2YKQA

Structure of the human line-1 orf1p trimer
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
212
structure length
200
Chain Sequence
b'DQLEERVSAAEDEINEIKREGKFREKRIKRNEQSLQEIWDYVKRPNLRLIGVPESDVENGTKLENTLQDIIQENFPNLANVQIQEIQRTTPRHIIVRFTKVEMKEKMLRAAREKGRVTLKGKPIRLTVDLSAETLQARREWGPIFNILKEKNFQPRISYPAKLSFISEGEIKYFIDKQMLRDFVTTRPALKELLKEALNM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LINE-1 ORF1P
publication title Trimeric Structure and Flexibility of the L1Orf1P Protein in Human L1 Retrotransposition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 62
structure length 200
sequence length 212
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02994 Transposase_22 L1 transposable element RBD-like domain
A PF17489 Tnp_22_trimer L1 transposable element trimerization domain
A PF17490 Tnp_22_dsRBD L1 transposable element dsRBD-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ykqA01
3.30.70.1820 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykqA02
3.30.250.20 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 Rec A Protein; domain 2 2ykqA03
1JOCA 3CL3D 2YKPA 2YKOA 2W6BA 3SOOA 3EQ2A 3BRTB 2LDYA 2W7AA 3BRVB 2YKQA 2JRBA 3L4FA
chains in the Genus database with same CATH superfamily
3M8PB 4N77A 2C28A 2ZVNB 2VBYA 3HT3A 2B9YA 3R9LA 3IF4A 2Z5IA 1LNQA 1IXKA 1QAXA 1FWKA 2E1PA 4ED2A 5AJ3J 3BCCJ 3JCUH 2QG9B 2YQ0A 1NKBA 1S0MA 1AFOA 2BANA 3CL3D 2WT7A 1FRHA 2E29A 1RWVB 3BM7A 3G6EP 5IT0A 1RE3A 2NR0A 2EPIA 4PR0A 1Y5NB 1SXLA 5F8HA 1PYTA 3N7NA 1B0PA 3NGRA 1Y10A 2CPFA 3J80Y 3NMRA 4Y0FA 2QLJB 2DNGA 2RHSB 1J5OA 3CCVP 3UW1A 3CJKB 2KVIA 4HVZA 4DT0A 5KFOA 3JCUE 5ETPA 2GMJA 2QX0A 5A2QU 3W2WB 2VICA 2MQPA 5AXKA 3O1LA 3ZZYA 4QR0A 4F0HA 5C24B 4USWA 1N7SC 5KFQA 2WZ7A 4PD4D 4ILMA 1J1DB 1V5VA 3HM9A 2FYUK 3CDEA 2AU0A 1ZAWA 3M9NB 4JB8B 1FS0E 2K2PA 3HMJG 1VDFA 2CPJA 4YR3A 2YH1A 1Q82Q 4C3LA 3OPKA 4C2MA 1W2BO 4JI5J 2P10A 4RUHA 2NQPA 2E76B 1HWIA 3P45B 3ILLA 1CI6B 1NK9A 2EBEA 3UPFA 1H88A 4P71A 1B7FA 2HPCB 1HMVB 2WITA 2EWHA 4N56A 1IQZA 1C1BA 2OEKA 3P6YC 1R6YA 2W4CA 2FYUD 2DO4A 3THVA 5F8LA 5KG5A 4ZDNA 5APVA 4M5KA 1FDDA 4AQYJ 1ZMEC 1MG7A 3LPYA 4UY85 3Q8VA 2BASA 3W3SA 2FFDB 3PLNA 5CXTA 1ZR2A 4LIWA 5I3UB 2ZAEB 4WY4B 3ZZOA 1QSYA 5L1JA 4H4MA 2B0GA 3V2RA 4LFBJ 3GSDA 1W7WA 1PGZA 3BGOP 3H7HB 3N0VA 2NSCA 3EGWB 2M3EA 1JUNA 2WB1D 4H44D 4OLOA 3GV7B 3HHKA 3AE2C 3LOUA 1FCAA 1Z4UA 1VBZA 3ICLA 3GIRA 3NY0A 1L0LK 3QGGA 3T19A 4GODA 1FE4A 3JSMB 2QVAA 1RZMA 2HZCA 2KKHA 2HNZA 2GUSA 2ZJRQ 1R89A 4X64F 2OE2A 1JLCB 3HRNA 2NS1B 1RQVA 2ACYA 3QWUA 2WVEA 5CHCB 1U7MA 4DV2J 3SIPB 2LQ8A 5J1PA 3W64A 1F5AA 3MM9A 1L0LD 3J81j 4IKAA 1S5ZA 2ZUGA 4JI6F 1BWVA 5F8JA 3L72J 2JDIH 2J6SA 4DPTA 1JLGA 4NYOA 5CCLA 2CQ1A 2Q66A 3K57A 2RT3A 3THTA 1LWXA 2C9NY 4PTLA 4ZJQA 4Y2IA 1LWUB 3J7A1 1SLQA 2QRRA 2ZDOA 5B0AA 3W8GA 1DQ9A 2MZRA 2IBOA 3TDKA 1XQIA 3R6LB 1T3JA 2GUVA 2IDEA 1VISA 5KAIH 1K9MT 2ZVSA 1FKOB 5LJ3Y 1FU1A 4X62F 1P84H 4YB7A 2PP6A 2XMVA 2IZ0A 1QAIA 1FD2A 3PW5A 2ZVIA 1B4SA 4OQFA 5AW8B 2DITA 2HYIB 1TKZB 1TP7A 4RJVA 5JXSA 3HE5B 1GL2B 4PJ0H 2ZD1B 4A46A 2PA3A 4CO5A 3CDWA 4NEYA 4DPOA 5KAIE 1VQ6P 4DR5J 2JNJA 3MAHA 4PG4A 1WD6A 1S4FA 2BQUA 1U2CA 1CQMA 1NTKE 3II6A 2BM1A 2ZH9A 1FWLA 1P84E 1JCDA 2DJWA 2HHUA 4QZVB 2BCCD 4EGLA 4H0LD 4PQUB 1HJBA 3PACA 1S2EA 4PXBA 3CB4A 3OQ2A 4DR2F 2O01N 4KV8B 4MK9A 4PJ0E 3TW0A 2YKPA 1FFWB 2UXCJ 2HIYA 1KB9D 3W61A 5GADI 4FS1A 4K8RA 4Z2XA 1MZ9A 4DV5J 4KGVB 2R5DA 1EB0A 3V81A 4YXDC 4N76A 1YTYA 3DHWC 1UA0A 4QBUA 1EXIA 2RU3A 1OJ4A 5BVZA 5AW1B 3TGUJ 2M0BA 3F89A 3V4IB 3VHQA 2WTFA 2D2CB 2A06G 1WHVA 2MSSA 3OTBA 2P8IA 3VTIA 2MPUA 4NCGB 2UVWA 1KQGB 2LXBA 3D0GE 5K9FA 1SQVK 4IUFA 4OYIA 3H8YA 3AE7C 4P73A 3UWTA 5HQMA 4ES3A 2D9OA 1B7YB 3A0BH 1REVA 1URQD 1OVVA 4KIAA 1S9KD 1U4BA 3HKWA 2JP3A 3I55P 5CA5A 2KNCA 1DURA 4YR2A 4FZVA 2C9LY 4R8UB 4ZP7A 2WVRA 2O5DA 3QNWB 4GRSA 2A1BA 1KD1T 2YWFA 3HSZA 4CO0A 3H2VE 4X4PA 2DHAA 2FHKA 4KPCA 1ZZNA 3H42A 1N34J 2DNYA 4QW8A 1SQVD 1FJGJ 1WG1A 2GO8A 1IBCB 1O8BA 1OWAA 2HQCA 3WBZA 4ZLPA 2JH3A 3G8QA 1GK8A 3A0BE 3RK2D 2P1JA 2MZJA 3IG1A 1RT6A 4I0WA 1R7IA 1X4GA 1F3VA 3ZTPA 4W90B 4HYKA 5K8PA 1DLOA 3HF5A 4Y2AA 3L4FA 4N7TA 3OSNA 1NDKA 3GIKA 1REGX 2E74C 2V6AA 4Q2LA 3BO3A 4DOJA 1M5KC 2NZ4A 2ZYGA 1FZBA 2R7RA 4WKRA 5IS2A 4NLUA 3PR4A 1KLMB 2NXJA 4FYDA 3KG1A 2KP8A 3PCOB 7AT1B 2VA2A 1RTDB 4JUZA 1ZV8A 4RUAA 1LEOA 2GJIA 5EX3A 1S7IA 5J2NB 2QGFB 4JI2F 1ZA1B 4RNFA 3LAMA 3RK3D 3O3LA 3M32A 2KHDA 3KHHA 3GHGA 2PRRA 1GXTA 3M1VB 5BYSA 4X4OA 3SQGA 1KQKA 3HI9A 1UZHA 4PXEA 3CEDA 2HW3A 2ZC4A 4DSJA 4YQWA 2DIUA 4PUOB 3IBCB 2G88A 3F56A 3L74D 3FGAD 3PH0A 1RTIA 1OZHA 2HMIB 5KOWA 3H1LD 3T1HJ 4OZ1A 4QOTA 3PNIA 5ETSA 3DRPB 2ZHAA 1TL3B 1X7VA 2YNHB 3IM9A 1CVJA 2CPSA 2VQFF 4W4MA 2WRMA 3M6WA 2GNKA 4XDCA 1ZAVA 1KR4A 5F8GA 4M5DB 3MDFA 2DCUB 1KYOD 3H1HD 5KG7A 2ILZA 2RKLA 2K37A 1Q78A 2XB2D 1N73C 4ZCKA 3PTZA 1RWOB 3EX7B 5HLFA 4I2QB 2DVIA 4LFCJ 4ZKAA 1NSQA 5DGAA 5AVVB 1LW2B 1O0PA 1HLWA 3CCQS 2WSFJ 4N5SA 3M9QA 1BUXA 3LTOA 4KO0A 3H1KJ 1RUSA 4NL5A 1NO8A 2OJ3A 1HQUA 4RR5A 3CJQA 1RBOB 3OXFA 5C42A 2L91A 2XLJA 1FVSA 3H1JG 1MWYA 4DZDA 4KJMA 3C16B 4WK1A 5FLXY 4XPCA 2WCXA 1J5EJ 