 1EZVE 3WMM0 1VDFA 3TSIA 4H44C 2WMMA 3B5NB 4OGQD 3AEGC 1XTGB 2ZT9D 5KJ7D 3AE6C 1M56D 2WSEJ 1DD4A 4BWNA 2JEEA 1VQ9P 2A06E 3GW6A 1VF5D 3JSVC 1L0NK 3B4SA 3AEFC 3EFFK 4LC1A 2A45G 4EDFA 4DCKA 1Q7YQ 3WU2E 1SLQA 4H13C 4ZKPA 5BU5A 3KPEA 3V2NA 3Q5SA 1LJ2A 2JJLA 2M8RA 3M0DC 1IFJA 1JNMA 3OA7A 1BCCD 1M1JC 4H44D 4U7JA 1IK7A 3CWBJ 1HWTC 1NTZG 1SQVD 4JYCA 2YKPA 2HODB 2ZAEB 3M9HA 1AA0A 1JB0J 1NU1G 2FXMA 5APUA 2WVRA 2J58A 1KYOE 1USDA 1SFCB 3MIWA 1VPCA 4GODA 1IFDA 4H13D 2OYIB 2QRXA 1FZCB 1LGHB 3HE4B 1FZBA 1LT9A 2W6BA 5AVSB 1FC2C 4HB1A 2JR8A 3CCMP 3ZDMA 2KSJA 1BGYD 1Y47A 3KZIE 5AW4B 1N86A 4RO0A 1IO4A 3H1JD 3BCCG 1SQPK 1SQXJ 1JY3P 2OGUA 1M90Q 3ABVC 2FYUD 2HPCB 1QVFO 2IDBA 4WBAA 3VP8A 1KFMA 1BGYE 2YO2A 5APTA 2O01J 3FWLA 1LTGC 1NU1D 1L4AA 5APYA 1D7MA 5KLVD 2HG5D 1VQ8P 2E76B 1PL5A 1PGQA 3RK3E 2R5BA 3V4QA 1K8AQ 3SWYA 3L75J 1RE4C 5C39A 3F5HA 3P8MC 4YTPC 1OVUA 2YKOA 3IAOA 2QM7A 1KQSO 3A3YB 1NTZE 5AW0B 1IFNA 2AEMA 1L0LD 3IR9A 3HE4A 2IFNA 4IFDK 1FOSF 5TJHA 1NU1E 3HRNA 1HF9A 3MHVA 3L37A 1H0TA 3BCCD 1H89A 1IFIA 3JCUH 5CCGA 1LWUC 1FBMA 1UIXA 3L70G 1G2CB 3D6ZA 3CL3D 1HGZA 1L0LE 4I2LC 1IFMA 2B9BA 3W68A 3BRTB 5CCHA 2HPCA 5KKZC 3RK2C 4I7ZC 4ZMDA 2OTKE 5GTIE 2HFED 3WUVA 1YQ4C 3BCCE 2OYHB 2LR2A 5AVTB 2YIUC 1RE3A 1NKNA 1NTKG 5KLIB 2KZJA 3H1IJ 1LP1B 1KD1Q 3CXHH 4I1LA 2AXTH 2Q6QA 3HD7B 1J1DB 4YPCA 1S9KE 2YMKA 1DEEG 2N1TB 2YO3A 3CC7P 4H0LC 1SQQK 3RL0C 4N6JA 3MUDA 5KAFH 1EDJA 2KK7A 2FFDA 3KQGA 2FBWC 4L75A 1R5LA 3RK2D 2NPSB 1EXIA 3L71J 1FU1A 3V2RA 3AE9C 5CBOA 5EFWB 1Q86Q 1QX8A 2OYOA 3L70D 4WB4A 1G1IA 1KB9I 1Q90D 3H32A 2K9JB 2W6JH 2D2CC 3BATA 1GL2B 3F89A 1G2CA 4N3YB 4WY4C 3KYQA 3SWKA 4JBZA 1GU4A 1FJKA 2IYPA 2I1KA 1HBWA 4H0LD 3RL0D 3S4RA 1QEXA 2Q3IA 1IZNB 3OAKA 2ZJSE 1N7SC 2YXRB 1NTKD 2KI7B 1QL1A 3L70E 1RY3A 2FYNC 1FE6A 2IZ1A 5AW5B 4UB6H 1JMMA 3HD7A 4IL6E 1LT1A 1KILC 1PGJA 1LTAC 1IC2A 2D2CD 2KYVA 1BCCJ 4XA4A 2QJKC 2WWWA 1S1CX 1SQVJ 1CW5A 2E43A 2OTJP 5AVXB 4YXWH 1NTKE 3A0HE 2GUVA 5TISE 2QJPC 4OH8B 2K9YA 1SQBK 1N7SD 2IYOA 1NTMK 1LTIC 5AW8B 3P7KA 4WVZA 3AEDC 1QL2A 2AXCA 4PJ0E 3BRVB 3H1HJ 2WT7B 2E75C 1JMBA 2PFXA 1HH0A 1HTLC 5K5GB 1KILD 1S5LX 2WSFJ 4W80A 3H1KG 3QH9A 3S1KA 1OWAA 1L0NG 1YYCA 1BGYJ 2ZXEB 5BVZA 1KB9D 2FXPA 3C1LA 2M5AB 4EYYQ 2ZYGA 1KV4A 3CC2P 1R5SA 5APWA 3H1JJ 2M3BA 5AW3B 2NRGA 2JWAA 3CCJP 5APVA 3GF3A 2FYUJ 4XFJA 3KHUA 4C7NA 2HYNA 5KAIH 2B89A 1Q81Q 5B66H 2E75D 4ASVA 1EDLA 5AVQB 3NMDA 2RMZA 4U3FG 2ZYDA 3CX5D 1OVVA 3Q5PA 1KB9E 3L73D 2SPZA 2H8PD 4N78D 3B5NC 1ZV8A 1N2DC 1VQ6P 5KLVJ 2XNXA 3L36A 1U7JA 3TF5A 5AW1B 2WSEH 1GDTA 2W90A 1AV1A 3H1KD 2OTLP 1L0LJ 1VQNP 1ZLLA 1L0ND 3CX5E 1H88A 3L73E 3SFEC 2Z5HA 4HJGH 2QA4P 3B5ND 1JY2N 1SQPG 4K3AA 5H2FE 1OW7A 3LW5H 1LTJA 3GHGC 1SQXK 3H1KE 3AEBC 3L72D 3T97A 5B5EE 1QVGO 2KOGA 1L0NE 1SFCC 4U3FD 2N9BA 4OVNF 2OYIC 1FZCC 2E42A 3GMAA 1EDIA 2PRRA 3CXHI 2GM4A 1XTCC 3V2PA 5BU8B 3CCRP 5AVYB 3L72E 5CCGC 3VMAA 4R4MA 3H1LD 3CC4P 4NPEA 3PHLA 4U3FE 2Y0CA 1VQOP 4YXDC 2AEFA 3EQ2A 2QVAA 1LT9B 1YTZT 1SFCD 5DJTB 3AE1C 1RF0C 3EWKA 1SQPD 3USSA 1VQKP 2G8YA 1SS1A 2KNCA 1HUCA 2O01H 2E76C 2Y0DA 3H1LE 2Q9IA 1T6AA 1JTHA 1KQFB 1KYOD 1AJYA 3TNUA 5AVWB 5E79E 1GK6A 1URQA 1NJIQ 2W6AA 1SQPE 4BXLA 2KP8A 4L73A 3LW5J 2QJYC 1L4AB 1PP9D 1N8RQ 3SWFA 4LGDE 1GD2E 3P32A 3RK3C 2V4HA 1E79H 1FDIA 3QWOC 1SQQG 1Q82Q 2XZRA 2R3CA 1VQMP 4GDOA 2E76D 2J5UA 1ZXGA 5APXA 1GMJA 4JF7A 2CPSA 3L74G 4D6TG 3PH0A 1PP9E 1KC8Q 1KZUB 1H0TB 4OGQB 2ZT9B 2YMYA 2Z4EA 2OYHC 2R3SA 1NO4A 1VF5B 3RK3D 4PD4H 1NAFA 5KLIC 3U59A 3CXHE 1J1DC 1ZMEC 4JPZB 2L91A 2ZYAA 1EXJA 2N1TC 2RKLA 1NGMB 1NTZD 3A2AA
