1GW4A

The helix-hinge-helix structural motif in human apolipoprotein a-i determined by nmr spectroscopy, 1 structure
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
46
Chain Sequence
SPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOA-I
publication title The helix-hinge-helix structural motif in human apolipoprotein A-I determined by NMR spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags High density lipoproteins
total genus 6
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1997-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.20 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gw4A00
3R2PA 1GW4A 1GW3A
chains in the Genus database with same CATH superfamily
1ZOYC 1RF1A 1J1DC 3C8VA 2M8RA 1NTZD 2O1KA 1HGZA 1CZQA 3RK3E 5KLVJ 2AEFA 1QEXA 1GL2A 1M90Q 3ITKA 1KB9E 4UB8E 5TJHA 2P7JA 4EYYQ 3HD7B 2ZFCA 2LXBA 2AXCA 1SQBK 1X22A 4MN4C 2HG5D 2A06G 1SQXJ 1CI6B 3HUSA 3P32A 1K8AQ 3AEEC 2YO2A 4KHXA 2Q3EA 1NO4A 1P84E 4KJMA 3CCLP 1NTKK 2BEZF 3HE5B 3W67A 3KQGA 1KILA 1KMIZ 3H1JG 2V7QJ 4ASWA 4B86A 3RBXA 1N73A 2KZIA 3U1AA 3CCMP 3TNUA 5DJTB 2BEQD 3H1JD 3HTKA 3O6QA 1RF0C 1S4XA 5AW5B 1KILC 2WPRA 5B5EE 1SQPD 1D7MA 3MZWB 1J2JB 1RE3C 4H13B 3MTUE 1N73C 1YJ9P 1YQ3C 2K88A 1KFMA 3WUVA 2CK3H 1LTAC 2E43A 4WB4A 5K5GB 1JCCA 1KYOH 2WZ7A 1JMMA 5KLIC 3SWYA 1UIIA 4I7ZC 1JM0A 1K73Q 1FZAA 2UWJE 3H1JJ 3L35A 3W68A 1SP4A 3H1KD 1SQPJ 3CC7P 4JQ0D 2E74D 5GTIH 3B71A 2C9NY 4OWFA 2JWDA 1HWTC 2RKLA 5CJ0A 4C7RA 5DJUB 1LNQA 5GTHH 1GU5A 3FXDA 2E76D 4K35A 1X9VA 3CXHI 3SFEC 3NMDA 4K3AA 1WRGA 5APXA 2N1TB 3VP9A 1FZCB 2ZJSE 3T97B 1DEBA 5AW2B 3H1HE 3E7KA 1TU3F 4L75A 4EOTA 2Q7CA 4XA4A 4GODA 1NOHA 2N9BA 4WWIA 2IYPA 1L0ND 1NU1D 1NTME 4N3YB 2FKWB 1VDFA 2L5GB 2JEEA 1SFCD 1IFPA 3HD7A 1J1EB 3SWKA 3M91A 4GOEA 2WWWA 4C46A 3KYQA 4W7ZA 2Q1KA 1CI6A 4LLHA 5GTIE 1EZVI 1BDDA 1KD1Q 3N7NA 2YO3A 3HE5A 3L71D 2M3BA 5GTHE 1FC2C 3L70G 1AV1A 1L0NJ 3HD7C 3P8CE 2WPQA 4GKGA 5AW4B 1W2BO 1R5LA 3G3ZA 1DD3A 4RJTA 1SQQD 1URQD 1AJYA 3A5TA 2W6AA 1PP9G 2FYUK 2H43A 4PV1D 1VPCA 3TK1A 1BGYD 4IL6H 3AE4C 2AEJA 2HLOA 1LT9B 3L73G 3VYIA 2XU6A 2NZ2A 1S1CX 3L71J 1KTMA 1RE4C 2WSSH 1Q86Q 1UIXA 3G4SP 1L0LG 1PIXA 3M06A 2VRSA 1PP9D 1PPJE 2WPVB 3BATA 4IFDK 3JCUH 3EQ2A 3CX5E 2KYVA 1G2CA 4I1LA 3WUTA 1W2EA 1SQQJ 3CWBG 4H13C 1E5WA 2FXMA 2WSCJ 5BVZA 3CCUP 3L70J 3AE1C 2P2UA 2YKQA 2OYIB 1G1IA 1NHLA 3M0AA 1LT1A 2IYOA 1NTZK 1YYCA 1BGYJ 2FYNB 1FZBA 3D6YA 2KZJA 5BU8B 2FFDB 1G1JA 1KB9D 1VL2A 3M9QA 3B4SA 2K1AA 2H7HA 3R4YA 1PP9J 1OMIA 3EWKA 1MV8A 1JCDA 5CCHD 1IFDA 1FZCA 2E74B 1S3JA 3T97A 2CPBA 2I8DA 1P84D 2HODB 3L73J 3P7KA 4IL6E 2O3JA 2L91A 5APUA 5CCGD 3AE6C 3L37A 1OXZA 2E76B 4RO0A 2B89A 3CC4P 3AE5C 3L74D 1AFOA 2N1TC 3Q5PA 3JCUE 4DOJA 1OX3A 5AW3B 3IF4A 1KV4A 2IBZI 1SQPK 1DIPA 1Y9BA 1SQVK 3Q2YA 2W90A 2OYOA 1R5SA 4RKUJ 2KK7A 2ZYGA 1OW7A 1SFCB 4BWNA 4OH8B 3VOPA 3P8MC 1NYHA 1K04A 4OGQC 5AVWB 3WU2H 5EFWB 2GUSA 2QJYC 2I1KA 1VQKP 1BE3E 5CBNA 1KQSO 3H32A 2KLVA 4H44D 5APWA 2Z5HA 4TLFA 2QJPB 5AVZB 1YTZT 5KLIB 5AVSB 3H1HG 3UIAA 3AE2C 1BSHA 1A02F 3CCQP 1KILE 1URQB 2WSFH 1NTMG 5APSA 1QL2A 5AVQB 1OWAA 3H1HD 1IK7A 3V2QA 1KQGB 1LT9C 4PJ0H 2A45H 2OYIA 1L0NK 1NU1K 3L75E 2MKVA 1NTMD 2YKOA 2IX7C 3H1IE 2FFDA 1KYOD 2C0WA 3GW6A 2G8YA 1RQUA 3VN0A 2QJKB 2B88A 2IDBA 1H89A 1DX7A 5KAFH 1GK6A 1NVOA 2OYIC 1SQXD 3H1HJ 1H8AA 2HODA 1FJKA 3L73E 1NTKE 1EZVG 4N6JA 3SWFA 5B5EH 1GTWA 1L0LE 2OQQA 1VQNP 1JTHB 3L72E 2FYZA 3P8CD 4DZOA 1NTMJ 4IL6X 1IFMA 1PGQA 3WMM0 2QA4P 4HB1A 3VMXA 3TYYA 1ZW0A 4JBZA 2E74C 1VQ5P 1JNMA 1GMJA 1SQQK 3MUDC 4H0LC 4YTPC 2QM8A 3CWBE 2J59M 2P10A 1PPJG 2YIUB 2FXOA 5CBOA 4JYCA 1S72P 2E76C 4PJ0E 2Q3IA 1MZ9A 3QH9A 1IC2A 1SFCA 4EIJA 1RQVA 1RF0A 4DT0A 2OARA 1PPJD 2JP3A 1Y8AA 3V4QA 1RE3A 3R2PA 2IZ1A 1VF5D 1KQLA 1JY3N 2A06D 4TT3H 5KAFE 1U7JA 1AQ5A 1KORA 1NH4A 2RN0A 3IN6A 