2YKQA

Structure of the human line-1 orf1p trimer
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
212
structure length
200
Chain Sequence
DQLEERVSAAEDEINEIKREGKFREKRIKRNEQSLQEIWDYVKRPNLRLIGVPESDVENGTKLENTLQDIIQENFPNLANVQIQEIQRTTPRHIIVRFTKVEMKEKMLRAAREKGRVTLKGKPIRLTVDLSAETLQARREWGPIFNILKEKNFQPRISYPAKLSFISEGEIKYFIDKQMLRDFVTTRPALKELLKEALNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trimeric Structure and Flexibility of the L1Orf1P Protein in Human L1 Retrotransposition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords LINE-1 ORF1P
total genus 62
structure length 200
sequence length 212
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02994 Transposase_22 L1 transposable element RBD-like domain
A PF17489 Tnp_22_trimer L1 transposable element trimerization domain
A PF17490 Tnp_22_dsRBD L1 transposable element dsRBD-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ykqA01
3.30.70.1820 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykqA02
3.30.250.20 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 Rec A Protein; domain 2 2ykqA03
3SOOA 3EQ2A 2W7AA 2W6BA 1JOCA 2YKQA 3BRTB 2YKOA 2JRBA 2YKPA 3BRVB 3L4FA 3CL3D 2LDYA
chains in the Genus database with same CATH superfamily
2WSFC 2FFDB 4WKRA 1GL2C 4UY85 4BWMA 3BCCJ 4MT1A 1K0TA 3POTA 1YI2S 3VMXA 1QVFR 5F9NA 1MSWD 2B9YA 4LSLA 3MXHP 1NCLA 1K8AQ 2ALYB 4WU2A 1MLAA 2VA2A 5AVQB 1GL2D 3VMYA 3DMJA 2E5HA 2JLFA 4YUDA 3UN3A 2BCCJ 1HH0A 3MEKA 1H2TZ 4P7VA 4B08A 4A48A 1FJ7A 1JXVA 1GTHA 2OD4A 1FD8A 4YMEA 5EGYA 2BR0A 4DJBA 4GDOA 4NMLA 1AV1A 2Q5UA 2PGCA 2FYUJ 3CWBE 4N6JA 2IDEA 1PGJA 1X4CA 2AYGA 4I4BA 3H98A 3JTPA 2LQ8A 3B4MA 3L75J 1JY3N 1RYSA 2I0XA 3KLHA 4OZNA 2I2YA 2QYCA 3BKTA 3DM2B 3IRWP 1Q7YT 3RBDA 4WXOA 3E2EA 4M5GA 1FC2C 2HYNA 2HQCA 3UR3C 5HMZA 3J7A1 2BOAA 1VQPP 1CVJA 2DRBA 2JDIH 2KOGA 1G1XA 3CD0A 4A46A 2KN4A 5BYSA 2UVUA 2Q3EA 1Y00A 3NY0A 4G1IA 1IKXB 3ULHA 2K37A 3T3FA 3DKDA 2YKNB 3MAAA 4K59A 2ZUAA 3CMES 1ZXGA 3CCRP 1B0VA 4EIJA 2JNJA 2BEZF 2P10A 1HWUA 3QIPA 1YBUA 5D77A 1ZA1B 4R25A 4PQUA 2A45I 1RAAB 1D8YA 4MK7A 4Y28J 2W01A 4F3MA 1S6UA 3JAMY 2Y0EA 4NLYA 2I5JA 2GQCA 2ZFHA 1TKXB 3NRBA 4X66F 2WPVB 1RISA 3Q83A 1H74A 4OZ2A 5IT9Y 4WY4D 1X4FA 3DRYA 3D6ZA 2YWKA 5I3UA 1HBOA 3VAMA 3D6TB 2L9NA 4F67A 3H2UB 4HACB 5HJYA 2YQ1A 3CD7A 4NRUA 4Q2LA 3QRQA 3W2WB 2CIMA 1ZAWA 2FLOA 3KUHA 3B5NA 2Y8WA 1M57D 4CLSA 1LT9A 1QAYA 4K0KJ 5KFOA 1RE4C 3P8CD 3MEGA 2C1EB 4URGA 1NHVA 4F3QA 4DT0A 3DRXA 4RJVA 1RWUA 1HNZJ 4AD6A 3DN9A 4KBIA 3KUGA 2Q6BA 4V19J 2H51B 4A8KA 3AOBA 2Q3IA 5L1JA 4LF8J 2FXPA 3V2NA 3H5XA 1RZMA 2YWWA 2MZJA 1X4AA 3C14B 2NZ2A 3ZXWA 2LQBA 1SVFA 1VQ4P 3Q2YA 3NGUA 1BGYD 3ZZPA 4TLRA 3OVAA 1KQKA 2QLWA 3KG1A 3CMQA 1WHWA 1VQSA 2HG4A 4PZVA 4C9DA 2KJVA 3B6BA 3RK3E 4A47A 2APOA 1NU1J 5CCGD 5F8IA 2A18A 4N47A 6FD1A 4AYBD 2ZE2A 4LRBA 1FOSE 2IYGA 3GONA 3G71P 3KLEA 4ZHRA 4IFVB 3LGNA 2W1BA 3VAKA 4KJIA 3H1IG 4M5IA 1D8ZA 3G96A 1URRA 3SSQA 2B5JB 2VPZB 4LSNA 4F4WA 4DL2A 1LWEA 3ITHB 4NA3A 3BSCA 2I9SA 4OYPA 5DZ6A 4Y2MA 1KVJA 3Q8YA 2V67A 4I2QA 5AW4B 3CL3D 2DNMA 3FWNA 4ER8A 1SC4B 3OL7A 1VQ9S 2WONA 4KFBB 1KONA 2RF2A 2AEJA 1NK9A 4USHA 4PUOA 2KSJA 2RH0A 1M5PC 4ZVPB 3L9ZA 2RDIA 3NS7B 2KG0A 1F0XA 3L72E 2B51A 4RNNA 2OHDA 1Y4ZB 4PWUA 3F0NA 1KLNA 1GTEA 4ANDA 2WMMA 3ZTOA 2IDLA 2EVZA 1KYOH 3Q86A 5ADZA 4D6TE 4AYCA 1WG5A 1T6AA 3KJFB 1QE1A 4NA2A 1JOCA 3AXMA 1B0PA 2F65A 2UXDF 5L8RJ 2GVZA 1A02F 4EYHB 2V4QA 1HNZF 5B08A 1IBKF 4NEYA 3HSZA 2OTLS 3R7SB 2QRXA 1F5AA 2G3AA 4OJGA 2W90A 2POHA 3CIZA 5B7WA 1T7PA 1N36F 1SQBG 5B66H 3FRZA 5J1EA 3DU5A 2C0WA 1MO5A 3UVJB 1GMUA 2E7WA 5F3TA 2J8SA 2LXIA 2P67A 2HVZA 2UP1A 2V4RA 3LIEA 3NWRA 1SQQG 1NB2A 2R8HA 2HQFA 5J2MA 3M2RA 3TUIC 1DY3A 2XNXA 3AE1C 1RSCA 1IKWB 3CCJP 4ALZA 2QEXS 3JCUE 1HHTP 2XGPA 4OHVA 1L0LG 3Q2SC 3J7YI 4DG1A 3D67A 3RRKA 5BR8F 3WX4A 1HYSB 1J1EB 1K1QA 4LFCJ 2BKNA 3C6UA 2OGUA 3A4TA 5CYJA 1APSA 3OXGA 4RNMA 2XMKA 2W9CB 4DWIA 4MMOA 3TSIA 5C25A 3KK3B 1KNZA 3IGNA 3CC2S 2EXUA 4WFBQ 5L1LA 4ECXA 1H2VZ 4YN3B 3AE3C 1T03B 3A8IA 4PQRA 1PGOA 2J7WA 3IG1B 1DLOB 3R8YA 2WITA 2WRMA 3PZPA 3M8ZA 4B9LA 3VZHA 3KZIH 1TKDA 4ZPVR 3FGAD 1W7WA 1KFMA 4CIOA 1V3SA 1T9VA 5HI7A 3QJJA 4RW9A 3VALA 1I94J 2QJPB 5B09A 5B0EA 3IG1A 1GDTA 2DY9A 1AUSL 1SFCA 1T03A 1R6VA 4CT9A 3CWBG 1NK5A 1HBUB 2W2MP 3L4BC 1E79H 3EXCX 4TNOA 1UFKA 1MV8A 3TA1A 2YX4A 2DGTA 5CD4H 2BUNA 1XMQF 2C0XA 2QVAA 4BRYB 1VBZA 1QL1A 3SEOA 1WG4A 4Z2XA 1RWKB 3HLUA 2ZRBA 5APQA 2IM1A 1Y5NB 1XTGB 2HK2A 2Z5HA 1GW3A 4HHUA 2QG9B 5CYQA 4JV0A 2NPFA 1MZ9A 3AD8C 3LP1B 2BA9A 2MSSA 1NDKA 2FJDB 1VQMP 2ADCA 3AE8C 5D15A 3CTRA 2EFNA 4I7ZC 4ERDA 1F9FA 1CW5A 4K4XA 3HCXA 2KRBA 1UKUA 1S2EA 3LW5J 2CPHA 4C7RA 1UL3A 1S79A 4ELVA 3KQGA 3CDUA 4O3QA 1YJRA 3TGUD 1U1PA 2OARA 3DRPB 1RT6B 3EVMA 3V6IA 3G2XA 3PEJA 4H0LB 3DOMA 1LW0A 3OFGA 4IH7A 2ODWA 4I7FB 1S1VB 1SUQB 1YJ7A 2NLWA 4PD4E 1S4EA 2DNKA 1RBLA 5KFCA 3PYFA 4X4VA 1BSNA 5D4LA 1R7IA 2Q79A 1TKZA 4JI8F 1SQFA 1ZW0A 2CZVC 2UZAA 1WELA 5K9FA 3O3LA 2HHPA 2G1DA 1R5SA 4LRAA 2PFDA 2VJUA 3V2QA 4LGDE 3DHWC 3TEGA 4TXSA 1SIZA 4RUCA 4FF1A 3K57A 2DW3A 2G1HA 5KOWA 3MEEA 1XMOF 4CWBA 1NSQA 2DNRA 3G8TA 3BSAA 4NLGA 5DS7A 