2YKQA

Structure of the human line-1 orf1p trimer
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
212
structure length
200
Chain Sequence
DQLEERVSAAEDEINEIKREGKFREKRIKRNEQSLQEIWDYVKRPNLRLIGVPESDVENGTKLENTLQDIIQENFPNLANVQIQEIQRTTPRHIIVRFTKVEMKEKMLRAAREKGRVTLKGKPIRLTVDLSAETLQARREWGPIFNILKEKNFQPRISYPAKLSFISEGEIKYFIDKQMLRDFVTTRPALKELLKEALNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LINE-1 ORF1P
publication title Trimeric Structure and Flexibility of the L1Orf1P Protein in Human L1 Retrotransposition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 62
structure length 200
sequence length 212
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02994 Transposase_22 L1 transposable element RBD-like domain
A PF17489 Tnp_22_trimer L1 transposable element trimerization domain
A PF17490 Tnp_22_dsRBD L1 transposable element dsRBD-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ykqA01
3.30.70.1820 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykqA02
3.30.250.20 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 Rec A Protein; domain 2 2ykqA03
3L4FA 1JOCA 2W7AA 3CL3D 3BRVB 2LDYA 3SOOA 2W6BA 2YKPA 3BRTB 3EQ2A 2JRBA 2YKOA 2YKQA
chains in the Genus database with same CATH superfamily
3CIMA 2I5JB 1Y5LB 5ADZA 3CWBG 2FVRA 1YBAA 1DLOA 3MR7A 3VQTA 2UXDF 1XP8A 1BD6A 2DJWA 3NL0A 5KLVK 1C1CB 1Q8KA 2X3DA 4JF7A 1YSJA 3EXCX 3D6MB 5HVGA 1CJUA 3CPWO 2YWKA 2OPSA 1SCJB 1NPPA 2X51A 1YITS 1GAOA 2VOOA 1U2FA 1NU1D 3CMAS 4DR4F 1NSPA 3KK1B 2IFMA 3DI6A 4RR5A 4KGKA 2XNXA 5GAEI 3KLEA 3BDEA 4WY4B 1LTJB 3KLGB 4HDHA 2G1HA 1CQNA 3A3PB 3LP0A 1JB0J 2ACYA 1I51B 1FTCA 1QUPA 2Y0BB 4ZVPB 4U95A 3M2UA 1EZZB 1T03B 2JOQA 1PL5A 4RU2A 3OJSA 4I6MC 1HNWF 3MPWA 1U57A 4CO5A 3OLAA 2BUNA 3AJ2A 4J9KA 3BJYA 1H3DA 3T1YF 2EFPA 4RNHA 2Q7CA 4TT3H 1Z1ZA 4JP8A 2ZVOB 3SOOA 4C7RA 1NPKA 4B3SF 1OQ6A 3SXLA 1JY3O 3NOCA 1IFPA 1R89A 4M5NA 2NXNA 1U6BA 4LSLB 2E1RA 3SDEB 1ZW0A 1TKXB 2QC3A 3IRXA 1XMOJ 1M5HA 4KJIA 3H6PA 2VICA 4CLFA 3CDUA 5L39A 2VFSA 2E1AA 1XQIA 2RKIB 1HUCA 4DZDA 2CUYA 1ZM9A 2XZWA 1RTIB 4NLGA 3IM8A 2SXLA 4EDFA 4DV4J 3MCOA 2HGNA 2DR6A 1K44A 2CPFA 4HEA9 2YIUC 2Y3YA 1SKSA 1JTHB 2K9JB 1RI7A 4H4MA 1FDOA 2LLZA 4IG0B 4J9UE 2WVCA 3TK1A 5KLVJ 4NLYA 1RA6A 2G88A 4F3MA 1NDLA 1FE4A 3VQSA 1DQ8A 4P2SA 3GHGB 1ZRTE 1FEHA 2QJYC 5KFBA 3VWSA 2LMIA 4EOTA 3QGIA 1S1XB 3QT5A 1QTNB 1VRUB 3N79A 4MIBA 3OLBA 2PN6A 3GV7B 3FCVA 1FA0A 2BEFA 2AKWB 1P27B 3HJVA 2W9BA 4F02A 4MIWA 2V69A 3O2IA 4GKKJ 1PGZA 2WW4A 1O6XA 2RB7A 5I42A 3UQSA 2HPCA 3AD8C 4FYDA 1M56D 2HVEA 2FYUK 1QEXA 3WC0A 3D67A 3TWZA 3I9V9 4GRSA 2LXIA 3HVTA 3DRPB 1QAYA 2HNZA 2YKAA 3D5MA 3KJNB 1NYHA 1N5QA 1S10A 3Q5RA 4NA1A 1T8ZA 3L75J 4ER8A 1BCCD 1TL7B 3CX5E 5KFCA 1Z4UA 3CCMS 3UWTA 1SKWA 2Y9ZA 3PO4A 1NKCA 4L73A 1H2UX 2OEJA 3KLFA 5T7LB 5CCGA 4HHUA 3KLHB 1CJTA 1HWLA 2R8IA 1R27B 4XO0A 3L74J 3ZTQA 1FDBA 4D6TD 2KYXA 1SKUB 3KJVA 1OYEA 4O3RA 4NPOA 1FESA 4Q43A 1B70B 2MY8A 5G4DA 1H74A 3G8TA 1FC2C 4ED5A 1BHNA 2OHDA 2W2NP 5HQ8A 1N6QA 3ETOA 5KT2A 1JMTA 1RT3A 1JLAA 1S1CX 3AE6C 5D0GA 4LSNA 4B9TA 2VG5A 3VMXA 5F8HA 3DC2A 4JI6J 5DDRC 3CD6P 4LR9A 4CLZA 2OYIC 2RQMA 4DL3A 5L8RC 5DDPC 2VIHA 5HLFB 1N73B 2IZ1A 1U1RA 1FXDA 4ZCIA 1HQEA 2FYUJ 3M0DA 5J1EA 5KG2A 5A8KB 2CADA 3W66A 5APXA 2QIWA 3D0GE 4YXDC 5KFRA 5HK4A 2OMLA 2U2FA 3TYTA 3GFXA 2FZCB 3R27A 3WU2E 1GL2A 4B08A 3HZEA 1KTVA 2HS3A 1SIWB 5LM7E 2NYIA 2VQFJ 3U1MA 3I5CA 1Q4RA 4E0DA 3FXEA 4DCOB 3ZZYA 1IBMJ 1HBOB 1M1GA 1HNVA 5A6WA 3OR1B 3MTJA 1WEXA 2XNDH 3CVKA 2ALYB 3FQLA 2CAJA 3HFVA 3W9HA 1S99A 4ZIVA 2HFUA 2LXBA 3NTNA 1UPPA 2A18A 5K8NA 3KK3A 1X4DA 4X65J 4A8MP 1I6JA 5AXKA 2YWEA 5JXSA 2ZYDA 2NXCA 1FKOB 3L73D 1NM2A 3D68A 4BDPA 2J59M 2WQYC 2YH1A 1CSJA 4N7TA 4N77A 3BH7B 4DFKA 1XNRJ 2O3JA 2F9DA 4AQYJ 2WB4A 3JQJA 3TO8A 2M5AA 2DGOA 2C9NY 1M5KC 3G71S 3RK3D 3WDOA 4ZPDA 1MW7A 2DY1A 4FBUA 2GIQA 4S0MA 1VISA 4FDFA 2NPSD 2CJBA 1KC8Q 5C25B 3CXHI 4CYUA 1OZHA 2VBYA 3ZDMA 4O4GB 4C7QA 3HSDA 3RRGA 1SC6A 3CCZA 5KT6A 1F3FA 2Q6QA 2C2DA 2AX1A 1VQ8S 4A47A 2ZJQQ 2CQIA 3LIDA 2E1PA 4P71A 1JY2P 4H4KA 4DUZJ 2ASDA 4B9MA 3IBCB 3GG1A 4WFBQ 3B5NC 3CCRP 5FLXY 1DTTA 3TA0A 1EHWA 1WF0A 1YBUA 3OHAA 2DNLA 3P4UB 5IT0A 1NTMD 3D3BJ 1LV5A 4B3OA 1RT4A 2GVZB 1CC7A 1PGPA 4PABA 3O6QA 3GSIA 1G1XA 2A10A 1Y00A 4CO1A 3CSKA 5ETKA 4CI0B 1Q8BA 4G65A 4CPGA 4CT9A 4PKDB 3O8ZA 3OR2B 3NAIA 5E7OB 3W5ZA 1I94J 1MMLA 1NTZG 3HSZA 3I56S 3QIPB 1LTIC 3TR5A 4C9DA 5GMEA 1XTGB 1Q79A 3VYIA 4GT1A 4ASVA 1YG0A 1GD2E 1XBWA 1L0NJ 5E3PA 5KAIH 1QVFO 3UO0A 1X0FA 1VOMA 4JI2J 3MMBB 1AFJA 3BCCD 1ELOA 2D3ZA 3L09A 4KT0J 5C2GA 1VQSA 3AFGA 5ETPA 4H0LB 2CIMA 2VG6A 8ATCB 3MR2A 3PW5A 1G1IA 3N6LA 3TZWA 3VGUA 2R5BA 4LRAA 3PCOB 3GQCA 1NDPA 3BV8A 3W2VA 3QZ8A 3B54A 4OGQD 2DO0A 4NXNF 1RWPB 4WY4C 3GILA 1JKHB 1LTJC 3P5TL 2QMWA 1SQBG 3HTKB 1UWBA 4X4NA 1YI2S 1PAEX 5CCMA 4I64A 4K7QA 2DXDA 1F1BB 4AQRD 4O44B 3PP5A 3V4QA 4ZHRA 3R1HA 2MHEA 4CH1A 1JLEA 2YTCA 4DSKA 3PRDA 2IX7C 3EICA 1X4BA 3QGGA 4U96A 3THVA 4IR1A 4FKYA 3UW1A 2DNZA 2RHQB 3PRBA 4OX8A 4DHVA 1B4SA 2A6MA 2N1TD 3ITKA 1C4AA 1S4EA 1U45A 3V2PA 3VP8A 1SC1B 1U1OA 1E79H 2HHHJ 2MYFA 2BV3A 4ZKPA 4OLPA 5AVRB 1AFOA 4ZPCA 5GAEU 