3GLMA 3RL0D 2Y0DA 1SFCC 3RK2C 1N7SD 2POHA 3BCCG 3E1RA 3BVHA 5AW9B 2Q6QA 1T6AA 1GW4A 1GW3A 2W6JH 2M5AB 3PHLA 1PZQA 3S9OA 3VMZA 1VQMP 1FU1A 2E75D 1PGJA 4R4LA 1AVOA 5CMZA 1FZGA 3G9RA 1LTJC 3CXHH 2N9YB 1L4AD 3CMAP 4NPFX 2QJPC 1FE6A 2GA1A 1PV3A 1H0TB 1HGVA 4PD4I 1KFNA 1T3UA 1URQC 5APVA 1YTZI 1MFTA 4ZKPA 2OTJP 1L2PA 2XNDH 4PV1C 3GG2A 4H0LD 1GD2E 3NXSA 1KZUB 4GIFA 1T2KD 2HFED 2GM4A 2W8ZA 2BCCG 2KOGA 1BE3G 1ZRTE 3H1LG 3FX0A 2WT7B 3A7OA 1RY3A 3B5ND 1JTHA 4JF7A 5CHXA 1JO5A 4WY4D 1KYOI 2QJKC 2WSEH 2PRRA 4XFJA 4IOIH 1FS0E 3CXHE 3RK2D 2ZXXA 2C9LY 5BU5A 4C7NB 2KUBA 3KXDA 4DCKA 1KN7A 1YI2P 4OGQB 2WVRA 3AE9C 3CX5H 3PP5A 2KXPB 2QJYB 1LP1B 4AQRD 1JY2N 5CCHC 1EXIA 1VQ9P 5APYA 3EFGA 1LTTC 3TF5A 2P1JA 3AEFC 1FDOA 3GHGC 4ZNCA 5CCGC 3L75G 2YIUC 2K3RA 3IR9A 1M1KQ 2Q9IA 1NKZB 2ZYAA 2Z5IA 3H1IG 1BE3J 1RE4A 4Z1MH 4R4MA 5AW8B 2PP6A 4LGDE 1EZVE 5H2FH 3CPWO 3RBZA 1FOSF 3L70D 3L75D 2JDIH 1NTMK 2HPCB 1JMBA 3CLQA 2M5AA 3V2RA 1NTZE 5KLVK 2OTKE 2ZAEB 2PAJA 1PL5A 1NTKG 2D2CD 2WITA 5AW0B 1W5CE 1N7SB 2KB7P 3L72G 3CCEP 1SQXK 3N4XA 2ZYDA 1H0TA 3CCRP 3L73D 1ZR4A 4U3FE 1HVVA 2QEXP 2ZXEB 1Q82Q 4M3LA 1L0LD 3L75J 3L72D 4L73A 4H44C 5AVVB 3OAKA 2IFNA 2A45G 1VQ8P 3H1IJ 1SS1A 3RK3D 3Q1MA 3LW5H 2ZT9D 3CWBD 3CC2P 1RHZB 3TDKA 2KIKA 2OYHB 5H2FE 1YJWP 2FY8A 1N2DC 2YMKA 3BCCE 2N1TA 4OVNF 1SQVE 3AEDC 4H0LB 1NTKJ 1LWUB 2YXQB 2WT7A 2WPSA 1L0LJ 3L72J 3I5CA 2GUVA 1LGHB 2WSFJ 1WMKA 3V2PA 2J5UA 2W27A 3ABVC 1IFNA 1EQ7A 3CWBJ 4C7NA 2IZ0A 3H1KE 3IAOA 3SFDC 1LP1A 2NPSC 2SPZA 1RF1B 1HJBA 3BRTB 1ZN5A 1KQFB 3VMAA 3RK2B 1OW6A 2QE7H 3JC22 2OGUA 1S9KE 3H6PA 3D71A 1NGMB 1EDLA 2KP8A 2IBZE 1M1JC 2BCCE 3JSVC 1AQTA 1AA0A 4NPDA 3H1LE 3M9HA 3OA7A 1FBMA 3L36A 1DEEG 2ZVNB 4HJGH 1Z56A 1LTJB 1IK9A 1BCCE 1NAFA 2HPCA 5AVYB 4Y28J 1EDKA 1NU1E 3MGNA 3F89A 2ZVOB 3TGUG 3WUUA 3KZIH 1LT9A 1ZLLA 3FXEA 2MJZA 3IFMA 2C0XA 1N7SA 1M56D 4EDFA 2K9YA 1VQ4P 1NWQA 4LC1A 4PV1B 1IJDB 3Q5SA 3CCVP 4AUWA 5AVRB 1VF5C 1ZRTD 2O01H 3HRNA 1GDTA 2K9JB 3HE4B 2JKVA 2D2CB 3C1LA 3RL0C 2FYUG 3Q3DA 1DH3A 2JO1A 1N7SC 1PFIA 3CXHD 2KLUA 2R5DA 1VQOP 2IPPA 1XTCC 5M1BA 2OYHA 2NPSD 2E75C 1SQBE 3GF3A 3TGUJ 5C39A 3MUDA 4JYBA 1S5LH 1L4AC 1Q90D 1YIJP 2R5BA 3RK3B 2KSJA 1LWUA 1ZP0C 1XTGB 2AXTH 2ZT9B 3KZIE 1JY3O 2PGDA 3AECC 1LTBC 3VTPC 2BASA 4GDOA 1KB9I 2OYHC 1NTZG 1JUNA 2YNYA 1Q81Q 3CL3D 5L8RJ 4N78E 1EZVD 4DJGA 3GHGB 1LWUC 1U7MA 3A3YB 4EI2A 1P84I 1VQ6P 1T2KC 1LJ2A 4WBAA 3M0DA 1FDIA 3U59A 4U3FG 1NJIQ 3A0HH 3A0BE 5KJ7D 1QL1A 3U1CA 3B5NC 4WY4C 2V4HA 3CX5D 4ZKUA 2RH0A 1RF1C 2LXCB 2YMYA 1S5LE 3M0DC 1GL2C 3VMYA 4U3FD 1M57D 1LTJA 1L0LK 1S2EA 2AXTE 2Q5UA 3CI9A 3MP7B 2R3SA 1SQPG 4PD4H 2Y0EA 3NFQA 5AW6B 1SQVG 1R8EA 2K37A 2P67A 1NTZJ 2WSEJ 3L74E 2E42A 4NPEA 1USDA 3OW2O 1EDIA 3HUSC 1BSNA 1GK4A 1IZNB 1URQA 3QWOC 4H44B 1U57A 3BCCD 3CCJP 2PFXA 1SQVD 1YBKA 2K9JA 3HE4A 1OVRA 4YPCA 4U3FJ 3BASA 3MHVA 3H1KG 2KNCB 1NAYA 1FOSE 3A0HE 1G2CB 5KKZC 2B87B 3E1IA 1IFIA 1ZMEC 2LKMA 1A02J 1JY2O 1JB0J 3K5BA 4D6TE 2D2CC 3BCCJ 2P58A 1SQVJ 4UB6H 4PD4E 2CPSA 2IBZG 5E79H 1GZLA 3A2AA 3TGUE 1N8RQ 3C9IA 1HUCA 2M3EA 2V7QH 1N86A 1M7LA 1X8YA 1S9KD 1VQLP 2NRGA 1QLED 1BCCG 1FZEA 2NPSB 5CCHA 1L0NG 4HYTB 1NU1G 3V5BA 4BRYB 2IBZD 1EDJA 2BCCD 3G71P 1BE3D 1GL2D 3FWNA 2IFMA 3H1LD 3RK3C 1HBWA 3GHGA 2O1JA 5CCGA 1AVYA 3H1KJ 2ZT9C 3LIDA 1X0TA 1BCCD 2FYUE 2JWAA 2KS1B 1QGKB 1FAVA 3TSIA 1M1JB 3EFFK 1LTIC 4Y99C 1KYOE 5KLVE 1E79H 3PLNA 3L71G 3LW5J 5KAIH 1KILD 4XE5B 3PH0A 1Q7YQ 1MUUA 2AEMA 5AVTB 3F5HA 3PJSK 1SQXE 2BCCJ 5CJ4A 4UB6E 2FBWC 1X79B 1NKNA 5E79E 3H1LJ 1SQQG 3O8ZA 1VQ7P 2Y0CA 1JY3P 1USEA 1BCCJ 1Q2NA 1EXJA 2QIWA 3G6EP 1OZHA 1NU1J 1S5LX 1SQBG 3V4WA 1BGYG 1VF5B 4A7PA 3H1ID 3RGUA 1CSBA 2QSIA 2WMMA 2R44A 3USSA 2E5YA 3CX5I 3RL0B 2H8PD 3AEGC 3H32B 3OJAB 1EC5A 2JJLA 1SQBD 3KDPB 2RMZA 3AEAC 1NTKD 3V6IA 2W83C 2E75B 1MFZA 2QM7A 3BRVB 2KNCA 5KAIE 4AYCA 