2YKQA

Structure of the human line-1 orf1p trimer
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
212
structure length
200
Chain Sequence
DQLEERVSAAEDEINEIKREGKFREKRIKRNEQSLQEIWDYVKRPNLRLIGVPESDVENGTKLENTLQDIIQENFPNLANVQIQEIQRTTPRHIIVRFTKVEMKEKMLRAAREKGRVTLKGKPIRLTVDLSAETLQARREWGPIFNILKEKNFQPRISYPAKLSFISEGEIKYFIDKQMLRDFVTTRPALKELLKEALNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trimeric Structure and Flexibility of the L1Orf1P Protein in Human L1 Retrotransposition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords LINE-1 ORF1P
total genus 62
structure length 200
sequence length 212
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02994 Transposase_22 L1 transposable element RBD-like domain
A PF17489 Tnp_22_trimer L1 transposable element trimerization domain
A PF17490 Tnp_22_dsRBD L1 transposable element dsRBD-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ykqA01
3.30.70.1820 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykqA02
3.30.250.20 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 Rec A Protein; domain 2 2ykqA03
2W6BA 2LDYA 2W7AA 2YKPA 3EQ2A 3L4FA 3BRVB 3SOOA 1JOCA 2JRBA 2YKOA 2YKQA 3CL3D 3BRTB
chains in the Genus database with same CATH superfamily
4R8UB 3UCGA 5CCGA 3IR9A 3MXHP 3LW5C 3PEHA 4OL8A 1VF5D 2X3GA 2KU7A 3I5BA 4CLLA 1RT3A 3ZDMA 3OVSA 2VFRA 2W83C 3H4BA 4K3AA 1DBDA 1FKOB 3B5NC 1SQQD 3HX9A 2B7CB 4DSKA 2KKHA 3HVAA 3WIVA 4JI5J 2UXCJ 4B9UA 1F5CA 1X4AA 2L9DA 1QD1A 1KWMA 2XI2A 3FK4A 4HL9A 3W64A 3TK1A 4BHQA 4IO9Q 2Q79A 2V7QJ 4JI2J 5KAIE 5APQA 1ZRTE 1Y9OA 1RXOB 2FJEB 3H1IE 2GHWA 4ZKUA 1E5WA 3OHBA 2OESA 4BRYA 1WI6A 1Q78A 4CLKA 3EWGA 3ISND 1Q81T 2C3UA 1HNVB 3VZHA 3KZIE 2VB6A 1B64A 3D6TB 2Q3IA 4QPXA 2VPYB 4Y34A 1HNZJ 3BDPA 2B6AA 1NK8A 1LW0B 4QZVB 3I4PA 4N7TA 2BVZA 5K8OA 4O0NA 2M3BA 3H32A 2BJ8A 1RK8A 1DQ9A 2IFXA 2E1CA 3FEZA 3QBCA 4FF4A 2AYEA 4XTTA 4E8UA 4CYUB 4B3RF 1BGYJ 4K4YA 1M5SA 4X84A 4KV8B 1AA0A 4RU2A 2EBEA 3BCCJ 2JFKA 2OARA 4WY4A 4X4PA 1U1PA 4QR1A 2E76D 1ZM2A 2AGOA 3I87A 5FJ4A 4JP8A 4A48A 2Y0SD 2XSJA 4DU8A 2KLVA 3FRZA 4RWXA 2HPCB 2W1BA 1U1RA 1RSCA 2R2SA 1SPBP 1REGX 2WOMA 1HA1A 2J6SA 1JKHA 2NRGA 1NTZK 1N5YA 4DV0J 3IWXA 3CC7P 2R2UA 1SQPJ 1L4AD 2VOOA 3M8SA 1H2TZ 6AT1B 1S6QB 3G71S 2L5GB 1ITPA 2ZRCA 2HRTA 1WC1A 2QFIA 4WFBQ 5AW4B 5CYQA 4ZPCA 4IRDA 1N8RQ 1KHVA 2K1RA 3A0BE 4GVBA 1UBCA 1TVRB 3AE3C 5CHCB 1Q81Q 1YJTA 1FTRA 1UAWA 2D3ZA 3K8WA 4PXCA 4IH6A 4WP8A 5HLFB 1ZM4A 2LU1A 4V19X 3T5KA 3VGSA 2C28A 1AJYA 5KFZA 1J1DB 3EE3A 1S1VA 4M63A 4JI8J 4X4UA 1SQXD 3G82B 2V8PA 1K9MT 2YKMA 3S6EA 1XNQJ 1C4AA 5LJ5Y 3DXSX 1S1CX 3KLVA 1LTTC 2QN6B 3HSZA 3J7YU 4OHVA 2F4VJ 1T3UA 2IDEA 1KTQA 1S1XB 2D9PA 3PTWA 2AEJA 3Q5SA 1EZVD 5E3CA 1X8DA 1RAAB 1SCJB 3SV3A 2LXIA 2Q1KA 2DNQA 1N88A 1WORA 1RT6A 3PRVA 2D7SA 4AXIA 2DNGA 3VWSA 2HQDA 2V68A 4OZJA 5IV4A 1K73Q 4A8SA 2KOGA 2JWAA 2ZC4A 3NRBA 1G1IA 3EVOA 4RWWA 3JYTB 1BWEA 4KKOA 2OO4A 1N4LA 2VA2A 2QLFB 3CWBE 3LPEA 4TVAB 1FNXH 3W9JA 1PBUA 1VJWA 3MUTP 1EZVE 3KKFA 3GIRA 2QJPC 4PWDB 1PPJG 2M5AA 2VG6B 1JXVA 5DQIA 3W2WA 2QIFA 2CQ4A 3K0JA 2CNOB 1S6PA 4O4GB 3TUPA 3QATA 4J9MA 2QA1A 3KJNB 1WEXA 3RW7A 1T8EA 1X9WA 2FIUA 2AD9A 3AFGA 2XM3A 3PO5A 2JC1A 3RL0C 3WQPA 3R2CJ 2NXNA 1Y47A 2FYXA 4I6WA 2W8ZA 4OI0A 1REVA 2P9GA 1YJUA 4Q45A 2W90A 5D0GA 2BX6A 2LXCB 5CBOA 3OTBA 5JRJA 3L74E 2N1TD 2V9KA 2CJYB 3LWLA 2YKOA 4LC1A 2W01A 3MMAB 4KYZA 1NCLA 2CA9A 3AE2C 3SOOA 2OTJP 1KQGB 1V5VA 2B43A 5D8HB 3VHQA 2M7SA 4ES1A 2OFGX 2AZ3A 3S01A 2BE2A 3QYYA 3DRXA 5HMZA 1NPPA 3PFEA 3UE2A 2VQEJ 4IO1A 4V19J 1RHUB 2X7IA 1KQLA 2WITA 1XMBA 1U49A 4TYAA 3CCLP 2BW2A 1MO6A 1EDJA 2VPZB 4QWDA 2OPRB 1XNRJ 2H7HA 1OXZA 3T97A 1VQSA 4D3HA 3A3PB 3IBFB 1AW0A 4JYCA 1NVOA 2CZ4A 4EZ9A 2IAJA 2LXFA 3MR6A 4BXLA 1NTKG 3VGTA 2GZOA 2NYIA 3PYDA 2ZHBA 1FDBA 1SQXG 2DIUA 4B17A 3C9IA 2FYUG 1RT1B 2ROEA 4DV2J 1NTMJ 1ZAXA 3RB4A 4RNFA 2HHHF 1SV5A 5LOQA 2W8LA 4YY3F 1YJNP 3DU5A 1NJYA 1L3VA 5AXKA 3W2VB 4IOIH 1FRIA 3CE8A 3H1IG 1TK5A 2ZRJA 4WJBA 3MM8B 4DFPA 2DH8A 4RW4B 2CFXA 2OQQA 3SQOP 2ZXXA 1RHMB 3I5AA 2H65B 1N56A 2YNYA 2MQMA 1FRXA 1KVJA 1A0OB 5C42B 4CNZA 2DR9A 1SQQE 2VC0A 1EQMA 2MQOA 1OPZA 4AL7A 3Q83A 4UB6E 3D28A 3JSMB 4F25A 3TVZA 3PW7A 1Y3KA 1VQPS 2MJZA 3ZZPA 3L36A 3SYZA 3OVBA 4Y2AA 2UVVA 1CG2A 2EW9A 3BR8A 1VDHA 4TLRA 1RCXB 1L0LK 1L4AB 3IWNC 3M2RB 4DZDA 1RF0A 3E01A 4DQIA 2ZD1B 4KGZB 4DXLA 1AXQA 2HIQA 2IM1A 3MP7B 3CXHI 3R2PA 1WOOA 2NPSA 4WY4B 1C1CA 3CF5Q 3I55S 4JI4F 4JI1F 3UW1A 2J6UA 1KQSR 1SKRA 2DXEA 4L3KA 4CH7A 1AA1B 1JLCA 4F8RA 1MO3A 3OD2A 5AJ3J 3B5ND 4K50A 3SWKA 1TK8A 2YBVA 2KFYA 3NL0A 8RUCA 5F0UA 3H1JD 4J7CA 5F9NA 3ULHA 4PQAA 3ZO7A 3CLQA 4TU9A 4R4LA 1PBAA 1IKYA 1RE4C 2ATCB 4TU8A 3TARA 3FXDA 2E9TA 1OMIA 4DZ6A 1FJCA 1TKXA 3MEDB 2CJKA 4NI2B 2XEXA 4JBCA 1USEA 2XZRA 1VQMS 1DLOA 1U6ZA 2A06D 3UO0A 4H4MA 4CDIA 3P7KA 1KQSO 4K7QA 1CULA 1NSQA 3O8WA 3ET6A 4OYXA 1JY2P 4DJGA 4Q43A 3E7KA 1MNEA 1S7IA 1K1SA 3QNWB 2Y8YA 1IC2A 1VFJA 1TFYA 3L73D 1ZZFA 1U25A 2C2OB 4UUXA 3MM9B 2V0NA 2P5VA 1KILE 2UXDF 1UCNA 2Z5IA 4WCEQ 4LGDE 3OUYA 1TKZB 3BM7A 5KFEA 2MHNA 5DO2A 1SQXK 2I0XA 1OVVA 3V81A 2P58A 4URSA 3PYGA 3R5BA 3MGJA 1ZA2B 4UT4A 1WHYA 