3W62A 4BBYA 3D2WA 2BCCE 3NMAA 3C3LA 4QOTA 4XK8C 4EYYQ 2D1CA 2WPSA 2G2YA 1CW5A 2B4VA 3EZ5A 4HKQA 1V6HA 1YIJP 4G1IA 4RL1A 2F8MA 1TFYA 1W2BR 1PYOB 3MAHA 4D3GA 3Q3DA 2CNNB 1VC5A 2FTRA 2MKSA 4J9MA 3GHGC 3CCLP 3HXMA 3TUPA 1TL4A 3AB2B 4ILLA 3UI3A 3J7YI 5IWAF 1U7JA 1X4GA 3QLHA 5D3GA 3NRBA 1CI6B 1Q0NA 1KYOI 1VQPS 1AB8A 2KRBA 4DUYF 4R4MA 1L0LK 3PNIA 3OL8A 1Q82T 3AEFC 1S5LE 4PG7A 3N4XA 3BYPA 3ELHA 4K0KJ 3CCJP 3E1IA 4U3FG 1RLCL 4IDKA 1PYSB 2DYAA 5CCHC 1S9KE 2MY7A 3QO9A 3IN5A 2UXDJ 1NU1E 3UCGA 3CC4P 3OD2A 4ID5B 2CYYA 4F36A 4WE1A 1LK7A 3LGMA 4M3LA 1W7WA 3DRYA 2VQEF 2QG9B 1LTBC 4LMZA 1FAVA 4TU7A 4HH0A 2ZH4A 1MO4A 4EK2A 4L3KA 2NS1B 1CJVB 2XHCA 1B7YB 5KFEA 2ZE2B 4DR4J 2RS2A 5HP1B 5L46A 2CNKB 3RRKA 2FBWC 4JV0A 4OZ3A 2VA2A 4E8UA 2P6TA 1JEKA 4WVZA 3G9RA 4NL5A 2JC0A 2HQ3A 1U1QA 4EMDA 1EDLA 2JDJA 4QWEA 2GAHC 3OFHA 2O1JA 2H4WB 3HVRA 1HNWJ 2O01C 3GLMA 4HL9A 2BX6A 3IR9A 1NTKD 1P84D 3OJUA 3QAUA 4B3SJ 4I7ZB 1RQ0A 3CUNA 2HQGA 2DCUB 3H1IE 5E79E 2WSCJ 1YJNP 2AQ4A 5J2PB 3HT3A 4F04B 3OTDA 1MZ9A 2B43A 2QA1A 2W7AA 4L76A 1CLFA 4XDCA 4IG3B 4KFBA 5HBMB 1H0TB 2UXBF 2A0FB 2HWHA 1AV1A 1N73C 3HVAA 1SH2A 4UW2A 4LF6F 3MZIA 4N41A 2IYPA 3H1KD 1S72P 3GFZA 3VVUA 4N76A 5D4LA 1FD8A 2ZNZA 2E29A 4UB8H 2O1KA 3OVSA 1PJ5A 2WVFA 4IOIH 3FWNA 3DRSA 3JYTB 1T94A 1O0PA 3DGVA 5J1NA 1ZPWX 3CD0A 2PEHA 3DHXA 2NXJA 1CEZA 5DZ7A 1H72C 2MQOA 1H2TZ 2GGPB 4HACA 4EBEA 3DRRA 3L4FA 3MZWB 4KAIA 4YB6A 1ACMB 1PP9G 4ECUA 3M2VB 1JLFB 4P73A 5F8MA 2XMUA 1RT1A 1U0HB 1ZA1B 5CA5A 4ECRA 3DGPA 2G8YA 4YDDB 5E3RA 1OW8A 4JB8B 1RHRB 3W65A 4DV3F 2CQ1A 3L71G 4DX5A 1WI6A 3MMJA 1FFWB 4F0MA 3VF0B 1CQMA 4OZLA 2Z0GA 3A2AA 4ED6A 3KJFB 5K14B 3CT9A 3D1QA 1H7WA 3MOZA 2M3EA 2GNKA 4FNHA 2J5AA 3NGKA 1VYAA 1R0AA 5CCLA 1VIOA 5C2CA 2M0GB 3UDVA 4OZ0A 2KYVA 2EBEA 1MG7A 1JCDA 1X5TA 4WIQA 4KQZA 1SUQB 3SFDC 2V2VA 2H8PD 2CPJA 2GIFA 3SCIE 2CRLA 1HLWA 2C2RA 3AOCA 2ZREA 2GMJA 5KFGA 4XAKA 1ZOYC 5AW8B 1FZGA 2QL7B 2ILZA 1HMVA 1VQMS 1VQ5S 2BRLA 4OI6A 3OXGA 2PMWA 3KK2B 1DHMA 2WTFA 3EYZA 2E74D 1GX6A 4ZVQB 4ED1A 3NMDA 3HHLA 1YJWP 4EBCA 3NS7B 3U02A 2XULA 5KKZB 3MMCA 4HI2A 2JP3A 4OJHA 4YB5A 5G0RA 3Q8QB 3ILJA 2HMIA 4ID8A 1JNMA 5KFUA 3KLIA 1YTZI 2OYOA 3H25A 1OY8A 4ZVGA 5HROB 3QGPA 3KUGA 2X1FA 2Y0DA 4LRBA 4O0NA 4WPAA 1KRPA 3C19A 4C7NA 4FVCA 2OKQA 2LYVA 2JL9A 3Q8PB 4M5DA 4TY8B 5I3UA 3Q24A 2OTKE 3V4WA 4YFUA 4X4OA 2EKYA 1U2CA 3R7BB 4KKOA 1RAOA 1D9AA 2AJ2A 3OL7A 3BO3A 1A7GE 3M9HA 1T9VA 1U6FA 4XPEA 3NBPA 1R0BG 1Q53A 2ZOGA 3D66A 4H0LC 4NI2A 4C6AA 2DGQA 1NAQA 1IM6A 1Q8IA 1T9YA 4WTYA 2DH7A 4RUCA 3KYQA 1HNIA 2ZYAA 2O5DA 1GK8A 2NZ4A 4DJGA 1SQEA 2QJPB 3M6XA 4O23A 3J7Z5 4ICLA 3BQ2A 2NZCA 4PPFA 3EZOA 1HVVA 4Z7CA 3TUZC 1UBFA 5AT1B 4Z2XA 2HGMA 2ADCA 2M3BA 1FT8A 1WKJA 4TYBA 3QH9A 1FDDA 2FQQB 3R9LA 2FC8A 1DH3A 2XI2A 2ASJA 1L4AD 2GMHA 2OH2A 2GZOA 2Z2LA 3D4JA 4RW6A 2HGLA 3N7NA 4JI8F 1YJ7A 1S77D 3F44A 1EQ7A 2B51A 1M5OC 5GTIE 2R7SA 1XR6A 2XS5A 3CXHH 1G19A 5C24A 4JI4F 1IO4A 3JSRA 3BSCA 1RKIA 5U47A 5LJ5Y 2ZH1A 1X7VA 3WIVA 3TAQA 3UIAA 3M9NB 4B02A 3L4BC 3M32B 4JI7F 2IHR1 4OJGA 1S0OA 2DNGA 5HMZA 5KFJA 4B86A 1NRKA 5JUMA 3N5BA 2UUBF 2IJNA 3I4HX 2KOGA 3C8VA 5B5EH 1R0CB 1S4FA 3TUJC 2FHJD 1TL3A 1SL1A 5C5JA 3H4BA 1ZYQA 3QATA 2ZRFA 2IVMA 2BCCJ 2XMAA 5F9NA 3F5HA 3EFFK 1MWQA 4IH6A 1AZSA 2GJIA 1S1VB 2W25A 5C42A 1D8ZA 2VG7A 1QX8A 3SCJE 1K0TA 2AX0A 3F0NA 5KAFE 3BYRA 2LCWA 2QL5B 2IC3A 2J9DA 3D0HE 3HLUA 1DBDA 3V6DA 4HHHA 3E3XA 5CABA 3TAMA 3DM2A 4CNZA 1QL1A 5ITHA 5HN0A 3P96A 3BKUA 1BQMB 2W7PA 4R0JA 4BC7A 3H1LE 4GO7X 2RUSA 1ROFA 1LWFA 4FBTA 4DR1F 5E33A 3MUMP 3F41A 1IQZA 4ZPTR 3VTPC 4IYQA 1VQOS 1C0TB 2D41A 1YTZT 2RD5C 1VC0A 1SQGA 4LIRA 5L38A 1LTTC 3IWNC 5J2MB 2ZRGA 4DCJB 4NWBA 2X1GA 1N36F 1LT1A 1H89A 4I2PB 1TZ0A 2XYGB 1JIHA 5B66E 2OEKA 3EJMA 4NA2A 4NXNJ 1TL1A 4Q8EA 2ZEJA 2CDRB 4X66J 2ZH7A 2QEXS 1UETA 5IXUA 1DRZA 4AE5A 3Q0AA 2B87A 3HRNA 3KHUA 2LEBA 4OX7A 4HT5A 3DI6B 4YUDA 1TVRB 2IRYA 5B0DA 5A2QU 2N7CA 1PJ7A 2WOMA 3QBCA 1PPJG 3Q5SA 4WU3A 1BCCG 1OY6A 3RBEA 5A8RB 1EJ7L 1NSQA 3FBBA 3IWXA 1Y5NB 4JV5F 3TDKA 2JWDA 4U7UD 2F8EX 4I7ZC 5KFIA 3HK2A 4WCEQ 2B6AA 4RNNA 2XMKA 1ZAXA 1ZA2B 4D6TG 2CA9A 1RF0A 3N6NA 2AD9A 2PEBA 1N2DC 3H59A 1HNXF 3TZXA 3D7SB 3R5DA 3B71A 3UDLA 1DTQA 2RSQA 5K9FA 2YQ0A 3H1IJ 3HKZD 4Y34A 2MPUA 1UCNA 1LEOA 4PWDB 3BATA 5KFWA 3T97B 4X84A 3BN7A 2R8KA 5H9FJ 1ZS6A 2QJKB 2V2ZA 1U1KA 1VK3A 4G6VB 4JI1F 2V50A 1RWVB 1Z2LA 3ISNC 4ZMDA 2K1AA 1KYOH 1QVGO 2FC9A 1NJZA 1CULA 3GF7A 1EARA 1FFSB 1X8DA 1T2KC 5IWAJ 3A0HE 4IFYA 2FLPA 4PPZA 3HKWA 2RE1A 3V2UC 4ED4A 4DT0A 4DUYJ 1FXRA 2WSFC 1ZTWA 4H44D 5A2QY 2QG4A 4PTLA 2K7JA 2B5JB 3BR9A 2EC0A 5HVHA 4LR7A 2LECA 2H4YB 2HW3A 2WSCH 3S8SA 4HLBA 1NUEA 5TISH 1QL2A 1SQPE 4USJC 3R5GA 1KP6A 3JCUE 2MGZA 2KLVA 1F9HA 5L9XA 4IFVA 2H5JB 4I7FA 1L3TA 3MAAB 3MEDA 2B7BB 5BU8B 4NLUA 1S7HA 1K73T 4DU7A 2J9DE 3K0JA 1TL5A 2KI7B 1RT2A 3HVTB 2UWJE 4C97A 1FKPB 3DDKA 5F9LA 2WPQA 2ILYA 5EWGA 2HNZB 1VQ7P 4W80A 2AJ0A 5DDQC 5DG9A 1JJHA 3DOKA 3H1JE 3L73G 1UFLA 1OW7A 3SV3A 3RB0A 1NTKE 1P84E 4ZITA 3UR0A 1OJ4A 3G2XA 3FVYA 2YKMB 1RP5A 1N52B 4KGXB 2EBGA 2GHVC 4R8UA 3WU2H 1JLQA 1FI4A 2OP5A 1DD3A 2QM7A 9ATCB 4Y99B 2R7TA 5KKZC 2JSXA 4WWIA 1N34F 3MM7B 2ZRAA 3G9CA 