2R32A 5TISH 3II6A 4YXWH 2A06E 2B87A 1L4AB 1DD4A 1JEKA 4U7JA 4N78D 1H88A 1OVVA 3SSUA 2XZRA 3H1JE 1SQBJ 1SQPE 4BXLA 5B66H 5KTBA 4HKZH 3AEBC 3RL0g 2KSEA 4O9BA 4I6MC 4JPZB 2G3AA 4W7YA 2XDJA 1HF9A 3D70A 2XNXA 2NPSA 2Y9ZA 1ZV8A 1Y47A 5AW7B 1J1DB 4BRYA 2OTLP 2XV5A 1ZR2A 3L74G 4ASVA 4L74A 2WQYC 2HYNA 3FWLA 3MD0A 2JR8A 3PTZA 2O01J 3LIEA 3I55P 3HD7D 2KS1A 2DW3A 2M0BA 4QMAA 2Y9YA 3B5NB 3S4RA 4WY4B 1BDCA 1M1JA 1VQPP 2KI7B 5TISE 1FZCC 3B8EB 5AW1B 1GL2B 1HH0A 3KPEA 1JY2P 4RESB 3FGAD 1WT6A 4IFMA 1FZFA 3KHUA 4GOFA 1YITP 3D6ZA 1K9MQ 1OFCX 3I56P 1MKMA 1QVGO 3ZDMA 1N7LA 1QVFO 3HUSB 4L76A 3MIWA 5B66E 5AVXB 2ITAA 1OVUA 2WSCH 3AE3C 1KILB 4D6TG 1LTSC 1QX8A 1J1EC 1T8ZA 5KJ7A 5APQA 1K05A 3GMAA 3PRJA 2H89C 1L0NE 3L74J 3M9BA 1N73B 4H13D 1IO4A 3TNUB 2Z4EA 1GU4A 1HJ0A 2LR2A 2I1JA 4D6TD 5AVUB 1SLQA 1KC8Q 3HTKB 3O6QB 4HH2A 4PD4D 5KKZB 2WTYA 5KJ7C 2W6BA 3NTNA 3CCSP 4I7ZB 3TGUD 1T3JA 4IFFA 1OIPA 2YKPA 2E5TA 3L71E 1M8OB 2XKMA 1SVFA 1OW8A 2QRXA 3S1KA 1JOCA 1LTGC 1PGPA 1L4AA 2FXPA 1PGOA 1YJNP 1KB9H 4UB8H 4CPGA 1ZXGA 5KLVG 4KT0J 2B9BA 1SQQE 2QG4A 4D6TJ 3A0BH 1YHQP 2YXRB 2FYUD 3L70E 3Q5RA 2N1TD 3V2NA 4YXDC 2QVAA 1P84H 1SQXG 3VP8A 3WU2E 4WVZA 1BGYE 5KLVD 2R3CA 3AE8C 1HTLC 1YQ4C 1FJPA 4I2LC 3L4FA 2O01N 1CW5A 1PP9E 2HR3A 3CD6P 1RH5B 3CMEP 4GT1A 3AE7C 4Y99B 5APTA 2H88C 2FYNC 2FFDC 3H25A 2J58A 1FDMA 2A45I 4OGQD 1IFJA 4ZMDA 3GF7A 3B5NA 2FYUJ 4W80A 4WY4A
chains in the Genus database with same CATH topology
5AVWB 1RF1A 2GUSA 1J1DC 2CPSA 1SQXK 3N4XA 2M8RA 1GZLA 3A2AA 2O1KA 1HGZA 1CZQA 2I1KA 1GL2A 3C9IA 1HUCA 1ZR4A 1HVVA 3H32A 1N86A 2KLVA 1M7LA 2P7JA 1X8YA 1S9KD 2ZXEB 5APWA 4M3LA 2Z5HA 3HD7B 2ZFCA 1FZEA 2NPSB 1SQBK 5CCHA 5AVZB 4HYTB 2HG5D 5AVVB 1YTZT 2IFNA 3OAKA 3V5BA 2A45G 1CI6B 3HUSA 5AVSB 3P32A 3RK3D 3UIAA 2YO2A 4KHXA 1GL2D 1NO4A 1A02F 2IFMA 3LW5H 1NTKK 3HE5B 3RK3C 1HBWA 3KQGA 3GHGA 1KILA 2O1JA 1URQB 5CCGA 3LIDA 2OYHB 4B86A 2WSFH 1N2DC 2N1TA 1N73A 1FAVA 3TSIA 1M1JB 5APSA 1QL2A 1LTIC 5AVQB 1OWAA 4Y99C 3U1AA 3TNUA 3V2QA 1LWUB 1LT9C 1KILD 2WT7A 2WPSA 3HTKA 1RF0C 4XE5B 5AW5B 2A45H 1KILC 2WPRA 3I5CA 2OYIA 1L0NK 1MUUA 1NU1K 2GUVA 5AVTB 1LGHB 1J2JB 3V2PA 2YKOA 2IX7C 2W27A 2FFDA 5CJ4A 1RE3C 1IFNA 3MTUE 1EQ7A 1X79B 2C0WA 1N73C 1NKNA 3O8ZA 4C7NA 1JY3P 1KFMA 3VN0A 1H89A 1LTAC 2NPSC 2E43A 1DX7A 4WB4A 1GK6A 1HJBA 1JCCA 1RF1B 2WZ7A 3V4WA 2OYIC 3BRTB 1JMMA 1ZN5A 1CSBA 1H8AA 2HODA 3SWYA 1FJKA 3RK2B 1FZAA 4N6JA 3SWFA 3RL0B 3L35A 2H8PD 3H32B 1S9KE 3H6PA 1GTWA 3OJAB 1SP4A 1JTHB 2FYZA 2JJLA 3P8CD 4DZOA 1IFMA 2KP8A 3WMM0 2C9NY 3KDPB 3VMXA 3TYYA 1M1JC 1HWTC 1JNMA 5CJ0A 4C7RA 1SQQK 1GU5A 2QM8A 3OA7A 3M9HA 1FBMA 3L36A 2J59M 1MFZA 1Z56A 1LTJB 1X9VA 2QM7A 3BRVB 1IK9A 4AYCA 4JYCA 1NAFA 2HPCA 3NMDA 5AVYB 1WRGA 2R32A 5APXA 3II6A 3MGNA 2N1TB 2Q3IA 3VP9A 1MZ9A 1L4AB 1FZCB 1IC2A 1DEBA 5AW2B 1SFCA 4EIJA 1LT9A 1ZLLA 2MJZA 3IFMA 4N78D 1RF0A 4EOTA 1H88A 2C0XA 2Q7CA 2OARA 4XA4A 1N7SA 2XZRA 1NOHA 2N9BA 1NWQA 4LC1A 3V4QA 1RE3A 3R2PA 1KQLA 1JY3N 4N3YB 1IJDB 5KTBA 2FKWB 1VDFA 4AUWA 2L5GB 2JEEA 5AVRB 1AQ5A 1SFCD 1NH4A 4O9BA 2O01H 3HRNA 4I6MC 1GDTA 3HE4B 3RL0D 4W7YA 2XDJA 1SFCC 3RK2C 3HD7A 1J1EB 2XNXA 2NPSA 1N7SD 1ZV8A 3RL0C 2POHA 5AW7B 3M91A 3BVHA 1J1DB 2WWWA 4C46A 1DH3A 1N7SC 3KYQA 2XV5A 4W7ZA 1ZR2A 5AW9B 1CI6A 1PFIA 4LLHA 2R5DA 1GW4A 1GW3A 3N7NA 2YO3A 2IPPA 3VMZA 2HYNA 3HE5A 3MD0A 1XTCC 1FU1A 2M3BA 3LIEA 3HD7D 2OYHA 5CMZA 2NPSD 1FZGA 1LTJC 3B5NB 3HD7C 4WY4B 1L4AD 1M1JA 3P8CE 2WPQA 4GKGA 5AW4B 3MUDA 4JYBA 1L4AC 1FZCC 3B8EB 2R5BA 5AW1B 1HGVA 3RK3B 3G3ZA 1GL2B 2KSJA 1HH0A 1LWUA 1XTGB 3KPEA 1JY3O 1URQD 1JY2P 4RESB 1KFNA 3A5TA 2W6AA 1T3UA 1WT6A 4IFMA 1FZFA 2FYUK 1LTBC 1URQC 5APVA 3VTPC 2H43A 2BASA 1YTZI 4ZKPA 2OYHC 1VPCA 3TK1A 1GD2E 1JUNA 1N7LA 3HUSB 3NXSA 3MIWA 2YNYA 3CL3D 5AVXB 1KZUB 2HLOA 1LT9B 3VYIA 2XU6A 4N78E 1RE4C 2WSCH 3GHGB 1KILB 4GIFA 1LTSC 