2XZTB 1GTWA 4WTOB 2M2BA 5LT5A 1Q8IA 4USHA 3HULA 1WC5A 3JTOA 5E79H 3H5SA 1CJVA 3KJVA 5EDWA 3HUSC 1IFIA 3QIPA 4OIXA 3UIAA 3N79A 2K3IA 1HBWA 3PX6A 1VJQA 3NGRA 2F8EX 3L73G 2FY8A 3HKWA 3HHKA 2IPPA 2XHCA 2HFVA 3FVYA 1VHIA 1B0PA 3AEDC 4ANDA 5D0RA 2NLWA 3GJQB 3Q2SC 1FRHA 4IFVA 1WC4A 2D2CB 4ED8A 3B4SA 3ZTOA 2ODNA 2WB1D 3VVTA 1JJCB 2VODA 2GV1A 5APUA 3TQ1A 1P84I 4YB1P 3H25A 2KIKA 2W4CA 2M70A 3TVYA 2R8KA 2CVIA 3NWRA 2M9KA 4MK8A 1R89A 4NXNF 1M7LA 3DOLA 1X5PA 2W9CB 1WF0A 4JBZA 4Q5VA 2Z0GA 3T19A 4ZJLA 1RQUA 1URQA 1U4BA 1YTZT 1B3TA 5CYMB 4UZBA 2GA1A 1LT9B 2AJ1A 4DS4A 3TRGA 2YX7A 3KHHA 2ASDA 2VFTA 3GIMA 1RU2A 2QYGA 3HT0A 2W9BA 5F8LA 3TQEA 2YKPA 1ROFA 4NCAA 4NLXA 3QWPA 2ZT9B 1S49A 2HS4A 4QBUA 2YY3A 1NH8A 1T95A 4DSEA 2CQ0A 3MECB 5HBMB 3SV4A 5CZVA 4IFVB 3GV7B 3QT5A 1KFNA 4IG3A 5KFPA 3L72J 3BEGB 1KFMA 4IKAA 4QIGA 5HROB 4RBUA 4WFYA 3DLEB 3RB0A 1BMQB 3L70G 1UP1A 1HYSA 1S0OA 3W2VA 1JB0C 5KLVG 3EQ2A 4ZITA 1VQ4S 4JI5F 2AEFA 1M5HA 2RRBA 3P4UB 2EWHA 1YTYA 4Q2LA 1HBNA 1SC4B 1ZZNA 4XAKA 3FGAD 3M8RA 4DOJA 4KHPJ 3M9BA 1SQQK 2EK6A 4YR3A 4L3NA 3HHLA 2N1TC 2DH7A 4OHXA 2MY7A 1JTHA 3GILA 5D4LA 1SKWA 2QSWA 2PDAA 1DTTB 2QLJB 4YDXA 2R9LA 2WBRA 5A8WA 2W6BA 3UPFA 2Y8WA 2W9BB 1OZHA 1WG1A 1FE6A 1PILA 4EBCA 1RT3B 2HW3A 2YH0A 4ER8A 4J9OA 1P8GA 3TGUG 2E9ZA 2B9EA 4DR1J 1RKIA 3H5YA 4X65F 3IR7B 1RT6B 4PJ0E 1EXJA 3KG1A 2CPEA 5G0RA 3N4WA 2FHOB 1URQB 5CD4A 5H9FJ 2CXEA 2ZXEB 2YWHA 8AT1B 2RQKA 1LT9C 2NYHA 5ETOA 3ITHA 3VVUA 1UMJA 3UWTA 1WACA 2IVYA 3J81U 4YXWH 4DHVA 1FFSB 3DOMB 3AJ2A 2BCCG 5KOWA 1R0CB 4O44A 5B0FA 4MKYA 1FNOA 2ZRNA 5GMEA 5A0YB 1T0TV 4QIEA 3R6LB 2ZRMA 1B7FA 1SI9A 3BSOA 3BGRB 4L72B 1I5OB 1QL1A 1U48A 3MM7A 3CMAP 3H1HD 1YJ9P 3NGSA 2KG0A 4HYKA 3DLEA 2WSCC 1NJZA 4NCGA 3HHEA 4NI2A 4F67A 3CPWO 1FK9A 1DEBA 2RDDA 4ZVTB 3HHDA 2O01N 3HT3A 1S1VB 5BYQA 5C39A 1W2EA 3JCUH 1EXIA 3A3YB 1S9GA 1SJ4P 2QE5A 1UW9A 4L73A 1R7IA 1G6BA 2GQQA 2LR2A 5KFMA 2V2QA 4OQJA 1VDFA 2Z2MA 4NASA 1OS5A 5F3TA 3KMSA 3HHLD 4KGKA 3GIKA 3MURP 5LJ3Y 3H1HE 1CSJA 5KLIB 1IUJA 2W9CA 2LQ8A 2XY5A 2XS7A 1XTZA 2J59M 1ZOTA 4ZMDA 3G2XA 4I56A 1LW2A 4LFBF 1AV1A 4F0HA 2PRRA 2LECA 4G1IA 1WOSA 2P1JA 5B7WA 1Z4UA 5KLIC 3JQKA 5HP1A 3Q8RB 4IUFA 1XEZA 1LW2B 1UVLA 2BQRA 3QZ7A 3D6MB 1R8CA 5D0HA 2FGCA 4KKOB 1K0VA 1BQXA 1L0LJ 4DR4F 3KLGB 3I0RA 2ROGA 1ZOYC 2GVZA 2HGMA 2FFDA 3FCHA 2XMUA 3BKFA 3BPDA 1A02J 2YNFB 1H8AA 1PP9G 4NLQA 1P84D 3VAGA 3IMQJ 4DPUA 2GFFA 1VQ6P 1T9VA 1RT4B 4ZP8A 4CLYA 3CEDA 1K73T 1KONA 4LR9A 4Z7YA 1S57A 3LIDA 1G2EA 1QSLA 1T3OA 3OXGA 1I94F 3I32A 4B08A 4WYWA 3US5A 3W61A 3BV8A 1Q86Q 2PN6A 2VFUA 4JV1A 2A10A 3WBZA 1MW7A 1EP4A 4NLPA 1E79H 2KL8A 2XV5A 3AEGC 3G71P 2JR8A 5BR8F 1PGJA 3UN5A 3T1HF 3K5PA 2CUYA 1IK7A 1PIEA 1TZ0A 5LMUF 3NWGA 1RLDA 1Y8AA 1M1JB 2MQLA 2OKQA 1NSAA 5DDRC 3SSQA 1PAUB 4PO1A 4PYDA 3CXHE 5KFHA 4LSNA 2MQPA 2UV8G 1HJ0A 4ED4A 1JLGB 2OLWA 3RB3A 1FERA 2MZRA 2YWKA 3THTA 2YTCA 2FD2A 4FKYA 4QIWD 3M9QA 2R7UA 1OQ3A 1VQ9S 3AE4C 2CDRB 3Q8VA 1JLAA 3F5HA 1GFWB 2J9DE 2NZ4A 1EJ7L 5D78A 1FDIA 2P6SA 4Y65A 1NAYA 1R8PA 2ASLA 1F6TA 1WEYA 3EX7B 3H6PA 2EC2A 3QGPA 4I6MC 1VISA 3MM6B 1NSPA 4DOZA 2RDIA 3HE4A 4YS2A 1NUEA 2QV6A 4YN3B 1SQPK 1O8BA 2JLFA 2VC1A 1F3FA 3BATA 2JNJA 3H20A 3AXMA 4ECUA 1VF5C 4PAAA 1PIXA 1AQ5A 3L9ZA 2KYVA 4I6YA 4ATNA 2YNHB 4B02A 3KHLA 3HFKA 4P2MA 2PFXA 1S5LE 1CQMA 4D6TE 3H2LA 3DLBA 4IG0B 4RJTA 2M0BA 3M6VA 2GMLA 3DLHA 2PFDA 2D3O1 1S1WB 3IO1A 2R3VA 4A47A 2VBXA 3ZTPA 2Z57B 4CT9A 2FYNB 3OV7A 2NUUG 2POHA 1UIXA 3DRRB 3AA9A 1RAHB 1LWFA 4LBIA 2IVFB 1NHUA 5A8KB 2O67A 2JJLA 5HSPA 1GNKA 2P6TA 2UWJE 1W2BO 1KB9D 1AA3A 2LQ9A 2PP6A 2FC9A 2Z4EA 1YRXA 3GPAA 3ENAA 3TGUD 1X8YA 1URQD 1R27B 4CWBA 5J1NA 5LXRA 4AQRD 3L4FA 4RPFA 4X4OA 3IS9A 4HT5A 5KG3A 4IDKB 3MUMP 3GU0A 5KFKA 4U3FG 2WSFC 1HLWA 4EU0A 4H13C 3CMAS 1G19A 2ZHAA 2HMIB 3EXCX 1VRUB 2MGZB 4MKBA 4LSNB 1QM9A 2HBZB 4BLGA 5AW2B 4NL5A 3D4JA 1R0AA 1Y9BA 1OSDA 4A8KA 1GH8A 2QX0A 4B3OB 2W2QP 4C3KA 2BEQD 1SQQJ 5GAHU 1MWQA 3GYNA 1X4HA 2XNQA 1R5SA 5BYRA 1MMDA 2W4PA 2R8HA 1U1QA 1ZP0C 5K8MA 1N32F 2KDOA 3A2AA 3EZ5A 2FB0A 3AOCA 3V4IA 3HFZB 4U7CA 1ZTWA 3D3BJ 1JMBA 3J7AN 2GIFA 3TI0A 3SFEC 5KFXA 4NXMF 4N78D 1L0ND 2F40A 4J9LA 5IM0A 2W7PA 3LGMA 4ZCLA 5IT9U 2IA0A 5GADU 1OSCA 1U1OA 3CW2C 2LCWA 3O44A 5E41A 4DR3J 1UVKA 3CCTA 4RBVA 1VQ8S 1L0LD 1NTMK 2KZZA 2R32A 2SXLA 5KFJA 2L91A 3GJTB 5IFMA 1UBFA 2AIRB 4H13D 4C0BA 1VRTA 2HEKA 5DQGA 1N54B 2Q43A 1JLQA 4KBIA 4QCLA 3T1AA 2H43A 1FESA 3KK2B 3CXHD 3TZWA 1CC7A 4XDDA 1X0PA 2RQMA 2G2OA 4LRFA 1L0NE 5JVHQ 4M5KA 2OPQA 4DR5F 2AU0A 2E7VA 4OX6A 3F56A 3OJSA 1G2CB 1U0HA 4WYLA 1Y3JA 2H8PD 3KK2A 1PGQA 1NHLA 4H44C 1RHRB 1TV6B 2MZ1A 3PJSK 3BGFA 1SQPE 3MECA 5ETQA 3EPIA 2PGCA 1PGZA 1S5LX 5AE3A 3FMBA 2KNCB 2L9NA 1P84H 2QE7H 2MPUA 2OSRA 5HROA 1OJ4A 3K5NA 4KB7A 3GTYX 1Q16B 3I55P 1B70B 2JLGA 4ID8A 4ZLLA 2C2MB 5KT4A 3ZZZA 4DZOA 1NMEB 1T7PA 3EICA 3THVA 4W92B 4GKJF 5SZTA 4NMXA 3TEHB 5J1EA 1HMVA 3C8VA 1UL3A 2C3OA 3DC2A 3MD1A 5J2NB 4EBDA 1B99A 2JLEA 1X9MA 4WXOA 3PXGa 1OW8A 3I0SA 1SQBK 5AVZB 1T8ZA 5KT7A 3RB6A 4EO8A 3VMYA 3K2YA 3BSNA 3GHGA 2JWNA 2QMUB 4M95A 1IBMF 3HVRA 1LP1B 2C1EB 4FVMA 1VQ9P 2FHMA 2ZRAA 1SQFA 1FJPA 3H1ID 4ELUA 2O3DA 1MLAA 2XMTA 