chains in the Genus database with same CATH topology
3RK2D 1HVVA 5CCHC 1MUUA 2NPSB 5AW7B 1FU1A 3V2RA 3A5TA 1FOSE 1T3JA 3M0AA 5CJ0A 2PAJA 1DEBA 1URQD 1KILA 4WB4A 2NPSC 1G1IA 1W2EA 2Q5UA 3H32A 4WY4B 1NTKK 3C9IA 1FZGA 1N73C 2YNYA 1G1JA 1RE3C 1RF1B 1FDMA 4W7YA 3BATA 2GUSA 1GL2B 3B8EB 4RESB 2R5DA 1G2CA 4N3YB 4WY4C 1CI6A 1X9VA 3KYQA 3NFQA 3UIAA 1N7SB 1NH4A 1GU4A 1FJKA 2FFDB 2I1KA 1HBWA 5CCGD 3NXSA 3RL0D 1GL2C 3MTUE 2Q3IA 1JCCA 3N4XA 3OAKA 2N1TD 1N7SC 3VP9A 2FFDC 1SQVK 2W27A 1QL1A 5CCHD 1GZLA 1RY3A 4KHXA 1KILB 1GTWA 2QM8A 2H7HA 5KJ7A 3H32B 4Y99B 3CLQA 5AW5B 1DH3A 1AQ5A 2NPSD 2C9LY 1JMMA 1NKZB 3HD7A 3L4FA 1SP4A 3L35A 2WT7A 3TYYA 2O1JA 3VTPC 1KILC 1HJBA 4Y99C 2P7JA 1LTAC 1IC2A 3H6PA 3HUSA 1S9KD 4N78E 2KYVA 2I1JA 1SVFA 2WPQA 4IFFA 4XA4A 1T8ZA 2WWWA 1CW5A 4XE5B 3VMZA 5AW9B 2E43A 5AW2B 5AVXB 2KB7P 2YKQA 2WPSA 1GL2D 1Z56A 2GUVA 3IFMA 1E5WA 3GHGB 4OH8B 1SQBK 3PP5A 1N7SD 4M3LA 1NTMK 1FJPA 1JY2O 1LTIC 2IX7C 5AW8B 1FZEA 1H8AA 5AVVB 3P7KA 4JYBA 1QL2A 3P8CE 3BRVB 2HLOA 3BASA 3LIEA 3M91A 2WT7B 2Q7CA 1ZR2A 1HH0A 3II6A 1HTLC 4I6MC 5KJ7C 5KTBA 5APQA 1RF1A 3N7NA 3BVHA 1GK4A 3B5NA 5AVRB 2FYUK 1KILD 3HTKB 4W80A 3HD7C 3VMXA 2PP6A 1HGVA 1IJDB 1OWAA 3MGNA 2WITA 1JOCA 1YYCA 2ZXEB 3HUSC 5BVZA 3I5CA 2MJZA 3EFGA 1JCDA 2C9NY 5AW6B 4EIJA 3A7OA 5APWA 1NHLA 3V4WA 1EQ7A 2WSFH 5KLVK 2M3BA 5AW3B 4B86A 4GIFA 1JO5A 5AVZB 2P1JA 3M0DA 5APVA 2A45I 1LTSC 3MD0A 3OJAB 1M1JA 3HE5B 2A45H 1VDFA 3WMM0 4C7NA 2HYNA 3TSIA 2XKMA 3B5NB 5AVQB 3NMDA 1XTGB 5KJ7D 4DZOA 1L0LK 1FZAA 2HODA 1RF1C 1JUNA 2H8PD 2JEEA 3HD7D 4N78D 5CHXA 3B5NC 1ZV8A 1N2DC 1A02F 2IPPA 4LLHA 3M9QA 1T3UA 2R32A 1L0NK 4EOTA 3GHGA 2XNXA 1OXZA 3L36A 2BASA 4LC1A 2A45G 1JY3O 3NTNA 1JY2P 3V5BA 5AW1B 3U1CA 1SFCA 1FAVA 1KQLA 2WSEH 1GDTA 1SLQA 4ZKPA 5BU5A 3KPEA 3V2NA 2OYIA 1M1JB 1FZCA 4C7NB 2JJLA 2M8RA 3M0DC 1IFJA 3P8CD 1JNMA 3O8ZA 1M7LA 1ZLLA 3OA7A 2XV5A 1H88A 5AVUB 1M1JC 4IFMA 1T2KC 3RK3B 1HWTC 3HTKA 4JYCA 2YKPA 1J2JB 4WY4D 1ZN5A 2HODB 2Z5IA 2Z5HA 3R2PA 3M9HA 2VRSA 1PFIA 1NOHA 1LTBC 3LIDA 3B5ND 1JY2N 2FXMA 5APUA 2P2UA 1J1EB 2WZ7A 2J58A 1AFOA 2H43A 3LW5H 1LTJA 1SFCB 3MIWA 1A02J 1VPCA 3VN0A 3GHGC 4C7RA 4HYTB 1KFNA 1SQXK 2LKMA 1J1EC 3T97A 1IFDA 1CZQA 2OYIB 1FZCB 1LGHB 1RF0A 3HE4B 2KOGA 1SFCC 4DOJA 2J59M 3HE5A 2N9BA 1X8YA 1FZBA 1LT9A 2WPRA 2W6BA 5AVSB 2OYIC 1FZCC 2IFMA 3U1AA 2KSJA 2E42A 1T2KD 1NTZK 1RE4A 5AW4B 1MV8A 1WT6A 1N86A 3M9BA 2GM4A 1IO4A 1XTCC 3V2PA 5BU8B 1SQPK 1NU1K 2FKWB 2L5GB 5AVYB 1JY3P 3VMYA 1LTJB 2WSCH 5CCGC 2HPCB 4AQRD 2OARA 1LTJC 3CI9A 2XDJA 3EQ2A 4WBAA 2POHA 3VP8A 1LT9B 1YTZT 1SFCD 1IK9A 1KFMA 2YO2A 5APTA 3TK1A 1N73B 1RF0C 2C0XA 1LTGC 1L4AA 5APYA 1LT9C 1LWUA 2HG5D 1YTZI 1JY3N 3V2QA 2R5BA 3E1IA 3V4QA 2XU6A 1CSBA 4HH2A 3SWYA 