2YKQA

Structure of the human line-1 orf1p trimer
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
212
structure length
200
Chain Sequence
DQLEERVSAAEDEINEIKREGKFREKRIKRNEQSLQEIWDYVKRPNLRLIGVPESDVENGTKLENTLQDIIQENFPNLANVQIQEIQRTTPRHIIVRFTKVEMKEKMLRAAREKGRVTLKGKPIRLTVDLSAETLQARREWGPIFNILKEKNFQPRISYPAKLSFISEGEIKYFIDKQMLRDFVTTRPALKELLKEALNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords LINE-1 ORF1P
publication title Trimeric Structure and Flexibility of the L1Orf1P Protein in Human L1 Retrotransposition
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 200
sequence length 212
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02994 Transposase_22 L1 transposable element RBD-like domain
A PF17489 Tnp_22_trimer L1 transposable element trimerization domain
A PF17490 Tnp_22_dsRBD L1 transposable element dsRBD-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ykqA01
3.30.70.1820 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ykqA02
3.30.250.20 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 Rec A Protein; domain 2 2ykqA03
2YKOA 3BRTB 3CL3D 2LDYA 3EQ2A 3L4FA 3SOOA 2W7AA 2YKPA 2JRBA 2W6BA 3BRVB 2YKQA 1JOCA
chains in the Genus database with same CATH superfamily
3OFEA 2Y0SD 4WCEQ 5KTBA 4A8WA 5KFPA 2QM8A 3NOGA 4RBVA 3UCGA 3EZ5A 1S1XB 4M5DA 1MWYA 2HRYA 3C14B 5F3TA 2IM2A 2CZ4A 2ZH5A 1F9EB 3DRSA 3GJTB 3NCQA 4QWEA 4RU9A 4CQ1A 4PWDB 3KMQA 4O44A 3AA9A 2RIJA 1BE4A 4NLGA 2MQQA 2QMUB 1ZAXA 1IBLF 1EETA 5HLFA 3H1KE 3AEEC 1FS0E 1RT1A 3OLBA 2XLJA 4X62J 4LSNB 4UB8E 1FERA 3G6YA 1X22A 2H89C 2VJVA 1U7MA 3G6ES 1KQSO 3EVOA 1YJTA 3DGVA 5I42A 1SQVG 3NXSA 3V2RA 1OWXA 2YKAA 4OLPA 5A8WA 5B0CA 1T8ZA 1C0UB 2FJAB 1BGYG 5DM7Q 4ZP9A 2BQUA 4WU3A 2ZH1A 2JJ4D 1KVJA 3LALA 4I2QA 1KLMB 1UEUA 2HQCA 2JWDA 3IG1A 1YWXA 1PC5A 2PE8A 2E1PA 3SQGA 1ZZNA 3ENAA 3MDFA 3V6DB 1SP4A 4MFBB 1R0AA 2XMVA 2ZH3A 4LRAA 1K44A 3OD2A 1YJNP 3RBDA 1CLFA 3DKDA 4OMFG 2OI2A 1HJ0A 4A4JA 1A02J 1K8AQ 3Q1MA 4Q0BB 3Q2SC 4D6TJ 1NU1K 4A7PA 3R9LA 1T95A 4UOGA 3Q86A 1XIQA 1H73A 4NLQA 2P6TA 3TAMA 4IRKA 1FD8A 2DR8A 1VQKP 4H4MA 4RZRA 3SSRA 4IG0B 1Y3JA 3OTEA 1KQLA 4DV4F 4OZ1A 2G8YA 1RQVA 2AWZA 4DSEA 2DGWA 2MEWA 2X1GA 1LWFA 1U0HB 2W6AA 3D70A 2K9JB 1W7WA 1N48A 3CULA 1MUUA 2YBVA 1AYEA 2DXFA 1Y00A 3S8SA 3H1LE 2BABA 4TY8A 3M9BA 5K8NA 4OI2A 2WVBA 3SDEA 4QIWD 3KYQA 1M5VC 1IFJA 4OGQB 1VRUB 5KLVJ 2AV5A 2ZXXA 1U6BA 1U4BA 2EI5A 1M5PC 1VQLS 2COLA 5B0BA 5C25A 2GA7A 3BEGB 2FDNA 4WU2A 1JY3P 3UQSA 5LXRA 1T9VA 1FDBA 1Q7YT 1PP9J 4OGQC 4C48A 1M7LA 5CJ4A 3CCQP 5GADI 1LWCA 4KGVB 2GIQA 4ELTA 1UWBA 1VQOP 1JNRB 3BV8A 3BSNA 4DL5A 4C11A 2W2OP 2YWEA 2HW3A 1OW6A 2HHSA 4PPQA 2QLWA 3D9BA 3MFHA 2RNEA 4YEAA 2AJ1A 2KXFA 2RQMA 1N36F 2OTLS 2QLJB 1YTYA 1HNVA 2ZYAA 2ABYA 5GTIE 3K59A 1BE3D 1SQPG 5ETSA 1VQ7S 3DLEB 2WRMA 1XN9A 1BC6A 2JP3A 2PMZD 2AHOB 2CVIA 1CJTA 3PX0A 1KTQA 3W2WB 2H88C 4EOTA 4B3RF 4BRYB 2HVEA 4POAA 4OX6A 4KTQA 2V9KA 1SH0A 1LT9A 1HVVA 4EDFA 3MTUE 2Y1JA 3BYPA 1XP8A 4J9QA 4ZDNA 3CVKA 4A8XA 2YNHB 3HSJA 5CCMA 3KUEA 2DNKA 4AQRD 5KFTA 1Q8IA 1WOOA 1OO0B 3BGLA 3IN5A 4N5SA 2XHCA 1UBCA 2ZH7A 1KDNA 2CXEA 2FY1A 3OTCA 2J6TA 1FA0A 1SVFA 2J58A 3LIEA 1NHKL 1KHVA 1HBMA 2JEFA 3MCOA 4YFUA 1Y5IB 1KWMA 1VHIA 4DR2F 1AA1B 4DR4J 3MUTP 1W5CE 1CJKA 4HH0A 1HNZF 2QA4P 1FC2C 3CIZA 3OXLA 2XU6A 2QMWA 3RBEA 4L73A 3M6UA 3DI6B 2GAHC 1HL6A 5HMWA 5TJHA 1PGQA 3MMJA 2O01J 3AXMA 3TUZC 3FWNA 4DUZJ 2XBPA 1J1DC 2XYHB 2F3JA 3T5JA 3K5LA 1IC2A 5F8LA 3KYLA 1N7LA 2AQ4A 4DR3F 1HBOB 5E0OA 4U96A 3OJUA 4RW4B 1FD2A 2DRAA 4DQQA 5DDOC 2Z2ZA 2BQRA 2ZWOA 3DRRB 1LTGC 3HLUA 3KJVA 2ZRFA 4DV0J 2HFED 2K7KA 3M7VA 4LRDA 2M52A 1T9UA 1Q1KA 3EVMA 1HD0A 3OPKA 2MZJA 2Z2LA 3NP5A 2LXCB 2QO3A 3MEGB 2ZITA 3L74E 1OX3A 3RW7A 3W63A 2V4RA 1D0EA 1RF1A 1JXEA 1JJ2R 3ZTOA 4M3LA 1RB0A 2K1RB 3M8PA 2XNRA 4USKA 4DX8H 2XHWA 3AEDC 3KK2A 4FF2A 4H54A 4OX7A 3EE3A 4LRBA 3LP2A 3TA2A 3I82A 5LMUJ 3P8CD 4ATNA 1OPZA 4EBCA 1RLDA 2FLPA 3B5NA 4LSLA 2WB1D 1X4AA 4LIRA 2D69A 2GO9A 1Y0HA 2Q7CA 2ZR7A 2GO8A 1UJ4A 1AA0A 1JCDA 3C6TB 2MGZA 3CMQA 4JF7A 1NTZJ 2BX6A 2YPYA 3CMAP 2IC3A 2MPUA 5J2PB 4K0KF 4TU8A 4JBZA 2RQ4A 3CTRA 4QYZJ 5DJBA 1X9SA 2HVDA 3LW5C 2RSQA 2D1CA 5KFOA 1QE1B 2ROPA 4PUOB 2HYIB 3H1IG 4O3PA 2O1JA 5LMNJ 2W25A 3THVA 1K47A 1H98A 4KB7A 1ZXGA 1CJUA 3HE4A 2KZJA 1KYOH 3H5XA 3GHGB 4ZP7A 3MM9A 2HMIB 1UBEA 1GZLA 1DX7A 1HQEA 4CYUB 1FHTA 3CD6P 4U7JA 3PV8A 5M1BA 2EPIA 2QMXA 1HQUA 3L72E 2KK7A 1N5SA 1Y3KA 2BCCG 1QM9A 1NM2A 2CDRB 2ADBA 1KTMA 3GCXP 3MR6A 1N32J 2CKWA 4FNHA 1XNQJ 3GHGC 3PFEA 3IBFB 2PIIA 1HBNA 1G7CB 3QLHA 4IG3B 2MYFA 5KFMA 4PEOA 4NA1A 1MMLA 2ASLA 3GB0A 3A5TA 1VC0A 5K9FA 3Q8QB 3LWLA 2KXNB 3SFGA 4L6V3 4IRDA 4MKVA 3GG1A 3LAKA 4UOHA 1QTNB 3A8IA 2BACA 1T2KC 4F36A 3SOOA 4DN9A 2HWHA 4FBUA 3UCZP 2R7XA 2ITAA 3MGNA 1PIEA 4IL6E 1NLKL 2E1AA 2IBZE 4OI3A 3CC7P 1T3OA 5AVVB 5KFNA 3TGUG 2MXYA 1YYCA 2HIQA 3BCCJ 1UA0A 4CO4A 5D0GA 2Q6BA 4PPNA 4DU8A 3CW2C 1LK7A 1TL3A 3GJSB 2R5BA 1SQQG 3HUSB 2PO4A 1AXQA 3TP2A 3CJ8A 4F4ZA 3BO2A 4JI5J 3L72G 4G1QB 7FDRA 4IFVA 5D0HA 2UUCJ 4H0LD 3CC2P 2HNZA 3Q8PB 4CI0B 3HSZA 4IKAA 2ZFCA 4AUWA 3KHGA 3CUNA 2A6OA 5H2FH 4DN0A 5AT1B 3I55S 3ISZA 3QJJA 