2YKQA

Structure of the human line-1 orf1p trimer
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
212
structure length
200
Chain Sequence
DQLEERVSAAEDEINEIKREGKFREKRIKRNEQSLQEIWDYVKRPNLRLIGVPESDVENGTKLENTLQDIIQENFPNLANVQIQEIQRTTPRHIIVRFTKVEMKEKMLRAAREKGRVTLKGKPIRLTVDLSAETLQARREWGPIFNILKEKNFQPRISYPAKLSFISEGEIKYFIDKQMLRDFVTTRPALKELLKEALNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LINE-1 ORF1P
publication title Trimeric Structure and Flexibility of the L1Orf1P Protein in Human L1 Retrotransposition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 62
structure length 200
sequence length 212
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02994 Transposase_22 L1 transposable element RBD-like domain
A PF17489 Tnp_22_trimer L1 transposable element trimerization domain
A PF17490 Tnp_22_dsRBD L1 transposable element dsRBD-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ykqA01
3.30.70.1820 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykqA02
3.30.250.20 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 Rec A Protein; domain 2 2ykqA03
3EQ2A 3L4FA 3BRTB 2LDYA 3BRVB 2YKQA 3SOOA 2W6BA 2W7AA 2YKOA 2JRBA 1JOCA 3CL3D 2YKPA
chains in the Genus database with same CATH superfamily
1PYSB 5IV3A 1KC8Q 3G6EP 1PP9J 3MPWA 2JEGA 1ZRTE 2F8HA 2PN6A 5H9EJ 1CJUA 4WZQA 2ZE2A 2R9LA 3H1LJ 4DUYF 4Y34A 4BS2A 3VP9A 4X4TA 2YKPA 3RAQA 1S3JA 5KT4A 2EFPA 2UXDF 4X4RA 2O01H 3OSNA 2E5YA 1DEBA 1WT6A 1NXIA 2IM0A 2IBKA 1VR6A 4ECRA 3FWLA 3THPA 1YJRA 1JXLA 3MF5A 3KZIE 4FF1A 2FYUG 2XULA 4ED4A 2DCUB 4MIBA 4RPFA 5AW8B 3SMZA 4LF7J 1FT8A 3L95X 5CYMA 2ZHAA 1FZAA 3SQGA 1RY3A 2LA4A 5E0OA 1TU0B 2GM4A 3MEGB 2YH1A 5CMZA 3J7A1 1IC2A 3KHLA 1EHWA 4JI2J 3IWXA 5T41A 3IMQJ 4IH6A 4KB7A 1MO3A 1WELA 1C0TA 3T6BA 1RWUA 2M9KA 4DV1F 4PTLA 2KIKA 1SQBD 4OZ0A 2GA1A 1L0LJ 4EWTA 2ZYAA 4C8LA 2EKNA 2YNGA 3LP1A 2XZRA 3VQTA 3CCUS 3OTCA 4LBIA 5L9XA 3M0DA 4G65A 2ATLA 1AFOA 2E9TA 3SSRA 2SXLA 2A06D 2AYMA 5ETLA 2R7VA 1VPCA 2OYHA 3GG2A 2OPPA 1PYTA 1SL1A 1X8DA 2YWEA 5JMNA 1FWPA 3K7RA 4IOAQ 4CO3A 1T11A 3FEYB 3CCJP 3D6MB 2OLWA 4R4MA 2QEXS 3QRPA 3CXHI 3WDOA 2FXOA 4JI4J 3GSDA 4QPTA 3A5TA 2WSFH 2HLTA 1SFCA 3TRGA 3PR4A 2GHPA 1VQNP 1C1CA 2YXRB 3R27A 1N52B 3MHVA 5DM6Q 1T05B 2BANA 4MYUA 2M5YA 2PFXA 3QLHA 3TGUJ 1RACB 2VFTA 1PAUB 3PYEA 3RL0g 5CH7B 1MO4A 3BCCD 5KFCA 2EXUA 4U7CA 2QRRA 3DHWC 6FD1A 2QE7H 5KTQA 2ZR0A 4KPCA 3VAHA 2G2OA 5KFBA 3DDIA 2KVQE 5CABA 3DYAA 2QG4A 4QYZK 4DR6F 4YTPC 1OQ6A 3EGZA 1IKWB 2DD8S 5C42B 2DHXA 1NTZE 4UUWA 1RTIA 4GT1A 2ZDPA 5KFMA 1TU3F 2BW2A 4GDOA 1X5SA 3DLLQ 2ZKTA 4RESB 4O3QA 2CPDA 1S12A 1KN7A 4WTOB 1B7YB 3CJ4A 5IWAF 5E5NA 4K50A 1FZCB 1SQVG 5A0YB 1R5SA 1FJCA 1HIYA 1X9MA 2DNNA 1X9WA 4JYAJ 5B08A 5AVRB 1S1UB 4IG3B 4C7NA 1HBMA 3H1JE 2HYIB 1S1WA 2QJ3A 1JTHB 1RT3B 1JJCB 2XMVA 4A47A 3PO5A 4O4GB 2JH3A 1JUNA 1SCJB 2MZJA 4QW8A 2IBZD 1MFZA 3GJRB 1UWBB 3IN5A 3U02A 2KK7A 2XSFA 3RL0D 3BGRA 1SJ3P 1S72P 3G6ES 4ZKAA 3M8ZA 2YY3A 4O44B 2KDOA 3Q3DA 2LCWA 1KTMA 4PWWA 4NYOA 1H2TZ 1RF1A 1EDJA 4KIAA 3MGNA 2R8JA 1D3WA 5KG4A 1Q95G 3L74E 2DGTA 1SFCD 2ASDA 3TF5A 1KVIA 4OV1A 5DG7A 1IK7A 1KHWA 2DIVA 1NTKG 1K1SA 1URQB 3RYLA 2ILYA 2K9JA 2ADBA 2WVCA 3PHEA 1IR1A 2OPQB 4DX5A 3OQ2A 3MEDA 4EO6A 2W2OP 1HQEB 3OXGA 2AXTE 3DN9A 2JL9A 4I2QA 4YEAA 5D4NA 2UV8A 1RB0A 1X4CA 2GMHA 2FVQA 3PVXA 2HWHA 5ETRA 4HYKA 3RBXA 3C6UB 1NJZA 3V81B 5CD4A 4NLSA 4TVAB 2BR0A 4W7YA 2E5LF 3C6TA 3HDSA 4ZHRB 4KHPF 1GK4A 3G6VA 1C4CA 1DRZA 1T3OA 3C15B 2UXBJ 2HW3A 1KB9H 2AYGA 4OYBA 1NPKA 1RE3A 2PSZA 4KC5A 4EFAC 3BGLA 1FJKA 1S1XA 3P45B 1RF0C 2PDAA 5TISE 2GVZB 2HHQA 1S9KD 2MQ8A 5AT1B 3CCJS 4MT1A 2BJ8A 3TDKA 3DXBA 3QGPA 1JLCB 5DDQC 4CLTA 4CO2A 4ECXA 3B82A 3DOKA 2DNMA 3BREA 2OEPA 5IS2A 5EHHA 1U2FA 5GAEU 1NTZK 3KKFA 1E79H 3W65A 1VQNS 3GJQB 2HFZA 1SJFA 1FJ7A 2FYUE 3D6ZA 3FBCA 3ZTRA 2E75C 2Z8QA 1OW8A 1RHQB 1FOSF 2VH7A 2W9CA 3C2PA 2CFXA 2HIQA 5KFKA 4Q8FA 1AT1B 4DZDA 4X62F 1XTCC 2MZTA 3KLGB 1NJIQ 1RAEB 2IJFA 3KJVB 1RAIB 4PPZA 5FLXY 1R8AA 1D0EA 2HRYA 1CS4B 4ZPWR 2G13A 3QWUA 4ZVUB 3E1IA 2QA4G 3WQPA 3SFUA 1MW7A 4IUFA 2V4RA 5KLVJ 2C2KB 1XBWA 3QJJA 4NE9C 4PUOA 1D8YA 5E79H 4XA4A 3UDEA 2WSCH 1GQEA 1TR0A 3IBFB 3DGPA 2DIUA 4ID5B 2ZH3A 4YY3J 1AA3A 2JEIA 1S5LX 2EK6A 4E98A 4KGMA 2YNFA 1PYOB 2C3MA 3A8KA 3MD1A 4NASA 3V4QA 2LLZA 3ZZOA 5B0GA 5HAOA 1A02F 4U3FD 2GQ2A 3H2UB 1KQSR 3AE2C 5GAHU 2KP8A 4GOFA 1G4CA 3IRXB 3OFHA 2VBXA 2K1RA 2WOMB 5CBNA 1TL3A 1U94A 1WI8A 1S72S 2G8YA 2YPYA 2IAJA 4NLWA 3TNUB 3GTYX 4RW7B 1N5TA 2HS4A 3PO4A 3J7ZT 5D6GA 2AGOA 2DR8A 5KG7A 5APTA 2A6MA 3H5YA 1NH4A 5THWA 4CPGA 1ZRTD 3FBFA 4LF2A 4CLSA 3UR0A 3OW2R 4B9NA 2IYGA 1KVJA 2G0CA 5JVHQ 4KJMA 1Y00A 1JCDA 1KV4A 2HQDA 2Q43A 3PYDA 5DGBA 3LALA 1QSSA 2AZ1A 1BUXA 4DL6A 1RGVA 2ZVIA 4RNMA 3RZAA 3BBFA 4OYIA 5B5EE 3L71G 5LMUF 4CYUB 1NK8A 1IM6A 1I5OB 1S6OA 2YVSA 1VF5D 3TQEA 1YTZT 3QJPA 4PG8A 5LMNF 2CPZA 3OHBA 1N7LA 2E1RA 2ATCB 3P3DA 3L4BC 2HURA 1KDNA 1FC2C 2B89A 1ZAVA 1HD0A 4DF8A 2MKKA 2IY5B 2C2NA 1SQEA 1KFDA 4USUA 1WRGA 4G1QA 5A2QU 1R43A 5ETQA 4RNOA 2G1DA 1FRJA 3KHUA 4ZN3A 2E7WA 3SZ2A 4D6TJ 3Q89A 1TUWA 5GAEI 3VF0B 2FYUK 1R7IA 3SSQA 4JI7J 4K0KJ 3G71P 1WC4A 