1N2DC

Ternary complex of mlc1p bound to iq2 and iq3 of myo2p, a class v myosin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
48
structure length
48
Chain Sequence
QISQAIKYLQNNIKGFIIRQRVNDEMKVNCATLLQAAYRGHSIRANVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Myosin Light Chain
publication title Structure of the light chain-binding domain of myosin V.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 22
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2002-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n2dC00
1EQ7A 1JCDA 3H6PA 1KFNA 2GUSA 2GUVA 1N2DC 1KFMA 1JCCA 1T8ZA 2IX7C
chains in the Genus database with same CATH superfamily
3H1KJ 2M3EA 2QJPC 1VF5C 1JUNA 2GM4A 3VYIA 2N9YB 1IFPA 4K35A 4HKZH 3AEDC 3VMZA 1LTJB 3CXHI 2WITA 2B9BA 3MD0A 1LGHB 1AVYA 1PGOA 1K05A 2E75D 4JF7A 2KIKA 2KS1B 1NU1G 3HTKB 2KYVA 2V4HA 3G9RA 5KJ7D 1NU1D 3TNUA 2BCCE 2PP6A 3SFDC 1SQXJ 5AW8B 1A02F 3RK3B 3FX0A 3EWKA 1S1CX 2Y0DA 3LW5H 3L73E 4DT0A 1L0NK 2OYOA 2M5AA 3TYYA 3GF3A 1NTMG 1SQVK 2P1JA 1NTZD 1SQPK 5AVSB 2K9JB 4EI2A 2RKLA 3JCUH 2L5GB 3TSIA 2JJLA 1N7SC 1LJ2A 5APUA 2D2CD 2JP3A 4PV1C 5KLVG 3MIWA 1FZCC 3BRVB 1ZLLA 4BXLA 1M1JA 4U7JA 1M1KQ 3KYQA 4TLFA 4H13C 3C8VA 3CL3D 3SSUA 4I7ZC 4GOEA 2OYHB 2JKVA 2P67A 3WUUA 1AV1A 1BSHA 3GW6A 2QJYB 2ZXXA 3H1IG 2FFDA 1S5LH 4IFDK 2BCCJ 1VPCA 2HODA 2E75B 3H1ID 1RQVA 3CX5D 1SFCC 3Q5SA 2C9LY 1QEXA 1L0NE 3FWNA 1L0LG 1W5CE 2H88C 3L73J 1NKZB 3MTUE 3H1JJ 1L0LD 1SQVE 3TGUE 4R4LA 1ZR2A 2N1TC 1NWQA 1M57D 3L75E 1JY2O 4ASVA 5E79E 1X0TA 2HYNA 1G2CA 2O01H 4OWFA 2W8ZA 5TJHA 1JTHB 5DJTB 5AW9B 4U3FG 4I1LA 1VQPP 1VF5D 1ZMEC 1YIJP 1Q86Q 2PRRA 1M56D 2QEXP 1HGZA 1M7LA 1SQBD 3E1IA 3R2PA 2QJKB 1BCCG 2E5TA 2D2CB 1DD4A 1FZFA 3Q5RA 1T2KC 2HG5D 3A0HE 5CJ4A 3E7KA 4DJGA 2YIUB 1URQC 3GHGC 2W6BA 2FYNB 1Q2NA 1BDCA 4GT1A 3U1CA 1IFJA 3RL0g 2WPSA 3TNUB 5AVXB 3KPEA 3TGUJ 2W90A 1EDKA 3RL0D 3L75J 1N73A 1P84D 1ZOYC 3FGAD 3CXHE 1FZBA 5KKZC 2M5AB 2AXTH 4N78E 3CX5I 2WSCJ 5B66E 3OAKA 3L35A 2V7QH 3D6ZA 1GDTA 1SQQD 2WZ7A 1HF9A 2WWWA 1LTJC 1OW8A 2QJPB 1NAYA 2P2UA 4RJTA 1MKMA 4ZMDA 1VF5B 1YI2P 4L76A 3ABVC 2LKMA 3A5TA 4OH8B 2OYIA 1XTCC 1K04A 3MUDC 5AVYB 4H13D 3MHVA 4IFFA 1ZXGA 1EQ7A 3CC7P 3KZIE 3AE4C 3RK3E 5CJ0A 5APVA 1AQ5A 3RK3C 1SFCD 1NU1K 4AYCA 1EDJA 1BGYE 1Y47A 3M0DA 1KFNA 2J59M 3L71G 1OFCX 1SQVG 3B71A 4NPFX 3L71D 1SQPG 1G1IA 1T8ZA 1IK9A 1SQPD 1VQ8P 3RL0B 1RE3A 1NTZK 3GF7A 2BASA 2MJZA 1JCDA 5KLIC 3CWBG 3A0BE 1KZUB 4UB6H 3BATA 3CMAP 3CWBD 3CCLP 1X9VA 1KILA 4YXWH 2ZYAA 1P84I 3H32A 2JEEA 3B5NC 3HE5A 4R4MA 2B88A 3B8EB 2WSCH 2O1JA 1N2DC 3TDKA 3BVHA 2YO2A 2QJYC 1NGMB 4IL6E 2E75C 2YXQB 2XZRA 1NU1E 5AW2B 1URQD 3HRNA 3KHUA 4H13B 4Y99C 4D6TG 1CI6A 4C7NA 2BEZF 3N7NA 5AW4B 1GMJA 1HH0A 3I5CA 3OJAB 4D6TD 5KJ7C 1BGYJ 2WPVB 3AEBC 2R3SA 1DX7A 1SFCB 2KLUA 1NTKJ 2E74C 4WVZA 2IFNA 1LWUA 3P8CD 1NTZE 1MV8A 2P7JA 5AW7B 4BRYB 2N1TB 1PIXA 4JYBA 2GUSA 3L72J 3CCUP 3PP5A 1JCCA 1FZEA 1FZAA 1IK7A 3Q3DA 3CXHH 5TISE 2QJKC 2WSSH 5KLVE 2D2CC 3H1LJ 2YO3A 1SQBK 1KMIZ 3S4RA 1KV4A 1JY3N 2ZYDA 4W80A 3BCCG 3M9HA 1DEBA 2OYIB 1VQ9P 3BCCD 3SWYA 1PGPA 3LW5J 3H1IE 1RH5B 2HPCA 2R44A 4LGDE 1ZV8A 2HLOA 3CX5E 3PTZA 1AJYA 1IFDA 4PJ0E 1DH3A 1URQB 1L0LE 2YXRB 1PP9J 3KZIH 3PHLA 4BWNA 3M9QA 1S9KD 2R5BA 4ZKPA 1NTMJ 1LT9A 1GU4A 1IZNB 4C7RA 1E5WA 2KOGA 3L74D 1T3JA 3IFMA 5KKZB 1Q7YQ 2Q9IA 1LTTC 3M06A 3ZDMA 3V4QA 1FDOA 1S2EA 1JMBA 5CCHA 1SQQK 1G1JA 1SQBE 5KLVJ 3B5ND 3BASA 2H7HA 5AVWB 3CLQA 2P10A 3V5BA 3M9BA 2FXPA 4GODA 3H32B 1BCCE 3QH9A 1OVVA 4HH2A 1GL2A 1M1JC 2LR2A 3A0BH 5GTHE 2LXBA 3AE5C 4IOIH 5BU5A 3D6YA 3V2PA 2H89C 4MN4C 1LTIC 3P8MC 3SWFA 1WT6A 2RN0A 2FFDC 3B4SA 2WSEH 1KQLA 2Q3IA 2O01J 4C7NB 1L0LJ 1LTBC 3A2AA 1FC2C 5AVTB 1YHQP 4IL6H 3VOPA 3F89A 1YJNP 1BE3J 2E74D 2LXCB 4H0LD 2Q3EA 1P84E 5CMZA 3G6EP 3L36A 4HJGH 3VP8A 3RL0C 3Q5PA 2FY8A 3AE9C 