1RE4C 1HUCA 1X79B 1NWQA 2P67A 2O01H 4C46A 1FZFA 3P8MC 1GW4A 2Q9IA 2YKOA 1JTHA 2QM7A 3A3YB 5AW0B 1IFNA 3TNUA 4GKGA 4W7ZA 3IR9A 5AVWB 3HE4A 1GK6A 1URQA 1WRGA 2IFNA 2W6AA 4IFDK 1FOSF 2KP8A 3HRNA 2OYHA 3L37A 1L4AB 1GW3A 1LWUB 3SWFA 4LGDE 1GD2E 1H89A 4GT1A 3P32A 1IFIA 3RK3C 5CCGA 1L4AC 4AYCA 1LWUC 1FBMA 1G2CB 1DX7A 2KLVA 1CI6B 2N1TA 2XZRA 2R3CA 3CL3D 3RK2B 1HGZA 1JTHB 1N7LA 4I2LC 1IFMA 5APXA 3BRTB 1LTTC 4JF7A 2CPSA 3TNUB 5CCHA 5CMZA 2HPCA 3RK2C 1URQB 2HFED 2NPSA 1KZUB 2FYZA 5APSA 2O1KA 2OYHB 1N73A 5CJ4A 1URQC 5AVTB 1RE3A 1NKNA 3M06A 2YMYA 2Z4EA 2OYHC 4WY4A 4I1LA 4AUWA 2C0WA 3HD7B 3RL0B 1J1DB 1NO4A 2ZFCA 1S9KE 3RK3D 3G3ZA 1L4AD 1NAFA 2N1TB 1GL2A 1MFZA 3HUSB 3KDPB 2YO3A 3U59A 1MZ9A 1SQQK 3RL0C 1J1DC 4N6JA 2CPBA 3MUDA 1N7SA 2WTYA 2FFDA 4ZKUA 1GU5A 1ZR4A 2N1TC 3KQGA 3VOPA 3VYIA 4O9BA 3A2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQ7 A;  2GUV A;  1KFM A;  1T8Z A;  1KFN A;  2GUS A;  1JCC A;  2IX7 C;  1N2D C;  3H6P A;  1JCD A; 
#chains in the Genus database with same CATH topology
 1HVV A;  1ZP0 C;  1VQ7 P;  1R8E A;  3TGU G;  1T3J A;  5CJ0 A;  2PAJ A;  1DEB A;  2NPS C;  1BDD A;  1N73 C;  3GF7 A;  2N9Y B;  1DIP A;  2YNY A;  2B87 A;  1FDM A;  1PV3 A;  4W7Y A;  3O6Q A;  1P84 I;  3NFQ A;  4D6T D;  2FFD B;  2Y9Z A;  1GL2 C;  3MTU E;  3L73 J;  2N1T D;  3WUT A;  1SQB G;  2KLU A;  1SQV K;  1S5L E;  1BE3 G;  1NTM G;  1SQQ E;  2KUB A;  2ITA A;  5KJ7 A;  3H32 B;  3CLQ A;  1AQ5 A;  3D71 A;  2NPS D;  1NKZ B;  3L74 E;  2CK3 H;  1NYH A;  1BSH A;  3TYY A;  2O1J A;  4D6T E;  2P7J A;  2V7Q J;  1S9K D;  4UB6 E;  4IFF A;  1T8Z A;  4XE5 B;  5AW9 B;  2YKQ A;  2WPS A;  1GL2 D;  3IFM A;  1WMK A;  1Q2N A;  3GLM A;  1E5W A;  2Y9Y A;  2BCC J;  3PP5 A;  4RJT A;  1OW6 A;  1PPJ G;  1JY2 O;  3MZW B;  1FZE A;  3P8C E;  1OZH A;  3M91 A;  3L72 J;  4OWF A;  3II6 A;  3KZI H;  5APQ A;  1GK4 A;  2FYU K;  3G9R A;  2PP6 A;  4ZNC A;  3MGN A;  3CWB G;  3FWN A;  2YXQ B;  2G3A A;  1NTM D;  3HUS C;  1K73 Q;  2QE7 H;  2MJZ A;  3EFG A;  1JCD A;  4GOF A;  3CMA P;  2C9N Y;  4EIJ A;  3A7O A;  1EQ7 A;  2WSF H;  5KLV K;  1P84 D;  3CCV P;  2WQY C;  4L76 A;  3M0D A;  5AVZ B;  1FDO A;  3H1L J;  1M1J A;  3HE5 B;  2A45 H;  4NPD A;  1EC5 A;  3K5B A;  3FXD A;  4DZO A;  1NTM E;  1L0L K;  1RF1 C;  4R4L A;  1S72 P;  1A02 F;  4LLH A;  1X0T A;  1T3U A;  4EOT A;  1P84 E;  3IN6 A;  3AE2 C;  3NTN A;  3V5B A;  1FAV A;  1KQL A;  1SQX G;  4RKU J;  2P58 A;  2W83 C;  2Q3E A;  4C7N B;  3A0B E;  3O8Z A;  4A7P A;  3CWB D;  1RHZ B;  2XV5 A;  4BRY A;  1T2K C;  1J2J B;  4WY4 D;  1ZN5 A;  5GTH E;  4PV1 B;  2Z5I A;  1PPJ E;  1PP9 J;  1PFI A;  1NOH A;  1LTB C;  4UB8 H;  2ZXX A;  1J1E B;  2WZ7 A;  1AFO A;  2H43 A;  2WPV B;  3W67 A;  3L75 G;  5GTI H;  3VN0 A;  1RH5 B;  3TDK A;  4HYT B;  1YI2 P;  3PTZ A;  3H25 A;  3CWB E;  4DOJ A;  3HE5 A;  1X8Y A;  2WPR A;  2YIU B;  3CPW O;  3AE8 C;  3U1A A;  3CCS P;  2WSC J;  1T2K D;  1RE4 A;  2ZVN B;  4PD4 I;  2LXC B;  2IBZ I;  2RH0 A;  3VMY A;  1LTJ B;  2JWD A;  3T97 B;  4AQR D;  2OAR A;  3CI9 A;  2E74 B;  1NTZ J;  1IK9 A;  2QEX P;  3TK1 A;  3CCU P;  1VL2 A;  1LT9 C;  1LWU A;  1SQX