1IFMA 5ETPA 1Q8IA 1E6VB 2J76E 3GG1A 2IA0A 2Q7CA 4IFYB 2O5DA 5F0UA 3GLJA 3MUVP 4PO8A 5DO2A 3H4DA 1BMQB 1QVGO 4LF6F 5C5JA 4E8UA 1Q78A 1FRKA 4ZK7M 2J6TA 3AD8C 3W5XA 3MEGA 1EQMA 5CCHC 4JI5J 4RWWA 1L0LE 3ZZ0A 4IKAA 1S1CX 4J9UE 1VBZA 1JB0C 3A2AA 2CJYB 3GFXA 5KG1A 1U1OA 1SQXJ 2DNQA 2YKNB 1E5WA 4ZPDA 3AA9A 1JNZB 4NLOA 2OKQA 4DU7A 4CLWA 4L3KA 3M05A 3MCMA 5IV4A 3K2YA 1OSCA 2M2BA 2ZH4A 2DB1A 1KHVA 3AEEC 3L70G 2KHDA 1FVQA 2J8AA 2GMLA 1ACMB 1S6PB 4P2SA 3KK1B 4NPDA 4ED1A 2REBA 2FYNC 2X1AA 3EVWA 5GAHI 2I1JA 1N0VC 4OYXA 2RMLA 2WVEA 1XR6A 1VQ7P 5KT3A 3CJ5A 2Q6QA 3TGUE 1M56D 4Q44A 3HXMA 1HF9A 2LQBA 4WY4C 1T05A 1NTZD 4UW2A 1J1EC 2FLPA 2JOQA 5K20B 3J7Z5 3X1LB 2KXFA 1NSPA 2K37A 1GMVA 1NKEA 1RQ0A 2A18A 1S4XA 4A8YA 1BHNA 2HHUA 4Z1MH 1H38A 4EYYQ 3TZXA 1GXUA 1RADB 4PKDB 1DHMA 4HKZH 3LIEA 5ETMA 3H1JD 2ZM6F 1IKWA 3K0JA 4PXBA 3RW6A 2NLWA 5C42A 1UPPA 2RMZA 3CE8A 3MCNA 2BV3A 3HI9A 3SWKA 2JC0A 2WTFA 2OH2A 2FLLA 1RZMA 2JWAA 5L38A 1FZCA 3EZOA 4MK7A 4URQU 2G88A 5A0YA 4YXDC 3NTNA 3WMM0 3AD7C 5AVYB 4C8KA 2BEZF 3HX9A 5J2QB 1S1UA 4IG3A 3L74D 1RT3A 2AKWB 2QSWA 4O4GA 1J1DC 3HPOA 2MB0B 3GHGC 1XMOF 3UI3A 1NU1J 4PQFA 2R3CA 1VQOP 1VC5A 2MYFA 3GFZA 3MM9B 1U6FA 1TV6B 4JV5F 5C25B 2IMWP 1S49A 2BJ7A 4O44A 3CJ3A 3IA0A 1Z1ZA 4JI3F 4DPTA 1WC6A 3R8YA 3ENWA 1U47A 1VQMP 2Y1RI 1L0LK 5AW3B 2GHVC 2H5IB 2AWZA 1IXKA 2IYOA 1RSCA 1UBGA 3ELHA 1URQA 4N3YB 2PMWA 3L7OA 1P9YA 2OPQA 3H1HE 4DZ6A 3G71S 1ZM4A 5K5MA 1PGQA 4NYPA 2WRMA 4OI3A 1AQ5A 2V8GA 4USVA 5B0EA 3C46A 3V2RA 1EZZB 2B9YA 3B8HA 2J0QD 4B3RF 3PW2A 3HD7C 3C6UA 4C8NA 3V81A 4PD4I 4ZPCA 2B4PA 8ATCB 5K8PA 4KT0J 4WCEQ 4ZHRA 2WMMA 1HARA 4HKQA 4ITSA 4EZ9A 1DQ9A 2QLFB 3ZTSA 3C15A 4H4KA 3HSDA 4X4QA 2WT7B 1N36F 4K3AA 4DQSA 1TK0A 2ZROA 4XPEA 2B5JB 2UXCF 3Q24A 2H8PD 4DV5J 3MD0A 1L3SA 1PBUA 2FYUD 3DRRB 2LFVA 3AE8C 1Q90D 3CLQA 1HNIB 3RR8A 3A8EA 1FRLA 5F9NA 4CH7A 3FCVA 2BOPA 2GVZA 2K3IA 3QT8A 1YJWP 1NJWA 1VJQA 5AXKA 5LSRA 1LQ9A 4R4LA 2YKOA 3T9NA 3R3TA 4OHXA 4ZLPA 5J1NA 3QT7A 1U0SA 1WKLA 1YJVA 1JLCA 1M5KC 1TKDA 2GIQA 2MPUA 5I3UA 1VQ7S 1T03B 2UWJE 3DCAA 3N79A 4MIAA 4FXVA 1VDHA 2FJAB 5J2MB 2AIRB 3Q8VA 3DRYA 1KB9E 1GZLA 2N1TB 5AVWB 2KG0A 1QEXA 5C24B 2B51A 1URQD 4ANEA 3MUDA 4CLYA 1CJKB 4PSKA 3S6EA 4BBYA 4IOCQ 4M3LA 2MSTA 2NUHA 2XMKA 3OLAA 3TJAA 1IFPA 2J58A 4F3QA 2XDJA 3KLGA 4WFNQ 1U8SA 2PP6A 3GPAA 2F4FA 3ZNJ1 3GB0A 2ZHOA 3IBWA 1V3ZA 2JRBA 2B9XA 2CJXB 3ENQA 1CS4A 2JWNA 3UW1A 1QLNA 5LXRA 4L75A 5LXYA 3HD1A 3OJAB 3EZ5A 4DDFA 3C66A 4FF4A 1PJ5A 1FJGF 2HHHF 4N7TA 4J9QA 1FNOA 1IBMJ 1U7LA 2MEWA 3L70E 4AUWA 5B0FA 1Z56A 3VYIA 2PD1A 2VU5A 2DNPA 5CHCB 4AL5A 1NB2A 4IQMA 4LQ3A 1VGYA 2A1BA 3BKFA 3CCWA 1S1TB 2J6SA 3IRXA 4OQFA 1VQOS 4YHHJ 2WOMA 4BRYA 1T9UA 4J9RA 5KJ7A 2V7QJ 3PNIA 3T5LA 2Q6CA 1GK6A 3EGNA 1U26A 2B4OA 2VKRA 1UW9A 2CPEA 3TNUA 3R6LB 4NOHA 5E79E 2XBPA 4RW7A 2H48B 2OYIC 1IVZA 3ICLA 2JHEA 1VQMS 2DH9A 1U09A 3KHGA 3HVTB 4LSLB 5DZ6A 4M5NA 1LNQA 1Q5VA 1RT4B 3HT3A 4LFBJ 1WC1A 1RWXB 2J5AA 2YNIB 3L37A 1SQVJ 4IOBA 3SDEB 4CYUA 3VVTA 1GTHA 1Q16B 4M63A 4UUXA 2H51B 5CYJA 2IC3B 1LTIC 1WNEA 1X60A 1S6QB 1WMKA 4DS4A 1LTJC 1C0UB 4QWCA 4TU9A 4LSZB 3WC2A 2BQ3A 1KLMB 2BCCE 2I6WA 1JB0J 1MSWD 1U1QA 3M30B 1L0LD 2Y1IA 1U2RA 3G6YA 4WXWA 2QMWA 2OTJP 2V34A 4TLFA 1DTTB 2DRAA 4P2MA 5JUMA 1BY9A 1X0TA 4IFYA 1BWVA 1SP4A 4TYBA 3GP9A 4OJ1A 2VQFF 1RT5B 3HT0A 4DPYA 1NHKL 1NDKA 4WF9Q 2E76B 5KJ7D 2A10A 1YJWS 2E7XA 1NLKL 4JF7A 1RWWB 1K73T 1SQPG 2U1AA 1ICEB 1FDAA 1SQXE 1S5LH 3A1YG 1N33J 1WORA 3BSAA 1VFJA 4EIJA 3VTIA 2JLEA 2CJ9A 4NRTA 2YMYA 2WWWA 2PMZD 3HJFA 2LEBA 3UE2A 1X5TA 3GJTB 2YKNA 4LIRA 3AJDA 2MDAA 1R8PA 4Y2MA 2QT7A 2OTLP 1RBAA 2FHKA 3TI0A 1W26A 2GUSA 1AFJA 1PILA 3GR0A 4WFZA 2XGQA 3MAQA 3JSMB 1HNWF 4E2FB 2V0NA 3P8BB 1RKJA 3GF3A 3FZ2A 4B9TA 3CWBJ 2NR0A 4F0KA 2SPZA 2BJ3A 3BB5A 1S0MA 3KK1A 4OYWA 1KFMA 4NEYA 1M57D 5JXSA 2NPSC 2DNLA 1KMIZ 4F04B 4HT5A 2LXBA 2B9EA 4K59A 4KH1B 2DITA 2GQCA 2LQ5A 3VAJA 2YMKA 2CQ2A 4B3MJ 4WK1A 4MKBA 2QFJA 4EDFA 3IXQA 1QAIA 1TK5A 4PG4A 3L75J 1PGPA 1GH8A 2M4MA 5BYRA 1X9SA 3GJSB 3HE4B 2HFSA 1OPZA 1NCLA 2LA6A 1HFEL 1S1VA 3LIDA 2GGPB 2E74C 1UJ6A 2AJ4A 2XV5A 2VPWB 5FLXU 2QRXA 1JLQA 2DGSA 4U8VA 1P8GA 1GL2B 2P6TA 3KYQA 4ZVHA 4X2BA 1REVA 4DI6A 3LGNA 2IIHA 4CT9A 4M8LA 9ATCB 3M9OB 4ZVOB 1W7WA 3OTOF 3NY0A 5BR8J 2W6AA 5ETNA 3TVZA 3MMCB 3ETOA 1U7JA 2KZJA 4NLYA 2W4DA 3FXEA 3A3OB 4I1TA 4PG6A 4WIIA 4TU8A 4UQTA 1VDFA 1NU1E 4Z7YA 5J2QA 2Q6BA 4J7CA 3EXCX 3HKWA 3M6WA 4F67A 2Z2ZA 1WHXA 3L9ZA 1S5ZA 3FJ2A 1TV6A 3IAM9 3ZZTA 3GV5B 3NP5A 3H1HD 4DUZJ 4I2LC 1P6TA 2V8PA 2FFDC 2OE2A 4EGLA 2MXYA 5JVGQ 2J7WA 1WJ9A 2DGOA 1PL5A 3OR2B 2ODWA 1X5OA 2HQ3A 1FFWB 1EZVE 4U8YA 3AEAC 2RDIA 3DDNA 1KFSA 3MXHP 4A7PA 1SQXK 1G6BA 2V4HA 4LBPA 1P84I 3Q83A 2ZBCA 2CNKB 5GVQA 5AXLA 2R32A 3M4XA 5EX3A 1UFKA 1MU2B 3D0GE 1OJ4A 4QMAA 2L5GB 1H0HB 5ITHA 4H0LC 3CDAA 2K06A 3E01B 2O66A 1XN9A 3BQ0A 4JI8J 3HVWA 4C7RA 4B3SJ 2VJVA 1IFDA 3RR7A 2LXCB 1BSHA 3MM8B 3L71J 2LP4A 2XY7A 1HWKA 4I64A 1Q7YT 3F5HA 1RYSA 5DG8A 3TQ1A 4F2RA 3C9IA 1AZSB 1NHUA 5B66H 2HQCA 1JLEB 2B7BB 2QYGA 4F26A 4QR0A 4MKAA 4YXWH 3MUTP 1WTFA 2WT7A 2OTLS 4NLQA 1Q5YA 3ABVC 2B5JA 3IRWP 4DMZA 3HHEA 2CNLB 3WX8A 5AW1B 3MEEB 3ITHB 3P6YC 1KB9D 