1OXZA 1NTZG 3TF5A 3CMEP 4U3FJ 4JPZB 1DEEG 1PZQA 3FWLA 5CCHD 4OVNF 2Z5IA 4I6MC 1QX8A 1Q90D 2JWAA 1N86A 5KLIB 4NPEA 3IN6A 3N4XA 1KORA 1W2EA 3A7OA 1BCCJ 3K5BA 1JY2N 2KZIA 3PRJA 2FYUG 5AW3B 4W7ZA 3B5NB 2FYUD 1EZVD 2WQYC 1QGKB 3CPWO 2O1KA 2KNCA 3H1HG 1Q81Q 3H1HD 4Y99B 1GW3A 2ZVNB 1NJIQ 1L2PA 1VQ7P 2ZT9D 3CCSP 1VDFA 2V7QJ 3L71E 2IX7C 3L70G 2KP8A 3CX5H 1N73C 1SQPE 3SWKA 2HFED 1OZHA 1IO4A 1JY3P 3L70D 2E74B 1VQNP 4WY4A 4H0LB 3GMAA 3H6PA 2I1JA 3L4FA 5H2FE 2JR8A 3CWBE 4RESB 2A45H 2KB7P 1OW7A 2WMMA 1GW4A 1SQXD 1HVVA 2KUBA 3CCJP 5C39A 3Q1MA 2Y0CA 3ITKA 1R5LA 2ZAEB 1SQBG 1RY3A 2FXMA 1NAFA 3W68A 5APXA 2OYIC 1FDMA 1YTZT 1H0TA 1FS0E 2JWDA 1PPJD 1U7MA 4Z1MH 2QA4P 2KSEA 3G71P 3AEGC 3JC22 3V2QA 3RK2C 2XNXA 1KB9D 3LIEA 4D6TE 2C0WA 5CHXA 3SFEC 3A3YB 1L0NJ 3M0DC 1FBMA 1EZVI 3F5HA 1TU3F 2KK7A 1SQVJ 1SQPJ 2FXOA 3P8CE 4WY4D 4ASWA 1AVOA 2C0XA 5CBOA 3D71A 1RE3C 2G8YA 3WU2E 3AE2C 4YPCA 2QSIA 1PGJA 1SQQG 1ZR4A 2ZXEB 2KSJA 1KILC 3H1JG 1K8AQ 3T97A 1EDIA 5K5GB 5B5EE 1KYOD 3H1JD 1FU1A 2Q5UA 1FJPA 3II6A 1YQ4C 3BCCE 3HUSA 2E5YA 2IZ1A 3IF4A 3P32A 3NMDA 1S72P 1M1JB 2B87A 3G4SP 3E1RA 4D6TJ 4W7YA 1RQUA 1OMIA 1S3JA 1YITP 2KNCB 2FFDB 4L73A 1L4AA 5KAFE 2HODB 2M8RA 5APWA 3HE4A 2A06G 1U57A 1HTLC 1S9KE 4JYCA 2JDIH 1LNQA 3CCEP 2A06D 4AUWA 2AEFA 2OARA 2KXPB 1LWUC 1JY2P 1KB9I 1QL2A 1Y8AA 2SPZA 3L74E 1LP1A 1G2CB 2YNYA 3O6QA 4WY4B 5AW5B 4H44D 3AEFC 5E79H 4RO0A 1Z56A 2NPSA 2AEJA 1KN7A 1RF1A 1NOHA 1PV3A 3CCRP 2JO1A 5H2FH 3VMXA 1YJ9P 2E43A 3I56P 2W6JH 2O01N 1M90Q 3LIDA 1H0TB 2RH0A 2FYUK 3RGUA 1MFTA 1CSBA 4DCKA 1EXJA 1KYOI 2YKPA 3RK2D 1JNMA 1FOSE 2Z5HA 4PD4D 1GU5A 2N9BA 2QM7A 4UB8E 3U1AA 2QRXA 1ZW0A 3EFGA 3A0HH 2QE7H 1LT9C 1SP4A 4H0LC 5APYA 2NRGA 1S5LX 1QVFO 4LC1A 1N73B 4WWIA 1USDA 4ZNCA 3MZWB 1KILD 2BEQD 5CCHC 1SQXK 2C9NY 1OW6A 5AW0B 4EOTA 2K9JA 4YTPC 2WSEJ 3T97B 1NVOA 4M3LA 1N7LA 3WU2H 4A7PA 5B66H 5CCGA 1IJDB 2FYUE 1GL2C 1EZVE 1X8YA 2WPRA 3V2RA 2FYZA 4OGQC 5APSA 3AE8C 2B89A 2CPSA 3TK1A 1GZLA 1NU1J 1ZN5A 3M0AA 1USEA 2QG4A 1QL1A 3H1HE 3U59A 5GTIE 4AQRD 2IFMA 2IBZD 3RK2B 1NYHA 1QLED 3BRTB 2OYHA 1GK4A 1BSNA 1J1DB 3PLNA 3HE4B 2FBWC 1VQ6P 2ZT9C 3L70E 1NTZJ 3VMYA 3AE3C 4PD4I 5KAFH 1KQGB 3W67A 3L74G 1SQXE 1RF0A 5AVRB 1LP1B 2Y9YA 1IFIA 1LTSC 2YKOA 1HGVA 3MP7B 4NPDA 1VQ4P 2K1AA 2YMYA 4DZOA 1NTKG 1DIPA 3NXSA 1JTHA 1NTKD 1KILB 2R3CA 1GD2E 5BU8B 1PPJE 3HE5B 2K9YA 2OTJP 3HD7A 3L72G 2M3BA 3L72D 2I1KA 2WTYA 1GTWA 1T6AA 3QWOC 3S1KA 1KB9E 3H1IJ 2W27A 3H1HJ 4ZKUA 1HJBA 4EDFA 1NH4A 1OVRA 1AA0A 3H1LG 5EFWB 2L91A 1CI6B 4XA4A 3H1LD 2WSFJ 1WRGA 3C1LA 3L70J 1FJKA 4N3YB 4JQ0D 4TT3H 3KQGA 4WY4C 4UB8H 2AXTE 4LLHA 1LWUB 2HR3A 2YKQA 2IBZI 3JSVC 2K37A 2KLVA 1VQMP 1SQQE 1H8AA 1PP9G 1KYOE 3PH0A 1SQBJ 3H1JE 1PP9D 4QMAA 4L74A 1VL2A 2O3JA 2PFXA 1QVGO 2UWJE 1ZRTD 1CW5A 3HD7D 1T3UA 1GL2D 1NTMD 1CZQA 1RE4A 1EZVG 4OGQD 3H1KG 5TISH 3O8ZA 3H1KD 1H88A 3GG2A 3M91A 4WB4A 2J58A 2QVAA 3V6IA 1AQTA 4Y28J 5KLVD 2AXCA 3CCMP 4C46A 2HPCB 4EIJA 1Q82Q 2A06E 1PGQA 3AE7C 4GOFA 1HJ0A 1LTAC 2E76D 3USSA 3KXDA 1EDLA 5KAIE 5GTIH 2W83C 1HUCA 1LT9B 4PJ0H 3NFQA 1SQQJ 4GDOA 2WSFH 1KFMA 5APQA 1SQXG 1BDDA 1RHZB 2ZJSE 2A45G 1EXIA 2M0BA 1NO4A 2WPQA 4UB6E 1BE3G 1OVUA 1AFOA 2ITAA 1J1EC 4JBZA 4H44C 1BE3D 1SLQA 2W6AA 1LT1A 3Q2YA 1PPJG 1NKNA 3HUSC 2QIWA 4U3FD 3CC2P 1M8OB 3HD7B 1GL2B 2FKWB 1N7SA 5L8RJ 1UIXA 4WBAA 4IFMA 4OGQB 4PD4E 2K3RA 3D70A 4HB1A 2WT7A 3V4WA 3FXDA 1ZP0C 1L4AC 4CPGA 4XE5B 1FZCA 3IR9A 1J1DC 1BCCD 5GTHH 3CC4P 1KTMA 5CBNA 1VQ5P 2KZJA 1KB9H 3L71J 1K9MQ 4GKGA 1WMKA 2XNDH 1JOCA 3C9IA 3L37A 1UIIA 4KJMA 2H43A 3AECC 2ZT9B 2BCCG 3FXEA 1MZ9A 2Y0EA 2E76B 3VMAA 1KILE 1SFCA 2BCCD 2GUVA 2MKVA 3CWBJ 2IYOA 3NTNA 1P84H 3RBXA 4BRYA 3L73G 2NPSC 1RF1C 1MUUA 2N1TA 1A02J 3KDPB 3L73D 3GLMA 2XU6A 1NTKK 1FOSF 4N6JA 1N7SD 1FDIA 1JMMA 1KYOH 5AW1B 1VQKP 1OWAA 2Q1KA 2QM8A 1FZGA 2A45I 1YQ3C 4PV1D 