E;  1NU1 J;  1YTZ I;  1JY3 N;  2IBZ G;  3E1I A;  2XU6 A;  3H1I G;  4HH2 A;  1NWQ A;  2QIW A;  1GW4 A;  1YJ9 P;  1OX3 A;  1EZV G;  2KSE A;  3AEE C;  4IL6 H;  3L71 G;  1IFP A;  3BCC J;  2KNC B;  1L4A C;  2WSS H;  1OW8 A;  1DX7 A;  1CI6 B;  3A0H H;  1Y9B A;  1JTH B;  1PIX A;  3TNU B;  4QMA A;  5CMZ A;  1URQ B;  1AVY A;  2OQQ A;  2R44 A;  2JDI H;  4CPG A;  4PJ0 H;  2O1K A;  5CJ4 A;  2I8D A;  3IF4 A;  3M06 A;  4WY4 A;  1NAY A;  1OFC X;  4AUW A;  2C0W A;  2ZT9 C;  1L4A D;  3KDP B;  3OW2 O;  1OIP A;  1N7S A;  1VF5 C;  4ZKU A;  1GU5 A;  3MP7 B;  4PD4 E;  1BCC G;  3E1R A;  1SQV G;  1W2B O;  5CCH C;  5AW7 B;  3A5T A;  2KS1 A;  3RBZ A;  3M0A A;  1K04 A;  1KIL A;  2Q5U A;  2KXP B;  3C9I A;  3L70 J;  1G1J A;  1KB9 H;  1HJ0 A;  1YIJ P;  2JP3 A;  1RE3 C;  2QSI A;  4MN4 C;  3H1H G;  4WWI A;  4RES B;  1CI6 A;  1NH4 A;  1OVR A;  5CCG D;  3NXS A;  3L71 E;  3AE5 C;  1JCC A;  1YJN P;  1BGY G;  3MUD C;  2FFD C;  5CCH D;  1NTK J;  1GZL A;  4JQ0 D;  3H1J G;  1USE A;  3CX5 H;  2QM8 A;  4Y99 B;  4Y28 J;  2XND H;  2B87 B;  3Q2Y A;  4ASW A;  2C9L Y;  3L4F A;  1RQU A;  2FYU G;  1HJB A;  3O6Q B;  3H6P A;  3C8V A;  1KN7 A;  3JCU E;  2I1J A;  5H2F H;  1SVF A;  2QG4 A;  3CXH D;  5AW2 B;  2KB7 P;  1Z56 A;  1KQG B;  3GHG B;  3Q5R A;  5KLV G;  1Y8A A;  5B5E H;  2V7Q H;  4M3L A;  1H8A A;  3H1H D;  2O01 N;  2HLO A;  3BAS A;  3LIE A;  1BCC E;  1ZR2 A;  3AE4 C;  1SQV E;  5KTB A;  2LXB A;  3N7N A;  3BVH A;  3B5N A;  1L0L G;  2M3E A;  3HTK B;  3HD7 C;  3VMX A;  2AXT E;  1VQ4 P;  1PZQ A;  1IJD B;  3AE7 C;  3I5C A;  1M1K Q;  2FY8 A;  4EI2 A;  5KAF E;  1NHL A;  3V4W A;  3Q3D A;  3H1H E;  4B86 A;  2P1J A;  3RGU A;  4H44 B;  1SQQ D;  1LTS C;  3MD0 A;  2P10 A;  3CCL P;  1ZOY C;  2XKM A;  3L74 D;  4IOI H;  1PGO A;  1M57 D;  1FZA A;  2HOD A;  3FGA D;  1JUN A;  3HD7 D;  3WUU A;  5CHX A;  2KIK A;  3H1J E;  2IPP A;  3M9Q A;  2R32 A;  1AVO A;  3WU2 H;  2MKV A;  2JKV A;  4H13 B;  3GHG A;  1OXZ A;  5E79 H;  2BAS A;  5CBN A;  2FYU E;  1JY3 O;  3G6E P;  1JY2 P;  2RN0 A;  1SFC A;  4KT0 J;  3U1C A;  1QLE D;  2OYI A;  1M1J B;  1FZC A;  2NZ2 A;  2QJY B;  4K35 A;  3P8C D;  1M7L A;  3R4Y A;  3H1K J;  5AVU B;  4IFM A;  5KLV E;  3RK3 B;  3HTK A;  1L0N J;  3G4S P;  5M1B A;  3PRJ A;  1AQT A;  3R2P A;  2VRS A;  3TGU D;  3KXD A;  1KYO H;  3LID A;  3FXE A;  1K05 A;  2IZ0 A;  4PV1 C;  2P2U A;  1U57 A;  2Y0E A;  2KZI A;  3B71 A;  4UB8 E;  2ZVO B;  1A02 J;  1MKM A;  3Q1M A;  4C7R A;  1X22 A;  1KFN A;  2LKM A;  1LNQ A;  2E5T A;  1J1E C;  1CZQ A;  1RF0 A;  2J59 M;  4U3F J;  4BRY B;  2IFM A;  4KJM A;  1YJW P;  1SQB D;  3TGU E;  1NTZ K;  1BE3 D;  1MV8 A;  1WT6 A;  3M9B A;  1NU1 K;  2FKW B;  2B88 A;  2L5G B;  4PV1 D;  1VQ5 P;  1TU3 F;  2WSC H;  2H88 C;  2W8Z A;  4NPF X;  1S2E A;  2JO1 A;  1LTJ C;  2XDJ A;  2POH A;  2M0B A;  1SQB E;  1K9M Q;  1N73 B;  2C0X A;  1BE3 E;  1VQP P;  1JM0 A;  4Z1M H;  1ZW0 A;  5KAI E;  2E74 C;  1MFT A;  1RQV A;  1SQP J;  5B66 E;  3V2Q A;  1PPJ D;  2K88 A;  1KOR A;  1CSB A;  1X79 B;  2P67 A;  4C46 A;  1FZF A;  3RL0 g;  3ITK A;  2HR3 A;  1S5L H;  3I56 P;  4GKG A;  4W7Z A;  1WRG