4QR2A 3CCMP 5DDQC 1XBWA 1SQGA 3DCAA 2IFXA 2BQ3A 2GIRA 4A47A 2IM0A 4FYYB 1L0LD 3WU2H 2BE7D 1QL1A 4ELVA 1JXVA 2IBZG 2JOQA 1M90Q 3RBZA 5AVWB 3LGNA 3G96A 1SL2A 3HTKB 4I6YA 1AV1A 1NTKD 4N8NA 3GIRA 5KTQA 4NRUA 1KQSR 2DKOB 2O1KA 3QT6A 3LWMA 2B4VA 3BQ0A 4B3MF 3CL3D 2KS1B 1WACA 2NPFA 2M8HA 3C16A 4GOEA 5HP1A 4LF4J 3EQ2A 2LU1A 5DQGA 3KLGA 4GC7A 2H5IB 3K5OA 1TU3F 1VIXA 3CX5H 2IAJB 1FCAA 1NMEB 2RT3A 1NB7A 1FVQA 7AT1B 1PC4A 1Q82Q 1KILC 3M2UB 3M1VB 1L0NE 1ZETA 4TLQA 4YUDA 3OXGA 4ZPDA 1SUQA 4RW7B 1YBAA 2FYUJ 4DZOA 2OP5A 2BJ9A 1VQNP 3UVJB 2RMZA 3SWYA 4URQU 5KFLA 4QJVA 4OYAA 2I1RA 1CC8A 3ZTSA 1UETA 1SFCB 3TJ8A 2UUAJ 3W8PA 4PKDB 1FJKA 4JV5J 2U2FA 3RUBL 2QLFB 1DLOB 4ZVOB 5KFYA 2OPPA 3A4TA 1YITS 1RHKB 2E5LJ 4GO7X 3HVAA 3NBPB 5JVHQ 2J0WA 4UOFA 1V9OA 3PRVA 4OX9J 3P6YC 1SC6A 3HHLB 1W2BR 2YNIA 1NEEA 5L8RC 1RBLA 4Y0FA 1GT8A 1KHWA 4PV1D 2NPSD 1OFCX 3OJAB 3FMBA 2NSBA 3T3FA 1WI8A 1BUXA 3DU5A 1FTRA 4LR8A 1JKHA 1Y47A 3MPVA 2FYXA 1MO4A 1UPPA 3LUYA 1S5LE 4YB5A 3HHLC 1L0NG 4ITSA 1UW9A 1RWNB 1N52B 5CJ0A 3D6YA 1ZW0A 2R8HA 4MIBA 4M5MA 3H1HD 3M30A 1YHQP 2VG5A 4UUXA 2MKHA 2RHQB 2KT2A 4J37A 4DPUA 2MMYA 1S7HA 2VF3A 4M95A 1C2PA 1SQXK 4DPOA 1TKTA 2XY6A 2FHMA 2I5JB 2UVUA 2LECA 3D5MA 1FX2A 3E2EA 3IFEA 1LTBC 1N2DC 2ZNZA 3BO3A 2C3YA 1ZM9A 5BU8B 2E75D 3UD3P 2VG7A 4ZN3A 3I6PA 3R8YA 1B70B 1KORA 3KKFA 3HP6A 1U09A 4YPCA 1TKXB 1NBEB 2DGVA 4X65F 4WK3A 4DCPB 2O1PA 3A3YB 2GUVA 3MAAB 2NPSA 4KV8A 2IMWP 4X4NA 4RL1A 3KMSA 2OELA 4G6VB 1RKIA 2JEIA 1I1GA 2VG6A 1XMBA 5J2NB 2B56A 3ILIA 3KJQB 3MEDB 2N1TD 1UVIA 1PFIA 2OO4A 2Q1LA 2CPYA 3PM9A 4IOCQ 4LFAJ 3AECC 5FLXU 4ECQA 2MLZA 2Y1LB 4X4UA 3W5XA 4J91A 3WDOA 2B8QA 3H25A 3WX4A 2GMHA 1NU1J 4FKYA 2VFTA 3MM5A 2WSCJ 1UP1A 2CQDA 3U1AA 3A1YG 2POHA 1ZTWA 4DV1J 3L37A 3VAHA 3HZEA 3L70J 4ZMDA 2LDIA 4LF5J 1B4SA 1WHVA 1B7YB 4WKYA 1JXLA 3FEYB 2LEAA 3D6MB 2AW0A 4DFJA 4LF6J 2V7QH 2WBMA 3EYZA 3TZYA 4GKKJ 1HBUB 3MGJA 1BCCJ 5CXTA 3JCUE 3S1KA 2CVEA 1G1XA 2HR3A 2HGLA 1BMQB 4F3QA 3ENVA 3FCHA 2ZH6A 2QRRA 3V4MA 3L3CA 2HVHA 2RD5C 4LF7J 2V2KA 5ETNA 5L1IA 2WVCA 2QG9B 3AOBA 2BV3A 1C1CA 2VBWA 1ACMB 3L71G 2JNJA 4ALZA 4DLEA 1N5QA 3KLHB 3THTA 4I6MC 4CH1A 4YQWA 2ILZA 5F8MA 3AE5C 3CCJS 1G2EA 2BUNA 5KFZA 3QATA 2QVAA 2KFZA 4WY4B 1TL1A 2B4OA 2ZXEB 4DV7F 4PG8A 4IFFA 1TUVA 1Z4UA 3GV8B 2FFDB 2W24A 1VQ6P 2J5AA 3P96A 1SJ3P 3OR2B 4WK1A 1D9FA 4WY4C 2FGOA 4ID5B 4LF8F 3FKBA 4OWFA 5C24A 2ZBQA 1OSCA 4YR2A 4ECZA 1Q8KA 1OY9A 3H20A 2VH7A 1ZS6A 4R4LA 1Y9OA 4DPTA 1XTCC 3RK3E 4I68A 3CWBE 3JTOA 2R32A 3ULHA 5EWEA 2DNOA 1NK7A 4WP9A 2IZ1A 1KQFB 4USUA 4ECWA 2OARA 3E01A 1B7FA 1VK3A 4CNYA 2QJPC 4IQMA 1XR5A 4DEZA 5T7LA 4CDIA 1SPBP 5FJ4A 2ACYA 3RL0D 4TNOA 2NXEA 1FU1A 1T7PA 5KT5A 4Y2CA 2ZRJA 1M5HA 1R43A 2K1AA 2J5UA 3QRQA 2RHSB 1IBKJ 5M2UA 2CADA 5SZTA 3WUVA 2XM3A 1MKMA 2B0GA 1X0PA 2FTRA 1CSJA 2KZZA 2FUG9 3D68A 1WELA 3M2RB 1RT7A 4W7ZA 4OYBA 2KVQE 1YSJA 2XMUA 4F4KA 3B82A 3AQPA 3I4HX 3WC0A 2VL1A 1ZH5A 1K8AT 1SC3B 4U7CA 2HHWA 3OVAA 1SQVD 2DNRA 2KDOA 4DQRA 4TYBA 2W9BB 4WB4A 4JV2A 3OT9A 2FLLA 3I5BA 1I51B 1YRUA 2JLFA 1W25A 2OE2A 4KHMA 1BE3J 1VQMS 2PEHA 1I94J 1PZQA 4KBIA 1X5SA 2VBYA 2Q3PA 4ZLLA 4C0OC 3SWFA 1EAYC 2DR6A 2GVZB 1TUGB 3M8QB 5EX0A 3MCSA 4ECYA 4PO1A 3T1HF 3H32B 3AOCA 4DR1J 2HGNA 4J9OA 3G3ZA 2G1DA 4EMDA 4J9KA 3R3TA 4CWBA 1W2EA 3K5MA 4BHQA 4NWBA 1KSPA 3CCVP 2H3EB 3AE4C 1PILA 1FJGF 3H1KD 1FXLA 3CXHH 5J2QA 1EZVI 1KILE 2OPSA 4I64A 1UFKA 1Y10A 4P75A 2HNDA 3SEOA 4FF4A 4P72A 4DOJA 4M5GA 5D77A 4ED8A 2FHOB 2Y0BB 3D1QA 4KHXA 3EGVA 3G9RA 1UTAA 3GYNA 2RJZA 2YWKA 1RAFB 4JYBA 1VQSA 1H2TZ 4BWNA 1EDLA 2UVRA 1UPMB 2XYPB 2CJQA 2AEFA 1MROA 4JV1A 4X66F 2KFNA 1KN7A 2WK4A 2PA8D 2C2RA 1KFSA 3Q2YA 3OLAA 5KT2A 1DRZA 3I31A 3GPAA 1CPZA 2WW4A 1Q79A 3TQEA 3H7HB 3KNGA 4Q8FA 1N73B 4EZ6A 1PBUA 3L73E 2HVZA 2OPRA 3KLIA 3DLBA 1U1KA 3BPDA 3IS9A 1S4XA 3CXCR 1H0TA 1SC1B 1F5BA 3EJMA 1NK4A 2I9SA 4NLXA 2HFUA 3H1JE 2D41A 3DOMB 3NOCA 2VQFJ 2OSRA 4EK2A 2RN0A 2V8HA 2JLGA 4RW6B 1XMOF 1M57D 4USIA 4B3SJ 1AFOA 1N73C 1HWKA 1VQ5P 4NA2A 2AJFE 2LA6A 1FEEA 1FWPA 1RT6B 4ZKPA 3B8EB 1HGZA 3KJNB 2KU7A 3MPUB 5ITHA 4V1Ak 2C9LY 2Z0GA 1U0SA 4N6JA 4WFYA 1QSLA 1RGVA 2YNGA 1KR4A 4P2XA 5AE3A 1VQOS 3A12A 5C2GA 3I32A 1RHQB 4NLRA 3Q5PA 3CE8A 4OZ0A 1CS4B 3W65A 4KE5A 3TJ9A 1OY6A 1FZBA 3DC2A 4DBQA 2ADCA 2Q79A 1IM4A 2DW3A 4EU0A 1PGZA 4HH2A 4PYAA 1X0TA 1M5SA 1DHMA 4C4WA 2R7RA 3L73G 5A8KA 1MMNA 1EP4A 5L9XA 1IFIA 3VZHA 4NE9C 3L9ZA 2RKIB 2E43A 2KZIA 2WT7A 5ETRA 5KFRA 3H1JG 1KS2A 5CYQA 4RNHA 3GWCA 1I6JA 2KXPB 5DG9A 1MFTA 3IWLA 4C8KA 2UVWA 2V67A 4DSJA 4PG6A 3EPIA 1VBZA 5ADZA 3AE2C 5EDWA 1TKZA 2R7OA 1G6BA 5IM0B 4DZ6A 3DOKB 3KLFA 3OR1B 2QL9B 1EJ7L 2HQDA 5CAAA 1IK9A 4NLUA 4PSVA 1FZEA 2RQKA 4YB7A 2R5DA 2DGSA 2OMLA 1KYOE 2LFVA 3TK1A 4A46A 4A8QA 4U8VA 3MPDA 5CYMB 2I1KA 1RTIB 2DJWA 3CJKB 1G19A 1P84I 1LP1A 5KFDA 3QH9A 1BQNB 4Z7CA 2QA4S 2YKPA 4YTPC 1F6TA 4JI2F 2LEBA 2QT7A 1N33J 3R1LA 4U6PA 4YXWH 1RE3C 2PD1A 2DK2A 5KAKA 3V6KA 4ED1A 1RWMB 4C8NA 2KG0A 4CNZA 3NCRA 1VBYA 1RBOB 3ILOA 3DXSX 1PIXA 1X9VA 3JSMB 5E41A 2F63A 4E2FB 4DL2A 2HURA 3QFHA 5E2QA 4RW8A 4QCLA 1IWGA 4CO5A 1CJVB 2C2NA 3HHKA 4FXWA 2OAUA 2IYOA 1JY2O 2OEMA 2DNNA 4EO8A 2VA2A 1HJBA 2XY7A 1N34J 4ILLA 