4F4XA 2C2EA 3BH7B 1H7XA 1J1DC 3RR8A 2FQQB 4KGZB 3H90A 1RF1B 4ID8A 1UVLA 2YQ3A 2X7IA 4WYWA 1U6BA 1E6YB 2GAHC 3LWLA 3HVWA 1U1LA 5KLVK 2KT2A 4PO9A 4GC7A 1WKLA 3CCJS 2CPIA 4CO2A 1P1TA 1MROA 2YKAA 5F9LA 3J81Y 1UBFA 4DPYA 4ATNA 4KHPJ 3M8ZA 2CVIA 3QGIA 5KG1A 4RWXA 3FWNA 2B9EA 1VBKA 4PQRA 4GVBB 4BWNA 1ULRA 1D8YA 1V5IB 3Q83A 2R7UA 5B0BA 1QUPA 3SMZA 1GT8A 5KLVD 1XNRJ 3RGUA 3SSSA 1FDMA 2EXUA 2V2VA 1JLBA 3HSJA 1RTJA 2B43A 3N5BA 1UFKA 2B51A 4RNHA 1Y8AA 1HBUA 1MMNA 2EW9A 1FDBA 2HHHJ 5K14A 2VG6A 3KJFB 1VIOA 4WIIA 1BCCG 1GDTA 2K1AA 1OSDA 2AP6A 2R42A 3X3UA 4WY4C 5HATA 1N4LA 1IBKF 4OHYA 3KJVA 2RDIA 3SV3A 2LA6A 1NTME 3HHLC 1LT1A 3R1LA 2WQYC 4DQPA 1UBEA 5D0RA 4F7VA 1UWAA 3CCES 2Q6QA 2ZBCA 5GAHU 5HMZA 2IX7C 2CPEA 2Z2ZA 1R5LA 3OVBA 4EI2A 5F0UA 3H0PA 3U27A 2HWTA 1BQNA 4CT9A 4B9TA 1UCNA 3IRXB 2D3ZA 3HE4A 1RBLA 1TQLA 4Y2CA 5DM7Q 3K5MA 1FNOA 1NVOA 2G0IA 4WP3A 4KH0B 1YIJS 3CNQP 3SDEB 3E3XA 1WHYA 2KU7A 3KHRA 2MB0B 2E7VA 1RQUA 1WEZA 3Q8QB 2ABYA 2HZAA 2PI4A 3SCJE 2KS1B 1NU1K 3A13A 3AECC 2CG8A 1PYSB 3LIEA 1AB8A 1HNWJ 3GFXA 2DGUA 4PRFA 2XYGB 5G4DA 1HD0A 2FJAB 4RW7B 4EBEA 5E79H 3BBFA 2BEFA 1HA1A 2HNDB 2XLKA 5HJYA 3OUYA 1GMUA 3MEDA 1JY2O 2VPYB 5HQ8A 5KFSA 4ES1A 3MR3A 4RW8B 1R8PA 1NU1D 1OFCX 1S9EB 1JCCA 2FKWB 5DJTB 1VC0A 1LWUC 5A6PA 1DH3A 2IAJB 2HFSA 2LXCB 1NB2A 3M8PA 3EM1A 2NRGA 2OAUA 4W7ZA 1EZVE 2E1CA 5IT9U 1UFWA 1G3OA 3GYXB 5LL6d 3HZGA 5E79E 4U7UK 4DCKA 1YRXA 2DNQA 4MFBB 2FC8A 1U8SA 4B86A 3D7SB 1RK8A 4QYZK 3HR8A 2BRKA 2KB7P 2LU2A 2HFUA 3AE4C 1AA1B 2U2FA 1VGYA 4Y99B 1FEEA 1WWHA 4JI0F 4C0HA 2DT9A 2P2CB 1OQ6A 3SXLA 4WJBA 3FNNA 4OYOA 3UD3P 1PP9D 1VQSA 1CG2A 2W25A 3UCZP 4C4WA 1Q1KA 3DNCA 1Q82T 4U7UD 1GL2C 2PN6A 2Q79A 3KOAA 3A8KA 1QUVA 2ZRLA 5HVHA 2KFYA 3GE9A 3AE5C 4HTIA 3CJKA 1KEKA 3R3TA 1S79A 5M2PA 2COLA 2AX0A 3PIPQ 2C42A 1S97A 5C24A 3CIZA 1FD8A 3GF7A 1XTGB 2RF2A 2GV1A 4C0BA 5HROB 4GO5X 4DMZA 2EFQA 4MYUA 3C6TB 4LF4J 1IZNB 4HT7A 4LBIA 3GW6A 2CXEA 3BO4A 3MZWB 2ZH4A 1RHMB 2K7JA 1CI6A 1RADB 1Y4ZB 2FJWA 2Y8YA 2HPCA 2Z5HA 1BXNA 3L70D 1HMVA 3TSIA 4FPIA 1NK6A 1HPZA 2IBZG 3AB2B 3BB5A 1HARA 2DGXA 2FGOA 2R7QA 2NYIA 1VQ7S 1FHTA 4DJBA 2WSFC 1K1QA 2K9JB 3WHIA 4BDPA 5KFXA 4PO1A 2Y3YA 1Y0HA 4HI1A 2Y9YA 1H72C 2BYCA 3KLEB 1H2UX 1YJNP 2FFDA 3ZTRA 3KWMA 2BQRA 2D2CC 1VQPP 2CQHA 3S8SA 3CCQP 2EVZA 5I3UA 4WY4A 4LF8J 1ZXGA 4GKGA 3W7BA 4CYUB 2CYYA 4P75A 3CXHD 3MPWA 3DI6A 4RU9A 1FZCA 2BABA 1LTJB 2HHQA 4QQBA 1C0TB 2GO9A 3TUIC 3G9RA 3VZIA 2HBRB 3CWBG 1AT1B 1TELA 4AT1B 4RNMA 2CQBA 3R27A 2FVPA 2B9XA 2OFGX 4NZ0A 2F65A 2F5GA 4C8YA 3USSA 2KM8B 2IJFA 2I6WA 2J9DA 1U09A 2CAJA 3RRGA 1FESA 4C8OA 2KDOA 4Y3CA 3JSMA 4IR1A 2LKMA 3PG9A 4OWFA 5D78A 4H54A 2NXEA 2IRXA 3HO1A 1JLCA 3D3BJ 3CCJP 4DQRA 2W83C 1IKVB 5E3CA 2PEHA 3EGZA 1RU2A 2N4CA 4NLPA 3QH9A 1TL7B 4GKJF 2AXTH 4W98A 2E43A 4DR1F 2O1PA 4NXMF 2VQEJ 1N32J 2H7HA 4OVNF 3GJTB 1JIHA 2HFZA 1T3UA 1EDJA 3CC7P 4RNOA 1ZW0A 5KFMA 4DBQA 3IXQA 1VRQC 1SQGA 3W8PA 3PX6A 1NSPA 3DRSB 4TY8B 2UXDF 4OH8B 1L0NE 1N2DC 2K06A 1IM4A 1Q0NA 4DFPA 3SWKA 4X4QA 4ES2A 5APYA 5A2QY 1KLNA 4HKQA 1YQ4C 3Q5PA 2E1MC 2PMHA 4UZCA 1A0OB 2AXTE 1U0HB 1NH7A 2N7YA 1HJ0A 2G2ZA 3HSGA 3VR1A 4ZCMA 1YJ7A 1X4HA 1UEVA 4NYPA 1YK9A 3K8VA 1FKOA 1VDHA 3CCEP 3DFEA 3D71A 3W5YA 4IFFA 3JSBA 2YNFB 3V4MA 4LRDA 3KPEA 2CQ3A 2QLWA 1YBKA 5ETVA 4A47A 1E79H 1M7LA 2O1JA 1S5LH 1U8WA 1AZSB 2K1RB 2V63A 4WFNQ 4JI8J 2RH0A 1S6PB 3TP2A 3I4PA 4DSFA 1TKZA 2QFJA 4CM2A 1GW4A 2E5IA 2A6OA 5KJ7A 2XC9A 3HE5A 1GL2A 2ZD1A 2IYPA 4DX6A 3F41A 3IBFB 4WFXA 2YIUB 2VPZB 2ZHOA 3U1NA 3OHAA 1WDDA 4MN4C 4YDXA 4V19J 4K4TA 3ZZPA 1S5LE 5EFWB 4QPXA 4PQUA 2N9BA 3MHVA 1F60B 3W5XA 4XAKA 4YY3F 4NASA 4I7FA 3BCCG 4HL9A 1MN7A 5M2UA 1U26A 1SQQE 2OYHC 1V3RA 3UQSA 3VZHA 3DLGA 5HSPA 1U24A 2Y1JA 2M5AB 2OI2A 8RUCA 3GR1A 2W2OP 1N7LA 4HT5A 2N1TC 3EXCX 2L08A 3TNUB 1HR0J 3FFIB 4DWIA 5APWA 2XY6A 1QVFR 2R44A 1MO5A 2RAQA 4OL8A 2LFVA 2XY7A 1D0EA 1RHJB 4PG8A 3M0AA 2DGTA 3J7Z5 1VF5D 3VAHA 2IBZI 5DO2A 1S1UB 1X79B 3MTUE 5TJHA 3I0RB 2BKPA 4Q0BB 4KKOB 4NLWA 5AXLA 5GMEA 3V4IA 4RBTA 3UD5A 4FKXA 2QO3A 2KJWA 1R8BA 3A2AA 5GAEI 4DUZF 2ODWA 3UO0A 3MM5B 1RI7A 4NCGA 3MM8A 4K3AA 1JXVA 2OD4A 3BASA 1SQBE 3P8BB 4CZCA 1X4CA 1RB0A 1F2HA 3ETOA 4USUA 2RQMA 3BR9A 1M5SA 1IN0A 4LJMA 4PEOA 1QLED 1IQTA 2EK6A 1ZRTD 2V5HG 2QRXA 3CO0P 5EGYA 4R8UA 2BE7D 1YTZI 4K4SA 2I9SA 3QT7A 2W6JH 1O5JA 2FXPA 1YI2S 2CQDA 1DD3A 3CCLS 1XNQF 2QMWA 2GZOA 2XTJP 3HJVA 2ZT9C 4POAA 1X31C 3A8JA 1URRA 1NKZB 1KILD 2ZJQQ 4ZK7M 4MTPA 1ZR4A 4YP3A 1SJ3P 2LYVA 3KDPB 2CNKB 2OARA 2HHXA 2BKNA 4K4UA 2EEYA 5LOQA 2LU1A 4TLRA 1Y47A 1I6JA 1WUUA 1NTKJ 1VQ7P 1OPIA 1FKAF 1LKZA 3BSCA 2ZOGA 1RCXB 3OFEA 4EMDA 2VKRA 3SCIE 4NWBA 1NTMK 3TO8A 1JNRB 4WIQA 1AUSL 2YVSA 2F9JA 1MMLA 4TYAA 4K50A 3HUSA 2ZJPQ 1TK8A 4USHA 2E5TA 3B4MA 5CJ4A 3T5KA 1H73A 2PGDA 2EG2A 2RQ4A 2G2OA 4ZJLA 1WC5A 2JHEA 2YO2A 2M3BA 1KLMA 2O1KA 5C2GA 2H5EA 4OZ3A 2G0JA 4M5NA 3QRQA 2XZWA 1VRTB 1RTDA 3SBMA 2ZRFA 2R2RA 1FTCA 1WC6A 3CD0A 2Y0SD 5LMNF 1U99A 3W9JA 5CH7B 1HW9A 2ZOMA 3CI9A 4USJC 2P9EA 3NCQA 4TVAB 4LLHA 3D0IE 3HFKA 3R6GB 3C6UB 3L72G 1VMBA 3M1VA 1EX8A 4QR2A 2VDIA 2DR5A 2W9BB 3PKYA 2FXOA 3J7YI 4PUOA 3BZQA 3N6MA 3ZTQA 1S1CX 1MFZA 3L37A 2BACA 2ZH3A 