1LWUC 3M06A 2VRSA 1T2KD 1J1EC 1T8ZA 5KJ7A 2HFED 3BATA 5APQA 2GM4A 4IFDK 3A3YB 1T2KC 3M9BA 3EQ2A 2KYVA 1G2CA 4I1LA 4WBAA 1N73B 3M0DA 1IO4A 2KOGA 1W2EA 3TNUB 2Z4EA 3U59A 1GU4A 1E5WA 2I1JA 2FXMA 5BVZA 5AVUB 2WT7B 3A7OA 1RY3A 3B5ND 1JTHA 1SLQA 4JF7A 3HTKB 5CHXA 1JO5A 4WY4D 5KJ7D 1QL1A 3U1CA 4HH2A 2WSEH 2P2UA 2YKQA 2OYIB 1G1IA 3B5NC 1NHLA 3M0AA 2WTYA 4WY4C 5KJ7C 1NTZK 2W6BA 3NTNA 4ZKUA 1YYCA 1FZBA 1RF1C 5BU8B 1T3JA 2FFDB 4IFFA 1G1JA 2YMYA 3RK2D 2YKPA 2C9LY 3M0DC 5BU5A 3M9QA 1GL2C 3VMYA 4C7NB 2H7HA 1LTJA 1L0LK 2XKMA 2Q5UA 3CI9A 1SVFA 1MV8A 1JCDA 5CCHD 1JOCA 3PP5A 1IFDA 1LTGC 3NFQA 5AW6B 1L4AA 1FZCA 4AQRD 2P67A 3T97A 2CPBA 2E42A 1JY2N 5CCHC 5APYA 3EFGA 1LTTC 2HODB 3P7KA 3HUSC 1GK4A 2P1JA 1URQA 5APUA 5CCGD 3L37A 1OXZA 3GHGC 5CCGC 3IR9A 2Q9IA 2N1TD 1NKZB 3V2NA 2Z5IA 3VP8A 1AFOA 2N1TC 4DOJA 1RE4A 2R3CA 1HTLC 3HE4A 1FJPA 4I2LC 5AW3B 3BASA 5AW8B 2PP6A 4LGDE 3L4FA 1FOSF 1CW5A 1SQPK 1FOSE 1NTMK 2HPCB 1SQVK 4GT1A 4Y99B 5APTA 3CLQA 1G2CB 3V2RA 3E1IA 5KLVK 1IFIA 2LKMA 1SFCB 2FFDC 2PAJA 1A02J 2J58A 1JY2O 1FDMA 2A45I 4OH8B 2WITA 5AW0B 1IFJA 3VOPA 3B5NA 1N7SB 2KB7P 4W80A 4WY4A 3P8MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R2P A;  1GW4 A;  1GW3 A; 
#chains in the Genus database with same CATH topology
 1ZOY C;  1RF1 A;  1J1D C;  3C8V A;  2M8R A;  1NTZ D;  2O1K A;  1HGZ A;  1CZQ A;  3RK3 E;  5KLV J;  2AEF A;  1QEX A;  1GL2 A;  1M90 Q;  3ITK A;  1KB9 E;  4UB8 E;  5TJH A;  2P7J A;  4EYY Q;  3HD7 B;  2ZFC A;  2LXB A;  2AXC A;  1SQB K;  1X22 A;  4MN4 C;  2HG5 D;  2A06 G;  1SQX J;  1CI6 B;  3HUS A;  3P32 A;  1K8A Q;  3AEE C;  2YO2 A;  4KHX A;  2Q3E A;  1NO4 A;  1P84 E;  4KJM A;  3CCL P;  1NTK K;  2BEZ F;  3HE5 B;  3W67 A;  3KQG A;  1KIL A;  1KMI Z;  3H1J G;  2V7Q J;  4ASW A;  4B86 A;  3RBX A;  1N73 A;  2KZI A;  3U1A A;  3CCM P;  3TNU A;  5DJT B;  2BEQ D;  3H1J D;  3HTK A;  3O6Q A;  1RF0 C;  1S4X A;  5AW5 B;  1KIL C;  2WPR A;  5B5E E;  1SQP D;  1D7M A;  3MZW B;  1J2J B;  1RE3 C;  4H13 B;  3MTU E;  1N73 C;  1YJ9 P;  1YQ3 C;  2K88 A;  1KFM A;  3WUV A;  2CK3 H;  1LTA C;  2E43 A;  4WB4 A;  5K5G B;  1JCC A;  1KYO H;  2WZ7 A;  1JMM A;  5KLI C;  3SWY A;  1UII A;  4I7Z C;  1JM0 A;  1K73 Q;  1FZA A;  2UWJ E;  3H1J J;  3L35 A;  3W68 A;  1SP4 A;  3H1K D;  1SQP J;  3CC7 P;  4JQ0 D;  2E74 D;  5GTI H;  3B71 A;  2C9N Y;  4OWF A;  2JWD A;  1HWT C;  2RKL A;  5CJ0 A;  4C7R A;  5DJU B;  1LNQ A;  5GTH H;  1GU5 A;  3FXD A;  2E76 D;  4K35 A;  1X9V A;  3CXH I;  3SFE C;  3NMD A;  4K3A A;  1WRG A;  5APX A;  2N1T B;  3VP9 A;  1FZC B;  2ZJS E;  3T97 B;  1DEB A;  5AW2 B;  3H1H E;  3E7K A;  1TU3 F;  4L75 A;  4EOT A;  2Q7C A;  4XA4 A;  4GOD A;  1NOH A;  2N9B A;  4WWI A;  2IYP A;  1L0N D;  1NU1 D;  1NTM E;  4N3Y B;  2FKW B;  1VDF A;  2L5G B;  2JEE A;  1SFC D;  1IFP A;  3HD7 A;  1J1E B;  3SWK A;  3M91 A;  4GOE A;  2WWW A;  4C46 A;  3KYQ A;  4W7Z A;  2Q1K A;  1CI6 A;  4LLH A;  5GTI E;  1EZV I;  1BDD A;  1KD1 Q;  3N7N A;  2YO3 A;  3HE5 A;  3L71 D;  2M3B A;  5GTH E;  1FC2 C;  3L70 G;  1AV1 A;  1L0N J;  3HD7 C;  3P8C E;  2WPQ A;  4GKG A;  5AW4 B;  1W2B O;  1R5L A;  3G3Z A;  1DD3 A;  4RJT A;  1SQQ D;  1URQ D;  1AJY A;  3A5T A;  2W6A A;  1PP9 G;  2FYU K;  2H43 A;  4PV1 D;  1VPC A;  3TK1 A;  1BGY D;  4IL6 H;  3AE4 C;  2AEJ A;  2HLO A;  1LT9 B;  3L73 G;  3VYI A;  2XU6 A;  2NZ2 A;  1S1C X;  3L71 J;  1KTM A;  1RE4 C;  2WSS H;  1Q86 Q;  1UIX A;  3G4S P;  1L0L G;  1PIX A;  3M06 A;  2VRS A;  1PP9 D;  1PPJ E;  2WPV B;  3BAT A;  4IFD K;  3JCU H;  3EQ2 A;  3CX5 E;  2KYV A;  1G2C A;  4I1L A;  3WUT A;  1W2E A;  1SQQ J;  3CWB G;  4H13 C;  1E5W A;  2FXM A;  2WSC J;  5BVZ A;  3CCU P;  3L70 J;  3AE1 C;  2P2U A;  2YKQ A;  2OYI B;  1G1I A;  1NHL A;  3M0A A;  1LT1 A;  2IYO A;  1NTZ K;  1YYC A;  1BGY J;  2FYN B;  1FZB A;  3D6Y A;  