3F0NA 4OYXA 3M9QA 2QTWA 2MLXA 2KH9A 3PRBA 3PTWA 1BQMA 1X4GA 3QNWB 4MKAA 1RCXB 3RRHA 2QEXS 3C6UA 4Q7AA 3HI9A 4HT7A 4OV1A 1LV5A 5APQA 2DT9A 3RRKA 1RT2B 1JMMA 4B9MA 3CD0A 1LTJB 2HPCA 3F41A 3TZZA 3IMQJ 4U8YA 3UR3C 3TAPA 5LT5A 5H2FE 2YO3A 4HKZH 4H44D 2BJ1A 2C9NY 1D9DA 1YIJP 4MK8A 1B3TA 3IFMA 1YG0A 1L0LJ 4C3MA 5J2MB 1ZM2A 1KRPA 1GMJA 1L3KA 2XMMA 1XMQF 3PRDA 3L74D 3CO0P 1LTJC 4QU7A 1FKPA 3HSGA 3D0HE 3WU2E 1S1WA 1YI2P 4ENOA 1NTKJ 4E98A 4EZ9A 4FS2A 3H1ID 4X4RA 2BEQD 3CMAS 3IR5B 2O01C 2J7WA 5A6WA 2HHHF 3QJPA 2EG2A 2RUGA 2FJWA 2LMIA 2Z2YB 2RVJA 3MMAB 1IBLJ 2R2UA 5E79H 4TY9A 4AUKA 5JVGQ 4W92B 1HIYA 3HPOA 1SQXJ 4DV2F 1CSBA 2B7BB 1FFSB 2WOMA 4DV3J 3PYFA 2BCCD 2JSXA 2YKMB 4B3OB 2YIUB 4NLPA 1RT3B 1SL1A 2LQBA 3PW7A 1K0VA 1MV8A 2DNMA 3M9OB 3CD6S 1E79H 3CX5E 3L75E 2XULA 1FFWB 4MH8A 2KKHA 3SXLA 3R5JB 1NU4A 5HQ8A 4DSLA 1M1JB 2YIUC 2B9XA 3QO9A 2GA1A 2B51A 1S0OA 2QZ8A 3N6MA 1KQGB 3QGIA 3I9V9 1YJUA 1YZ7A 4AE5A 2VQEJ 5I3UA 1S1UA 2MQMA 1RE4C 1YRTA 5D6GA 2OSQA 2UZAA 2J9DE 1JLGB 1SIZA 2R2SA 1VC5A 2KM8C 3BSOA 1M1JC 1T94A 1Q86T 3V4IA 1SCJB 3N01A 3KXDA 3TANA 4JI6F 2CWXA 2XSJA 1WMKA 1NNDA 2YMKA 2JR8A 2WTYA 2DGOA 3CC7S 2VFVA 3UDLA 3CDAA 5F9NA 1H2VZ 1JNZB 3L72D 2O3DA 1JLQB 2R7SA 4ICLA 2B9YA 1EXIA 2ROEA 5F3ZA 1XJWB 1R6YA 3H98A 3GV7B 1KOOA 3VTPC 2DGQA 2WSSH 4EO6A 3L75G 1QAJA 3LP0A 3MM6B 1OSDA 3CC2S 2ACMA 3H1HJ 2YH0A 4CT8A 1BSHA 3MCNA 4E0DA 3USSA 2WPSA 2IRYA 5KFSA 1JQGA 2YWHA 3CCMS 2BASA 2JFKA 1SQBE 4B9LA 4AFFA 1VISA 2O5DA 1S77D 3U59A 2E5JA 4I2PB 2EC2A 3HFKA 3ETOA 1Q82T 2IBZD 1RAOA 4GO5X 2LXUA 2UU9F 1QGKB 2G1HA 2WPQA 1UZDA 3Q8YA 3M9MB 1T03B 2UP1A 4FYXB 4PG5A 4K4VA 2B5JB 6AT1B 3BS9A 2YNFB 3AE7C 4ZLNA 3H42A 1URNA 4LQ3A 3T97A 2OEKA 3LPEA 4EBDA 5E3AA 4K4ZA 1S57A 1XERA 4I6AA 2BRKA 4X4QA 4CLYA 3UI3A 2CQ3A 3HF5A 4ZHRB 1WRGA 2EW9A 2JEEA 1OW8A 5CABA 3GFHA 4A8FA 1LTAC 1HNIB 1YDLA 1JB0J 2AXTH 1MN9A 4ZCIA 4WIQA 4DFMA 3NNHA 3TI0A 2KB7P 1SQBG 2OPQA 3TWZA 2AD9A 3TA0A 4PWDA 4TXSA 3UN3A 2CJKA 4UB6H 1RY3A 3N0VA 2J76E 5FD1A 1N0VC 3A0HH 1LWEB 2DR9A 3PRJA 4ETXA 2UXCF 5K8PA 4LSNA 3S01A 1JOCA 2UXDF 2Y9ZA 4OZLA 4B3RJ 1LOUA 5EHHA 3O6QB 3HCXA 1D1UA 3CT9A 1J5OB 1Q78A 1E6YB 1UBGA 1C0UA 4GT1A 1GNKA 1S5ZA 3KHHA 3NKYA 2FHJD 4M5IA 3WHIA 2DBBA 2Q1KA 3H8YA 4UB8H 1HWJA 3V6DA 1HNXF 4MFBA 1GX5A 1F5AA 1V5VA 1SJQA 1HW9A 4AYCA 2F40A 4D3HA 2CPXA 3BKTA 3DGPB 2HQFA 1NH4A 4QZVB 1VQ7P 1L0ND 4OGQD 4NLWA 4DR2J 4EGLA 1WTFA 3L09A 2OQQA 3LANA 3MMBB 4USJC 1PAEX 3PDNA 4KGKA 5AW2B 3TNUA 4JUZA 4MIWA 4KO0B 1Q4RA 4EUVA 2XO6A 2BE2B 2R9LA 1WC6A 3NGUA 2VFSA 1UW4A 2DIUA 5GAEI 2DR7A 4DF4A 2Q6CA 2D2CB 1UMJA 4FN5A 1IM6A 1NKCA 5KFBA 3K8WA 4ZOSA 3WQPA 4RNOA 1U2RA 4TLRA 3PEHA 2L48A 1EHWA 3AJ2A 3TYTA 4NPDA 4DR6F 2YWFA 2C2EA 2D2CC 4RNFA 3KK1A 1T3JA 2VBXA 1NSPA 2AGQA 4QBUA 5K20B 1DARA 1E6VB 1MU2A 4U67Q 3N79A 2DTJA 3HD2A 2DPJA 1S4FA 4Q5VA 1N7SB 5DDRC 2R3SA 4C98A 1GL2B 2M88A 4BXLA 4I4BA 2OFGX 2XYGB 3G8SA 4DJGA 1K9MT 3ZZUA 1DH3A 3HSDA 3MEKA 2K3IA 2HVIA 2YO2A 4NLDA 4KR0B 1N7SC 5GAHU 3Q89A 4ZP6A 5HO4A 1QUPA 2HHXA 3RK2B 2HK2A 2RU3A 5KFQA 3UFCX 3T5LA 4M94A 1C4CA 5KLVG 4KKOB 3PKYA 1URQB 1VK8A 2PA3A 1KYOI 1WEZA 4D3GA 3UNYA 2J9CA 1Q16B 1HHQA 3RK2C 3TW0A 2U1AA 5K5MA 2JZ5A 3U27A 1PP9G 4LVOP 2ZVOB 3JC22 4K0KJ 3BGUA 2CPEA 1RACB 3M0AA 3LAMA 2NXCA 2J0XA 5D15A 2W8LA 1C1BA 5IWAF 4ECXA 2MB0B 2MHNA 3PX6A 3U7JA 2A0FB 2JWNA 2CK3H 3TX8A 4M5DB 3PP5A 3Q8RB 5F8GA 1UIIA 1SQVJ 2WBRA 3FSXA 3E1RA 3QIDA 5KT3A 3GR1A 5AW9B 1VFJA 3DRSB 2CJBA 3Q5SA 2VBZA 1NK5A 2ILYA 4O44B 2YNHA 4X4OA 4LC1A 2Q66A 1EETB 5HLFB 4Z37A 2Z5HA 2CPIA 3R2PA 2MKKA 4DG1A 3FBFA 2ZT9C 1VI7A 5KFKA 5I42B 4ZVRB 4YDDB 1LFWA 2K8GA 4DSKA 4CTAA 3LGMA 2JH3A 4FF3A 3ENWA 4LFCJ 5MLCV 3NMDA 3AXKA 2DITA 3TA1A 1IKWB 4I2QB 2BA9A 1XC9A 1NK6A 2UUBJ 4FKXA 4L74A 1H8AA 4HTIA 3W7BA 3SQGB 1U47A 2Y8WA 2GQQA 1YJVA 3NTNA 3EVWA 1R0AB 3H1KJ 4RLEA 2Y1IA 3GILA 1VQ6S 3QJLA 1VRTA 2MKCA 3GR0A 3C15A 4UQGA 4DOZA 2OD6A 3CXHE 4PD4H 3R5GA 2Q5UA 5KFAA 3SSQA 2GCFA 1Z56A 2NS1B 1WF0A 2ZVNB 2BKOA 2DO4A 2P5VA 1QVFO 1AUSL 2R7QA 2E44A 3AEBC 1NDLA 3WMM0 4ZVQB 3TAMB 3QT7A 3OUYB 1IFNA 3DRRA 3GIMA 3ENQA 2K37A 4H4MB 1FKOA 5E3CA 2VJUA 3PNIA 5L1LA 1PJ7A 3MEGA 3QPIA 3G87A 1S9EA 3J81Y 2X3GA 3GFXA 2HHTA 4YP3A 2F1FA 5B66H 1LWFB 2YQ3A 3D3CJ 1B64A 1X5OA 4DX7A 3I56S 1TMJA 1K1QA 2K1RA 5CZVA 3U1CA 1L2PA 4DUTA 2MY7A 4XDDA 4BWJA 1SKWA 1GMUA 3IBCB 3CX5I 1QVGR 2OYHC 4CM0A 1IN0A 3TZXA 5B0AA 2AZ1A 2DGTA 4DCOB 3CDUA 2MQLA 4R0EA 4XA4A 4R0JA 2FQQB 2YXQB 4B3MJ 2MKYA 3RK3D 5CH7B 4PSAA 3CWBD 1U2CA 2QA2A 1VBKA 1OYEA 2AT1B 2DXDA 2B87B 2HLOA 3C6TA 3H1LJ 4F3MA 4OQFA 2ZUGA 3PR5B 1LWCB 4K4YA 1UWBB 2YQ0A 2VKZG 5J2PA 4C11B 4FDFA 5AE1A 3PW2A 4HI1A 2OEJA 4F04B 3UE2A 1VMBA 1I3OB 4PUOA 2DNHA 3A13A 1N86A 4ZPAA 3M6WA 3Q83A 5F8HA 1WOPA 1HNVB 8AT1B 5ETQA 3N9UC 4K7QA 3CDWA 1NTZG 2IA0A 3QQCD 3OTBA 1BY9A 2R7UA 2ZRMA 1CJTB 3LTOA 4ZCKA 3JSVC 2XMTA 3UW1A 4O3RA 1K1SA 1QSSA 2EEYA 2JFDA 3BQ2A 2K2PA 2C0WA 3FJ2A 2MQOA 2CPSA 3L95X 3QRPA 4I67A 3CNQP 3CGIA 5IT9U 4JI3J 3EM1A 5DG8A 4F02A 1LT9B 1R3NA 1EKRA 2DHAA 3TF5A 5B09A 1RAGB 3HKZD 1KFMA 1Q8BA 4IG3A 2F65A 2CQHA 1Q8LA 1HR0J 3PEJA 2W2MP 5JUMA 1N5YA 1CC7A 4R5PA 3UO0A 1X9MA 4I69A 3W61A 4I7FA 3IRXA 1RA7A 