2HMIA 2HGNA 1CJVB 1GX6A 4LSZB 3H32B 3GYNA 1OW7A 5I42A 1F5BA 3MPUB 2A06D 3DRPA 2KI2A 4ENOA 2HURA 3NAIA 5EHHA 4KC5A 1TL3A 2AZ1A 2PC6A 4NMXA 2QT7A 3BV8A 1QE1B 3R1HA 1D9FA 4H13D 5L39A 3V5RA 3Q22A 1JY3N 3LP0B 1KRPA 4M5DA 2WB4A 3DM2B 4F25A 3L4BC 4FBUA 2XZDB 1NUEA 2HODB 1L3TA 2HG5D 2R8JA 4DR7F 3D68A 1XTZA 2F63A 4C3KA 2G8YA 3HD7D 4I2QA 1XERA 2R3SA 2CQPA 3AA9A 5B0FA 3CTRA 2XSFA 1R0BG 3MXHP 3Q24A 2XQCA 1TKXB 5HQLA 2HHWA 1HYSB 1KBRA 4OFZA 3CULA 2XY5A 4X62J 1FXLA 1ZYQA 3NOGA 3US5A 1U45A 1QTMA 2YKOA 4CDIA 4B3RF 2B4UA 3C16A 2B5JB 1MFTA 1UTAA 4I2PB 5A76A 2O66A 1KN7A 2V8VA 2CPYA 4CLSA 2DH8A 3D4JA 3M2UB 3PZPA 1FA0A 4B9NA 1RU1A 2J76E 1RF1A 4U8VA 4YPCA 2JEGA 2KTQA 2DNOA 4C8KA 1LV5A 1MSWD 2MY8A 2JX2A 4E0DA 1LOUA 5G0RB 2JWAA 4DPUA 5CCGD 3RL0C 1UL3A 4NLGA 1P9QC 3QWPA 3MIWA 4ZIVA 3U7JA 2PD1A 3RAXA 1NJWA 4NRUA 1TUWA 1VJQA 3DOKB 3CXCR 1SV5B 4DG1B 1SKRA 5FIIA 1CULB 4RW4B 4GVBA 4B9VA 1UAWA 3TEHB 4DR2J 3RW7A 1X5SA 2CFXA 1HVVA 1Z2LA 1NPRA 2WW4A 3QGPA 3LP2B 3C14B 3TGUG 1NAFA 4TYBA 1Y3JA 2DYAA 1KSPA 1ZLLA 2SXLA 4ZNCA 3PP5A 3TJAA 4F4WA 2JEIA 2V4JB 2AJ1A 1Z2ZA 3UR0A 3JTNA 1PAUB 2J8SA 3PYDA 3CO9A 1GFWB 1EZZB 4H4OB 2ZDPA 2ZRBA 1Q7LB 1H7WA 5IWAF 1LTJC 1NJZA 1GZLA 1FFGB 1UVKA 1RT7B 1CJTB 4DV7F 1AA3A 4R5PB 2OTKE 2NYHA 3CCMS 2V7QH 2K9YA 3ET6B 3T1AA 1VQOS 3VVUA 1PPJD 1RAOA 4U3FD 3KDOA 3IRXA 3RBZA 2WVBA 3CPWR 4ZMMA 2HR3A 2IA0A 4IOIH 5DDRC 3QO9A 2CUYA 3SDEA 1OVRA 2P2UA 4URGA 4OZ2A 3O6QA 3I56S 5KFIA 2KS1A 5D4PA 3V2QA 1P8GA 3CD5A 5AT1B 5C7PA 4YHHF 3CJRA 3DOLB 2GCFA 2HK2A 3ITHB 5D77A 4A48A 2HWIA 2XMTA 4C8ZA 3GFZA 3A8IA 3OTOF 2CJKA 1YWXA 2ZJSE 4RW7A 1JY3P 1NYHA 2RDDA 1J27A 2HNDA 3AJDA 5DG9A 4ETZA 2VFSA 1YI2P 1K8AT 3CCLP 2P6SA 4OHWA 2YPYA 4RW8A 2OELA 3H1JD 1RA7A 3HFVA 1HBOB 3D6HB 5DLFA 2OLWA 4C98A 2MQLA 2IDLA 3QFHA 2VODA 4MH8A 2IAJA 3W60A 4LR7A 1G2CB 4G1QB 1ZAXA 1A6LA 1R5SA 1M5VC 1S6QA 2WHOA 5J2QA 1HIYA 3FCWA 3PIOQ 2XNRA 4RO0A 4KT0C 2WOMB 2J0XA 4MFBA 1L3VA 4OIXA 1IVZA 2MKYA 3CJSA 3VN0A 1WMKA 4DV6F 2KXNB 2FPHX 2VIHA 3TUZC 4CQ1A 4FF4A 4ZLJA 1CSJA 2AGQA 2XMWA 4W7YA 2AV5A 4C7RA 4ZVEA 2AF6A 1Y3KA 1W2BR 1VQNS 2BEZF 1N5VA 8AT1B 4TY9A 3KUGA 3R5BA 2LLZA 4DPWA 3QAUA 5K5MA 4JI2J 2YIUC 1DIPA 3MM7B 3TJ9A 4CH1A 2ZRDA 1UFLA 4OYZA 1BCCD 4OHXA 2HFNA 4KTQA 2OTJP 4KSEB 2GMLA 3VCDA 3FK4A 3OT9A 1RGVA 3FEXB 4K7QA 4CTAB 5HROA 5KFZA 4Q45A 3C15B 1JX4A 1AQTA 4TQRA 1ZM2A 4WFYA 2IVFB 2WAQD 4B3SF 2FYNB 4I56A 3TQEA 2HRUA 3IS9B 1IR1A 4F67A 1N52B 4PXDA 4DN9A 2NXCA 1Z56A 3Q2TC 4UUXA 2CPHA 5KFVA 1ZOYC 1DX7A 2HHTA 2VQFJ 3H1KG 5K8OA 4RW9B 4O0NA 4B3TF 2AJ4A 2PFXA 3EUNA 4UQTA 3DLKB 4X4RA 4OGQB 2K9JA 2JLEA 3ILIA 3N79A 2PFFB 3H2LA 3ZC4A 4OHZA 1UETA 2KO1A 4O23A 1SJFA 1S12A 1L4AB 1RF0A 2HGLA 2NPSB 4U7CA 3KLEA 5LSLA 1S9GB 1NH8A 4RUBA 1WOOA 3T9ZA 4NPOA 1XIQA 3NCRA 2IY5B 3HTKB 4OI2A 2M8RA 4DL3A 2OPSB 4CYUA 1FFSB 2C3MA 3N4XA 1KN6A 2H8PD 1LTJA 3CJ0A 3I0SB 5CYMB 3ZFVA 2E75D 1X4FA 2JWNA 2W24A 1T9YA 4ZCIA 4Z37A 3RTVA 1FZGA 2V50A 1V3ZA 2GMHA 1B0VA 3QGHA 3MPDA 2DD8S 5F8IA 2IMOA 5EWGA 4K0KF 3RUBL 4URQU 1QL2A 4ECRA 3AE3C 4PWDA 4PD4I 4H44C 5DJUB 2APOA 4JV2A 1E6VB 3TYTA 2MDAA 3JQKA 1SFCB 1Z1ZA 3TUPA 1IKVA 1IK7A 3FZ2A 3BATA 3CJTA 1TZ0A 3AD9C 4B9MA 2OPRB 2UVRA 4USIA 1KFNA 2B4PA 4P2FA 1IKWB 4MYTA 3ZNJ1 3D6MB 4LREA 1NTZK 2OMOA 4EK2A 3G86A 3A1YG 4EWTA 2UVUA 2BJEA 1N8RQ 3VAIA 2DNHA 1LTGC 4ZKUA 2K88A 4ECWA 3A3NB 4TY8A 4LF9F 3MECB 4DXLA 3CC4P 1FVQA 1U1QA 2NREA 4OI6A 4OYPA 5AE2A 1XC9A 2QEXS 2XS5A 3A0HH 1Q2NA 5H9EK 2Z2YB 1IBKJ 1U0HA 1HNIA 5HN0A 3K58A 3OJUA 3CJ5A 1NTZD 4I1TA 1G19A 2BVZA 2QE5A 4LUBA 3L7UA 3N6LA 1SC3B 3P3DA 3AD7C 2CKWA 4DV1F 2YNFA 3CCMP 2M3DA 1GTHA 5EX0A 1RT2B 3Q1MA 1VQOP 1AZSA 3MUDA 2K1RA 3DOMB 5DG8A 1VC5A 4I67A 1FDOA 2XMKA 3QT5A 4CRJA 3QPIA 1M1GA 2IBZD 4I68A 3OL6A 3FEZA 1S6PA 3NWRA 3A0HE 4N47A 3QIPB 1NHUA 1FERA 3PTWA 1JO5A 4G65A 4PG7A 3QAEA 3VGTA 3I56P 1M1JC 1SQXE 3CF5Q 4JBZA 1FJCA 1ZETA 1PG5B 3M30B 1UW9A 2E7WA 4LF5J 4L73A 5KFFA 1BQMA 5CCMA 3KLVA 4F3QA 1Q81Q 4A8OA 4OZNA 3CWBD 3PYGA 2ZNZA 2M5AA 3OW2O 1WG4A 5E3PA 2YWKA 3FUYA 1N7SB 2UUAF 5IXUA 2Z2MA 4HH2A 1BE3D 2UWJE 1DFDA 4D6TE 1X4DA 3TNUA 1I1GA 4U95A 3FFIA 2M4MA 4NI2B 1KV4A 3IR9A 1NJYA 3V2UC 2KLVA 2GW8A 3F5HA 3MEGB 4BLGA 1LXNA 1GTEA 4TNOA 3TWZA 1RT5A 2H1YA 2JOQA 2R3CA 1WC3A 3R4YA 5CZXA 3FCHA 4PXCA 4ZVGA 1GH8A 2RS2A 4R0EA 1S1UA 3L71D 3I0RA 4WTOB 4Q0BA 1I94F 4NX9A 1F3FA 2FYZA 2B87B 4JI0J 3UNYA 1RT3B 1VQNP 3MM5A 4WTYA 3H1IE 1L0NJ 3L7PA 2I38A 1U02A 2R8IA 1RTHB 2ROPA 3AE6C 3M8WA 1FJKA 3PW2A 1YTZT 3H1LG 2XHWA 1TK5A 5DZ6A 2LQJA 2RRAA 5L1KA 4FF2A 1OY9A 2XM3A 2B4VA 2KUBA 5L9XA 3CDAA 4WFAQ 4NLYA 3VV2B 3BBCA 1MUUA 3P4UB 3PHTA 3ZTOA 2AEMA 5HANA 1HWKA 5CQGA 1URQC 3H1HG 2LVWA 1BLUA 5L46A 2W9CB 3VGVA 2F4FA 3H4DA 4DZOA 2FVSA 5ETRA 1HL6A 3EZUA 5ETQA 1NEEA 2EFPA 1B3TA 2W6AA 5T7LA 1WDTA 5LSRA 4NPEA 2LXFA 4U8YA 1SH0A 3B5NB 1VJWA 5A8RA 1KB9I 2CNOB 3KLFA 2BQ3A 1AVOA 4DV0F 2Q6CA 2VASA 4K5SA 1C4CA 3UFCX 3A12A 4K4XA 3ABVC 2XO6A 3P5BP 3H4BA 4MK7A 3RK2C 3Q8PB 3MCMA 1Q86Q 3M2VB 2L5GB 1X8YA 1L3KA 2VFVA 1TTHB 5KFCA 1SQQJ 2MZTA 3H5XA 2Q3IA 2GQ2A 3M7VA 2BJ1A 2XULA 1DZ5A 4FYWB 2DBBA 1PC4A 4DQSA 2KFZA 3BCCD 1MO6A 3UCGA 2ZRPA 3QSIA 2KXPB 3R5GA 1NJIQ 2LDYA 1CW5A 