A;  1W5C E;  5DJU B;  4GOE A;  1KMI Z;  2OYH A;  3CX5 I;  1GW3 A;  1LWU B;  2K1A A;  4GT1 A;  3G71 P;  1PGP A;  2E74 D;  1LP1 A;  1S3J A;  4AYC A;  3AE3 C;  1YHQ P;  1OMI A;  2AEJ A;  2KLV A;  2N1T A;  5KKZ B;  3RK2 B;  4I7Z B;  1N7L A;  3I55 P;  1LTT C;  4TT3 H;  3L73 G;  2NPS A;  2FYZ A;  5APS A;  3V6I A;  1N73 A;  1URQ C;  4H0L B;  2K9J A;  4TLF A;  3RL0 B;  1SQX D;  2ZFC A;  5L8R J;  3G3Z A;  1GL2 A;  1MFZ A;  3HUS B;  1MZ9 A;  1ZRT D;  4DT0 A;  2CPB A;  2O3J A;  2WTY A;  1ZR4 A;  2K3R A;  3VOP A;  3PLN A;  3VYI A;  4HKZ H;  4O9B A;  1YBK A;  3RBX A;  3AEC C;  1EZV I;  1EDK A;  3SSU A;  1MUU A;  1KTM A;  1FOS E;  2BCC G;  1M8O B;  3CCE P;  3SFD C;  2D2C B;  1URQ D;  1W2E A;  4WY4 B;  1NTK K;  1FZG A;  3L75 D;  1SQQ J;  1KIL E;  3PJS K;  1RF1 B;  1ZRT E;  2K37 A;  1FS0 E;  2GUS A;  3L72 G;  3B8E B;  2R5D A;  1X9V A;  3L74 J;  1QGK B;  1P84 H;  3UIA A;  1N7S B;  2E5Y A;  4D6T J;  3N4X A;  1UII A;  2FYN B;  1S4X A;  3VP9 A;  2Q1K A;  3D70 A;  2KS1 B;  2PGD A;  2W27 A;  3A0B H;  1JEK A;  3GG2 A;  2A06 G;  2GA1 A;  4KHX A;  1KIL B;  2FXO A;  3L75 E;  1GTW A;  2H7H A;  3CME P;  1DH3 A;  5GTH H;  2WT7 A;  1SP4 A;  3L35 A;  3VTP C;  3H1L G;  2QJK B;  4DJG A;  4Y99 C;  3HUS A;  4N78 E;  5TIS H;  2WPQ A;  2QJP B;  1VQL P;  2BEZ F;  1KYO I;  2UWJ E;  3VMZ A;  3D6Y A;  4L74 A;  2BCC D;  3JC2 2;  4PD4 D;  3TGU J;  2M5A A;  2BEQ D;  1U7M A;  1BDC A;  2IBZ D;  1FJP A;  2IX7 C;  2DW3 A;  2E75 B;  3H1I D;  5AVV B;  4JYB A;  3FX0 A;  1DD3 A;  2Q7C A;  3CD6 P;  1EZV D;  4I6M C;  4OGQ C;  5KJ7 C;  1RF1 A;  3AEA C;  5AVR B;  1NVO A;  3E7K A;  1HGV A;  2BCC E;  1YIT P;  2WIT A;  1JOC A;  1BSN A;  1SQB J;  1L2P A;  1BE3 J;  3CCQ P;  1NTM J;  1PP9 G;  3L71 D;  2A06 D;  5AW6 B;  2H89 C;  2IBZ E;  3S9O A;  4IL6 X;  3H1I E;  4GIF A;  1JO5 A;  2A45 I;  1YQ3 C;  3OJA B;  1EZV E;  3WMM 0;  1VDF A;  3TSI A;  4H44 C;  2WMM A;  3B5N B;  4OGQ D;  3AEG C;  1XTG B;  2ZT9 D;  5KJ7 D;  3AE6 C;  1M56 D;  2WSE J;  1DD4 A;  4BWN A;  2JEE A;  1VQ9 P;  2A06 E;  3GW6 A;  1VF5 D;  3JSV C;  1L0N K;  3B4S A;  3AEF C;  3EFF K;  4LC1 A;  2A45 G;  4EDF A;  4DCK A;  1Q7Y Q;  3WU2 E;  1SLQ A;  4H13 C;  4ZKP A;  5BU5 A;  3KPE A;  3V2N A;  3Q5S A;  1LJ2 A;  2JJL A;  2M8R A;  3M0D C;  1IFJ A;  1JNM A;  3OA7 A;  1BCC D;  1M1J C;  4H44 D;  4U7J A;  1IK7 A;  3CWB J;  1HWT C;  1NTZ G;  1SQV D;  4JYC A;  2YKP A;  2HOD B;  2ZAE B;  3M9H A;  1AA0 A;  1JB0 J;  1NU1 G;  2FXM A;  5APU A;  2WVR A;  2J58 A;  1KYO E;  1USD A;  1SFC B;  3MIW A;  1VPC A;  4GOD A;  1IFD A;  4H13 D;  2OYI B;  2QRX A;  1FZC B;  1LGH B;  3HE4 B;  1FZB A;  1LT9 A;  2W6B A;  5AVS B;  1FC2 C;  4HB1 A;  2JR8 A;  3CCM P;  3ZDM A;  2KSJ A;  1BGY D;  1Y47 A;  3KZI E;  5AW4 B;  1N86 A;  4RO0 A;  1IO4 A;  3H1J D;  3BCC G;  1SQP K;  1SQX J;  1JY3 P;  2OGU A;  1M90 Q;  3ABV C;  2FYU D;  2HPC B;  1QVF O;  2IDB A;  4WBA A;  3VP8 A;  1KFM A;  1BGY E;  2YO2 A;  5APT A;  2O01 J;  3FWL A;  1LTG C;  1NU1 D;  1L4A A;  5APY A;  1D7M A;  5KLV D;  2HG5 D;  1VQ8 P;  2E76 B;  1PL5 A;  1PGQ A;  3RK3 E;  2R5B A;  3V4Q A;  1K8A Q;  3SWY A;  