1R0AB 2HGLA 3PVXA 2BX6A 3NWGA 4TU7A 1OY9A 4LFCF 3WMM0 1F6TA 3BM7A 4ED1A 5KG0A 3PJSK 2DGSA 4YHHF 9ATCB 2U1AA 1AFJA 5AVRB 4K3AA 4IQMA 3ZZZA 2REBA 3I0SA 2Y8YA 3CMAS 4UZCA 4QIFA 3QRPA 3KWMA 1Q53A 1S1WA 2QTWA 4KT0C 1VDFA 2NPSD 1PAUB 2GW8A 3BGLA 3GPAA 1VHIA 1FOSF 2HZCA 1PO6A 4CP5A 4DUZJ 5IOLA 2MQQA 5A8KA 1VI7A 4YHHJ 2J7KA 2QYGA 3K58A 2QM7A 2BJ7A 5KLIC 2XSFA 3F73A 2W2OP 2J9DA 2QRRA 2ROGA 4B9TA 2A3JA 2LQ5A 1PGPA 4G6VB 2R7SA 2KB2A 2X1FA 3V6KA 2F5GA 3CJRA 3W5ZA 2CJQA 3QYYA 3EGVA 4I1TA 4EO6A 1XMOJ 3OPKA 2MJZA 4R8UB 2HG5D 1GXTA 4LQ9A 5K20B 3R5GA 2CQ2A 4TQRA 3QRRA 3HD7D 4LF6F 5I4MA 4URQU 3N7NA 4L76A 3GILA 4WYLA 4C6AA 1FT8A 2ALZA 3AXKA 2BJDA 1UW9A 2HNDA 1VRTA 2LMIA 2YXLA 2WSCC 1WMKA 1ZPVA 2C2RA 1NKEA 3GV8B 3TZXA 5KG5A 1A0OB 3FWLA 4OYBA 4DR2F 2Y1LB 1AXQA 3KTQA 2XKMA 3FCHA 4ZVTB 4DV6F 3ABVC 3EMTA 4QR2A 5DG8A 2ZFCA 2KT3A 3R5JB 2KYZA 2CJYB 3AY0A 3VGVA 5LOQA 2Z56B 4ZPBA 3MAQA 1RE1B 1YJWP 2ZZMA 3ZNJ1 4WBAA 2BACA 3L74G 1BCCD 4FS2A 4S0MA 2KM8B 1NYHA 1UZDA 1RT4B 2VRSA 5E3PA 3HSDA 5J2QA 1KC8Q 4E98A 3CCSP 1AT1B 2D2CB 4N7TA 2Q7CA 3X1LB 3EGNA 1NPRA 4NLRA 2XYPB 2G0CA 2FYNC 3BB5A 4LBIA 3RJMB 1L3SA 3GF7A 4X4OA 1SQQD 3M2UB 3U1LA 5CYMA 2O3DA 1SIWB 2HVDA 3BYRA 2X1AA 5D0HA 1SPBP 1SH3A 5F0WA 3TVKA 4BC9A 3L74E 3FDSA 4CDIA 3TOQA 2XS7A 1R8EA 3HE4B 4OQJA 3MOJB 1ELOA 4A8FA 1RQ0A 1RF1A 2HZVA 3OV7A 2W4DA 2E5TA 3R3TA 4PO9A 1N32F 3NCQA 2AJ2A 2MZSA 5H2FE 2WSCJ 1PP9D 3KLFB 1FFWB 5THWA 3PACA 3C16A 1FDBA 3KYQA 1UPMB 2HPUA 1S1TB 3W5YA 1LTSC 3CJ2A 1NJXA 3HTKA 5J2PA 4DX5A 5KFXA 4L72B 1PAEX 2CPXA 4P74A 1IK9A 2HHTA 2MLZA 4DL7A 3HD7C 4WPAA 4C8KA 2FC8A 4K4WA 2EI5A 3R7BB 4OHZA 4ZN1A 1REVA 2OTLP 2IZ0A 4J9NA 1PPJD 3M8WA 3CC4S 5J1PA 2ZR7A 1MW7A 2ZRPA 4JYBA 3L37A 3R4YA 3HD2A 3J81j 3NTNA 4DV3J 4P2SA 4LT6A 3BGRA 1CJUB 3HF5A 3LO3A 4ZVUB 4DF8A 3O2IA 5ETQA 3B54A 1RQVA 3UN5A 4ZVSB 1NHLA 3D68A 1OPIA 1N88A 4JI1F 2GZOA 1BY9A 3LP2B 4GOEA 4BRYA 4HL9A 3I0RA 2POKA 3SCIE 4GVLA 1H73A 3TQ1A 2U2FA 1HFEL 1P9YA 1CBKA 3KMSA 3HRNA 3M0AA 3QO9A 1NK8A 3OUYB 3CCMS 2ZWOA 3R2CJ 2QC3A 3H1JJ 1TFWA 1SJ4P 5HSPA 2JX2A 2VJVA 3DGVA 2PN6A 4P2FA 4KQZA 5J1EB 3U27A 3VGTA 3M1VA 2LP4A 2ZH2A 2V7QH 1HTLC 4DR3J 4OHXA 4M5DB 3OUYA 4FS1A 5H9FK 5FDLA 1RTJB 3M9BA 3GIJA 1M1KQ 2DK2A 2XNRA 5B0GA 4MH8A 4DFPA 1UJ6A 4DR1J 1D0EA 1IR0A 1USEA 3H4DA 4OI2A 3W63A 3FSYA 1ZAXA 3I55S 4DR5J 2J5AA 3KHUA 3LF0A 1D9FA 2XGQA 4M5DA 4FKYA 4FXVA 3V6DA 1JMBA 4IFMA 3B8HA 4DXLA 2J7UA 2DR5A 3G9CA 1QD1A 5GADI 2DVIA 4KHXA 4X4RA 4DOZA 2GGPA 2R2RA 1L5UA 5C24A 1DJ0A 2ITAA 2FJBB 4X4SA 1RLCL 2M0GB 5CH7B 5AE2A 2LU1A 4TY8A 4Q2MA 5KT5A 5KFSA 4PG6A 3JC22 3TVYA 1NNDA 2E74C 4FYYB 2FLNA 4KGZB 1CPZA 2AF6A 5KFNA 1UIXA 2ZOMA 2CQ3A 1I6JA 1PGZA 2PMWA 2CQCA 2V69A 4OFZA 4Q7AA 3N4WA 4IKAA 4DV4J 2YNIB 2FB0A 4C2MA 2HQGA 2DYAA 3MMBA 1RT7A 4J7CA 2F4VF 3MM6B 1CZQA 4NPFX 3H1LD 3BASA 2JEIA 3C15B 3ICLA 5ETLA 1J5OB 1XMQJ 2B9EA 4HACA 3OFHA 1BWVA 3RW7A 2PFXA 4ED4A 1SBRA 3IRXA 1OWXA 3BBCA 5BYQA 3MMBB 3UNGC 1RTZA 4RU2A 3PR4A 3EE3A 4HDHA 4NCBA 2H65B 5HP1A 2R5DA 2BE2B 2VKZG 3OQ2A 3O8ZA 1GMVA 2AEMA 5KG7A 4O9BA 5T14A 3A0BH 4GKKF 3HM9A 1JY2P 2IJFA 2H5JB 2ZZTA 4CH7A 1GT8A 1T2KC 4DV0F 3ZO7A 2QA4G 2QJYC 1N8RT 1CLFA 1DQ8A 4TYAA 3M06A 3R2DJ 1JLEB 3GCXP 1LGHB 2NXEA 3H1ID 2CQHA 4CLWA 5M2UA 1NTKE 1H6KX 1IFDA 3PW5A 2RRBA 2CXEA 2Q6CA 4J9KA 2RMLA 1WEXA 4EFAC 5LMUF 4FVMA 1RCOB 2XYHB 3BCCG 2MGZA 4QWCA 1SQPG 3L75G 1T9XA 1RWXB 2JH3A 2J59M 3IBFB 4LBPA 3L73J 3S1TA 2RSQA 3JSRA 4QWDA 2Q66A 4QBUA 2I1JA 2OKQA 1RTHA 5KFJA 4GC6A 2D9PA 2FY1A 2I38A 2N9YB 3BBBA 2BCCE 2WONB 4YXDC 2HNDB 1N0UA 3LPYA 3BH6B 2CPYA 4M5HA 1OVRA 4YB6A 3L7OA 4OVNF 3EXYA 4DPXA 5AVSB 5KG1A 1WKLA 2YNFA 1T3NA 5B5EE 3H1KJ 4L3NA 4OZLA 3HT0A 4CQ1A 3A5TA 5D6GA 2ZKTA 2CQ4A 1SL2A 3TDKA 1S7HA 1NJWA 3M2UA 1KILB 4X64J 1S5ZA 3PFEA 3BCCE 1Y8AA 5U47A 1VYAA 4QIGA 4LREA 3T1HF 3TYTA 1SV5A 4ILMA 2ZM6J 2DNGA 1RE3C 2W7OA 2FVRA 5IZHA 4JBCA 2C2ZB 4WF9Q 2OYHB 3MP7B 4IO1A 1HIYA 1VIOA 4KGVB 5HMYA 3PJ9A 3R5CA 2NR0A 2YO2A 2R2TA 5D4NA 1EAYC 2ATLA 1SP4A 3RAMA 1MROA 1AFIA 3IBWA 2YNGB 4CNYA 2AX0A 4RW8B 3UPFA 3MURP 2ZYDA 2XBPA 2UUCF 1YIJP 1JUNA 2AZ1A 3TNUA 1M1JB 4MFBB 4P71A 3BV8A 3TK1A 4CO2A 1YQ3C 4IOAQ 3MFHA 2ZH3A 2AXTE 3T1YF 1T8ZA 5KJ7D 3IM8A 1MROB 2KT5A 1LKZA 2P6SA 2OEJA 2R8IA 2YNGA 2Z58B 2D69A 3UE2A 1Q78A 2YNHA 3CVKA 1N32J 5KKZC 4GVBA 1WUUA 2ZH4A 2FGCA 1Q82T 3DNCA 3FXEA 3F44A 4ZIWA 4ECQA 1P27B 3FK4A 2QSIA 2XSJB 1VJQA 1PSDA 1FKPB 2LECA 3DGPB 3UDLA 1HNVA 1ZN5A 1FDNA 2KUBA 1TK5A 4FXDA 1RBAA 1HNXJ 3PCOB 2XNQA 3MF5A 3BBFA 4IR9A 4NPEA 1TL4A 1SQXD 4JI5F 2LFVA 1BUXA 1H0HB 2D9OA 4K8RA 4B9SA 1KQSO 1EB0A 2ZR0A 3M91A 4TU9A 2YKMB 2RKIB 2BV3A 4Y2AA 3PJXA 1UVLA 2CK3H 1YJ9S 3Q24A 1DFDA 5LSRA 1UWBB 1Y0HA 1Q86Q 1HUCA 1HWKA 5ETKA 1VISA 5SUHA 1U8SA 4EU0A 3T1YJ 2QX0A 4HH0A 2JEFA 3H1HD 4PKDB 1KMIZ 1TP7A 1QL2A 2RS2A 2F8EX 4J9LA 4XDCA 4CO0A 4QJVA 4FF3A 2RILA 3MD1A 2XMAA 2ZD1B 3C8VA 2N82B 4IG3B 3TWZA 2WOMB 4HDGA 2HFSA 1ACMB 4FVCA 1VR6A 1HJ0A 5KLVE 3MI7X 3S1KA 3SBMA 3B71A 4DFMA 1S0VA 4O44B 1VBKA 3BSNA 5AVYB 1S12A 1RAOA 1MWQA 3MM8B 4DSLA 4NCGA 3HK2A 1R6YA 1WRGA 4WY4C 4PPGA 3ZZYA 4OI3A 2YMKA 1KYOI 3OA7A 3QATA 3PG9A 3KLHB 3NL0A 3FCVA 5BU8B 1MO4A 5IM0A 3HVWA 5HLFA 