3DRRA 3R6GB 1HNIA 2H5JB 2JZ5A 1F5AA 1FXRA 4NLRA 1TK8A 3M6UA 4I0WA 2MKCA 3QGGA 3VQSA 1YIJP 1IBCB 1FOSE 4M5GA 4OGQC 2XMJA 2RKIB 1ZPVA 2EK1A 2OTKE 3HHNB 3O2IA 3K58A 2YXQB 2GX8A 5ADZA 3I4HX 1CZQA 1FO1A 2AP6A 1HH0A 3I5BA 4X64J 5KTBA 1J5EF 2N1TA 2M5AB 5C24A 1CJKA 2PI4A 2CDQA 1OWAA 2KFYA 2MKIA 3GIRA 4NWBA 1S0VA 3SBMA 1IFNA 1SQPE 3L70D 5AXNA 3MR2A 4PD4H 1Y7PA 4F4XA 2FXPA 2WVRA 2HHXA 4X4OA 3CCLP 1I1GA 2HODB 1R31A 3EVOA 3R5AA 3GZ7A 2NZ4A 4ZVEA 1RWNB 1ZV8A 2G0JA 1RYRA 1IK9A 1EKSA 3PW7A 2CVIA 4DSEA 1H98A 2O3JA 2HVDA 3MTKA 5E3CA 2H7HA 5DJUB 1JIHA 3K5PA 1RISA 2HHVA 4OI0A 4NCBA 4ECUA 4GKJF 5DDRC 3A3PB 2D69A 1VQPS 2V4JB 2XS7A 1J1EB 2JLGA 2UVRA 3OBIA 2HS3A 1P27B 3MM6B 4JI1F 4GODA 2CZVC 2V6AA 4WVZA 1KP6A 1S1TA 3L73E 1IQTA 4LRCA 1FAVA 2VG7B 2JEFA 2EFOA 5KT2A 3D0HE 1Y9BA 3D0IE 4CLUA 4QIWD 1FBMA 1WACA 4FNIA 3N9UC 2W8KA 2FTRA 1KS2A 4LR9A 3AJ2A 1Q0NA 3NGDA 2W24A 1DURA 4EU0A 2FBWC 2F3JA 3V2PA 4PPFA 3SWFA 5GTHE 1HWJA 5E3AA 3JTPA 2ABYA 1RE4C 3JSYA 4LSLA 3JQMA 5ETOA 3BN4A 3W60A 2F4VJ 1RT4A 3PJSK 1NYHA 3QZ7A 1N73C 4GRSA 4UY8T 1Y8AA 2BCCD 1PO6A 3AE6C 1NJXA 2YNIA 2XKMA 4NI2B 3DRSB 1TZ0A 1J1DB 2VHGA 4FS1A 1AUDA 4ZP9A 1LTBC 2ZH7A 2X1FA 1TMMA 1S6QA 1XNRF 4JI0F 2R7OA 4B9SA 1NKNA 3ZTOA 1C0UA 3BO3A 3S9OA 2D9PA 1KWMA 2QMXA 3M32B 2V63A 1RA6A 1F0XA 3O8ZA 1KLMA 1LK7A 2G2YA 1DARA 1CULB 1WWHA 3M30A 3D54A 1FCAA 1SQXD 1DY3A 2IPPA 4ECZA 1X4BA 2J9DE 3THVA 1VLYA 4DR2F 1SQQG 5KFJA 1T0TV 3H1KJ 3B78A 4DL4A 4HYTB 2WW8A 2XO7A 3EVMA 3M7VA 1DTTA 4PWUA 2QTWA 2HNDA 2MTLA 1RT5A 1SQPK 3IF4A 2LKMA 2VQEJ 1WF1A 1QTNB 4PEOA 4LRBA 1EDKA 2MSSA 2DPJA 1FKOB 1X5PA 4N5SA 3VAKA 1YBUA 4J90A 3VVUA 5I3QA 2UUBF 2CPYA 3IWLA 5KFIA 4Y2IA 2RDJA 2VBYA 4MIWA 1MKMA 3RK2C 3NKYA 1YBAA 4FS2A 2RT3A 1ZTTA 2VFVA 4K4YA 3JSMA 2ROPA 3JTNA 4ZCLA 2QLJB 1RTHB 2DPIA 3OXLA 4PRFA 1R6VA 4B9VA 2BE2B 3UD5A 3OTEA 3D1OA 4C98A 2EFQA 2OI2A 5BJRA 1S5LE 3AH6A 3GV7B 2V9KA 4C4WA 3KLHB 1UW4A 4DQPA 3LW5H 3KK2B 3RK3B 1AA0A 3BV8A 3KQGA 5LM7E 3M6VA 2I1RA 1BQMB 1E6YB 2UUAJ 5AJ3J 3ENVA 5KT6A 5AVVB 3CD6P 1H6KX 4LRFA 4DR4J 2B56A 3QQCD 3HE4A 2VDIA 1IWAA 5GMDA 1KNZA 1BGYE 3M9MB 2GGPA 1VJWA 3TA0A 2KVIA 1UMJA 3D6TB 1TTHB 1ZH5A 5HVHA 1GT8A 4UY85 2KRRA 2A45I 4WKRA 3AEFC 2E76D 1GL2A 2DNYA 3C8YA 2MQPA 2CQ3A 1HR0F 2Q79A 4CIOA 5M2UA 5BYSA 1F9FA 2KTQA 4TWZA 1M1JB 1VI7A 3I87A 4ZJOA 5AVUB 1IO4A 5KFWA 2VIHA 5HLFB 3CDUA 3MMCA 2EFVA 1W2BR 5KOWA 2EG2A 4R0EA 4HTIA 2BABA 3MR7A 1XR5A 5KFDA 5FIIA 4DV7F 4ZIVA 4ED3A 3CDBA 2ZWPA 2ACMA 4OI4A 1FD2A 1EZVD 3W63A 4V19X 2EG1A 2P9GA 3M91A 3L72J 1CW5A 2W4CA 1FNMA 1RTJB 3ENAA 3WX4A 3LWMA 2MJUA 1K44A 3D66A 1S57A 5E3QA 1RAOA 3D68A 3NMRA 3T97B 3GONA 3HUSC 2KKHA 1CVJA 2R8HA 3SFGA 1EQ0A 3W9HA 3KUHA 4A46A 3T6JA 4BWMA 3QPIA 2XMTA 1HHSA 4DPXA 1OVVA 1EKRA 1TELA 4NRUA 1EAYC 2F1FA 4N41A 3CPWR 1NM2A 2CK3H 2QO3A 1RHKB 4O3RA 4OX9F 5EN1A 1VQKP 3QIDA 4KFBB 1EC5A 1MU2A 4DL3A 4EEYA 1N34J 1FXDA 1VYAA 1SQBG 1M7LA 2MJNA 3KLIB 2BXJA 3HHLB 2E75D 1WG4A 4LIWA 4PSVA 1KONA 3E01A 2AYEA 1KOOA 2BEQD 4KGXB 1LTTC 5CCGA 4C3MA 4OI2A 2ZFCA 2ZRMA 2A06G 1GL2D 3RK3E 5LOQA 3MM8A 3OVBA 3I0SB 2ZH6A 4UB6H 4CTAB 4FF2A 2ZRBA 1JLEA 3I55P 1SC3B 1TAUA 1RQVA 1HNZF 1TKTB 2ZHBA 3PTWA 4ILRA 3BZQA 5GADI 3PACA 2MZ1A 2HVIA 4YOEA 1NK6A 2B4VA 1N56A 1G3OA 2IHR1 4YR3A 3DLBA 2A2DA 3MEEA 3ITHA 3E1RA 3G6XA 3LOUA 5J1EB 2XMUA 3TWZA 3H5XA 2JO1A 1RDRA 1Q4RA 3CCSP 1P84H 1AQTA 1SQPD 2M0GB 3AQPA 3ZZPA 1Y11A 2RKIA 4J9KA 2ALZA 2R5DA 4EO8A 1GU4A 2A0FB 3BPSP 3MURP 2W2QP 5TJHA 2HMIB 1SQQE 3TNVA 2B4UA 2XI3A 2WZ7A 3LH2S 3QSYB 2DR6A 4XE5B 4LR8A 4GVLA 1WOPA 5AW6B 5D8HB 2OELA 1QAJA 4ELVA 1L0NJ 4JBZA 1NSQA 3S1KA 4P7TA 3H32B 1L4AC 4CM0A 3CD6S 1BE3E 3E3XA 2OPRB 2CJAA 3QMQA 2KFZA 4Y28J 3A0BH 5DLFA 2QN6B 2NXEA 1EDLA 2CRLA 3UO0A 1A02J 3LF0A 3W67A 1SJRA 2ZNZA 2L9WA 2HODA 5CCGD 4LT6A 2BACA 2YIUC 4H4MB 2IBZG 1QSLA 3HO1A 1F9EB 4URSA 3L73D 1LEOA 2NPSB 1WUUA 2DHAA 4LFCF 1XJWB 4F36A 3BYPA 3O3LA 1IFJA 3SCKE 3VGUA 1WHWA 4GVBB 3CCEP 1SJ4P 4X66J 3D2WA 4IFVA 4RL1A 2NYHA 4W98A 2QA1A 2V4JA 1M5HA 4H44C 2EWHA 2QM7A 2KNCB 2D74B 1M5OC 4PD4E 3MCOA 1U2CA 3MM6A 1N54B 2HHPA 4K8RA 1LT9C 3USSA 3QZ8A 2KHCA 3L09A 4GO5X 1LWEB 3PRBA 2E74B 1CBKA 2XYPB 4XDCA 2R8IA 4ECYA 3UNGC 4FVCA 3NCPA 5KOXA 2WSSH 4DBQA 4BHQA 5LMNJ 1UEVA 2DH8A 3K5BA 2C0XA 3KZIH 2UUCJ 3J80Y 1HWLA 2ZZNA 5C2GA 2CPSA 1WC5A 3KLFA 1HTLC 4A8FA 2XYHB 1KZUB 2DNOA 5KKZC 3O5TB 3CULA 2DHGA 2X1GA 1VLOA 2B6AB 4RR5A 2Z4EA 1SC6A 1MZ9A 1UL3A 3GYNA 2R7TA 2F8EX 3N5BA 2ACYA 4KJIA 2Z58B 3PYGA 4NI2A 3DRSA 2N9YB 2D2CB 2RKLA 3K5NA 3RJMB 1B70B 4HI2A 3R7NB 2KU7A 3B8EB 4PAAA 3KNGA 4X4VA 1UVLA 3VV2B 2DGUA 3POTB 2PT0A 1BD6A 3M32A 1FNXH 4RLEA 2R2SA 3VAFA 5HVGA 2E1MC 2QG9B 4DR7J 3I55S 1UVMA 1Y47A 2CPHA 1N5QA 4EMDA 2ZOFA 1DH3A 3H1KE 1CULA 1SQQK 2NXJA 4WY4D 4OH8B 2H89C 4M5IA 4ZN1A 4O4RA 4DN0A 4HH1A 1IM4A 1GW3A 4Y3CA 1X4GA 3QAEA 2MQLA 2DNZA 3RGIA 4JI2F 5F0WA 1N48A 1T3UA 4JOUA 2YWGA 2KI2A 1W25A 1T9YA 4DX7A 2R2UA 2DCLA 3W64A 2KYVA 4OJ3A 1FTRA 4C48A 4PWDB 3CCSS 4H0LB 1DTQB 1FE6A 4LREA 2FUG9 4LUBA 1KILB 1KSPA 3W8PA 3OFFA 2BRLA 4MN4C 4TT3H 3IS9B 3CCQP 1JNMA 1YK9A 2BQRA 1HBOB 3BGUA 4FPRA 4HL9A 3J81j 1MMNA 3KLEB 2AZ3A 2UV8G 3GR1A 1Q86T 3PHTA 4DSKA 4DV0J 1F3FA 5DRKA 