3L75 J;  1RE4 C;  5C39 A;  3F5H A;  3P8M C;  4YTP C;  1OVU A;  2YKO A;  3IAO A;  2QM7 A;  1KQS O;  3A3Y B;  1NTZ E;  5AW0 B;  1IFN A;  2AEM A;  1L0L D;  3IR9 A;  3HE4 A;  2IFN A;  4IFD K;  1FOS F;  5TJH A;  1NU1 E;  3HRN A;  1HF9 A;  3MHV A;  3L37 A;  1H0T A;  3BCC D;  1H89 A;  1IFI A;  3JCU H;  5CCG A;  1LWU C;  1FBM A;  1UIX A;  3L70 G;  1G2C B;  3D6Z A;  3CL3 D;  1HGZ A;  1L0L E;  4I2L C;  1IFM A;  2B9B A;  3W68 A;  3BRT B;  5CCH A;  2HPC A;  5KKZ C;  3RK2 C;  4I7Z C;  4ZMD A;  2OTK E;  5GTI E;  2HFE D;  3WUV A;  1YQ4 C;  3BCC E;  2OYH B;  2LR2 A;  5AVT B;  2YIU C;  1RE3 A;  1NKN A;  1NTK G;  5KLI B;  2KZJ A;  3H1I J;  1LP1 B;  1KD1 Q;  3CXH H;  4I1L A;  2AXT H;  2Q6Q A;  3HD7 B;  1J1D B;  4YPC A;  1S9K E;  2YMK A;  1DEE G;  2N1T B;  2YO3 A;  3CC7 P;  4H0L C;  1SQQ K;  3RL0 C;  4N6J A;  3MUD A;  5KAF H;  1EDJ A;  2KK7 A;  2FFD A;  3KQG A;  2FBW C;  4L75 A;  1R5L A;  3RK2 D;  2NPS B;  1EXI A;  3L71 J;  1FU1 A;  3V2R A;  3AE9 C;  5CBO A;  5EFW B;  1Q86 Q;  1QX8 A;  2OYO A;  3L70 D;  4WB4 A;  1G1I A;  1KB9 I;  1Q90 D;  3H32 A;  2K9J B;  2W6J H;  2D2C C;  3BAT A;  1GL2 B;  3F89 A;  1G2C A;  4N3Y B;  4WY4 C;  3KYQ A;  3SWK A;  4JBZ A;  1GU4 A;  1FJK A;  2IYP A;  2I1K A;  1HBW A;  4H0L D;  3RL0 D;  3S4R A;  1QEX A;  2Q3I A;  1IZN B;  3OAK A;  2ZJS E;  1N7S C;  2YXR B;  1NTK D;  2KI7 B;  1QL1 A;  3L70 E;  1RY3 A;  2FYN C;  1FE6 A;  2IZ1 A;  5AW5 B;  4UB6 H;  1JMM A;  3HD7 A;  4IL6 E;  1LT1 A;  1KIL C;  1PGJ A;  1LTA C;  1IC2 A;  2D2C D;  2KYV A;  1BCC J;  4XA4 A;  2QJK C;  2WWW A;  1S1C X;  1SQV J;  1CW5 A;  2E43 A;  2OTJ P;  5AVX B;  4YXW H;  1NTK E;  3A0H E;  2GUV A;  5TIS E;  2QJP C;  4OH8 B;  2K9Y A;  1SQB K;  1N7S D;  2IYO A;  1NTM K;  1LTI C;  5AW8 B;  3P7K A;  4WVZ A;  3AED C;  1QL2 A;  2AXC A;  4PJ0 E;  3BRV B;  3H1H J;  2WT7 B;  2E75 C;  1JMB A;  2PFX A;  1HH0 A;  1HTL C;  5K5G B;  1KIL D;  1S5L X;  2WSF J;  4W80 A;  3H1K G;  3QH9 A;  3S1K A;  1OWA A;  1L0N G;  1YYC A;  1BGY J;  2ZXE B;  5BVZ A;  1KB9 D;  2FXP A;  3C1L A;  2M5A B;  4EYY Q;  2ZYG A;  1KV4 A;  3CC2 P;  1R5S A;  5APW A;  3H1J J;  2M3B A;  5AW3 B;  2NRG A;  2JWA A;  3CCJ P;  5APV A;  3GF3 A;  2FYU J;  4XFJ A;  3KHU A;  4C7N A;  2HYN A;  5KAI H;  2B89 A;  1Q81 Q;  5B66 H;  2E75 D;  4ASV A;  1EDL A;  5AVQ B;  3NMD A;  2RMZ A;  4U3F G;  2ZYD A;  3CX5 D;  1OVV A;  3Q5P A;  1KB9 E;  3L73 D;  2SPZ A;  2H8P D;  4N78 D;  3B5N C;  1ZV8 A;  1N2D C;  1VQ6 P;  5KLV J;  2XNX A;  3L36 A;  1U7J A;  3TF5 A;  5AW1 B;  2WSE H;  1GDT A;  2W90 A;  1AV1 A;  3H1K D;  2OTL P;  1L0L J;  1VQN P;  1ZLL A;  1L0N D;  3CX5 E;  1H88 A;  3L73 E;  3SFE C;  2Z5H A;  4HJG H;  2QA4 P;  3B5N D;  1JY2 N;  1SQP G;  4K3A A;  5H2F E;  1OW7 A;  3LW5 H;  1LTJ A;  3GHG C;  1SQX K;  3H1K E;  3AEB C;  3L72 D;  3T97 A;  5B5E E;  1QVG O;  2KOG A;  1L0N E;  1SFC C;  4U3F D;  2N9B A;  4OVN F;  2OYI C;  1FZC C;  2E42 A;  3GMA A;  1EDI A;  2PRR A;  3CXH I;  2GM4 A;  1XTC C;  3V2P A;  5BU8 B;  3CCR P;  5AVY B;  3L72 E;  5CCG C;  3VMA A;  4R4M A;  3H1L D;  3CC4 P;  4NPE A;  3PHL A;  4U3F E;  2Y0C A;  1VQO P;  4YXD