2PI5A 3GFZA 1MWZA 2DNRA 2OMLA 4ECZA 1J5OA 1SIWB 2U1AA 5F8MA 1FWLA 3W5YA 4POAA 2A06G 1L3SA 1VI7A 2OPPB 2GMJA 1L2PA 4USMA 3T1YJ 4PUOA 4YDDB 5A8RB 2WWWA 2XULA 3L7PA 3DLKA 1JLQB 3AY0A 1HWJA 4DBQA 3NMDA 1G4CA 4PSAA 1JB0J 3W8PA 4U3FJ 4NCBA 1U99A 1HVVA 4A7PA 2GAHC 1HWUA 3KLEB 1T9YA 4QIVA 5KG0A 2R7VA 1RA7A 5AVXB 1YZ7A 1JOCA 2RF2A 4U7UK 2UXDJ 1HW8A 2KLUA 1N0VC 1SQXE 2QMWA 3FBFA 4AT1B 3PJ9A 4LSLB 4U7UD 1RZMA 3QH9A 1IK9A 3EJMA 2V34A 2EKNA 5KAFE 5D77A 1XR5A 4KT0C 4F4ZA 3MHVA 1RDRA 3HKZD 3H59A 1EDKA 5DS7A 1N8RT 3CC7S 1SFCC 2D3OR 4DV5F 3RBEA 3TO8A 4J9UE 2EK1A 3CCEP 1IR1A 2CNKB 1KB9E 5A8WB 3J81j 4J9VA 3QJLA 3TSIA 1FBMA 4H4OB 1IN0A 3JC22 2KS1B 4ECWA 3C14B 5F8NA 1CPZA 1Z1ZA 2XMMA 2LXBA 2HGLA 1BXNA 1FZFA 4NXMJ 4LF8F 4ASWA 4N77A 2KZMA 3J80Y 1Q90D 1DTQA 3IRXB 2A45I 3TZYA 4J5OA 2P2UA 2WVBA 2HSEB 4QIFA 2G0JA 5ETSA 2JVRA 2YWFA 5B09A 1S48A 5EHHA 1IWGA 3HD7B 4DL3A 2FLPA 2DPJA 1TL3A 1J27A 3RYLA 3G9CA 3HO1A 5E3QA 4A8MP 2WT7B 3TEGA 2ZJSE 1IR2A 2DIVA 1NEEA 1S0NA 2AJQA 1XIQA 2XY6A 3BVHA 4H4KA 5ETNA 2HYNA 2CQBA 3TUZC 4DDFA 4P72A 1T05A 3LP2B 5FLXY 3ZTQA 4YHHF 3AEAC 2MKVA 2KUBA 4HH2A 2WK4A 3CJ2A 3OL6A 5IZHA 1RT5A 1W25A 2BE7D 1RWMB 2ZRIA 4OI3A 4B3RJ 2YKAA 1OY8A 1RTHB 1N33F 3MUDC 1T94A 2C9LY 1F3VA 4M5DB 2M5YA 3HP6A 3H5UA 3Q89A 1ZH5A 1WOPA 4JOUA 4JYAF 4B9NA 1YK9A 2PO4A 2ZYDA 2Y0BB 4H4MB 1UJ4A 5LXYA 1OIPA 2YQ1A 5CA5A 4EFAC 2LQ5A 2XLJA 2VA3A 2N82B 3VCDA 1NO8A 2DGUA 4XIUA 4I7FB 5DGBA 3A0HE 4WKYA 3R6GB 4WPAA 2K7JA 5DDQC 2Y9YA 3N9UC 4DV4J 5B0EA 3PCOB 1RHJB 4DSFA 2IC3A 5IT9Y 1X22A 5IV3A 3IS9B 2OJ3A 4JV2A 2OFOA 3PEJA 2FKWB 1JO5A 3CNQP 3J7Z5 3PR4A 3C15B 4DR6F 5BU8B 2E43A 2WOMB 3RL0g 2NS1B 4N56A 1VQ5S 3MTKA 1G2CA 1NKBA 1KN6A 1C0UA 3I5CA 4O3NA 2G4BA 3BASA 2HQIA 4WK1A 2A3JA 2ASJA 2VU5A 3W8GA 1M5OC 4DX5A 2KNCA 3VQTA 1GMVA 2KRRA 3R9LA 2H48B 4RLEA 4FS2A 4LFBJ 1WT6A 2J76E 2M52A 3TZXA 2ZT9C 1V5IB 2NREA 3DNCA 1IKWA 2NSBA 1VMBA 3R5JB 2YXLA 3GB0A 1IBCB 3K59A 2XGPA 2FHJD 4HEA9 2HZCA 4X65J 2C2EA 4PZVA 4Y28J 4M5LA 4LIWA 1JXLA 3TYYA 1FFGB 5K8NA 2JDIH 3MEDA 1U2FA 5KKZB 5HQMA 4PXDA 4LFCF 2OYIC 5DRKA 2XMWA 4JI8F 4TKTA 4UB6H 4MH8A 1IJEB 3L70J 1YX2A 3CJ4A 1EB0A 3GQCA 2ZOMA 4O23A 1HL6A 4X4SA 1LTSC 4ED1A 4B3TJ 5D3GA 1QGKB 1YQHA 3V2PA 3ELHA 1BCCJ 1Q8BA 2ZOGA 3SFGA 2JEFA 1I94J 1FZCB 3DKDA 1LOUA 3VMXA 1S99A 2ZE2B 2YX1A 1WF1A 4G1QA 2H3EB 2ZZNA 2M8HA 2QJKC 2BCCJ 5DJUB 1BWVA 2H1YA 4RUHA 5U47A 2XLKA 1QDUB 2C3YA 3PRDA 1UJ5A 4M5NA 2KHDA 2C2DA 3PKYA 3AE8C 4UW2A 3EWKA 2LU2A 3L7UA 1NTME 1DRZA 3M32B 1RQVA 1C2PA 4DFKA 4HHJA 3NY0A 2C0XA 1TL3B 3BJYA 2XSJB 1NB7A 5KFLA 1RI7A 4F0MA 1VQ5P 3TP2A 2R2RA 4WKRA 5J2QB 1LTJB 2V67A 3VAMA 1VBXA 4M5HA 1FF2A 2GO9A 2XDJA 3TJ9A 1C1BB 1MU2B 2V2VA 2XU6A 1UBEA 3NGUA 4ZVFA 1RF0C 3PW4A 3V6DA 1VQNP 5E33A 3G9RA 2PAJA 3ETOA 3V6JA 4PG5A 4IL6H 1U2RA 4ED7A 5H1SV 2W6AA 1HBOB 4AXJA 1NHKL 4HHHA 1KZUB 2D74B 4RW8A 1C0TB 3KYQA 1UVJA 2ZRDA 2YNIA 3RK3C 4BC7A 3NS6A 1NK9A 1NTMD 4EI2A 3L73J 3Q8UA 4O4RA 4ZVUB 2ERRA 1EHWA 2EVZA 4LFAF 2DRDA 2P9EA 1T9UA 4KSEB 5E5NA 5HVGA 2P67A 1OWXA 4RW8B 4FNHA 2DEJA 1TL1A 4ECXA 1S4EA 3CC4P 5KLVJ 2XMAA 2BCCE 2DISA 2XC9A 2J7WA 3KUEA 2NUHA 1JEKA 3B82A 2BKPA 2OPRA 5KG5A 2E5HA 3FMWA 5CYMA 1NAFA 2P9CA 2Z56B 2YO2A 2B56A 3BCCD 2KM8C 2GNKA 2OYHC 4U95A 4GKKF 4PG8A 2HHQA 1MMLA 4NYPA 5KLVK 5T7LA 1FVQA 2HAIA 3DOKB 1BHNA 5E0OA 2YVSA 3CL3D 2WSFH 4DJBA 3MWBA 3X1LB 1DH3A 2F1FA 3G87A 3K7RA 4XPEA 1NKEA 5J2QA 3LA0A 1LJ2A 3IA0A 2BQ3A 2NXUA 1NDCA 1H3DA 1YVFA 2R4FA 2MDAA 3MR2A 3ISZA 1FT8A 2QL5B 2E5LF 4B9SA 1NZAA 1FKPB 4BWNA 5H2FH 5KG1A 3CJ3A 3V6KA 2VG7A 2BANA 1LW0A 4WY4C 1MMNA 4PABA 1UIIA 2Q6BA 2YKNB 1P9YA 4J9SA 5AW8B 3JSYA 3WU2E 2WCXA 3A3NB 4MKVA 2KXNB 5HK4A 5B08A 1H0TB 3L75E 3CCQP 3V4MA 4BRYB 4OQFA 1YBTA 3B8EB 2RQCA 2NPFA 4EBEA 3T41A 3RGUA 5APSA 3LPYA 1QLED 3MMCB 3JAMY 4PTLA 1KYOH 5IWAF 2HVEA 2D2CC 5D4NA 1N36F 1SFCA 2FXPA 3BBFA 2IVMA 3U1CA 4TY8A 2QJYC 2IDBA 4H44D 3PV8A 4KJIA 3DLGA 1S9KD 2B6AB 1S9GB 5KFYA 3ILOA 2IA6A 1JIHA 3B54A 2B9YA 5EWEA 1T02A 3CUNA 4I2LC 1FJGF 1FCAA 4C0OC 5AXMA 5KLVE 1X4FA 1SJQA 1CEZA 3MPDA 2RMZA 1OO0B 4KHXA 1Y5LB 2ALYB 5JMNA 3ZFVA 3H42A 2GGPB 1PKUA 1S12A 4OZNA 2O3JA 1CJUB 3H2UB 4UB8E 3DLKB 3BO3A 2A0FB 3D67A 4EYIB 2CPXA 3KLHB 4DLEA 3D68A 3SXLA 4GC6A 4ED0A 1CJKA 3C6UB 2KT3A 4ELTA 5K20B 2ZJQQ 3V2NA 3GWCA 4FF3A 4J37A 4OV1A 3UD5A 1H73A 3CD0A 4G65A 4ZP9A 3H1JG 1MFZA 2QLBB 2WPQA 1U47A 5DGAA 2XNRA 1WC3A 3TNVA 1RT5B 1DHMA 3SCLE 4KC5A 5AE1A 1KEKA 3PJXA 1M5KC 4QYZJ 2UP1A 2I5JA 1NM2A 2C2NA 4OJ1A 5ETRA 3KNAA 1NDPA 4M5DA 1GX5A 2DGSA 5IT0A 3WZ0A 5KTQA 3HFVA 1VC6A 1QX8A 2C0WA 2CQCA 3FKBA 4X2BA 4X4RA 5FDLB 4UOGA 1WHVA 1RY3A 3DU6A 3HM9A 5CCHA 2IYPA 2A2CA 4AE5A 1NKCA 3MEGA 2EG2A 3SCJE 1RAJA 4F4WA 2VZ9A 4ECSA 4OGQB 4PPFA 3PTZA 3O3LA 3CPWR 5APYA 1AB8A 2RKIA 2R8GA 1S97A 2HZAA 1MROB 2EFPA 3CI9A 4CI0B 4DL0C 2EFQA 2CQ1A 3F0NA 4NPFX 1WSRA 4DN9A 1U0SA 2OEMA 4CH0S 2LQBA 2OTLP 1CJVB 4LF2A 2PFFB 3AEBC 2KB7P 1HGZA 2L3MA 1U1LA 3BH7B 3GW6A 2WZ7A 2G8YA 1NPRA 1TKTA 2E44A 4LF7F 1PYSB 3PX0A 4WFZA 4NWBA 3X3UA 5A76A 1BE3E 1R3NA 4FF2A 1RKJA 3R3TA 5K5GB 3SSRA 2GUVA 4ZDNA 2Y9HA 2RH3A 1GL2A 2VASA 1IKXB 3VGUA 3A12A 2G1DA 2V6AA 4ED6A 1NAQA 5C24B 2IPOB 2PGDA 2KG1A 3L09A 