2KZJ A;  5BU8 B;  2FFD B;  1G1J A;  1KB9 D;  1VL2 A;  3M9Q A;  3B4S A;  2K1A A;  2H7H A;  3R4Y A;  1PP9 J;  1OMI A;  3EWK A;  1MV8 A;  1JCD A;  5CCH D;  1IFD A;  1FZC A;  2E74 B;  1S3J A;  3T97 A;  2CPB A;  2I8D A;  1P84 D;  2HOD B;  3L73 J;  3P7K A;  4IL6 E;  2O3J A;  2L91 A;  5APU A;  5CCG D;  3AE6 C;  3L37 A;  1OXZ A;  2E76 B;  4RO0 A;  2B89 A;  3CC4 P;  3AE5 C;  3L74 D;  1AFO A;  2N1T C;  3Q5P A;  3JCU E;  4DOJ A;  1OX3 A;  5AW3 B;  3IF4 A;  1KV4 A;  2IBZ I;  1SQP K;  1DIP A;  1Y9B A;  1SQV K;  3Q2Y A;  2W90 A;  2OYO A;  1R5S A;  4RKU J;  2KK7 A;  2ZYG A;  1OW7 A;  1SFC B;  4BWN A;  4OH8 B;  3VOP A;  3P8M C;  1NYH A;  1K04 A;  4OGQ C;  5AVW B;  3WU2 H;  5EFW B;  2GUS A;  2QJY C;  2I1K A;  1VQK P;  1BE3 E;  5CBN A;  1KQS O;  3H32 A;  2KLV A;  4H44 D;  5APW A;  2Z5H A;  4TLF A;  2QJP B;  5AVZ B;  1YTZ T;  5KLI B;  5AVS B;  3H1H G;  3UIA A;  3AE2 C;  1BSH A;  1A02 F;  3CCQ P;  1KIL E;  1URQ B;  2WSF H;  1NTM G;  5APS A;  1QL2 A;  5AVQ B;  1OWA A;  3H1H D;  1IK7 A;  3V2Q A;  1KQG B;  1LT9 C;  4PJ0 H;  2A45 H;  2OYI A;  1L0N K;  1NU1 K;  3L75 E;  2MKV A;  1NTM D;  2YKO A;  2IX7 C;  3H1I E;  2FFD A;  1KYO D;  2C0W A;  3GW6 A;  2G8Y A;  1RQU A;  3VN0 A;  2QJK B;  2B88 A;  2IDB A;  1H89 A;  1DX7 A;  5KAF H;  1GK6 A;  1NVO A;  2OYI C;  1SQX D;  3H1H J;  1H8A A;  2HOD A;  1FJK A;  3L73 E;  1NTK E;  1EZV G;  4N6J A;  3SWF A;  5B5E H;  1GTW A;  1L0L E;  2OQQ A;  1VQN P;  1JTH B;  3L72 E;  2FYZ A;  3P8C D;  4DZO A;  1NTM J;  4IL6 X;  1IFM A;  1PGQ A;  3WMM 0;  2QA4 P;  4HB1 A;  3VMX A;  3TYY A;  1ZW0 A;  4JBZ A;  2E74 C;  1VQ5 P;  1JNM A;  1GMJ A;  1SQQ K;  3MUD C;  4H0L C;  4YTP C;  2QM8 A;  3CWB E;  2J59 M;  2P10 A;  1PPJ G;  2YIU B;  2FXO A;  5CBO A;  4JYC A;  1S72 P;  2E76 C;  4PJ0 E;  2Q3I A;  1MZ9 A;  3QH9 A;  1IC2 A;  1SFC A;  4EIJ A;  1RQV A;  1RF0 A;  4DT0 A;  2OAR A;  1PPJ D;  2JP3 A;  1Y8A A;  3V4Q A;  1RE3 A;  3R2P A;  2IZ1 A;  1VF5 D;  1KQL A;  1JY3 N;  2A06 D;  4TT3 H;  5KAF E;  1U7J A;  1AQ5 A;  1KOR A;  1NH4 A;  2RN0 A;  3IN6 A;  3GLM A;  3RL0 D;  2Y0D A;  1SFC C;  3RK2 C;  1N7S D;  2POH A;  3BCC G;  3E1R A;  3BVH A;  5AW9 B;  2Q6Q A;  1T6A A;  1GW4 A;  1GW3 A;  2W6J H;  2M5A B;  3PHL A;  1PZQ A;  3S9O A;  3VMZ A;  1VQM P;  1FU1 A;  2E75 D;  1PGJ A;  4R4L A;  1AVO A;  5CMZ A;  1FZG A;  3G9R A;  1LTJ C;  3CXH H;  2N9Y B;  1L4A D;  3CMA P;  4NPF X;  2QJP C;  1FE6 A;  2GA1 A;  1PV3 A;  1H0T B;  1HGV A;  4PD4 I;  1KFN A;  1T3U A;  1URQ C;  5APV A;  1YTZ I;  1MFT A;  4ZKP A;  2OTJ P;  1L2P A;  2XND H;  4PV1 C;  3GG2 A;  4H0L D;  1GD2 E;  3NXS A;  1KZU B;  4GIF A;  1T2K D;  2HFE D;  2GM4 A;  2W8Z A;  2BCC G;  2KOG A;  1BE3 G;  1ZRT E;  3H1L G;  3FX0 A;  2WT7 B;  3A7O A;  1RY3 A;  3B5N D;  1JTH A;  4JF7 A;  5CHX A;  1JO5 A;  4WY4 D;  1KYO I;  2QJK C;  2WSE H;  2PRR A;  4XFJ A;  4IOI H;  1FS0 E;  3CXH E;  3RK2 D;  2ZXX A;  2C9L Y;  5BU5 A;  4C7N B;  2KUB A;  3KXD A;  4DCK A;  1KN7 A;  1YI2 P;  4OGQ B;  2WVR A;  3AE9 C;  3CX5 H;  3PP5 A;  2KXP B;  2QJY B;  1LP1 B;  4AQR D;  1JY2 N;  5CCH C;  1EXI A;  1VQ9 P;  5APY A;  3EFG A;  1LTT C;  3TF5 A;  2P1J A;  3AEF C;  1FDO A;  3GHG C;  4ZNC A;  5CCG C;  3L75 G;  2YIU C;  2K3R A;  3IR9 A;  1M1K Q;  2Q9I A;  1NKZ B;  2ZYA A;  2Z5I A;  3H1I G;  1BE3 J;  1RE4 A;  4Z1M H;  4R4M A;  5AW8 B;  2PP6 A;  4LGD E;  1EZV E;  5H2F H;  3CPW O;  3RBZ A;  1FOS F;  3L70 D;  3L75 D;  2JDI H;  1NTM K;  2HPC B;  1JMB A;  3CLQ A;  2M5A A;  3V2R A;  1NTZ E;  5KLV K;  2OTK E;  2ZAE B;  2PAJ A;  1PL5 A;  1NTK G;  2D2C D;  2WIT A;  5AW0 B;  1W5C E;  1N7S B;  2KB7 P;  3L72 G;  3CCE P;  1SQX K;  3N4X A;  2ZYD A;  1H0T A;  3CCR P;  3L73 D;  1ZR4 A;  4U3F E;  1HVV A;  2QEX P;  2ZXE B;  1Q82 Q;  4M3L A;  1L0L D;  3L75 J;  3L72 D;  4L73 A;  4H44 