C;  2AEF A;  3EQ2 A;  2QVA A;  1LT9 B;  1YTZ T;  1SFC D;  5DJT B;  3AE1 C;  1RF0 C;  3EWK A;  1SQP D;  3USS A;  1VQK P;  2G8Y A;  1SS1 A;  2KNC A;  1HUC A;  2O01 H;  2E76 C;  2Y0D A;  3H1L E;  2Q9I A;  1T6A A;  1JTH A;  1KQF B;  1KYO D;  1AJY A;  3TNU A;  5AVW B;  5E79 E;  1GK6 A;  1URQ A;  1NJI Q;  2W6A A;  1SQP E;  4BXL A;  2KP8 A;  4L73 A;  3LW5 J;  2QJY C;  1L4A B;  1PP9 D;  1N8R Q;  3SWF A;  4LGD E;  1GD2 E;  3P32 A;  3RK3 C;  2V4H A;  1E79 H;  1FDI A;  3QWO C;  1SQQ G;  1Q82 Q;  2XZR A;  2R3C A;  1VQM P;  4GDO A;  2E76 D;  2J5U A;  1ZXG A;  5APX A;  1GMJ A;  4JF7 A;  2CPS A;  3L74 G;  4D6T G;  3PH0 A;  1PP9 E;  1KC8 Q;  1KZU B;  1H0T B;  4OGQ B;  2ZT9 B;  2YMY A;  2Z4E A;  2OYH C;  2R3S A;  1NO4 A;  1VF5 B;  3RK3 D;  4PD4 H;  1NAF A;  5KLI C;  3U59 A;  3CXH E;  1J1D C;  1ZME C;  4JPZ B;  2L91 A;  2ZYA A;  1EXJ A;  2N1T C;  2RKL A;  1NGM B;  1NTZ D;  3A2A A; 
#chains in the Genus database with same CATH homology
 3RK2 D;  1HVV A;  5CCH C;  1MUU A;  2NPS B;  5AW7 B;  1FU1 A;  3V2R A;  3A5T A;  1FOS E;  1T3J A;  3M0A A;  5CJ0 A;  2PAJ A;  1DEB A;  1URQ D;  1KIL A;  4WB4 A;  2NPS C;  1G1I A;  1W2E A;  2Q5U A;  3H32 A;  4WY4 B;  1NTK K;  3C9I A;  1FZG A;  1N73 C;  2YNY A;  1G1J A;  1RE3 C;  1RF1 B;  1FDM A;  4W7Y A;  3BAT A;  2GUS A;  1GL2 B;  3B8E B;  4RES B;  2R5D A;  1G2C A;  4N3Y B;  4WY4 C;  1CI6 A;  1X9V A;  3KYQ A;  3NFQ A;  3UIA A;  1N7S B;  1NH4 A;  1GU4 A;  1FJK A;  2FFD B;  2I1K A;  1HBW A;  5CCG D;  3NXS A;  3RL0 D;  1GL2 C;  3MTU E;  2Q3I A;  1JCC A;  3N4X A;  3OAK A;  2N1T D;  1N7S C;  3VP9 A;  2FFD C;  1SQV K;  2W27 A;  1QL1 A;  5CCH D;  1GZL A;  1RY3 A;  4KHX A;  1KIL B;  1GTW A;  2QM8 A;  2H7H A;  5KJ7 A;  3H32 B;  4Y99 B;  3CLQ A;  5AW5 B;  1DH3 A;  1AQ5 A;  2NPS D;  2C9L Y;  1JMM A;  1NKZ B;  3HD7 A;  3L4F A;  1SP4 A;  3L35 A;  2WT7 A;  3TYY A;  2O1J A;  3VTP C;  1KIL C;  1HJB A;  4Y99 C;  2P7J A;  1LTA C;  1IC2 A;  3H6P A;  3HUS A;  1S9K D;  4N78 E;  2KYV A;  2I1J A;  1SVF A;  2WPQ A;  4IFF A;  4XA4 A;  1T8Z A;  2WWW A;  1CW5 A;  4XE5 B;  3VMZ A;  5AW9 B;  2E43 A;  5AW2 B;  5AVX B;  2KB7 P;  2YKQ A;  2WPS A;  1GL2 D;  1Z56 A;  2GUV A;  3IFM A;  1E5W A;  3GHG B;  4OH8 B;  1SQB K;  3PP5 A;  1N7S D;  4M3L A;  1NTM K;  1FJP A;  1JY2 O;  1LTI C;  2IX7 C;  5AW8 B;  1FZE A;  1H8A A;  5AVV B;  3P7K A;  4JYB A;  1QL2 A;  3P8C E;  3BRV B;  2HLO A;  3BAS A;  3LIE A;  3M91 A;  2WT7 B;  2Q7C A;  1ZR2 A;  1HH0 A;  3II6 A;  1HTL C;  4I6M C;  5KJ7 C;  5KTB A;  5APQ A;  1RF1 A;  3N7N A;  3BVH A;  1GK4 A;  3B5N A;  5AVR B;  2FYU K;  1KIL D;  3HTK B;  4W80 A;  3HD7 C;  3VMX A;  2PP6 A;  1HGV A;  1IJD B;  1OWA A;  3MGN A;  2WIT A;  1JOC A;  1YYC A;  2ZXE B;  3HUS C;  5BVZ A;  3I5C A;  2MJZ A;  3EFG A;  1JCD A;  2C9N Y;  5AW6 B;  4EIJ A;  3A7O A;  5APW A;  1NHL A;  3V4W A;  1EQ7 A;  2WSF H;  5KLV K;  2M3B A;  5AW3 B;  4B86 A;  4GIF A;  1JO5 A;  5AVZ B;  2P1J A;  3M0D A;  5APV A;  2A45 I;  1LTS C;  3MD0 A;  3OJA B;  1M1J A;  3HE5 B;  2A45 H;  1VDF A;  3WMM 0;  4C7N A;  2HYN A;  3TSI A;  2XKM A;  3B5N B;  5AVQ B;  3NMD A;  1XTG B;  