2V0NA 4PQAA 1VRTA 1LT9A 4K5RA 3TVKA 1SCJB 4AXIA 4LRBA 5APTA 3A3PB 3D1HA 3IAS9 2VFRA 1D3WA 3JYTB 1GMWA 2KRBA 4L3NA 5DDQC 3QJJA 3G6ES 2DRBA 2G9OA 3OTCA 2W8ZA 2YWHA 3M8YA 1OPZA 1SKUB 1G7CB 3GPAA 3C6UA 4IQMA 1XTCC 2FHOB 2WSCC 1X60A 2HYNA 5DS7A 4UOHA 2GVZB 3NLCA 2NCKL 3M6VA 3H5YA 5KLVG 3G2XA 1LP1B 1T03A 3AQPA 2WONB 5IC4B 3LGNA 3VAMA 1QLNA 2E66A 4CT8A 1CJVA 3M0DA 1S76D 4Q8FA 2WVFA 1JB0C 1OQ3A 2YX1A 3HVAA 4GKJJ 3TX8A 1HQEA 2FLNA 4DR1J 1SQBJ 4F0MA 1JLFA 2P67A 4NXMJ 2NZ2A 1QE1A 2E1AA 5H9FJ 3MUTP 2DNNA 3TANA 2MEWA 2YMYA 3ETMA 1WF2A 3SOOA 1WF0A 3D0HE 2XNQA 4NXNF 3LP0A 3MAAB 3NRBA 3DM2A 4H4KA 2E5HA 2F1FA 2HODA 3B4SA 3QT8A 1JTHB 4OZJA 4C6AA 3DLHA 4LMZA 3CWJA 2DGQA 4A8QA 2QEXP 4DJGA 3MCOA 3ILJA 1BGYE 4RKUC 1ROFA 1WELA 2OKQA 2BJ9A 3MEKA 1K04A 2G2YA 4NRTA 1H0TB 3D66A 3A7OA 1TKXA 5AXMA 4GO7X 1BY9A 1S1WB 2OPPB 2Q3EA 1HYSA 2VOOA 1FEHA 5BYQA 1SUQA 1R31A 2RH3A 3KK3A 1N36F 1JLEB 1EP4B 1SQPE 2PE8A 1AXQA 2P9CA 2WK4A 2KT3A 2D69A 2C2OB 5HMYA 2YKNB 1S1XA 4CNZA 2OFHX 1TL1B 1NK8A 3OVAA 3W9IA 3H2UB 1BQXA 4I2PA 5KFDA 3I82A 2B7CB 4ZVTB 4YS2A 1TFYA 1VS3A 2I5JB 3OLAA 3IFMA 4PSKA 1HNZF 1T0TV 2E74D 3M2UA 4UY8T 2DNPA 5B0DA 3I4HX 1VF5B 4P6QA 1BDDA 2LEAA 4LFAJ 4GKKF 3BEGB 3MUMP 1NK5A 5KFHA 5G0RA 4QWEA 1YITS 3T41A 4GT1A 2HLUA 5HP1B 3G6VA 4KFBB 3MD0A 4C7QA 3GG0A 3DOKA 1RAAB 3G4SS 4N78E 1CULA 2DEJA 2E9ZA 4ITSA 3OFHA 4YY3J 2FY8A 1C1CA 1MV8A 2IIHA 3FDSA 3HHDA 8ATCB 5MAOA 4OGQC 1XP8A 1JXEA 5F3ZA 3LP2A 1HBNB 4C7NB 1VCTA 3C14A 1H74A 3V6KA 1L4AC 2LP4A 3GONA 2NPSC 1YJVA 2ZYDA 2W9AA 2QJ3A 2EK1A 1EQ0A 1YQ3C 2MZ1A 1PP9G 3L72D 1MKMA 2V4JA 3HD7A 1MU2B 5IV3A 1TU3F 4LF1A 5A6WA 4H4OA 2P5VA 5J2PA 1EDLA 3KMSA 1KONA 2KZIA 4CLWA 1RT7A 1CJTA 3BN7A 4R5PA 2CWXA 1HWJA 3GWCA 3OSPA 3NGKA 4P7VA 3ET6A 2PI5A 3VQSA 3IWLA 2QL9B 1RBAA 1PZQA 3HCXA 4R0JA 4UUWA 1WC1A 2OYIB 3F44A 2KZZA 1M5PC 4DUZJ 1TMJA 4AE5A 1EAYC 1LGHB 2MKCA 3UCUP 3J7YU 4Q5VA 1RHQB 2ZH7A 2MKHA 2ROEA 2A45H 5AVQB 2BE2B 2ZXEB 3PEJA 5E3AA 4DX5A 2G13A 2XNDH 1RWUA 3DOLA 3ITHA 4PAAA 4A8WA 1AQ5A 1C0UB 3MMJA 3L70G 1N86A 2BUNA 2OQQA 4FXDA 1Y9OA 1R0AB 1YBUA 2GVDB 2CNLB 1QX8A 1CPZA 1Q8BA 2HWHA 1U6FA 1W5CE 1SJ1A 1RP5A 1XNQJ 3EE3A 4OX6A 3CJ8A 5IFMA 3VF0B 2QV6A 3AQOA 4ZVHA 2R8KA 2JLFA 5D8HB 3K89A 4B3OB 1HBOA 4YEAA 4ZITA 2ZRAA 2KZJA 2UV8A 1S0NA 4OI0A 1S9FA 4A8XA 3GJRB 2VRSA 1G2CA 2ROGA 1J1EB 3QZ7A 3H40A 1OSCA 2J58A 3Q8UA 2E76D 5HMXA 1X0PA 1HHQA 1M8OB 3CPWO 1IJFB 1T2KD 1VRUA 3WQPA 4PQFA 5AW0B 1N48A 2IHR1 4ID5B 2K3KA 2MYFA 5AE1A 1IJEB 1TFWA 2Z58B 2VJUA 3DU5A 3BPSP 2R9LA 5DQGA 2PA8D 2L9WA 4O0IA 2YWEA 4A8MP 1TV6B 2RUSA 3IM8A 4PPFA 2NUHA 1FWPA 4ZMDA 3VQTA 4FVMA 1HNVB 1DHMA 1U0SA 2KXHA 1N73B 2AJ0A 1FX2A 2X1GA 4ZP6A 4WY4D 3TGUD 3U1MA 4O3PA 5DDPC 1P1LA 5LMNJ 4WBFA 3MM7A 1RT1B 4Y00A 4C97A 1EJ7L 4AQRD 2Y0DA 2H54B 2BJDA 5GTIH 3T1YF 1T11A 3J7AN 3E01B 2V2KA 4U6PA 3LF0A 1PIXA 3G8TA 2K8GA 3H20A 1RE4A 3VAGA 3PJXA 2MTLA 3I55S 1T8EA 3RB3A 3GJSB 1LJ2A 1N54B 2W8KA 1AFJA 2MLXA 3IS9A 1NU4A 3G96A 1VFJA 2ZBRA 3NEKA 2OP5A 3CDUA 2QLBB 2JEEA 2W27A 4CLZA 2B88A 3UVJA 1VLYA 1YLXA 4RW9A 3DC2A 3H5UA 4P52A 1MNEA 4TQSA 5GTIE 3AEEC 4DU7A 1O6XA 3DLKA 3B71A 1GX5A 4ED4A 4FYXB 4QCLA 2V7QJ 7FD1A 2WBRA 3OL7A 2NUUG 4IFDK 4DR7J 1L4AA 3Q23A 5BU5A 2Z4EA 1N5TA 1H98A 3F73A 1S9GA 4P74A 4ETXA 1RYRA 3KLGB 2OPQB 3NAHA 3RRKA 3EMTA 2E5YA 2FVCA 1RH5B 3HTKA 3QWOC 2HQGA 3MF5A 1XJWB 2OPSA 3N5FA 1YQHA 5H2FH 2R7SA 3EPGA 3I0SA 5CYMA 3DDIA 3EQ2A 4RBVA 2IC3B 1PGOA 2MKIA 1SH3A 3CIMA 2FIUA 4B3RJ 4J9KA 2IPOB 1RWKB 2XCPA 2VH7A 3M9BA 3HHLB 3PJWA 3SZ2A 1QVGO 2HBYB 2C2NA 1PBUA 2VBWA 1HWUA 1NZ8A 3FEYB 4V1Ak 4P2XA 1AV1A 2DIVA 1T05A 2X51A 1N8RT 1VQKS 1QAYA 3SV4A 1U1PA 4OV1A 3NNAA 4F4AA 1E6VA 2JLGA 4LR8A 4CP5A 1QSSA 5H2FE 1SFCA 1YITP 5KJ7D 4U96A 1EETB 2DK2A 1GL2D 2I1RA 4HTJA 1MMDA 4UQGA 4ECYA 4F4ZA 2OPRA 2QLFB 2WT7B 3B5NC 3T3FA 1IKWA 3G4SP 2O3DA 4URSA 2MMYA 1KQSO 2Z30B 1FOSF 2GHVC 3QRRA 5DLGA 2JZ5A 1R8EA 3L73E 4ZKPA 2KFNA 4DOZA 3MECA 3PJ9A 2AIRB 1HF9A 3RB0A 3KJQB 2DB1A 3CCUS 2KYVA 2MZQA 3KTQA 4OQJA 4Y6IA 3CJ3A 1J2VA 4DSEA 4K2JA 1BGXT 5HI7A 4LSLA 2ATCB 3D3CJ 1MWQA 2RKIB 3IFEA 3MI7X 2CNNB 3CXHI 2A0FB 4DV7J 3TZXA 1N34F 2AEFA 1QGKB 2J9EA 2EBGA 3VVTA 2XWXA 1FJGF 3OVSA 1RT2A 2IYGA 4ZVRB 5DG7A 4EYIB 2HSEB 3KYLA 2CA9A 3H1KD 1LWCA 2QJKB 1T6AA 1Q81T 3UR3C 6FDRA 3DLBA 1NPPA 4ED3A 2ZREA 3ZTSA 3TA0A 3QIPA 5HVGA 2J7KA 4LBPA 1VLOA 3WUUA 2D2CD 1G6BA 2CQ0A 3BBBA 2OTLS 2YXRB 3U02A 3TI0A 2HPUA 4M5HA 1TKTA 2R7VA 2UUCF 4QU7A 4YHHJ 2KI7B 2DRDA 1KQFB 3G6YA 2GQCA 5HBMB 4ZP9A 1HNXF 3BRVB 3M30A 2BDPA 4J90A 3HJFA 3OTOJ 3K5OA 2CJYB 5CYJA 4DFKA 4AYCA 4DS4A 2MQNA 4OX7A 4EEYA 1FBMA 3CCZA 2CJBA 3V6DB 3KHGA 2XV5A 1S4EA 4UTGA 1QDUB 1H38A 4AFFA 4LF6F 1WTBA 3NXSA 3P8CE 1IR0A 1UEKA 1PILA 4DCPB 1N7SA 2QJYC 3WU2H 4JV1A 5IC6B 2NZCA 1JMTA 1C2PA 4CO1A 3ITKA 2VBXA 4WB4A 4K4ZA 4YUDA 3MEGA 1HH0A 1TU0B 3AB4B 1DEEG 1RSCA 3L75E 2AZ3A 1KOHA 1OW6A 2ZZMA 4DL7A 3PXGa 3C66A 3N4WA 4DV6J 1NTMG 4MKVA 1FRMA 3LO3A 2ZE2B 1K0VA 2ERRA 4K4VA 2B87A 4M5IA 1A02F 2Q1LA 2HFVA 3WU2E 1UP1A 2GA7A 3PRJA 4TU8A 3NXZA 3C2PA 2R4FA 2QL5B 4LF2A 2DNZA 2XMJA 1VF5C 3H98A 1RTHA 1IC2A 4USVA 2JO1A 1JLGB 4PD4H 1RLCL 4FNHA 1FOSE 1WACA 1LTSC 3EWGA 3A3YB 1Y11A 2QMUB 