4DR5F 2DGWA 1XK8A 2E66A 5CBOA 3CC4P 4C8MA 4IQXA 1XC9A 2IX7C 3T1HJ 3KTQA 1RTHA 1RWPB 1R5LA 2HPUA 4WU2A 1FERA 4JI4F 3C16A 2GJIA 2KLVA 5CAAA 4WP8A 4ECTA 4OZ1A 1RXOB 2PGDA 1VRQC 4C3KA 2ERRA 1L2PA 4ZP8A 2BE2A 2VJUA 4U3FG 3PCOB 1BGYD 3IR5B 2ZM6J 3SSSA 3BR8A 2HSEB 4ZVPB 2RQCA 4KKOB 3AEDC 1S79A 3KK2A 2MQNA 2KM8B 1EQ7A 4HB1A 4LF1A 4DCKA 2V5HG 1BQMA 3LQVA 3CCES 5H9FJ 1R0CB 3WHIA 1U1RA 1SVFA 2UVUA 3NMDA 4MKVA 3FFIB 4OZLA 1PV3A 4K5RA 2I9SA 4K4SA 5IQ6A 4KHMA 2XSJB 3BH6B 2CYYA 3M9BA 1K1QA 2HHTA 2QM8A 2LKZA 3DU5A 5DDPC 2EBGA 2A3JA 5HANA 4S0MA 2Y0EA 4JYAF 1M1JA 3FK4A 4OIXA 1UFWA 3WUVA 1KB9I 5HLFA 1K9MT 3HD7D 3UD4P 4LRDA 4P9SA 1OY6A 4ZP7A 1FX2A 3DU6A 4WXOA 4FYWB 4ZS6A 1I6JA 1W2IA 4K4UA 1KRPA 1H89A 3R7BB 5MAOA 4I4BA 4TYAA 4G3IA 2V2KA 4WWIA 3TR5A 1RTJA 5BVZA 1KILE 1CI6B 2WK4A 3HSZA 3MAHA 5B7WA 2Z30B 4RU9A 2W1BA 2RF2B 5M2PA 4LF4J 4F4AA 3T97A 2H1YA 3GQCA 2MQOA 4ED6A 2OJ3A 3M0DC 3H7HB 1Q82T 1IQZA 4FPIA 3MHYA 3TYTA 3EE3A 1X79B 1MG7A 3IM8A 3WIUA 1CQMA 2O3DA 4X4UA 2OYHC 3RK3D 4RJVA 1SXLA 1JXEA 4TN2A 5KG3A 2FJXA 4N6JA 4J9SA 3RL0C 2A45H 2Z57B 1TFWA 3VAMA 3GILA 4XFJA 3KLIA 3HHLA 1PIXA 4KRWA 2XEXA 4DPWA 4EYHB 2FJDB 2UXCJ 4LBHA 1S7IA 3KDPB 5B0AA 1SFCC 1NGMB 3CD7A 1KORA 3QWOC 4WPAA 2RUGA 1S48A 3V4IB 2B9BA 1S6UA 3AE7C 3CCQS 2XI2A 2KT5A 1WKKA 2NXCA 3I0SA 3Q23A 2GA7A 3UCZP 4CTAA 3K59A 2Z4PA 1KEKA 1WC3A 1JLAB 5A8RB 4Q7AA 1TKTA 4I6AA 1N5VA 3VR1A 4FVMA 1VBYA 2X7IA 4PYAA 1I94F 1AXQA 3I9V9 2GO8A 3T5JA 1VOMA 2ASLA 1SQQD 3DLGB 1WKJA 1CQNA 3CC4S 3B5NB 2XU6A 1SKRA 1NTZG 1B99A 1Y5NB 1XQIA 1T2KC 2GFFA 1BQNB 1CC8A 1WEZA 5J1EA 4TQSA 2I38A 3FX0A 4J9OA 1IKVB 1BE3D 1ZPWX 1VIXA 1OO0B 3P7KA 3MAAA 3MECB 4ID8A 2HLOA 3J7AN 2XLJA 4YDXA 2JC1A 1P1TA 1G1IA 4UB6E 4PXEA 1FS0E 4NLUA 2JFKA 3AB2B 2NZCA 3IAOA 3H1JG 2ZZMA 2HMIA 4I1LA 3B71A 4AFFA 1LTGC 1FZEA 3U7JA 2MZSA 4F4KA 3JAMY 5HMYA 1Q7LB 2ZRIA 1S2EA 4BWNA 1XMQJ 3H32A 5EDWA 1FRMA 1XMVA 1KQLA 5D3GB 2OPRA 3OW2O 2OEJA 4FNHA 3ISZA 6FDRA 2DHSA 3Q5RA 3HHLD 1RF1C 3R97A 4U9RA 3ZZYA 5I3PA 3CJRA 4IFFA 3VMXA 4A8QA 2H54B 4DV4J 2EC0A 1P84E 3U27A 1IBLF 3L74G 4PPQA 2ASYA 2OQQA 3CMEP 1TQLA 3P5BP 4PD4D 3GIIA 4H4MA 4YY3F 1HMVA 1NDPA 2V2VA 3R5GA 4KHRA 1FWLA 3CJKB 1BWEA 5CJ0A 3IP0A 4LSNB 4OX8A 4TU7A 4YP3A 1UIIA 2IM2A 2Q1LA 2ZAEB 2WBRA 4GVBA 4IDKA 4NX9A 4L76A 2VOPA 2C3YA 2JWDA 1T9WA 3LA0A 2XLIA 1S97A 1M90T 3ETMA 3A0BE 3PH0A 4ALZA 3GW6A 2KNCA 1XEZA 1HW8A 3BGFA 1PBAA 4GC6A 3E7KA 2IA6A 3K8VA 4XAKA 3WC0A 4NLGA 2RVJA 3N4XA 3LPEA 1FKPB 5RUBA 1LWEA 2AJFE 3V6HA 1VISA 2VODA 3M8RA 3PLNA 3MPUB 1BDCA 3IN6A 2J7UA 2IRYA 2J59M 4OX7A 1F5BA 8RUCA 2Q3PA 1EETB 2K2PA 1I51B 2QX0A 1BCCE 4U96A 1XTGB 1RE3C 3HTKB 4F8RA 1ROFA 4I56A 3UCGA 2GZOA 2PAJA 3BDEA 4UQGA 1SPBP 2ZOMA 4HJGH 2VONA 3I6PA 3US5A 4N78E 5L1KA 2QJPB 5KFOA 3GFHA 4G1IA 2BM0A 3U1CA 1SL2A 3NEKA 3VALA 3F73A 3BO4A 2XY5A 1RI7A 5DS7A 1S10A 1BC6A 4DZOA 3JYTB 2PC6A 4ZPAA 1AJYA 2D3ZA 2DKOB 1U6BA 1IZNB 1MUUA 2ZRFA 1K73Q 2GUVA 2R7XA 4Q43A 4K2XA 2OSQA 3O8WA 2VQFJ 4C97A 2P67A 3Q8PB 3HUSB 3POTA 4ZMMA 4Y6IA 4B86A 3ET6B 1GEHA 1UVNA 3CCVP 2IDEA 4JI7F 4K0KF 3ILOA 2FDNA 2NPSD 2ZXXA 1D09B 1PPJG 4I67A 2HBRB 1VF5C 1NNDA 1YX2A 2CADA 1H72C 3W68A 4C0HA 4ZCIA 4RUBA 2QJKB 2C1EB 1P1LA 3U59A 2DY9A 1WDDA 2EC2A 2M88A 1NU4A 3CGIA 1YBTA 4B9LA 1UETA 4JI5F 2C2RA 1WOOA 2K88A 1OVUA 3FSYA 2DR7A 3T1AA 3SCJE 4EI2A 1T95A 5HP1A 1WSVA 4KSEB 4LMZA 4PWDA 1SQBJ 2E74D 3HK2A 1KILA 2FGCA 2RH3A 1EZVI 3IS9A 2QSIA 5KFNA 2WTYA 4WP9A 2HZCA 1LWUB 2OIHA 1HBOA 3D71A 5M1BA 1T3NA 1N8RT 4ZA1A 2YQ0A 2HFED 1UCNA 3KLEA 1F6TA 2ZT9B 2XLKA 1F1BB 1L3TA 3HM9A 5K14B 4J5OA 4U95A 3SXLA 3TSIA 1L3VA 3Q5PA 1Q2NA 1U02A 2XQCA 2YKMB 2P1JA 1M8OB 3BKUA 1SIZA 2NQPA 1JM0A 5DJBA 3BGOP 2ILZA 5IC4B 2D2CD 2BMBA 4HVZA 2DNRA 2W83C 4PQUB 3M2UB 4IL6E 3Q2TC 2OMOA 3CMES 1HGVA 4ED0A 4XIUA 1M1HA 3D1QA 2Z2MA 2K3KA 3BCCJ 4KKOA 3P8CE 1HBUB 2E5HA 1X0PA 3M8PB 1DX7A 2O01N 4N8OA 3V2UC 3BYRA 1N7SB 1H2UX 3OTOJ 1PP9G 1GX5A 2W2PP 4KY3A 3KHRA 3M9HA 1LJ2A 2BVZA 2D9OA 3FFIA 3G8QA 2FZGB 2HIYA 4J9MA 2XSJA 4U7JA 5CA5A 4ZMDA 4NL5A 2DGQA 4ELTA 2M3BA 2UZAA 3V5RA 2R7WA 2MLZA 2MZRA 3CCMP 1KR4A 4QW9A 5GMEA 4H0LD 2ZITA 4EK2A 2LQ8A 4I6YA 2XM3A 2YH0A 2Z5HA 1KILD 4F7VA 4I7ZB 4LF9J 4QYRA 5EGYA 4L72B 3U1AA 1B64A 1RT2B 1YLXA 1FI4A 2CWXA 4RUAA 1VK3A 2KZZA 4HHUA 5U47A 5F8NA 1NK0A 1FZFA 4QWAA 1SV5A 2CAJA 2CXEA 5HMXA 1VQ9P 2DRDA 3MCSA 2XNQA 2N7CA 2P2CB 4LF5J 3EJMA 4ATNA 1UBEA 3CDEA 4RBTA 4EOTA 2M8DB 4F02A 1EB0A 2F65A 1UVIA 1JMTA 1KKHA 5CCLA 4H44B 4H4OB 1CI6A 5LSLA 1L0LG 1UP1A 2APOA 4DSLA 4ZP6A 3PEJA 2WITA 1TMJA 2RF2A 2WVDA 3Q8QB 1LT9B 4D3GA 2I8DA 3T1YJ 1Q7YQ 2CDRB 1RTZA 2BYCA 2FVRA 1UPMB 1NHVA 4AE5A 2WPQA 5HVFA 3FSIA 1L3UA 2H65B 3QT5A 1KTVA 3HD2A 1NK5A 3J80U 4O0NA 2JFDA 5KG5A 3GIMA 1FJEB 5APVA 1RKIA 3NGTA 1SI9A 2RRNA 2IDBA 3ZDMA 3PKMA 4KTQA 5F3TA 5CCMA 3TAMB 5KFTA 2KL8A 5EFWB 2YX7A 3FMWA 3QBCA 2NCKL 4MFBB 2JNJA 4ELUA 4DHVA 4Z37A 1EDIA 3TGUG 3V4IA 1KTQA 2DGVA 2Q9IA 2FD2A 2C3OA 1OYEA 2NRGA 1X9VA 2D7SA 1FTCA 4PABA 1NPRA 2J8SA 2R7UA 3CC2P 4B08A 4LVNP 5E7OB 1YQ3C 2HVZA 3TVKA 3S4RA 1NTMJ 4DV5F 1H8AA 4M5KA 3MR5A 2HR3A 2R2RA 1D9DA 3WZ0A 1JLAA 2FPHX 3HZEA 5A8RA 4F3OA 2LEPA 1TKZB 2P9EA 2QA4P 5B09A 3BATA 1FF2A 