2A10A 3G4SP 4B3OA 1Y11A 1FF2A 5KG2A 1D9DA 5KT7A 3CCES 2DHHA 2VF3A 4FXWA 3IC1A 3J81Y 1FDAA 2P7JA 2E76D 2XCPA 2P5VA 2PA3A 4FKXA 1SQQE 4U9RA 2ZH1A 5DGAA 2W4CA 2M3DA 4L74A 1S6PB 3G6VA 3D1HA 4JI3J 5AJ3F 4ZK7M 4LRFA 5KT4A 1RT7B 3GV7B 3FBEA 1RAFB 5M2PA 1JLCB 3TNVA 4CI0B 3H40A 5GTIE 2HFZA 4NZ6A 1G18A 1CI6A 1EZVD 1M5KC 3L72D 2EFPA 3VP9A 5BU5A 4YY3F 2KRRA 3PTWA 3MHVA 4A7PA 5JVHQ 4Y3CA 3G86A 1WKJA 3PW0A 2IZ1A 1HD0A 1VCTA 1JQGA 5G0RB 1NAFA 1YJVA 2WTYA 3E51A 4FF2A 1KHVA 3GHGA 3SQGA 3MM6A 2B9BA 1KTQA 1TMJA 3OL8A 1RQUA 1LWFA 2ATCB 3LALA 1NTKD 4B3TF 2RIJA 4ANEA 1UBCA 2A06E 2NZCA 2RQCA 1KB9E 3EWKA 3LP2A 2OSRA 1J5OA 3LP1A 4X65F 4FNHA 2CPBA 3I9ZA 5ETRA 1RTIB 4MKVA 3G6XA 3TZZA 2BRKA 2EK6A 1S4XA 3CCRS 3HHKA 1EZVE 3L73G 4XFJA 2ZJPQ 1S9FA 3QT5A 3AEBC 2XZRA 1UA1A 3FQKA 1NTZE 1LT9C 3PJWA 1GD2E 3MM7B 4ZMMA 4J90A 2B87A 5C7PA 2VFVA 2FXOA 3Q5PA 1AVOA 1KZUB 1F9HA 1CEZA 2MSTA 2C42A 1UCNA 2IBOA 4OZ0A 4AUWA 1L3UA 4MKBA 4AL7A 4ID8A 1NTKJ 3GW6A 4KT0J 2UUCJ 3DOMB 2WVFA 4DSFA 5FJ4A 1G3OA 2JL9A 3CCVP 1IM4A 3G3ZA 1SC1B 4L6V3 1EDJA 1V9OA 3AJ1A 2OESA 1IKVB 3CX5I 5LXRA 1RT2A 2OUGA 4ZKUA 2M0BA 1U6BA 2DISA 4WE1A 2WSEJ 4C11A 4NWBA 3OXFA 1SQGA 2XZWA 1I1GA 4RNFA 4IFDK 2KB7P 2KYXA 1CSBA 5AW0B 4HLBA 2C2MB 2MMYA 1AJYA 4PJ0H 1K73Q 1FK9B 3O44A 2H5EA 2A6MA 3SFEC 2XMJA 1GZLA 4UW2A 5FD1A 2A0FB 1PP9E 1RTDB 1P6TA 4WP8A 1FNOA 3AEAC 2F63A 1HLWA 4CLFA 2E7XA 4PQYA 1Q86T 4WP9A 2ZYAA 3GIKA 4ZP8A 3NGSA 5B5EH 2R7UA 4RLEA 2FHMA 3DFEA 3TAMA 1X4EA 3BN4A 3KLIA 2ZRCA 5ETNA 1XQIA 2PAJA 3S7RA 4XO0A 3CXHH 5KAIE 2HQ3A 2WCXA 1UP1A 2GHWA 2MJUA 3F56A 1LT9B 1JLAB 5B0AA 1F60B 3MEGB 4U8VA 2XCAA 4O4RA 1D7MA 3SIPB 1DARA 1VIXA 4CH1A 4HI2A 3M30B 2W25A 2RN0A 4PQUB 2K9JA 2KZJA 5J2QB 3RGIA 1YZ7A 3DDKA 5IT0A 2QA1A 2HODB 1DEEG 2KNCA 2NYHA 2PT0A 2WBMA 4WY4A 2ROEA 5GMEA 4GVBB 2B9XA 2E5LJ 4HHHA 2RU3A 2HS0A 8RUCA 5J2MB 3K2YA 3V81A 2AGOA 1JJ2R 2QA4S 1HQEA 4EI2A 1RT1A 2MQPA 1S1CX 4C8OA 3B5NB 1OWAA 2G9OA 5EWGA 3U1NA 3DLJA 3W8GA 3PFOA 1SQVK 1KFNA 5AVZB 4CO1A 4NLQA 1TVRB 3H25A 4OYIA 3CCUS 1VQ7P 1NH4A 2DCUB 2VPWB 3BO3A 3CDBA 4WIQA 1U2RA 1EIYB 3L35A 2ZT9C 3MOZA 1FTCA 1KLMB 2HFUA 1LTTC 4H13D 3R7NB 3SI8A 4O3OA 3M9QA 3CJ8A 3KK3A 2E5IA 4NYPA 3HVTA 1WG1A 3C14A 4C3LA 2J0WA 2J0QD 4CZCA 1V5VA 2JVOA 2P2CB 3OVSA 4KR0B 4O23A 1OX3A 3H1IE 3CC7S 4PPZA 3EDQB 3CPWO 1T3JA 5H9EK 1IKWA 1ZOYC 3WC2A 1JCCA 1TL1B 1BCCG 1T9YA 2BQ3A 1SKRA 2BJ3A 3WZ0A 1L4AB 1CULA 5AJ3J 4DOJA 1H38A 4C0HA 2UV8G 3BGUA 1R8BA 1PZQA 2AJ4A 4CCHA 1C4AA 4DV0J 1Q5YA 4O4GA 4Q0BA 2KSEA 2K8GA 3H20A 2W9BB 3LQVA 1G1JA 2UUAJ 4DL5A 1FJKA 2RKIA 3Q3DA 2IVMA 2WAQD 2GAGC 3PIOQ 1SQVE 2IPPA 2ZITA 3K8VA 1L4AA 1K8AT 1VRUA 3J80Y 2W6BA 4QWEA 5CCHD 1YKWA 3V5RA 2KZMA 1C0TB 1X8YA 1RT4A 1S1XB 3NNHA 2FVCA 3VQTA 4C4WA 4PPFA 1KD1T 3M6XA 4Y6IA 1NDPA 2WPSA 2ILYA 2QA2A 1F2GA 1KORA 4ZA1A 3Q0AA 4BS2A 1NTMG 4F7VA 2XQCA 2CWKA 2KXHA 4I0WA 4CLPA 3HT3A 1URNA 4QMAA 2CJ9A 2R3SA 3GFYA 1VQ8S 1E6YB 1VC6A 1JB0J 3OD2A 3JB9k 4IO9Q 4ENOA 1OSDA 2ZRAA 1GMJA 4LF8F 2L5GB 1SS1A 3BQ1A 4KV8B 1MO6A 1JMTA 3MM5B 2FJAB 4B86A 4PD4H 2ZJSE 3O8WA 2QV6A 1L4AD 4JI8J 3ADAC 1LW0B 1GK6A 2ZH8A 4JV5F 2I6WA 5KLVJ 1UA0A 3P32A 2V2KA 3E1RA 1RF1B 2EFQA 5F9LA 4B9UA 1ZZNA 1SJ3P 2KK7A 2G0IA 1U57A 3RRHA 3F5HA 3M8YA 4I67A 1H0TA 3I56P 5TISH 2CG4A 5ETSA 4B3SJ 2DHAA 1YJ9P 4JB8B 1B70B 4ICLB 3D0GE 4PPDA 3PM9A 2CQPA 3M9MB 5F8NA 4IR1A 2LEAA 1RUSA 1N5YB 1RHZB 3BRTB 1IBMJ 1IFNA 3GJQB 1X79B 2G0JA 4UB8E 3LAKA 4ITSA 2YKOA 2IBZI 2IM3A 2VG6A 2YWHA 2BRLA 2PC6A 4P75A 2LU2A 2K3KA 2M8RA 4RWWA 3WQPA 5C5JA 2O5DA 1U94A 2D3ZA 4DHVA 4DI6A 2DT9A 1NU1G 2VDIA 3VAFA 2QG4A 1M5SA 4YB7A 1RHQB 4LFAJ 3GMAA 4E2FB 1CI6B 4OI1A 1AZSA 4GT1A 4DPTA 3N5BA 1LW2A 2MTLA 3I0SB 1GU5A 4DL3A 1R0CB 4LSLB 5GAGU 1R3NA 5K8PA 5KLIB 2YNIA 2V8DA 3TR5A 3MPDA 5HATA 2K1AA 4WVZA 2IDBA 1RF1C 3JQKA 4X65J 1QVGO 4B02A 3GZ7A 3K5PA 3PV8A 3D9BA 2H9ZA 1MMDA 3G4SS 4LF7J 1GK8A 2OPPB 4BC7A 3HHLD 3IMQJ 2OFOA 1RHJB 1LWXA 3U1AA 5KAFH 2KXFA 3A0HE 4ZP9A 2HGNA 2G8YA 1ZS6A 5K5MA 3THPA 3GFHA 2LR2A 3CD5A 1RWNB 4ECRA 3RUBL 1NO4A 4LF6J 2Q9IA 2FBWC 2FJWA 2OAUA 5DLFA 4DX8H 4PTLA 5TISE 2IBZG 1NM2A 2MHNA 1UMJA 3T5JA 1JLEA 2FYUK 4DCPB 1TMMA 1YVFA 2HHWA 2BKOA 1X0PA 2CRLA 2B87B 2HW3A 3EVWA 2CYYA 1CG2A 3T6JA 4LIRA 2UV8A 2OFHX 1I3OB 1TELA 4G1QB 2WT7B 3QWOC 4RJTA 3CCLP 4X2BA 4WFXA 1MKMA 4TN2A 5F0UA 2O1JA 2H8PD 1WT6A 2YY3A 1FNMA 5A8WB 1QSSA 4GKGA 3CLQA 4WE1B 5KFAA 4OMFG 2BE9B 2AEFA 1U98A 4JYAJ 1YHQP 2VBYA 3H1KE 5E79H 3D4JA 1NWQA 2R7WA 4WB4A 5HVHA 3GYGA 2MKYA 2KG1A 4Q5VA 5KG3A 2MDAA 3Q8RB 2VQEJ 4WZQA 1X4HA 3H59A 2YKAA 1DH3A 1HD1A 3LGMA 3ET6A 4DUYJ 2AD9A 4IRKA 4OWFA 1YI2P 1NJIQ 2KI2A 3CCQP 5KFHA 2RS8A 2KLVA 1EC5A 4K7QA 1JK9B 2VICA 5D8HB 1JY2O 4G65A 1VQNS 2Y9YA 3PR5B 3DU6A 3L70E 1Q7LB 4C8MA 4DCJB 2X3GA 3C6TB 2V8GA 3E7KA 2KFNA 3M4XA 4QIVA 3KJNB 1UVJA 1L0NJ 4F4ZA 1W5CE 2A6OA 2DGXA 2ZH5A 2UVWA 5GAGI 3KKFA 3T1AA 3T19A 3VTIA 2PFFB 1AROP 2V8VA 5KKZB 4OGQC 2FJVA 1KOHA 3BVHA 2K9JB 3J81U 4ECVA 1WC5A 1XTZA 4USKA 1MU2A 1BCCE 2HPCA 4OX6A 1C1BA 3LWMA 2PRRA 4WY4B 1M5OC 2FD2A 3DDNA 2WWWA 1BQMA 4IL6E 4MYTA 1M5HA 1EKRA 1Q95G 3CCTA 5T41A 2HR3A 2GJ2A 4XK8C 5T7LB 2DNPA 1KD1Q 4IRCA 3SDEA 1FRHA 1VC0A 3HULA 1RI7A 1KBRA 2XNDH 