1YBKA 3WUVA 2GA1A 4GIFA 1XTGB 4KHXA 2IBZE 2VRSA 1YJWP 5AVQB 5M1BA 3AE6C 1JO5A 2AEMA 2KI7B 1IC2A 3PJSK 1HWTC 2R5DA 2PGDA 1URQA 3GHGA 4YXDC 2YMKA 2CK3H 3CI9A 2Q6QA 1L0NG 5BVZA 1L0ND 2N1TD 4IL6X 3TGUG 1NHLA 5KAIH 1NTKE 2RMZA 3L75G 2H8PD 1SQVD 3TGUD 1EC5A 4XFJA 3L75D 5CCGC 1S4XA 3BCCJ 2IPPA 3MGNA 1NTMK 5AW6B 3L72E 1X22A 2IYPA 2K88A 2P58A 1PL5A 1HBWA 1X79B 1LTJA 1N7SB 5AVZB 4KT0J 1IFMA 2PAJA 4B86A 2ZFCA 3AE1C 1L4AD 1SS1A 1H89A 3H1LE 2WT7B 4PV1B 5KLVK 1T2KD 1SVFA 2OYHC 5AVUB 2OTKE 1FZCB 3MUDA 2Z4EA 3AEAC 3CD6P 2NZ2A 1W2BO 4O9BA 2KS1A 4PD4H 3I55P 1MFZA 3HTKA 1FE6A 1JEKA 1YTZI 3WMM0 4I7ZB 4DOJA 3L74J 1IFNA 1J2JB 3RBZA 3UIAA 2J5UA 3G3ZA 3H25A 4EYYQ 1RF0C 1U7JA 4I2LC 3JCUE 1PP9E 3EFFK 1L0LK 1K73Q 2NPSD 3OW2O 3P7KA 1ZRTE 4HYTB 1NTME 2WVRA 2POHA 1VQLP 2XDJA 1J1EB 3CXHD 4H44B 1E79H 3HD7C 2DW3A 4N78D 2Q7CA 2OGUA 4K3AA 3H1KE 1R5SA 1KD1Q 1GK6A 2ZVOB 3HUSB 5B5EH 2ZYGA 1OX3A 1LTGC 2B87B 3B5NA 3WUTA 5DJUB 1DD3A 1S5LE 3OA7A 2IBZG 2XKMA 3VTPC 1VQOP 1FAVA 2IZ0A 1KQFB 2G3AA 2Y9ZA 1Y9BA 2OQQA 3AEEC 3VP9A 1L4AB 5AVVB 2YIUC 2E42A 2XV5A 2FYNC 5APTA 1OIPA 3V2NA 3RK3D 1JB0J 2E76C 1JM0A 2IDBA 1YYCA 3EQ2A 3IAOA 3GHGB 1PFIA 4RKUJ 5KJ7A 2OTLP 1BGYG 5KTBA 1D7MA 3S9OA 1BGYD 1BE3E 3O6QB 3VN0A 2R32A 3CCQP 1R8EA 1KQSO 2I8DA 5CCGD 4L75A 1JY3O 1KC8Q 2CPBA 2FYUJ 3R4YA 1N8RQ 3CCVP 1RE4C 2NPSB 4U3FE 1RF1B
chains in the Genus database with same CATH topology
3N7NA 5AW4B 1HH0A 1LTAC 3I5CA 3OJAB 5KJ7C 1FU1A 2Q5UA 1FJPA 1JUNA 2GM4A 3VYIA 3II6A 1DX7A 1HUCA 1SFCB 3HUSA 3VMZA 1LT9B 1LTJB 3NFQA 3P32A 2WSFH 2IFNA 3NMDA 1KFMA 2WITA 1LWUA 3P8CD 5APQA 1MV8A 1M1JB 2A45G 2P7JA 5AW7B 3MD0A 1NO4A 2WPQA 1LGHB 4W7YA 2N1TB 4JYBA 2GUSA 1AFOA 1J1EC 4JF7A 1SLQA 2FFDB 2W6AA 3PP5A 1L4AA 1JCCA 2HODB 1FZEA 2M8RA 5APWA 1FZAA 3HE4A 3HTKB 2KYVA 1HTLC 5KJ7D 1S9KE 1NKNA 4JYCA 3HUSC 3TNUA 4AUWA 2PP6A 2OARA 5AW8B 3HD7B 1GL2B 1LWUC 1A02F 1JY2P 2FKWB 2YO3A 1SQBK 1N7SA 3RK3B 1QL2A 1JY3N 4WBAA 4IFMA 4W80A 3M9HA 1DEBA 3LW5H 2OYIB 2WT7A 1L0NK 1G2CB 3V4WA 2YNYA 3SWYA 4WY4B 1L4AC 3TYYA 4XE5B 1FZCA 3IR9A 5AW5B 1J1DC 1SQVK 2P1JA 1SQPK 5AVSB 2HPCA 4LGDE 1ZV8A 2HLOA 1IFDA 1Z56A 4GKGA 2NPSA 1RF1A 2L5GB 3TSIA 1JOCA 3C9IA 1NOHA 2JJLA 1N7SC 1DH3A 1URQB 3L37A 3VMXA 2E43A 5APUA 2H43A 3M9QA 3LIDA 1MZ9A 1S9KD 2R5BA 3MIWA 4ZKPA 2FYUK 1SFCA 2GUVA 1FZCC 3BRVB 1LT9A 1CSBA 1ZLLA 1GU4A 4C7RA 2YKPA 3RK2D 3NTNA 1E5WA 1M1JA 1JNMA 3KYQA 2KOGA 1FOSE 2Z5HA 3CL3D 1GU5A 1T3JA 3IFMA 2NPSC 1RF1C 1MUUA 2N1TA 1A02J 3KDPB 2OYHB 2Q9IA 2N9BA 1LTTC 2P67A 2QM7A 2XU6A 3M06A 3U1AA 3V4QA 2FFDA 1NTKK 4IFDK 1VPCA 5CCHA 1SQQK 1FOSF 1G1JA 2HODA 4N6JA 3B5ND 3BASA 3EFGA 1N7SD 1JMMA 2H7HA 5AVWB 5AW1B 3CLQA 3V5BA 3M9BA 1SFCC 1OWAA 1LT9C 3H32B 1SP4A 2C9LY 2QM8A 1FZGA 2A45I 4HH2A 5APYA 1GL2A 1M1JC 1NKZB 3MTUE 4GIFA 4LC1A 5BU5A 1N73B 1XTGB 4KHXA 1ZR2A 2N1TC 1NWQA 2VRSA 1JY2O 3V2PA 5AVQB 2HYNA 2O01H 1G2CA 1LTIC 3P8MC 3SWFA 1KILD 1WT6A 2FFDC 2WSEH 1KQLA 5CCHC 1SQXK 2C9NY 1JTHB 1JO5A 2Q3IA 5AW9B 5AW0B 4EOTA 4I1LA 1IC2A 4M3LA 4C7NB 1N7LA 1LTBC 3A2AA 5AVTB 1HWTC 5CCGA 1IJDB 1GL2C 1X8YA 2R5DA 3VOPA 1URQA 3GHGA 2WPRA 1HGZA 1M7LA 3V2RA 2FYZA 3CI9A 3E1IA 5CMZA 5APSA 3L36A 3R2PA 3VP8A 3RL0C 2CPSA 3TK1A 1GZLA 1OXZA 1ZN5A 3M0AA 5BVZA 1FZFA 2N1TD 1T2KC 1QL1A 1NHLA 2HG5D 3U59A 2H8PD 4AQRD 2IFMA 5CCHD 3RK2B 5CJ4A 5CCGC 3BRTB 2OYHA 1GK4A 2Z5IA 4I6MC 1URQC 1N86A 3GHGC 2W6BA 1J1DB 2IPPA 3MGNA 1NTMK 5AW6B 3N4XA 4GT1A 1W2EA 3HE4B 3U1CA 1IFJA 3A7OA 2WPSA 3TNUB 1JY2N 3VMYA 5AVXB 5AW3B 1HBWA 3KPEA 1X79B 4W7ZA 1LTJA 3B5NB 1N7SB 5AVZB 3RL0D 1IFMA 2PAJA 4B86A 2ZFCA 1L4AD 1RF0A 5AVRB 2O1KA 1N73A 1H89A 1IFIA 2WT7B 1LTSC 1FZBA 2YKOA 1HGVA 5KLVK 1T2KD 1SVFA 2OYHC 5AVUB 4N78E 1FZCB 3MUDA 2YMYA 2Z4EA 4DZOA 4O9BA 3OAKA 3NXSA 1JTHA 3L35A 1MFZA 3HTKA 1GDTA 1KILB 4Y99B 1GW3A 2R3CA 2WZ7A 1GD2E 1YTZI 3WMM0 5BU8B 2WWWA 4DOJA 1LTJC 