3NOCA 3WC0A 4JF7A 3R7NB 1U98A 1M57D 3KDNA 1D1UA 1X22A 2NLWA 1LWFB 2LXUA 1R27B 3CJ4A 4C0OC 5KLIC 1VQLS 1Q86T 2H5JB 4DQQA 1H2VZ 1D9AA 2C3OA 5IM0B 2W9CA 4K4WA 4YN3B 4M8LA 3LIDA 4PV1B 4B3SJ 1WT6A 2JEJA 6FD1A 5KAFH 4PD4E 4E8UA 2AD9A 1U49A 2CADA 3H25A 1OY8A 3OXGA 1TL4A 3FSXA 2QN6B 1ZPWX 3B5NA 2RMLA 4P2SA 4JI4F 1NJIT 3R5DA 3PRDA 1SQXJ 5M1BA 4L76A 2PO4A 4PPZA 3C1LA 4P72A 2W6BA 1APSA 2OGUA 3GQCA 2WBMA 3NGTA 4ZVSB 5KT4A 1TUGB 3BR8A 3MR2A 3W2VB 4NCAA 1KHVA 3AXKA 3M2VA 5HJXA 1GU4A 1ZTWA 2RIJA 1EQ7A 4KJIA 2EFOA 2IYOA 5EDWA 2ZXXA 1KVIA 5KAFE 2DTJA 3NGDA 4CWBA 2HHVA 2FYUE 3C8YA 2OYIC 4J7CA 1YVFA 1ZOTA 2KHCA 5DGBA 1KZUB 2HLOA 4D6TJ 4JI1F 2M70A 3OJSA 4F4KA 1U7JA 3MPVA 4YB1P 3QFWA 1IUJA 3JYTA 3CMES 3BKUA 2MKVA 1WRGA 3MGJA 4WCEQ 1HBMA 3OR1A 1A9NB 5AW9B 3BKTA 3FSIA 5B7WA 4X4NA 3TUJC 3L35A 4IG0B 4I69A 4C11B 1KWMA 4WE1B 3GV8B 2UV8G 2XI3A 1VQKP 2GVZA 2V34A 2BOAA 4DCJB 5D0EA 1LP1A 3SQOP 2WONA 1CJUB 3G82B 5LM7E 1CC7A 4LF7F 1BSNA 2LQ9A 3ISND 2POKA 3BQ1A 3H1IJ 3U1CA 2AJQA 1XBWA 1HHSA 1LWEB 1FJPA 2VA3A 1J1EC 3G3ZA 3UDVA 3OLBA 4G1PA 3WUTA 3PX0A 2JFDA 3DLJA 4DV4J 4LC1A 1NOHA 1VQ8S 3KK2A 2KK7A 2XLIA 2DGSA 2W90A 4BC9A 2F8EX 2DHSA 4IQXA 3AE1C 3PRVA 1X4BA 3AY0A 3MAAA 1VBYA 1RWMB 4LF9J 1P6TA 4K59A 2ZBIA 1SB6A 2VBZA 4IRDA 1PPJG 1L0LE 3D6TB 4J9MA 4U3FG 4I7ZB 3T5HA 5B09A 3CCUP 1GQEA 4CLUA 4DDFA 3VAKA 2ADBA 2OYHB 4HHUA 3QLHB 2AX1A 4ERDA 2E5JA 5BU8B 2B89A 4DUYF 1SJRA 4M5LA 1Q53A 2L48A 1S1WA 2GX8A 3FBFA 3Q8SB 3CX5D 4GMKA 2OPPA 2WPQA 1YJNS 1JLEA 1EP4A 2N1TB 4DV1J 2BX6A 1B0TA 4Z7YA 1TAQA 2YKNA 2BRLA 1VQPS 3KNGA 4HHHA 1ZPVA 2RILA 1TL1A 2HEKA 3ZZUA 4B02A 1T8ZA 1SIWB 4L74A 3NBPB 4IH6A 2JFKA 2JVOA 2CQGA 1NKCA 5F0WA 1JKHA 3R7SB 3SYZA 2R7WA 4QMAA 2IM3A 2O3JA 3MCSA 3RRHA 5CYQB 1T9XA 4EOTA 2VPXB 2Z2LA 1DLOB 1EARA 2F8HA 2OTLP 1NHVA 1S1TB 2AT1B 5I4MA 4BCAA 3IR7B 4QR1A 2FHMA 3VALA 2BOPA 2J0SD 2WZ1A 4JYBA 4KFBA 2OMLA 3KUEA 2XO7A 2MQ8A 4X84A 5JMNA 5A0YB 2ASJA 2J6UA 2IA6A 4WF9Q 1S59A 2YNGB 1KB9H 2D7SA 3UI3A 3O2IA 4NZ7A 4O9BA 5CCGC 2YWGA 1IBMF 1U1NA 5J2MB 1HBNA 4KRWA 2W01A 4C7NA 3W68A 3PW4A 2ZRJA 4RX6A 1YJWP 2UUAJ 3D67A 2ZRNA 2BCCE 3RAQA 4I6WA 2YWWA 3FXDA 4M3LA 3AEDC 3HX9A 4ZLLA 3CC7S 3M6XA 2WVDA 2PSZA 2GA1A 1BWEA 1MU2A 4N3YB 3C3LA 3MFIA 4OZ5A 2ZT9B 4I4BA 2IYIA 3HLUA 4IFMA 1R6VA 1N6QB 2HQDA 1FX4A 4KYZA 2MGZB 1KB9E 2BE9B 3GJQB 2QSIA 3PYFA 1BHNA 1NSKL 4WVZA 4LF4F 1I94J 4NLVA 1S1VB 1AA0A 2UUTA 1KTVA 3VAJA 2QFIA 5EWFA 3JTPA 4I64A 2P9GA 2QC3A 1YJTA 4FDFA 4C8LA 4A8FA 5DETA 3B8HA 2OYIA 2LQBA 3JB9k 2Z0GA 1NBEB 3CDBA 3P49B 1ELOA 1XK8A 2XZTB 2M0GB 3TR5A 3MTJA 2CDRB 1K0TA 5BR8F 4I1LA 2IVYA 2Y8WA 2BE2A 1BGYJ 2POHA 5ETMA 4R4LA 4LRCA 2JJLA 4HH1A 2V67A 1IBLF 4OYMA 4EYHB 2ZFHA 2Q9IA 2B3TB 3GYGA 2IJNA 1W2EA 2B4OA 4DR3F 1FZEA 3BKFA 3UNGC 4BS2A 2Y1LB 5CJ0A 1R0AA 5THWA 4I6YA 5AW4B 2GVDA 2OUGA 5E0OA 1M56D 3RYLA 1SQPJ 5LT5A 2FC9A 1CEZA 1VK3A 4Q43A 1PGPA 3AOBA 1PV3A 3NCPA 1VQLP 2OEMA 1S9KE 3MMAB 3OBIA 4B3OA 3DGPA 1ZBTA 3HHEA 2LKZA 3FRYA 3IBWA 4J9NA 1WEXA 5AVRB 3QZ8A 3IR6B 4A8KA 4DCOB 1SQVE 2VJVA 4DV0J 2ZFCA 1ZM9A 3UDEA 1FDAA 4DSLA 4ID5A 5K8MA 2E44A 4DZ6A 2DH9A 2CJAA 3DCAA 4KY3A 2D41A 1KQLA 1TUVA 1LTAC 2HKEA 2WSCH 1MROB 4ELTA 1FI4A 2DXFA 4QPTA 9RUBA 3GCWP 4Z1MH 4Y2KA 1U1MA 1TV6A 2QJKC 4BRYB 3ADAC 1V6HA 4ED1A 2N9YB 1VC6A 1N5SA 2RDJA 1X9SA 1K8AQ 1N32F 1HNVA 4X2BA 1SL1A 2BKOA 1N73A 3NS6A 2OO4A 4XFJA 3EJMA 5DM6Q 4IOAQ 3EZ5A 1M90Q 3VAFA 3CMEP 3B78A 2ZYAA 3EXYA 2BR0A 3LW5H 3MMCB 4QWDA 5AW7B 1HTLC 2H4YB 3RB4A 1RTJB 2YNIB 2MZSA 1UVJA 4CH7A 5CMZA 3E01A 3J7ZT 2O01H 5KFYA 3KNAA 3DYAB 2VG7B 1Q5VA 3W2WA 3RK3E 4WXOA 1OO0B 3FZBA 3I31A 3IO1A 3NGUA 4ZPWR 4DSKA 5KTBA 3KG0A 3EVOA 3SI8A 2PMWA 2ZZNA 2J7UA 4KGMA 2H4WB 1NTKK 1KYOH 2QM8A 3T9NA 5AW6B 3PHEA 1VQ8P 1BQNB 4LRAA 1AW0A 1X8DA 1NTZG 3L74E 2UZAA 1Y5LB 1KMIZ 1SC4B 4R4MA 2YX7A 4NXNJ 1D09B 3H1LE 4FF1A 3RL0B 1LW0B 1RKJA 3D5MA 2HS0A 1IR2A 3BQ0A 4J9LA 1NK7A 1UWBB 3L7OA 3FSYA 4I6MC 3SSQA 2DR8A 2MHNA 3IWNC 2LCWA 2FZKB 4DV3F 2OPQA 2NXNA 1N0VC 5D3GB 2WSSH 1NTKD 4K4YA 3I6PA 3RBXA 4M5MA 4QWCA 5CAAA 1DTTB 3Q0AA 1P84D 1KYOE 3H1HE 1DARA 3MD3A 2G1HA 5KAKA 5CBNA 2BJ8A 3QYYA 3BGRB 3OUYB 1KP6A 1FRXA 4UT4A 4B9SA 3NKYA 1N36J 1NH4A 2IC3A 4IFVB 3KFWX 5KG3A 3D70A 4ER8A 1FE6A 1KC8Q 4JI7F 2HNYB 4GVLA 3THPA 2FTRA 3HHLA 2FVQA 2XSJB 2OEPA 1WJ9A 5ETNA 3FCVA 4ED0A 1HR0F 4LQ9A 4WBAA 4F26A 3Q89A 2E75C 4DLEA 4UZBA 1ZZFA 2H65B 2BEQD 3U59A 2CJXB 4G1IA 4GKKJ 3M9HA 4PV1C 2R2UA 2QL7B 1BE3G 2Q7CA 4ELUA 1EETA 3EGNA 5L8RJ 5A8WB 1S4XA 1RACB 1U25A 2VZ9A 3HKZD 3MEEB 2RN0A 1SL2A 2E5LF 3CVKA 1L3SA 1LTIC 4MIAA 1N88A 3OFFA 2DW3A 5KFJA 2V8PA 1SJ4P 5IT4A 1PC5A 4KR0B 3DXBA 1VI7A 1H8AA 1GD2E 1KTQA 3L71G 1U57A 5AVUB 2J5UA 2VHGA 1XEZA 2VONA 4CO3A 3L09A 2WVCA 3CGIA 3IN5A 2JL9A 3AJ1A 4V19X 2W2PP 4YOEA 1R8CA 1L2PA 2AYEA 2GAGC 1DRZA 2P7JA 3T97B 4MKBA 3BDPA 3HFZB 2MLYA 1R3NA 5KLVE 2CG4A 2RF2B 1NSAA 4BC7A 1U1OA 2UXBF 1LWUA 2RKIA 2E1RA 5HK4A 4PYDA 2CZ4A 2PGCA 3JSRA 2YQ1A 2R8HA 4IR9A 3CCRS 1HD1A 3W63A 4MMOA 3SFDC 5KFEA 4L3KA 1IO4A 1BC6A 4X4TA 1DTQB 2DXDA 3NG8A 3OW2R 4F3OA 2AEJA 3O5TB 1UMJA 1HPZB 2GJ2A 1PL5A 3K17A 1OWXA 1RAIB 3N01A 2AGPA 5HBMA 1HHTP 2L9DA 2YKMB 1XMQF 3OFGA 2Q43A 1USEA 3TZYA 1FNXH 