2BQRA 2CPDA 4P73A 3KDPB 2OEKA 3UVJA 2Y1RI 4JV5J 4ZDNA 3C1LA 3UDCA 2B4VA 4ED0A 4ED8A 4X4PA 2ZZNA 4N77A 1VQOS 3L74D 4TQSA 5EX0A 4KE5A 3KHRA 3SCJE 3H2LA 1KS2A 1JLGB 3V4IB 2G2ZA 3E01B 2HIQA 3KLEB 3HVTB 3FX0A 4HHJA 3JTNA 1GMWD 5IT4A 1SKWA 1SC3B 1NKZB 1B3TA 4KTQA 1NTMK 3ILIA 3OR1A 5ITHA 1TL1A 3U02A 1U45A 3H8YA 2DO0A 2IRUA 1VS3A 1EZZB 1QTMA 5FIIA 1VQKS 1VGYA 3E3XA 1RT3A 3V4IA 5CHXA 4NOHA 3D28A 3BGOP 2HBQB 5KG6A 3FUYA 4LR7A 1SL0A 5E79E 2O3JA 2HQIA 2OYIB 2UUBF 1ZR4A 4RUAA 4C7NB 4NXMJ 4DPUA 4IOIH 2KJWA 1Q7YQ 3FBBA 2K1RB 3PYGA 2VBWA 2H5IB 2FYZA 2VA3A 1PJ5A 3CCWA 3S9OA 5CJ4A 4DPYA 5D0GA 1H88A 1KOOA 1VQLP 3HI9A 1NOHA 3U7JA 2WOMA 2R8KA 1S9EA 1ZA2B 5IV3A 5F8LA 1Y9BA 3PRVA 3T1HJ 3KNGA 2VOPA 1SB6A 1GX6A 1W2BO 3JSYA 3HE5A 3HUSB 1JKHA 1U7LA 3AE5C 2P2UA 2M52A 4DQQA 4O44A 1FEHA 4OX9F 2Z30B 2DBBA 2JEJA 1QX8A 1MMNA 2BW7A 3PO4A 3ZTSA 2KVIA 2R7TA 1FDOA 1HQ2A 4WBFA 2R7XA 1N33J 5CZVA 3SSSA 3C6UB 2B4OA 1BQNA 1RWOB 2K88A 1F5BA 3H1JE 4YFUA 1LP1A 2R8GA 3K5OA 1S9KD 4ZOSA 4KKOA 1XMSA 1CQMA 1YRUA 3OJAB 3FBCA 4RW6A 3UCGA 3RK2D 1ZP0C 5DDPC 4DS5A 1NTZJ 2ZJQQ 3R2PA 3TJ8A 2V63A 4GIFA 2WPQA 1NEEA 4FBTA 3S01A 3CWBJ 1RA6A 1XNQF 2ZBQA 3P8CE 1S6PA 4KJMA 4UY8T 1O0PA 2WVEA 1U6ZA 3PRDA 3MUMP 2XI3A 1SJQA 3LANA 1U26A 3MGNA 1OW6A 3GQCA 2XLIA 2MZRA 3HD7A 3D0IE 2D7SA 1DTQB 3M8PA 3FVYA 1LEOA 4X62F 4H4OB 2DH9A 2ZRMA 4WZMA 2KFZA 3SV4A 2GAHC 4RW4B 1ZRTD 4C46A 2QIWA 3VYIA 1FCAA 1QUPA 1URQD 3IA0A 5F8GA 4HYKA 2RUSA 2CPFA 1N5VA 2RU9A 3FGVA 1WKKA 1H72C 1Y5IB 1CQNA 1VJWA 3GG1A 3VN0A 3QZ8A 2YX1A 1Q81Q 2DITA 5D0EA 4U67Q 1AW0A 3PDNA 2HVEA 3IXQA 2KLUA 4ED6A 1JNMA 1BWEA 2E76B 3CWJA 2J9CA 1CC8A 2OPRA 4Y99B 1T05B 1GK4A 3G6EP 1NO8A 2Z2LA 3MZWB 2JJ4D 3TEHB 1IN0A 4KPCA 3Q8SB 5KFDA 4OL8A 4EK2A 3CX5H 1XTCC 1IR2A 2ERRA 3ZZTA 1T8EA 1L3KA 4ZP7A 1F3VA 1N48A 3AOAA 3KJVB 1V5IB 3T5KA 4BHQA 1N54B 5EUHA 3QGIA 4MJKA 2NYIA 2N7YA 5IM0B 1JIHA 2WSFJ 4OIXA 1ROFA 5KJ7A 4GC7A 2J0SD 4OX7A 1G19A 2MQLA 1N6QA 1MNEA 4FYWB 5DQGA 2I8EA 3FSIA 4ETXA 3A13A 2H89C 4WFZA 3L3CA 2RJZA 4KHMA 1Z2LA 3ZZRA 4J91A 5AE1A 2J58A 3D70A 1ZM4A 1J1DB 2IFXA 2JWNA 3TF5A 4K4SA 3S8SA 1T9WA 1NPKA 2D41A 3N9UC 1HW8A 1X9MA 4AE5A 3JSMA 2ZUGA 3RK3C 5DJBA 1FKAF 1RTDA 3R1HA 2V34A 1YX2A 4IH6A 5A6PA 3MR6A 2AW0A 3H4BA 1R31A 4LF5J 3V2PA 1N8RQ 3JSMB 4ILRA 4DV2F 2XMTA 1ZZFA 4GKJF 5E3AA 1WACA 3V6DB 1PCAA 3EGWB 5G4DA 1XN9A 1FHTA 4PSVA 5APVA 5IC6B 4F2SA 3D0HE 3SCKE 4M8LA 5HBMB 2AJQA 3NOCA 2BJ9A 3AH6A 3Q8PB 1Z56A 1NPPA 5L1IA 3G87A 4JYAF 2GX8A 4D3HA 3MEDA 1DQAA 3A7OA 1K0VA 4B3SF 2FHKA 2C3OA 2YNYA 4F0HA 5AW5B 3P6YC 5HROA 2VASA 1RAHB 2Y1IA 2DPIA 3M9NB 1AA0A 4FF4A 5L1KA 1QSYA 4CLZA 4Y00A 1LWCB 2DHSA 2FPHX 1S3JA 4DUZF 1SQXK 1HR0F 2XO6A 1PBUA 4NLOA 2O66A 5LMNF 4B9MA 3V81B 1YJUA 1VF5B 3I5CA 3CJ4A 4M5NA 1HQEB 4UB8H 5AW7B 5DM6Q 1UBGA 1NU4A 1K9MT 1AQTA 1Q8LA 1EDLA 4PD4I 2HPCB 2BXJA 1SKSA 1PILA 4CT8A 4A8QA 2RQ4A 5AW3B 1GNKA 4IOCQ 2QLXA 1QTNB 2K2PA 1HI8A 3CIMA 4U8YA 1KFSA 2IYPA 4NX9A 5JMNA 3ONQA 2G13A 1N56A 1SCJB 1J1EC 4B3RF 1FESA 1WF2A 4NE9C 4PV1C 3CCQS 2QL7B 4QW9A 4DLGA 2RDJA 4NXNF 2WW8A 3SCLE 3G8QA 4JI2F 3G9RA 2MKSA 3IWNC 2E1AA 1R8PA 2AKWB 3DXSX 1Y7PA 3NNAA 5ETTA 1S6QA 3H2VE 3RRGA 2HLTA 5C42A 3OR1B 1SQVD 3P5TL 1KILA 1VQ6S 1WORA 2FIUA 4IFYA 4DU7A 2DNNA 1MN7A 3CX5E 5E33A 4Y0FA 4O0NA 3QJLA 4U7CA 4OV1A 3BN7A 2RF2B 2QJPC 2HHHF 2XS5A 1CJTA 3GLMA 1GH8A 1NH7A 4CYUB 3NKYA 3GU0A 4ES1A 1CC7A 1ZAVA 2E5LF 3QLHA 4V1Ak 2VG7A 2B88A 2PA8D 1LTAC 3QMQA 1HBUA 3T9NA 4C7NA 2L9WA 1DURA 3H32B 3DCAA 4UTGA 4U95A 5KFPA 3AODA 2DR8A 4HKZH 4I6WA 4DMZA 4CRJA 2CQBA 5F41A 3OVBA 2M7SA 5AXNA 3HR8A 2D3O1 1HWJA 4M1KA 1GTWA 3MPVA 4ZPAA 3L70D 4AXIA 1WOPA 2JEEA 4ES3A 3DXBA 1VMBA 4WWSA 3MD0A 2H1YA 3Q22A 3MR2A 4YTPC 2MKHA 4X4UA 4KB7A 3MMAB 4DR7F 3OL6A 3SV3A 4KGMA 5JVGQ 4UOHA 4DCKA 1HNWF 2VG5A 2IPOB 2AGPA 2VB6A 2WQYC 2OTKE 1YJNS 1U02A 4OYXA 3PTZA 3OHBA 3CULA 4AQYJ 1XMBA 5F8HA 3HJVA 2NCKL 3LW5H 4ATNA 3CO0P 4QQBA 1RWWB 2OEPA 3UI3A 2D3OR 1SQXJ 3GG2A 1FO1A 4XIUA 1RU1A 2XMUA 3TX8A 5M1BA 3OFEA 1RY3A 2QGFB 1YJWS 4OI6A 2LQJA 4MYUA 4WFNQ 1PBAA 3R9LA 1J5EF 1U99A 2AP6A 2DIVA 1SQBK 1VQLS 2MKIA 3I31A 4GRSA 5HN0A 2NZ4A 2VHGA 3MUTP 3B78A 5A0YA 4RNHA 1QAIA 1Q4RA 2EC0A 3ZC4A 4ID5B 3MUVP 3VWSA 4HVZA 3I0RB 2BANB 3CW2C 2ZC3A 1ZBTA 4W7ZA 3WU2E 2V2QA 3GIRA 1X9SA 4U96A 2L41A 2CZ9A 1N5TA 4DZDA 4DPOA 2B8PA 1SFCB 1OYDA 4ID5A 3W66A 4NLPA 2HVIA 1MMLA 4ES2A 4JI4F 2JKVA 1XMVA 3GFXA 3TVZA 2ZH7A 4JI1J 1BQXA 2YXRB 5E0OA 1QSLA 3Q8VA 2NPIA 4HH1A 1N7SB 4WTOB 3VGSA 4NASA 1K73T 2WB1D 1FZFA 2EEYA 5KFWA 1XWLA 4FDFA 2OH2A 1FD2A 1XR6A 1N5SA 1S72P 2E5GA 2OO4A 3I5AA 3S6EA 2XWXA 4W7YA 1VHFA 1ZH5A 3VAIA 1TL7B 1OFCX 2HYIB 5KLVG 2AIRB 3GHGB 1LTJB 4EGLA 2WK4A 3JXOA 3OLAA 1RAGB 3D54A 4F4YA 3KZIE 4U3FD 2O01H 3MHYA 5CQGA 3DRRA 5EWFA 1HKAA 3T5HA 2JFKA 3L7PA 4OGQD 3UFCX 3T9ZA 1EETB 3UD5A 3CJSA 5EN1A 4FP9A 2GM4A 1SQBJ 2E66A 1HI0P 3VCDA 2J6TA 3IS9A 1UEVA 5IFMA 2O01C 4AUKA 2WT7A 1LTJA 4N8NA 1WC3A 1JLQB 4DV4F 2KYVA 2XHWA 3EX7B 2V8HA 4RL1A 1FK9A 3H1HG 2CA9A 3OSPA 5ETMA 1DIPA 5AE3A 5KLVK 2GUSA 2OD6A 1XR7A 3OAKA 3QFWA 1Q8KA 2QFIA 2VOOA 1BE3G 4CLKA 4ZLPA 1FAVA 4KGXB 3TAQA 3LP0B 2YNFB 5RUBA 2X1BA 2QFJA 2K9YA 5AXLA 3OR2B 3M8QB 4DV1J 