1IFNA 1VDFA 1J2JB 3HE5B 3UIAA 3HD7A 2P2UA 2M3BA 3G3ZA 2IX7C 1RF0C 2I1KA 2KP8A 1N73C 2WTYA 1GTWA 2HFED 4I2LC 2LKMA 3A5TA 4OH8B 2OYIA 1JY3P 1IO4A 1XTCC 2W27A 4ZKUA 5AVYB 1HJBA 4WY4A 1L0LK 3H6PA 2NPSD 1NH4A 4IFFA 2I1JA 3L4FA 3P7KA 1EQ7A 4RESB 4HYTB 2A45H 2KB7P 1GW4A 1HVVA 2POHA 5CJ0A 1CI6B 4XA4A 2XDJA 1J1EB 1WRGA 5APVA 3HD7C 4N78D 1AQ5A 2Q7CA 3RK3C 1SFCD 1RY3A 1NU1K 1FJKA 2FXMA 4AYCA 4N3YB 1NAFA 5APXA 2OYIC 1GK6A 3M0DA 3HUSB 1FDMA 1YTZT 1KFNA 3KQGA 2J59M 4WY4C 4LLHA 1LTGC 1LWUB 2YKQA 3B5NA 1G1IA 1T8ZA 3OA7A 2KLVA 1IK9A 2XKMA 3VTPC 3V2QA 1H8AA 1FAVA 3RL0B 3RK2C 2XNXA 1RE3A 3LIEA 3VP9A 1NTZK 1L4AB 2C0WA 5AVVB 2BASA 2MJZA 2E42A 1JCDA 2XV5A 5CHXA 1KZUB 5APTA 3A3YB 3BATA 1CW5A 3HD7D 1T3UA 1GL2D 3M0DC 3V2NA 1FBMA 1X9VA 1CZQA 3RK3D 1KILA 1RE4A 1YYCA 3EQ2A 3H32A 2JEEA 3B5NC 3P8CE 3HE5A 3GHGB 1PFIA 5KJ7A 4WY4D 3O8ZA 3B8EB 2WSCH 1H88A 2O1JA 3M91A 5KTBA 2C0XA 1N2DC 4WB4A 1RE3C 3BVHA 2J58A 3VN0A 2R32A 2YO2A 4C46A 5CCGD 1ZR4A 2HPCB 2ZXEB 4EIJA 1JY3O 2XZRA 2CPBA 1URQD 3HRNA 2KSJA 5AW2B 1KILC 4Y99C 1RE4C 2NPSB 3T97A 1RF1B 1CI6A 4C7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQ7 A;  1JCD A;  3H6P A;  1KFN A;  2GUS A;  2GUV A;  1N2D C;  1KFM A;  1JCC A;  1T8Z A;  2IX7 C; 
#chains in the Genus database with same CATH topology
 3H1K J;  2M3E A;  2QJP C;  1VF5 C;  1JUN A;  2GM4 A;  3VYI A;  2N9Y B;  1IFP A;  4K35 A;  4HKZ H;  3AED C;  3VMZ A;  1LTJ B;  3CXH I;  2WIT A;  2B9B A;  3MD0 A;  1LGH B;  1AVY A;  1PGO A;  1K05 A;  2E75 D;  4JF7 A;  2KIK A;  2KS1 B;  1NU1 G;  3HTK B;  2KYV A;  2V4H A;  3G9R A;  5KJ7 D;  1NU1 D;  3TNU A;  2BCC E;  2PP6 A;  3SFD C;  1SQX J;  5AW8 B;  1A02 F;  3RK3 B;  3FX0 A;  3EWK A;  1S1C X;  2Y0D A;  3LW5 H;  3L73 E;  4DT0 A;  1L0N K;  2OYO A;  2M5A A;  3TYY A;  3GF3 A;  1NTM G;  1SQV K;  2P1J A;  1NTZ D;  1SQP K;  5AVS B;  2K9J B;  4EI2 A;  2RKL A;  3JCU H;  2L5G B;  3TSI A;  2JJL A;  1N7S C;  1LJ2 A;  5APU A;  2D2C D;  2JP3 A;  4PV1 C;  5KLV G;  3MIW A;  1FZC C;  3BRV B;  1ZLL A;  4BXL A;  1M1J A;  4U7J A;  1M1K Q;  3KYQ A;  4TLF A;  4H13 C;  3C8V A;  3CL3 D;  3SSU A;  4I7Z C;  4GOE A;  2OYH B;  2JKV A;  2P67 A;  3WUU A;  1AV1 A;  1BSH A;  3GW6 A;  2QJY B;  2ZXX A;  3H1I G;  2FFD A;  1S5L H;  4IFD K;  2BCC J;  1VPC A;  2HOD A;  2E75 B;  3H1I D;  1RQV A;  3CX5 D;  1SFC C;  3Q5S A;  2C9L Y;  1QEX A;  1L0N E;  3FWN A;  1L0L G;  1W5C E;  2H88 C;  3L73 J;  1NKZ B;  3MTU E;  3H1J J;  1L0L D;  1SQV E;  3TGU E;  4R4L A;  1ZR2 A;  2N1T C;  1NWQ A;  1M57 D;  3L75 E;  1JY2 O;  4ASV A;  5E79 E;  1X0T A;  2HYN A;  1G2C A;  2O01 H;  4OWF A;  2W8Z A;  5TJH A;  1JTH B;  5DJT B;  5AW9 B;  4U3F G;  4I1L A;  1VQP P;  1VF5 D;  1ZME C;  1YIJ P;  1Q86 Q;  2PRR A;  1M56 D;  2QEX P;  1HGZ A;  1M7L A;  1SQB D;  3E1I A;  3R2P A;  2QJK B;  1BCC G;  2E5T A;  2D2C B;  1DD4 A;  1FZF A;  3Q5R A;  1T2K C;  2HG5 D;  3A0H E;  5CJ4 A;  3E7K A;  4DJG A;  2YIU B;  1URQ C;  3GHG C;  2W6B A;  2FYN B;  1Q2N A;  1BDC A;  4GT1 A;  3U1C A;  1IFJ A;  3RL0 g;  2WPS A;  3TNU B;  5AVX B;  3KPE A;  3TGU J;  2W90 A;  1EDK A;  3RL0 D;  3L75 J;  1N73 A;  1P84 D;  1ZOY C;  3FGA D;  3CXH E;  1FZB A;  5KKZ C;  2M5A B;  2AXT H;  4N78 E;  3CX5 I;  2WSC J;  5B66 E;  3OAK A;  3L35 A;  2V7Q H;  3D6Z A;  1GDT A;  1SQQ D;  2WZ7 A;  1HF9 A;  2WWW A;  1LTJ C;  1OW8 A;  2QJP B;  1NAY A;  2P2U A;  4RJT A;  1MKM A;  4ZMD A;  1VF5 B;  1YI2 P;  4L76 A;  3ABV C;  2LKM A;  3A5T A;  4OH8 B;  2OYI A;  1XTC C;  1K04 A;  3MUD C;  5AVY B;  4H13 D;  3MHV A;  4IFF A;  1ZXG A;  1EQ7 A;  3CC7 P;  3KZI E;  3AE4 C;  3RK3 E;  5CJ0 A;  5APV A;  1AQ5 A;  3RK3 C;  1SFC D;  1NU1 K;  4AYC A;  1EDJ A;  1BGY E;  1Y47 A;  3M0D A;  1KFN A;  2J59 M;  3L71 G;  1OFC X;  1SQV G;  3B71 A;  4NPF X;  3L71 D;  1SQP G;  1G1I A;  1T8Z A;  1IK9 A;  