3RW7A 4Y2AA 4KT0C 2FLNA 3N6LA 5K8OA 2ZNYA 3M1VB 2HQFA 3DLGA 1Y5IB 1PGOA 3Q5SA 3B5NA 2HFOA 4CCHA 5AE3A 1BSNA 1PZQA 3W8GA 2B88A 5CD4H 4AYCA 3PKYA 1OVRA 2MGZA 1BQNA 1IKVA 5APSA 2BEFA 4RU2A 1FK9B 5AW9B 3MECA 3RGUA 1PPJE 3HRNA 1FZCC 3R2DJ 1T8EA 2PFDA 3UDLA 4YN3B 4DT0A 1L3KA 1X4FA 4F25A 2Z0GA 2K7KA 2CZ4A 1P84D 4O9BA 1ZR2A 4B3TJ 4LF8J 3Q22A 5AW5B 3KUEA 1SJQA 3EMTA 3B6BA 1J2JB 3H1IE 5KFHA 4DR1F 3QIPB 2W25A 5D3GA 4TY8B 5DZ7A 3EICA 1QTMA 1OMIA 2B8QA 3VMYA 1YG0A 4C7QA 4C9DA 8AT1B 4MKYA 3T5HA 2FVCA 1TVRB 3OR1B 2FJEB 1QM9A 3CCMS 4KAIA 1UJ5A 2E9ZA 4ZOSA 3H42A 1IJEB 2ZJRQ 3OA7A 3D4JA 1URQC 5JRJA 3CJKA 1GK8A 3KMQA 2O67A 1LW0B 2CZ9A 2ZBIA 1VRUB 3O44A 3H1HG 3PJWA 2PGCA 4U3FJ 5GMKa 2VD3A 2WSEJ 3JS9A 4YHHF 3LANA 3MFIA 1BCCD 1VQ9S 1TL1B 4GC7A 5HROB 1JWWA 4P75A 1KYOE 1G2CB 3M2RB 3B5ND 3I32A 5D4LA 4N78D 3TUZC 2W9BB 2EBEA 3WIVA 5F9LA 1U1MA 1MFTA 1FHTA 3WUUA 2ZE2B 3UQSA 2H3EB 5KFUA 3CB4A 3IC1A 4H4KC 4Q2LA 3FWNA 1EETA 1PP9E 4IRDA 5JJBA 3PW5A 4Y99B 4NMXA 4ZLLA 4LFBF 1XNRJ 1IWGA 4JI0J 3HTKA 5AE2A 2H43A 2XG8A 3H1LE 2CPFA 1F3VA 3C19A 2X1BA 1NKZB 5D4PA 5APYA 2XGPA 4AL7A 2QIWA 4P74A 4PJ0H 5FDLB 1SJ1A 3ADAC 4CDIA 1YJUA 1APSA 5M2RA 2ZRGA 2LECA 1R0BG 3SQGB 1RU2A 3TJ9A 4DR2J 2R7SA 1QY7A 3DM2B 3JYTA 3TX8A 1UWAA 1FE0A 5IT0A 2DISA 3W5ZA 1HNXJ 2F7VA 1OSDA 2WVBA 3MPYA 3PTZA 3CC2S 1UEKA 3B4DA 2RSQA 2P7JA 3HUSA 3MUDC 3OHAA 3NFQA 1YQHA 1ZZNA 1AV1A 3ET6A 4AD6A 1GD2E 3UN2A 4ZKPA 1V5IB 5L46A 1WG5A 4W80A 1G7CB 3LAKA 2UU9J 2KS1B 1GTWA 2FC8A 4AYBD 4EZ6A 2ZRDA 3CSKA 2OYHB 2QA4S 5HSPA 4RJTA 4PG5A 4ZVTB 1CG2A 2VBWA 5KFXA 5EUHA 1NVOA 2DGXA 3CO0P 4OLOA 4J9PA 3NRBA 3HP6A 1N33F 4QCLA 1JY2O 4ZVRB 3W3SA 4CO1A 2Y9YA 2X3GA 3R2CJ 4DL2A 2BM1A 1C1CB 2HQGA 2OFGX 2B87B 1FVSA 2DNGA 5IFMA 3BQ2A 2O01C 1LWUA 1QD1A 3D3BJ 4YB7A 1JXVA 5HMZA 1RHRB 4ZJLA 2XC9A 5D78A 3QH9A 4DOZA 4ENOA 4J9NA 1CC7A 5F41A 5B0DA 2J0SD 2M3EA 5KJ7C 2KB7P 1U57A 1WOSA 2VPXB 3J81Y 3P8CD 5D4OA 2HVEA 2ZUAA 4QJVA 4DL0C 5K14A 1GNKA 1ZP0C 1RU1A 3PM9A 2YKMA 4RW9B 5CJ4A 2YWFA 2OPSB 4FKXA 4PV1C 4ZKUA 1VS3A 2AGPA 3NLCA 2UUWA 4M5LA 4PQUA 3M2UA 3BCCE 1LWFB 4PPNA 1NTZJ 2ZRKA 1GMJA 4YPCA 4Q8EA 3DLEB 3IG1B 1HBUA 1G19A 3K17A 3M8PA 3JAMU 5APQA 4C3LA 2ZEJA 1HBMB 1T9VA 1PFIA 3SYZA 5H9EK 1N7SA 3MP7B 4R0JA 1YHQP 2YXLA 4FF3A 4A8XA 1CLFA 2MY8A 3H1JJ 3ZNUA 2LQ9A 2Y0DA 4DV7J 1HWIA 2CJBA 1WF2A 2QL5B 4NLTA 2XYGB 3Q8YA 3D7SB 4DL7A 2DXEA 4LFAJ 2LYVA 1MMLA 4USIA 5BR8F 4OWFA 5KFGA 3W9JA 3VMZA 1JTHA 4JV2A 3CDWA 5KG6A 2VG5B 3DRXA 4DFJA 2BCCG 1S0NA 4D6TG 4XDDA 2HGMA 4FYVB 1PC4A 3K89A 3G4SP 1UWBA 3HZGA 3FEXB 1R3NA 3KJNB 4NCGB 4P6QA 4RBUA 2LXUA 4MMOA 1RT6B 4UOCA 1OQ3A 2W90A 2L9DA 4C6AA 3L74J 4U6PA 3HLUA 1TL5A 1PC5A 1RT2A 4W7ZA 3UN5A 3PJXA 2HGLA 4PG7A 4EYIB 2ZT9D 3M9NB 5HMWA 1UKUA 1EARA 2BZ2A 1S9FA 4OX9J 1HJ0A 3ISND 2IM3A 1V3RA 2Y8WA 5L1JA 2GIFA 1YBKA 4WFXA 4M1KA 4H4OA 1Q8BA 2BKNA 1SQXG 1PKUA 2VFSA 1VQ8P 2AT1B 2ZH8A 2RAQA 7FDRA 2XZTB 3C6TB 4NLPA 3SCIE 1DIPA 1H7WA 5ETKA 2PEBA 1HQEA 3KYLA 4RNNA 2K1AA 2D1CA 4NPFX 3CXCR 4H13C 3V4MA 1NO4A 3UCUP 1NWQA 4B3OB 2MKYA 3RUBL 1N7SD 2GW8A 4JI8F 3R5CA 2VF3A 2L9NA 4B3SF 3W62A 1HNZJ 2ASJA 3FGAD 1MMDA 5BU8B 3PFOA 4OYOA 1XWLA 4CLLA 2ZDOA 5BYQA 1SH3A 1WI6A 2VBZA 2HG4A 1L4AD 4MFBA 1K0TA 3CCRP 1SIWB 2N4CA 1MWYA 1RABB 4IFDK 3DOKB 2ZH9A 3E51A 1MROB 4JYBA 2F8MA 2F40A 2P5VA 1CSBA 2UUTA 1WC0A 2BJ9A 2DNHA 1NTME 1UTAA 5IT4A 2PI5A 1F5CA 4IG0B 3L36A 4JV1A 1XMBA 2MKVA 3UPFA 3R4YA 3G82B 5KFEA 4DV6F 4GIFA 1SKSA 1PPJD 4IFMA 3LTOA 2W7AA 2W9CB 2NYIA 4KQZA 2FYUJ 3UN3A 3U1LA 2I2YA 2FJBB 5D0GA 3II6A 2HZAA 1TKZA 2HNYB 3ILLA 2FZKB 3KNAA 4Q2MA 3DDKA 4HT7A 3M1VA 4DPOA 1RWKB 1DD4A 2OO4A 2WZ1A 2ZVSA 1FDOA 4RW8B 1LP1B 3I56P 3Q2YA 2PA3A 2W8ZA 3H1ID 4H44D 2XS5A 4YB5A 4RW4B 1P9QC 1FK9A 1IKXB 3BF4A 5CYQB 3A4TA 2R8GA 1R8EA 4X64F 3KLVA 3BBBA 1ZM3A 2L08A 3VMAA 1NH8A 3KJVA 3Q8SB 2V7QH 1NU1G 4HH2A 3O1LA 5KLVE 1JLFB 5CZVA 3EM1A 2KSJA 1ELOA 1ZR4A 4LFCJ 1YHQS 2C9NY 1H74A 2Z2LA 3N6NA 3QIPA 2I5JB 3NGSA 4UZBA 3HFZB 4TY8A 4RKUC 2RIJA 1T3JA 4NYZA 1M1KT 5GTHH 4ID5A 4PXCA 1IBKF 1LK5A 4NZ7A 3ZZUA 1NSAA 1B0PA 3PHLA 2IAJB 1TVRA 3OR1A 2YPZA 3D70A 2GMJA 2EFGA 1EZVG 4ZNCA 4ZIWA 1HQUB 2MQMA 4FN5A 1IUJA 3R5DA 4A48A 1DLOB 5E33A 2O1PA 3VP8A 2YWKA 5GTIH 2M8HA 3G4SS 3EXYA 2V69A 1LW0A 4Z7CA 4DR3J 4ZPVR 1VRUA 1MN9A 2DO4A 2KRBA 2AJ2A 4KHXA 4UZCA 4CWBA 3TAQA 1PP9D 1U7MA 3OPKA 4I6MC 1YYCA 2OAUA 4X65J 2DTJA 2E7VA 5HROA 3H1LD 2PO4A 3HR8A 1G2CA 1XMSA 4WB4A 2HZVA 3M2RA 3J7YU 4CNZA 1NK9A 2YWHA 2W9BA 3AE1C 3I96A 2Q1KA 1RBOB 4Y0FA 3H5SA 4PQYA 5CHXA 2W6JH 2Y8YA 2W4PA 1VQ8S 3AXKA 1WD6A 4MAKA 2HHWA 4Q45A 4J37A 2WSCC 1Q81T 2J9EA 3H20A 3HKZD 4G1QB 2NSBA 3AE5C 5EX0A 2F4VF 3LGHA 3VHQA 4HH0A 4USWA 5CQGA 1NTMK 2FY8A 4J9LA 3MMBB 1HYSB 1QGKB 3EX7B 4A8WA 3OJSA 3KXDA 3BN7A 4P71A 3CCTA 4DS5A 5L1IA 2JP3A 5FDLA 2XB2D 2AEJA 2JEEA 1QUVA 2BOAA 2E5IA 1RAHB 2CQ0A 1VK8A 1GMWA 2QLWA 2DBBA 4D6TE 4ECQA 2H5EA 2GO9A 2QFIA 4QWDA 3CCRS 2NXNA 2AGQA 3DM2A 1HL6A 2PIIA 2FVPA 1HWUA 2LQJA 1ZM9A 4USKA 3CJSA 1ZOTA 4QR1A 2FVSA 2N1TC 1E6VA 3VCDA 2NXUA 1NTKJ 3VZHA 2YNHB 4KR0B 3H25A 3TZWA 3OL9A 1Q86Q 2O01J 3BSCA 4PJ0E 2FZCB 2NREA 1YJNP 2KS1A 5MLCV 2XS2A 5KLVK 1F60B 1KVKA 4O3SA 3H40A 1KLNA 2VQEF 3FCWA 