C;  5AVV B;  3OAK A;  2IFN A;  2A45 G;  1VQ8 P;  3H1I J;  1SS1 A;  3RK3 D;  3Q1M A;  3LW5 H;  2ZT9 D;  3CWB D;  3CC2 P;  1RHZ B;  3TDK A;  2KIK A;  2OYH B;  5H2F E;  1YJW P;  2FY8 A;  1N2D C;  2YMK A;  3BCC E;  2N1T A;  4OVN F;  1SQV E;  3AED C;  4H0L B;  1NTK J;  1LWU B;  2YXQ B;  2WT7 A;  2WPS A;  1L0L J;  3L72 J;  3I5C A;  2GUV A;  1LGH B;  2WSF J;  1WMK A;  3V2P A;  2J5U A;  2W27 A;  3ABV C;  1IFN A;  1EQ7 A;  3CWB J;  4C7N A;  2IZ0 A;  3H1K E;  3IAO A;  3SFD C;  1LP1 A;  2NPS C;  2SPZ A;  1RF1 B;  1HJB A;  3BRT B;  1ZN5 A;  1KQF B;  3VMA A;  3RK2 B;  1OW6 A;  2QE7 H;  3JC2 2;  2OGU A;  1S9K E;  3H6P A;  3D71 A;  1NGM B;  1EDL A;  2KP8 A;  2IBZ E;  1M1J C;  2BCC E;  3JSV C;  1AQT A;  1AA0 A;  4NPD A;  3H1L E;  3M9H A;  3OA7 A;  1FBM A;  3L36 A;  1DEE G;  2ZVN B;  4HJG H;  1Z56 A;  1LTJ B;  1IK9 A;  1BCC E;  1NAF A;  2HPC A;  5AVY B;  4Y28 J;  1EDK A;  1NU1 E;  3MGN A;  3F89 A;  2ZVO B;  3TGU G;  3WUU A;  3KZI H;  1LT9 A;  1ZLL A;  3FXE A;  2MJZ A;  3IFM A;  2C0X A;  1N7S A;  1M56 D;  4EDF A;  2K9Y A;  1VQ4 P;  1NWQ A;  4LC1 A;  4PV1 B;  1IJD B;  3Q5S A;  3CCV P;  4AUW A;  5AVR B;  1VF5 C;  1ZRT D;  2O01 H;  3HRN A;  1GDT A;  2K9J B;  3HE4 B;  2JKV A;  2D2C B;  3C1L A;  3RL0 C;  2FYU G;  3Q3D A;  1DH3 A;  2JO1 A;  1N7S C;  1PFI A;  3CXH D;  2KLU A;  2R5D A;  1VQO P;  2IPP A;  1XTC C;  5M1B A;  2OYH A;  2NPS D;  2E75 C;  1SQB E;  3GF3 A;  3TGU J;  5C39 A;  3MUD A;  4JYB A;  1S5L H;  1L4A C;  1Q90 D;  1YIJ P;  2R5B A;  3RK3 B;  2KSJ A;  1LWU A;  1ZP0 C;  1XTG B;  2AXT H;  2ZT9 B;  3KZI E;  1JY3 O;  2PGD A;  3AEC C;  1LTB C;  3VTP C;  2BAS A;  4GDO A;  1KB9 I;  2OYH C;  1NTZ G;  1JUN A;  2YNY A;  1Q81 Q;  3CL3 D;  5L8R J;  4N78 E;  1EZV D;  4DJG A;  3GHG B;  1LWU C;  1U7M A;  3A3Y B;  4EI2 A;  1P84 I;  1VQ6 P;  1T2K C;  1LJ2 A;  4WBA A;  3M0D A;  1FDI A;  3U59 A;  4U3F G;  1NJI Q;  3A0H H;  3A0B E;  5KJ7 D;  1QL1 A;  3U1C A;  3B5N C;  4WY4 C;  2V4H A;  3CX5 D;  4ZKU A;  2RH0 A;  1RF1 C;  2LXC B;  2YMY A;  1S5L E;  3M0D C;  1GL2 C;  3VMY A;  4U3F D;  1M57 D;  1LTJ A;  1L0L K;  1S2E A;  2AXT E;  2Q5U A;  3CI9 A;  3MP7 B;  2R3S A;  1SQP G;  4PD4 H;  2Y0E A;  3NFQ A;  5AW6 B;  1SQV G;  1R8E A;  2K37 A;  2P67 A;  1NTZ J;  2WSE J;  3L74 E;  2E42 A;  4NPE A;  1USD A;  3OW2 O;  1EDI A;  3HUS C;  1BSN A;  1GK4 A;  1IZN B;  1URQ A;  3QWO C;  4H44 B;  1U57 A;  3BCC D;  3CCJ P;  2PFX A;  1SQV D;  1YBK A;  2K9J A;  3HE4 A;  1OVR A;  4YPC A;  4U3F J;  3BAS A;  3MHV A;  3H1K G;  2KNC B;  1NAY A;  1FOS E;  3A0H E;  1G2C B;  5KKZ C;  2B87 B;  3E1I A;  1IFI A;  1ZME C;  2LKM A;  1A02 J;  1JY2 O;  1JB0 J;  3K5B A;  4D6T E;  2D2C C;  3BCC J;  2P58 A;  1SQV J;  4UB6 H;  4PD4 E;  2CPS A;  2IBZ G;  5E79 H;  1GZL A;  3A2A A;  3TGU E;  1N8R Q;  3C9I A;  1HUC A;  2M3E A;  2V7Q H;  1N86 A;  1M7L A;  1X8Y A;  1S9K D;  1VQL P;  2NRG A;  1QLE D;  1BCC G;  1FZE A;  2NPS B;  5CCH A;  1L0N G;  4HYT B;  1NU1 G;  3V5B A;  4BRY B;  2IBZ D;  1EDJ A;  2BCC D;  3G71 P;  1BE3 D;  1GL2 D;  3FWN A;  2IFM A;  3H1L D;  3RK3 C;  1HBW A;  3GHG A;  2O1J A;  5CCG A;  1AVY A;  3H1K J;  2ZT9 C;  3LID A;  1X0T A;  1BCC D;  2FYU E;  2JWA A;  2KS1 B;  1QGK B;  1FAV A;  3TSI A;  1M1J B;  3EFF K;  1LTI C;  4Y99 C;  1KYO E;  5KLV E;  1E79 H;  3PLN A;  3L71 G;  3LW5 J;  5KAI H;  1KIL D;  4XE5 B;  3PH0 A;  1Q7Y Q;  1MUU A;  2AEM A;  5AVT B;  3F5H A;  3PJS K;  1SQX E;  2BCC J;  5CJ4 A;  4UB6 E;  2FBW C;  1X79 B;  1NKN A;  5E79 E;  3H1L J;  1SQQ G;  3O8Z A;  1VQ7 P;  2Y0C A;  1JY3 P;  1USE A;  1BCC J;  1Q2N A;  1EXJ A;  2QIW A;  3G6E P;  1OZH A;  1NU1 J;  1S5L X;  1SQB G;  3V4W A;  1BGY G;  1VF5 B;  4A7P A;  3H1I D;  3RGU A;  1CSB A;  2QSI A;  2WMM A;  2R44 A;  3USS A;  2E5Y A;  3CX5 I;  3RL0 B;  2H8P D;  3AEG C;  3H32 