1SQP D;  1VQ8 P;  3RL0 B;  1RE3 A;  1NTZ K;  3GF7 A;  2BAS A;  2MJZ A;  1JCD A;  5KLI C;  3CWB G;  3A0B E;  1KZU B;  4UB6 H;  3BAT A;  3CMA P;  3CWB D;  3CCL P;  1X9V A;  1KIL A;  4YXW H;  2ZYA A;  1P84 I;  3H32 A;  2JEE A;  3B5N C;  3HE5 A;  4R4M A;  2B88 A;  3B8E B;  2WSC H;  2O1J A;  1N2D C;  3TDK A;  3BVH A;  2YO2 A;  2QJY C;  1NGM B;  4IL6 E;  2E75 C;  2YXQ B;  2XZR A;  1NU1 E;  5AW2 B;  1URQ D;  3HRN A;  3KHU A;  4H13 B;  4Y99 C;  4D6T G;  1CI6 A;  4C7N A;  2BEZ F;  3N7N A;  5AW4 B;  1GMJ A;  1HH0 A;  3I5C A;  3OJA B;  4D6T D;  5KJ7 C;  1BGY J;  2WPV B;  3AEB C;  2R3S A;  1DX7 A;  1SFC B;  2KLU A;  1NTK J;  2E74 C;  4WVZ A;  2IFN A;  1LWU A;  3P8C D;  1NTZ E;  1MV8 A;  2P7J A;  5AW7 B;  4BRY B;  2N1T B;  1PIX A;  4JYB A;  2GUS A;  3L72 J;  3CCU P;  3PP5 A;  1JCC A;  1FZE A;  1FZA A;  1IK7 A;  3Q3D A;  3CXH H;  5TIS E;  2QJK C;  2WSS H;  5KLV E;  2D2C C;  3H1L J;  2YO3 A;  1SQB K;  1KMI Z;  3S4R A;  1KV4 A;  1JY3 N;  2ZYD A;  4W80 A;  3BCC G;  3M9H A;  1DEB A;  2OYI B;  1VQ9 P;  3BCC D;  3SWY A;  1PGP A;  3LW5 J;  3H1I E;  1RH5 B;  2HPC A;  2R44 A;  4LGD E;  1ZV8 A;  2HLO A;  3CX5 E;  3PTZ A;  1AJY A;  1IFD A;  4PJ0 E;  1DH3 A;  1URQ B;  1L0L E;  2YXR B;  1PP9 J;  3KZI H;  3PHL A;  4BWN A;  3M9Q A;  1S9K D;  2R5B A;  4ZKP A;  1NTM J;  1LT9 A;  1GU4 A;  1IZN B;  4C7R A;  1E5W A;  2KOG A;  3L74 D;  1T3J A;  3IFM A;  5KKZ B;  1Q7Y Q;  2Q9I A;  1LTT C;  3M06 A;  3ZDM A;  3V4Q A;  1FDO A;  1S2E A;  1JMB A;  5CCH A;  1SQQ K;  1G1J A;  1SQB E;  5KLV J;  3B5N D;  3BAS A;  2H7H A;  5AVW B;  3CLQ A;  2P10 A;  3V5B A;  3M9B A;  2FXP A;  4GOD A;  3H32 B;  1BCC E;  3QH9 A;  1OVV A;  4HH2 A;  1GL2 A;  1M1J C;  2LR2 A;  3A0B H;  5GTH E;  2LXB A;  3AE5 C;  4IOI H;  5BU5 A;  3D6Y A;  3V2P A;  2H89 C;  4MN4 C;  1LTI C;  3P8M C;  3SWF A;  1WT6 A;  2RN0 A;  2FFD C;  3B4S A;  2WSE H;  1KQL A;  2Q3I A;  2O01 J;  4C7N B;  1L0L J;  1LTB C;  3A2A A;  1FC2 C;  5AVT B;  1YHQ P;  4IL6 H;  3VOP A;  3F89 A;  1YJN P;  1BE3 J;  2E74 D;  2LXC B;  4H0L D;  2Q3E A;  1P84 E;  5CMZ A;  3G6E P;  3L36 A;  4HJG H;  3VP8 A;  3RL0 C;  3Q5P A;  2FY8 A;  3AE9 C;  1OXZ A;  1NTZ G;  3TF5 A;  3CME P;  4U3F J;  4JPZ B;  1DEE G;  1PZQ A;  3FWL A;  5CCH D;  4OVN F;  2Z5I A;  4I6M C;  1QX8 A;  1Q90 D;  2JWA A;  1N86 A;  5KLI B;  4NPE A;  3IN6 A;  3N4X A;  1KOR A;  1W2E A;  3A7O A;  1BCC J;  3K5B A;  1JY2 N;  2KZI A;  3PRJ A;  2FYU G;  5AW3 B;  4W7Z A;  3B5N B;  2FYU D;  1EZV D;  2WQY C;  1QGK B;  3CPW O;  2O1K A;  2KNC A;  3H1H G;  1Q81 Q;  3H1H D;  4Y99 B;  1GW3 A;  2ZVN B;  1NJI Q;  1L2P A;  1VQ7 P;  2ZT9 D;  3CCS P;  1VDF A;  2V7Q J;  3L71 E;  2IX7 C;  3L70 G;  2KP8 A;  3CX5 H;  1N73 C;  1SQP E;  3SWK A;  2HFE D;  1OZH A;  1IO4 A;  1JY3 P;  3L70 D;  2E74 B;  1VQN P;  4WY4 A;  4H0L B;  3GMA A;  3H6P A;  2I1J A;  3L4F A;  5H2F E;  2JR8 A;  3CWB E;  4RES B;  2A45 H;  2KB7 P;  1OW7 A;  2WMM A;  1GW4 A;  1SQX D;  1HVV A;  2KUB A;  3CCJ P;  5C39 A;  3Q1M A;  2Y0C A;  3ITK A;  1R5L A;  2ZAE B;  1SQB G;  1RY3 A;  2FXM A;  1NAF A;  3W68 A;  5APX A;  2OYI C;  1FDM A;  1YTZ T;  1H0T A;  1FS0 E;  2JWD A;  1PPJ D;  1U7M A;  4Z1M H;  2QA4 P;  2KSE A;  3G71 P;  3AEG C;  3JC2 2;  3V2Q A;  3RK2 C;  2XNX A;  1KB9 D;  3LIE A;  4D6T E;  2C0W A;  5CHX A;  3SFE C;  3A3Y B;  1L0N J;  3M0D C;  1FBM A;  1EZV I;  3F5H A;  1TU3 F;  2KK7 A;  1SQV J;  1SQP J;  2FXO A;  3P8C E;  4WY4 D;  4ASW A;  1AVO A;  2C0X A;  5CBO A;  3D71 A;  1RE3 C;  2G8Y A;  3WU2 E;  3AE2 C;  4YPC A;  2QSI A;  1PGJ A;  1SQQ G;  1ZR4 A;  2ZXE B;  2KSJ A;  1KIL C;  3H1J G;  1K8A Q;  3T97 A;  1EDI A;  5K5G B;  5B5E E;  1KYO D;  3H1J D;  1FU1 A;  2Q5U A;  1FJP A;  3II6 A;  1YQ4 C;  3BCC E;  3HUS A;  2E5Y A;  2IZ1 A;  3IF4 A;  3P32 A;  3NMD A;  1S72 P;  1M1J B;  