1WG5A 1UW9A 3CJQA 2UXBJ 3TSIA 4RW9A 1KEKA 1XMBA 3TX8A 5K8OA 4TKTA 1R8AA 2I6WA 4J9SA 1F60B 4LF6J 5DO2A 2BMBA 2D2CB 1KVKA 4ZPBA 4RO0A 3QSIA 3W2WB 3NS6A 2V4QA 4IFMA 4AUWA 3H90A 1M1KT 3FMWA 3QGHA 2E7XA 1YQHA 5F3ZA 2JLEA 2HHXA 3CNQP 1RTJB 3LW5J 1M1JA 2JH3A 5LSOA 5FDLB 2KZZA 2ERRA 1S9EB 4PXEA 4B9NA 1SXLA 4J91A 3NXSA 4I6YA 4X2BA 1X9SA 2CNLB 1C0UA 3RUBL 4UZCA 2NYHA 4NE9C 3TNUB 2E9ZA 1VGYA 1SFCD 2MQNA 3GYNA 5IS2A 1K73Q 2AXTE 5L1KA 4TQRA 1F2GA 9RUBA 4IO9Q 1TFWA 1PGQA 4F4YA 1UFWA 2RVJA 1H98A 2UXCJ 1HQUA 1EIYB 2KLUA 4WK3A 2QJPC 4WB4A 3I82A 1JY2O 4KGZB 3GP9A 3TARA 4ED3A 1JX4A 3NNHA 3UCZP 3BCCG 4NRUA 3IAS9 1SV5A 1SJ1A 1SS1A 2R5DA 1S6UA 3W5XA 5F8IA 2HWTA 1NTZK 2Z5HA 2AEFA 4LF8F 4R5PB 2AGOA 2Z4EA 3TJ9A 2W27A 4UY8T 3SCKE 4NZ0A 1CJKB 2B9XA 3QFHA 1RE3C 1U7LA 2XLJA 1S97A 1ZOTA 2HSEB 4USKA 4QYZK 4DPTA 2DKOB 1RADB 3TI0A 3HUSA 1J27A 3PRVA 5F3TA 3NGDA 3O44A 4HT7A 2XZRA 4K4SA 1M1KQ 3ENQA 2VU5A 2R7QA 2WSEJ 1WEYA 4DR3F 2M70A 1FK9B 1LTAC 1U02A 3T6BA 3BR8A 1K1QA 1SQBK 1NKBA 4A48A 1GEHA 1S1UA 3MECA 1Y9BA 4PQUA 1M0SA 1VQ9P 1HBMA 4ZLPA 5B08A 4EYHB 5F8LA 3TA2A 3I0RB 4F4WA 3H1HE 3HX9A 1AQTA 4FN5A 2DRBA 2E7VA 1YHQS 2JEIA 2QA4P 5KLVD 7AT1B 3LWMA 1VQLP 1WHXA 3IG1B 1ZPVA 4O3QA 4W7ZA 1X4FA 3L70E 3CCSP 3VAIA 4BWJA 5EFWB 3R3TA 1K9MQ 4QWBA 3W8PA 3PRJA 5F8GA 4B3RJ 2BBEA 2EK6A 4NA3A 3DOLA 4GC6A 2K1RB 2RUGA 1FE6A 4LF1A 2GA1A 2OELA 3QT6A 3UD4P 1F9FA 1QE1A 2ZRLA 4MIAA 2AGQA 2BA9A 2HRYA 1J1DB 3H1LJ 3PYGA 1VQKP 1AYEA 5AW2B 4DPUA 3V81B 1JM0A 5KFZA 1OWAA 2OEPA 3OTCA 1BC6A 3K5OA 4M5GA 3L75D 3IP0A 3SSQA 1T9TA 5GVQA 2MB0B 4ZVUB 2M52A 2YNHB 3OBIA 4A8KA 3C6TA 1XWLA 2FGCA 3MR5A 1HPZB 2FJAB 2CZ9A 1S59A 4WZQA 3RR8A 4DL6A 1UWBB 2C1EB 3L74D 3FRYA 5DM6Q 4C0OC 1FNXH 3BKTA 2V2KA 4DV7J 1NH4A 4JI4J 1ZAWA 3TJ8A 1IKWB 2KFNA 4AXJA 2BEZF 4A8WA 4PG4A 3HHEA 2RH0A 4JI7J 3A8JA 2QX0A 1S5LH 1RYRA 3RL0D 3R2PA 2XWYA 1SH0A 1BE4A 2UUBJ 3LPEA 4ZVOB 1HBUA 2WT7A 2NPIA 2QJKC 3MM8B 2ZDPA 2H5EA 4K59A 4D3HA 1SQVE 2P5VA 3IRWP 1QAXA 2C2KB 2V2QA 3VR1A 3AA9A 3UDCA 2W7OA 2LVWA 2ZRCA 5CBNA 3CCUS 5IV3A 4C8ZA 3TNVA 2FYUD 3AEAC 4ZPAA 3I0SB 4IRCA 3PIPQ 4FYXB 3H1KG 2XG8A 3MGJA 3M91A 4M95A 3K5BA 3NWGA 1TAUA 1WWHA 2QZ8A 3M8PB 4NLOA 1RXOB 1TTHB 1UJ6A 2OFHX 2HNDB 3EVOA 4PPQA 2KS1A 3KG4A 3AEGC 2HQFA 2RF2A 4DR2F 1OVUA 3QLHB 1X8YA 1WI8A 4JI5J 4OL8A 2PRRA 4PWUA 4EUVA 3UFCX 1WF2A 1SH3A 2LU1A 4WJBA 1RE4A 2OD6A 4OWFA 2CPDA 3R5CA 3Q2TC 1Y11A 5E79H 2AJQA 3U7JA 3RGUA 3VOPA 1IJDB 1SQPJ 3TEGA 3FSIA 2YVSA 4LT6A 1U47A 2YNYA 1FWPA 4WE1B 3IO1A 3RJMB 3F56A 4ECWA 2XSFA 3DMJB 4F4KA 3MUVP 2AGPA 1T2KD 3FZBA 1QY7A 1RTHA 2MXYA 1NZAA 2IBZG 2ROGA 4I6AA 5D4OA 2RIJA 1UJ4A 4K4UA 4NCGB 3H1JJ 2CWXA 3DFEA 4KTQA 4G1QA 1FS0E 1NHVA 4LBIA 2Z56B 4CTAA 2ZJRQ 3J81U 3K57A 2BANB 1SJ4P 4Y99C 1IR2A 1NWQA 1KQKA 4A46A 4OH8B 4UTGA 2P10A 1RU2A 2M5YA 5APQA 4OZJA 2QL9B 2V94A 2C3PA 4FYVB 1TKTA 2LQ8A 3QAEA 1HNXJ 2IA6A 1T3NA 2MLXA 1T3UA 2Q3EA 3ITHA 3DYAB 5D78A 1JY3N 2QLFB 3I6PA 1RAGB 2D2CC 1KHVA 1S0VA 2FJVA 3BBFA 4X4UA 2R3CA 3G6VA 4FF2A 5D77A 2KKHA 1URQA 1JXLA 4YP3A 4JI1J 2DBBA 3TANA 3CO0P 2YX7A 2D9PA 4ZN3A 3MCNA 1EXIA 4PG6A 4AYBD 3CMEP 1R43A 2VOPA 3M30B 3PJ9A 5CHXA 4PQAA 4XTTA 3CXHD 2LQ5A 2MKKA 3KTQA 1RDRA 1R8BA 3RK3B 1RWOB 2VA3A 2JRBA 3AXMA 3QIDA 2W6AA 1NNDA 4PG5A 4IOAQ 1L0ND 2V8GA 3ISZA 2RNEA 2KUBA 4RESB 1A9NB 4KJMA 2NPSB 4HDGA 1EP4A 2ZJSE 4DG1B 3AEBC 2HBZB 1K04A 4MYTA 4X4RA 5DQGA 4UT4A 5HO4A 2C3YA 3SQGA 2M3DA 2YWFA 3L71J 3QQCD 3H4DA 3CCQS 4OHXA 2EFNA 4Z1MH 3JB9k 5JJBA 1RWUA 1JMMA 3POTA 2RDIA 4JOUA 4RW7B 1SBRA 2CFXA 3LANA 2GFFA 1RQUA 2JC1A 2K3RA 4C0BA 3CULA 1TU0B 1ZV8A 3CL3D 2W83C 1G18A 2KG1A 2IYIA 3LW5H 1TV6B 3OFFA 1PC4A 4OYWA 3IN6A 3C15A 1HFEL 3EGWB 5IM0B 4UQGA 1MWZA 2A2CA 4B17A 1VLOA 5HQMA 2HBRB 2JEGA 2BJEA 2Z2ZA 4OIXA 1GH8A 3HSJA 1EKSA 1FZAA 4YOEA 1SQQE 4OV1A 1WC6A 1NHKL 1F6TA 2XO7A 1AROP 2FJDB 2I8DA 2OUGA 3M0AA 2QV6A 1N34J 1MMDA 3S4RA 4RNFA 1U94A 3ENVA 4XDDA 2MKYA 2LQBA 1EX8A 3TOQA 1IN0A 3J7ZT 3HE5A 3R5BA 3BSNA 1EZVE 4USIA 1M90T 1YRTA 4ZDNA 1XNQF 2DITA 3T9NA 4OGQB 4NZ6A 2D3O1 3C16B 3H1HJ 1FXLA 3N5FA 4A8QA 2ZR9A 1VQYA 3HD7D 2W8LA 3OXFA 1M57D 5AW4B 2K8GA 3O5TB 3K5LA 3JQMA 3PTZA 3L70J 2WCXA 1YJ9P 2H1YA 2ZH9A 1S1TA 3QWPA 2GVDA 2ZM6J 2ZWPA 2B7CB 3A8KA 4P75A 4DSFA 2XMWA 5GTIH 1RAHB 1XJWB 2B8QA 4Y2KA 5E3CA 1ZTTA 3QRRA 3IBWA 2CPXA 3M1VB 1J1DC 4EO8A 1FHTA 4A7PA 2N1TB 2BKPA 3BKFA 3A3NB 5HL7Q 2WSEH 4DR5F 4DQRA 4HH1A 2HYNA 2IJFA 4DBQA 2E1MC 4DN9A 5GADI 1S4XA 2C0XA 2YKNB 3EQ2A 2JX2A 1RT5A 2XZTB 2HRTA 4J9QA 3OL6A 3DLEB 1JLCB 1FJPA 3P8CE 1FZCA 1LWEA 2IBKA 3PJSK 3R7NB 2KJWA 5LMNF 1UPMB 2PAJA 3CJKB 3OJAB 1WC0A 3DLHA 1RAEB 4HVZA 3A4TA 2LDIA 2VZ9A 4KO0B 2XCPA 4J9NA 2ZC4A 4USVA 3NG8A 2QN6B 1S49A 5KAFH 1NSKL 4C46A 1Y7PA 2HVIA 4NMXA 3LP1A 2P8IA 4F3QA 4ZIWA 1ITPA 1M1HA 1BWVA 2JRSA 3MPDA 3DLGB 4JV2A 2FVCA 3PM9A 5C24B 4FF4A 2YBVA 3N28A 1N5YA 1M90Q 3NNAA 1IM4A 3CD6S 2QYGA 1LFWA 5J2NB 2KSEA 4DR6F 4KGVB 3KYLA 2AHOB 3PW2A 1VIXA 3M9BA 3WUTA 1YJVA 2HBQB 1SQFA 4Y2AA 4PR6A 1LXJA 1LW0A 4GOEA 4F0HA 1Q81T 1P8GA 1E6VA 2DB1A 1SQVJ 2PD1A 2ZVSA 2ACMA 1LP1A 3CJ5A 1NB2A 4RPFA 3BPSP 1K8AQ 2ODWA 5B66H 1IKXA 2F9JA 2P2CB 1VI7A 2OYIA 4RUHA 2EFGA 2U1AA 5CYQB 2DW3A 1YDLA 2Z2YB 