B;  3OJA B;  1EC5 A;  2JJL A;  1SQB D;  3KDP B;  2RMZ A;  3AEA C;  1NTK D;  3V6I A;  2W83 C;  2E75 B;  1MFZ A;  2QM7 A;  3BRV B;  2KNC A;  5KAI E;  4AYC A;  2R32 A;  5TIS H;  3II6 A;  4YXW H;  2A06 E;  2B87 A;  1L4A B;  1DD4 A;  1JEK A;  4U7J A;  4N78 D;  1H88 A;  1OVV A;  3SSU A;  2XZR A;  3H1J E;  1SQB J;  1SQP E;  4BXL A;  5B66 H;  5KTB A;  4HKZ H;  3AEB C;  3RL0 g;  2KSE A;  4O9B A;  4I6M C;  4JPZ B;  2G3A A;  4W7Y A;  2XDJ A;  1HF9 A;  3D70 A;  2XNX A;  2NPS A;  2Y9Z A;  1ZV8 A;  1Y47 A;  5AW7 B;  1J1D B;  4BRY A;  2OTL P;  2XV5 A;  1ZR2 A;  3L74 G;  4ASV A;  4L74 A;  2WQY C;  2HYN A;  3FWL A;  3MD0 A;  2JR8 A;  3PTZ A;  2O01 J;  3LIE A;  3I55 P;  3HD7 D;  2KS1 A;  2DW3 A;  2M0B A;  4QMA A;  2Y9Y A;  3B5N B;  3S4R A;  4WY4 B;  1BDC A;  1M1J A;  1VQP P;  2KI7 B;  5TIS E;  1FZC C;  3B8E B;  5AW1 B;  1GL2 B;  1HH0 A;  3KPE A;  1JY2 P;  4RES B;  3FGA D;  1WT6 A;  4IFM A;  1FZF A;  3KHU A;  4GOF A;  1YIT P;  3D6Z A;  1K9M Q;  1OFC X;  3I56 P;  1MKM A;  1QVG O;  3ZDM A;  1N7L A;  1QVF O;  3HUS B;  4L76 A;  3MIW A;  5B66 E;  5AVX B;  2ITA A;  1OVU A;  2WSC H;  3AE3 C;  1KIL B;  4D6T G;  1LTS C;  1QX8 A;  1J1E C;  1T8Z A;  5KJ7 A;  5APQ A;  1K05 A;  3GMA A;  3PRJ A;  2H89 C;  1L0N E;  3L74 J;  3M9B A;  1N73 B;  4H13 D;  1IO4 A;  3TNU B;  2Z4E A;  1GU4 A;  1HJ0 A;  2LR2 A;  2I1J A;  4D6T D;  5AVU B;  1SLQ A;  1KC8 Q;  3HTK B;  3O6Q B;  4HH2 A;  4PD4 D;  5KKZ B;  2WTY A;  5KJ7 C;  2W6B A;  3NTN A;  3CCS P;  4I7Z B;  3TGU D;  1T3J A;  4IFF A;  1OIP A;  2YKP A;  2E5T A;  3L71 E;  1M8O B;  2XKM A;  1SVF A;  1OW8 A;  2QRX A;  3S1K A;  1JOC A;  1LTG C;  1PGP A;  1L4A A;  2FXP A;  1PGO A;  1YJN P;  1KB9 H;  4UB8 H;  4CPG A;  1ZXG A;  5KLV G;  4KT0 J;  2B9B A;  1SQQ E;  2QG4 A;  4D6T J;  3A0B H;  1YHQ P;  2YXR B;  2FYU D;  3L70 E;  3Q5R A;  2N1T D;  3V2N A;  4YXD C;  2QVA A;  1P84 H;  1SQX G;  3VP8 A;  3WU2 E;  4WVZ A;  1BGY E;  5KLV D;  2R3C A;  3AE8 C;  1HTL C;  1YQ4 C;  1FJP A;  4I2L C;  3L4F A;  2O01 N;  1CW5 A;  1PP9 E;  2HR3 A;  3CD6 P;  1RH5 B;  3CME P;  4GT1 A;  3AE7 C;  4Y99 B;  5APT A;  2H88 C;  2FYN C;  2FFD C;  3H25 A;  2J58 A;  1FDM A;  2A45 I;  4OGQ D;  1IFJ A;  4ZMD A;  3GF7 A;  3B5N A;  2FYU J;  4W80 A;  4WY4 A; 
#chains in the Genus database with same CATH homology
 5AVW B;  1RF1 A;  2GUS A;  1J1D C;  2CPS A;  1SQX K;  3N4X A;  2M8R A;  1GZL A;  3A2A A;  2O1K A;  1HGZ A;  1CZQ A;  2I1K A;  1GL2 A;  3C9I A;  1HUC A;  1ZR4 A;  1HVV A;  3H32 A;  1N86 A;  2KLV A;  1M7L A;  2P7J A;  1X8Y A;  1S9K D;  2ZXE B;  5APW A;  4M3L A;  2Z5H A;  3HD7 B;  2ZFC A;  1FZE A;  2NPS B;  1SQB K;  5CCH A;  5AVZ B;  4HYT B;  2HG5 D;  5AVV B;  1YTZ T;  2IFN A;  3OAK A;  3V5B A;  2A45 G;  1CI6 B;  3HUS A;  5AVS B;  3P32 A;  3RK3 D;  3UIA A;  2YO2 A;  4KHX A;  1GL2 D;  1NO4 A;  1A02 F;  2IFM A;  3LW5 H;  1NTK K;  3HE5 B;  3RK3 C;  1HBW A;  3KQG A;  3GHG A;  1KIL A;  2O1J A;  1URQ B;  5CCG A;  3LID A;  2OYH B;  4B86 A;  2WSF H;  1N2D C;  2N1T A;  1N73 A;  1FAV A;  3TSI A;  1M1J B;  5APS A;  1QL2 A;  1LTI C;  5AVQ B;  1OWA A;  4Y99 C;  3U1A A;  3TNU A;  3V2Q A;  1LWU B;  1LT9 C;  1KIL D;  2WT7 A;  2WPS A;  3HTK A;  1RF0 C;  4XE5 B;  5AW5 B;  2A45 H;  1KIL C;  2WPR A;  3I5C A;  2OYI A;  1L0N K;  1MUU A;  1NU1 K;  2GUV A;  5AVT B;  1LGH B;  1J2J B;  3V2P A;  2YKO A;  2IX7 C;  2W27 A;  2FFD A;  5CJ4 A;  1RE3 C;  1IFN A;  3MTU E;  1EQ7 A;  1X79 B;  2C0W A;  1N73 C;  1NKN A;  3O8Z A;  4C7N A;  1JY3 P;  1KFM A;  3VN0 A;  1H89 A;  1LTA C;  2NPS C;  2E43 A;  1DX7 A;  4WB4 A;  1GK6 A;  1HJB A;  1JCC A;  1RF1 B;  2WZ7 A;  3V4W A;  2OYI C;  3BRT B;  1JMM A;  1ZN5 A;  1CSB A;  1H8A A;  2HOD A;  3SWY A;  1FJK A;  3RK2 B;  1FZA A;  4N6J A;  3SWF A;  3RL0 B;  3L35 A;  2H8P D;  3H32 B;  1S9K E;  