2B87 A;  3G4S P;  3E1R A;  4D6T J;  4W7Y A;  1RQU A;  1OMI A;  1S3J A;  1YIT P;  2KNC B;  2FFD B;  4L73 A;  1L4A A;  5KAF E;  2HOD B;  2M8R A;  5APW A;  3HE4 A;  2A06 G;  1U57 A;  1HTL C;  1S9K E;  4JYC A;  2JDI H;  1LNQ A;  3CCE P;  2A06 D;  4AUW A;  2AEF A;  2OAR A;  2KXP B;  1LWU C;  1JY2 P;  1KB9 I;  1QL2 A;  1Y8A A;  2SPZ A;  3L74 E;  1LP1 A;  1G2C B;  2YNY A;  3O6Q A;  4WY4 B;  5AW5 B;  4H44 D;  3AEF C;  5E79 H;  4RO0 A;  1Z56 A;  2NPS A;  2AEJ A;  1KN7 A;  1RF1 A;  1NOH A;  1PV3 A;  3CCR P;  2JO1 A;  5H2F H;  3VMX A;  1YJ9 P;  2E43 A;  3I56 P;  2W6J H;  2O01 N;  1M90 Q;  3LID A;  1H0T B;  2RH0 A;  2FYU K;  3RGU A;  1MFT A;  1CSB A;  4DCK A;  1EXJ A;  1KYO I;  2YKP A;  3RK2 D;  1JNM A;  1FOS E;  2Z5H A;  4PD4 D;  1GU5 A;  2N9B A;  2QM7 A;  4UB8 E;  3U1A A;  2QRX A;  1ZW0 A;  3EFG A;  3A0H H;  2QE7 H;  1LT9 C;  1SP4 A;  4H0L C;  5APY A;  2NRG A;  1S5L X;  1QVF O;  4LC1 A;  1N73 B;  4WWI A;  1USD A;  4ZNC A;  3MZW B;  1KIL D;  2BEQ D;  5CCH C;  1SQX K;  2C9N Y;  1OW6 A;  5AW0 B;  4EOT A;  2K9J A;  4YTP C;  2WSE J;  3T97 B;  1NVO A;  4M3L A;  1N7L A;  3WU2 H;  4A7P A;  5B66 H;  5CCG A;  1IJD B;  2FYU E;  1GL2 C;  1EZV E;  1X8Y A;  2WPR A;  3V2R A;  2FYZ A;  4OGQ C;  5APS A;  3AE8 C;  2B89 A;  2CPS A;  3TK1 A;  1GZL A;  1NU1 J;  1ZN5 A;  3M0A A;  1USE A;  2QG4 A;  1QL1 A;  3H1H E;  3U59 A;  5GTI E;  4AQR D;  2IFM A;  2IBZ D;  3RK2 B;  1NYH A;  1QLE D;  3BRT B;  2OYH A;  1GK4 A;  1BSN A;  1J1D B;  3PLN A;  3HE4 B;  2FBW C;  1VQ6 P;  2ZT9 C;  3L70 E;  1NTZ J;  3VMY A;  3AE3 C;  4PD4 I;  5KAF H;  1KQG B;  3W67 A;  3L74 G;  1SQX E;  1RF0 A;  5AVR B;  1LP1 B;  2Y9Y A;  1IFI A;  1LTS C;  2YKO A;  1HGV A;  3MP7 B;  4NPD A;  1VQ4 P;  2K1A A;  2YMY A;  4DZO A;  1NTK G;  1DIP A;  3NXS A;  1JTH A;  1NTK D;  1KIL B;  2R3C A;  1GD2 E;  5BU8 B;  1PPJ E;  3HE5 B;  2K9Y A;  2OTJ P;  3HD7 A;  3L72 G;  2M3B A;  3L72 D;  2I1K A;  2WTY A;  1GTW A;  1T6A A;  3QWO C;  3S1K A;  1KB9 E;  3H1I J;  2W27 A;  3H1H J;  4ZKU A;  1HJB A;  4EDF A;  1NH4 A;  1OVR A;  1AA0 A;  3H1L G;  5EFW B;  2L91 A;  1CI6 B;  4XA4 A;  3H1L D;  2WSF J;  1WRG A;  3C1L A;  3L70 J;  1FJK A;  4N3Y B;  4JQ0 D;  4TT3 H;  3KQG A;  4WY4 C;  4UB8 H;  2AXT E;  4LLH A;  1LWU B;  2HR3 A;  2YKQ A;  2IBZ I;  3JSV C;  2K37 A;  2KLV A;  1VQM P;  1SQQ E;  1H8A A;  1PP9 G;  1KYO E;  3PH0 A;  1SQB J;  3H1J E;  1PP9 D;  4QMA A;  4L74 A;  1VL2 A;  2O3J A;  2PFX A;  1QVG O;  2UWJ E;  1ZRT D;  1CW5 A;  3HD7 D;  1T3U A;  1GL2 D;  1NTM D;  1CZQ A;  1RE4 A;  1EZV G;  4OGQ D;  3H1K G;  5TIS H;  3O8Z A;  3H1K D;  1H88 A;  3GG2 A;  3M91 A;  4WB4 A;  2J58 A;  2QVA A;  3V6I A;  1AQT A;  4Y28 J;  5KLV D;  2AXC A;  3CCM P;  4C46 A;  2HPC B;  4EIJ A;  1Q82 Q;  2A06 E;  1PGQ A;  3AE7 C;  4GOF A;  1HJ0 A;  1LTA C;  2E76 D;  3USS A;  3KXD A;  1EDL A;  5KAI E;  5GTI H;  2W83 C;  1HUC A;  1LT9 B;  4PJ0 H;  3NFQ A;  1SQQ J;  4GDO A;  2WSF H;  1KFM A;  5APQ A;  1SQX G;  1BDD A;  1RHZ B;  2ZJS E;  2A45 G;  1EXI A;  2M0B A;  1NO4 A;  2WPQ A;  4UB6 E;  1BE3 G;  1OVU A;  1AFO A;  2ITA A;  1J1E C;  4JBZ A;  4H44 C;  1BE3 D;  1SLQ A;  2W6A A;  1LT1 A;  3Q2Y A;  1PPJ G;  1NKN A;  3HUS C;  2QIW A;  4U3F D;  3CC2 P;  1M8O B;  3HD7 B;  1GL2 B;  2FKW B;  1N7S A;  5L8R J;  1UIX A;  4WBA A;  4IFM A;  4OGQ B;  4PD4 E;  2K3R A;  3D70 A;  4HB1 A;  2WT7 A;  3V4W A;  3FXD A;  1ZP0 C;  1L4A C;  4CPG A;  4XE5 B;  1FZC A;  3IR9 A;  1J1D C;  1BCC D;  5GTH H;  3CC4 P;  1KTM A;  5CBN A;  1VQ5 P;  2KZJ A;  1KB9 H;  3L71 J;  1K9M Q;  4GKG A;  1WMK A;  2XND H;  1JOC A;  3C9I A;  3L37 A;  1UII A;  4KJM A;  2H43 A;  3AEC C;  2ZT9 B;  2BCC G;  3FXE A;  1MZ9 A;  2Y0E A;  2E76 B;  3VMA A;  1KIL E;  1SFC A;  2BCC D;  2GUV A;  2MKV A;  3CWB J;  2IYO A;  3NTN A;  1P84 H;  3RBX A;  4BRY