1G3OA 3TGUG 4Q0BB 5KG3A 4A8YA 4FXDA 2FIUA 1JO5A 1GT8A 1S3JA 2P1JA 2UV8A 2BQRA 2UVWA 4OI2A 1R8HA 4P72A 1JXEA 5LMUF 3V6DB 4I6WA 3CC7P 5F0WA 4DPYA 3MHVA 3DU6A 5F41A 1NK9A 2CQ4A 3M8QB 4C8YA 1ZZFA 1S9FA 1CBKA 1OWXA 2YWGA 1HWTC 4UB8E 3G8SA 1AA0A 1MLAA 3EGNA 3L35A 4CZCA 2HG4A 3MMAA 2W9CA 4PG8A 4DQSA 3EGZA 1KD1T 2ZRIA 4ENOA 2W6BA 4PQRA 4KV8A 1IKYB 1HW8A 4PYDA 5IT9Y 3BGRB 2HLTA 2A45G 2G3AA 4XPCA 4DLGA 2MQMA 2BR0A 2C2EA 3WZ0A 3KPEA 1U0SA 3IFEA 1JXVA 5DLFA 1FDNA 5CYMB 2E7WA 2JJ4D 3MM9A 2VKRA 2G9OA 4Z37A 4KRWA 4CLWA 1HHTP 4CH7A 1H88A 1X4AA 4MFBA 1FO1A 4MKAA 2RRAA 2V7QJ 2C3OA 3LPYA 4MK9A 5KG1A 2WSSH 3PX4A 4CO3A 2DH8A 1Q81Q 4QPTA 2V4JB 4O9BA 3LGNA 3TRGA 2DGUA 3W60A 5AE2A 1I3OB 3JTOA 3U1CA 1EXJA 1KILE 3D1HA 1NDKA 2FJXA 3M6VA 4K5SA 2WRMA 2YNGA 1S6QA 2B3TB 2ZBCA 1YGYA 1NEEA 5HMXA 2WK4A 2OPQB 2W2QP 1D1UA 4C3LA 5AW5B 2VPWB 5GAGI 1RWKB 2CJQA 2QLWA 3JSMA 5H2FE 4G3IA 4J9PA 1B3TA 2WBRA 4GVBB 3JCUH 2ZFHA 1XTCC 2OTJP 2DXFA 3BRVB 2VFRA 2RU9A 2J6SA 5CCGD 3DKDA 5E3AA 1RT6A 4U7JA 1DY3A 3ET6A 4E2FB 5KFOA 4PRFA 3H8YA 3DOMA 3GF3A 3IS9A 3WC2A 3IGNA 2V6AA 3ZNJ1 2Q3PA 5AVYB 3B5NA 4H13B 3V2QA 3OFGA 4BRYB 1VBZA 4HYKA 3FX0A 3RK3C 3GMGA 4CQ1A 4OZ2A 3PFOA 1KQSR 4QMAA 5HI7A 2KHDA 1YRUA 2ZROA 3J80Y 5IV4A 5AVQB 1KD1Q 3MDFA 5CAAA 4DR2J 3GZ7A 2QMXA 2NPSC 1OYDA 3G4SP 3SQOP 3IGVA 2XV5A 1PO6A 2DNYA 2D2CD 3CJ4A 1USDA 4DV6F 1U1NA 2E74B 1XMQF 1U49A 1Z2ZA 4DS4A 4Q8FA 2K06A 4N56A 2YY3A 2W2OP 5DRKA 1TKZB 1U25A 1WTFA 4OVNF 2WSEC 4UOFA 1RT7B 2H88C 2WVEA 1REVA 3VAMA 4RWWA 3MGNA 1C1CA 3TVYA 4PO9A 4QIVA 1RF1B 1T8EA 3J7A1 1GL2D 1VHFA 1NTMK 2IBZE 1J1EB 4KC5A 2FVPA 1Q90D 2H5IB 1SI9A 1WDDA 2GS8A 2MZ1A 1N7SB 1SC3B 2N3OA 3KK1A 3L72G 1ZMEC 1NH8A 4P9SA 3NY0A 3GJRB 3G6EP 3SWYA 4CLTA 2IAJA 4WY4A 3AE8C 1LTJA 3UR3C 3KLGA 2XSJB 4RW4B 5DDOC 2XY7A 2RDDA 4DJBA 2VRSA 1YTYA 1BQNB 1SQQJ 1T03A 2HS0A 1V3ZA 3UVJB 5F0UA 3V5BA 2ZR7A 2AXTH 2BJDA 2MZJA 1VR6A 2ZITA 1YIJS 1CG2A 1GXTA 2A06G 5CJ0A 4DSEA 5KFTA 1XTZA 5AW0B 3UE2A 5BJRA 3WX8A 3SDEA 1TKXA 2MEWA 5APVA 3PR4A 2MZSA 3OVAA 2R4FA 1VDFA 2BCCD 3H2UB 2HHSA 3I32A 4CO2A 4IKAA 4OGQC 3H40A 2VDHA 2RKIA 3Q22A 1S9GA 1RTIA 3PW0A 4JI3F 2QVAA 2J8SA 2XC9A 4IRKA 1RTZA 5DQIA 4YQWA 1C2PA 3US5A 1JTHA 2K9JA 2ROPA 1VRTB 3RBDA 1B0TA 4IG0A 3VMYA 1U48A 1L4AB 1RUSA 3HSGA 1LWCB 1MNEA 2ASYA 2POHA 3CCJS 2YNFB 3H5XA 2UUTA 2F7VA 3GHGA 5B5EE 4ZP9A 3G82B 3ONQA 3T41A 1JLBB 4AL6A 1IBCB 4N8OA 1WC1A 3CC4S 2N1TC 3GR0A 1S1XA 4DX8H 1M5VC 2C9LY 2ZOMA 1VRUA 1B7FA 4QIWD 2MLZA 1GMUA 1GFWB 1LW2A 4A8OA 2UUCJ 5KFVA 1FWKA 3R5JB 3A8IA 2XY5A 2ZXEB 1S9KD 2QSFA 5FD1A 4OZNA 2VD3A 3KDPB 1OY9A 4KHPJ 3L9ZA 1HQUB 1JOCA 3NKYA 4P74A 2Z5IA 5CCHA 5MAOA 4FF1A 3A7OA 1X79B 1FKAF 1J2JB 5CBOA 3DRPA 5LSLA 3BCCJ 4N8NA 2HZAA 1IFDA 3PYEA 2XTJP 2ZXXA 2QE5A 1SV5B 1NHLA 3BZQA 4I69A 1MSWD 3FSXA 4ELVA 1K47A 3L75G 3SI8A 1TL7A 3BPDA 3GV8B 3V4IB 3K5NA 1G2CB 2HK2A 1C1BB 2QTWA 5GADU 3CD5A 1S6OA 1YJNS 1LFPA 3PFEA 5T7LA 3KLHA 3MM5B 4TXSA 2HZCA 1HNZF 1QJHA 4O3PA 3CJRA 3LAMA 4Y2IA 4WYWA 2F4FA 2UU9F 4LR8A 2HAIA 3HUSB 3PKMA 2B9BA 3H1ID 3BS9A 1IFIA 1LNQA 1S72S 5ETTA 4P7TA 2NZ2A 3ILOA 2WVRA 3Q8UA 5SUHA 2I1RA 4RJTA 2EVZA 2REBA 1N7LA 1KHWA 4I1LA 4DV1F 3BN4A 4OV6A 3MEEB 5HLFA 3K8VA 3KNAA 2KB7P 3NGTA 1N73A 1W2IA 3KMSA 3N9UC 4OYOA 3ENAA 5BYQA 5K8MA 2K3IA 1FJEB 4ERDA 1AA3A 3VV2B 5IC6B 1IFMA 3C14B 4X62F 4GC7A 1X5OA 4X64F 1B99A 1RCXB 1EETB 4NYOA 3PH0A 1JLGB 4OQFA 2DEJA 3OSNA 3R5AA 3EPGA 2B0GA 3M2RB 3BDPA 3S1TA 4DR5J 2C2MB 3CEDA 1S0NA 3OR1A 2H65B 5IFMA 2DR8A 1QSYA 1HD1A 1KYOE 1T05B 1UZDA 4BWNA 2G0IA 2R2RA 3KXDA 5LJ3Y 2W2PP 1AA1B 1EQMA 4WFZA 4KE5A 5GAHI 4QQBA 5EGYA 2CZVC 1LGHB 4AXIA 4AUKA 3BO2A 3BF4A 3EVMA 5AXLA 2H43A 4A4JA 5LMNJ 2Q6CA 2AU0A 3JS9A 1FKOA 2HRUA 4FP9A 2MJNA 1E6YA 1N0VC 1YZ6A 3QWUA 5E41A 3C6TB 1OIPA 1NPRA 2SPZA 3R6LB 4PEOA 1RTDB 2KG0A 2H51B 2V0NA 1BE3G 2HS4A 1T11A 2B9WA 4XIUA 4WTOB 5TISE 4WWSA 3F89A 2HIYA 1Y10A 2ZT9B 1L0LE 3HVWA 4YHHF 2ASLA 1T9XA 1YJWS 2R2TA 1NHUA 2VJVA 2B9YA 1FX4A 1VQ6S 4F25A 3ZZRA 2E75D 1KLMB 3THPA 4H44B 3GV5B 3OUYB 3RZAA 5C25A 1VHIA 1KC8T 4O4GA 3SEOA 1SP4A 2WZ7A 1Q16B 2AJFE 2FDNA 1TK8A 4M5JA 1UVMA 4ED8A 2W90A 1BGYE 1YJTA 1VLYA 5ETQA 5KOWA 5EX0A 4U7CA 2XY6A 4DZOA 2ZUGA 5A8WB 4BWMA 3M9MB 1U1MA 1VK8A 3Q5PA 4H13C 1UBGA 3NGRA 2EI5A 4CLUA 3PLNA 1FTRA 2XYHB 1HBNB 1MMNA 2M8HA 3PYFA 2GVZA 4ETZA 1F5BA 5ETMA 4LVNP 2V7QH 5KFKA 3V6JA 5APUA 5DGAA 1U98A 4IFFA 5GAGU 4OX9F 5LMUJ 2BDPA 1T3JA 1G1JA 3P6YC 3OR2A 2IBZI 2KS1B 1R5LA 2CDQA 4DWIA 4O3OA 2E74C 3QIPA 4LSZB 3JSBA 2NRGA 2BKOA 3T1HJ 3KHLA 2F4VF 2ZYGA 2Q6BA 2VBZA 4F4XA 2QLBB 1L0NG 3W1YC 2V63A 3RR7A 2FJWA 4I68A 3MMBA 3A8EA 2YPZA 2X7IA 4B3TJ 1RF1C 3KFWX 3MTUE 1J1EC 3NFQA 3FK4A 3DLLQ 2PI4A 4YS2A 3PW7A 4OYBA 2JLGA 5L8RJ 1MFZA 1N7SC 4Q2LA 4QPXA 4DR7F 1FE0A 3K5PA 1NK5A 1BUXA 1U8WA 1S1WB 3AH6A 3I55P 4DQIA 4RNOA 1SQXG 3CCES 2I2YA 1JKHA 1REGX 3HTKA 3FCWA 1NDCA 2MKIA 2P6SA 2VBXA 4KSEB 3PX6A 4M8LA 2E43A 3GG2A 2L41A 3SSUA 3M9QA 4O44A 2DNOA 1PSDA 3FCHA 4K4XA 5AVZB 4CLYA 1SFCB 1O51A 4PD4E 1U1PA 4USHA 4EBDA 2MQLA 2GQQA 2CKWA 3W8GA 1ZLLA 4LLHA 1M8OB 3OAKA 3K59A 1LTGC 4C8LA 4M5IA 2NR0A 1SL0A 3DDIA 3TVZA 1R31A 3PIOQ 4F26A 2XDJA 4NLTA 2FHMA 2CJ9A 1WORA 2XS2A 