2M0BA 3VAIA 3OVSA 2ZH5A 4DR5J 2Z5IA 3V6DB 4ECVA 3I56S 3MI7X 5LT5A 3JC22 2GNKA 4PPGA 3OFEA 4HACB 4FZVA 3TGUD 2AX0A 4CT8A 1DZ5A 1UBCA 2NPIA 4F0HA 4IO1A 4PO9A 3B54A 2W8LA 2B87A 2V8HA 3DI6B 3PYFA 1S6PA 2XHCA 1K04A 4G1PA 1DQ8A 2IMOA 4DCOB 3QFHA 1T9XA 1VQLP 3L73G 3W5YA 2PA8D 2KXNB 2HQIA 1W2BO 1H3DA 4LQ9A 1GMWD 3AFGA 4RW9A 4G6VB 3MM5B 2XTJP 2OPSA 1FKAF 1RWMB 3Q0AA 2Z2YB 1FD8A 3TVYA 1WEYA 1JY2N 1FE4A 2E75B 1SC1B 3BQ1A 1LWFA 3J7YI 1RAGB 4AQYF 4Y65A 2UUAF 2NSCA 5AJ3F 2WSFJ 1TAQA 2Y9HA 3DLEA 4CP5A 5HQMA 4GKKJ 3M8QB 4EBEA 3MR3A 3IG1A 4OZ3A 1K0VA 1K9MQ 4DR4F 3GE9A 1GMUA 4YR0A 4KGKA 3DMJB 4ERDA 2IVYA 4DLEA 4Y2CA 2B43A 4JI6J 1DQAA 1YVFA 2AEFA 3HMJG 1C2PA 1RT1B 3GIKA 4TXSA 1HPZB 3CPWO 2EW9A 3NGKA 2GIRA 1Y9OA 1JY2P 2KO1A 1NKCA 4RBVA 4I2PB 1XP8A 3NAHA 1RT7B 1YZ6A 4BC7A 2VG5A 4KO0B 2IYIA 4DL5A 3DFEA 1Q82Q 3TW0A 4F4WA 1HBWA 3DNCA 4DCPB 2ZVOB 4NCGA 1RT6A 2R7RA 3MM9A 2OP5A 2XMMA 1UA1A 1FU1A 5C25A 2CJKA 4LLHA 4HHJA 2RS2A 4GOEA 4C46A 2X3DA 4USTA 4B17A 1VQYA 5GAGU 3TEGA 2BX6A 3MEKA 3UWTA 3DC2A 5IZHA 3FVYA 1S76D 3S01A 3D9BA 2E76C 5C7PA 3N7NA 3H1HJ 3N5FA 2RDDA 1ITPA 2FY1A 1ZETA 4X4SA 2DYAA 4MK8A 4HLBA 2PRRA 1A6LA 3QWPA 3IAS9 5HI7A 3RAMA 1HQ2A 1M0SA 2VFRA 5AE1A 2OTJS 2XZWA 1T2KD 2MHEA 3QYYA 4DV3J 5K9FA 1Q53A 1NRKA 1LFWA 1OYDA 3AOBA 1T6AA 3MDFA 1N34F 3CWBG 3GIJA 2L41A 3QSIA 3TA1A 4B3OA 1VBXA 1NTMD 1YJNS 5APXA 2OMLA 4OZ5A 2XWXA 1U8WA 3JB9k 2DEJA 1ZA1B 2HG5D 3C3LA 1URRA 2FYXA 1C4AA 5J2NB 1I94J 5KFSA 4M5DB 4WFBQ 1N5YB 1C1BB 4OQJA 4KGVB 5H2FH 1X4EA 3R2PA 2MHNA 2QV6A 4F50A 3HHDA 1MROA 5I3UB 3L75G 3QAUA 4WK3A 5HJYA 2ZD1B 3SFEC 5DQGA 4OYAA 4IG0A 4NA3A 4QWBA 3CUNA 4NXMJ 3G82A 4BXLA 3R1HA 4Y2KA 1UZHA 2E5GA 2JEJA 2HVHA 4EBDA 1BGYG 1NAYA 1ZN5A 3FNNA 3PRDA 5L8RC 2ZJQQ 4A8KA 4I69A 2ZH2A 1VQLS 2HNYA 4TLRA 2KJVA 3VZIA 1T03A 1GL2C 5KLVD 1H73A 3PX0A 3OTDA 1OW7A 1HBNB 2CKWA 4YQWA 4JUZA 5J2MA 1X0FA 3QO9B 4RKUJ 2J6UA 2QYCA 2YBVA 4RW8A 4FP9A 1LP1A 3CCZA 3TO8A 2RU9A 2I8EA 4YR2A 4DG1B 1WTBA 4MK9A 4RW4A 2P10A 1IKXA 4ANDA 5CYQA 2OARA 1XNQJ 1NU1K 1IBLJ 4PQAA 3PX4A 1S9EB 2YWWA 4RW6B 2IVFB 1JLFA 1WG1A 3UDCA 4P2FA 3KWMA 3JCUH 1AYEA 3L70J 1M90Q 3IM9A 4NXNJ 3BH7B 4BWJA 2FYNB 1U99A 1X7VA 3J81U 3NOGA 4ZLJA 3JSRA 2P9CA 5ETTA 1SQGA 2I5JA 1DAXA 4BRYB 1HI1A 2OD4A 3DLJA 3CC7P 4IL6X 2PFFB 1LWCB 3T9ZA 4P72A 5GAGI 1D9AA 4WY4B 4M95A 3T41A 5I42B 1QX8A 4Y28C 3SV3A 4ZVSB 1HQUA 4RO0A 4PV1B 2HAFA 3BJYA 1NKBA 2BASA 3QRQA 4X66F 1DLOA 3HJVA 4QIGA 1FJPA 2ODNA 2Z56B 2WSCJ 2J0XA 3VOPA 4LR7A 4RX6A 4BDPA 2DH7A 1CSJA 2EPIA 1Y3KA 1N32J 1RHMB 1RAAB 5KFZA 4A8SA 4BCAA 5CCGC 3H8YA 1KD1T 2DT9A 4CRJA 4DUYJ 3PW4A 3HVTA 4DJBA 4I7FB 3IR7B 2UUCF 1TL7B 2UXDJ 3H98A 1SQVE 4UB8H 4CQ1A 5KT7A 1JJ2R 1QVFR 2VUGA 4ZLNA 5GTIE 2W2NP 3FBEA 4D6TD 1WSRA 2GHWA 2BE7D 3CIZA 1UFLA 2IYPA 5APUA 3SDEA 2C2DA 2VDHA 1S4FA 3THTA 3DRPB 3GHGB 3I4PA 3AE9C 4WU3A 2IC3A 5EWEA 4R25A 2HS0A 2BCCJ 1EXIA 2HNZB 4HEA9 3MMBA 1HYSA 3G86A 1SBRA 2KJWA 4OYZA 4ES3A 2DR9A 2WPSA 2RQ4A 3AEGC 4TY9A 3D6YA 2KXPB 1UA0A 2UVWA 5IOLA 3EYZA 2ZRJA 4DV1J 3V4WA 4N76A 1T94A 4DR7F 1KOHA 1NTKE 2QMUB 4DWIA 3NWRA 1JLGB 1N8RQ 3MZIA 1Y5LB 2FXMA 1PGZA 2H4YB 2YNHA 4WBFA 1BE3G 3UNYA 2E42A 4O3OA 1VQ4P 2QLBB 1YIJS 2Q5UA 2W7OA 4H13B 2KYZA 5LSOA 4W4MA 2Y3YA 1U48A 1Q8KA 1GTEA 3Q8UA 2C22A 4K7QA 3W1YC 1N88A 3NG8A 5DETA 2IJNA 3HD7B 3W2VB 3MTJA 3I5AA 4GO7X 3KJQB 1Y4ZB 3NAIA 5F8LA 2CQIA 3V6DA 1LFPA 2FLOA 4RNFA 3V5BA 3CWBE 3DGVA 4HACA 4C11B 4OYPA 1LTSC 5DLGA 4DV0F 3TARA 2C2EA 2JDJA 1K8AT 1NEEA 3DI6A 5HK4A 3T1HF 1OIAA 3CCLS 3IR6B 3AJ1A 1RF0A 3W2WB 3D1HA 2ZYGA 3EGVA 2ZREA 5KFYA 3MTUE 4KE5A 1UAWA 4DR6J 2KB2A 3N0VA 2JR8A 5LJ5Y 1S1VB 3AEBC 4IH5A 4J91A 4Y00A 1NJYA 1JLQB 1AFIA 1U1KA 7FD1A 1ULRA 2L3MA 1OXZA 5K8NA 2KUBA 3L75E 1AROP 3M8SA 2RUSA 1YJTA 3VGVA 4USHA 3CC7S 2ZVNB 3MM5A 2OUGA 2JX2A 3QATA 4URGA 2ZBQA 1RE1B 3VTPC 3IFEA 1REVB 2RHQB 5IWAJ 4WFAQ 2ADCA 1SQVK 3QFWA 3CI9A 3CMAP 3M8QA 3HFKA 1NU1D 2F5GA 2OGUA 2ALYB 3BSOA 4DCJB 5KFRA 4N8NA 1GXLA 3DMJA 5EWFA 4WYLA 4WWSA 3V2QA 2Q3IA 2PMHA 2OD6A 3CXHH 4O0IA 2CNNB 1RT1A 2Y1JA 4OI6A 1HHQA 2OEKA 2UVVA 1RK8A 1HPZA 2RRBA 3EUNA 2NPFA 5ETSA 4ED7A 5AVTB 4I2PA 1BGXT 2B0GA 1O6XA 1RT7A 2C28A 3UR3C 3GV8B 2VA2A 4ZITA 1NK4A 2HGNA 3BPDA 1HA1A 4KO0A 2WONB 1L5UA 3MGJA 4OI1A 3MPDA 3CX5I 4IYQA 4CO5A 5D0RA 3H1KG 1NTKK 2GV1A 3ZXWA 4K2JA 3TZYA 2QLXA 1S4EA 4AXJA 4JBCA 1DD3A 2J0WA 3W9IA 3OR2A 3BVHA 1LW2B 4LF4F 3SQOP 1RBLA 3C14B 5HN0A 3MUMP 5AW2B 3GWCA 2N7YA 1UVJA 1U4BA 2OYIB 2MJZA 1T02A 1KQGB 2DNKA 3CO9A 2E5LJ 2IFNA 3TANA 3AE3C 4KHPJ 3DOMB 3FBBA 2XWYA 2JDIH 4ES2A 3MR6A 4DN9A 2WQYC 1SH0A 1HNVB 2ZRPA 3W7BA 5FJ4A 3FEZA 1V6HA 3T19A 3L71E 1EX8A 4Q0BB 5B0CA 4NZ0A 1B7FA 1VQ4S 3L3CA 3N28A 4WP3A 3EWGA 3GMGA 2CUYA 1KYOI 1U0HB 1X4HA 1LTJB 1FDMA 4NEZA 1AZSA 4ZVQB 5L8RJ 3W66A 2PE8A 2V4QA 4QPXA 2IBOA 5J2NA 4R8UB 2D3OR 2C42A 4M5DA 2G2ZA 4PZVA 1N5YA 1RLDA 1C1BA 3GCXP 3H4BA 1UEUA 3CJ8A 2C2OB 1HGZA 3RK3C 2LR2A 5BXIA 2IFMA 3HHKA 3PZPA 4TKTA 1TKXB 2ZD1A 3DLKB 2P2UA 1PCAA 4NCAA 3KDNA 3R9LA 3CJ2A 5C39A 4QWEA 4YUDA 3L35A 3H59A 4X62J 1YI2P 3TUPA 3D5MA 4ASVA 1G1JA 2CQHA 3H2LA 4JV0A 1HJBA 3RTVA 5KT5A 3PRJA 1N4LA 2ZR7A 3P5TL 1NDLA 5CCHA 5DM7Q 1U1LA 2QSFA 1HBNA 1X31C 2JJ4D 