A;  3L73 G;  2NPS C;  1RF1 C;  1MUU A;  2N1T A;  1A02 J;  3KDP B;  3L73 D;  3GLM A;  2XU6 A;  1NTK K;  1FOS F;  4N6J A;  1N7S D;  1FDI A;  1JMM A;  1KYO H;  5AW1 B;  1VQK P;  1OWA A;  2Q1K A;  2QM8 A;  1FZG A;  2A45 I;  1YQ3 C;  4PV1 D;  1YBK A;  3WUV A;  2GA1 A;  4GIF A;  1XTG B;  4KHX A;  2IBZ E;  2VRS A;  1YJW P;  5AVQ B;  5M1B A;  3AE6 C;  1JO5 A;  2AEM A;  2KI7 B;  1IC2 A;  3PJS K;  1HWT C;  2R5D A;  2PGD A;  1URQ A;  3GHG A;  4YXD C;  2YMK A;  2CK3 H;  3CI9 A;  2Q6Q A;  1L0N G;  5BVZ A;  1L0N D;  2N1T D;  4IL6 X;  3TGU G;  1NHL A;  5KAI H;  1NTK E;  2RMZ A;  3L75 G;  2H8P D;  1SQV D;  3TGU D;  1EC5 A;  4XFJ A;  3L75 D;  5CCG C;  1S4X A;  3BCC J;  2IPP A;  3MGN A;  1NTM K;  5AW6 B;  3L72 E;  1X22 A;  2IYP A;  2K88 A;  2P58 A;  1PL5 A;  1HBW A;  1X79 B;  1LTJ A;  1N7S B;  5AVZ B;  4KT0 J;  1IFM A;  2PAJ A;  4B86 A;  2ZFC A;  3AE1 C;  1L4A D;  1SS1 A;  1H89 A;  3H1L E;  2WT7 B;  4PV1 B;  5KLV K;  1T2K D;  1SVF A;  2OYH C;  5AVU B;  2OTK E;  1FZC B;  3MUD A;  2Z4E A;  3AEA C;  3CD6 P;  2NZ2 A;  1W2B O;  4O9B A;  2KS1 A;  4PD4 H;  3I55 P;  1MFZ A;  3HTK A;  1FE6 A;  1JEK A;  1YTZ I;  3WMM 0;  4I7Z B;  4DOJ A;  3L74 J;  1IFN A;  1J2J B;  3RBZ A;  3UIA A;  2J5U A;  3G3Z A;  3H25 A;  4EYY Q;  1RF0 C;  1U7J A;  4I2L C;  3JCU E;  1PP9 E;  3EFF K;  1L0L K;  1K73 Q;  2NPS D;  3OW2 O;  3P7K A;  1ZRT E;  4HYT B;  1NTM E;  2WVR A;  2POH A;  1VQL P;  2XDJ A;  1J1E B;  3CXH D;  4H44 B;  1E79 H;  3HD7 C;  2DW3 A;  4N78 D;  2Q7C A;  2OGU A;  4K3A A;  3H1K E;  1R5S A;  1KD1 Q;  1GK6 A;  2ZVO B;  3HUS B;  5B5E H;  2ZYG A;  1OX3 A;  1LTG C;  2B87 B;  3B5N A;  3WUT A;  5DJU B;  1DD3 A;  1S5L E;  3OA7 A;  2IBZ G;  2XKM A;  3VTP C;  1VQO P;  1FAV A;  2IZ0 A;  1KQF B;  2G3A A;  2Y9Z A;  1Y9B A;  2OQQ A;  3AEE C;  3VP9 A;  1L4A B;  5AVV B;  2YIU C;  2E42 A;  2XV5 A;  2FYN C;  5APT A;  1OIP A;  3V2N A;  3RK3 D;  1JB0 J;  2E76 C;  1JM0 A;  2IDB A;  1YYC A;  3EQ2 A;  3IAO A;  3GHG B;  1PFI A;  4RKU J;  5KJ7 A;  2OTL P;  1BGY G;  5KTB A;  1D7M A;  3S9O A;  1BGY D;  1BE3 E;  3O6Q B;  3VN0 A;  2R32 A;  3CCQ P;  1R8E A;  1KQS O;  2I8D A;  5CCG D;  4L75 A;  1JY3 O;  1KC8 Q;  2CPB A;  2FYU J;  3R4Y A;  1N8R Q;  3CCV P;  1RE4 C;  2NPS B;  4U3F E;  1RF1 B; 
#chains in the Genus database with same CATH homology
 3N7N A;  5AW4 B;  1HH0 A;  1LTA C;  3I5C A;  3OJA B;  5KJ7 C;  1FU1 A;  2Q5U A;  1FJP A;  1JUN A;  2GM4 A;  3VYI A;  3II6 A;  1DX7 A;  1HUC A;  1SFC B;  3HUS A;  3VMZ A;  1LT9 B;  1LTJ B;  3NFQ A;  3P32 A;  2WSF H;  2IFN A;  3NMD A;  1KFM A;  2WIT A;  1LWU A;  3P8C D;  5APQ A;  1MV8 A;  1M1J B;  2A45 G;  2P7J A;  5AW7 B;  3MD0 A;  1NO4 A;  2WPQ A;  1LGH B;  4W7Y A;  2N1T B;  4JYB A;  2GUS A;  1AFO A;  1J1E C;  4JF7 A;  1SLQ A;  2FFD B;  2W6A A;  3PP5 A;  1L4A A;  1JCC A;  2HOD B;  1FZE A;  2M8R A;  5APW A;  1FZA A;  3HE4 A;  3HTK B;  2KYV A;  1HTL C;  5KJ7 D;  1S9K E;  1NKN A;  4JYC A;  3HUS C;  3TNU A;  4AUW A;  2PP6 A;  2OAR A;  5AW8 B;  3HD7 B;  1GL2 B;  1LWU C;  1A02 F;  1JY2 P;  2FKW B;  2YO3 A;  1SQB K;  1N7S A;  3RK3 B;  1QL2 A;  1JY3 N;  4WBA A;  4IFM A;  4W80 A;  3M9H A;  1DEB A;  3LW5 H;  2OYI B;  2WT7 A;  1L0N K;  1G2C B;  3V4W A;  2YNY A;  3SWY A;  4WY4 B;  1L4A C;  3TYY A;  4XE5 B;  1FZC A;  3IR9 A;  5AW5 B;  1J1D C;  1SQV K;  2P1J A;  1SQP K;  5AVS B;  2HPC A;  4LGD E;  1ZV8 A;  2HLO A;  1IFD A;  1Z56 A;  4GKG A;  2NPS A;  1RF1 A;  2L5G B;  3TSI A;  1JOC A;  3C9I A;  1NOH A;  2JJL A;  1N7S C;  1DH3 A;  1URQ B;  3L37 A;  3VMX A;  2E43 A;  5APU A;  2H43 A;  3M9Q A;  3LID A;  1MZ9 A;  1S9K D;  2R5B A;  3MIW A;  4ZKP A;  2FYU K;  1SFC A;  2GUV A;  1FZC C;  3BRV B;  1LT9 A;  1CSB A;  1ZLL A;  1GU4 A;  4C7R A;  2YKP A;  3RK2 D;  3NTN A;  1E5W A;  1M1J A;  1JNM A;  3KYQ A;  2KOG