3H6P A;  1GTW A;  3OJA B;  1SP4 A;  1JTH B;  2FYZ A;  2JJL A;  3P8C D;  4DZO A;  1IFM A;  2KP8 A;  3WMM 0;  2C9N Y;  3KDP B;  3VMX A;  3TYY A;  1M1J C;  1HWT C;  1JNM A;  5CJ0 A;  4C7R A;  1SQQ K;  1GU5 A;  2QM8 A;  3OA7 A;  3M9H A;  1FBM A;  3L36 A;  2J59 M;  1MFZ A;  1Z56 A;  1LTJ B;  1X9V A;  2QM7 A;  3BRV B;  1IK9 A;  4AYC A;  4JYC A;  1NAF A;  2HPC A;  3NMD A;  5AVY B;  1WRG A;  2R32 A;  5APX A;  3II6 A;  3MGN A;  2N1T B;  2Q3I A;  3VP9 A;  1MZ9 A;  1L4A B;  1FZC B;  1IC2 A;  1DEB A;  5AW2 B;  1SFC A;  4EIJ A;  1LT9 A;  1ZLL A;  2MJZ A;  3IFM A;  4N78 D;  1RF0 A;  4EOT A;  1H88 A;  2C0X A;  2Q7C A;  2OAR A;  4XA4 A;  1N7S A;  2XZR A;  1NOH A;  2N9B A;  1NWQ A;  4LC1 A;  3V4Q A;  1RE3 A;  3R2P A;  1KQL A;  1JY3 N;  4N3Y B;  1IJD B;  5KTB A;  2FKW B;  1VDF A;  4AUW A;  2L5G B;  2JEE A;  5AVR B;  1AQ5 A;  1SFC D;  1NH4 A;  4O9B A;  2O01 H;  3HRN A;  4I6M C;  1GDT A;  3HE4 B;  3RL0 D;  4W7Y A;  2XDJ A;  1SFC C;  3RK2 C;  3HD7 A;  1J1E B;  2XNX A;  2NPS A;  1N7S D;  1ZV8 A;  3RL0 C;  2POH A;  5AW7 B;  3M91 A;  3BVH A;  1J1D B;  2WWW A;  4C46 A;  1DH3 A;  1N7S C;  3KYQ A;  2XV5 A;  4W7Z A;  1ZR2 A;  5AW9 B;  1CI6 A;  1PFI A;  4LLH A;  2R5D A;  1GW4 A;  1GW3 A;  3N7N A;  2YO3 A;  2IPP A;  3VMZ A;  2HYN A;  3HE5 A;  3MD0 A;  1XTC C;  1FU1 A;  2M3B A;  3LIE A;  3HD7 D;  2OYH A;  5CMZ A;  2NPS D;  1FZG A;  1LTJ C;  3B5N B;  3HD7 C;  4WY4 B;  1L4A D;  1M1J A;  3P8C E;  2WPQ A;  4GKG A;  5AW4 B;  3MUD A;  4JYB A;  1L4A C;  1FZC C;  3B8E B;  2R5B A;  5AW1 B;  1HGV A;  3RK3 B;  3G3Z A;  1GL2 B;  2KSJ A;  1HH0 A;  1LWU A;  1XTG B;  3KPE A;  1JY3 O;  1URQ D;  1JY2 P;  4RES B;  1KFN A;  3A5T A;  2W6A A;  1T3U A;  1WT6 A;  4IFM A;  1FZF A;  2FYU K;  1LTB C;  1URQ C;  5APV A;  3VTP C;  2H43 A;  2BAS A;  1YTZ I;  4ZKP A;  2OYH C;  1VPC A;  3TK1 A;  1GD2 E;  1JUN A;  1N7L A;  3HUS B;  3NXS A;  3MIW A;  2YNY A;  3CL3 D;  5AVX B;  1KZU B;  2HLO A;  1LT9 B;  3VYI A;  2XU6 A;  4N78 E;  1RE4 C;  2WSC H;  3GHG B;  1KIL B;  4GIF A;  1LTS C;  1LWU C;  3M06 A;  2VRS A;  1T2K D;  1J1E C;  1T8Z A;  5KJ7 A;  2HFE D;  3BAT A;  5APQ A;  2GM4 A;  4IFD K;  3A3Y B;  1T2K C;  3M9B A;  3EQ2 A;  2KYV A;  1G2C A;  4I1L A;  4WBA A;  1N73 B;  3M0D A;  1IO4 A;  2KOG A;  1W2E A;  3TNU B;  2Z4E A;  3U59 A;  1GU4 A;  1E5W A;  2I1J A;  2FXM A;  5BVZ A;  5AVU B;  2WT7 B;  3A7O A;  1RY3 A;  3B5N D;  1JTH A;  1SLQ A;  4JF7 A;  3HTK B;  5CHX A;  1JO5 A;  4WY4 D;  5KJ7 D;  1QL1 A;  3U1C A;  4HH2 A;  2WSE H;  2P2U A;  2YKQ A;  2OYI B;  1G1I A;  3B5N C;  1NHL A;  3M0A A;  2WTY A;  4WY4 C;  5KJ7 C;  1NTZ K;  2W6B A;  3NTN A;  4ZKU A;  1YYC A;  1FZB A;  1RF1 C;  5BU8 B;  1T3J A;  2FFD B;  4IFF A;  1G1J A;  2YMY A;  3RK2 D;  2YKP A;  2C9L Y;  3M0D C;  5BU5 A;  3M9Q A;  1GL2 C;  3VMY A;  4C7N B;  2H7H A;  1LTJ A;  1L0L K;  2XKM A;  2Q5U A;  3CI9 A;  1SVF A;  1MV8 A;  1JCD A;  5CCH D;  1JOC A;  3PP5 A;  1IFD A;  1LTG C;  3NFQ A;  5AW6 B;  1L4A A;  1FZC A;  4AQR D;  2P67 A;  3T97 A;  2CPB A;  2E42 A;  1JY2 N;  5CCH C;  5APY A;  3EFG A;  1LTT C;  2HOD B;  3P7K A;  3HUS C;  1GK4 A;  2P1J A;  1URQ A;  5APU A;  5CCG D;  3L37 A;  1OXZ A;  3GHG C;  5CCG C;  3IR9 A;  2Q9I A;  2N1T D;  1NKZ B;  3V2N A;  2Z5I A;  3VP8 A;  1AFO A;  2N1T C;  4DOJ A;  1RE4 A;  2R3C A;  1HTL C;  3HE4 A;  1FJP A;  4I2L C;  5AW3 B;  3BAS A;  5AW8 B;  2PP6 A;  4LGD E;  3L4F A;  1FOS F;  1CW5 A;  1SQP K;  1FOS E;  1NTM K;  2HPC B;  1SQV K;  4GT1 A;  4Y99 B;  5APT A;  3CLQ A;  1G2C B;  3V2R A;  3E1I A;  5KLV K;  1IFI A;  2LKM A;  1SFC B;  2FFD C;  2PAJ A;  1A02 J;  2J58 A;  1JY2 O;  1FDM A;  2A45 I;  4OH8 B;  2WIT A;  5AW0 B;  1IFJ A;  3VOP A;  3B5N A;  1N7S B;  2KB7 P;  4W80 A;  4WY4 A;  3P8M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...