2FYUD 2V4JB 5GTIE 2DGTA 2HLUA 1N33J 1S6QA 1FKPA 2VBZA 2RD5C 2N3LA 1N7SD 2FHKA 3PHTA 1HW9A 1FZAA 3M6UA 4DFJA 1YJ7A 4FYWB 3IGNA 5JUMA 3ZZUA 1D0EA 1DJ0A 2KP8A 3MGNA 2MQNA 1Z56A 3LW5J 3OFGA 3CD7A 4JI0J 5L39A 1BE3D 2ACMA 1DLOB 5L8RC 3TR5A 2QRXA 1JLEB 3D71A 3M06A 5KKZC 3WDOA 3H1IJ 2V8DA 1FZCA 2XCPA 1KNZA 4OX9F 4RW6A 1RU1A 2V4QA 1RQ0A 4USVA 1L0LE 1UEKA 1NJIT 1MKMA 1LFWA 2E7WA 4NZ7A 1DTQB 3SWYA 2ZDPA 3CJ0A 4PUOB 4CTAA 1S10A 4IRKA 4OYZA 3GYGA 4J90A 1YHQS 4TLQA 1UWBA 4ZHRB 5FD1A 3R1LA 4C7RA 3USSA 1GMWD 3CDBA 1NTKJ 3B78A 4ZPVR 2REBA 2B87B 4EYHB 4CLUA 3IAS9 4OX8A 4OZ5A 4X4TA 3OTCA 4DV7F 2WTFA 2PI4A 3BGUA 2ZJPQ 1FJGJ 4PCQA 2L41A 1SJ1A 1HHTP 3RJMB 2JRSA 5DJTB 3I9ZA 5IQQA 3C2PA 4LQ3A 5J2PA 2HNDB 4IOCQ 2QGFB 3QRPA 2ZVOB 3ITKA 3TNUB 4LF6F 5AVVB 1N73B 5ADZA 2RHSB 3LP0A 1UFLA 2MLYA 2HNYB 1NKZB 3DHWC 3BN7A 2KZIA 3RU0A 2RMLA 2JRBA 1KLMA 3RK3D 3M30A 2J5UA 3TNUA 2RE1A 3H32B 4ETZA 4URGA 1NB2A 1Q5YA 3W2WB 3H7HB 1G1XA 1Z2LA 4NE9C 2UV8A 2E76C 4PPZA 2PE8A 5H9FK 4DV2F 1YIJP 3UNGC 1UWBB 3QRRA 2XMJA 1VQKS 1TTHB 4Q44A 1FI4A 3JB9k 2W8KA 3DDKA 1Z2ZA 3HI9A 2WONA 3CMEP 3NBPA 1FRLA 4BC9A 2GMHA 3UN3A 2FXMA 4WIIA 1S9FA 1VRQC 2MJUA 4CLSA 4KR0B 1GXLA 4LF8J 2NXEA 3QPIA 3JSMA 3OW2R 1FJ7A 5ETTA 2BXJA 5JXSA 4OZ3A 4FYDA 1TKDA 2ZBCA 4CM2A 4HT7A 4X66F 1FDOA 2WVCA 3N6NA 4NLSA 3CIZA 1WG5A 3AQPA 2BJ9A 1FU1A 2R8JA 4AL5A 5DDOC 1HWIA 4HH1A 1BGYE 3A8KA 2HBRB 3VAIA 1CBKA 4GT1A 1B0VA 1LEOA 5AW6B 3OFHA 2VBWA 4KHRA 3D66A 1T3NA 3CCLS 1QUVA 3CCSP 3POTB 2ZAEB 4OGQD 3BSCA 1RTHA 3OW2O 1SC3B 3T6BA 1NU1K 4EK2A 1OY6A 3DHXA 2HVDA 2AHOB 2R2TA 1NHVA 1IXKA 1AUSL 2B4PA 4CIOA 4WF9Q 1RTZA 4LJMA 1JTHB 4IG3B 1T2KD 2YXQB 3PVXA 2QSIA 1ZMEC 3HPOA 3RG6A 5KFFA 5L1IA 4FYVB 1Q7LB 3L71E 3M8YA 3PJWA 3IP0A 1JJHA 3PH0A 2FJWA 2YWWA 3CMQA 1FXRA 2ZM6J 1SUQA 1JNZB 5D3GB 3TOQA 4RW4A 4KT0J 2WB4A 3EZOA 2VPWB 2JFDA 3OT9A 2WSSH 5E3PA 1D9FA 1FD2A 3JS9A 1NXIA 3I96A 1RTDA 1M5VC 1AZSA 2CG8A 2EI5A 4PPNA 3HK2A 4ZLNA 3V6HA 1ACMB 3NS5A 3OTOJ 1EAYC 3DOMA 1JKHB 3NBPB 4FS1A 3HZGA 4NPEA 2ZD1A 1XBWA 3Q1MA 1SS1A 1KS2A 3QT8A 3U27A 5DG8A 2HFOA 1KRPA 3CCUS 1U8WA 3WU2H 3T97B 2R7SA 2H9ZA 4EEYA 3ENWA 2COLA 1QAJA 2V8HA 3K5MA 2ZBQA 1D7MA 1RTIA 3H1LG 3JSBA 5DM7Q 4HTJA 4MN4C 4ENOA 1AROP 2XO7A 1IKVB 1U7JA 2CPSA 2HS0A 1BQNA 2UXBF 5HL7Q 2C3PA 3D54A 3DYAB 2DGXA 4B3MF 3NFQA 2BQUA 1X9SA 1M57D 2NXJA 3AQOA 3KLIB 3UR3C 3DM2A 4LRCA 4CM0A 4KHPF 1UA0A 2KJWA 1F2GA 4JI1J 3P8BB 5AW3B 4RNOA 2Y0DA 5EUHA 2DKOB 4PD4D 2IZ1A 4RBTA 5LMUJ 4ZCIA 4N5SA 1LT1A 4IL6X 3MOJB 3VYIA 2QG9B 3LAMA 2W2OP 4ZVHA 3L75G 2CZ9A 1VQOS 3MR3A 2YKMB 4RZRA 2LKMA 2HS3A 2RUGA 3MCNA 1M8OB 4ILRA 4A46A 2HZVA 2KTQA 4K4VA 2ZUAA 2GUSA 4DV1J 2HHXA 4WE1A 1NGMB 3BRTB 1HD0A 3HJFA 3DCAA 4YHHJ 2GIQA 2GC8A 1UW4A 3ZZ0A 3R4YA 4LQ9A 2WSEJ 5IWAJ 4ZIVA 2E74B 4GOEA 3E2EA 2A45G 3FEXB 4HKZH 4RR5A 1S3JA 2MKHA 5K9FA 1SJ3P 3P32A 2K88A 4NRUA 1OIAA 2NPIA 4YR0A 2ZR9A 1OWAA 4WP3A 5AW9B 1TL5A 2DVIA 4DG1A 2EBGA 2LKZA 3MR5A 5E79E 4OJHA 4A8OA 3LF0A 2HIYA 3AHPA 1N7SB 1SKUB 1HKAA 5HANA 4PD4H 1NKNA 3KJVB 5H2FE 1D8YA 1I6JA 1VQPP 3HZEA 1QEXA 1BCCG 1IQZA 1RTJB 3AJDA 4I2PB 4XK8C 2Z58B 2FZCB 4WK3A 5E7OB 4KIAA 2XY7A 1JK9B 4LF4F 1SH0A 1SIZA 4C7QA 4W90B 2VHGA 1XP8A 3A8IA 4O3OA 3FC9A 3UN2A 2DRAA 2WTYA 2HFUA 2GIRA 2UUWA 3CX5H 3Q86A 3NGDA 1GZLA 2IRUA 3EMTA 2UU9F 1QLNA 4HB1A 4GOFA 3M9OB 3MM5B 1KC8Q 1OW6A 3MMAA 4LF9J 3CXCR 4Y99B 4I2QB 2XS2A 1R8HA 4QPTA 1IFNA 1RWNB 3R5AA 3II6A 1N32J 1NDKA 4ZVEA 1IM6A 3GIIA 2IM2A 3DGPA 4HLBA 4O0IA 1S9EB 1FJKA 3H40A 1CW5A 1SH2A 5HO4A 3BQ2A 2B9BA 4RO0A 4OHWA 2L08A 3KMQA 1H7XA 2HPCA 3H98A 3M4XA 3MTJA 3KFWX 4EUVA 1MWYA 3ENQA 1VQ7P 3PZPA 1N6QA 1VQKP 3J7YI 1URRA 2M3DA 1FOSF 1LTJC 1YJRA 2N9BA 5HMYA 5CMZA 3JCUE 4B3SJ 1QSSA 2AYGA 4IRCA 3OR2B 5C2GA 3GFXA 4TQSA 3GHGC 3QJPA 2MKCA 2CWKA 2VF3A 1UJ6A 5KFIA 1HQEB 4DPOA 1PO6A 2G3AA 5CD4H 2XYHB 2J6TA 3R7SB 4CZCA 4YR2A 2BJ3A 1ZW0A 3VOPA 2I5JB 4NZ0A 2MHEA 4PSVA 2XBPA 5B0GA 1J2JB 3ITHB 3G8QA 1XWLA 3TUIC 1R8EA 1S6PB 3N01A 4NLRA 2UVWA 3BBCA 4PPQA 3GCXP 3FFIA 3LP1A 3AXKA 5IXUA 1RUSA 5IM0B 1Y11A 2G2YA 2KZJA 1M56D 2HODA 1H88A 4ZJQA 2GHPA 3MM6A 3QJJA 2KN4A 2ZH5A 4DFMA 4MT1A 1ZBTA 1X4EA 2AEMA 2JWDA 1IFPA 4N76A 2APOA 5B66E 3HJVA 2LA4A 5I4MA 4R5PA 5CQGA 5DDPC 4DQPA 1CC8A 4ED5A 2B5JB 1U7LA 2B7BB 2WONB 3I9V9 4CH1A 1KC8T 2DXDA 1L0LG 3N5FA 2C3MA 3OLBA 1O51A 6FDRA 1O0PA 4Z7CA 4A4JA 1S1WA 2HQ3A 4GKJJ 2IY5B 2OYHA 2LEPA 5I42A 1NTKD 1FWPA 2KSJA 4P71A 2J8SA 5CXTA 1MG7A 5K14B 2HMIA 2B5JA 2QJ3A 5KFSA 3AH6A 3BO4A 2ZYGA 5HN0A 2OFHX 3FSIA 2JEIA 1J5OB 1T2KC 4P73A 4FNIA 3QWOC 4YB5A 3GFYA 4MAKA 3V81B 1LT9A 1S72P 5L38A 3W5XA 1F9HA 4QR0A 3S8SA 3KLGA 3CCWA 1RT7B 5AVSB 4K0KJ 1SP4A 3TUJC 3CSKA 1N5QA 4XPCA 4I7ZC 3D6HB 2OI2A 1Y4ZB 2K7KA 3FZBA 2BACA 1FDAA 3CC4S 1SBRA 4DPTA 4KGXB 2HLOA 1Q86T 5GMDA 1RT4A 2M5AB 2F5GA 1VBKA 2YNGA 2K2PA 3AB4B 5HBMA 2E5GA 4FXVA 1VS3A 4C4WA 3CXHH 4F3OA 4CO0A 3IFEA 1QJHA 2HLTA 1MZ9A 4KY3A 4HJGH 1SJFA 1N5YB 2CQPA 1HPZA 4S0MA 2DHXA 2UUCF 3IAM9 4G1PA 1CS4A 4KGMA 4DUYJ 5F9LA 2YNFA 1QAYA 3CCVS 5M2PA 5B0CA 3GR0A 4IQXA 3Q24A 4X4VA 1JCDA 2AQ4A 1N2DC 4PD4I 2FVRA 2QT7A 3QZ8A 3DM2B 2YPYA 1RWUA 4P74A 1CS4B 1BY9A 1EKRA 1D3WA 2G0IA 1J5EF 1W2IA 4OX9J 2DHSA 