1SH0A 1FBMA 2CNNB 4N5SA 2FXMA 3ILOA 2KZIA 1A9NB 2KL8A 2GQQA 4E0DA 1IBLF 4DR4F 3G6ES 4Y28C 4MKYA 1YSJA 1A6LA 4F26A 4Z1MH 1BDDA 4F0MA 2DGOA 5AXMA 4WFAQ 1LFWA 4NZ0A 3LW5C 3FMBA 1VK8A 5LJ5Y 4UZBA 4A8WA 3PHEA 4BXLA 4HT7A 1LWUA 2DNZA 3VAGA 3GHGC 1OYEA 4R4LA 1FU1A 2XDJA 2PSZA 1R8AA 2GIRA 1UW4A 2J9DE 3DOKA 1L0LK 1USDA 5KFKA 2GA1A 1T95A 3QT8A 4I69A 4KRWA 4YP3A 3CXHD 3Q2TC 1F1BB 3MM7A 5BR8J 4LR9A 4DBQA 3OTCA 2EPIA 4RKUC 2IVFB 1TK0A 4RW7A 2I5JB 2M8DB 2B3TB 5A8KB 4DR6J 1CS4B 2H88C 3MECB 3DLHA 3H1LJ 1SFCC 1IQTA 1LTJC 1L0LE 2OLWA 5C2GA 3HHLC 1B4SA 4NLSA 1FRIA 2J0XA 3RB3A 4W80A 4J9MA 1XK8A 2HAFA 3R5DA 2ASJA 5KFLA 4F02A 1HBMB 3CJ0A 2J76E 2JP3A 1RT5B 4B3RJ 2AT1B 2IBZE 3MECA 3RW6A 1ZETA 2M2BA 4QYRA 5K14A 3BKUA 5DJTB 1SQXE 3SWKA 4Q43A 2BCCD 3V4QA 2EFVA 2IYOA 1N34F 4KY3A 3U59A 2ZNZA 2R2SA 2XU6A 4JI3F 4DDFA 1NGMB 2DKOB 4YDDB 3JTOA 3PYEA 1JLFA 1S5LE 3DI6B 2MKKA 2HLUA 3W9JA 1B7YB 4C0OC 5CMZA 2BQUA 3SZ2A 1E5WA 2F7VA 2IBZD 2CPZA 4X4NA 2C9LY 1ZM3A 1TUGB 3HX9A 2CVEA 3CT9A 2OYHA 4R5PB 2ZH9A 2OQQA 4I6MC 4GMKA 3DLKA 3H1KG 2QMXA 3UCZP 1NK0A 2YKQA 1VFJA 3II6A 4OI0A 1OIPA 2CJBA 3IF4A 2G4BA 4ZVRB 4PSAA 1S6OA 2WVDA 2KS1B 3GE9A 4YR3A 3CDEA 1RU2A 1SQVJ 1WSVA 3HHLB 4Y99C 3AEGC 2DXEA 2KHCA 3POTB 2GA7A 1LOUA 1TKTA 4EOTA 3RGUA 5HL7Q 1VBXA 4FYVB 3GF3A 5L8RC 3E1IA 3KDOA 3M2VB 1JJHA 4YR2A 1L4AC 3TAMB 5GTHH 4J5OA 4NEZA 2D1CA 2Z4EA 1GFWB 1NVOA 1S0MA 2QLJB 3RR8A 5E7OB 4DV7J 3MMCA 1DD4A 2VL1A 1PYSB 2YO3A 2R7OA 2ZDOA 3DYAA 4J9RA 1SQQK 2Z2MA 3KYLA 3PKYA 4CLLA 3FZBA 2PIIA 1FZBA 4M95A 1BGYJ 3DGPA 1S0OA 2ZRFA 4R0EA 3HKWA 4MIAA 4DZOA 4RO0A 4LVOP 1ZM2A 2HVHA 4PO1A 3WBZA 1UAWA 5JJBA 1KB9H 3L70J 4MK9A 1HYSA 3R6GB 3MTJA 1IM6A 4YEAA 3I82A 2PMHA 1NKCA 1S1VA 2LDYA 1RT1B 5CJ0A 4WU3A 1KILE 3FEXB 3NFQA 4Y2KA 1WNEA 3M0DC 2VDHA 5I3PA 4ZLNA 6AT1B 4ECWA 5HVGA 2WVRA 2DO4A 2GIQA 3RB0A 2IJNA 2IBKA 1BDCA 2H43A 3IWLA 1P84H 3EUNA 4Q8EA 4UQGA 5D3GA 3A12A 1DLOA 5ETOA 4F2RA 7FDRA 2BBEA 4F25A 2XTJP 2IC3B 2OEMA 2JR8A 2Y0CA 1J1DC 3OSNA 3OTEA 2DNOA 1NU1D 1SQPD 3QNWB 2JJLA 2FHJD 4PCQA 4YB5A 1DX7A 1Y3KA 3PW4A 4H4MB 4JI6F 1FRJA 5DDRC 4RZRA 1NSAA 5KFUA 2FVPA 1IKYB 1OY6A 5A0YB 4P72A 4XPEA 5FLXU 5HQLA 2OYIA 3AHPA 2FYUG 1JLBB 1NK7A 4RBTA 3KK2A 4QYZK 5KFQA 2CQIA 5IC4B 1O5JA 3FBFA 2O1KA 2HKEA 2Z8QA 2VBZA 3SMZA 1HMVB 5AW6B 3N01A 4I1LA 2XB2D 2W9AA 4H13C 3TUJC 1RBOB 3MDFA 1YIJS 1QVFO 3IR9A 3X3UA 2HS4A 2KXNB 2E9RX 2ZT9B 5CCGC 1FZCA 2DTJA 3I4HX 3VAJA 2EG1A 1WI8A 2RRAA 3PLNA 3OHAA 3PW7A 2A06D 2HK3A 2JDJA 1YJNP 1FTRA 3QFHA 4CM2A 1Q2NA 5C39A 1KN6A 2YWGA 3CC2P 3EPGA 4TLQA 1LWFB 1I51B 1PC4A 1UETA 2V7QJ 1G6BA 1NK4A 4A8OA 5KTBA 1GXLA 1WD6A 1WHYA 4NCAA 5KT3A 1KTMA 2C3YA 1U49A 4GODA 4Z7YA 4M94A 3EFFK 2W7AA 2E29A 3GYNA 3OBIA 4K4YA 5B66E 2ASDA 2ODNA 2LVWA 4C11B 1TL5A 2AQ4A 1VF5C 1JMMA 4IL6X 4MIBA 2B43A 3CDWA 1OY8A 1JY3P 1KTVA 5DRKA 5HQMA 4G1PA 1BXNA 2GJFA 5HMXA 4AL6A 3BJYA 3N0VA 1SQPE 1X4DA 2IA0A 3CXHI 1C0UA 2J6UA 2PGDA 4NPDA 3V6HA 4GKJJ 3CUNA 3G82A 3CPWR 2M5AA 1H3DA 3WHIA 3H90A 5CBNA 3HFZB 1FE4A 3AEDC 2N3LA 1K9MQ 5IS2A 4Y2IA 5DZ7A 4RNOA 3FCWA 4ZVFA 3A8EA 2IMOA 3C66A 1LWUB 1QVGR 3W65A 3RBXA 4B3TJ 3PEHA 2QIFA 3GLJA 4HTIA 3KLGB 4OJHA 4YQWA 4UT4A 3NMDA 1XNQJ 2XO7A 1GAOA 2V50A 4HB1A 1IKVA 2PDAA 4PPQA 2IRYA 1J2JB 3MCMA 3J7YU 1JLAA 2R5BA 4TY8B 1SJFA 4PUOB 1FXRA 1JLCA 3Q89A 4LF5F 4I7ZB 3IAS9 1BD6A 1ZV8A 2CPSA 4W92B 5HVFA 2GV1A 3KLGA 2EBEA 2OSQA 3AEFC 2P9CA 5DJUB 1G2EA 3HO1A 4LF7F 2N3OA 5APUA 4OV6A 4K4TA 1TK8A 1V3ZA 4JOUA 2OFGX 2B8QA 3R5BA 3SOOA 3CCLS 5APTA 1NXIA 2BE7D 1H8AA 1G2CA 2HHHJ 3UD4P 2L08A 3W61A 2KI7B 2HLOA 3KLIB 1VQ5S 1P84I 2KXPB 3KHHA 2AV5A 2NXJA 2CADA 2DNLA 3EZOA 2W6AA 4LR8A 3UIAA 4U7UD 3CCEP 1NTMD 1WTBA 1CJKA 4ZKAA 2UU9J 2DEIA 3IGVA 5I42A 2R8JA 4IUFA 4PD4D 5GADU 2YWEA 1MO3A 1P84D 1TUWA 1MG7A 1SQEA 1RF0A 2VFRA 3KLVA 4TKTA 3M2RB 4EYYQ 1S77D 3AB2B 3IM9A 3FC9A 4L73A 3VTPC 3H42A 1HBNB 3GJTB 1N6QB 5JRJA 3IP0A 3AJDA 5HK4A 1TTHB 3C19A 1VL2A 4ZHRB 1VQNP 4PG7A 1HA1A 3HHDA 2E5JA 3RZAA 2NQPA 1N73A 4K5RA 4N78E 4B3MF 2VPXB 2LCWA 1IFJA 2GVDB 1XJWB 3QJPA 4HR2A 2E1CA 4H4KC 1NTMJ 1HGZA 3RK3B 2E42A 2HWHA 2YTCA 5C25B 2SPZA 3GV5B 1KR4A 1H2UX 3FFIB 3CMAP 2YNHB 5APYA 2YPZA 1BMQB 2IVYA 2R42A 3K5MA 2ZRNA 5E5NA 5HO4A 1RLDA 2XSJA 5K5GB 2DGWA 4LRDA 2PEBA 1FKPA 3PX0A 1NK6A 1T3OA 1BE4A 3L95X 5C42B 1S6QB 2VQFF 2WZ7A 5JXSA 4EUVA 1UIIA 2XM3A 2KKHA 2K1RA 3CD6S 1IUJA 3MPWA 2DNQA 4IFVA 2QJKB 5A8WA 1IJDB 2RQMA 4PO8A 1N0VC 1VOMA 4DR7J 3RYLA 1VQMS 4OLOA 4FPIA 4C8LA 4WJBA 1L0ND 2RDDA 3BGRB 1EKSA 2ZWPA 3IR7B 2G2YA 2PI4A 3V2RA 1VQOP 3DOKB 1JXEA 4ZPCA 2N1TD 4BBYA 1X60A 3MD3A 2DPJA 3CXHE 1LK7A 2C2DA 2E1RA 1LWCA 4ILLA 2MLYA 2Q3PA 3ENQA 3R5AA 4I2PB 3D6FB 2W7PA 2HAIA 1UVIA 4QPXA 4F4AA 2AYBA 3H1LE 4YXWH 2YXQB 2NUHA 4LF1A 4LFAF 4DQIA 3HD1A 1VQKP 3CJ3A 2YIUC 3VMZA 1MFZA 4AQRD 3MMCB 4OX9J 1EDIA 2FLLA 2H54B 1D1UA 2W2PP 3BEGB 3F41A 1WHXA 2K7KA 1TVRA 4D6TG 1IXKA 1O8BA 2ZNYA 3MFIA 2C9NY 1WDDA 1Q8IA 3W64A 1GEHA 2KVQE 4JI4J 4WYWA 4F04B 1X5SA 3O1LA 3I87A 3WUUA 1TR0A 2FFDC 4W98A 2EWHA 1IO4A 3G6YA 1WWHA 2CWXA 1PP9J 1O6XA 3D6MB 3CCSS 4TYBA 3TUPA 1H0TB 3OLBA 1EQMA 5AT1B 1URQC 4CO3A 1FZGA 4ICLA 2H4YB 2GHVC 2O1PA 4BWJA 5AVVB 1PIXA 2Y9HA 2DHXA 2M4MA 