2I8DA 3M8QB 4YXWH 1RAGB 3V4QA 3V6DA 5D0GA 3ZZ0A 2YBVA 3GF3A 2VUGA 3AOCA 2C2KB 2C3YA 3IGNA 3DI6B 4QIVA 1FZCB 1T9UA 4OI1A 4ANDA 2Y9ZA 2WPRA 4DI6A 2CWKA 4OV6A 4IO9Q 1VQ9P 3EFGA 5CZVA 4I7ZC 2ZBQA 3JQMA 3R7BB 1XWLA 1MW7A 1JLQB 2KSEA 4KV8A 4WZQA 1CZQA 2DHXA 1OMIA 1NU1E 2O67A 2V2QA 2KXFA 3VGSA 4DHVA 1N5YB 4G6VB 4EYYQ 3H6PA 2MY7A 4DL4A 1XN9A 2ZE2A 3SEOA 3JXOA 3L73J 3GV5B 2QYGA 3VGUA 3LPEA 2DXEA 1VQ4S 1FKPB 2EKNA 3E1IA 3FVYA 3JQJA 1VOMA 3BO2A 3F0NA 2H89C 2N82B 4MAKA 3BSNA 1PCAA 5L9NA 4CLLA 4E98A 1PP9E 1JQGA 4CNYA 4L75A 4OI3A 4HH0A 4RW6B 1ZA2B 3TYYA 3OR2B 3T1YJ 1BDCA 4ECUA 4DQIA 4EO6A 1JXLA 1LWFA 1X0TA 1GMWD 2DPIA 3AE9C 1HGVA 1MO4A 3TQ1A 2XBPA 3H59A 1TL5A 4OMFG 2HQ3A 3FX0A 3BN4A 3P32A 3KJNB 1YHQP 3AOAA 3OL8A 3G87A 3Q8RB 5IM0A 5D15A 5CBOA 4WZMA 3NFQA 5APQA 5D0HA 3MURP 1C4AA 4L72B 5F8NA 1KFMA 2GGPB 3POTB 4GOEA 1T9VA 4JV5F 3FGVA 3MD1A 1SQFA 4H44B 2KSJA 3BRTB 5CCHC 2AJ2A 3GHGC 3GMAA 3KG4A 1AUDA 2HK3A 3DHXA 1PIEA 4LGDE 5D6GA 2IRYA 5ETOA 2W2NP 3P96A 3FXEA 3W2VA 4FNIA 4ZVQB 4MT1A 4BHQA 3I5BA 2CDQA 2GIRA 3L70E 3CXHH 3IA0A 3M6UA 3OXLA 1EDKA 3GCXP 1T9WA 4GC6A 2WSEJ 1U47A 1FZFA 4UF4A 1UIIA 4KGXB 2WW8A 3EGVA 4ZVPB 2YH0A 4I7FB 3TF5A 3OV7A 2XMMA 2JWDA 4WKYA 2HVHA 1HKAA 3D2WA 3DLGB 4KT0J 1R0CB 1DY3A 5A8KB 1XMVA 1Q7YQ 3LALA 1QL1A 4WP9A 3CXHE 2YY3A 4IG0A 3L75J 3CCTA 3OJAB 4C11A 2QIFA 4WE1A 3M9OB 5L8RC 5E5NA 2PAJA 1TVRB 1NWQA 1PGJA 3LGHA 3GZ7A 2H51B 2DCLA 4O3NA 5J2NA 2Q1KA 1S99A 4TKTA 3AEFC 4X65F 1NTMD 1HGZA 1CJUA 1KKHA 3G82A 3EWKA 3DLLQ 3UD4P 2HBZB 2OTJS 1F5CA 1QJHA 3NTNA 1LWEA 4CI0B 5FDLB 1KHWA 3T5JA 1FO1A 2IVMA 4P2MA 4IG3B 3MMBB 1XR7A 3LWMA 2XS7A 4CLKA 1RWWB 2FXMA 2DGOA 4Y65A 1USDA 3GFYA 1M1JB 3EFFK 2B7BB 4X64J 2P58A 3NNHA 1K47A 4ZPBA 2ZOFA 5GAGU 2H43A 3MM8B 1EQMA 3HULA 1HFEL 4N8NA 3LANA 2ZH5A 4AUKA 2FJXA 2ZR7A 4DL5A 1LXJA 2OEJA 3OAKA 2ZEJA 3SSUA 3HT0A 1QD1A 3G6XA 3R5AA 1L3UA 5KT6A 1RT4B 1Y9BA 2YNHA 2VG5B 2W4DA 4NLRA 4JI6J 2Y1IA 2B56A 1X4AA 2RSQA 2OYHA 1RAJA 3LA0A 3C19A 4XA4A 3QLHA 3BGLA 3CMAS 1S7HA 3K5BA 2HGMA 2C2ZB 4C48A 2XYPB 4OLPA 4H0LB 2N1TA 3ISZA 1KFSA 2RB7A 3CCRP 1OY6A 1LW2A 4DUTA 2MQMA 2MKJA 4HYTB 3LQVA 1JY2N 2B6AB 1YZ7A 3NBPA 5JUMA 3H5SA 1GEHA 5L1LA 3JSVC 4AL7A 3DXSX 2KZMA 3VYIA 1QAJA 4WWIA 5CYQA 4NMLA 1EZVD 1GNKA 2RJZA 3R2CJ 2M52A 1S1TA 3TAQA 4ECZA 3T6BA 4M1KA 2FYUJ 4DN0A 4EZ9A 5CD4H 2UUCJ 4KQZA 1MLAA 2XGQA 2I1JA 2QTWA 4DLGA 1HNXJ 2G0CA 2B8QA 1IWAA 3Q5SA 3HUSB 3JC22 2ALZA 5A0YA 1E6YA 1G1XA 2WPSA 4F36A 5IOLA 4AUWA 3V2PA 3NS5A 2YNGA 4LF6J 2DR7A 3UDLA 2AQ4A 3K0JA 4QWAA 5J2MA 1F0XA 3GSIA 3A3OB 4PWUA 2C1EB 2OSQA 4OJ1A 3DN9A 2ZHBA 1G2EA 2YX4A 2AKWB 2R7XA 2V9WA 4B9LA 1YBAA 4WYLA 3QRPA 1VPCA 4M5GA 3TVZA 1R8AA 1URQB 4QIEA 1WOPA 3IMQJ 4O3RA 5CCHA 3RB6A 3ZZZA 2ZRKA 1IFJA 1LQ9A 1N6QA 3CC4S 1UVNA 2MGZA 2W4PA 4WU2A 4Y2MA 2BBEA 1RHUB 3NP5A 3UE2A 1RKIA 1S1VA 2RQCA 4XPEA 1A02J 1UBCA 3NS7B 4LVNP 2LR2A 5I42B 5APSA 1VQ4P 2I2YA 3RZAA 1M0SA 1L0LJ 3RK2B 5I3PA 3Q3DA 2LECA 1UJ5A 4NEZA 2DY9A 3PKMA 3N6NA 2FY1A 4UOGA 2YTCA 3TZWA 2ZITA 3GIJA 1FXRA 1FTRA 1BMQB 1SJQA 3I9ZA 1WEYA 2KRRA 2HAFA 1TKDA 3L36A 2IRUA 1SQXG 2X1FA 1FRIA 4ZP8A 2JDJA 4O4GB 1HWLA 3OL9A 3BSAA 1GTWA 1ZH5A 3IWXA 2KL8A 2HFOA 2JVRA 4KE5A 3SWFA 3IGVA 1JJHA 2NPFA 4ALZA 1HI1A 2GS8A 3MMAA 1ZRTE 3GG2A 1KTMA 1HI0P 4C8MA 5SZTA 1UIXA 4O44B 4MKYA 4CH0S 2G4BA 2F4VF 1S10A 4JBCA 1H6KX 1EDIA 2GFFA 4PYAA 3EPIA 1U1RA 1IWGA 4EZ6A 2UUBF 4JI4J 2E9TA 1OIAA 3E7KA 4D6TG 2WSEC 3RK3B 1KILE 2FB0A 1M90T 1NXIA 1S9EA 1JY2P 4NYZA 4F04B 2LEBA 1GK6A 4GOFA 3B8EB 4CO4A 1VQMS 1B70B 2D3O1 4OGQD 1L0NK 2E76C 1YJUA 3QT6A 4P10A 4WP8A 3HD1A 4B3MF 2UP1A 2L9NA 4DX7A 2OD6A 4BRYA 4OYXA 1T2KC 1L4AD 1X4EA 2NPSD 1E5WA 2BCCJ 4NLDA 4JI1J 2QJPB 4KHRA 3EVMA 1IJDB 3H1IG 2GIFA 5IQ6A 1LK5A 2M7SA 3MMCA 3FQKA 2W7PA 5KG6A 4DFJA 1HQ2A 1L0ND 5HAOA 1GAOA 2YNIA 1IFNA 2AW0A 4NE9C 3Q2SC 2FFDC 7FDRA 3I5AA 4XIUA 3PY8A 1UPPA 4U9RA 1Q79A 3M91A 3PEHA 1UA1A 4USTA 4U67Q 2B8PA 1SBRA 1KVJA 3DYAA 3BH6B 2VG7A 3KXDA 2W7AA 2V4RA 1WKKA 4X4VA 1FZCC 4LF7J 1UKUA 1VYAA 1Y5IB 1NK0A 4OYBA 5LJ5Y 2ZNYA 4AYBD 4XTTA 4CM0A 2N3OA 3QATA 3MR7A 1SFCD 2HVDA 3TAPA 5J1EB 3C6TA 4UOFA 2HS3A 3L9ZA 2PT0A 2YNYA 4QWBA 4J9PA 3QO9B 1LW0A 3AT1B 1SQQK 1QVGR 2A06E 3O6QB 4HJGH 1DQ8A 1KC8T 2XZRA 1UWBA 1JY3O 5RUBA 4E2FB 3EDQB 4DR6F 1FF2A 3OTDA 4K2XA 1N33F 1VQYA 4AL5A 5D3GA 2ZUAA 3ENAA 3ZNUA 1U7LA 4DS5A 1DTTA 4F50A 1W25A 2A2DA 1Q8KA 4LF5F 5ADZA 4DUYJ 2LA4A 5DQHA 3IP0A 2KLUA 3BGRA 4F3MA 1VHFA 3CMAP 1S72S 4RESB 3JTOA 4PR6A 4IFVA 2XCAA 2R7OA 2ZKUA 1SQQD 3I87A 4XK8C 2FDNA 1NDLA 1SQVJ 4A7PA 3OD2A 3MOZA 1KQSR 2UU9F 2HNYA 2D9PA 2XSJA 2EC0A 1VR6A 3WX8A 1C0TA 1S3JA 1WG5A 1S6QB 5J2QB 1U48A 2ZWPA 1KVKA 5KOXA 1SS1A 4IOCQ 4TU7A 1S6UA 1TK0A 1SQBK 5KFKA 5BYRA 3UDCA 1N0UA 1IFIA 2E5GA 3OA7A 5H9FK 4HEA9 5A8WA 1MO3A 1UJ4A 3MM6B 5IT9Y 2UUWA 3MEEA 1K44A 1X9WA 2E7XA 1S57A 3GLMA 3BQ2A 2RVJA 5F3TA 2OSRA 4X66F 2A18A 5E2QA 2A10A 2ZVOB 1U6ZA 1IBMJ 5KJ7C 1TL7A 1M5HA 2HS4A 2WSCJ 1SQBD 2XEXA 2QIWA 3EYZA 2FLOA 4DFMA 2M5YA 1T7PA 1FJEB 5E41A 1XMOF 5JVGQ 4X4UA 4WWSA 2ZZTA 3T97A 1YG0A 1N7SD 3P8MC 2VC1A 1JB0J 1VL2A 2JRSA 3DRSA 2KH9A 1BGYG 2EFVA 4QIGA 2N4DA 3LW5J 2ZRHA 3K2YA 1G18A 3KUHA 4JV0A 1I5OB 2IPPA 