2XTJP 1RISA 2QG4A 4JPZB 3SBMA 2HFNA 1NRKA 1LNQA 3CWBD 3C16B 2CK3H 5LL6d 2KS1A 1F2HA 3PRJA 4PV1B 1O6XA 5KG6A 1JUNA 4G3IA 3NCPA 1WTBA 1RABB 3KUHA 2CAJA 2QSFA 3CVKA 1IVZA 4P9SA 2E66A 5KT3A 3AD9C 2DNMA 1JY2N 3B4MA 1HHSA 3M8PB 3K58A 3TGUJ 4U9RA 4H4KC 4KQZA 2K37A 1RHKB 1Q79A 5LMNF 5C7PA 2NXCA 2DO4A 3HXMA 4CLTA 3PHEA 4HDGA 4FXDA 2P10A 2F4FA 3POTA 2J9DA 3ABVC 4OHZA 3Q2YA 4DG1B 1HQUB 2U2FA 2FJBB 1Q1KA 1W5CE 4I7ZB 3AE7C 1I51B 2IBKA 2XZDB 1HNWJ 3P8MC 1L3TA 4WBFA 1LWUC 2GVZB 4UQGA 3OXLA 2ZVNB 2HG5D 3HE4B 5ETMA 3ENVA 1FK9B 3M8QA 1SUQB 4TN2A 2UXBJ 2HRYA 3KHUA 1XMQJ 3CJQA 2WPVB 4IR1A 1RWWB 2ZEJA 2DT9A 2HG4A 2ZITA 3L7OA 3H1LJ 2M3EA 3GJSB 2X1FA 4JQ0D 4LF4J 1U7MA 3M2UA 3TYTA 2VV5A 2E5IA 1SFCB 2GHVC 1VL2A 2JEJA 1KN7A 1PPJD 1KB9H 1LWFB 4IFDK 2XWYA 3FQLA 3AE1C 1LGHB 3S1KA 1F1BB 3ZXWA 4I68A 3T9ZA 4K59A 3IWLA 3CCRS 1FC2C 3F41A 4UUWA 2ZR0A 5IT4A 1PAEX 1LFPA 1CJUA 1GK6A 3FSYA 4UOHA 1U1KA 3FBCA 1IBMJ 1HQEA 5HMWA 3MEEA 4NLTA 3VP8A 4QWAA 1SFCD 1RGVA 2F9JA 1S0MA 1V3ZA 5KFCA 1HNIA 5HJYA 3BGRA 3W5ZA 4IOBA 2ZC3A 1Q53A 4MYTA 3TANA 2CKWA 1EDIA 3CULA 3RK3E 2POKA 4LR7A 3MEKA 2W27A 2OTJS 4NLDA 1RH5B 5DJBA 5L1LA 4HH0A 4NLOA 3C46A 5LMNJ 3JTNA 3H1KG 2FYZA 3A13A 1GX6A 3BGOP 4RUCA 1O5JA 4F04B 3GF7A 1HNWF 1D9AA 5F8IA 3FBBA 1GK4A 1S2EA 3FX0A 1TFWA 2G88A 2DYAA 1FZCC 1VIOA 4XA4A 1BD6A 1GMWA 3SSSA 4NMLA 2O66A 4MIWA 2C2RA 2I1KA 2E7XA 1YRUA 5H9EK 3D6FB 1G18A 3HD1A 5CZXA 4Q8EA 1B7YB 4LSZB 3B8HA 4L76A 3HF5A 5GAGU 1BSNA 2A6MA 1TV6A 1SQQG 1LWCA 2LLZA 4Y2MA 2VQFF 1TR0A 4NA1A 3RAMA 5CH7B 4PWUA 3SDEA 4DV3F 1TP7A 5FIIA 3N6LA 2QL9B 1N5VA 3C66A 2QYCA 1S4FA 3CMES 3H2VE 2IBZI 4PV1C 4DR1F 3GJRB 1BDCA 1X5TA 3KK1B 1EC5A 1X4GA 1RAFB 3V4WA 2ZH4A 2VRSA 4TQRA 4BBYA 4F36A 3CO9A 1XMQF 1VQ6S 4ECQA 2BM1A 4WWSA 4RESB 4DN0A 4MIBA 2VBYA 4AUKA 2Q7CA 2BCCD 2F63A 2OEJA 4TU7A 1UPMB 2ZH2A 5KT2A 1CSBA 4NCGB 5APXA 4XE5B 5C24A 1MUUA 2CPZA 2N3OA 2OEKA 2E75C 5J1EB 4JI4J 2ZH7A 1WNEA 2Q6CA 2XMKA 5EX3A 1KILB 1QSYA 4DV6J 3FXEA 1WKKA 2I38A 1FA0A 1N5TA 4ZMMA 4DT0A 1TL7A 5E3RA 3V2UC 3C15A 4B86A 1RTDB 2X1BA 1U1MA 1SL1A 2WQYC 3CWJA 4ZPTR 3EM1A 1TAUA 2QA4G 4L74A 3NAHA 2M8DB 1HBUB 1WDTA 2V9WA 5TISH 3KYLA 1GTEA 5DLFA 4G6VB 3PKMA 3CO0P 4RJVA 5HP1B 3AJ1A 5ETKA 1SQBJ 4WIQA 1JQGA 3HE5A 1NPKA 3KLEA 4RX6A 2GA7A 4DR2J 2RIJA 4K5RA 1A02F 1RAGB 3L74G 1PC5A 3RBDA 2WPSA 2I1JA 2OPPA 3UD4P 1KLNA 4RNHA 1QY7A 2B4UA 3MCOA 2DNHA 2BJ7A 2E29A 4DR4J 1VC0A 4AFFA 2RS2A 3R97A 2GJFA 5DLGA 3PW0A 1UWAA 4IL6E 1N48A 4FXWA 3IRWP 4D6TJ 1E6YA 2MMYA 3LUYA 3J81Y 1RYSA 1C1BA 5MLCV 1RYRA 4FKXA 2AT1B 3M1VB 1ZR2A 4NPDA 1F9EB 2UUTA 2VG7B 2A6OA 4YP3A 4XFJA 2BW7A 2F8MA 4QJVA 3BQ1A 1S7HA 3QQCD 3T1HJ 4WFNQ 3F89A 4C7NA 1K47A 4ASVA 1UFKA 1J1EB 2B88A 3DRRA 4PG4A 3MD3A 1Y7PA 4P7VA 4Z2XA 2QJPB 1XQIA 1L3KA 2AKWB 2QL7B 2ZOFA 1SH3A 3L72D 4K4XA 2FYUJ 2WMMA 4DSJA 3HD2A 5DZ7A 3K5BA 1WEZA 2HBYB 1SQXJ 4DL6A 1SJRA 3MF5A 4K4ZA 2E42A 2VICA 1VQNS 1PP9J 1YTZI 3RRKA 1W2BR 1QVFR 4JV5J 1JLGA 5APVA 1Q4RA 2KI7B 3BO2A 2UZAA 4GIFA 2RN0A 2ITAA 5CCMA 4CTAB 1TUGB 2ZRBA 2BDPA 1X0TA 1JLFA 3LTOA 3E01B 1KYOE 1S0VA 3G8TA 3UDEA 1RF1B 5M1BA 4NA2A 1NTZD 4Y2CA 3QSYB 3M8ZA 2ATLA 3D0HE 3DRPB 2EEYA 3MHYA 3PIOQ 4F26A 5GAHI 1WC6A 2VFSA 2O01H 2BANB 1IFDA 1S1TB 3PM9A 2MSTA 1S1UA 1FDNA 4CNYA 1UETA 1HBNB 3VP9A 4R0JA 2HQGA 5I3QA 1M1HA 2A1BA 3O2IA 3H1LD 2XLIA 2IRYA 2WT7A 2HHWA 2DNNA 2RS8A 3DFEA 1PPJE 5CYJA 2JP3A 2XSFA 4YOEA 3M8WA 4Q2MA 2UUAJ 5J2NA 4OYOA 5KFTA 2WBMA 2JZ5A 1Y5IB 3QAUA 4MYUA 1AVOA 1C4CA 4EO6A 1Q5VA 5KJ7D 1NSKL 2MKYA 3VF0B 2XZWA 3HUSA 1QVGO 5A8KA 2OD6A 5I3PA 3CCRP 1H74A 1IJFB 4PR6A 2DR6A 3PDNA 1KVKA 2VFVA 1N7SC 1CLFA 1X60A 1LWUB 1MU2A 2ZM6F 3IBCB 2ALZA 3SWFA 9ATCB 4QR2A 3EDRB 2PIIA 4QYRA 1RAOA 2XQCA 3QIDA 1K1QA 1TL4A 3CD5A 3GFHA 4M8LA 1H7WA 5L9NA 3EDQB 2D3UA 2FVPA 1TKZA 2LP4A 3L74J 1VQLP 1DY3A 1IQTA 3OBIA 2W2MP 3AD8C 4NEZA 2HAFA 4MFBB 4PPDA 3EUNA 1UFWA 2DHAA 3MPWA 4QYZK 4KV8A 4E98A 3KDNA 5KT5A 5RUBA 1S5ZA 4K4WA 1RCOB 2MLZA 3SI8A 4A8WA 4EMDA 4OZ0A 1UEVA 4DF4A 2YNGB 4R25A 1JNRB 3TAPA 4K5SA 2J0SD 2RF2B 1FKOA 1KB9I 3TAMA 4DR7F 3V4QA 3Q5RA 2YO3A 3HD7C 1M1KQ 2YIUC 1HWLA 3ILLA 3V4IB 1WJ9A 2PC6A 5KJ7C 5L9XA 1R6YA 2AX1A 1EKSA 3DRPA 4I1LA 2DEIA 2BJDA 4ZA1A 3MUDA 2WW4A 2JX2A 1ULRA 3V2QA 1S1TA 2ZNYA 3CCJP 1RBOB 3KQGA 2CQHA 5GVQA 1JXEA 2FYNC 1PC4A 3LP2A 3NP5A 2LEAA 4C8OA 5ETPA 3GHGB 2GVDB 2CPYA 4O44B 1U2CA 4OH8B 1M90Q 1LWEB 2R5BA 2Y9ZA 2Y1JA 1KP6A 3NNHA 1ZPWX 1LWXA 2C42A 2M88A 2Q66A 2SPZA 1RHZB 3BKTA 3ZNUA 4OWFA 4CCHA 3N4XA 1OVRA 3KK3A 2OP5A 3T3FA 1UTAA 1UZHA 3M7VA 4H13B 2PMZD 3Q8PB 3QO9B 3C14A 2RAQA 3ZNJ1 4H0LC 3KUGA 3L35A 2OYIB 2P7JA 4FBUA 1FS0E 5KG7A 2A2DA 5G4DA 1FTCA 1X7VA 3RBZA 4GKGA 2X1AA 1K0TA 4NRTA 2DGQA 1CJKB 1ZPVA 2B89A 1WKJA 3B71A 3O8ZA 1XMSA 1SXLA 3NOCA 3SEOA 1EETB 2DY1A 2BYCA 4KTQA 2QA2A 5HJXA 3NMAA 4I4BA 2QEXP 4LT6A 5LSRA 2IBZG 2HHVA 4KJMA 3BN4A 1BLUA 3IBWA 3MEEB 1LTJA 2R3CA 1GDTA 3FJ2A 3S1TA 7FD1A 3EZUA 4FPIA 4FBTA 2CQ2A 4JI3F 2RHQB 1YHQP 1UZDA 5J2MA 3WC2A 3GLMA 2W6JH 2V8GA 4ID5A 5AVWB 1Q0NA 2HR3A 3A7OA 3UCZP 3M1VA 1YG0A 2AJ0A 4QWEA 1YKWA 3AEEC 1FVSA 1JMMA 3EFFK 2D1CA 2QIWA 2UU9J 2B3TB 3D3CJ 2FFDB 3IGVA 1BUXA 4ILLA 1TL1B 2VONA 2IX7C 2LFVA 1FKAF 2F65A 2DCLA 