3GLMA 5H2FE 2CNOB 1SQPJ 4DR1J 1SKWA 3EWKA 3QO9A 2OYOA 2BKPA 1M1JC 2M70A 2M5AA 3FCHA 3FZBA 1G18A 3K5OA 4DG1A 4WE1B 1QAXA 1UJ4A 2AV5A 4DFPA 4NLVA 1MN7A 3G87A 2B9WA 4HDGA 3L72G 1XMQF 2DW3A 4DV2F 3CMAS 1S9EA 2J9DA 4RW6A 3KFWX 5F8MA 1KN6A 1NDCA 3A3NB 4P52A 3JTOA 2W9AA 3BDPA 2YTCA 4DV4F 2GC8A 1QSYA 4DX8H 5DGAA 1NAQA 1WF0A 4OL8A 1ZBTA 1LWCA 4JQ0D 3FRYA 4NA1A 3L73J 3GF7A 4WY4A 2V94A 5I42A 3NXSA 2AYBA 1S0OA 3BRTB 3PW0A 5T14A 1QJHA 1KFNA 1U6ZA 4M94A 1SQVD 5A6PA 3BR9A 2KXHA 3SOOA 2ZJPQ 5LMUJ 3JCUE 2VG7A 1USDA 1Z4UA 3HHLC 2LU2A 4K4TA 4ILMA 2ZWOA 4F0MA 3WBZA 2GS8A 9RUBA 1U25A 2E44A 1EJ7L 5AW4B 2XMWA 5IT9Y 5T7LB 1PJ6A 4DFKA 3A13A 1DFDA 2ZUGA 4NA2A 2KLUA 5CCHD 1A9NB 1YTYA 2WB1D 3RAXA 2CPXA 2K3RA 4I7FA 1ZA2B 2QL9B 1TL7A 4JP8A 1VQKS 2FYZA 2YO2A 1LXNA 3MIWA 2OHDA 1YZ7A 2MLYA 3OL6A 4IR1A 1FDNA 3NCRA 2HRTA 4UF4A 2QA2A 2D3O1 3TP2A 1KC8T 3DRPA 2ZC4A 3GHGA 5DG9A 2ZRLA 1VHFA 1NTKD 1ZLLA 4KV8B 3S8SA 1GXTA 4YB1P 2HNZA 4E0DA 2VFUA 3GFYA 4PXDA 4LF6J 3DLHA 2FFDB 3CTRA 4YMEA 2HNDB 1LXJA 4X4PA 3KDOA 4FYYB 5D0HA 5DQHA 3PR5B 3PY8A 1X4AA 4UB8E 1YGYA 4LF7F 1FDDA 3TUJC 1VMBA 1IJDB 1HVVA 2A2CA 2F9DA 4DPUA 3GCWP 1L0NG 1TP7A 1UBFA 1HD1A 1Q79A 2IBZI 4PV1D 4KYZA 1JLGA 1QE1B 3EQ2A 2HFVA 2VKZG 3TZZA 3CWBD 1RHZB 3WU2H 1I3OB 1RJJA 1YI2S 4WJBA 3QRRA 1G1XA 4IL6H 5HO4A 5AW0B 4PYDA 4OZNA 1FKOA 4OZ2A 2EEYA 4CO0A 3TOQA 1S7HA 3HD7A 3E2EA 3W2VA 2CWKA 1LGHB 4DUTA 3GYXB 2ZOGA 1NMEB 2EI5A 3PXGa 2VB6A 2AJQA 5A76A 1MO5A 1KBRA 1QVGR 1ZXGA 2FC9A 2G1HA 3OV7A 3BS9A 2X51A 2J9CA 1IN0A 4C11A 3L75D 1SS1A 5DJTB 2XNRA 2W7PA 1MO6A 3GU0A 3JXOA 4UOHA 5HJXA 3CT9A 1Y3JA 1AVYA 4O3NA 4ANCA 2M3DA 5E41A 3CJ0A 3W2WA 4ZCMA 3PFEA 2JVOA 1FZGA 2C2ZB 2HFNA 1A0OB 5KFQA 3KLHA 3AHPA 4OGQB 4ICLB 3DHXA 2GVDB 2E1PA 2IRXA 1NK7A 3IGNA 2Q3EA 1D8ZA 1BGYJ 1OMSA 1OZHA 5SUHA 2KI7B 3F44A 1E6YA 4DQIA 1BCCG 3OJUA 3CNQP 4C8ZA 1OWXA 5KLIC 3EFGA 2AD9A 5F8IA 4A8OA 1PSDA 2BJDA 2FHJA 3DOLB 2KFNA 3CJQA 2ZXEB 3KMSA 3SWYA 3FKBA 1XMOJ 3CJTA 1VQPP 4DSJA 5A8KB 5K8MA 2AU0A 1DBDA 1B4SA 4JV5J 2D2CC 1JJHA 1X8YA 4ECWA 4H13D 2EVZA 2KYXA 3LWLA 3AT1B 1RH5B 1K47A 3T3FA 4HR2A 5LJ3Y 4JI3J 4OHVA 5E3PA 2HPCB 2AEMA 3M2VB 3L72E 1H0TB 3M8YA 4LF9F 4QIEA 1V5VA 1HLWA 1U1NA 1BQXA 5KAIH 4W92B 2R5BA 5HATA 1IJFB 1RWVB 2WONA 3ZTPA 2XCAA 3LW5C 2A6OA 2AHOB 4LF5F 3IGVA 4K4VA 2H4WB 3A8IA 1YRUA 3G2XA 5AW7B 4BLGA 3PV8A 2DXDA 3EDQB 3CXHE 4N56A 2IJRA 2MMYA 3SEOA 4WTYA 3L71D 1V3SA 1LW2A 1PIEA 1HKAA 3C14A 4B3RJ 3MFHA 3BKTA 3T1YF 1MWZA 1KILC 4ETZA 3R5JB 3LAMA 2OYIA 2W01A 1RA7A 6AT1B 1CJTB 2U2FA 3OSPA 1CEZA 3DOMA 5J1PA 1JO5A 4WKYA 4KFBA 1S99A 2CQPA 2VRSA 3LO3A 1SL0A 2BE9B 1N36J 1N5SA 3O6QB 1OS5A 3V6JA 1B0VA 2KN4A 3HFVA 2QZ8A 1HNVA 3L7PA 2IZ0A 2FHJD 1N73B 1EXJA 4W90B 3G3ZA 1TUGB 2R7QA 1VQ6P 4Q0BA 4ZVFA 2LMIA 3ILJA 1LOUA 4BC9A 4LJMA 1FDIA 2DVIA 2UXBF 2V67A 3DXSX 2MLXA 1O0PA 3H0PA 4DV6J 3PRVA 1U0HA 2F63A 5D0EA 1EP4B 2V68A 1LTJA 5DQIA 3QGHA 3U1MA 1F2GA 2PEHA 3LGMA 3KHHA 4B9UA 5IM0B 3CX5H 2RH0A 4PQRA 3HULA 5KAFH 4R8UA 3UVJB 5C2CA 1SH2A 2RS8A 3AD9C 4ILLA 4QU7A 4ER8A 1ZOYC 2GAHC 4PPDA 2ZBPA 2KM8C 4DQQA 2J5UA 2RHSB 1V9OA 2AMCB 1Z2LA 2KOGA 2KT3A 4AT1B 1TKXA 5HBMB 2OSRA 5L1LA 4P10A 1QL2A 5G0RB 3DLKA 2BQUA 2IZ1A 1O8BA 2HK3A 5D77A 4FYXB 3HVRA 3VGTA 3VN0A 3Q2SC 2P58A 1SQQJ 2BUNA 1KQSO 3CL3D 4FBTA 3A8JA 1RAFB 2ZJSE 2ZFHA 1MV8A 4P73A 3OUYB 1OIPA 4K35A 2ZKUA 3NWGA 3AECC 4MYTA 3CVKA 1BE3J 3GG0A 4P7VA 1M1KQ 1L0NE 1YDLA 4QIFA 4U67Q 2I1KA 2HRUA 4ZDNA 5H1SV 1FJGJ 2RN0A 2HHHJ 1FRHA 1H7XA 2VG6B 1GAOA 4B3TF 4LF8F 4WE1A 1IBKJ 4WIQA 3M9QA 3IWNC 3RK2B 3HCXA 4YFUA 2IVMA 1NJIT 1GDTA 3A0HH 1KYOH 1T8ZA 3KOAA 4FXWA 4OVNF 5FD1A 2FJWA 1M1GA 4OFZA 1WHYA 3S7RA 3HF5A 3FUYA 4IFVB 2IPOB 2WHOA 1SQFA 2OESA 2VASA 3BRVB 2W6BA 4ED8A 1AA1B 1YRXA 4JB8B 3V2NA 3QGIA 3IFMA 4NLDA 2C9LY 5AXMA 3OT9A 3CF5Q 2NPSA 2CQ4A 2ZYDA 1SUQB 3MMJA 1G2EA 2JRSA 2VPZB 5E2QA 4CNYA 2QJYC 5A8WB 4AQRD 2V2QA 3AAWB 4ASWA 3F0NA 1FRXA 1FESA 1Q81Q 1R6YA 1RCOB 4FKYA 1EIYB 2BJEA 1UVKA 3OD2A 1IFIA 1KQFB 1TUVA 3KLFB 4CH1A 1R8CA 3VGSA 1FFSB 1BE4A 2E5TA 2N1TD 2VZ9A 4IOIH 3P96A 1U1PA 3NS6A 3OFGA 1FRIA 5G4DA 4NZ6A 2YKAA 4NMLA 4HTJA 2JKVA 3G8TA 2GJFA 5T7LA 1MNEA 3NGRA 4WZMA 3OL7A 2B8PA 3RRGA 3Q1MA 2WSEC 2NS1B 4DX6A 1YJ7A 4OHYA 2MKJA 3G9RA 4OHWA 2YX4A 2ZR9A 4NLXA 1ZYQA 3TYYA 3FSXA 1ZW0A 2R44A 1YWXA 2B6AA 2XNXA 2CQ1A 3LP2B 4UTGA 3T5KA 3H2VE 2YQ1A 3ZZZA 2A45G 3H1KD 1RTDB 1ZM2A 4UOGA 2WB4A 2H88C 2EKYA 2AW0A 1VQ6S 3B5NC 4U7UK 4KV8A 4LVOP 2COLA 3ILIA 1Y10A 2E43A 1ZAWA 3MM7B 1NZ8A 2FFDA 2WVFA 2QGFB 1HNXF 3I0RB 3KG4A 3BEGB 3JQKA 4A8MP 1ZAXA 1L0NK 5AVZB 3RG6A 3M8WA 1WDTA 3BASA 2UU9F 3D3CJ 4PR6A 2DO0A 2K7JA 1OX3A 1QE1A 1XTZA 3H1IG 1OY9A 3MWBA 2CG4A 1HNWJ 2D41A 4DJGA 1SC4B 1FX4A 4FYDA 2HBQB 2RB7A 1CJVB 1DTQA 1AB8A 3EPIA 2ZRHA 3KUGA 2XO6A 4FXDA 5A6WA 2HBZB 2GJ2A 4N77A 3ZTQA 3C16B 1AVOA 2AJ0A 2GQQA 1YJ9P 2RQKA 2G0IA 2VA3A 3D6FB 2CQGA 2XHWA 2ZRNA 1OY8A 2RRAA 2NUUG 1QLED 4CLFA 5GADU 3CWJA 1R0AB 2FIUA 2VC0A 4QIVA 3QJLA 3FRZA 1D1UA 3ZFVA 3WU2E 3K5LA 3NMAA 2F9JA 4C8OA 4UOFA 2WPRA 1N6QB 4AQYJ 1MLAA 1YRTA 2LEAA 3WUTA 2Y1LB 3IO1A 2OFOA 1WEXA 1QDUB 2GCFA 4ICLA 2GVDA 3N01A 2R3SA 1NPPA 4DU8A 1HUCA 1IKYB 3V6IA 3R7SB 4OMFG 2MKHA 3NCQA 