1EXIA 4RPFA 4C3MA 4LRCA 3L71E 4CLUA 5LL6d 3QGPA 1BCCJ 4ZVEA 2QA4P 2KO1A 3W3SA 4ZVHA 1UEUA 2JC0A 1T05A 4JI0J 4OZJA 4H4OA 3KNAA 2ZBRA 3BH7B 3C15A 1C1CA 3M0DA 3L09A 1U0SA 4PYDA 2I1KA 1WI6A 4U3FG 3CCUP 3SQOP 1S9GA 4N76A 1RCXB 3GJRB 4DUTA 3NCRA 3QH9A 1N4LA 1FFSB 3ZZUA 5KAIH 2CNLB 4IQXA 4QR0A 4IDKB 3DYAB 4CPGA 1KKHA 1K1SA 3A3YB 2ZRHA 3LUYA 2JHEA 5AXKA 3MCOA 2VC0A 2YIUB 3G8SA 3I96A 4USIA 4P9SA 3CC7P 2C28A 2RVJA 5GAHU 3QGHA 2M88A 2EC2A 4K35A 1HPZB 1G7CB 1TQLA 3HP6A 2HSEB 1NKBA 2DGVA 1XP8A 4KV8A 1FWLA 3PH0A 2QZ8A 1PJ7A 1KFDA 4DV5J 2HZAA 5KFFA 2NPSC 2LXUA 3V6JA 1J2VA 1JY2N 3LP0A 3PX6A 1Z4UA 3EJMA 2PD1A 2I1RA 3M1VB 3M7VA 1B0TA 3PRJA 1BHNA 2UU9F 2HGMA 4JI7J 4NA1A 3K17A 2HHVA 1KYOE 4EO8A 1Q81T 1P9QC 1QY7A 5GMDA 3THTA 5GAEU 1HI1A 3A3PB 3GJSB 3B4SA 2JRSA 4C3KA 3AJ2A 4EWTA 4OYOA 2FTRA 3W1YC 1GL2A 3KK1A 4IG0A 1CJVB 3GIIA 4DQSA 3TJ9A 3TGUE 4YB1P 3LGHA 4ZPDA 3CNQP 3M05A 1S48A 5GAEI 2JLGA 1HNIA 2AJ1A 4PXBA 4EZ9A 1FDIA 2OPRB 3AFGA 3MCNA 3GSDA 3CWBD 4DZ6A 1QGKB 3WIVA 3SFGA 2ZXXA 5J2NA 3NOGA 3IWXA 2Y1JA 1VDHA 2G88A 3ET6B 2OTJP 2BEFA 2KHDA 4A8MP 2FLPA 4PXEA 2GGPB 4GO7X 1S97A 4X4QA 2F1FA 4FPRA 1AA1B 4BCAA 5AVUB 2E7VA 4CTAA 3IRXB 3N6NA 3SFUA 2W2NP 3OJUA 3NMRA 3IR6B 4F4KA 5A8RA 1M1KT 1Q1KA 2QMWA 4ZP6A 1HWLA 4USVA 1R89A 2V0NA 3QQCD 4EBCA 4LFBF 1NTKK 3C3LA 5L38A 2BM0A 3DRRB 1L3TA 5K8MA 4DV3F 2MJNA 2B7CB 4BLGA 4M63A 1S1WB 5TJHA 2ZH6A 2JWAA 2IIHA 2XEXA 1WSRA 2FYNB 1C1BB 2BJEA 1MU2B 2WW4A 1SFCD 2IFMA 1HBNA 2BDPA 4LFBJ 2BEQD 5CXTA 1NSPA 4QCLA 4C7QA 1L2PA 3CJKA 2Y0SD 3H1JD 3MZIA 2JZ5A 2R44A 5J1NA 5APSA 4NZ7A 4I68A 3VOPA 1NZ8A 4FNIA 3TQEA 5CA5A 3OL9A 1QM9A 4PABA 3AA9A 4ZJLA 2D74B 1Q16B 1VRQC 1VPCA 4A8YA 4IFYB 2VIHA 2WVBA 4XAKA 5DETA 2PI5A 2J9EA 2HWTA 2V68A 1F9EB 3FJ2A 5IWAJ 1OXZA 3WDOA 2ZHBA 1LWEB 3ITHA 3CE8A 2MQNA 4H54A 5DO2A 2B5JA 4ZLJA 2EK1A 5LM7E 2OP5A 1KQFB 4PSKA 3Q8UA 2F8HA 2CQ1A 3DOLB 1IK7A 4C98A 1GU4A 1BGXT 1YITP 2J8AA 2QJYB 3NCPA 4USUA 4K0KF 2PMZD 2RD5C 1N86A 4K50A 4ZNCA 1BGYE 4Y65A 4TLFA 5AW2B 4ECTA 1BQMB 2JOQA 4JPZB 2HFED 3MCSA 3GB0A 2N4DA 2E5YA 2A2CA 1FJEB 4F0KA 1FRLA 3L75E 1BE3J 4ED3A 1EQ7A 2LXCB 1DTTB 1Y5LB 3MR5A 2AHOB 3KUEA 3PRBA 4IH5A 4WP3A 1WEYA 1N73C 3MMAA 4ED7A 3QT6A 1RAIB 5AVXB 4H13B 1R5LA 2BCCG 2P6TA 2C2KB 1FI4A 1MUUA 2GVZB 4LSZB 3OTBA 3F89A 1QE1B 4NYOA 3R1LA 5IQQA 4I6AA 4ZCKA 5APXA 3VR1A 1RKIA 2LXFA 2VG5B 1KDNA 4O3SA 1YLXA 3QZ7A 3QWUA 2X51A 3LTOA 4J9UE 4YS2A 3E01A 4Q44A 2OPQA 5LMUJ 1Q82Q 2Q1LA 4D6TJ 1LWUC 1YHQS 2GJIA 3C16B 1MWYA 3IAM9 4OZ3A 3L71G 1UFLA 2ZVOB 2ZRJA 3CD6P 4DFJA 1X5TA 3TI0A 1Y9OA 3IAOA 4KH0B 1YDLA 2QL9B 3HTKB 2RE1A 2XG8A 2ZXEB 4LC1A 4X4TA 5DGBA 1LV5A 3SDEB 2CDQA 3L73D 3GWCA 2X7IA 4ZJOA 4MFBA 1OQ6A 3RK3D 3W68A 4DG1B 3DRSB 3SYZA 5HQ8A 2QMUB 2W8KA 4UB6H 2BANA 2ROPA 5FDLB 1R8HA 4L75A 1IKXA 1YZ6A 3MAAB 3PIPQ 2DGUA 3JAMU 4B3OB 1HF9A 1Y10A 4TU8A 1S1TA 2FJEB 1VQ4S 2CJAA 4DV6J 2L48A 1NB7A 2F40A 2VBXA 2HWIA 3H5UA 3R27A 5D78A 3A8JA 4RX6A 5A2QY 4OJ3A 1RT3B 4DUYF 3QIPB 4JBZA 3GFZA 4ZPTR 2HHQA 4DN9A 2QLFB 3SQGB 1TL3B 3DLEB 1FX4A 3ISNC 2YBVA 1UJ5A 3K59A 5LJ3Y 4WCEQ 3AD9C 5MLCV 5K8OA 4DV5F 1K44A 4PQFA 2WHOA 1Q5VA 1C0TA 2XV5A 3VP8A 2MZQA 1NUEA 1U47A 4ZCIA 1NTZG 1T9UA 2RH3A 1VF5D 3BSOA 1QAJA 1GMWA 3H1KD 2FQQB 3GTYX 2HURA 1NDCA 1U8WA 4PPNA 1V6HA 4RESB 4NCGB 4NMXA 2RT3A 2W6JH 1WC0A 3D6YA 1KN7A 1IC2A 1NTZD 5G0RA 2IFNA 1B64A 1IBKJ 1HVVA 1VQ9P 1JEKA 2UUTA 3UDVA 3MR7A 2ABYA 3TYYA 3EWGA 2KZZA 2C2NA 5HLFB 1SJ1A 1OVVA 1QEXA 4PR6A 2YVSA 4EYIB 1TZ0A 5L9XA 5DQIA 4JYCA 3KJVA 1IVZA 3KK1B 1P1TA 2DR9A 2WPRA 1C2PA 2PP6A 2FZKB 3D1QA 3EZUA 3FRYA 2YKPA 4POAA 3KHGA 3TW0A 2BJ1A 4TVAB 1I5OB 1WF0A 5KOXA 4DLEA 1FDDA 1NU1K 1N5YA 4NXMF 1ZTWA 3RBEA 3K7RA 1NJYA 4WK1A 2E43A 2YMYA 4KGKA 4PR0A 1S7IA 3Q23A 2DNYA 4KHPJ 4GKKJ 4D3GA 4QIWD 2B9WA 1YQ4C 2HRTA 3M8SA 4W90B 1Q79A 2UXCF 3L71J 3P7KA 1E6VA 2HFVA 3IR5B 1FVSA 1U1NA 2JLEA 1N52B 4LF4F 4M3LA 3K5LA 1D09B 3AECC 3A1YG 1RYRA 1NJIT 1D3WA 4PXCA 1KV4A 5BXIA 1K05A 1TAUA 3NAIA 2OYHC 4DN0A 1IJEB 3CCJS 7AT1B 1XNRF 1NTZK 2QEXP 3MIWA 5B0BA 3AD7C 3QAUA 4XPCA 2V4JA 2MQOA 1IJFB 1VQYA 4ECUA 2FYUE 1ZR2A 2DIUA 1AQ5A 2DRDA 3BS9A 3RBZA 2NUUG 2QL5B 1OW7A 4HKQA 1TL7A 1R43A 1T9TA 1C1CB 5APWA 4K5SA 5IT9U 2H7HA 4KC5A 1IBMF 1CS4A 7FD1A 2ZT9D 1MWZA 4UUWA 3H5SA 2BJ8A 2GC8A 3S4RA 1PL5A 4PV1D 1X0TA 3M6UA 2MEWA 3M32B 1RE3A 3Q5SA 2JO1A 3WU2H 1QAXA 4I6YA 4IRDA 1ZPWX 4OZ5A 4YOEA 2GIFA 1SV5B 1FWKA 4UOGA 1XERA 1Y47A 2QSWA 2HNZB 4Y2CA 3DLBA 3PW2A 2BABA 1LXJA 4OYZA 2G2OA 1F3FA 1RABB 3ZZ0A 2VD3A 1KVKA 3M6VA 3BATA 1PYTA 2FHJA 4DSIA 2W83C 5H2FH 3LPEA 3HZEA 1ITPA 5T7LA 3JYTB 1ZOTA 3B82A 4A8SA 1SC6A 2RQKA 1KVIA 5F8JA 3CEDA 5H9FJ 4Z37A 2HBZB 3KDNA 3OTOJ 5DLGA 5A6WA 2HNYB 4ZS6A 1T02A 3FFIA 1IQZA 4K4VA 2RKLA 5KFTA 4EZ6A 1EX8A 3H1HE 1JTHA 2B56A 3PNIA 4ASVA 1EDKA 1TU0B 3FQLA 3NGKA 2D3UA 1GQEA 4LLHA 1RACB 1D9AA 1KQGB 4NLWA 3P8MC 3IS9B 1RF0C 1FJCA 4J9QA 4CYUA 3BKFA 1EZVG 3L73E 2LYVA 1T94A 2ZDPA 3QAEA 3AE4C 3UR0A 4LF2A 2N1TA 1K04A 5KLVD 3DHXA 3ZDMA 4MTPA 3ZTRA 1KLMA 1N7SC 4QYZJ 2DH7A 2CPEA 1YG0A 1URQB 2AMCB 3U1CA 4CM0A 3B8EB 2GCFA 5F8MA 3VAHA 3MR3A 1V3RA 1X0FA 1RXOB 3M8QA 2M3BA 4DX6A 1ZRTE 4NLTA 4RW9B 5D4OA 3OW2O 2BMBA 4AQYF 1SJRA 2WSCH 