2ZH9A 2Z4PA 1ZS6A 4LRAA 1APSA 2CDQA 4B9MA 3CWBJ 2YNIB 2UUAF 2BR0A 4ELVA 2KK7A 2RRNA 1U02A 1LK7A 3CJTA 2FVSA 2WSCJ 4DX6A 1YJ9S 1U94A 4D3GA 5B0AA 1NTKE 4RKUJ 4MK9A 1X5SA 5L8RJ 4N6JA 2IC3B 1TUWA 4HHUA 1K8AQ 4C6AA 2EFGA 2V50A 4DWIA 2D9OA 4F3QA 2R7RA 1YZ6A 3KTQA 2NQPA 1R0AB 4FDFA 3TX0A 1RT1A 1IBLJ 3HVTB 3MFIA 4Y6IA 4BS2A 2MXYA 4DCKA 4J9PA 2ABYA 1C0UB 4FPRA 2NPSC 2HFED 4FVCA 1NK5A 1V9OA 4DMZA 1T11A 1EETA 2JDJA 3TVKA 3WIUA 2FJAB 3ZZOA 4WWIA 2KT5A 3GYXB 3MM8A 4ZVQB 3W3SA 3TGUE 4LSLA 5BR8J 2H5IB 2C2ZB 2H5EA 4K2JA 2DNZA 2BZ2A 2OEPA 3R8YA 3IR6B 2KVQE 4I2PA 3R5GA 4OYWA 4USJC 2NSCA 2IHR1 4IOAQ 2I8DA 5B5EE 2E1MC 1PGOA 3FUYA 3QT7A 2FHJA 1MO4A 1XNQF 1BGXT 4DUZJ 2G9OA 3M0DA 4OVNF 3M0AA 3EGNA 4WZQA 1GU5A 1BSHA 4DCOB 3S9OA 4KPCA 1XK8A 2E1PA 4QOTA 5FDLA 2V5HG 3IR5B 2IBOA 4GMKA 1JWWA 2ZJRQ 3NEKA 4MK7A 4RW9A 4JI7F 1H38A 2RT3A 5CCGC 1PGPA 3LIEA 4U8YA 2CQGA 3IAOA 4K2XA 1LWCB 1R0BG 3IM9A 4IR9A 2NCKL 1T3JA 2V4RA 3OL8A 3DLLQ 2Y0EA 2HWHA 1AFIA 4OLPA 4DSLA 1AZSB 1I3OB 3I56S 4CO2A 4RL1A 2O5DA 1AUDA 4WU3A 1SQVK 5HQ8A 5KFVA 1FZGA 1M1GA 4CO1A 3CCMS 3L70E 3RRHA 1H0HB 3GZ7A 1JMTA 2VJUA 1U98A 4HI2A 2OSQA 5L1KA 1SQEA 2DCUB 1HNXJ 3RW6A 2OMOA 3E8OA 2I6WA 1DD4A 4JI6J 2QFJA 4HACA 4C46A 3D2WA 2R5DA 3D6ZA 5KOXA 4N41A 3VZIA 2K3RA 2J7UA 1TK0A 2BASA 2E1AA 3QFHA 2IBZD 1H6KX 3OJUA 3BDEA 2V7QH 4B3TF 3WMM0 1X4CA 3BREA 4ZVGA 1CZQA 4PG7A 3KLFA 2DR5A 2ZDOA 4ZN1A 3LQVA 2H88C 3K89A 5CYQB 4ED2A 1LWUA 2HWIA 1C0TA 2OGUA 1RWXB 2ZZTA 3BF4A 1RJJA 2F7VA 4C97A 2I2YA 2H4YB 2ZNZA 3KLFB 1HJBA 1FO1A 4GVBB 3MIWA 4DV7J 5J1PA 1YQ3C 3AD7C 1CI6B 2ZYAA 5KFNA 3CJRA 2HK2A 2DHHA 3OSPA 1F0XA 3SFUA 1KHWA 4P52A 3F44A 1XERA 3P8CD 5ETLA 2JO1A 1GL2C 2MJNA 2WVRA 2VOPA 3FBEA 3N28A 4MFBA 2XGQA 3MOZA 2J58A 1P1TA 4C11B 3UNYA 5KFDA 4OX7A 3OFFA 4ZJOA 1Q7YQ 4RW9B 1Y10A 3BS9A 4J9QA 4HDHA 2WSCH 1RWVB 3IXQA 1ZN5A 2K06A 4AYCA 5CHXA 1USDA 1VRTB 1DFDA 1BC6A 1WC0A 1E6VA 4Y2IA 3AAWB 1NBEB 3HR8A 3SZ2A 1FZEA 5BU5A 4DQSA 2BA9A 3C19A 2CPFA 3FCWA 4HTIA 1YITP 4F7VA 5A0YA 2B8PA 2QC3A 4U7JA 3PG9A 5IQ6A 3C3LA 4LF5F 3IG1A 2OE2A 2RB7A 3Q8YA 1SL0A 4AQYF 3QMQA 4K4TA 1UVMA 5JJBA 2MB0B 1FRKA 4M94A 3OTEA 4P6QA 5CCHC 2JOQA 4PPGA 4LREA 4NPOA 5DG9A 5JVGQ 1AQTA 1T03A 2GJ2A 3NMRA 2N9YB 1CJTB 2V94A 4TWZA 3HRNA 5HLFA 2FLLA 1S79A 4C8YA 3CDWA 2H89C 3M8QB 5CCLA 1YBKA 4UZCA 1FOSE 1RF1C 1FE0A 3MAHA 5LSOA 1P27B 5AW5B 3H4DA 1HH0A 4KFBA 2Z2YB 3KDPB 1S6UA 3OR1A 2XB2D 4ZPWR 1NTKK 4DSIA 5IC6B 3DLGB 2XG8A 2HVIA 3Q22A 3GF3A 1VOMA 2LDIA 2N1TB 3HDSA 2XCAA 1KOOA 3KXDA 1RBLA 1CI6A 2AXTH 4JV5F 6FD1A 1JCCA 4MTPA 5T7LB 4Z37A 3D1HA 1Q82Q 1QE1A 4DS5A 4Y2KA 1FFWB 1GMJA 3IG1B 2BRLA 1GW4A 2XWXA 5AXLA 2ZZMA 4B3MJ 3DYAA 1SQBG 2IJRA 3HHNB 4QQBA 2ZH3A 3G6YA 2J9CA 3NLCA 3C6TB 3L37A 1XN9A 2ZH6A 4C7NB 3T5LA 2E76B 2XNDH 3EPGA 1FD8A 1S76D 3CGIA 1UA1A 4TT3H 2FDNA 1RT2A 2GQCA 1ZYQA 1KFDA 5EFWB 1N73A 3RL0D 3ZZRA 1LXJA 3Q8QB 1KVIA 3VTPC 1IKVA 1FRMA 4YPCA 1BQNB 1BGYD 2ZH8A 4ICLA 1LKZA 3M30B 3AECC 2H5JB 5GMKa 1WELA 3R7NB 5HVFA 3QT6A 3UI3A 4ED3A 3A1YG 1L0NG 3DDNA 4TY8B 1UKUA 3D70A 4DV4F 4TNOA 3Q5PA 1S9KE 4CT8A 1EZZB 1GU4A 1M1JA 2KHCA 3I82A 2E74C 5EN1A 2H51B 3UDLA 1KD1Q 1NH4A 1PJ6A 4K8RA 3MM9A 2OUGA 4E0DA 4QMAA 1H72C 1SQPG 4OGQC 1U24A 3MZWB 5TISE 5A6PA 1ICEB 3OL9A 4H0LB 4DPXA 4NEYA 2UUBF 5CABA 2KSEA 3G6XA 1N86A 1ZLLA 2ZRFA 2FYUK 2W7OA 1M1JC 2HWTA 1FE4A 1OX3A 1RACB 3Q23A 2AMCB 1IKXA 2VUGA 3SQGB 1SQVG 3QSIA 5KTBA 2ZKTA 2IMOA 5GTHH 3P49B 3RK3B 2R7XA 3P96A 4UTGA 1VK3A 2ZHOA 2GAGC 3V5BA 3NNAA 4C3MA 1HNVA 4UB8H 2H54B 2ZRPA 2AP6A 5ITHA 4OZ1A 1P84E 1HMVB 3O1LA 1YWXA 4KH0B 1HQ2A 1Y5NB 4PWDA 3PACA 4I2QA 1N7LA 4FZVA 3O6QB 1W26A 3TZZA 4YTPC 4NYOA 1U57A 1JLBB 3OSNA 2YKQA 3GG2A 4CPGA 1EX8A 4Q0BA 4H0LD 2W9AA 2ZH1A 1FDDA 1MROA 4ZS6A 1SQVJ 5CJ4A 1JLBA 1XNRF 3KWMA 4NOHA 3JXOA 4ZKPA 3I4HX 1GXTA 1ZRTD 2BE9B 1Q8KA 3LAKA 4OHYA 3THPA 2YMKA 4ECVA 5DG7A 2ILZA 5T41A 5KFQA 3IN5A 1F9FA 3U1LA 3KLHA 3LANA 1TKTB 4M5JA 3M2VB 1A7GE 4P2XA 1VF5B 4WE1B 1VHFA 2WVFA 3IM8A 4TY9A 3PO4A 2XS5A 1U8SA 3S4RA 3LGNA 3V2RA 4EDFA 2PT0A 4O3SA 3A0HH 2I9SA 4FN5A 4KH1B 1HBMB 3SIPB 2ZBPA 3U1AA 5KFWA 3M2VA 1U09A 4PQYA 4PG6A 2WVEA 3Q2TC 3CDAA 4U8VA 3HMJG 2Q5UA 2HVZA 2ZRKA 4QWBA 3CCZA 1TVRA 3RAXA 3Q0AA 4P2FA 2KVIA 2K1RB 2IYOA 3P8CE 3W60A 1VLOA 2CPJA 4BCAA 3HCXA 2MZTA 1N7SA 1VQLS 2ZRHA 1VGYA 1L3UA 2DNPA 4DCPB 1T9WA 2HNYA 4I69A 4CO4A 2Q3EA 4JUZA 2QZ8A 5B0DA 1HARA 2YIUB 4C8ZA 1YGYA 4BWJA 3ETMA 1Q7YT 2LA6A 1L4AC 4P7TA 1TUVA 4M5MA 2R7QA 3H8YA 3L72E 3VQSA 1NTZJ 4J9NA 1KILD 1SVFA 3M05A 4NXNJ 1HHQA 4F2SA 1KQFB 3Q3DA 4LVOP 3T5JA 3OUYB 2Q1LA 2WHOA 3JTPA 2GGPA 1SB6A 4MMOA 4DL4A 3WUTA 3DMJB 3EXYA 4DX8H 3FWLA 2KFNA 3LOUA 2Z8QA 3IC1A 2HFSA 3K57A 4ZHRA 3HVTA 5EWGA 4UF4A 3RK2D 1JY3O 1X9VA 1OQ6A 1R6VA 2RDJA 4JYAJ 2GM4A 4EZ6A 2RJZA 1HWKA 5L1JA 3MAAA 5KG4A 4YB6A 1NO4A 1G3OA 2VG6A 3T1YF 4AD6A 1PG5B 3AB2B 3OXFA 3CDUA 4DL5A 2BABA 5J2PB 3H1JE 5AW0B 2N4DA 3OLAA 2IRXA 2RSQA 1KORA 3W1YC 4JV0A 3QWUA 2JVOA 3KJQB 2Z2ZA 1NJIQ 4CO3A 1HWTC 2XI3A 1TAQA 1HI1A 3JYTA 3M9HA 4F50A 2MKKA 1TKXB 4WU2A 1U1NA 3RRGA 4N47A 3P6YC 4IH7A 2E75D 1KOHA 3AEFC 4JYBA 1UBGA 3MCSA 4M1KA 1HGVA 2HBQB 1S6OA 3H0PA 2DD8S 3R5CA 5MAOA 1NU4A 3KLIA 1D09B 4X62F 3SMZA 