1YBKA 3W9IA 1TKDA 1D09B 2ZFCA 1NMEB 3E7KA 2DHGA 2XCAA 3VAJA 3II6A 4UY85 2KYZA 1PKUA 3H42A 3EWGA 2CXEA 4K4YA 2PC6A 1L4AC 3GIKA 4DV4F 2ZNYA 4CP5A 4PWWA 1R7IA 2RAQA 3DCAA 1G2EA 3NXZA 1FERA 1Y47A 1JUNA 1A6LA 1RHJB 3HHLD 2HVZA 1CI6A 3HCXA 1Y3KA 3T5LA 2E9RX 4IO1A 3BQ0A 4PUOB 3RTVA 2I1JA 1XMQJ 2E1CA 5AW6B 1VL2A 1RWMB 3AEDC 3H1LD 5BXIA 3BSOA 3VZIA 3PZPA 2ZBPA 4YY3F 2IDBA 2Z58B 3BVHA 3LP2B 3CIZA 3IM9A 2DR5A 3C9IA 2KJVA 1MU2B 2ZRMA 4ID5A 1IBKF 3AE7C 5AE1A 1X60A 2IZ0A 2NLWA 2ZZMA 2R7RA 3SSSA 2B4PA 2CPBA 4NLXA 5BR8F 1CJVA 4HYTB 3KDOA 4F67A 2ZE2A 2GAGC 3L72E 5HP1A 3ZTPA 1OS5A 3GE9A 3MWBA 5B0GA 1EKRA 4B9UA 4ZVFA 4M5LA 1OQ3A 1U26A 4O4RA 1D0EA 3H0PA 4QYRA 4P2FA 2FLNA 4QW8A 1T02A 4V1Ak 2JKVA 2E5TA 4GKJF 3TJAA 2GUSA 5SZTA 4X4SA 1S48A 3H5YA 2HURA 1HGZA 3PYDA 3VGVA 2R7WA 3FFIB 4DV2F 2YMYA 1PGOA 3AODA 4YB1P 3BSAA 5AJ3F 2J9CA 3KHHA 2VODA 2UUAF 1RACB 5CZXA 5J2PA 3JSYA 5KJ7A 2KVIA 1GNKA 2VDIA 2O66A 3W68A 3LO3A 4IG3A 4B9VA 5HBMA 5KAKA 1GX5A 2ZHAA 4JI3J 4URQU 3T3FA 2C3MA 2VC1A 3GFYA 4JBCA 3V2RA 1WOPA 2FVSA 2RKLA 3CCWA 3A1YG 3IFMA 1S7IA 4PJ0E 2KNCB 3JYTA 1DZ5A 4DLEA 1VRQC 2JEJA 3Q1MA 3FZ2A 2FFDB 4Q45A 3RB6A 2B4UA 2VC0A 4HR2A 5JRJA 3N4WA 3CWBE 1NK0A 5IQQA 3C6UA 5L9NA 2DGTA 2GGPA 2YIUB 3R97A 2J0QD 2OPPB 2QYCA 3L36A 2GVDB 1FRIA 3SFGA 3UDEA 5LSRA 3L3CA 3M2VA 5HANA 1PZQA 1YHQP 2RQKA 3Q23A 3HE4B 2B4OA 3WX4A 1GXLA 2GHWA 3I87A 3RL0B 1QAIA 4CM0A 2WBMA 2FD2A 1SQPD 5HATA 2LU2A 1VQ7S 1IFNA 2RQ4A 2IY5B 1JY2N 4DS5A 2CQGA 1S76D 1KILB 4FPRA 5A6PA 1KNZA 1OIAA 2Y1IA 2VHGA 1T0TV 1S6PB 2PMHA 1D3WA 3RU0A 5K14A 2YX1A 4RBVA 1MN7A 1FZCB 3D1OA 1WKKA 4DX7A 4DX6A 3KWMA 4K4WA 2KI2A 1ZR2A 1L3SA 2IMWP 1CC8A 1J5OB 1NAFA 3T1YJ 3H1JD 1JQGA 2C22A 2C28A 4NLVA 2ZT9C 4XA4A 2R7VA 5KFPA 4OZ5A 1XMVA 1SUQA 1XERA 3CPWR 3GJQB 2Y1RI 1RAIB 5KG5A 4NEZA 1XNRF 2DD8S 3QJLA 3GMAA 3B82A 5T14A 5GAHU 4H44C 2BJ1A 4NRTA 1L0LJ 2UU9J 1L3UA 2ZOFA 3D6FB 3VHQA 1RB0A 2BXJA 2AYGA 3FXDA 3KK2A 3CDBA 1RH5B 5DGBA 2LP4A 4W4MA 3ABVC 3MM6A 2VB6A 4RLEA 1IKVB 5AW7B 5B0CA 1JK9B 1YX2A 2H54B 2MLYA 4DV1J 2AYBA 1VBYA 3H7HB 4Y28C 2ITAA 3ZZTA 2MMYA 1B0PA 1YK9A 2L08A 3TP2A 2KXFA 3MEGB 1GTEA 4CM2A 2HHQA 2M8DB 1BGYJ 3DLJA 3V6IA 1R8EA 4TLQA 2ZD1B 1BDCA 2R7UA 5HROA 1IWAA 2E76D 3DDNA 2YKQA 1IKXB 2A45I 3RBZA 2LR2A 3MFIA 2YNIB 4X62J 2CQDA 3AE4C 3D28A 3TGUJ 5ETSA 4UUWA 3K58A 4AT1B 2RDJA 4NPDA 1H6KX 4X64J 3IR5B 1CVJA 4CWBA 4TY8A 4OJ1A 2J9EA 2R8GA 2VASA 1KFMA 2KL8A 3CCUP 4PPDA 4NXMF 2O01J 4H4OB 5HAOA 5AVVB 4DQQA 5D15A 3AD7C 2Z57B 2Q5UA 1L5UA 4K3AA 3WIUA 2CPZA 2FXPA 2JDIH 2XNRA 2DO4A 2J76E 2GM4A 1UVKA 2KTQA 3L71D 3DLKB 3FEXB 4OI4A 3SIPB 1RKJA 2B56A 3ZFVA 2FGOA 1S12A 2WW8A 5L1LA 1X0TA 2BM0A 4MAKA 4DPXA 1NJIT 1DQ9A 4ZPWR 5HSPA 2CVIA 3JAMU 4H13D 4PD4I 5H2FH 4GVLA 4J7CA 1QAJA 1H73A 3S01A 4PR0A 4QIFA 2DHHA 3DHWC 2OYHB 2R8HA 3R2DJ 1Z56A 2NXEA 4WFAQ 3AJ1A 2KXHA 4WXWA 2XBPA 4YPCA 1RQVA 3RAXA 2WHOA 4Y2CA 2K3KA 2ZAEB 3AD9C 2C2ZB 2MSSA 1XK8A 5GMKa 1SFCC 4YHHJ 3MPUB 1WACA 1PAUB 5AVSB 2XS7A 3ILLA 1RE3A 2VONA 2ALZA 3HFKA 1W2BO 3K8WA 3P49B 3KMQA 4KPYA 3BB5A 2J6TA 2JJLA 3M32A 1VQ9S 3AA8A 4LFAF 2LQ9A 2GJ2A 3UPFA 2G1DA 2M88A 2VFUA 2QA4S 4UQTA 1VQLS 1N7SD 1CS4B 2CQ0A 4TLRA 5A0YB 3W63A 2N9YB 3D71A 1IJFB 1LJ2A 2MJUA 2HODB 4ECYA 3CCSS 5CXTA 2C42A 1ZXGA 1FFGB 3N01A 1OSCA 5EUHA 1Y5IB 2QIFA 2BOAA 3B4MA 3C66A 2DGWA 3H1HD 3D54A 4QWDA 1V3SA 1UL3A 4J37A 2O1PA 2FZGB 2OPRB 1ZBTA 4LC1A 1MROB 1JB0C 3SSRA 2W8KA 3L70D 3L7UA 2ZBIA 5EWFA 2R32A 3IS9B 3PO5A 2C2NA 3UNGC 4OX9J 2IDLA 1NJIQ 4X4QA 2BQUA 4K2JA 4ZP8A 1W25A 1XN9A 2Y8WA 2YQ3A 1V5VA 1VQKS 4PZVA 4C3KA 4LF7F 4DL2A 3TW0A 4W92B 4C3MA 3A13A 2O67A 1YRXA 4DCPB 2CG8A 2F4VJ 2K2PA 3HHKA 4MJKA 2M8RA 2BW2A 3SFEC 4DL4A 2J0SD 3V2NA 1VQNP 3MCSA 4J9LA 3PEHA 2DGVA 2YO3A 4UOHA 4W7YA 3FWLA 4K0KF 2P7JA 1C0TA 3G3ZA 2CQ2A 3PJWA 2VBWA 1LTSC 1NBEB 1BXNA 5DETA 5J2MA 1OX3A 1REVB 4F4ZA 1NU1G 5KTBA 1TUWA 2Z30B 4DR7J 4I2PA 1U09A 1GMWA 2YKPA 3QRPA 1OO0B 2BE2B 2HBYB 4NMLA 1SQXE 3I9ZA 3W3SA 1D9DA 3GCWP 4OHYA 3L72J 3U1AA 2CQBA 2DK2A 3HD7B 2DHAA 3HFZB 3CCQP 4ZCLA 4USWA 1TVRA 1P6TA 2G0CA 4U9RA 1GW3A 2IAJB 5A8RA 3PJXA 2DGXA 3LGHA 3R1LA 4GKGA 3M9OB 4IOBA 2IRUA 2V34A 5I3QA 1FNMA 3SV4A 4CNYA 4ZCKA 2QGFB 3U59A 1KVJA 2FPHX 1UFKA 2QT7A 4CT8A 5KFLA 2QRRA 1RAAB 4K4TA 2HNYA 2RMZA 1SQVD 3H1IG 5B7WA 3HDSA 2V67A 5KT5A 4PWDA 5L1JA 3Q8RB 3T97A 2IPPA 2WB1D 2R3VA 3NGSA 2R2UA 3P32A 3G8QA 2BOPA 1NTZE 4Y00A 4BC9A 1S9GB 3E01A 3GSDA 2RQCA 2FFDC 3MD0A 2CQCA 2XGQA 1LWUB 2HQCA 2IM2A 2PIIA 4ZOSA 2OE2A 5J1PA 2IPOB 5DJTB 3R8YA 5KT4A 4N47A 3EWKA 1RISA 1FVSA 1VQ4P 3JTNA 4FF3A 4WU2A 3CWBJ 2GW8A 5ETLA 4EGLA 4N78D 3G86A 3RRHA 3UD5A 5EX3A 1DLOB 3RL0C 4ILRA 1NK6A 2PGDA 1GU5A 5LXRA 1NSAA 2B5JA 1KSPA 3TEHB 4YY3J 1KB9E 3FBEA 3OV7A 2LXUA 1DX7A 4RWXA 1LW2B 1KILC 1M5PC 5LOQA 4PAAA 1CJUB 4QJVA 2DPIA 1SQBE 5HJXA 2OPSB 4QIGA 1KBRA 1IBKJ 4V19X 2N9BA 1FZCC 4FYWB 3KHGA 4KH1B 2MZTA 2XMMA 4KHXA 1N0UA 4B3MF 3MUDC 3MAAA 4FNIA 2BKNA 3KLEB 1QVFR 3MP7B 5BR8J 1UEVA 1LXNA 2V9KA 4O3NA 1HI8A 1FKPA 2QO3A 4A8XA 1KMIZ 3LP0B 3TAPA 3GJTB 2GJFA 1NXIA 3CB4A 3WMM0 4I4BA 3M2UB 1S2EA 2MJZA 2OEMA 4AL7A 1WF1A 2KO1A 1PPJD 3I4PA 4JPZB 4DN0A 1RK8A 3MFHA 4ZPVR 3ZZZA 2YKMA 1WSRA 2BZ2A 2CJXB 