1OVRA 3S6EA 3H4BA 2ZM6F 4L75A 2H7HA 1IZNB 1JCCA 2ZD1A 2MQPA 5KLIC 4BC9A 1P6TA 4HB1A 1HBMB 1CULA 1FRIA 3WBZA 1CZQA 1VQ9P 1JJHA 3Q2TC 4HDGA 1CJKB 1A7GE 4FVCA 4IR9A 3JQMA 1WG5A 1Q95G 2W6JH 4OI4A 1O0PA 1KILD 1GXUA 4NOHA 5IXUA 4CLFA 1U8WA 1C0TB 1NPRA 5EUHA 5DQIA 3BCCG 4I1LA 4X4PA 3M9HA 4M5KA 2BKPA 3EUNA 4WXOA 1D3WA 2MKSA 4X65J 1MWQA 1PGJA 3PYEA 5BXIA 1PAUB 1G1IA 4W4MA 2KRRA 5D3GA 1FF2A 4NYPA 5A2QU 1VQ5S 1LNQA 2JEGA 1DURA 3KJVB 2VPYB 2I1JA 4QYZK 1RI7A 2W7OA 3VAKA 3I96A 2YX7A 1RABB 4ASWA 4JI0F 3BKFA 5T41A 3M6VA 1R8PA 1RF1B 4UZBA 3NRBA 1GU4A 4C46A 3TQ1A 5AVYB 2CQ1A 4A8OA 2CPBA 5CA5A 3W2VB 3M8PB 1FXRA 3MD1A 4JI1F 3L73D 1M1HA 4WBFA 4LLHA 2RRAA 1JTHB 4UY85 1TV6B 1TZ0A 2DGXA 4WYLA 1D7MA 3HHLD 4CT9A 4DV5F 3H1JD 1KILA 4OJGA 3DLGA 2XCPA 3BN7A 1H7WA 3UDEA 4ED7A 2VC1A 4I56A 3L74J 2IAJA 1WC1A 4GC6A 2G0CA 3B5NB 2B7CB 5IFMA 4NI2A 1NAYA 2KZMA 4CRJA 1AZSB 4LSLB 1UKUA 3MMCA 1H0HB 4ED3A 3KQGA 4QPXA 3P8MC 4B86A 5KFIA 4NYOA 5DJTB 2MGZB 3TAQA 4C7NB 3G6VA 4JB8B 4WWIA 1AFJA 2IC3B 4I7ZB 1R31A 4IH5A 3B5NC 2QFIA 2PEBA 1NB2A 3AE9C 1AVOA 1HYSA 4J5OA 2KYVA 1GXTA 3Q8SB 5E79E 2WVFA 3HVRA 4NX9A 1OZHA 1N54B 1RAHB 2FYUG 5CBOA 4X2BA 3ZTRA 1CJUB 4LMZA 1RT5A 1RBAA 5CD4H 4KHPF 4TU7A 5LJ5Y 3MM9B 1Q7LB 3HHLA 1RAEB 4G65A 2L3MA 2E9ZA 4RO0A 2N9YB 1S6UA 2V68A 5APUA 1IJDB 3CCZA 1HQUB 2V4HA 5HROA 1IVZA 4GRSA 1T05A 4K8RA 2F8EX 1LKZA 2VUGA 2IX7C 3GF7A 2XNDH 1HBNB 3R7BB 2LVWA 3QLHB 3HE5A 1JLEB 2XGPA 2JC0A 5F8JA 4I0WA 2K06A 3MTJA 3GU0A 3HKWA 3GTYX 4DR4F 4LF8J 3K0JA 2A3JA 4C3LA 4M63A 2CWKA 1OQ6A 1Q5VA 4KFBA 4C8YA 2JVOA 1KYOD 1OVVA 1FX4A 2VKRA 3AODA 2AZ3A 3L72J 3R4YA 2NYIA 1RAAB 2LQJA 3EGNA 3IO1A 4P2MA 2EFQA 3DLJA 4YDXA 4RR5A 1Y5NB 4WFXA 8ATCB 2EXUA 4DUZF 3A8KA 4ED5A 5JXSA 1SL0A 3N4WA 2AIRB 1ZV8A 1K05A 1J5EJ 1TL3B 4Q45A 1WD6A 2VDHA 4DWIA 4B08A 3RGIA 3MZWB 4PQAA 2ZREA 4RX6A 3MAAA 3RZAA 4IFVB 1NU1E 3QGPA 2AYMA 4Z1MH 1JJ4A 3FNNA 1QJHA 2EVZA 1NKBA 3GJQB 5DZ6A 4WP3A 1YIJS 1FAVA 1Z2ZA 5KJ7C 4A8MP 4W98A 3L4FA 3IA0A 2APOA 4CPGA 3HDSA 2I8EA 1JLFA 3BF4A 3BQ1A 4KC5A 1P84H 4P6QA 1KBRA 4O4GB 3NS5A 2POKA 5HMYA 2C3PA 3NMRA 3I5CA 4Y3CA 3BDPA 1YJ7A 3P45B 3B8HA 4MJKA 4CLZA 1NTMK 4KRWA 2V8PA 3ZZ0A 4WY4D 4HI2A 4DHVA 3K57A 2KYXA 4TT3H 2QIWA 1KB9I 1HW8A 3V4WA 1IBMF 2NPIA 5ETMA 3C16B 4XPEA 2ODWA 5AXNA 1TL5A 5HP1B 3OFGA 1NU1G 1GMWD 2JHEA 2OTKE 3GV5B 1FFGB 1BGYE 4K4TA 3KLGB 4QW9A 1S6PA 3ADAC 1PYSB 2AXTE 1XQIA 3L70G 4DQPA 2HZAA 4WBAA 4NMLA 3BPSP 1PJ5A 4HHJA 2ZFHA 1KMIZ 2JC1A 2FC9A 1ZRTE 2QSWA 4WFAQ 1V3ZA 4UB6E 3T1HJ 2KLUA 2NLWA 3A0HE 2WMMA 2V2VA 1SUQB 3Q0AA 1V3SA 1ZOYC 1MW7A 1YLXA 3JCUH 3BATA 2ATCB 1BCCG 1QUVA 3G71S 5CHXA 1DTQA 1FJGJ 3KLHA 3WX8A 3OL6A 3BGOP 4GMKA 4OHWA 3NXZA 2VU5A 3T1YF 1NPPA 3S1TA 4P10A 1FDMA 5H1SV 4XPCA 1U1RA 4PQYA 1QTMA 2OPPB 1URRA 2GV1A 3NNCA 3UIAA 1BGXT 3TNVA 3NAHA 3SV4A 1N32F 2HQ3A 3MR3A 2RMLA 1VQMP 1L0NJ 2LEPA 3LW5H 3CX5D 3L75D 2J9EA 1XNRF 1RTHB 2HSEB 2YNIB 4IQXA 1GMWA 4P74A 1CEZA 2AGOA 4AL7A 3OR2A 1RSCA 5J1EA 3IR9A 2UXBF 2GGPA 2G2ZA 2JJLA 1WOSA 2ZRHA 1ICEB 1JLCA 4FYVB 2VG5B 3WIUA 5IQQA 1WG4A 4M5HA 2XV5A 1TKTB 3R6GB 3ET6A 3GZ7A 4LGDE 2XMAA 4J90A 5KT6A 1RWOB 1CQNA 4Z7YA 4BWMA 2P1JA 4JI5F 1RP5A 1XMOJ 2QJYB 4ED4A 3VAFA 2HAFA 3D2WA 2G2YA 1HUCA 2XS5A 2FJEB 2RILA 2C28A 2ZR9A 2ZJSE 9RUBA 5L39A 1RYRA 2BEZF 3C8VA 4PV1B 5HVFA 2NPSB 2OJ3A 2QJYC 4PO8A 2DYAA 4OHZA 4C8ZA 2CQGA 1SQBD 1FRHA 5G0RB 1E5WA 5AW5B 4JI8F 1SQPE 2VG6B 5A0YA 1RWUA 3NGRA 5DS7A 1BXNA 2AYGA 1WF1A 2K3RA 1VDHA 1Q0NA 2J9DA 3G2XA 3L7UA 4ELUA 3DOLA 2KOGA 3R1HA 5HVGA 2NPSC 4DR7J 1XTGB 1KFNA 3V4QA 3GCWP 1KONA 2DRDA 2YX1A 1LQ9A 4H13B 1FJ7A 2KL8A 1NUEA 5AW4B 1SV5A 2N3OA 4M5NA 5D4PA 2W4PA 1GTWA 1PKUA 3MM5B 2XZWA 2FYNB 3M6XA 1VLOA 2QYCA 3QSYB 2MZQA 3K2YA 1LEOA 1PGOA 4O0IA 1L3UA 4H13C 3EFFK 1UCNA 2OHDA 2NRGA 4ZVUB 2Z8QA 2L9DA 3TX0A 5HVHA 2Y3YA 1WC5A 2FYNC 5AW6B 1IO4A 4AL6A 1BE3G 2GC8A 1D8ZA 1IKVA 1FNMA 4J9PA 4CM2A 4K4WA 1HWTC 2OESA 2KP8A 2CPHA 1Y8AA 2XCAA 2DR5A 4DPYA 2GVDA 3K7RA 4NPOA 5D0RA 3MAQA 3BASA 4ES3A 5LOQA 4ECTA 4JV5F 5CCHC 5F8IA 1N6QA 2DH7A 3BBBA 4H4KC 4GODA 2ZC4A 2G2OA 1T0TV 1C1CB 4OHYA 4KSEB 1VQ4P 2GHWA 3CEDA 4W80A 1G1JA 3AE1C 2DHGA 3AQOA 3IM8A 1JB0C 2LQ8A 1S3JA 3GSIA 4K5RA 1NJZA 1NSKL 2AYBA 1PV3A 4OYMA 4KAIA 1AUDA 1JLAB 4YHHF 2ZYDA 1BHNA 3IWXA 3MM8A 3V2NA 1REVB 4ZIVA 2DHSA 2Z4PA 4IR1A 1BWVA 2BANB 2QFJA 2DXEA 4HVZA 4L3NA 4ZVTB 1VRQC 2CJAA 4WE1A 4PD4E 2DEIA 2KVIA 2KO1A 1R0BG 3VZIA 5C24B 2ALYB 3LPYA 1YJ9P 3AEFC 4OL8A 2FZCB 4P2SA 2XWYA 5F41A 1A0OB 2KNCA 4K59A 4RW6A 5APYA 5KLVD 5L38A 1WUUA 4ZPTR 5ETLA 2AEMA 2XZTB 4ED0A 2H1YA 1IR2A 5AW8B 2E76D 2V63A 2CQPA 3KHUA 4NXNF 2DNYA 3S4RA 3R7SB 5B66E 1MWZA 3ITKA 4MKBA 2KSJA 4MTPA 4BS2A 4Y2MA 4HL9A 5EFWB 1Q81Q 1XMQJ 1X8DA 3CCTA 1U94A 4NZ6A 5T7LB 3AEAC 4RNMA 1RTDB 4DR5F 3M06A 3QMQA 2IA6A 1IKXA 4MKYA 2PFFB 3MP7B 1UAWA 3B78A 4DUYF 3GSDA 2V50A 5CYJA 1SJFA 4TKTA 3H2UB 4WJBA 2HHHJ 4P7VA 1FNXH 3H1IE 2AMCB 1PCAA 4C8OA 1J2JB 3CWBJ 4NXMJ 4PQFA 2QEXP 5KG7A 4DV2J 3PKMA 5KFEA 4B9NA 2WITA 5AVZB 3KHLA 3MF5A 2SXLA 2R2RA 4X64F 3WC2A 3R5BA 1X5TA 2N7CA 5BU5A 4IDKA 4IH6A 2IPOB 3PLNA 5DGAA 5HANA 1L5UA 2BCCE 2HHQA 2FLNA 2H9ZA 3DYAA 2DO0A 3DOKA 3F5HA 2E7XA 2ZYGA 1NZ8A 1SKSA 