3DOLA 4PJ0E 2FHOB 2W24A 3N28A 2DB1A 3RB6A 3W2VA 1VK3A 1S1XA 3CCVS 1FRKA 1JXLA 2DGQA 1S59A 3J80U 1NMEB 3K5NA 2WSFH 3BQ0A 1PYOB 3TA0A 2OMLA 4Z7CA 4ZPWR 1FDMA 1SLQA 3PXGa 2NXUA 6FDRA 5BJRA 3AQOA 4LUBA 2KU7A 5LSLA 2XI2A 2K06A 4B9NA 5EX3A 1CJKB 4I2LC 5F3ZA 3BPDA 2E74B 2VU5A 2QN6B 4ZCMA 4O4GB 4WIIA 3W2VB 1K47A 1RH5B 3QSYB 1WC4A 3USSA 4CLTA 3BYPA 2DY1A 3AAWB 3TJAA 5BVZA 3BR8A 2EW9A 1U4BA 3HJFA 2O67A 1VLYA 3BDPA 3EYZA 2Z2YB 1FFGB 3JSBA 2ACYA 2CQGA 3TGUJ 2V6AA 3QO9B 3OXLA 2W27A 3B5NC 1T0TV 4F36A 1KRPA 1N73B 2HODA 3BCCD 3VF0B 4USTA 3C9IA 2C3UA 3NGTA 1HGVA 1M56D 1LTGC 1U1LA 1OMIA 1FKOB 1SQBE 1FJPA 2WZ1A 1R8CA 5DG7A 5D3GB 2UXDJ 2ASYA 1U1KA 1YITS 2FDNA 3HE4A 4M5JA 1UVKA 2R7RA 2E75C 1YBAA 3CO9A 4USWA 2GNKA 1F5CA 4H4MA 2UUWA 4N3YB 1YTZT 3DLLQ 3RL0C 3VV2B 1SUQA 5KFGA 2GHPA 1XNRJ 2IM0A 3KXDA 5HMWA 1NZAA 1RB0A 4RUBA 2DNHA 2Z57B 3BPSP 4O3PA 3UW1A 3P5BP 2Y3YA 5CCMA 4WFYA 1QLED 4KO0B 5L9NA 3BF4A 2H48B 4PV1B 4LJMA 2HBRB 1U1OA 1SQPK 3EFGA 4DSJA 2EKYA 2NSCA 1QDUB 2VQFJ 1EJ7L 1AZSB 2K3IA 4ECYA 3VHQA 2ILZA 3CB4A 1VQ7S 1UVMA 1HHSA 2ZJRQ 1SH2A 1REVB 1NH8A 1CJTB 3SWFA 2N7CA 5CCLA 1A02J 2QSFA 2FUG9 1L3VA 1M0SA 2M3EA 1RAJA 2DH8A 4KH1B 1HBOB 3Q1MA 3KJQB 2E76C 4FN5A 2Y0DA 2VZ9A 3CXCR 3UDEA 2V9KA 3W2WA 5KFVA 4EMDA 4USJC 2YPYA 2ZKUA 1UBFA 1WDTA 4RR5A 3TRGA 1KQSR 2A2DA 5JUMA 1YYCA 1KYOD 1UEKA 1A7GE 1L0NG 3ILJA 4QR1A 4ASWA 1OIAA 5CCHA 3CI9A 1VLOA 3IO1A 3GCWP 2MY8A 1FEEA 4J37A 1LTIC 4HH2A 1FZCB 1C4CA 2E9ZA 3G82B 4F50A 2V2ZA 4X62J 3ENWA 2O01J 1M90T 3DC2A 1HPZA 4DU8A 1U6FA 4OYMA 1OMSA 2DCLA 5KAKA 2H4WB 3HVAA 4UOFA 3CMEP 4N41A 2OPPA 1PP9G 4QW8A 2VPYB 4C8YA 1P8GA 2X1GA 3T5LA 1HWTC 4DQRA 4N78D 3TZWA 3AE2C 1AB8A 3JQJA 2IHR1 4K2XA 1RTJA 1YBTA 1XIQA 2FYUD 3IN5A 2XMVA 2NXCA 3KHLA 1RP5A 2V4JB 2XULA 3PHTA 3UD3P 1QUVA 3HDSA 2UXCJ 5GVQA 1RDRA 1VQ8P 2O01N 2MKVA 1F2HA 5FLXY 2HHUA 3MTUE 3W60A 1PV3A 3D66A 1W2IA 1UTAA 3VQSA 2GQ2A 2CAJA 4B17A 3PP5A 1LW2B 2ZR9A 2ZREA 1NHUA 3PY8A 3M32A 3KOAA 5HJXA 5J2NB 2MKJA 2QO3A 3L74J 1R0AA 3HXMA 3O5TB 4J9OA 3GR0A 4ANCA 3MM9B 2V2VA 3A2AA 4PEOA 2KFYA 2R3CA 2YQ0A 1SL1A 3JS9A 2YKNA 4HEA9 3UNYA 3WC0A 2BOPA 5KAFE 2Z2ZA 2EBGA 2YH1A 2XS2A 1TAQA 2DXFA 4K4UA 2UUAF 1H7XA 1X31C 1X4BA 2CZ4A 2LLZA 2NXNA 3D71A 5GMKa 4CH0S 1MFTA 4CNZA 1X7VA 5L46A 2OMOA 1U1QA 4EEYA 4IL6H 1Q8BA 4LIWA 4J9VA 1XBWA 4JF7A 4LQ3A 2MQ8A 2JC1A 4JV1A 4O3RA 2ZRKA 4X66J 3ZNUA 5AW8B 3TX0A 1ULRA 2HRUA 4PG5A 2A06G 1Q0NA 4U6PA 4F4XA 2V9WA 3RR7A 3A0HH 3SSUA 3TNUB 1KILC 3T41A 1FRXA 2XY5A 1XC9A 2R7QA 3P4UB 1M1JA 2UWJE 1VQ5P 4JI0F 3D3BJ 4N56A 3MUDA 3TA2A 1AUDA 2FZCB 4ZMDA 4U3FJ 2MY7A 5B0DA 4ZVGA 2HNYA 1RT5A 2ZM6F 2F8MA 1YRXA 2W9CA 3LAMA 3R6LB 4NPOA 4LMZA 2FJXA 2NSBA 4K4ZA 3ZTPA 2ZAEB 4J9SA 3EVOA 3NS5A 2ZHAA 1WJ9A 5H9EJ 1YTZI 2W9BA 3H7HB 3M8RA 2JSXA 4ZJQA 4N8OA 1HQUA 1EHWA 4QOTA 3VGUA 2EFGA 2FGOA 2H3EB 2JVRA 4C0BA 1DBDA 3EPIA 2P9GA 3DI6A 4BWNA 1OS5A 1REGX 1U0HB 3GIMA 3GG0A 1S72S 4OYAA 1JM0A 2RRNA 4DR3F 3QWPA 3CX5D 1HHQA 1U1MA 1TV6B 2P9EA 2Q43A 4PAAA 1RHUB 2LA4A 3NNCA 4R5PA 4I2PA 5GTHE 1WOSA 4P2MA 3D1OA 2YKMA 4O3NA 1EP4A 1X8DA 2AX1A 1X4GA 2GMJA 2DR6A 2CNKB 3I55P 1UWBA 1OO0B 2AZ3A 2QT7A 4NI2B 1E6YA 2BZ2A 2M5YA 2CVIA 3HE5B 3HUSA 4ZVOB 1JJCB 2Z0GA 2Z5IA 2E75D 1U24A 2YQ3A 1X9WA 1JKHB 3H1JG 4E8UA 3BO4A 1FKOA 2HHXA 4MAKA 2QJKC 4M5KA 3I9V9 3I56S 1W2BR 4PWWA 3MGJA 1R0BG 2IMWP 2KTQA 3M30A 3V2UC 3AQPA 3D7SB 1FXLA 4RW7B 1WF1A 3ENAA 3LIDA 5CZXA 1M1JC 1FERA 5A76A 3WUTA 1OJ4A 1DEBA 4EDFA 4NLDA 1S1UA 2R3VA 5IWAF 1GXUA 4NLXA 2AGQA 1TUVA 1TFYA 2C22A 2QE5A 4D6TD 2CQDA 3D6HB 1WC6A 3NS6A 3CDAA 3L36A 5KG4A 1BLUA 3AA8A 1S57A 2JFDA 4PG8A 2OYIC 4Q0BB 4JP8A 4ZN3A 3L75D 3BO2A 3HKZD 1W25A 2OJ3A 1TU3F 5DDOC 5CABA 1DQ9A 1EXJA 1HBWA 4KAIA 4RW4A 2JRBA 3J7Z5 3R97A 4I56A 1N36J 3GYXB 1VRUB 4RW6B 4U7JA 3GMGA 4JV2A 4KO0A 3IBCB 3JCUH 1ICEB 4ELTA 2L91A 2UXBJ 3TZYA 3PX4A 1YBKA 1N7SD 3MMJA 4KHPF 2MPUA 2AJ0A 2DRAA 3DLEA 3UN2A 1W2EA 4XDDA 1J5EJ 4YY3J 1NJZA 1S9EB 4TT3H 2M70A 3SFDC 4ZKPA 2ZOGA 4H44C 1NAQA 3HVRA 1HNWJ 2XMWA 1RHRB 2R2UA 3H32A 2YX7A 2F3JA 1BSHA 2KS1A 1DAXA 2CKWA 4NL5A 4ETZA 1KHWA 1S99A 1JWWA 1L0NK 3N6MA 3N6LA 1GW4A 3MEEB 4H0LC 1S76D 2KT2A 1IFIA 4PQAA 1U2CA 4DCOB 2W8ZA 3T97A 4OZ1A 1IBLJ 1YK9A 5LT5A 1WC1A 2CJKA 2GS8A 3K89A 2Y9ZA 1BQNB 1JNZB 4QWAA 5GAHI 1SQVG 4OX8A 1LP1B 1FZEA 2VH7A 3NGRA 4F8RA 4FYDA 1T11A 3W9HA 1DZ5A 3T6BA 3AE9C 3JSVC 2B4PA 3O6QA 1M1GA 4F3OA 4OYWA 3W5XA 2GMHA 2E1PA 1OPZA 4W4MA 4DL0C 3BGFA 1EETA 1BE3E 3QPIA 2J6SA 1LNQA 1IR1A 3T97B 4BDPA 2B0GA 4H4KA 4RKUJ 1WHVA 4OQFA 1NTME 2KM8C 2OIHA 2AJFE 4JUZA 4NYZA 1AFOA 1ZLLA 5DG9A 3O6QB 1S49A 4RU9A 4QWBA 1U09A 3M8PB 5KFYA 2M9KA 2VKRA 2D2CC 2M5AB 2IM2A 3EQ2A 5KTQA 3M9HA 3MM9A 2OELA 1KC8T 4ZITA 1S10A 3L70G 2MXYA 1M90Q 3Q8QB 2BE2A 2FYXA 3PKMA 1H7WA 4UF4A 3OFFA 3EM1A 2XYGB 1IBCB 1RHKB 5E3QA 3AE7C 2RB7A 5C24B 5EHHA 2MHEA 4IYQA 2CPIA 1RTHB 4LBHA 1RHMB 1IFPA 1RADB 4LF9J 2HEKA 3BREA 2VQEF 2C3PA 3AOCA 5KFBA 3ETOA 2OYOA 3CJTA 1N2DC 2BW2A 3L71D 3QIDA 2WB4A 3QBCA 2V5HG 2HFNA 3JQMA 2IAJB 1AVYA 1JLBA 1G1IA 2ZC4A 1S9GB 2IRXA 1KILD 4I2QB 3KK2B 3RK2C 2AXCA 5A8RB 3M9OB 2DEJA 3LA0A 1GL2B 1IWGA 1HMVA 1SQQJ 1CJVA 1OZHA 2COLA 3QSIA 3RU0A 2Q6QA 1TKXA 1IWAA 