1DAXA 4USUA 4GKJJ 4KY3A 4WFXA 1N56A 1R8CA 2D69A 4Y0FA 3IRXB 2YWHA 3EE3A 4DV2J 2E5LF 2IRXA 1GDTA 4NPFX 1RCOB 4JV1A 5AJ3J 1WT6A 3MPYA 4NLWA 2ZRNA 1EQ0A 1N88A 3GYXB 2UUAJ 2KRRA 4KIAA 2AW0A 3QYYA 3MM7A 3VTIA 3T9ZA 3CMES 2NPFA 2IFXA 2D3UA 2LA6A 2AYMA 4H4MB 2YPYA 4OYIA 2AJ4A 1TR0A 4LVOP 2DTJA 3D9BA 1LK5A 3W2WA 2ZT9D 4NX9A 2DHXA 4DCKA 3BGUA 1BGXT 2GV1A 2M7SA 2JZ5A 3FNNA 2J7KA 2J7WA 1WHWA 1RTJA 4MKBA 5FDLA 1AUSL 5CHCB 5JMNA 4U3FE 1S9EA 5F8JA 4DOZA 2OAUA 4TVAB 1KOOA 4X4TA 4L75A 3O3LA 1BQXA 3M8ZA 2W9BB 5JVGQ 3K17A 3TNUA 2VQEJ 4Y6IA 1NK7A 5HQLA 5I42B 2HPCB 2ZRHA 3MR3A 1NH7A 4FS1A 3JXOA 3IF4A 3T5HA 2UVVA 1ZETA 5A76A 2XYPB 4FXVA 4UB6E 1KQFB 4DI6A 2ZRKA 3VAFA 4ZVTB 2J5UA 1R6VA 1UEKA 1VDHA 2OYHC 4NLPA 4U6PA 4WIIA 1RABB 1H0HB 5FLXU 2YX4A 4ZS6A 4IH7A 3D0IE 1UAWA 3NNCA 5CJ4A 3A3YB 1Q7LB 4XE5B 3KLFB 4EIJA 2FUG9 4P2MA 1CJTB 4WKRA 4K8RA 3SCLE 2D9OA 3KJVB 4K2XA 2YXLA 3M8WA 1E6YB 1WRGA 5D0HA 4R5PA 4M1KA 2K9YA 2IVFB 3F73A 1UW4A 1TMJA 2XMTA 1TK0A 1FWLA 4DU8A 1X9WA 1BE3J 1CJKA 1FEEA 4K50A 1SLQA 4WZMA 1FZBA 1SQQD 4BXLA 3G6YA 1L0NK 2ZHOA 4PO8A 1N6QB 2WZ1A 1DJ0A 2HIQA 2O01H 3E51A 2WSFJ 1RT3B 1X5PA 1JLAB 1KLNA 2VH7A 4LSNB 4OJ3A 4ECSA 4OYMA 2VG5B 4NLDA 4KT0C 3RYLA 1KKHA 1TELA 3IXQA 4BCAA 1Q7YT 1QSLA 3GIJA 3M8RA 1YBTA 1RHMB 1FK9A 3GPAA 4JBZA 1SQXK 4ZCMA 2OFOA 1HQEB 3MTKA 1F2HA 1EZVD 2A45H 5J1EB 4TWZA 1WD6A 3VZHA 2M0BA 5KT7A 1YJ9S 3OQ2A 3CDEA 1R8PA 1NTMG 2PT0A 3FBFA 1PP9E 1GL2B 2AMCB 3I0RA 3ILIA 5KFXA 3TF5A 3PHEA 3H32A 2R3SA 3IG1A 5AXMA 2LKMA 5K5MA 3PR5B 2CPIA 3P8MC 1D9FA 1HNVB 1JWWA 3G87A 4OYXA 4DV3J 3L71E 3QJJA 4NXMJ 3FGVA 3QFWA 1AVOA 4M5HA 2IBOA 1K9MT 4DV5F 4EEYA 3CC2P 2CJAA 1SKRA 4MH8A 3W5YA 1N33F 4ES3A 1V5IB 2K1RA 4PD4H 3KK3B 1AW0A 1URRA 1PGJA 1URQD 2BE9B 1DEBA 1UIIA 4JYCA 1VJQA 2ZRPA 2BYCA 1JCCA 5DS7A 4ANEA 1BSHA 5EN1A 3IAOA 4NCAA 4LF5F 3TYYA 3P8CD 3H1LG 3V81A 4RJVA 4L72B 2BRKA 3EX7B 1NJXA 2V8VA 4YEAA 2LKZA 4OFZA 1L2PA 3EVWA 1X0PA 4F50A 2M5AB 2AXCA 4LRCA 3PKYA 4HI1A 2HG5D 2YNHA 3Q83A 3HD7C 2PP6A 5BYSA 2VFTA 1HPZA 4TU9A 4C8NA 3RAMA 1SQXJ 3Q86A 3CCVP 2ATCB 1N5TA 1IBLF 2J58A 2LFVA 4YXWH 4LRFA 4OI0A 4X66F 1Q7YQ 1OPIA 3QSYB 2ZH8A 1IFJA 4OQJA 3BGLA 1K1SA 2QSIA 2HFNA 1U99A 4I1TA 4CYUB 1FRMA 2EFVA 4IOCQ 1IKWA 3K5MA 3PTWA 4WK1A 4EYIB 2EC2A 4DPOA 4DFPA 3WQPA 2OSQA 2B89A 6FDRA 4LFAJ 1N8RT 3L7PA 4EFAC 4WP9A 5CYJA 1NO4A 2E5JA 2APOA 2V8DA 3KG0A 1HF9A 4M5MA 2NXUA 1HBWA 2C3UA 2N4CA 3TQEA 1DTTB 2DGSA 2CWKA 3MM8A 4LQ9A 4TU8A 4B3OB 1QLED 1RT4B 3NAHA 2YXRB 3O6QB 2W1BA 1LWUC 4NLSA 2FXMA 4F8RA 6FD1A 2RT3A 1KB9I 3SYZA 4PSAA 2DNHA 3ADAC 3U27A 4URGA 3CC7S 1NTZJ 2OFGX 3I0SA 5J2QA 1S57A 2P67A 4LQ3A 4KH0B 4P10A 3VAKA 4NPEA 3OVBA 2ZH2A 1VFJA 3M8PA 2AIRB 1HWIA 1SPBP 3BGOP 1U7MA 2LEAA 4DQPA 4A8FA 3M8YA 2HNDA 4OX6A 2Y0CA 3DU5A 1ZH5A 4QYZJ 4LF7J 2F8HA 4MKVA 2WSCC 1IUJA 4ECZA 3M4XA 2DNRA 5M2PA 1WNEA 1T9WA 4WXOA 3HHNB 3SWKA 2P58A 2VG6B 3CX5I 2WAQD 5T41A 3RG6A 5ETOA 2YKOA 3KUHA 1UBEA 1QGKB 2CZ4A 2HHPA 3AHPA 3Q8YA 3RK2B 3W2VB 4HTIA 5CQGA 3ZTSA 2GMLA 4J9RA 1SQBJ 2O3DA 1FZEA 1GW4A 2DISA 4JI8J 2QM8A 1SQPG 1AFIA 1CSBA 2JVOA 4YR0A 2F3JA 2EPIA 3HD2A 4POAA 1WC5A 3R2CJ 3DMJA 4ZHRB 1X9MA 2FJEB 4F7VA 3GB0A 1HJ0A 1JLEB 1O8BA 4RKUJ 4NEYA 1YITP 1VBKA 1N8RQ 1RBOB 3RW6A 4PJ0H 3CMAP 3PHTA 2HFZA 2PSZA 1FJCA 4NCGA 5M2UA 4IL6H 2QA2A 1RLDA 4H54A 3H1JG 2Q1KA 4OYPA 4C11A 2O01N 3FEYB 4PPNA 1NTKG 1IR1A 2AV5A 2BANA 4RUBA 4DUTA 1KILD 2IVYA 3RB3A 3RGIA 2OTJS 2W2MP 4HB1A 3NCQA 2GX8A 4C8MA 3Q8VA 3GJSB 1L3VA 4ZJOA 2K88A 3DYAA 2Q79A 2BW7A 3H5UA 5AVXB 1FNOA 1GTHA 4ASWA 2R9LA 2IJRA 5KOXA 2CPHA 2E5IA 5F8NA 2W4DA 2OESA 4NYZA 1FJKA 4TQSA 4ECTA 1VS3A 2DIVA 5KFMA 3VCDA 3HT0A 4N78E 5D3GB 1GMVA 5GMDA 3G4SS 3OTOF 4YDXA 2FB0A 3VN0A 3ZZOA 1Q82Q 3RB4A 1IK9A 3G96A 3Q89A 1NZ8A 2ZHBA 4KYZA 2VPYB 5CMZA 3M30A 4J9VA 1RBLA 3E8OA 1LT9A 4U3FJ 4DR1J 2EG1A 2R42A 3OFEA 1WOOA 3EGVA 4IDKB 3C6UB 3J7AN 2G0JA 3A12A 4AYCA 3QO9B 2P9GA 3RAQA 1N36J 2GCFA 1IQTA 1M5SA 2E75B 1Q5YA 3AE3C 1RAJA 1ZR4A 4OMFG 2NPSA 2BJ3A 5CD4A 2NSCA 4DG1A 3LQVA 1XR5A 4DMZA 3TQ1A 2M4MA 4FKXA 1KWMA 3B8HA 1YVFA 4U67Q 2PGCA 4B3MJ 3EXYA 3IBFB 3C46A 3N0VA 4JUZA 3G6ES 2UXCF 4RW7A 5CCGC 1PPJE 1BCCE 1W2EA 5KG0A 1HW9A 2ZH5A 5LXYA 4JV5J 2DXEA 5K8PA 2IBZD 2ZBRA 3CCTA 1FBMA 5HMWA 1U4BA 3PW4A 2P9EA 5HJYA 1TV6A 1S0MA 1Y8AA 4D6TE 5B0FA 3CD7A 2JWAA 3P5BP 2K7KA 1IC2A 2PA3A 3MOJB 2EW9A 4QWCA 1RE1B 5IM0A 3CCMP 2BJ9A 5LT5A 3KJQB 3FKBA 4LF2A 2FJBB 2R8JA 1R3NA 2NUHA 4I67A 4IQMA 1R5SA 2FHKA 3P3DA 2UZAA 2E5LJ 1NKNA 2DR7A 4C98A 1IVZA 1T95A 1VF5B 4UF4A 4KFBB 3W64A 1T9UA 1LKZA 2GHPA 2CQ3A 1I1GA 3JC22 1KORA 3MM6B 3M0DC 4KR0B 4PXBA 4Q5VA 3P8BB 2XLKA 4IL6X 3DRSB 4I56A 4NOHA 2M9KA 2OTLS 3GCXP 4TN2A 1GL2C 2QSWA 1VQ6P 3CE8A 4CLKA 4DL7A 4YR3A 4ZLJA 2CJYB 3FDSA 3HI9A 3DXBA 2WTYA 2Q1LA 4HACB 3DRRB 4UUXA 5D0EA 2MZQA 2ZH3A 1PP9J 3C16A 3VMAA 4J90A 3CMQA 1TMMA 1DEEG 3H1HG 3ENWA 1RA7A 1HGVA 3LH2S 7FD1A 4JYBA 3MCMA 1RT1B 3J81Y 3DGPB 4GOFA 1FD2A 2EXUA 3L70G 2FXOA 2BACA 5KLIB 1QVGR 1Q1KA 5DG7A 3H2LA 3ZC4A 3D70A 2WSFH 3NCPA 1P1LA 1HD0A 3TUIC 1AXQA 5AE3A 1U6ZA 1U24A 2IM1A 2MSTA 2CVEA 3M1VA 4B3RF 4WBAA 5AW9B 2Y1JA 2N1TA 1RYSA 2ADBA 1DURA 3I31A 2PE8A 2ZR0A 3CJ3A 2YKNA 3L73E 3S7RA 2H89C 