3IR7B 3HVWA 2QL7B 1Q5YA 3EDRB 5AVRB 5AVXB 1CBKA 4USWA 2CQ4A 2Z56B 3R6LB 5L1KA 2YH1A 2QX0A 3W68A 4KGZB 3EDQB 4LF6F 2V4JA 3MWBA 3AHPA 1KVKA 3KJFB 4GKKF 3N6NA 3A0BH 3HHEA 1B0PA 1G2CB 2AX1A 3H6PA 4HT5A 1TAUA 3MURP 2ZKUA 3PW5A 2IJNA 4BBYA 3RL0B 1VS3A 2CQCA 4DSFA 2YXRB 2LLZA 1UA1A 4Q43A 5CCGC 2AX0A 3MM7A 2ZBPA 4GKJF 4LF7F 2ASJA 2MQNA 1CG2A 2H4YB 4JI6J 3TGUE 1LT1A 3RL0C 1FWLA 1AT1B 3FEZA 2F4FA 2JO1A 1HQ2A 2OEPA 4DCJB 1SQQE 2R8GA 2OPSB 3CSKA 2PAJA 2RB7A 2I8DA 1AVYA 1H3DA 2LA4A 2HNDB 2CJ9A 3QIPA 3BBFA 2V9WA 1LW0A 4PCQA 2MDAA 2CQBA 3ZDMA 1RHJB 4C8MA 2JLEA 1WHWA 4Y28J 3LH2S 5K14A 1HWUA 1QLNA 1TL7A 3O2IA 4FZVA 2D7SA 2R7TA 1YTZI 4DPXA 1MROB 1R6VA 5HI7A 3OTOJ 5H9FK 5AXMA 5IZHA 2B88A 3UN5A 1HGVA 2W4DA 1D09B 2UU9J 2PT0A 1WC4A 3CXHD 5KFHA 2CZ9A 4YY3F 3SZ2A 5BR8J 4OVNF 1RT2A 2C2DA 2OPRB 3KLIB 4TWZA 4LF9F 3IS9B 2WONA 5KG0A 1VQ8P 1OIAA 2HK3A 1JY2N 3JTNA 2HG4A 2A45G 1FZCA 3IAS9 4B9TA 4EI2A 1JLBA 5C42A 2N4CA 2R4FA 3ABVC 3V81A 5A76A 3DN9A 5AW0B 2PC6A 3TUJC 1G3OA 2YVSA 5D4LA 3Q24A 3TVKA 3H90A 4CH0S 3HUSC 3JYTB 1MO3A 2YNGB 3J80Y 5APWA 1R0CB 1JX4A 2W8KA 4F4WA 1NTZD 3N5BA 4P73A 1EZVE 4YN3B 3FX0A 3MMAA 5D8HB 3D6HB 1VLYA 1Q86Q 3D66A 2IRUA 4ZN1A 4NRTA 4WF9Q 1BDCA 2FBWC 2D3UA 4QQBA 1L3VA 4B3OA 1EP4B 4UT4A 3TARA 1WTBA 5B0FA 3MUMP 2WT7B 4ZVEA 4ZVGA 1RE4A 5CYQB 1NJIT 3SCIE 1SQXG 3JSYA 2IFMA 5A6PA 1X4BA 3FC9A 3GFZA 1HNXJ 1M1JA 5GAGI 1IFMA 1TKZB 1WHYA 1KD1T 3KLFB 4O0NA 3GYXB 2H4WB 2QGFB 2RDIA 2NZCA 4U95A 1S10A 4RBUA 2OKQA 4RWWA 3T19A 3KDNA 2FYZA 1S7IA 1EZVG 4V19J 1N88A 4ZVHA 2NUUG 2N3LA 4B17A 3PCOB 2K88A 5FDLA 2NZ4A 4PPDA 2HBRB 1VQ9S 3PACA 3KHRA 4ZPVR 4C6AA 1LP1B 1KEKA 1TVRA 3GLJA 1FRLA 1S9GA 2IJFA 1YBKA 3EFGA 1FBMA 2M5AA 1NTMJ 3LP1A 4KT0C 3BB5A 3G4SP 2EFVA 4DR6J 2HFZA 1RT4A 1XK8A 1L0LK 1RHMB 1EQMA 1SFCC 5HBMA 5KFCA 1PO6A 1PGPA 1KV4A 1FZGA 1PL5A 2A2CA 2GAGC 3CIMA 2RRNA 1FEHA 3ZTQA 3AB2B 1NTKK 4RW8B 4MN4C 3G6XA 4F0KA 4CLPA 4PO9A 3OVSA 2OGUA 2WSFH 4OFZA 4ZITA 2FGCA 3ZNJ1 3FDSA 3H1HG 1T03A 3QWUA 2W9CA 1RE1B 4ZJQA 1TFYA 4UQTA 3QT5A 2GQ2A 1MN7A 7FD1A 5GTHH 2HYNA 1X31C 2JX2A 2M3EA 1BQMB 2HS0A 1QSYA 1DD4A 2OIHA 5D4OA 2N82B 4F2RA 5E3PA 2CQ0A 2XZDB 1GH8A 4ZK7M 3VAJA 2HPCB 5AW1B 1RLCL 4TVAB 1HFEL 4J9RA 4Y00A 3SCJE 5A8RA 2Z57B 3HRNA 3M8ZA 2VIHA 2IM1A 2BJ3A 3MPYA 3FGAD 1RJJA 3GLMA 1P84E 2HLUA 3BREA 2UV8G 1FKPB 3I0SA 5L9NA 2EWHA 5IWAJ 2VOPA 1WC0A 3HFVA 1F9HA 3CPWO 2BMBA 4CH7A 2WCXA 2D3OR 1VPCA 3C2PA 3VGSA 8RUCA 2E1CA 2HLTA 3O6QA 1GK8A 2I6WA 1LFPA 4TQRA 4M1KA 3NCPA 1X0FA 3D67A 1E6YA 1JY3O 1IQZA 3II6A 2ZH9A 1RZMA 2C1EB 2HKEA 2LP4A 2WB4A 1HMVB 1O8BA 3L71E 3N7NA 4YXDC 2EFOA 2EBGA 4PD4I 2P10A 4HTJA 3VTIA 3V6JA 1FZFA 2IVYA 3H2LA 1VGYA 2BJEA 1NSQA 4NCGA 4BC7A 2KG1A 4ZKUA 1N7SD 4EBEA 4KJIA 2Z58B 2PSZA 3R2CJ 1K0TA 4ZPCA 2QG4A 1D8YA 3OW2O 1B99A 3MOJB 3MMBA 1QAIA 2WZ1A 3VF0B 1LXJA 2VODA 5IT0A 3T5HA 5C39A 2WPVB 3MD0A 4QR1A 5ETKA 3QO9B 3MHVA 1K9MQ 3W1YC 5AW3B 5I3UB 1S1UB 2E7WA 1Q2NA 2W1BA 1DD3A 1NZAA 3IRWP 2N1TA 3M8SA 4JI7F 1NDPA 2JVRA 3QGHA 3FEXB 5IOLA 3JS9A 1GDTA 3L75J 4FNIA 4OYWA 3V4IB 4R25A 4C2MA 2VC0A 2XSJB 1NK0A 3CLQA 2XC9A 2E74B 3FFIA 2M8DB 3KK3A 1TQLA 4QWAA 1RTJB 4QIVA 4ICLB 2UVVA 1Y4ZB 5F0WA 2IY5B 2W90A 4PXBA 4YMEA 1F0XA 2YWGA 2XEXA 2XLIA 3LP0B 4N56A 1VJWA 4DS5A 5IQ6A 2E74C 4F26A 1AJYA 3PJSK 2ZT9D 4OHXA 2X1FA 2CPZA 2YTCA 4I1TA 3RTVA 2LXIA 2J59M 1BDDA 1SI9A 3UN2A 5B0GA 3POTA 3B71A 1S6OA 3D6TB 1R27B 3I87A 1EZZB 3AD9C 1M0SA 4N3YB 5E3RA 2XB2D 2FFDC 1CI6A 2XSFA 1KN6A 5EGYA 1FESA 3K5PA 1HPZA 3CF5Q 2HPUA 4QMAA 2J8AA 1SJRA 2HEKA 3QYYA 3U1MA 2EBEA 3Q23A 1KC8T 3D1HA 3T97B 4KYZA 4RKUJ 3AB4B 4OYOA 1X4FA 4GVBB 3PJXA 3OHBA 1NKEA 1NU1D 2V8DA 2N9BA 3H5SA 2EFNA 4JQ0D 3KTQA 4KHRA 2I0XA 3MUVP 1SQBJ 5HQMA 2J7KA 4XTTA 2W2QP 2ZRAA 2B6AA 1S1TA 2N4DA 1RF0A 5CQGA 4CLUA 2G0JA 1HKAA 3D28A 3I56P 4C0BA 2ZROA 5THWA 1N8RQ 2FZGB 2A45I 2UUWA 3DFEA 4Y2AA 1MFZA 1MLAA 1RWKB 3RJMB 3G82A 1O51A 3CCSP 1H2UX 3BM7A 1U7JA 2PMWA 3GYGA 2OPQB 4C7RA 3KLEB 1BCCD 2DNGA 1UVMA 1YZ6A 1YJWP 3DRPA 3M9NB 3KG1A 2BR0A 1UL3A 4LSZB 1REGX 4DV3F 2OYIA 1S6QA 3P7KA 3FZ2A 3KUHA 3EGZA 3EZOA 3B4MA 3F73A 4N41A 4K3AA 1KP6A 2HRTA 3AT1B 1AA3A 2DISA 1LW2B 1IKWA 3HD1A 3VMZA 4MYTA 4WVZA 1BGYD 2RU9A 1HNWF 3MECA 5DGBA 2O01H 2G9OA 3BR8A 4RUHA 1AW0A 4JBCA 5D0EA 2CIMA 3VAIA 2ZM6J 3CI9A 1FK9A 2AJQA 4CLWA 1ZRTD 3P8BB 5J1NA 2ZOGA 4BCAA 2ZZNA 2VQEF 1S9KE 3B6BA 2HHUA 3M32B 2NXNA 4GVLA 1IBCB 1RAJA 3MR7A 5E33A 3AAWB 1V5IB 3GG0A 5TISH 4DMZA 3TNUB 4WFBQ 4NEYA 2MSSA 4J9MA 3MOZA 1RTZA 4DL0C 1KB9H 2Y8YA 3H1KG 2AJ0A 3FCWA 5BYQA 3OUYA 1NK8A 2KRBA 3NMAA 3LIDA 5IV3A 2DB1A 3QBCA 4UOCA 1HI8A 2BBEA 2R3VA 2V6AA 1O6XA 4OI0A 1CQMA 1S1VB 2WSFC 3VMXA 2V7QJ 5KT7A 2FZKB 3P32A 3HVTA 1R8BA 4OIXA 2OYHA 1IR1A 2ROGA 3K5NA 2H5EA 2M9KA 1W2BO 4IFDK 1UVLA 4Q8EA 1FWKA 2KJWA 1L4AB 5ETOA 4N77A 3KK1B 1OYDA 3DLKA 2ZC3A 4IFYA 2EKYA 1TL4A 2DVIA 1MU2B 4JI0J 3AH6A 3L7PA 4V19X 3JAMY 3MZIA 2J6UA 1KTVA 2XQCA 1L4AC 1SQVK 1HARA 4B9VA 2A10A 2BXJA 2XWXA 2PFXA 5C7PA 4JI1J 2ZRPA 4XO0A 3CCRP 4LJMA 4AXIA 2L08A 4DZDA 4X4TA 3OSNA 2IJRA 1T9WA 1YKWA 1FJCA 2DD8S 4HJGH 1OJ4A 2ZHAA 2YKNA 4DV5J 1ELOA 5DM6Q 2B87A 2E9RX 1X4CA 3JQKA 4DL3A 3P5BP 3J7ZT 1RAIB 2CAJA 2YQ1A 1RQ0A 3RB0A 