2RHQB 1Q90D 1PGQA 3AXMA 2YPZA 3CJ2A 3L74J 4N8OA 1RXOB 2GQQA 2KVQE 4ILRA 3H1LJ 1SQPG 4UB6H 1R8HA 2O01J 3A8EA 1DTQA 1NLKL 4MKAA 3C8VA 5KFBA 5BR8J 3DMJB 1JEKA 1AROP 2RRNA 1DEBA 1M5OC 4RKUJ 1WORA 3GIIA 4LIRA 3Q2YA 1PPJE 4U3FE 1IFPA 5F41A 3G9CA 3UIAA 1IBLJ 2AJFE 3T5LA 2ILYA 3H1HJ 4YB5A 2Y1RI 4IFYB 4IDKB 4DR3J 2YKMA 1CS4B 2FJEB 1YJRA 2DY1A 3R2PA 2ZROA 3IAOA 3M8QA 2J6TA 2RE1A 4HDGA 4UB6E 4OHVA 3HK2A 5KT2A 1OXZA 4I2LC 3D54A 2QE7H 1F1BB 3CD7A 1W2IA 4ASWA 1ITPA 3P7KA 2H48B 4J9SA 3MCNA 2DPJA 1EKSA 4CLYA 3KLIB 1TAUA 2C3UA 4ED5A 3WZ0A 1JLQA 1LTTC 2HVZA 3RU0A 3WX4A 4JYAF 3H1JE 1FDIA 2R2SA 3WUVA 4NLQA 1FRKA 5K20B 3B5ND 1N5YA 1DAXA 2REBA 1FK9B 4PWDB 4W92B 4H0LC 3QMQA 1TMMA 2KB2A 4WXWA 3I5CA 3DGVA 4YB6A 1VQMP 2W2MP 2W8LA 3M9MB 1RWNB 2DRAA 2DR6A 3MHYA 2ODNA 3PJSK 3QJLA 2QA1A 1S0VA 1BE4A 2M88A 4TLQA 4NLXA 3RR7A 1FKPA 1T02A 1YSJA 4HI2A 4JOUA 4DR4F 1S5LX 5FJ4A 5FD1A 4KKOA 2HIQA 2A3JA 3VWSA 3IR5B 4DL0C 4QIWD 1AYEA 1LFWA 2A2CA 5KLVJ 2VB6A 2CQIA 3VP9A 2HHSA 1VQ5S 2ZM6F 4A8SA 4RW6A 3PV8A 2MXYA 2DGWA 2EFGA 2YXLA 3OR2A 3HUSC 5MLCV 3I9V9 3HHNB 2DR9A 4I6AA 2ITAA 3TAMB 1FC2C 3ZO7A 1HNIB 2BM0A 1K73Q 3TEGA 3VTPC 2IFMA 1BCCE 4IO1A 5K8NA 3KHUA 2BW2A 4RZRA 3D6YA 1KDNA 4DL2A 4LT6A 3HVTB 4ED8A 4CPGA 2GGPA 3POTA 4ZJOA 2A45G 5AVSB 4LSNB 1FXDA 5H1SV 1SQEA 3T6JA 1N56A 3BYRA 3DU6A 1PJ5A 4G3IA 3VMYA 3ZXWA 5B0GA 2CRLA 4GIFA 2XMUA 3DRRB 5ETKA 1YIJP 3RW6A 3LP1B 2C2RA 1Q7YT 1UJ6A 2MKKA 3CUNA 4LFAF 5B5EH 2VV5A 2K3IA 2W7OA 5KFRA 4DV3J 2X1BA 3CW2C 3AEBC 2VC0A 2V68A 2V9KA 3PYEA 1QSLA 4TT3H 3GG1A 2Y0BB 5K5GB 3RAMA 3ILOA 3V6JA 1BQMB 4YDDB 5C25B 2N3LA 1UW4A 1S72P 5AVYB 2IBKA 3LH2S 3AEAC 2MKSA 2AYGA 1YYCA 2QSFA 4ZA1A 5A8KA 4ZN1A 4JI7J 1NU1J 4OX9F 1SP4A 4PPQA 1PFIA 5B5EE 5L38A 2VPWB 4ECVA 2JEFA 1XR5A 2B9BA 4PPDA 1TVRA 1RWXB 2PMZD 3EICA 5KFTA 4N6JA 3AJ2A 1CJKB 3JAMU 1RT5B 2I0XA 4JI3F 3WC2A 4O3OA 2MJNA 4J91A 5D4LA 3W5ZA 4IRKA 4F2RA 1CC8A 4J9QA 5FDLA 5E7OB 1Y00A 1RAFB 4IG3A 2E5LJ 3MMBA 2W9BA 4PG6A 2MHEA 4CCHA 4EDFA 3LUYA 1M1JA 3Q5RA 3KKFA 1RISA 1PP9J 2QA4G 1KORA 3RK3C 4EFAC 3NNCA 2ATLA 3ISNC 4XO0A 3H32A 1RF1C 2FJBB 3IC1A 1YJ9S 4RBUA 3VP8A 3JSYA 3M2RB 2V4HA 3S9OA 2V8HA 4QYZJ 1RT4A 3LW5C 3S6EA 2WWWA 4ILLA 2VG5A 2P6TA 3TARA 4P9SA 3E8OA 5LMUF 2ZBPA 1JK9B 3V6IA 2BMBA 2OH2A 5E33A 2ASLA 1JLAB 2QYCA 4DPXA 3L3CA 3DLEB 2UXBJ 2O01C 2UXDJ 1X0FA 1OW8A 2QJPC 2QJYB 1Q8LA 2F40A 3PFOA 4OYWA 1M1KQ 1LTBC 1J2JB 4ZPCA 3TX0A 4ZHRB 5GMKa 1SIZA 4LVOP 2B6AA 2PIIA 1FDNA 2BW7A 1NTZE 5B66H 5F9NA 4NA2A 5T7LB 3PO4A 4PZVA 5EUHA 4A4JA 2IFNA 2C2DA 3L70J 5A8RB 3KLFB 2W2QP 2IM1A 1WC0A 3D28A 2B5JA 3GB0A 3BPDA 1WI6A 4KBIA 3KYQA 5AVZB 2BXJA 1DBDA 3NL0A 2IBZE 2PDAA 2Q6BA 1WSRA 4FXWA 1XMQJ 6AT1B 2X3GA 3DDNA 3AH6A 5AE3A 5KG2A 1KFDA 3X1LB 2M8DB 1GK4A 5B66E 4KAIA 3QIDA 4ICLB 1YZ6A 5AJ3F 3Q8YA 4RWWA 1D8ZA 2BJ3A 1WKJA 3FC9A 1D7MA 1LT9B 2VL1A 1X5TA 4IOBA 4FBTA 1MWZA 1SV5A 3L73G 4DG1A 4U7JA 4RW4A 5B0EA 4PPNA 1TR0A 5KLIB 5BXIA 1URQA 4HDHA 3CWBE 1RCOB 2RMZA 3E1RA 5KFPA 3IN6A 2C0XA 3K7RA 2A45I 4DX8H 3BJYA 2V8GA 1BE3E 1WC4A 3AAWB 2Z4PA 4ASVA 2JSXA 1T03B 3CX5I 3W1YC 3WMM0 5KFNA 2M2BA 5L1IA 5KFUA 4ZPAA 4YR0A 3MP7B 4O4RA 1RDRA 5GADU 3V4WA 2AGOA 1HQEB 1FAVA 1NDPA 4ZLNA 2UVVA 1KILB 1JLFB 3SSRA 2WTYA 3PHLA 1F2GA 1Q5YA 4BWJA 3L71E 1NGMB 4F0KA 3SWYA 4BBYA 3BVHA 1NNDA 2HQFA 3HZEA 2DNMA 4JI5F 4O3QA 4WPAA 2DEIA 1X9VA 2HBQB 3RL0g 5GTHH 4C46A 3OHBA 1VQ5P 4FXVA 2XMAA 4Y99C 4NZ6A 2D1CA 4RU2A 2D3OR 4O4GA 2MJZA 4C8NA 5TISH 5U47A 2DH7A 2IM0A 3FBCA 3SFUA 2FZGB 2QG4A 4AQYF 1SUQB 3ENVA 3KK3B 4O44A 1W26A 4LRFA 4MK8A 4L6V3 1RE1B 3GU0A 1S1XB 1NTKG 5GTHE 2QM7A 2IFXA 2ZRGA 4JV5J 1YKWA 1F9HA 3GTYX 3PVXA 2GIQA 5AW5B 4LFBF 3AE8C 5HMWA 2MQOA 1X5PA 3R97A 5TISE 3D1OA 3M06A 4ZPDA 3PX4A 4HACB 3HSDA 2RRBA 1DD4A 4G1QA 2ASYA 3L75G 2DHGA 2AXCA 1WOSA 2DGVA 4QU6A 2WOMA 1Q95G 2H88C 1JWWA 4OYAA 3NMAA 4Q8EA 3BS9A 1RHKB 3N28A 2F8MA 3D1QA 1UBGA 5T41A 1IKXB 5JRJA 3VMXA 2F7VA 3RGIA 2LEPA 3I32A 1C1CB 5BJRA 1SI9A 1SKWA 3NMDA 1NDCA 2FHJD 4H13B 2MLZA 3KK1B 3SCLE 2R3VA 3ELHA 5SUHA 3BCCE 4DV2F 1QEXA 1RF0C 3CC2S 1UVMA 3VMAA 2C0WA 5HO4A 4ECTA 4KGKA 1NAQA 3J80U 3HD7B 4ZCLA 2FLLA 1OX3A 1XR6A 3HHLD 4X65J 2ZR9A 5J2PB 2HRYA 5KFGA 1AVYA 2R5BA 1M1HA 4FPRA 2VFTA 2ZH1A 3S01A 4QYRA 2GHWA 1SQXK 4CTAA 1URNA 1IKYB 3C15A 5E3QA 4ZN3A 2XNXA 1JJCB 5J1EA 3CSKA 1U2FA 4QIFA 2KM8C 5AVWB 4ZS6A 5DRKA 1UPMB 1IM6A 1SC6A 4ZVFA 2ZC3A 3ONQA 3TA1A 4EO8A 1D9DA 3D6FB 1RA6A 4NPFX 5IV4A 1YJ9P 4C9DA 5JVHQ 2RU9A 4IH7A 1Q8IA 2W1BA 1PBAA 4FYYB 1F6TA 4DEZA 1ACMB 2SPZA 4OJGA 1SQXD 4JQ0D 1A7GE 3PM9A 4USKA 1FZAA 2KG0A 3PW7A 1GW3A 4DSIA 1VIXA 4ECSA 3D9BA 2CVEA 3MOJB 1ZM4A 1KOOA 2FYUG 4NPDA 2D3UA 2NPSA 1FE0A 1HI8A 5F8MA 2BJ7A 4DR5F 2HAIA 2MSTA 3AD8C 2CPBA 3MFHA 4MIWA 2JRBA 4S0MA 4NA3A 2LDIA 4C3MA 3MUVP 1QM9A 1CLFA 4KPYA 2CZVC 4D6TD 1EXJA 2QMXA 4YTPC 4DU8A 5LSOA 1YX2A 3R2DJ 5KKZB 4MJKA 1RAHB 4FF3A 1DJ0A 4X4SA 3CCSS 2HHPA 3E51A 2FBWC 2JJ4D 3G8SA 2PEBA 1VRUB 3KLHB 5B0CA 3FBBA 5DZ7A 5CHXA 1NKNA 2UXCF 4TU9A 1JMMA 1V9OA 3B82A 1RAEB 3MM6A 5JJBA 4DV5F 1YDLA 3MUDC 1NK4A 3EDRB 3S4RA 1B99A 3O8ZA 4MIBA 2NXUA 4USMA 4Y28J 4NA1A 4ZPTR 1SC1B 1B64A 4B17A 2XDJA 3A5TA 3QJPA 2EC2A 3H1ID 1JNMA 4CLFA 4HB1A 1OYDA 