3CXCR 7FDRA 1R0AB 1MWYA 2DRDA 2JHEA 3DLEA 1JLCA 5CH7B 1BDDA 3B5ND 1MKMA 4QW9A 6AT1B 3GU0A 3ZZ0A 3EPIA 3CJKA 2BVZA 2VL1A 1NJYA 3KZIE 3C2PA 4KO0A 4KHRA 5DG8A 4ZVSB 1ZN5A 1SVFA 1RU1A 1DD4A 3RK3E 2XMJA 3X3UA 4RZRA 3QZ7A 1HMVB 1EC5A 3OTEA 2ZDOA 1HH0A 1HWJA 2L48A 1BLUA 2J8AA 2MQQA 3PVXA 1PBUA 2RRNA 1JJ4A 3LF0A 3HHLB 1RWXB 2GQ2A 3DLGA 3G71P 3B78A 1ICEB 4DV7F 4H4KC 4MK8A 3LA0A 3MMCB 3E1RA 2H3EB 5G0RB 1D8YA 3CCEP 1NU1K 2N7YA 1MO6A 5J2NA 2HMIB 4C8OA 5DM7Q 5APWA 3KLIB 4EZ6A 2Y9HA 3BBCA 4NYPA 2DHSA 1PYTA 3R4YA 1G4CA 1F5AA 4DZ6A 1OW6A 2Y1LB 2AP6A 1XEZA 4R25A 1NTME 1VQ8P 2RH3A 3CW2C 2JO1A 2ZWOA 3VGSA 1SQVG 4C7NB 5IZHA 4WY4D 4C8KA 1NK8A 3OW2O 4K4ZA 4CIOA 4M5DB 5I3UB 2HFVA 1K8AT 2ROEA 2YQ1A 2WONA 2Z8QA 3R6GB 3AOAA 2H7HA 5IOLA 3IA0A 1YJRA 5CYQA 2PMZD 4KKOB 1HQ2A 4Q0BA 3T6JA 2XQCA 4RX6A 2KT3A 1HI1A 1HWKA 3C1LA 2LEPA 3V5RA 1NJWA 3NBPB 2KH9A 1SJRA 3HD1A 1OVVA 4DV5J 2IA0A 3CGIA 2BJ7A 2MKHA 1D7MA 1IWGA 4NI2B 1N33J 1KTMA 2EEYA 3DRXA 4J9OA 3D6HB 1W5CE 5AVUB 3I56P 3PEJA 5GTHE 3BREA 1EDIA 3BCCE 1HNIB 3THTA 3RK2C 3M8QA 4JI5F 4JYAF 1FRLA 5H9FK 1KYOD 3SFUA 4I2QA 4ICLB 3TA1A 4LF8J 1Q86T 4LF5J 4GDOA 2COLA 2J0XA 2XLIA 4ECQA 3N6MA 1IKYA 4PSVA 3BGRA 2KXPB 1NU1J 2OLWA 1GK4A 4QR0A 1GXUA 4RW6B 1VMBA 3P7KA 4KBIA 3J7YU 1PV3A 2I38A 4ILMA 5CYMA 1KVIA 3VMZA 1K05A 1Q8LA 3LALA 4LBHA 4NASA 4WYLA 1IBLJ 2QRXA 1KR4A 2ZZNA 3VAGA 4UZBA 1RY3A 3L7OA 3NP5A 3CDAA 1HR0F 4I0WA 1PC5A 3DXSX 2HHVA 2A2DA 2KDOA 1YI2P 1DIPA 4DR3J 1L0LD 4RBTA 1YQ4C 2VPXB 3IR6B 2HHUA 1JJ2R 2V4JA 4YMEA 4Q7AA 2UUWA 1FX2A 2E5YA 4WF9Q 5K5GB 3HULA 5KG4A 2B8PA 1UKUA 2KM8B 4EZ9A 2GQCA 4E98A 2NCKL 4YTPC 2F63A 4PQYA 1TL3B 5CCHD 1JMBA 5THWA 2XU6A 4EU0A 1Q2NA 2OPQA 5KJ7C 4QU7A 5APYA 1KB9H 2QLJB 1UJ5A 1A02F 4Y65A 1WELA 1AZSB 1MV8A 5C42B 3A0BE 4ZLNA 2VG7B 1HJBA 2HNYB 4GVBA 1G6BA 3BASA 1BGYD 2E5GA 1UMJA 2IC3B 1URNA 3JQKA 2XGPA 5LL6d 1TUGB 4MT1A 2RRBA 2KZIA 3D6YA 4WKYA 1J5EF 3E01B 1KOHA 3TGUD 5AXNA 3TAMB 1AQ5A 1GQEA 5KT3A 1WMKA 3DM2B 2K37A 3MIWA 4BRYA 1O5JA 1HYSA 2P2UA 3H2VE 3K89A 1Q86Q 1OXZA 3CX5H 2EG2A 2L5GB 2E75C 4ECXA 5KFAA 2DR9A 1LWFB 3GR1A 3C8YA 5KFHA 1U8SA 3HF5A 3O1LA 4JQ0D 1VQPP 4PV1B 2BEQD 3FSYA 2FZKB 4LBPA 4IFDK 2DVIA 4DSIA 5AVWB 4HHJA 1FU1A 4X4PA 1RBAA 1ZZNA 2YO2A 2VJUA 5D4PA 2BE7D 1IR0A 1TKZA 1TL1B 2GC8A 3I55S 1UVNA 3PG9A 5EHHA 1RT7A 5E5NA 3BBBA 2B87B 3LW5C 1I5OB 2YWWA 2Q66A 2NREA 2MHNA 2W4PA 2NSBA 2HHWA 4NLQA 1BCCJ 2R7OA 1RF1A 4RU9A 2WOMB 3UD3P 2ZKUA 4K35A 4LIWA 1NKZB 4W98A 2E76B 1QDUB 3NCRA 1N7SA 1P9YA 1G7CB 3HJFA 1HIYA 3T1AA 3EM1A 2B6AB 3TVKA 1T6AA 2EKNA 3HO1A 4D6TJ 2DCLA 4URSA 4KPCA 1MN9A 5M1BA 5BU5A 3CCRS 8AT1B 3FUYA 2XSJA 2LXFA 4RW4A 1VF5C 1DTQB 2FVQA 1B64A 4I2LC 4PD4D 4FVMA 1BQNA 2PDAA 4ZJLA 3GWCA 2Y8YA 4XFJA 3UVJA 1SQQG 4ELUA 3FRZA 2Q9IA 4FXWA 3USSA 1NLKL 1VCTA 4DL5A 3M06A 2HVHA 3GIIA 3KNGA 5DJUB 3GG0A 5HVFA 3B4DA 4UB6H 3H1KE 2FKWB 3NGUA 2RS8A 2V4HA 1X4EA 3LWLA 3UN2A 4CO0A 1FDIA 1CULB 4CLLA 3W61A 2CQPA 1TAQA 3PV8A 3R7SB 4IFYB 1PJ6A 4RW8A 1RZMA 2E9TA 4ZMMA 4O0IA 3OTOJ 1EZVG 1QD1A 3U1NA 2QLXA 2CJKA 2AEJA 4PXCA 4FYYB 2KN4A 2IMOA 2ZVNB 2ABYA 2DNNA 1VRTA 2NUUG 2WVDA 5KLIC 4AL5A 1L4AA 2HLOA 3MR6A 2OGUA 1LWCA 3EFGA 4U8VA 4ZVEA 2I5JA 2YNFA 3W67A 1SC4B 4M63A 5E0OA 3G82A 1J2VA 1JLBA 1APSA 2V5HG 1FRKA 2ZM6F 3S6EA 1Q5VA 2MGZB 3MEKA 4ZNCA 3MI7X 2MZRA 4IFVB 4I7FB 1F9EB 1OMIA 1ULRA 3MEDB 4FPIA 4ZLLA 2H48B 3CWJA 1Y0HA 1RT2B 3BQ1A 3M05A 3T5JA 1LQ9A 3BM7A 3L73J 3QT7A 2R2SA 2FHJA 3DOKB 1M7LA 3KG1A 4PXDA 1WC3A 2AZ3A 3IAM9 4PQFA 3NWRA 3AQPA 4DL0C 4TLFA 2VKZG 3IMQJ 3RL0g 2XHWA 1U1LA 3L72D 5M2RA 4R8UB 4ANDA 1JLQB 2XKMA 3MHYA 1HL6A 2AT1B 1TQLA 3V4IA 2BM1A 1NKEA 3NS5A 5E2QA 2I8EA 3HHLC 2FYNB 1C4CA 1G2CA 4OYAA 1C1BA 1NK4A 1V9OA 3MM5A 4LSLA 2FLLA 4KB7A 5K20B 2IDEA 1HI0P 2HKEA 4DSLA 3CJ2A 2NQPA 4RW9B 1FRXA 3CCLS 2A06D 2PI5A 1VQMP 4H0LD 3KLVA 4ED0A 1VQ5P 3SWFA 2HLUA 5DQHA 3AEEC 1X4HA 2KZJA 2J6UA 1N5SA 1HKAA 3FC9A 1M1JB 1SJQA 5KLVG 2WMMA 1KN7A 1BWEA 3AY0A 1WJ9A 1QSSA 1GTWA 1NTMJ 3DLBA 3S1KA 2MQ8A 3MEEA 4F2RA 1C0UB 2W6JH 2CPSA 1BMQB 3QT8A 3OA7A 3S9OA 2XO6A 2ZBQA 2B9EA 4KHMA 3H32B 5D4NA 3VGTA 1IXKA 4RKUC 1HTLC 2I1KA 3CWBD 2FYZA 4BS2A 2RHSB 1VBXA 2CG4A 2ZJPQ 2BJ8A 3C14A 5APTA 5KFQA 3CI9A 3OTBA 1UTAA 1EETA 1JLGA 2DIUA 2DNMA 2EFOA 5HMYA 1DQAA 3SBMA 2HAFA 1JY3P 1OMSA 3T5KA 3M2RA 2A3JA 3MF5A 3UCUP 4LFCF 2L9WA 2RMLA 3LIEA 1S5ZA 3AT1B 4O3SA 3K7RA 3WUUA 4ZKUA 1T05A 4DF4A 2HWIA 3P45B 4ZP7A 4LF9F 3GONA 2BQ3A 1YYCA 2OQQA 2IM0A 3FMBA 1KQLA 4PCQA 2L9DA 4PYAA 4OI3A 2EK1A 2WPVB 2F40A 2N82B 2E44A 3CJSA 2IYOA 4ANCA 2DH9A 1YQ3C 4CO4A 1NVOA 1USEA 3CLQA 1RHKB 3I96A 2P9CA 5KFSA 2FLOA 3BH6B 4CCHA 4OI1A 1FCAA 1FJGF 3L74G 4C48A 3FQKA 1H2VZ 5B09A 2QE7H 1X22A 1WC4A 2KXNB 1RTDA 1XC9A 5I3PA 3L95X 3SZ2A 3O8WA 2F1FA 3RK2D 2Z4PA 3HHDA 2KM8C 2LQJA 1AJYA 3W9JA 1WUUA 3JSVC 2DNQA 2IIHA 2D74B 2V9WA 2N3LA 1TU3F 4ATNA 5L1IA 1RHUB 3V6KA 1KLMA 4C2MA 1IZNB 1SQPK 2RILA 5EWEA 1S1UB 1OFCX 1OPZA 3ETMA 3OUYA 1XNQJ 4OZ1A 1YLXA 3MECB 4PQUB 5KFFA 1EAYC 2HR3A 1HBMB 1WDTA 3CJ8A 1CPZA 4F4AA 1N32F 3L37A 1KQSO 2KVQE 4MK7A 3SMZA 4QR2A 4BLGA 4GO5X 4JI0F 1T7PA 5A8KA 2FYUG 2H9ZA 1DARA 2XMVA 4Q2MA 1PIXA 5A8WA 4Z7YA 5H1SV 1NTKK 1W26A 2DNPA 2JFDA 