5KJ7 D;  4DZO A;  1L0L K;  1FZA A;  2HOD A;  1RF1 C;  1JUN A;  2H8P D;  2JEE A;  3HD7 D;  4N78 D;  5CHX A;  3B5N C;  1ZV8 A;  1N2D C;  1A02 F;  2IPP A;  4LLH A;  3M9Q A;  1T3U A;  2R32 A;  1L0N K;  4EOT A;  3GHG A;  2XNX A;  1OXZ A;  3L36 A;  2BAS A;  4LC1 A;  2A45 G;  1JY3 O;  3NTN A;  1JY2 P;  3V5B A;  5AW1 B;  3U1C A;  1SFC A;  1FAV A;  1KQL A;  2WSE H;  1GDT A;  1SLQ A;  4ZKP A;  5BU5 A;  3KPE A;  3V2N A;  2OYI A;  1M1J B;  1FZC A;  4C7N B;  2JJL A;  2M8R A;  3M0D C;  1IFJ A;  3P8C D;  1JNM A;  3O8Z A;  1M7L A;  1ZLL A;  3OA7 A;  2XV5 A;  1H88 A;  5AVU B;  1M1J C;  4IFM A;  1T2K C;  3RK3 B;  1HWT C;  3HTK A;  4JYC A;  2YKP A;  1J2J B;  4WY4 D;  1ZN5 A;  2HOD B;  2Z5I A;  2Z5H A;  3R2P A;  3M9H A;  2VRS A;  1PFI A;  1NOH A;  1LTB C;  3LID A;  3B5N D;  1JY2 N;  2FXM A;  5APU A;  2P2U A;  1J1E B;  2WZ7 A;  2J58 A;  1AFO A;  2H43 A;  3LW5 H;  1LTJ A;  1SFC B;  3MIW A;  1A02 J;  1VPC A;  3VN0 A;  3GHG C;  4C7R A;  4HYT B;  1KFN A;  1SQX K;  2LKM A;  1J1E C;  3T97 A;  1IFD A;  1CZQ A;  2OYI B;  1FZC B;  1LGH B;  1RF0 A;  3HE4 B;  2KOG A;  1SFC C;  4DOJ A;  2J59 M;  3HE5 A;  2N9B A;  1X8Y A;  1FZB A;  1LT9 A;  2WPR A;  2W6B A;  5AVS B;  2OYI C;  1FZC C;  2IFM A;  3U1A A;  2KSJ A;  2E42 A;  1T2K D;  1NTZ K;  1RE4 A;  5AW4 B;  1MV8 A;  1WT6 A;  1N86 A;  3M9B A;  2GM4 A;  1IO4 A;  1XTC C;  3V2P A;  5BU8 B;  1SQP K;  1NU1 K;  2FKW B;  2L5G B;  5AVY B;  1JY3 P;  3VMY A;  1LTJ B;  2WSC H;  5CCG C;  2HPC B;  4AQR D;  2OAR A;  1LTJ C;  3CI9 A;  2XDJ A;  3EQ2 A;  4WBA A;  2POH A;  3VP8 A;  1LT9 B;  1YTZ T;  1SFC D;  1IK9 A;  1KFM A;  2YO2 A;  5APT A;  3TK1 A;  1N73 B;  1RF0 C;  2C0X A;  1LTG C;  1L4A A;  5APY A;  1LT9 C;  1LWU A;  2HG5 D;  1YTZ I;  1JY3 N;  3V2Q A;  2R5B A;  3E1I A;  3V4Q A;  2XU6 A;  1CSB A;  4HH2 A;  3SWY A;  1RE4 C;  1HUC A;  1X79 B;  1NWQ A;  2P67 A;  2O01 H;  4C46 A;  1FZF A;  3P8M C;  1GW4 A;  2Q9I A;  2YKO A;  1JTH A;  2QM7 A;  3A3Y B;  5AW0 B;  1IFN A;  3TNU A;  4GKG A;  4W7Z A;  3IR9 A;  5AVW B;  3HE4 A;  1GK6 A;  1URQ A;  1WRG A;  2IFN A;  2W6A A;  4IFD K;  1FOS F;  2KP8 A;  3HRN A;  2OYH A;  3L37 A;  1L4A B;  1GW3 A;  1LWU B;  3SWF A;  4LGD E;  1GD2 E;  1H89 A;  4GT1 A;  3P32 A;  1IFI A;  3RK3 C;  5CCG A;  1L4A C;  4AYC A;  1LWU C;  1FBM A;  1G2C B;  1DX7 A;  2KLV A;  1CI6 B;  2N1T A;  2XZR A;  2R3C A;  3CL3 D;  3RK2 B;  1HGZ A;  1JTH B;  1N7L A;  4I2L C;  1IFM A;  5APX A;  3BRT B;  1LTT C;  4JF7 A;  2CPS A;  3TNU B;  5CCH A;  5CMZ A;  2HPC A;  3RK2 C;  1URQ B;  2HFE D;  2NPS A;  1KZU B;  2FYZ A;  5APS A;  2O1K A;  2OYH B;  1N73 A;  5CJ4 A;  1URQ C;  5AVT B;  1RE3 A;  1NKN A;  3M06 A;  2YMY A;  2Z4E A;  2OYH C;  4WY4 A;  4I1L A;  4AUW A;  2C0W A;  3HD7 B;  3RL0 B;  1J1D B;  1NO4 A;  2ZFC A;  1S9K E;  3RK3 D;  3G3Z A;  1L4A D;  1NAF A;  2N1T B;  1GL2 A;  1MFZ A;  3HUS B;  3KDP B;  2YO3 A;  3U59 A;  1MZ9 A;  1SQQ K;  3RL0 C;  1J1D C;  4N6J A;  2CPB A;  3MUD A;  1N7S A;  2WTY A;  2FFD A;  4ZKU A;  1GU5 A;  1ZR4 A;  2N1T C;  3KQG A;  3VOP A;  3VYI A;  4O9B A;  3A2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...