3H1LG 3HVAA 4TNOA 1NZAA 3CMQA 3BSNA 2ITAA 3NBPB 4PCQA 1L4AB 2QJPC 4ED5A 3I31A 4UT4A 1M5PC 1VBKA 3L72D 1H2VZ 3MMAB 4X4NA 1JMMA 3DOLA 3LW5J 4F3MA 4OZJA 1FDBA 2JJLA 4OYMA 2W2MP 2Y0CA 2QIFA 4M5JA 5A8KA 4LFAF 3RB3A 5KG0A 2N82B 3OVAA 2CQBA 4WBAA 4L6V3 1W2EA 2YIUB 2H9ZA 4AUKA 5APWA 2CA9A 3P8MC 2HWIA 3FDSA 4ZPTR 3MZWB 3CXHD 2VPYB 4K4ZA 1RHJB 2HPCA 3M2VA 3G8SA 1H0TA 3TEHB 4I6WA 2LXIA 2CG8A 2BKOA 4OX6A 3VWSA 3ZZRA 3SSUA 2YQ3A 3NNHA 3B4SA 5SZTA 5KFPA 2POKA 1GFWB 2L91A 5B0BA 2QJKC 4MTPA 1LT1A 3NGUA 2MQQA 1S59A 2Y0BB 1R8BA 3EPGA 1GU5A 5AVQB 4DOJA 3PEHA 4Q5VA 3OXFA 2R4FA 4J9VA 5IT9U 2B3TB 3F41A 4CO4A 3CCVS 4RZRA 4OGQD 3MOZA 5AVXB 4ZJQA 1NBEB 3BBCA 4C0BA 2JVRA 3Q86A 3RBDA 5J2PB 3HE5B 5KAIE 2E9RX 1LWUC 2LDYA 1CJTA 1VQ5P 5I4MA 5KKZB 1RE4A 1S9GB 3AQOA 2XMAA 2JSXA 3M6XA 3O6QA 3KK3B 2YO3A 2ZT9C 1J2VA 1LV5A 1N73A 3SCLE 2YNYA 2HWTA 1NUEA 2OEMA 2HEKA 1TFYA 1NSKL 3D28A 1JLBB 4KBIA 4KH0B 2CPIA 3ISNC 2ROGA 2DJWA 5HL7Q 1ZZFA 1JKHB 4U7UD 3RRHA 4X84A 7AT1B 2FHOB 1QL1A 1X22A 3Q8RB 1EP4A 2DRBA 4XO0A 4IRCA 1J27A 2MY7A 1YJ9S 3EFFK 5IM0A 3BCCG 3MAAB 5KFLA 3F89A 4TLQA 3OAKA 4R5PB 5H9FK 2FKWB 4RUHA 3UVJA 5EWGA 1ZS6A 1JJ4A 3EDRB 2ZZTA 5B66E 3S1TA 1VRTB 1L0ND 3P49B 4IR9A 1J5EJ 1JY3O 3C1LA 1S77D 3AE4C 1Y0HA 1N7SC 2LXFA 2MKSA 5HBMA 2AF6A 4AL6A 3QT6A 5G0RA 4M5HA 1FA0A 3TK1A 3ONQA 3ULHA 1KQKA 4HHHA 2M7SA 2W27A 2N4DA 2QL7B 2CQCA 1J5OB 3OUYA 1YITP 1QUPA 1H88A 4OJHA 2C0WA 2DXFA 2HK2A 5CZXA 3CX5E 3LP0B 2ZBRA 3CD0A 5KAFE 2E5JA 3AODA 2R2TA 2WSEH 2FJVA 3M06A 1RAJA 1VIOA 2ZC3A 1Q8LA 1YSJA 1PJ7A 3PIOQ 1U45A 3C8VA 4I7ZC 4JPZB 2VOOA 1HMVB 2RQMA 2V9WA 2N9BA 2VG6A 3PG9A 1USEA 1U98A 2WBMA 1HI0P 1FWKA 4GKJJ 1SLQA 4IDKB 3GSIA 3PIPQ 1F9HA 4JI1J 1IBMF 1N86A 5LL6d 1GW4A 4QQBA 2GAGC 4CH0S 2QVAA 1KD1Q 2J7KA 2IFXA 3RRKA 2L48A 3BO2A 4LSNA 2G4BA 4O23A 4B02A 4ED2A 1QAYA 1B3TA 4D3HA 1JOCA 1JK9B 1HI8A 1SUQA 4CM2A 3AB4B 4CLZA 1RWOB 3MPVA 5A8WA 1T7PA 4DR3F 1RP5A 4GMKA 3ITKA 3A0HE 2AXCA 4DLGA 2CIMA 4QYZJ 3TJ8A 5KLIB 1LKZA 3HSGA 4X65F 1BCCJ 2LDIA 3G9CA 1CJUB 4Z2XA 2AX1A 2NZ2A 1FKPA 2AQ4A 2C3PA 3SI8A 2E1CA 1OPIA 4CLPA 3NNAA 2QE5A 1JNRB 4MH8A 3HSJA 1VQSA 1VHIA 3KJFB 3KG0A 1NO8A 2CVEA 4OJGA 4CI0B 3TUIC 4USJC 4ETXA 1VL2A 3I5CA 1R27B 2HFUA 1NTMG 5KFFA 1OFCX 3A7OA 2C3UA 3AY0A 2C2MB 3OTBA 1VQ5S 1B0TA 2RD5C 2JLFA 4XPCA 3NNCA 2FQQB 5CYMB 3LP2A 1URNA 3D67A 3RK2D 3FMBA 1IR0A 3TA2A 2V8DA 2KSEA 1VC6A 3PP5A 1RTDA 2E29A 2KH9A 5HQ8A 3AOCA 4QR2A 3PX6A 3N4WA 3W61A 1C0TB 1XR7A 4RWXA 3LUYA 4TQRA 4C2MA 2P8IA 4DEZA 3QNWB 2VC1A 4K4XA 1U24A 3MM7A 2DEIA 2YNGB 3LP1B 4PSAA 4POAA 1N0UA 3X3UA 1XERA 2VL1A 3GMAA 2CJQA 3NL0A 3I0RA 1NH7A 3G96A 5HP1B 3B4MA 5AVSB 4FDFA 3RU0A 2YX1A 4XK8C 4XTTA 3P4UB 1PAEX 2OPPB 1SKUB 3K8WA 2UUBJ 2IM1A 5KLVG 2O1JA 4OHZA 3RL0B 1M5VC 1BLUA 2KT2A 1VC0A 4CZCA 3CEDA 1WHVA 4QZVB 2R3VA 1K8AQ 3CW2C 5KG2A 1SQBE 4KPYA 1Q1KA 2N3LA 2HLUA 4K4WA 2QC3A 3H6PA 3SIPB 4ES1A 2DHHA 3PDNA 4K5SA 1CJVA 3BM7A 3RB0A 2KZIA 1SFCB 4FBUA 4H54A 2RU3A 1AUSL 5KAKA 2BRKA 1YITS 2HHSA 2BANB 2A06E 3QLHB 2RE1A 1R89A 2WW4A 2YKQA 4LGDE 2WPVB 2D3UA 4DFMA 1N2DC 2KG1A 3KPEA 4ZPBA 2DY1A 2V8VA 2RNEA 1XIQA 1NAFA 2Y0SD 4N47A 3JSVC 2BW7A 5K5GB 2BDPA 1R0AA 3DYAB 3K5MA 3RBZA 3NXZA 4NPOA 1HW9A 4QOTA 3SV4A 2LU1A 1RTIB 5KFAA 1RCXB 1N6QA 4QU6A 4P2XA 4B3MF 2K8GA 4HI1A 1RQUA 2O1KA 5L9NA 4DSFA 5IQQA 4ZVGA 1HWTC 1K05A 1HR0J 5F8JA 3V6KA 1VCTA 2ZH1A 4C7NB 1S1WB 1FZBA 4IRKA 4Y99C 2K9YA 4WFYA 4GKKF 2IDLA 2DK2A 1IKYA 3FC9A 1W5CE 1O5JA 1ZMEC 1DEEG 2WAQD 4JI6F 3RB6A 1BXNA 3I82A 3BGRB 3NBPA 2IRUA 4CLKA 1L4AA 2AXTH 2EFNA 4V1Ak 3NS7B 5L39A 3MMAA 4IH7A 3EGWB 4B9MA 3K57A 2HBYB 3RBEA 3N6MA 2BA9A 1SV5B 1ZTWA 1RF1B 3M0AA 3FXDA 1NHLA 2WSFC 1UZDA 3FQKA 1PG5B 3UIAA 2E1AA 2ZRAA 2Y9ZA 4ECSA 2IBZE 5A2QY 1F2HA 1D9FA 4RNHA 3D6HB 1Z2ZA 2K9JB 3P32A 4F4ZA 5F8HA 3U1NA 3MEDB 1A7GE 4DUZF 4PO1A 2I0XA 2R8KA 3JSBA 2QJYB 4I2QB 4JYCA 3VAGA 2P6SA 3I9ZA 2VV5A 1CPZA 3H5UA 5TISH 3ZC4A 1JX4A 3TAPA 2UP1A 2POHA 3A12A 2FGOA 1SQBK 3H90A 1AW0A 1IR2A 3JQJA 3R1LA 1LT9A 2ZRCA 2HKEA 3ZO7A 1U49A 2G3AA 4F2SA 4RUCA 2XY6A 4LRAA 3FQLA 2FHMA 4OV6A 1JQGA 3EZUA 3OL8A 4WYWA 3PJ9A 4L73A 4C0OC 1JMBA 2ROEA 1PGJA 5ETVA 4DV3F 4QBUA 4DF4A 2OFHX 1SVDA 1FEEA 5J2PA 3HE5A 4DXLA 1LTAC 2V50A 1S1XB 3TAMA 4DSIA 2XCPA 2CPBA 1FFGB 5F3ZA 2R42A 1JCCA 1S9GA 2BJ1A 2VICA 4AXIA 1M5SA 3KK3A 2MZQA 1UIXA 3CIMA 3TX0A 3SFDC 2KZMA 2BBEA 3A3YB 1JLBA 2M52A 2HAIA 2RILA 4I68A 1JKHA 2FB0A 5IC6B 4HDHA 4KGZB 1JEKA 5D15A 5CXTA 1T9TA 3MOJB 3CCUP 1SB6A 2G9OA 1RUSA 2MGZB 1S9KE 1RHUB 4OLPA 3E8OA 1NOHA 4R5PA 4NXMF 3FGVA 3UFCX 3CX5D 4USMA 1VF5B 1VRTA 1YQ4C 2XZDB 1YKWA 2AJ1A 4L3NA 3DKDA 2QEXP 3CD5A 5HQLA 3RB4A 1O51A 4PUOB 3MD3A 2XNDH 4NPEA 4DV2J 4YS2A 4YB6A 1J5OA 1OW6A 3L7UA 1DJ0A 5F8GA 3H1IJ 3DGPB 1YTZI 1LWXA 1RLCL 2RJZA 3LP0A 4GKGA 4M5MA 2YNFB 2N3OA 1XNQF 1GX6A 4O3PA 4ZCKA 3AOAA 1NB7A 2CQDA 3GYGA 1REGX 5E3RA 2K1RB 2WCXA 1R8HA 5B5EH 4DQRA 1TL4A 4MJKA 1JY3N 1TL3B 4NXNF 3OLBA 5BU5A 2CPJA 3R5BA 4V19J 4L74A 1QVFO 5KFVA 4PR0A 1D7MA 4EBCA 3F56A 1KYOD 2LVWA 5IXUA 3LPYA 1FEHA 3NOCA 5DDOC 1X4DA 1MWQA 2B7CB 4EUVA 3NS5A 3IBCB 4IO9Q 2M8RA 4U3FE 3L4FA 4LC1A 2Q66A 3UDVA 3AA8A 1HHTP 4F4YA 3IR9A 4C8YA 1JY3P 4A4JA 4YDDB 3KG1A 1FXLA