3M8SA 1HBNA 4IUFA 1HBOA 3H5SA 3DNCA 2MTLA 3GIRA 5J2QB 4GIFA 3DOLB 1TK5A 2FHOB 4R4LA 1FOSF 2POKA 1HA1A 3D6TB 3MURP 2ZH6A 2DEIA 2E66A 2FY8A 1QE1B 4LF4F 3VALA 1UVLA 1FDAA 4PV1C 5IQ6A 3OHBA 3AE9C 5KJ7D 3FBCA 5AVTB 4ZK7M 4P52A 3I5BA 3BGFA 2OJ3A 4JYAJ 3MAQA 3MUTP 3OW2R 5KFYA 4GODA 2MKVA 2AF6A 1P84I 3AQOA 2J0WA 1SIZA 1TUVA 2KFYA 2I0XA 3T19A 4DV0F 4F0KA 2C0WA 2VUGA 3AE2C 1RSCA 1PG5B 1VQOP 2DNKA 4DSJA 4DOJA 1GU4A 2W01A 4ALZA 1LWXA 3ISND 5C7PA 2E76C 4NZ7A 3B6BA 3LTOA 4DF8A 4LFBF 2EWHA 1F3VA 2YMKA 1UZHA 2L9NA 3M6WA 1S1WA 4ETXA 2V8PA 1RF0C 2V68A 2QEXP 1BE3D 1HR0J 2ZRDA 4DR6J 3QRQA 2UV8G 2KU7A 4MMOA 3CJ0A 3OSPA 3IWLA 3FJ2A 3AE5C 2N4DA 2G2ZA 4YR2A 1RJJA 1NTKJ 1WG1A 2IFNA 2W8ZA 4C11B 1MO3A 1HBUB 1SFCA 2WT7B 2OI2A 4EWTA 3GIMA 4DFJA 2HQIA 2HFSA 1ZAVA 4P2XA 1SVDA 2C2OB 1UP1A 4LGDE 2OMOA 1A02J 3EDQB 4QR1A 2R44A 1Y4ZB 1YZ7A 5AW3B 3ICLA 2HFED 4IRDA 2D3OR 3ZXWA 4HJGH 2HFOA 1EDJA 1LOUA 1RWWB 3H1KJ 1QTMA 3TGUE 2GA7A 3VP9A 3MD3A 2XM3A 2AZ1A 4Y3CA 4CH0S 3Q2YA 2ZRBA 5D6GA 2DRAA 3KOAA 1Y3JA 2IM3A 2A6OA 3M7VA 1FRHA 2X1BA 1Q95G 1J5EJ 4L3NA 4YN3B 1FOSE 2RF2B 2ZZTA 4N3YB 2AJ1A 3B4SA 1VF5D 2KIKA 1WHYA 2QJ3A 1S5LX 2KB2A 2UVRA 2ZUAA 1VQNS 1XR7A 1NGMB 1KDNA 3X1LB 2CQHA 1BSNA 1Y9OA 4ITSA 1LT9B 5EDWA 3PHLA 3PY8A 1K0VA 2HQDA 1JNZB 3PXGa 1RAFB 3ULHA 4PUOA 1X9VA 3WUVA 4ZN1A 5FIIA 3KDNA 1E5WA 5BYRA 3H98A 4CLPA 2KT5A 5H9EK 2M2BA 1HWUA 2LDYA 4WP8A 3LP2A 2UUCF 1RTHB 1KFDA 4QU6A 1HHQA 5KG7A 3V6HA 1MU2A 2VPZB 2Z2MA 5B0AA 2WVBA 1X31C 4V19J 1HHSA 4EI2A 3AOBA 2ATLA 4KHPF 3UNYA 2EFQA 2CNOB 5FJ4A 3EZUA 3PDNA 4G1QB 1SQXD 4USTA 3GYGA 4TYAA 4CTAB 2FYNC 2UVUA 4HTJA 4EO6A 3RW7A 2PFXA 1U2RA 2G2OA 4QBUA 1TKTB 4M94A 3M6UA 2YXQB 5KAIE 5D8HB 3ITHB 1NU4A 1KZUB 2LA4A 4R0EA 2L91A 2JEFA 3FFIA 4FZVA 1GK6A 1XMOF 1XMSA 3ZTRA 1NCLA 1URQB 3KHRA 2DT9A 4KGMA 3ZZPA 4QCLA 2KZMA 4P6QA 1M1JC 4K5RA 3VVTA 2E5HA 1KTQA 4PPGA 5APSA 2W24A 4ZVHA 2YH0A 4DDFA 3KUEA 4OLOA 1KQGB 5ETVA 1VQ4S 1NB7A 2F5GA 1MUUA 1H7XA 1NTZD 2MDAA 5H9EJ 1FJ7A 5KTQA 5B0EA 4LRDA 1N86A 3V4MA 1UBCA 4MKYA 3UN3A 3KZIH 3QJPA 2KNCA 4DV6J 3UN5A 3OT9A 4MN4C 2FFDA 1N5VA 1TP7A 2HEKA 4TY9A 1AUDA 2RJZA 1QM9A 4GMKA 5D0RA 2GO8A 1EP4B 3ZNUA 4WFNQ 2JNJA 1WG4A 2OPPA 4ZKAA 1PIEA 2G4BA 2KP8A 2HHTA 3SQGB 3AB4B 1ZRTD 5CD4H 2GO9A 2CPYA 4ES1A 4GKKF 2KHCA 4J5OA 3W7BA 4LUBA 4RUAA 5CZVA 1UA1A 5KFDA 3GW6A 2XZDB 3HE4A 3POTB 5JVHQ 1KB9D 2AYEA 4USMA 3KKFA 5KG6A 3WHIA 1F0XA 3QPIA 1SQVK 2MKCA 1NAYA 4CLSA 1P9QC 1SQBD 4C0HA 1FF2A 4ZVRB 3OL9A 1KILA 3CJTA 1UWAA 4TNOA 1BY9A 1NOHA 3C15B 1S6PA 3AJDA 1CZQA 3HUSC 2V4RA 2VV5A 3MUDA 2HPUA 1JJCB 4ED7A 1T3OA 1OSDA 1J5OA 4LJMA 1PCAA 1YKWA 3Q8SB 3CX5D 2A06E 4YB7A 4MTPA 1PILA 2Y0SD 2OSRA 2B88A 1ZM3A 4ELTA 4B9SA 3H20A 1KS2A 3EDRB 1H0TA 4DPWA 1UVIA 1L0LG 3JTPA 2XI3A 5GTHH 2GIRA 3HE5B 1UA0A 4JI6F 4WP3A 5RUBA 5ETRA 5IT9U 1GMWD 3AAWB 5MLCV 1B0VA 1IKVA 3IC1A 2OARA 2VF3A 2Q43A 3J81j 1OVRA 5KLVE 4IL6E 2HYIB 3BO4A 5BVZA 4U7UK 1X4CA 2GUVA 3MEGA 2WWWA 4HKZH 1N54B 1S1TB 2E42A 1BGYG 2ZD1A 1WEZA 1PFIA 1JLFA 3LAKA 1R6YA 4U3FD 2VQFF 2UP1A 1S79A 2WONB 1U0HA 2YNIA 2PFDA 2QJYB 2QMUB 1FRJA 2JVRA 3B8EB 3AECC 1IBMF 3ZZUA 3KQGA 3MXHP 2IYGA 4WBFA 2WITA 3PX0A 2VFVA 3I5AA 5DLGA 5AW1B 4H4OA 4X4VA 1RT5B 2KK7A 3DN9A 1H8AA 4LFCJ 3OPKA 1LWEB 2JR8A 3QNWB 2X3GA 4X65F 3DLKA 4PSKA 1RGVA 4DXLA 3LOUA 4LF9J 3L75E 3T1HF 2Y9YA 2PFFB 4I2QB 1WTBA 2L3MA 3CO9A 4DEZA 3BRTB 3FGAD 2G13A 3HR8A 3A0BH 2HVDA 2OO4A 3A5TA 1KN6A 2KT2A 4PO1A 3A3OB 3Q2SC 4FS2A 1WKLA 2RN0A 4B3TF 2OYHA 4N5SA 1HNZJ 1FJGJ 2XEXA 2JLFA 4AQYF 3L74E 1L3KA 3LP1B 2I9SA 4ZP6A 5E3QA 3J80U 4PV1D 4RBUA 3NMRA 4A8SA 3NEKA 5IC4B 1N5YB 1WSVA 4G1PA 1WHVA 4IH5A 1QLNA 5IT4A 4QWAA 2WPRA 3OXLA 4L74A 3A0HH 2ZVIA 2W9AA 2DPJA 2ZKTA 2FY1A 2BABA 2Y0EA 3EMTA 1LW0B 4L6V3 2JWNA 1E6VB 4ED2A 1Q78A 4OYZA 3ZTOA 1LP1B 1N32J 2AWZA 1A0OB 2W4CA 5TJHA 3LUYA 2JEEA 4DUZF 1N4LA 2MKJA 4JI0J 5KFNA 1CS4A 3E2EA 1UVJA 2KFZA 2FYUE 5A0YA 4F3OA 2OYIB 3D6ZA 3RBXA 1QUVA 2PO4A 1VJWA 4B9LA 2HODA 2PA8D 4QZVB 3HMJG 3TZYA 2KSJA 3HP6A 1SL2A 5ETNA 1GZLA 4LREA 1PP9D 3CTRA 3BEGB 4AFFA 2HZVA 2XWXA 3CC2S 1FDMA 2OPRA 3ZO7A 8RUCA 2QA4G 1MROA 1MO5A 5DZ6A 3NLCA 1RE4C 3EUNA 1I94F 4AD6A 1ZP0C 1LT9C 1SQQK 4LF4J 4OHZA 4QIEA 2XB2D 1HYSB 4CRJA 1YWXA 1P84H 4MYUA 2QFJA 1KONA 3TZZA 1AVYA 3MMAB 2BASA 1IK7A 2W9CB 3QWOC 3GLJA 1X5SA 1GMJA 2HK3A 1DFDA 4KV8B 4JI2F 3MD1A 3K2YA 3WBZA 1SB6A 1ZM2A 3FEZA 3IR7B 3PACA 4DV0J 3GTYX 3U1LA 1EDKA 1MFTA 2D7SA 1RHZB 3TX0A 3MM9B 3QMQA 1PBAA 4HH2A 1P1TA 4Y28J 4RNMA 3CCVS 1BE3E 1F5CA 4IR9A 1FZFA 4MFBB 2OD4A 4C4WA 4LFBJ 2OIHA 1XIQA 5I4MA 2BE2A 1NO8A 2X1AA 4NLRA 2J7UA 1KFNA 1RWNB 1EB0A 4ZA1A 3HD7A 4W90B 1SJ3P 3NOGA 3CDWA 1KV4A 2YNGB 1S6QB 2F65A 4NCBA 2CK3H 1EZVI 2DY9A 4P7VA 4OHWA 2MQPA 2RU3A 3JSMB 1URQC 2CPEA 2HHHF 4M5KA 2R7XA 2ZC3A 2LXCB 3CF5Q 2FYXA 2BCCG 1V3RA 3MPVA 4Q44A 3GFHA 1FVQA 3JAMY 4K4VA 1S1VA 2A1BA 1ZM4A 4WFYA 1N48A 1WOSA 4U8YA 5B0BA 1AT1B 1RT6B 3ET6B 1IJEB 3DOMB 4UOGA 1VC6A 4DFMA 4IQXA 2Q3IA 3VAHA 3B5NB 4UOCA 3HPOA 4OHVA 4ZJQA 2V8HA 5DJBA 3CXHE 1VPCA 1SJFA 2ZRJA 1JNRB 1UEUA 3G6XA 4BHQA 2AEMA 3AE1C 3HM9A 3AXKA 4RW8B 2JFKA 1LWUA 4Y2MA 1HARA 4F2SA 3D3CJ 4N6JA 5C39A 4CDIA 2QFIA 4ECVA 1KFSA 4ES2A 1RHQB 1YJUA