2C2KB 3CX5E 3P5TL 3OR1B 3CCUP 2J0QD 2KT2A 2RILA 2BE2B 3LALA 4PJ0H 3L4BC 5KLVD 3MMBA 1PJ7A 1NNDA 3PRBA 1U6FA 3M8PA 4NLGA 4OV6A 1KR4A 1RA6A 2PMWA 5B66H 1DTTA 1GT8A 1JNMA 1HI8A 1QVGR 1YQ4C 2KFZA 3L3CA 2HHTA 3B5NB 1KBRA 2ZWPA 1QE1B 5LM7E 4WFXA 4I64A 2G0CA 2OH2A 5A8RA 2FVQA 3A8JA 3PX4A 2DNYA 3E1RA 3SDEB 3RK2C 2ASYA 3PW2A 1RF1A 3G6EP 2JEEA 3N5BA 1HD1A 4UOCA 2ADCA 3J7A1 1JJ4A 3B4DA 3DMJA 1GL2B 2R7TA 2DBBA 5C2CA 2AYBA 5EX0A 3QFWA 1XR7A 2YQ0A 3WX4A 3NOGA 3GIJA 4LVNP 2DW3A 1H2VZ 3TAMB 5APTA 1UPPA 1UVIA 1U6BA 4WXWA 2ZRLA 3WUVA 1G1JA 1VCTA 2X1GA 2CVEA 5C42A 4FYYB 3D0IE 4DPWA 1FRJA 2O1JA 3VTIA 4WY4D 1GEHA 4ZN3A 2ADBA 1HF9A 3K5LA 1TU0B 3G3ZA 3AOAA 1HR0F 4Q0BB 2KXFA 2O1PA 3H1HJ 4ZVSB 4JI2F 3K5OA 3MFHA 1XR6A 3VAKA 1WUUA 3S7RA 3G4SP 2QA4P 1IBKF 2JH3A 4QU6A 4H4OA 1K44A 1RHQB 4PQRA 2HFZA 3DOLB 2AZ1A 3MM5A 2W2PP 4F4YA 2YQ3A 3M2RA 2K9YA 3RR7A 1HBUA 4W7YA 5AVQB 1FXLA 1YJVA 4I1TA 1UVNA 4C8MA 1VR6A 3U02A 1M5PC 1RE3A 5G0RB 5KFRA 5I42B 2UVUA 1JLCB 3E51A 4IFFA 2IAJB 3FQKA 3HVWA 4ZOSA 2WW8A 1GTHA 2ZT9D 3A5TA 3LW5H 4PYAA 2QLXA 3JSVC 1LK5A 2VDIA 5AVUB 3ZZYA 2CIMA 3DXBA 2EPIA 4DLGA 2QJKB 1S1XA 4FP9A 4LRDA 2GQ2A 3BH6B 4IFMA 3F73A 1SQBE 1R31A 1N52B 1ZXGA 1YYCA 2V4HA 3RK2B 3QRQA 4O3RA 4UY8T 1HPZB 3PR5B 2BKNA 2FUG9 3ONQA 1TMMA 1JLAB 3ZZTA 2DHGA 1RE3C 2L48A 1NK6A 1VQ7S 2KYZA 2CNLB 2FLOA 2O1KA 5GTIH 1QUPA 4X4QA 3J7ZT 8ATCB 2OAUA 5J2MB 2ZKUA 4RNNA 1KTVA 3OFEA 1T03B 3KG0A 1KILA 4YEAA 4QW9A 2AXTE 2XO6A 5A6WA 4ILMA 1HQUA 2G13A 1T9TA 2K8GA 3M0DC 2IJFA 3N7NA 1AYEA 1TL7B 3W9IA 2RKIB 1LWEA 1OY9A 2HVHA 1WD6A 2HODB 1XTGB 3G86A 3AA8A 5F3ZA 3OAKA 1YI2S 2AYMA 4X64J 4F3MA 1VBYA 1NU1G 3CT9A 4O4GA 1D9DA 2NZ2A 5C25B 3L72G 4ZKAA 1CVJA 3H1JJ 2EXUA 4Y3CA 1XC9A 3TWZA 2AX0A 4H44B 5BXIA 3OJAB 5EWFA 3CJKB 3A0BH 4MKAA 4DPYA 2E5TA 2FYUE 4LRBA 1YLXA 2QMXA 2EFOA 1WWHA 2QM8A 4ZCKA 1C1CB 4GO7X 3FEYB 2WRMA 4ECYA 4YMEA 2RUSA 4LF9F 2LQJA 3UVJB 2A06E 2R44A 3SFDC 9RUBA 2BM0A 2RQ4A 1VYAA 5IC4B 2RU9A 4YQWA 5A2QU 1R8BA 5C5JA 3TDKA 4NLYA 2DGWA 4YB7A 4P10A 3KZIH 4N8OA 3W9HA 2ODWA 1VQ4P 2HYIB 2PA8D 3VAJA 2RH0A 2WPRA 1IO4A 3QGIA 4PO9A 3KJFB 3CWBG 2GS8A 2OTKE 2Q6QA 2F4VF 1FWKA 1BCCE 2KH9A 2R3SA 1RLCL 4TYBA 4K4SA 2MZJA 2WVDA 5AW1B 4PR0A 1LTIC 1AVYA 4NZ6A 3VV2B 2IYGA 2OTLS 4RNMA 1PYOB 4W4MA 3P45B 4B3SF 1EIYB 3I56P 3VAFA 1WKLA 3ET6B 5BJRA 4YUDA 1X31C 1RTJA 4JI7J 1YBUA 4GC7A 1DARA 2PEBA 3KG4A 5F8HA 1X4BA 4FF1A 2VJVA 4CP5A 2JHEA 3M2UB 2LMIA 2CJXB 2ZFHA 1SV5B 1NH7A 2FZKB 4QWCA 1QAXA 3JQMA 4DUZF 4AL6A 3ISNC 1WRGA 5AT1B 4C2MA 1PP9E 3WUUA 4ZPDA 3MMCA 4DI6A 1L4AA 1DURA 1PL5A 4WBAA 4ES3A 4K35A 4DQQA 1HR0J 5CCGD 2XYPB 2J0WA 3UCUP 2L9WA 4LR8A 1LP1A 2IJNA 3HD7A 2V69A 3E1IA 5I3UB 4OYAA 4X64F 3DGPB 3NKYA 4PSKA 4ITSA 1WG4A 2AXCA 4YXDC 1BE4A 1KYOD 4WFAQ 5SUHA 4DF8A 4LUBA 2HHPA 1KYOI 4QW8A 1T05B 4PWWA 1SKSA 3SSUA 2HNDA 5KFAA 3N6MA 5BVZA 4F0KA 2UXCF 5K8PA 3M32A 1RTIB 1H98A 1PP9D 3I0RB 5D0EA 3OA7A 2DR8A 2HHSA 1S59A 2W25A 2W24A 4CO5A 3C1LA 2FTRA 3BBBA 1X79B 3D1QA 2B87A 1KD1T 3OTDA 2IFMA 3VGVA 1L5UA 2VD3A 4PXEA 4JF7A 4USTA 1SQGA 2VL1A 2YNHA 5CBNA 1Q8LA 2EC0A 2D2CD 3EGWB 3FFIB 2W2NP 1PZQA 1ZA1B 4R5PB 1TELA 2BBEA 4PQFA 2B4VA 1WDDA 3T6JA 3PY8A 4E2FB 4ETXA 4XO0A 3W65A 3OVAA 2XKMA 1HYSB 1YBAA 4C3LA 4MJKA 3VR1A 3CD6P 2LDYA 4ZIWA 2RU3A 1B0TA 3GR1A 5THWA 1FEEA 1FNMA 1ZM9A 3R2DJ 1EP4B 2FBWC 3NTNA 4YY3J 2AJ4A 1YITS 1XMOJ 3G8SA 3U7JA 5D6GA 3BPSP 4OI4A 1PSDA 4MIAA 2EFVA 1WHWA 2R8IA 4ZP7A 1VQMP 3C16A 3VAHA 1R5LA 2NPSD 4RW7A 2JJ4D 3ILIA 1SC1B 2DNKA 1JJ2R 4ZP6A 3CJKA 2OPSA 1IBKJ 5HATA 3E3XA 1LTGC 3UDCA 2Y1LB 4DR5J 3MI7X 2BV3A 3RZAA 5KFBA 1NJXA 3MTUE 4IDKA 4LF5J 4OYPA 1P6TA 1GXUA 3FSXA 2B51A 2V2ZA 5H9EJ 3AOBA 4U67Q 2AWZA 2QM7A 2KI2A 3QLHA 4B3OA 4B9LA 1P1LA 2B4OA 4X66J 3LP1B 1AT1B 5GADI 2DK2A 4HKQA 4ZVPB 2B9XA 1IBLF 3M6XA 2BOAA 2EFNA 4KHMA 4RU9A 2DH9A 3BYRA 3NNCA 1KDNA 3O6QA 2VQFJ 2BEFA 2WSEC 1WI8A 3QIPB 2MKIA 3HSJA 3TJ8A 3WX8A 2OIHA 1RAIB 2JSXA 4ECTA 3OTOF 3GG1A 2KO1A 1K04A 2MKSA 2ZBRA 3RTVA 4PEOA 3A3OB 3NG8A 4KE5A 1OMSA 2ZFCA 3L71D 4IH5A 4RKUC 4L75A 4M3LA 2XNXA 3GP9A 1N73C 4GVLA 2CG4A 2Z5HA 1NTMG 3BYPA 4EWTA 1I1GA 3TW0A 2ZRGA 4PXBA 1KTMA 3TJAA 1IFMA 1AFOA 1HUCA 3R27A 1OVUA 1QAIA 2K1AA 3IN6A 4PRFA 4Q7AA 5K14A 7FDRA 1X0FA 2XHWA 3GE9A 2FXOA 3C8YA 5D4PA 2E5YA 2RRAA 4LF6J 2G1HA 2R7WA 2IBZE 4H54A 2FZGB 2NPSB 1MFTA 5AE2A 2FLNA 1RT7A 1FHTA 3TX8A 3OHAA 1YIJS 3T5HA 1U45A 3HD7D 2AJ2A 1QL2A 3CJ8A 3DDIA 1YI2P 4F2RA 1X4DA 3L95X 3QAEA 2UVRA 4OYBA 4N8NA 1N0UA 3U59A 1ZM3A 4LIRA 4GO5X 2VH7A 3ICLA 2MQQA 4F02A 4GODA 1BE3J 1NJWA 3GONA 1FZBA 5DQHA 3H1HG 1Q95G 1KFSA 4OJGA 1ZTTA 4W80A 2CJBA 3AT1B 4ZVOB 3KOAA 1WF2A 4K4UA 3EGZA 4OLOA 2YX4A 3DN9A 3PHLA 4P75A 4LLHA 2ROPA 3NS7B 4KRWA 3U1MA 3AE6C 1KLMB 1S77D 2DGVA 1LTAC 1G7CB 5HVHA 1NLKL 2ZR7A 2BUNA 1PYTA 2DGOA 2FFDC 2PEHA 1SQBD 4D6TG 1GAOA 1ELOA 1VIXA 1XJWB 3DLJA 4O3PA 4DV5J 5AXNA 4CLFA 3H1LE 3CC2S 2LXUA 4DR7J 4TLFA 3VALA 2KXPB 1RE4A 3HHLB 1J5EJ 1A9NB 2K9JB 4C0HA 1YDLA 2QVAA 3DOKA 1BE3G 2CPHA 3BB5A 1S4XA 2YMYA 1DEEG 3OR2A 1Y00A 3CCSS 1GMUA 3W68A 3UDVA 2ZWOA 5T14A 1YRTA 3WC0A 2MKJA 3KK1A 1JLFB 4Z1MH 4USKA 4OI6A 4RW7B 5KFUA 4PQUB 5F8JA 1D1UA 3KHGA 3HE5B 5B5EH 2OHDA 3FGVA 2BEZF 