1OW7A 2Y0DA 5KG3A 4NLTA 2ZOMA 1S49A 3OVBA 2XS2A 1EDIA 2AYEA 3H1LG 4ANCA 4F0HA 4H4OA 1VYAA 4ZCLA 3ZZTA 2M5YA 1T3UA 3MCMA 2YKQA 2RDJA 2FVQA 4DI6A 4ID8A 4EEYA 1F3FA 1IFDA 3PY8A 1SQPD 2B9EA 2D3ZA 2WWWA 5I4MA 4Q44A 1C1BB 1KFDA 4ER8A 4JYAF 5H9FJ 1S4EA 3IN6A 3M05A 2W6BA 2F8MA 2W2PP 3Q8VA 2DCUB 4KHPJ 1FDOA 2B8PA 3A3PB 2E5TA 1NOHA 3FBEA 2C2ZB 4AT1B 4GIFA 4CO3A 4ZVPB 2SPZA 1OWAA 1CVJA 1J2VA 3BYRA 1HHTP 3OL9A 1FRMA 4DG1B 1IKYA 5GAEU 4YB1P 1XWLA 4X84A 3DXBA 1WI6A 1BQXA 1EDKA 3M8WA 1EDJA 1VQ4S 5M2PA 4CTAB 3UWTA 1FRJA 1LWXA 1RWWB 3A0BE 5CCLA 3K5BA 1WF2A 4P7TA 5AVUB 1QD1A 3J7YI 1ZAWA 1UVNA 1J1DB 4FF1A 1DY3A 4JI4F 2HHPA 3MEEA 1HI1A 2ZVIA 3MXHP 1Q81T 3EGWB 4PG7A 4DX5A 1PBAA 3SMZA 2AU0A 3D1OA 2KHCA 1BD6A 5B5EH 2KI2A 3EX7B 1NHVA 2P2CB 1VRTB 3PIPQ 2ZOFA 4N8OA 2HNYA 3C15B 2EK1A 1YQ3C 3SFDC 4ZMMA 1C0TA 2OH2A 1OMSA 3LGHA 1OVUA 3DRYA 1RK8A 4A48A 1USDA 2VD3A 3B5ND 4RW9A 1YJ9S 4LR7A 5KT4A 3ITHA 5GMKa 5AJ3J 1SQPK 1F60B 3ZZRA 3BRVB 4HACA 2NYHA 3BN4A 4QWDA 1FKOB 2CJXB 3D7SB 4JV0A 2LDYA 4LFBF 1Y11A 4YB6A 3NG8A 2G0IA 4XK8C 2QJ3A 1TK8A 1S9EB 2YKOA 2ZWPA 2ZKTA 3NL0A 2P9EA 2JEJA 4K35A 3J7Z5 1NPKA 3DM2A 1D9AA 3CPWR 1RQUA 2B9WA 3W2VA 2DHHA 4DSIA 3PIOQ 3RBXA 1H89A 2HODA 2FXOA 1JTHA 1TV6A 3QZ8A 4PD4D 1DIPA 2RF2A 4MT1A 2ZRGA 1FXDA 1S12A 4B02A 3M0DC 2WVRA 3NWRA 1X4DA 3JSRA 3TO8A 2GM4A 2AJ4A 5KFGA 1M1KT 4WXWA 1UFWA 2F4VJ 1WC3A 1NWQA 3SWKA 4FPRA 3PW4A 3RR8A 3E51A 2DNLA 1K73Q 1DQ9A 1AZSA 1NSAA 2GHPA 1IBMJ 3SYZA 5LSRA 1ZA1B 4J9UE 3ZZZA 4U3FE 4CCHA 3BSAA 3PVXA 3BGRA 1GAOA 4CZCA 3PX4A 3OW2R 2IDLA 1OIPA 2LQ9A 2PGCA 4C7NA 4OJ3A 2BJDA 3DMJB 4EIJA 3HX9A 2OTJS 4K2XA 3L74G 2PFDA 4ILRA 2V8GA 3TDKA 2CFXA 1HF9A 1RU1A 2W7AA 5EN1A 3SSSA 3ILLA 3I0RA 4F8RA 1FO1A 4MK9A 4GOFA 2CYYA 5HN0A 2L5GB 1NKZB 2GS8A 4DQIA 2RE1A 1N5TA 2WPRA 5KJ7D 1ZLLA 4G1PA 3NWGA 4AQYF 2ZBRA 3G8QA 3T1YJ 2MKJA 4NL5A 2F7VA 4YOEA 1X9WA 2X3DA 2HG5D 2C3MA 1HBWA 4PQUA 1GFWB 2XZRA 4XE5B 2CNNB 3RK3B 3M8RA 1U1MA 4U3FG 1O5JA 1XNRJ 1S2EA 4F2SA 4LFCF 3HD7B 4PJ0H 1JLEA 2Q43A 1N5YB 2UUBF 1OXZA 4R5PB 3C19A 2UXBJ 4I7FB 4LBPA 3PG9A 4QWBA 3IRXB 3CWJA 3RK3C 1SLQA 1VQYA 1HTLC 1BSNA 1SBRA 2Q6QA 3HD7C 4QWCA 2ZE2A 1DFDA 2ZD1B 4WIIA 5K8MA 1CULB 3G71P 3MI7X 4ZA1A 3CO9A 2GNKA 1GU5A 1H88A 3C46A 3VR1A 3BGFA 3W9IA 4RJTA 2HS4A 3PO4A 3NAIA 3TGUD 3PZPA 5JMNA 4OZNA 2RRBA 3CC4P 2Q9IA 1G4CA 5KJ7A 2R44A 3GFYA 4K4SA 4C8LA 4HH1A 3AOAA 4KPCA 1WEYA 1SQQD 4C3KA 3ZXWA 2E42A 1VCTA 3TYYA 4ANEA 1X4HA 1S48A 2P9GA 1Q53A 2HFSA 2ZZMA 4LT6A 2O66A 4XAKA 1OPIA 1ZM4A 4NLVA 1VQ8S 3EXYA 4PPZA 2VA3A 2ODNA 2MZTA 4DV4J 3LO3A 1DEEG 2L9NA 2ZHBA 1BLUA 5KFWA 5D3GB 3IWNC 5KFVA 4QU6A 2CNLB 2WSCH 4O4GA 2QL5B 5H9EK 5B08A 3M2VA 1EB0A 4JI8J 2JKVA 1RA6A 3AE3C 3T9ZA 1YBUA 2IMOA 1LWUA 3MUDC 5GTHE 3HULA 3FUYA 2ZJRQ 3VGUA 3L36A 1IJEB 3FVYA 3WUTA 2WSEJ 3FQLA 4MYUA 1QAYA 3WUUA 3Q5RA 2Z5IA 2AGPA 1SJ4P 1H7XA 2XKMA 3G86A 2EC0A 1KILB 4AXJA 3DLGB 3I5AA 1NK9A 1U48A 1NH7A 1F2HA 4R8UA 4Y28C 1SQXD 2MJZA 2IYPA 4LBIA 3HO1A 1NYHA 2PMHA 2M0BA 3O8ZA 4NI2B 2OYOA 3B4SA 2CUYA 3MMCB 2KLVA 4NYZA 5KAIH 2MTLA 1NCLA 4LR9A 1GTHA 1N36J 1ZR4A 1SQQK 1VJQA 3DHXA 2C22A 1S1XA 1EZVD 4N78D 2V5HG 3C14A 3SBMA 3H59A 2K7JA 3LA0A 5HMXA 5EWGA 1DBDA 2OFOA 1HYSB 1V3RA 2BW2A 2IM3A 5HATA 2ATLA 3OFFA 3CMEP 1GK6A 3JSBA 3G8TA 2MJUA 1QDUB 3X1LB 3HXMA 3J81j 4JI3F 1UJ6A 1R8CA 1RT5B 3V6IA 2FC8A 1WORA 1VF5B 3CJRA 1GEHA 1HA1A 1T3NA 1RTHA 4D6TE 5IS2A 2H43A 3HFZB 1HR0F 2KN4A 5AE2A 1SB6A 3HZGA 5E3QA 1KLMA 3T6BA 4KGMA 3T5KA 1L3TA 5HROB 1T05B 2QN6B 3FRYA 3OJSA 2V4QA 2FHKA 1X4EA 1MZ9A 1LJ2A 3G4SS 2FXMA 2E9TA 2O67A 4YHHJ 1VF5C 5ETPA 2HWIA 1EXJA 3R27A 3N6LA 5BVZA 3CD5A 3HE5B 2LCWA 3DLHA 3V5RA 2XI2A 2Z2MA 3VP8A 3ELHA 1YTZT 4RPFA 4B3TF 4Q0BA 1JY2P 1RHRB 4KFBB 1HNZJ 4H13D 1GTEA 3TOQA 2L41A 4DF8A 3CJ0A 1YK9A 2GJIA 4CO1A 1FT8A 2WHOA 4FYDA 4J9VA 3J81U 2C2KB 4OHVA 1LTIC 4IO1A 1F9FA 3D0IE 5JJBA 3IM9A 4IG0A 5KLVE 1RYSA 4DR3J 4D6TG 3V2UC 1ZZFA 1A9NB 1GW3A 4NXNJ 3PYDA 2HAIA 1P9YA 5CCHD 1DTTB 1U0HA 1FRKA 3LQVA 2FHJA 2K9JA 2GZOA 1TKDA 5U47A 3IGVA 1MSWD 2W7PA 1BWEA 1PP9E 3I4PA 3IAM9 5G0RA 4DR5J 2MJNA 2NUHA 2B89A 1S76D 4DUYJ 3NFQA 1IR0A 1TP7A 1YQHA 2E7VA 4WKRA 1JLFB 1VRUA 3W60A 4ERDA 1WJ9A 1ZYQA 3NGTA 3D6FB 2KFYA 1M5KC 2R3CA 5DDPC 4HR2A 5CD4A 3X3UA 3DLLQ 3F44A 4PR0A 1ZTTA 3RAMA 1TAQA 1M5OC 3GIKA 5B0EA 1EKSA 3ISNC 4K4XA 4X64J 5DQHA 3JQJA 1SH3A 1GL2C 1L0NK 1VQPS 2ZRCA 1K04A 1ZN5A 4IOAQ 4F4YA 2E1RA 2XMKA 2JRBA 2QSIA 2DY1A 2HFNA 2MZSA 1TELA 3BH7B 1OMIA 5F9LA 5CCHA 2VRSA 4RBTA 4L3KA 3Q3DA 1S6PB 4H4KA 5I3PA 1P84D 1FTCA 2FJDB 2UV8A 2L91A 3DLEA 1URQC 5DO2A 3MAHA 2BM1A 1XMSA 4GKJJ 3W2WA 4ETZA 4KH0B 1H38A 1JNMA 2PI4A 5D78A 4BRYA 4DU7A 3OHAA 2AKWB 1SC4B 1PSDA 5E7OB 2NCKL 1WDDA 1DTQB 1JUNA 1BGYJ 1S99A 2R7WA 1MO6A 2XDJA 4OYZA 3L71D 3W67A 3FMWA 3UDCA 3DDNA 2RKLA 3CDEA 3VN0A 3K89A 2GQCA 1KKHA 2M7SA 1NJYA 1RT1B 1IJFB 2RUSA 1AQTA 3E7KA 2P67A 4IUFA 1JLAA 1IK7A 3PXGa 5A8WB 2H8PD 1REVA 3P3DA 3N5FA 3LOUA 5HMZA 4LVNP 2BANA 2YXLA 3RYLA 4FPIA 2HBZB 3RRGA 3W8GA 3IG1B 5J1EB 3SI8A 3V5BA 3D71A 2GGPB 1FNOA 5TISE 1MG7A 2W01A 2Y1RI 1N8RT 1TR0A 4OYIA 4P2FA 1U25A 5G4DA 1KB9E 5C2CA 4ECRA 3CJSA 3DI6A 3HMJG 2XO7A 4YY3J 1JLCB 4LF1A 2QJPB 2JL9A 4LF9J 