A;  1FOS E;  2Z5H A;  3CL3 D;  1GU5 A;  1T3J A;  3IFM A;  2NPS C;  1RF1 C;  1MUU A;  2N1T A;  1A02 J;  3KDP B;  2OYH B;  2Q9I A;  2N9B A;  1LTT C;  2P67 A;  2QM7 A;  2XU6 A;  3M06 A;  3U1A A;  3V4Q A;  2FFD A;  1NTK K;  4IFD K;  1VPC A;  5CCH A;  1SQQ K;  1FOS F;  1G1J A;  2HOD A;  4N6J A;  3B5N D;  3BAS A;  3EFG A;  1N7S D;  1JMM A;  2H7H A;  5AVW B;  5AW1 B;  3CLQ A;  3V5B A;  3M9B A;  1SFC C;  1OWA A;  1LT9 C;  3H32 B;  1SP4 A;  2C9L Y;  2QM8 A;  1FZG A;  2A45 I;  4HH2 A;  5APY A;  1GL2 A;  1M1J C;  1NKZ B;  3MTU E;  4GIF A;  4LC1 A;  5BU5 A;  1N73 B;  1XTG B;  4KHX A;  1ZR2 A;  2N1T C;  1NWQ A;  2VRS A;  1JY2 O;  3V2P A;  5AVQ B;  2HYN A;  2O01 H;  1G2C A;  1LTI C;  3P8M C;  3SWF A;  1KIL D;  1WT6 A;  2FFD C;  2WSE H;  1KQL A;  5CCH C;  1SQX K;  2C9N Y;  1JTH B;  1JO5 A;  2Q3I A;  5AW9 B;  5AW0 B;  4EOT A;  4I1L A;  1IC2 A;  4M3L A;  4C7N B;  1N7L A;  1LTB C;  3A2A A;  5AVT B;  1HWT C;  5CCG A;  1IJD B;  1GL2 C;  1X8Y A;  2R5D A;  3VOP A;  1URQ A;  3GHG A;  2WPR A;  1HGZ A;  1M7L A;  3V2R A;  2FYZ A;  3CI9 A;  3E1I A;  5CMZ A;  5APS A;  3L36 A;  3R2P A;  3VP8 A;  3RL0 C;  2CPS A;  3TK1 A;  1GZL A;  1OXZ A;  1ZN5 A;  3M0A A;  5BVZ A;  1FZF A;  2N1T D;  1T2K C;  1QL1 A;  1NHL A;  2HG5 D;  3U59 A;  2H8P D;  4AQR D;  2IFM A;  5CCH D;  3RK2 B;  5CJ4 A;  5CCG C;  3BRT B;  2OYH A;  1GK4 A;  2Z5I A;  4I6M C;  1URQ C;  1N86 A;  3GHG C;  2W6B A;  1J1D B;  2IPP A;  3MGN A;  1NTM K;  5AW6 B;  3N4X A;  4GT1 A;  1W2E A;  3HE4 B;  3U1C A;  1IFJ A;  3A7O A;  2WPS A;  3TNU B;  1JY2 N;  3VMY A;  5AVX B;  5AW3 B;  1HBW A;  3KPE A;  1X79 B;  4W7Z A;  1LTJ A;  3B5N B;  1N7S B;  5AVZ B;  3RL0 D;  1IFM A;  2PAJ A;  4B86 A;  2ZFC A;  1L4A D;  1RF0 A;  5AVR B;  2O1K A;  1N73 A;  1H89 A;  1IFI A;  2WT7 B;  1LTS C;  1FZB A;  2YKO A;  1HGV A;  5KLV K;  1T2K D;  1SVF A;  2OYH C;  5AVU B;  4N78 E;  1FZC B;  3MUD A;  2YMY A;  2Z4E A;  4DZO A;  4O9B A;  3OAK A;  3NXS A;  1JTH A;  3L35 A;  1MFZ A;  3HTK A;  1GDT A;  1KIL B;  4Y99 B;  1GW3 A;  2R3C A;  2WZ7 A;  1GD2 E;  1YTZ I;  3WMM 0;  5BU8 B;  2WWW A;  4DOJ A;  1LTJ C;  1IFN A;  1VDF A;  1J2J B;  3HE5 B;  3UIA A;  3HD7 A;  2P2U A;  2M3B A;  3G3Z A;  2IX7 C;  1RF0 C;  2I1K A;  2KP8 A;  1N73 C;  2WTY A;  1GTW A;  2HFE D;  4I2L C;  2LKM A;  3A5T A;  4OH8 B;  2OYI A;  1JY3 P;  1IO4 A;  1XTC C;  2W27 A;  4ZKU A;  5AVY B;  1HJB A;  4WY4 A;  1L0L K;  3H6P A;  2NPS D;  1NH4 A;  4IFF A;  2I1J A;  3L4F A;  3P7K A;  1EQ7 A;  4RES B;  4HYT B;  2A45 H;  2KB7 P;  1GW4 A;  1HVV A;  2POH A;  5CJ0 A;  1CI6 B;  4XA4 A;  2XDJ A;  1J1E B;  1WRG A;  5APV A;  3HD7 C;  4N78 D;  1AQ5 A;  2Q7C A;  3RK3 C;  1SFC D;  1RY3 A;  1NU1 K;  1FJK A;  2FXM A;  4AYC A;  4N3Y B;  1NAF A;  5APX A;  2OYI C;  1GK6 A;  3M0D A;  3HUS B;  1FDM A;  1YTZ T;  1KFN A;  3KQG A;  2J59 M;  4WY4 C;  4LLH A;  1LTG C;  1LWU B;  2YKQ A;  3B5N A;  1G1I A;  1T8Z A;  3OA7 A;  2KLV A;  1IK9 A;  2XKM A;  3VTP C;  3V2Q A;  1H8A A;  1FAV A;  3RL0 B;  3RK2 C;  2XNX A;  1RE3 A;  3LIE A;  3VP9 A;  1NTZ K;  1L4A B;  2C0W A;  5AVV B;  2BAS A;  2MJZ A;  2E42 A;  1JCD A;  2XV5 A;  5CHX A;  1KZU B;  5APT A;  3A3Y B;  3BAT A;  1CW5 A;  3HD7 D;  1T3U A;  1GL2 D;  3M0D C;  3V2N A;  1FBM A;  1X9V A;  1CZQ A;  3RK3 D;  1KIL A;  1RE4 A;  1YYC A;  3EQ2 A;  3H32 A;  2JEE A;  3B5N C;  3P8C E;  3HE5 A;  3GHG B;  1PFI A;  5KJ7 A;  4WY4 D;  3O8Z A;  3B8E B;  2WSC H;  1H88 A;  2O1J A;  3M91 A;  5KTB A;  2C0X A;  1N2D C;  4WB4 A;  1RE3 C;  3BVH A;  2J58 A;  3VN0 A;  2R32 A;  2YO2 A;  4C46 A;  5CCG D;  1ZR4 A;  2HPC B;  2ZXE B;  4EIJ A;  1JY3 O;  2XZR A;  2CPB A;  1URQ D;  3HRN A;  2KSJ A;  5AW2 B;  1KIL C;  4Y99 C;  1RE4 C;  2NPS B;  3T97 A;  1RF1 B;  1CI6 A;  4C7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...