2IZ1A 2BZ2A 2BANB 2Y0EA 2RQKA 1Y7PA 3TRGA 1NTMJ 2JR8A 1OS5A 4J9RA 3S1KA 1L0LG 4A8YA 2K3RA 2ALYB 4WK3A 2IDBA 2YXQB 5C39A 1GMJA 2XHCA 3TK1A 1RY3A 3GR0A 5KT5A 3IRWP 2IM2A 4OZ0A 3M8SA 1P84I 1QY7A 3G71S 2V69A 1J5OB 3CD6S 4NOHA 3NWGA 2HFED 1NKEA 5HVFA 4EUVA 2I8EA 5DQIA 3L72E 4OJ3A 2VFUA 1ZN5A 4OZLA 1YBTA 2OESA 3K5LA 2ZH2A 3PFEA 4ED7A 3SFEC 1WI8A 2RUGA 2CPDA 3V6HA 3LAKA 2KIKA 5IWAJ 1LK7A 2KG1A 3P5TL 3KMQA 2FJDB 3UVJB 4Q7AA 3DMJA 3U1AA 1YRUA 3DOMA 4PSVA 3VMZA 3K59A 4GDOA 1O51A 4IFYA 4ZPVR 2VOPA 2OHDA 4IDKA 3ZZRA 1S48A 2V2ZA 2V8DA 1CS4A 1KNZA 4J37A 2WSEH 3AEGC 4FS2A 4LR9A 1RTZA 3FKBA 9ATCB 4AL6A 1C1BB 3L95X 2ACMA 1BSHA 3BYPA 1X9MA 1SPBP 2FD2A 2M8HA 5T14A 2ZRMA 1LFPA 2C3PA 4F02A 1CQNA 3AODA 1OMSA 2YMKA 2ZRCA 3KLIA 2F4VJ 4NLTA 5APXA 4PQYA 4EU0A 1WF1A 2UUBJ 4PV1D 1JNZB 4ZOSA 2BCCG 4H4MB 2EFNA 1T05B 2QA4S 3S7RA 1YJWS 1RWPB 1FK9A 2CK3H 4D3HA 3HPOA 5AW3B 5KG4A 2FZCB 2LMIA 2XWYA 4NI2A 3B4DA 4EBDA 2HQIA 4WU3A 4KHMA 2U1AA 1K05A 2KT5A 4KH1B 2Z57B 5KG0A 4B3MJ 3UN5A 2QA2A 4AD6A 1VBXA 1K73T 2X3DA 2HNZB 5GAGI 3RBDA 4DV4F 4ANCA 5DDOC 3B6BA 4OI4A 1G1JA 2KN4A 1WTFA 1UEUA 2AYMA 3CE8A 2H3EB 3T1HF 3DRXA 1SQPK 5ITHA 1RT3A 3O44A 3MM9B 3CC2P 4ZVOB 1RQ0A 1S0OA 3M8RA 3DDKA 5D4NA 3TAMA 5C5JA 1BGYD 3TGUE 1NB7A 4TWZA 1SVDA 1XMSA 4W80A 2NPIA 3ENWA 2Y9HA 1ZM3A 4O3SA 1LT9C 4LSLB 1RABB 4M63A 3Q86A 1SQPD 2N7CA 1BD6A 3HVTA 4LFCF 3UN2A 2AHOB 4Q2MA 3AHPA 4LSNA 2L3MA 3K5NA 3K8WA 2E75B 1SH2A 4U3FJ 2J9DE 1S6OA 2L41A 1LWCB 2Z8QA 2C22A 1XMBA 2G1DA 2JKVA 3TA2A 3DRRA 1T3NA 4LQ3A 2OFOA 4J9OA 3LP1A 1SQVG 2XKMA 3MWBA 3PO5A 1JMBA 2ZR0A 2KJVA 4DR6J 1TKTB 3U1LA 5C2CA 1J5EF 3C46A 1N33J 1G4CA 3M0DC 4B3TJ 1RJJA 4F2SA 2ZKTA 1KILC 1EZVG 3HXMA 2Q3PA 2R32A 5C25A 5KFWA 1NJXA 2LQ5A 4B08A 4K35A 4N78D 3PRBA 1K9MQ 2AYBA 2WMMA 3GIMA 3W9HA 4J9VA 2E9RX 4H4KC 4JYCA 2KYXA 1WNEA 3H1JJ 1I51B 4KHPF 2NSBA 2HRTA 2HVEA 4ZVUB 2UU9J 4XDDA 5AVXB 5KTQA 3GILA 2ZRIA 2N1TD 3MR5A 2V94A 4PSAA 4ZIWA 4HKZH 5AVTB 5B08A 3RG6A 2Q5UA 3QBCA 1NHLA 1R43A 3CCSP 4PO8A 1RYSA 4BXLA 5IQQA 1CJKA 4Y28C 2YKQA 1XNRF 3K5PA 1AFIA 2ADCA 4RUCA 4K0KJ 1U2RA 2HHHF 2VKZG 4RPFA 5LXRA 1T94A 1F9FA 2ZWOA 3HVRA 2FVRA 1Q16B 4TLFA 5GVQA 3RBEA 3BF4A 2EG1A 3V81B 4X66J 1P9YA 3D6ZA 1HBWA 1RHRB 1NHKL 2V4QA 1EKRA 2GHPA 4FP9A 1M1KT 1VHIA 4KB7A 1MN9A 3L74G 1IK9A 5KFAA 4ELVA 2CPZA 3MAQA 1PYOB 3M2RA 4IL6X 4M95A 2J7WA 3VOPA 3BSOA 4Q44A 4DF8A 1XMOJ 3TNVA 2BA9A 1H3DA 2G3AA 1EHWA 2FYXA 1BCCJ 2HVIA 4FN5A 4HHJA 2E42A 1SL0A 1JLAA 3KHLA 2WSFH 3DLEA 1U94A 3FBEA 1RLDA 1JTHA 5KFLA 1QVFO 3G71P 3CD6P 2RD5C 1REVB 4NCBA 3I96A 5CD4A 4H13C 1HNWF 3GMGA 5CCHD 4OX8A 5EWEA 2ZT9D 3LGMA 2DHHA 4ZHRA 2KNCB 2QSWA 1VK8A 2CQCA 1H0TA 3BGUA 2DKOB 2DO0A 4UOCA 2QZ8A 2MQQA 2J8AA 3GP9A 4PCQA 1RHZB 2CIMA 2Y0CA 4IL6H 4QJVA 3HD7C 3MGNA 5AW2B 2D74B 1SKSA 3HP6A 4P7TA 2I1KA 1FRJA 5FLXU 4PG5A 2H9ZA 2VF3A 3H1KE 3GLJA 2I5JA 3IG1B 1RT6B 4EIJA 2RNEA 1NAYA 3BREA 3MPYA 4DL6A 4J9UE 1HW8A 2Z56B 3R8YA 4TXSA 1KD1Q 4ICLA 3TVYA 4RNNA 3ULHA 4IL6E 3OTEA 2BV3A 5HP1A 4FVCA 3J81U 1OVUA 3E2EA 2XGPA 1OIPA 1CSBA 1FJ7A 3MR6A 2VU5A 1HBMB 3OR1B 4PWWA 4JP8A 4R25A 2OIHA 4BWMA 3R5CA 1QTNB 1GXLA 5ETTA 2CPXA 2R2TA 4ECXA 1PKUA 2QLXA 4JYAJ 1NM2A 2FLPA 4UB8H 5KT3A 3ENQA 2QA4P 4NLOA 1JM0A 4EBCA 3HD2A 3CCVS 4CLTA 2J5AA 3JAMY 1T3OA 2HLTA 5GAHI 3WIVA 2A6MA 2YO3A 3BDEA 1L0NG 1IFDA 3M32B 4CLPA 3GHGB 1JJ2R 4YFUA 2FJVA 2CQ4A 3MTKA 1N5QA 3SQGB 2C2MB 1KILA 2DNKA 2CZ9A 3GFHA 3AFGA 5KKZC 2DNRA 3KK2B 1HUCA 1NZAA 4DR4J 3CCWA 1FT8A 4D3GA 4UB8E 4M5JA 1RTIB 4PKDB 1EZVI 2XG8A 2HG4A 4IRCA 4TN2A 5M2RA 2GC8A 1PJ7A 2KYZA 2J9CA 1ZP0C 5J1NA 2ZM6J 1ZTTA 5ETLA 3QQCD 1PAEX 1GU5A 3W65A 3N9UC 3SFGA 4F8RA 2AWZA 2HZVA 3PW0A 2ASDA 5GAEU 3TOQA 4RL1A 1PSDA 5HL7Q 2ZH8A 4DF4A 1NTZJ 1ICEB 1C0UA 1X5OA 4ECQA 4Y34A 5HLFB 2IMWP 2J0QD 2XYHB 3KZIH 3FWLA 2MJUA 1WHXA 2DISA 1WSVA 2JC1A 1DQAA 4LF8F 1RE3C 2CQ2A 1CBKA 4KO0B 4IYQA 2IJRA 1F9EB 1G1IA 1JKHB 5H9EJ 1HQUB 2EKYA 4NLSA 3QSYB 3EVWA 1SQQG 4HACA 1VQ9S 5C42B 2J0WA 3WIUA 3W66A 1RE4C 1NU1G 5CABA 2RS8A 5LXYA 3FQLA 3CMQA 1H2TZ 3M05A 5APUA 2FYNC 3RL0D 3DRYA 1NPKA 4RLEA 3KZIE 1HWTC 2F3JA 3WDOA 5IZHA 3DKDA 3PR5B 4CIOA 1IKXA 3MZIA 4FKYA 3ZZTA 1Q4RA 3V5BA 4ANEA 1T9TA 3BGFA 3AA8A 3L73D 4KHXA 2K7KA 3KK1A 3CWBJ 4N41A 4AXJA 1JOCA 3RJMB 3CT9A 4OX9J 4YMEA 4M94A 4PPGA 2R8GA 2VQEF 1BE3J 1KYOI 1ZS6A 2F9DA 1S77D 2ZH6A 1WHWA 1NRKA 4FYVB 2AMCB 3SCKE 3V2NA 3HDSA 4ED6A 2PFDA 1H0HB 3W62A 1SQBG 4JI3J 1RT1A 1JLBB 4XE5B 1NMEB 3FMWA 3TZZA 2XS2A 1HBUB 2VD3A 5EN1A 2CJ9A 1P27B 3L71J 1FNMA 5K14B 3JS9A 1IKYA 2VG6B 1H89A 2GM4A 2DNLA 1FRLA 3KJVB 1YGYA 4WFBQ 3PDNA 2J59M 2JC0A 1YHQS 2OYOA 1L5UA 3O8WA 3R5JB 4WFZA 3IAM9 1K1SA 2LXIA 2E74B 5DJBA 1UZDA 2VDHA 4HR2A 5KT7A 1SFCC 1AJYA 2KOGA 4LBHA 4RJTA 3CX5H 3W67A 2CJQA 3TJ8A 4JI8F 3HE4B 5LMUJ 3A4TA 3M4XA 2XU6A 4Z7CA 3UN3A 1EIYB 1YRTA 4B9UA 3NGSA 5D4OA 1PO6A 3FMBA 1V3SA 5CCGA 2XI2A 1U1KA 4QW9A 1GMVA 2M9KA 2EI5A 2H5IB 1GXUA 1T95A 1S49A 4F4YA 1EC5A 1JJ4A 1NO4A 4UW2A 1VQ6S 2FGCA 3EZOA 1PJ6A 2X1AA 3CLQA 3C9IA 3KLGA 2FUG9 2GJFA 1SVFA 5E3RA 3KQGA 3P8CD 3DGPB 1UVIA 1OYEA 2FHJA 5GMDA 5I3QA 1I3OB 3CX5E 3MEDB 1IFMA 1KS2A 1NCLA 2B9WA 3S1TA 2WPVB 4J5OA 3ZDMA 4HLBA 3B54A 3KLHA 4PABA 4IH5A