2WSCC 1F5CA 2NXJA 1J5EF 4HHUA 3ET6B 5B0DA 1NO8A 2RS8A 2ALZA 1HBOA 1OQ3A 5CCGD 4RW4A 4NA3A 3HHDA 2FLOA 3LF0A 2NZ2A 5BYSA 2G13A 1WHXA 4RU2A 2XY5A 3FZBA 3KG0A 1RU2A 1RTDA 3KZIH 2ZDPA 2LU2A 2ZUAA 4OZ5A 3VYIA 4FYWB 4DQSA 3K58A 3PR4A 4WZQA 4K50A 2V69A 3ZZPA 4UZCA 3OA7A 2KHDA 1ITPA 3IAOA 3HJVA 4QPTA 2MQ8A 3R5AA 4TY8B 2BOAA 1NTZE 3P5TL 2DPIA 5A0YB 3TEHB 3SDEB 3CCSS 2GIFA 3DOLB 2EG1A 1VOMA 3D3BJ 3FSYA 2BRLA 2WW8A 2LQ5A 3OL8A 2NQPA 3VHQA 3TRGA 4DV6F 2ZRBA 4FP9A 5KFXA 1YJWS 4A8YA 3CWBG 2IBZI 1SV5B 4DX6A 5C25B 1UVJA 5CCGA 4LQ9A 1T2KD 1HI0P 2PDAA 3NS6A 4WWSA 4CO2A 3EMTA 2IHR1 2FD2A 5FLXY 2M3BA 1EQ7A 2QRXA 4DXLA 1G2CA 1SQPJ 4DS4A 4U7UD 2ZRIA 3KG4A 2BM0A 2GFFA 4KPYA 2EK6A 3BO4A 3VQTA 2H65B 1QE1A 3J7AN 3ETMA 1VDFA 5CMZA 1EC5A 1FZAA 1IKVB 1U57A 1YJNS 1U49A 3IBWA 2HRUA 4I2LC 5AVTB 3GHGA 1PJ6A 3HT3A 2GVDB 2HMIA 3FGVA 2QA4G 4URSA 4CYUA 1I5OB 4RKUC 2ZVSA 3DDIA 4USMA 3NLCA 1N6QB 4RWXA 4X62F 5KAFH 3VWSA 4PXCA 1YQ4C 3ZZOA 4GDOA 4OLOA 2QSFA 1NJXA 2GJFA 1T9XA 1NHLA 3DRXA 1VQKS 3BCCE 3CCWA 3IP0A 2QLXA 3HR8A 2KB2A 3GONA 2A45H 2WTFA 1MMDA 2P9CA 3CJ5A 5CBNA 1VL2A 2JDIH 5LSOA 1FDNA 4ZLJA 3FRZA 2R2TA 4WYWA 5KG5A 4WFNQ 1LT9C 3MFIA 3UCUP 1S9KD 2BEFA 5B5EE 2LYVA 3MM8B 1KOHA 5HQLA 3H0PA 3DNCA 4IO9Q 2RAQA 2A18A 1X7VA 3QAUA 1ZOTA 1SXLA 3DDKA 4CLLA 1U8SA 3GW6A 3ILJA 3L7OA 4WE1B 1A02F 2REBA 2BE9B 2I2YA 1VIOA 1UEKA 4U7UK 3EXCX 1FOSE 3HUSA 3VV2B 3GP9A 3RG6A 5APXA 3CCRS 2KNCB 1PG5B 1NJIQ 3FXDA 4G1QA 1RUSA 4LBHA 4LIWA 1RXOB 4USHA 2MY8A 2BW7A 1H74A 2J7UA 3FK4A 4ZNCA 4O3SA 3NNAA 1DAXA 5DLGA 2Y0EA 1HHSA 3ZTPA 1TU0B 3SIPB 3CCQS 3CD7A 4QR0A 2A6MA 1KD1Q 3JYTA 4KY3A 3SV3A 5KG1A 2HIYA 3H1LD 1UZHA 1JM0A 4O4RA 4F4AA 4F4XA 2FXPA 2PN6A 5GADU 1EARA 1JMBA 1FI4A 3SFUA 1XR7A 2Y0CA 3ZFVA 3E1IA 1IKXB 1ZM3A 4HHHA 4ZPWR 1SFCD 3W5YA 4DR7F 2FVCA 3HTKA 4OZ3A 3IF4A 2FKWB 1FDDA 3H5UA 2Z30B 2FYUE 3D54A 3KK2B 2CPJA 2W2NP 2GJ2A 3EWKA 2VPZB 4P9SA 2DNPA 2J0QD 2IIHA 2KS1A 4NLSA 2MZRA 4ZLPA 1RF1C 3KWMA 3IGNA 2QE7H 1UEVA 5HSPA 3OSPA 4DT0A 3LP2B 3QWPA 1YJRA 3ZO7A 4IDKB 4OYPA 2VB6A 2VPWB 3DYAB 2M0GB 3CJQA 2E76B 1JEKA 1NTME 2FPHX 5BJRA 1DQ8A 1WT6A 3ZNUA 3H1IJ 2WVDA 3M2UA 3M1VA 3V6HA 2V4JB 2K3KA 1OY8A 4RW7A 2MKVA 4C0HA 5LM7E 1GMVA 2ZR0A 3UVJA 2E76C 4NLOA 2Q3IA 5H9EJ 2P2UA 2ZHOA 2F9JA 3MM7B 1SFCA 3R5CA 1EQ0A 4PR6A 5CHCB 4JI7J 1HWLA 2BCCJ 2CJYB 1X8YA 1DLOA 3KPEA 4JPZB 1MO5A 2IFNA 4LRFA 3VCDA 1DEBA 2XNQA 1QY7A 4ES2A 3IR6B 3NBPA 3BDEA 3HE4B 4FXVA 4J9LA 2D3O1 4I7ZC 5E5NA 4P52A 3D6ZA 2C3UA 2R8KA 1HQEB 2A06E 4PJ0E 4AD6A 3VAMA 3GF3A 2OFHX 3CCEP 2LKZA 3QIPB 2HZCA 1JJCB 2GMLA 3AD7C 1LW0B 2W8ZA 2WSEH 4CLKA 1K73T 1R5SA 4ZPBA 2W83C 2CZVC 2ZH8A 4DJBA 1NTMG 4DV7J 4LREA 2HGMA 2R7VA 1PPJE 5K14B 4Y99B 1FE0A 1TL7B 3MR5A 3ZC4A 3BJYA 3TGUJ 2FB0A 1S0NA 2P7JA 2IRXA 4K5SA 4PYDA 3H40A 3CCUP 3BZQA 1SQQJ 1QAXA 4PABA 4X4VA 2DEJA 2CA9A 1NO4A 1NVOA 4ZJLA 2JDJA 1YRXA 2I5JA 4Y99C 2PRRA 2KUBA 1S72P 3RR7A 3EPGA 3AD8C 3TR5A 4HKQA 2KJVA 2D9OA 1TK0A 2LXBA 2XI3A 1P1TA 4XIUA 2Z4EA 2WONB 2FVSA 2I38A 3HJFA 2UUTA 2A06G 1FZCB 1TKXA 2V2QA 1YGYA 4EYYQ 5ETVA 3F89A 2A2DA 1XR6A 3Q22A 1JLBB 2IDEA 5C42B 2HNZB 2RH3A 4DV0F 1TMMA 3V81B 5AVSB 4AYBD 5K5GB 3R2DJ 2M2BA 1PPJG 4U9RA 3VGVA 3NGDA 3L70E 2QC3A 5EX3A 1N0UA 4O9BA 5J2NA 1FZCC 1LK5A 4QIFA 2CNOB 3MEDA 3HM9A 3AJDA 1KNZA 4N47A 3CCLP 2RH0A 3BRTB 1QVGO 5CZXA 3B54A 2HQIA 4DDFA 4NXMF 1QL2A 2LXFA 4J7CA 2E5GA 2E74D 1U26A 1KVIA 1HMVA 1BCCE 2YY3A 3WZ0A 4C9DA 4ZIWA 4UF4A 2ZNYA 1FKAF 2EKNA 1RH5B 1XTZA 3ZZYA 5LMUF 1Q90D 3QGGA 3FQKA 2HHVA 4U3FD 1F1BB 2B3TB 1HH0A 4OI1A 2JWAA 1NHUA 1JY3N 2E5IA 1HNWJ 5KAIE 2KM8B 3J7A1 3C66A 4H0LB 2O01N 1N4LA 1VBXA 3TVYA 1HBUA 1T02A 2ZAEB 5KFFA 4XFJA 3PTZA 2KT5A 5KOWA 1V6HA 4WP8A 2YNYA 1WKLA 5HK4A 1T9YA 1H72C 4H0LC 2AP6A 5LMNF 4IYQA 2ERRA 1FRXA 4RUBA 2YPZA 5APVA 3AA8A 2P58A 4NCAA 3G6EP 1J27A 1M90T 4PXDA 5FDLB 1KC8Q 1QVFR 4WZMA 4X4SA 2FJBB 3OAKA 1RTJA 3AE6C 1TVRB 3W5ZA 3CJ4A 1AQ5A 1S9GB 1USEA 2H51B 4KIAA 1FJEB 3CC4S 2X7IA 2JRSA 1WWHA 2WZ7A 4WY4A 5DG7A 1HLWA 2M5AB 2E5HA 2V94A 3LP1B 4DL6A 3OQ2A 1P9QC 4E8UA 3JXOA 1XNQF 2H5JB 2HBQB 1P1LA 3O5TB 1RT4B 3L4BC 3QAEA 2FFDA 5HBMB 2N7YA 1DZ5A 3DHWC 4ZVFA 5LXYA 2RS2A 3U02A 4O3NA 2ZRNA 4ID5A 4PPGA 3OTOF 4IFMA 3TZWA 4X66J 3OTDA 3VMAA 1JKHB 1KZUB 2BZ2A 3UR0A 3I9ZA 2NREA 1C4AA 4ED6A 5SUHA 1WNEA 4ZS6A 2W9CB 4K4UA 3OXFA 1EX8A 2CDQA 5BR8F 2ZDOA 3M30B 3TUPA 3CDBA 5LSLA 3PFOA 4FBTA 2XTJP 3CJ2A 3SFEC 4CLSA 4GVBA 3QWOC 3A8JA 1VHFA 1H6KX 4Y2IA 1Y7PA 3RB6A 1F3VA 2UUCF 2ZH4A 1U24A 1ULRA 3CJ3A 1T6AA 2VG7B 1S59A 4PXEA 5M2RA 1G18A 3VQSA 4JYCA 1XMVA 4OH8B 4P71A 5I3QA 3KUGA 4M8LA 5A8RB 4ZKAA 3M91A 3R97A 5AVQB 4KH1B 3HT0A 5BYRA 2IYIA 4KV8B 4UUWA 3RAXA 3KLEA 2IZ0A 1BE3E 3AEGC 1FOSF 1X5PA 3I0SB 5GAGU 2CG8A 2M70A 2B4PA 1L3SA 1VQLP 3C1LA 1DJ0A 1AFIA 3RB3A 3M2RA 4JYAJ 4LF2A 2CRLA 2VDIA 5KOXA 1IQTA 1VQNS 3KOAA 2YX4A 2ZEJA 3E3XA 3M4XA 4PV1C 3RB4A 3ONQA 1IWAA 3CMES 1LW2A 2W9BA 2WQYC 5KG2A 1Z2LA 1L4AD 2H54B 4ANDA 3DU6A 1GW4A 1VC6A 4LF4F 4HLBA 2OTLP 2Y9YA 3A3NB 2E75B 2W4CA 4NCGB 2E29A 1QX8A 2XGQA 2FVRA 2FJXA 1WG1A 4MMOA 1UIXA 2KSEA 2Y9HA 3B4DA 4USTA 6FDRA 4JI4J 2GVZA 1RKJA 3M32A 3M8QA 3C8YA 2W27A 4NMXA 4URGA 1U98A 2H48B 3BVHA 4DL4A 3H32A 