2DO0A 3A8EA 1SQPD 1N5SA 1HNIB 1KV4A 2DRBA 1NOHA 4ZVRB 1B4SA 4NA3A 1XTCC 4O9BA 3SQGA 1RB0A 1HTLC 4HR2A 1EQ7A 2ZBIA 3FCVA 3ZTRA 4ZLPA 4ES2A 3TF5A 5M2UA 4EOTA 1VK8A 4KO0A 3OQ2A 1VC5A 4PKDB 1VLYA 4KAIA 4LFCJ 4FYXB 2F9DA 3GCWP 2PA3A 1RT2B 4NX9A 3VN0A 3M9MB 1RP5A 2CNNB 3GLJA 2O01J 3UFCX 1DD3A 3AE5C 1FAVA 3MUVP 2FGOA 2K9JA 3IFMA 4ZK7M 5LSLA 2KM8B 1S9EA 3MM7B 3ZC4A 4C8KA 3V5RA 4HYTB 3EGVA 5D4OA 3PIPQ 3H1KD 4DV0F 5I3UA 3A4TA 1S5LH 3VMAA 4IFYB 4J9KA 1T9XA 1U26A 3CJSA 5TJHA 4LBHA 2NZCA 1GQEA 3JAMU 2CJQA 3PFOA 1OW7A 1DQ8A 2QRRA 3LWMA 1EQ0A 4Y00A 4R0EA 2HNZA 5KJ7A 4USUA 4KPYA 4C11A 1MSWD 1F5BA 2MYFA 3LH2S 4RUBA 1K9MQ 4GKKJ 2E1RA 4JI0F 4HI1A 2IM0A 4OYIA 5B0BA 1HNXF 2HQFA 1JY2O 1DIPA 1DAXA 2YWGA 1JY3N 2N4CA 1VQOP 2CJ9A 3HTKB 5KAKA 1ZETA 1ZAWA 3DRYA 4A8FA 2AW0A 2QTWA 5F41A 1QTNB 3UQSA 3M91A 2ZREA 3CD6S 4DL2A 5CAAA 2HHHJ 3J80U 1URQC 2G2ZA 1ZR4A 2YPZA 1LQ9A 1VPCA 1KSPA 1ZAVA 2AV5A 1Q82T 4F4XA 3CJ5A 2CQ3A 3H1KJ 4ZLJA 2CPBA 1VQYA 4ZCMA 2C9NY 3MDFA 1MN7A 2IDLA 1URNA 1FDMA 1WSVA 3QGGA 5F0WA 5D15A 4OMFG 2K3KA 2MLXA 3FDSA 4CLZA 3R1HA 4DCJB 1GK8A 1GD2E 2AGQA 4L6V3 4UY85 4BDPA 3LGHA 4U3FD 4EYYQ 3TA2A 1IFJA 2EG1A 4WTYA 4I7FA 1HBOA 4AYBD 3VMZA 4EGLA 2WSFJ 3P3DA 1IWAA 1RAEB 2W4DA 5BYSA 2Z2LA 1N34F 5AVTB 3D1OA 2VKRA 2XYGB 4ERDA 3PLNA 3NCQA 4X4NA 3UVJA 3D5MA 1AFJA 2OPSB 2YWEA 2HGNA 4G1QB 4CQ1A 5F8GA 2DNLA 1E6VB 4R8UA 4NLUA 2CQDA 4IYQA 1PCAA 4U3FE 3HSDA 2IZ0A 2X51A 2Y3YA 3BRVB 4C8NA 3RBXA 3NGTA 4C98A 2FQQB 2MY8A 3TA0A 1F60B 4DV3J 2DXFA 4P2SA 3U1NA 1NWQA 5FLXU 2CADA 4Y28C 3JSRA 1HBMA 3G4SS 2QA4S 4DR6J 3RAQA 4C9DA 4OZLA 5AVYB 3MAAB 4V1Ak 3RL0B 3UR0A 3WHIA 2BKOA 1U0HB 4USWA 2ACYA 2QO3A 3BCCG 2V2KA 5K5MA 4DQRA 2I8EA 3CCVP 4W7ZA 4WP9A 5HI7A 2M0GB 4OZ2A 1XMVA 1J1DC 3K17A 1P9QC 2MZQA 2QJYB 2HPUA 5KAFH 1BGYG 3M9NB 3CCES 3EFGA 4UOFA 3RUBL 2OD4A 5AJ3F 3BKUA 2ZUGA 3GV5B 1RBAA 3FWNA 1JLEA 2VG5A 3P5BP 3NXSA 5C25A 5KG2A 4OI2A 5M2RA 2J5AA 3AODA 3SCIE 3GSIA 2MSSA 3V6IA 3MR7A 4U96A 2UUCJ 4K0KF 2PMHA 2V63A 2DJWA 4NYZA 1XMOF 1OFCX 2P2CB 2DNOA 4IG0A 3MPYA 3PNIA 4OYMA 3I0SB 4F4KA 1REVB 4ECRA 1BQMB 3KK3B 3PW5A 2MEWA 4A8XA 3GSDA 1IJDB 2EKYA 2NR0A 5KFGA 4DX7A 1QVFO 2Y1IA 2FY1A 3I6PA 3MMJA 1YJNS 3B5NA 1MV8A 1UEUA 3I31A 2GJIA 4OI1A 2X3DA 3R7BB 3BGLA 1PV3A 1LV5A 5EGYA 2IMWP 2F8HA 1FJEB 3DI6B 1FX4A 1HIYA 5HQLA 1BCCD 4C8LA 1KKHA 2N7YA 3H5XA 1L0NJ 1T6AA 4M5IA 1H89A 4ZPBA 2A18A 2D69A 1KILC 2MTLA 1MO5A 2HHUA 2Q9IA 3CC2P 3DI6A 3MAQA 2BMBA 2A45H 1S72S 4B9VA 2FJVA 4GRSA 3TA1A 5GAEI 1SVDA 1QTMA 2BJ1A 3HUSB 2YKNA 3GG0A 2HK3A 3BCCE 5DETA 1NU1J 4X62J 4XDCA 4D6TD 3W67A 2IYIA 3D9BA 4ANCA 3MCMA 1DZ5A 2YH1A 3ILJA 2QEXS 1RWOB 2LEBA 1OYDA 5AW7B 2HRUA 3L73E 3SCKE 3W66A 4YFUA 2GCFA 5DM6Q 1YJWS 1RWKB 2VPXB 2J8AA 3PP5A 2M8RA 4QU7A 3IRXA 2ILYA 1Q2NA 3G82A 2BRKA 4IQMA 1RE1B 3CCJS 1X5OA 2H4WB 2ZVSA 2PSZA 1N34J 1RWPB 3PYEA 4AQYJ 2YXRB 1OPIA 5KFOA 3L71J 2RKLA 1EARA 2DTJA 2HURA 3T9NA 4I0WA 5APWA 1PJ5A 2ZROA 2DITA 2Y1RI 1M1KT 4WB4A 3LO3A 3QLHB 4ZPAA 3RGIA 2N7CA 3G6VA 3CTRA 1E6YB 3D7SB 3C6UA 2AGPA 4URQU 2IFNA 1EZVG 3CX5I 2M4MA 2LYVA 2P8IA 1H2UX 2CQIA 2E74D 3CX5D 2KXHA 1VRUA 2OELA 2IM3A 1SLQA 1J1EC 5KAIH 1CQNA 1J2VA 1WTFA 1KQKA 4W98A 2CYYA 2KJVA 2FPHX 2WZ1A 2VDHA 4LBPA 2GX8A 4HACB 3TAQA 3NCRA 2CPIA 3L75D 1GL2D 1IKYB 3MPUB 4M5GA 2CZVC 4N78E 3KDOA 2E9RX 3LP0B 5GAEU 4J9RA 2GVDA 1NK4A 2E5LJ 2Y0CA 2MQ8A 4I67A 2Z30B 3CDEA 1SC6A 2DR7A 2J9EA 1NU1E 3DRSB 4C48A 2V8VA 2WAQD 3NAIA 2OYIA 2E5JA 4R4MA 5AVRB 1CULB 1W7WA 2IIHA 3Q8SB 4DUTA 2O01C 1IR0A 4B9TA 4F4AA 3DRSA 5HAOA 3NXZA 4O3QA 3G96A 2CRLA 2BJEA 4ICLB 3D0GE 2HNZB 5L46A 3R5DA 1HI0P 4GDOA 2UUBJ 1MN9A 3HLUA 3DGVA 2F3JA 2JKVA 4CLWA 1D8ZA 4N3YB 4KFBB 1N6QB 1BQMA 2HKEA 3GMGA 1NK7A 3MD0A 4JI3J 1LTBC 1TU3F 3GV8B 2FVCA 4RUAA 3L70D 2JEGA 4DR3F 3HSGA 2MGZA 2D41A 2FJXA 2XMVA 4UQTA 5E2QA 1NU1D 5CCHD 3MPVA 3W63A 5IOLA 1NDLA 2B9WA 1K8AT 1M90T 4LMZA 5E3AA 3OL7A 2OPQB 4ZNCA 5IS2A 2DB1A 1V3RA 3QGHA 2C22A 2KB2A 2R7OA 3UD3P 5GTHE 2B8QA 4NLWA 4DV1F 3FNNA 1VBZA 2PD1A 3EVMA 4I6AA 3KHRA 3CCMP 1DQAA 4KO0B 4A8QA 3B6BA 2CJAA 2CWXA 2GO8A 1N36J 1EDLA 2Q3PA 3BQ0A 2BOPA 2HQCA 3C6TA 1GW3A 2ZVIA 2VG5B 3HHLC 4ANEA 4Y0FA 1IZNB 2FC8A 2VIHA 2V4JA 1IKWB 4NLVA 4LFAJ 4DU7A 1NTZE 4WZMA 4PD4E 1H0TA 1NZ8A 3QO9A 2VKZG 4CYUA 1K05A 1FXDA 2N1TA 3GMAA 3L74D 1WHXA 3D6YA 3KNGA 1A6LA 4IFYA 3KPEA 1FX2A 3BSAA 3NGKA 5HMXA 1CJTA 1SL2A 2ZE2A 1EZVI 2OYHB 2DPIA 4Q8FA 1IM4A 2W7AA 3BZQA 2I1RA 3EYZA 1R43A 2DY9A 4BWMA 1KMIZ 3MZIA 4HVZA 4RW6B 1JY3P 4TXSA 3JQJA 5KT6A 3CB4A 3M6WA 1DX7A 1M0SA 4PQUA 4AUWA 5ETVA 1Y0HA 4PV1D 1TQLA 3FZ2A 4JB8B 1S1UB 3HTKA 4CLPA 3O5TB 2OYOA 1FEHA 3K8VA 3ADAC 1HFEL 2FJDB 1HNZF 4CRJA 4OJ3A 4DL7A 1R8AA 2VQEF 2AF6A 2LVWA 1SQVE 3L71G 3L75J 3BR9A 4DR2F 1F5AA 4DV6F 1WMKA 3CCQS 3ZTSA 1YJWP 4ID5B 2MZSA 3IF4A 3W7BA 2WSEH 4PO8A 1VQ8P 5A2QY 1JM0A 4LF7J 3V6DB 1PFIA 4USIA 3W62A 1RADB 4KGVB 1LXNA 2B0GA 2R42A 3G6ES 3RR8A 3PYFA 2KRBA 4Y99C 1NTZG 5DZ6A 2J7KA 3MEGB 4JI6F 5CJ0A 2KYXA 2RVJA 4U6PA 2QLWA 1BDDA 3FRYA 1ZV8A 2AJFE 2J0XA 4OFZA 7AT1B 3MMBB 3H90A 4A8YA 1OYEA 1SQVD 4J91A 3N0VA 3OPKA 2JC0A 4DUYF 1YSJA 3H1KE 1NYHA 1TMJA 5GAGI 1JX4A 1V6HA 2CPDA 4ALZA 2GW8A 1NK0A 4DEZA 4LF1A 3AE9C 2E75B