1KP6A 1IZNB 3US5A 4Y34A 1LFPA 2YH0A 1SXLA 1PIEA 2BVZA 1NU1E 1M5VC 4DSEA 2DD8S 5ETVA 3OJSA 2RUGA 3FKBA 3MUDC 1XR5A 1KSPA 2B7BB 4PWDA 1FA0A 3C6TA 4L3KA 4RW8A 1JB0C 4YDXA 4O0IA 3UCUP 3MEDB 4C8ZA 1HJBA 4R8UA 2HHSA 1FXDA 2IA6A 1S5LH 1LK5A 3JYTA 3ZFVA 3NXSA 4KHRA 5HROB 4NRTA 4Q8FA 3FSXA 4NLVA 1HBMA 3RL0g 4OI4A 2HBYB 4WTYA 1RKJA 1FNXH 2MZTA 1HWIA 5L39A 2WSEH 1G4CA 2W2QP 1U7MA 1JTHB 9RUBA 3CF5Q 4B9VA 3P8BB 1C0UB 2LEPA 3KG4A 4HYTB 2VV5A 3SWYA 1ZMEC 2ACMA 1PKUA 4MIWA 1UVNA 2RAQA 2E44A 2GVDA 5CYMB 2DHGA 3OR2A 2E75B 2VC1A 4P6QA 3KG0A 4YR0A 1FJGF 2EFOA 1OVUA 1B7FA 4DSKA 5CCGA 1FZCC 1YGYA 3K0JA 2QM8A 3MPYA 5DM7Q 4LF9F 2AYEA 3MAHA 1I94F 3K8WA 1VBYA 1L0LJ 2JWDA 5AVWB 3QLHB 2CFXA 4K2JA 1P1LA 4H44D 1FWPA 3H6PA 1JLGA 1SI9A 2B89A 1BC6A 4UOCA 5I42B 5A2QU 1OW8A 4QIEA 4DR6F 2AYMA 4URSA 1HR0J 2UUBJ 4DS4A 1HNXF 2WVCA 1CJUA 2BM1A 3BDEA 3TO8A 1P84E 2MGZB 4DFKA 1M1HA 3MWBA 1TV6A 3ETMA 1EQ0A 1M7LA 5LSOA 2KDOA 5EWEA 5CBOA 4R4MA 1EP4B 3H0PA 2CDRB 2QE7H 2KH9A 3SSRA 1S1UB 1TKTB 3WX8A 5AW9B 3P96A 2L3MA 2CNOB 1LJ2A 3A8KA 2OPSA 3K5BA 3NGDA 1R27B 5E3RA 4M5MA 1L0LD 3RB4A 1Z1ZA 4UUXA 2YWFA 5IQ6A 4JI6J 1H98A 2XLJA 3ENVA 2IJRA 2A1BA 1X5PA 1YQHA 3BRVB 4P52A 3D3CJ 2OE2A 3CCZA 2IYIA 3RG6A 3U1MA 3H1HJ 4NXNJ 3P49B 3OTDA 2M8HA 1RWPB 2VFSA 4QU6A 1YRTA 4QZVB 1SQBD 3VVUA 4KPYA 5LXYA 4DV1F 4DEZA 2OI2A 5K14B 1PPJG 1LQ9A 1X9VA 2HFOA 1KB9I 2DR7A 1EZVI 3NAHA 2MZ1A 3KFWX 2NREA 2F9DA 5IV4A 4XA4A 2WBRA 3HD7B 4HI1A 3HUSC 1RWVB 3CC4P 1LT1A 2RHSB 2BKPA 4WXWA 4KSEB 1HNVB 2V94A 1N7LA 5DQHA 2B6AB 5HAOA 1N5QA 2KIKA 3L72J 3DM2A 2QLBB 2EKNA 1JLFB 1NHKL 3IFEA 4X64F 4P2XA 5IXUA 2ZRGA 4LVNP 3A0BE 1RE4A 2UXBF 3NXZA 1URQA 4I7FA 2C3MA 5GTIH 1DD3A 2FKWB 2CUYA 3W8PA 2MLXA 4DV7F 1RA7A 4WWIA 2B6AA 3HSJA 1CULB 2NS1B 2NRGA 2HIYA 3I32A 2ZBIA 1SVDA 1S5LX 1NDLA 2AU0A 2VG6B 2ZVNB 1LTBC 2WTFA 1Y3JA 2L9DA 1FZAA 1PPJE 4IFFA 3HFKA 3NBPA 4KIAA 2LEBA 2ZBCA 4ELUA 3KLFA 4JQ0D 1PC5A 3CCMP 1H89A 1O51A 3J7AN 5KT6A 1T2KD 5CAAA 2RNEA 5SZTA 3V5BA 1FRMA 1RGVA 2E1MC 1U1RA 4U3FE 1QLNA 2ZVSA 2W8LA 3N4XA 1FVQA 3OW2R 1N7SA 1XEZA 1FE0A 2W4PA 1UBEA 1ZM9A 1IFMA 2PEHA 4OLPA 1S0NA 1FJGJ 1LXNA 3B5ND 3AB4B 3HHEA 1VQPS 2CJXB 1NRKA 2GUVA 4JI7F 2LDIA 3NLCA 5I3UB 3J7ZT 3UO0A 2ZOFA 3RTVA 8AT1B 3GP9A 2OPQB 2FFDA 3W9IA 3IN6A 2UVRA 3QGGA 3MPUB 4DR1F 4IOBA 1WOOA 2R9LA 3AEEC 3M6WA 4RBUA 1JNRB 4DJGA 5BYRA 3P3DA 1JJ4A 4HT5A 5CYQB 1FE6A 3VZIA 2NPSA 2HRYA 2R4FA 1HL6A 3DMJB 1DHMA 4UB6E 4DL4A 3NP5A 5KFIA 2RMZA 3KPEA 4EBEA 3ISZA 5B0CA 5CHCB 3CJ5A 5D0RA 3DRSA 4GO5X 1HW9A 5KFZA 3DDIA 3A3NB 3SXLA 1DTQA 3L4FA 2ZRDA 3DRPA 5KFRA 1AA3A 1NTKG 1E6VB 1RT6A 5HP1B 4KKOB 3UQSA 3RAQA 2Z4PA 5KFEA 1GX5A 4DX7A 4RUHA 2JEGA 2HMIA 4ED5A 1M8OB 2XMMA 2ZRIA 2F4VJ 1JO5A 3BR9A 4MK8A 2KP8A 4YPCA 4C48A 4DR4J 3N5FA 2XZTB 3TGUG 2HMIB 2K7JA 1VC5A 2PO4A 1U48A 4OHWA 1TKZB 3C8YA 4CTAB 2R32A 5I3QA 3C2PA 3VVTA 4TWZA 2N4CA 5EDWA 3LOUA 1DRZA 2HQDA 3ZTQA 4ZCLA 4OHYA 4A4JA 1RT2B 3HPOA 3TP2A 2IY5B 2IAJA 2UVVA 3FEYB 1PJ6A 1NBEB 2DJWA 3G71S 3I4PA 4I64A 4AL5A 1NSKL 4PXDA 2PE8A 2V4HA 3H5YA 3LWLA 4QU7A 2XC9A 4C8NA 2KNCB 3NMAA 3ELHA 2AXTH 3OT9A 3W62A 1WEZA 1RTIA 2HS3A 1PFIA 5AVTB 2GFFA 3HZGA 3CGIA 3ITKA 2VFTA 4OJ1A 3TAPA 3I5BA 5KJ7C 4DQPA 1ZTTA 1X22A 1L0NE 2ZVIA 4PG4A 4PWDB 2WSSH 1UJ4A 4IDKA 2LKZA 2FY8A 2IX7C 1UZHA 2J5UA 3I6PA 1T3UA 4H44B 1VQ6P 3TARA 1J27A 2VUGA 4RBVA 3D2WA 3A3OB 5CCHC 2MYFA 3W7BA 4CO4A 3VMAA 1RK8A 2XHCA 3BZQA 4USMA 2P58A 1PGQA 5ETPA 5K8NA 3W67A 2A45H 3H1IJ 3FMWA 4DR2J 1CSJA 3UWTA 5DDQC 4G1QA 5HANA 2GMLA 2ADBA 1NAYA 5KT2A 3CJKB 2FVQA 4KYZA 2ZRLA 2BASA 3FEZA 1YTYA 1N33F 1HQUB 4OH8B 2C2EA 4QPTA 4CO5A 4J9PA 5D4PA 1PG5B 2K3RA 4FYXB 3ILLA 5CD4A 4RWXA 1JLQA 1U0HA 2C2OB 3EICA 4GOFA 2VG7B 3HMJG 4Q45A 3FXDA 3AE6C 1BGYG 3ZZOA 3AT1B 3MTKA 2SXLA 1Z2ZA 4P10A 1HARA 4IG0B 1B99A 1VRTB 4KFBA 4XE5B 4ECSA 3CJQA 3IFMA 2ZYGA 5E41A 2ZEJA 3PHLA 1NKNA 2N1TB 3WUVA 2AWZA 1QJHA 1G2CB 4AXJA 4AT1B 2D2CD 3L7UA 2ZE2B 1HNIB 3HFVA 1JY3O 3H1LG 3PO5A 1SQPJ 1YJTA 4JI5J 4WKYA 3RAXA 4A8XA 2LXBA 4DPWA 3EZ5A 4PRFA 3Q5RA 1FX2A 2P1JA 2MKCA 3EDRB 2F4FA 5AW1B 2HNZA 4LSNB 3KMQA 2QJ3A 2XY7A 2I8DA 1U2FA 2XLKA 5HBMA 2CQ0A 4XTTA 4G3IA 2VFUA 1X5OA 2Q1KA 3QT7A 2ZHOA 4CLYA 1OSCA 3MM8A 3RL0D 1DTTA 4WK3A 4ZLLA 2OPSB 4ED2A 2CPJA 3RL0B 4DF4A 1W26A 1JCDA 2VODA 1FS0E 3HHLA 3P45B 2P8IA 5E3CA 1AYEA 2GO9A 4PYAA 3D5MA 4OGQB 2CG8A 3V4WA 3B4DA 4MKAA 2RHQB 3NEKA 3GR1A 5LMNJ 4UQTA 2ZROA 3GSIA 2ZD1A 3PYDA 4H0LD 2A45G 4IG3A 2DXDA 4R0JA 3ISND 5H1SV 2V8PA 4TY9A 1S9KE 4X84A 1YWXA 1OQ3A 4EBDA 4DR5F 3L72G 4HJGH 2E9TA 1Q90D 2LKMA 3HHNB 5C2CA 2N1TC 3CSKA 2BYCA 2LQ9A 2IC3A 2MQMA 2GO8A 2B4UA 8ATCB 3THVA 2OTJS 3E8OA 4P7TA 3WIUA 1KQLA 3FZ2A 2VONA 1TL3A 5KFMA 3DLKB 2FZGB 5EFWB 2FVSA 1SKUB 2EG2A 3MM5A 1IKYA 2XY6A 4HTJA 3V4MA 3C46A 1U25A 3HSGA 4U7UK 2ASLA 1WTFA 3LH2S 4DV2J 1S4FA 1RJJA 2N9BA 1U7JA 2E74D 1BE3D 4JI2J 4B3MJ 4C97A 5J2PB 4FBUA 1UFWA 4ECZA 4ZIVA 3BQ2A 1JX4A 1UPPA 2X3DA 3RK2B 4AFFA 3M2VA 1KEKA 1EARA 5M2RA 1KWMA 3EGZA 3DLGB 2F9JA 1SQXG 4NI2A 3NBPB 4NLUA 4V19X 1KB9D 4MN4C 3FNNA 2XWYA 2LA6A 2NPSB 1N34J 3OTOF 1NLKL 4M5LA 3TANA 1ZYQA 5B0FA 1RAEB 2XZDB 2FC9A 4ZVQB 2ZBPA 2Y0BB 5MAOA 3NG8A 5E2QA 4DL6A 1RWMB 2R7VA 1MN9A