1SH2A 3RL0g 2QV6A 4ECUA 1NGMB 2E75C 2WSEC 3NGKA 2C2OB 1NH8A 1NAFA 3L71J 3S9OA 4YR0A 2P8IA 3P49B 1LGHB 1YHQS 1IXKA 3EWGA 1S1VA 2N1TB 1Q7YQ 2UUAF 4FVMA 2ZRDA 1R5LA 5DJUB 4IRCA 3QSIA 4HDHA 1NDCA 4JI2J 1M56D 1FVSA 2E5LF 2ZRKA 2IBOA 3QRRA 2G3AA 4D6TD 5HJXA 4MAKA 1L4AA 1SQBK 4OX9F 3FFIB 3NY0A 2GMJA 3KK3B 3W9JA 2N1TC 2DH8A 4LFBJ 4ASVA 4UW2A 2HZVA 1CW5A 1TL1B 2G88A 4Y2KA 2CNKB 1FE6A 4UTGA 4NASA 3SCKE 4EFAC 5KFJA 1NKNA 4YR3A 2XNXA 1ZPWX 1S0MA 4DFKA 3RAQA 4RNNA 3P4UB 3PJ9A 4TN2A 1N73A 3POTB 3LW5J 5K8OA 2V8VA 4PTLA 2QM7A 1TK5A 3T41A 2ZBIA 4OZ2A 1CI6B 3DOMA 4G1IA 3MD3A 4DFPA 2VFRA 3THPA 1RCOB 4PZVA 1HPZB 1R7IA 2EFPA 5LL6d 2VONA 1GK4A 3QFWA 1U1OA 3V2QA 3OL7A 3P8CE 3J80U 1PYTA 4FXDA 3KNAA 1RT6A 1OS5A 1RHZB 2A1BA 3VMYA 3HHNB 2CQ2A 3KZIE 4OX8A 1SQFA 2MHEA 3H2VE 3O44A 1R8HA 3A7OA 2XG8A 2C2MB 2B6AB 4OI6A 1S1TB 1PP9D 5HJYA 2VHGA 3E01B 1RWXB 4J9SA 4W90B 3MR2A 2VOOA 1CS4A 3FBCA 2F8HA 4JP8A 3AFGA 2MKIA 4RESB 2ZT9B 4HYTB 2R42A 3E8OA 2FJVA 5AW7B 5GTIH 2W9AA 2FIUA 1GQEA 3G82B 5EWFA 3PO5A 1S97A 3Q8UA 1RF0C 1TTHB 4LFAF 1U45A 1RWPB 4AQYJ 1B0TA 2RKIA 4ZJOA 1U1NA 3DRPB 1YBTA 4DPWA 1RT7B 4NPEA 2D74B 3T6JA 4F0MA 2OYIB 1APSA 1S6QB 1SVDA 3CB4A 2QA1A 1WKKA 4C97A 3HK2A 4DV1F 1Y5LB 1M8OB 1JWWA 2QJKB 4LF5F 5IM0A 4G3IA 2OTJP 1KQKA 1LTTC 3OR1A 3MTKA 2IPPA 3PW0A 1ZMEC 1LTSC 4IL6X 1S9FA 2OYIC 3A3OB 3MECB 1SIWB 3KDOA 1AROP 2MZ1A 5B7WA 5C5JA 2HFOA 2HFVA 2QJKC 1FK9B 3RGUA 3IC1A 4KJMA 2XMJA 3K17A 4CO0A 5KLVK 4KQZA 4QOTA 3F56A 1RE3A 1JIHA 5CYMA 1RTIA 3CJKA 1WEXA 4TLFA 1BQNA 1M1KQ 1ZP0C 4PG4A 4AL5A 1RDRA 3QT8A 2CPFA 5KKZB 2RDDA 2BOPA 5GMEA 1FJPA 5KAFE 4OQJA 1T9TA 3UD5A 5IC4B 2HWTA 5AXKA 3BKUA 6FD1A 1WKJA 2DH9A 5J2QB 3R7NB 1W26A 4O23A 3WIVA 2CPDA 1W2IA 3HVTB 2ZZTA 3JSMA 5KKZC 2OYHB 3M0DA 4IOIH 2M4MA 2GUSA 3CJTA 4FS1A 1JO5A 3UD4P 2R8IA 4ECSA 2V34A 3VGTA 2QIFA 2F5GA 3C9IA 1CJVA 1EIYB 4JOUA 3DLKB 3GMAA 1RHUB 4IFYB 4S0MA 2OD4A 3M8YA 3KDPB 2XS7A 1YX2A 2F9DA 1WSVA 1L0LE 4EYIB 2QLBB 1KB9D 2HBYB 4QIEA 2IVMA 4M5JA 1SJ1A 4K2JA 5IV4A 3UDVA 1FDAA 3N4XA 3MHYA 3PJWA 1N56A 4F50A 1NTKE 2V0NA 1NAQA 2AEJA 2YKNB 3OV7A 1LTJA 4Y65A 2G4BA 3HD7D 1H0TB 1NDKA 4QYRA 4PWUA 3I55P 2PI5A 1U99A 2QYGA 3GJRB 3NEKA 3DMJA 2V2ZA 1FDIA 4KT0J 2IBKA 5J2MA 2PGDA 2QE5A 4NZ7A 1SQXE 2BKNA 1R89A 4QW8A 5J1PA 4O3OA 1GXLA 5L8RJ 2BJ7A 4UY8T 1YVFA 5IT4A 3AY0A 4H4OB 4ECVA 3L73J 2DIVA 4R4MA 2HS3A 1IBKF 1ZAVA 1R8AA 3VP9A 4NZ0A 3PH0A 5ETTA 3GIIA 1L0LG 2DNQA 4RUCA 5APSA 5GVQA 4WTYA 4N78E 3H1JJ 2BJ8A 1NJWA 1U6FA 4O3QA 2M8RA 2IVFB 4RUAA 2GHVC 2UXCJ 3NS7B 2VV5A 3VVUA 4BLGA 1QLED 1RADB 2RQCA 4HYKA 3TSIA 2UXDJ 3CCVS 5FIIA 4XDCA 1NTKG 3US5A 5DETA 2YKMA 5A8KB 3TEGA 2GX8A 1RT3A 1HWIA 3HD7A 5KG6A 2BDPA 5KLIB 4GKGA 2KI7B 1S5LX 5DZ7A 1AB8A 2OMOA 2WAQD 1IKYB 3BBCA 3V2PA 5T14A 4ZP8A 3PHEA 5APTA 3GIJA 1I94F 2VFUA 3K8VA 3RW6A 4PWWA 2LKMA 1MNEA 4B9SA 3W3SA 1S1CX 3R5DA 4N7TA 4Z2XA 4IOBA 2X1AA 3GG2A 3MEEB 2DNZA 2UWJE 2X51A 2P6SA 1JLGA 4B3TJ 2KT3A 3BR9A 4DR1F 3H1HE 1U2FA 3D4JA 4F7VA 4ZVSB 3PHTA 4DL7A 3T1AA 2C42A 1YITP 1UVKA 5HL7Q 4F25A 4IL6H 1U7LA 1UJ5A 2HNYB 4PQRA 2NR0A 3O8WA 3NGSA 1SKRA 1JLQA 4J9NA 3A8EA 5IC6B 2HQGA 4OZJA 4RW9B 1X79B 2FVPA 3BCCD 1XEZA 1SS1A 3ITHB 3TVZA 3MUDA 1NTZK 3U1LA 1IUJA 1VR6A 2NSCA 1ZPVA 3MM6A 2E66A 4HACB 4W7YA 2DHXA 1U1PA 1J1EB 3VAGA 3H5YA 1ZR2A 5LJ3Y 3JB9k 1SQEA 3TUIC 2AF6A 1JK9B 2ZJPQ 5RUBA 4OJ1A 2B9BA 2ZH2A 1T8EA 4MK7A 4NEZA 2Q3EA 2M3DA 1RISA 2B4UA 3SSUA 4F3OA 3DM2B 4F67A 4I2PA 1NXIA 4HEA9 5DRKA 1J1EC 4DLGA 3EZUA 4B9UA 2WVEA 1PYOB 2HODB 1B0VA 1P8GA 4RJVA 2RF2B 4LUBA 1M1GA 2B5JA 4CP5A 1VF5D 1A6LA 2YNFA 1QEXA 2ASYA 4IH7A 1TUWA 3OBIA 1U6ZA 3TJAA 5KG4A 4EWTA 2VQFF 1T11A 3C6UB 5DLFA 3A2AA 1RWVB 3W9HA 4B3SF 4ZHRA 4YS2A 4L72B 4M5LA 2DCLA 3BGRB 1HNIA 2J0SD 3GMGA 4PRFA 4WTOB 1JMTA 4TQSA 5AXLA 2IYGA 4PPFA 3FCVA 3H4DA 5GAHI 2L9WA 3AJ1A 1ZA2B 3T9NA 1TFWA 4L76A 4OJHA 1UFLA 4NCBA 3KFWX 3I0RB 1LWEA 2YWWA 1S1WB 4CIOA 2KXHA 3RU0A 2PP6A 2D2CD 3FSIA 3J7YU 9ATCB 4LRCA 3MIWA 2D9PA 3N28A 3L35A 4U3FJ 4I6WA 5F8NA 4PSKA 2FYUD 2CQIA 2AJ2A 1J5OA 2NXUA 1VQPP 1WSRA 2EFGA 5L1JA 1U1QA 3SQOP 4EYHB 2KTQA 1GX6A 1R8EA 2XMWA 2BVZA 1ROFA 1WDTA 2C3OA 5F0UA 2WOMB 4PQUB 3D0GE 5L46A 4TYAA 1NTMD 3OFHA 4OV6A 4PAAA 2FY8A 3G9CA 3DGPA 3U1NA 4A8KA 5HAOA 4DCKA 3JTPA 1SKUB 3CCES 2B43A 3ISND 4H44B 2J6SA 5IT9Y 4NLYA 1GL2D 2R8JA 5MAOA 3S7RA 3PHLA 4ILMA 1S5LH 3FXEA 3W66A 4KO0A 4QIGA 3FBBA 4Y34A 2BE2A 2ZE2B 5GMDA 1IFPA 3RK2D 4H44C 3SCLE 4WPAA 4KGXB 1Y9BA 3CCUS 2ZRLA 2ASDA 2GW8A 3VOPA 3AE8C 2DRBA 1S79A 3CCJP 2OLWA 1URQD 3BSCA 2VICA 1X60A 1S72S 1N33F 5AJ3F 2O3JA 3EICA 3FWLA 4C7QA 4TU9A 3QZ7A 3JAMU 2A06D 1DTTA 2KIKA 3UPFA 1DQAA 1S0VA 3KLVA 2ZBCA 2DGUA 1E6VA 4NPFX 2ZJQQ 3BH6B 2YMYA 3VALA 1PPJD 4N76A 1ZBTA 2DY9A 4CLTA 4ES1A 2MLYA 4Y6IA 1UBFA 1N7SA 2FYUK 4A8SA 2LR2A 4WFZA 4ED2A 1N5VA 3W62A 1GL2A 3GE9A 2X1BA 1GD2E 5KFUA 3M2VB 4ZCMA 3IXQA 1YI2S 1P27B 3GQCA 1N34F 1U02A 4Q2MA 5A2QY 2VZ9A 1LXNA 1LWUB 3ICLA 3CCLS 1FE4A 5JRJA 2F4VF 2MSTA 2K9YA 2CG4A 2J8SA 2E1MC 4DV6J 3MPWA 2AXCA 3W64A 4KKOA 1HD1A 2VPXB 1URQA 2BYCA 2KYZA 3PYGA 1SQVE 4MIAA 2XLKA 3O1LA 1U1LA 2E5YA 2WSFJ 3CXHI 4USVA 3VVTA 1LWUC 1Z1ZA 2IDBA 4R8UB 5D4NA 4Q2LA 2VASA 2OUGA 3UNGC 1KLNA