2K9JB

Integrin alphaiib-beta3 transmembrane complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
43
structure length
43
Chain Sequence
PESPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb light chain
publication title The structure of the integrin alphaIIbbeta3 transmembrane complex explains integrin transmembrane signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 16
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2008-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2k9jB00
2KS1A 3L73D 1PP9D 3H1LD 3PHLA 4RJTA 1BGYD 3PRJA 2QJPB 5TJHA 1L0ND 5KLVD 5KKZB 3ITKA 4U3FD 2Y0EA 4PD4D 3FWLA 1BCCD 3L70D 1PPJD 3GG2A 2YIUB 3BCCD 1SQVD 2N9YB 4A7PA 1L0LD 3TF5A 1NTMD 2Y0CA 1EZVD 4EDFA 2RMZA 2QJYB 1KYOD 4D6TD 2FYUD 1BE3D 1KB9D 2QG4A 1NU1D 1NTZD 3TGUD 1NTKD 3CWBD 3CXHD 3CX5D 3L75D 1SQPD 2Q3EA 3PTZA 2Y0DA 1SQQD 1ZRTD 3H1ID 2QJKB 3KHUA 3PLNA 2KNCB 1P84D 1SQXD 2K9JB 3H1KD 2JWAA 2O3JA 2L91A 2A06D 2BCCD 3H1HD 2FYNB 3L74D 3H1JD 2RN0A 3TDKA 3VMAA 3GW6A 3L72D 5KLIB 2IBZD 3L71D 1SQBD
chains in the Genus database with same CATH superfamily
1NTKE 2R3SA 3G9RA 4H0LD 1BSHA 1SQQE 5AW1B 5TJHA 1OW8A 2N1TA 1LT1A 3AEGC 4PD4D 4TLFA 2ZJSE 1GZLA 2W8ZA 1LT9C 1BSNA 4DCKA 1AQ5A 3GG2A 2N9YB 4C7RA 3BATA 4WY4D 1GU4A 1GL2C 2C0XA 3USSA 1GK6A 1M1JB 5B5EH 4EDFA 1Q7YQ 1JUNA 4H0LC 2DW3A 1BCCG 4N3YB 1Q82Q 1M56D 3KYQA 3VP9A 1N8RQ 1LT9A 3CX5D 5KAFE 2FYNC 2ITAA 3E1IA 1S9KE 2XNXA 2W6AA 1EZVI 3HE5B 2XKMA 1JY3O 3VTPC 3BRTB 1H89A 5KLVE 4I2LC 1IFPA 1QL1A 4KJMA 2OYHC 2CPSA 1NTMJ 1HH0A 3E7KA 2O1KA 3U1AA 3VMZA 3CL3D 2AEJA 4U3FJ 1S5LE 2M3BA 3M06A 5AW8B 2WZ7A 3RBXA 3GW6A 1NO4A 1P84I 3SWKA 3RK2B 1A02F 1NOHA 2OYHA 2B9BA 3QH9A 4BXLA 1JEKA 1SQBD 3TNUB 1KYOH 1N7SB 3L75E 5B66H 1URQB 2E74D 3H1JE 1VQ7P 3VMYA 1RY3A 3CXHH 4YXDC 1OVRA 3AE8C 2WSEJ 3P32A 4YPCA 3RBZA 4I1LA 3H1IJ 2CPBA 3U59A 4RESB 1EXIA 1RH5B 3TF5A 1N73B 3H1HJ 1RQUA 4UB6H 1JY3N 1BE3D 1PGQA 2YKOA 3FWNA 2Q3IA 3OW2O 1EC5A 1GDTA 1ZMEC 3Q5PA 5BU8B 1PP9E 2IYPA 4DJGA 2OYIB 1GL2B 3CCMP 5E79H 3L4FA 4BWNA 1SQXD 5KAIE 2WPSA 4OH8B 1QVGO 1K8AQ 2FYNB 1DH3A 2RN0A 2NZ2A 1BCCJ 5KJ7C 3RGUA 2R5DA 1L0LK 3O6QA 2C9LY 1BDDA 1YJWP 3L73D 3H1LD 3AE7C 3WUUA 2OQQA 1NU1K 3D6ZA 2ZT9B 4R4LA 1DX7A 1MFZA 2H7HA 5KJ7A 3L72G 3M0AA 3FGAD 2P10A 2G8YA 1HWTC 4L74A 3PH0A 3CMAP 1HJBA 4Y99C 2A06E 3EFFK 3VP8A 1GK4A 1Q81Q 2P1JA 2AXTE 3CC2P 2QE7H 3CCUP 3NMDA 3TGUD 1SQVG 2R32A 3CWBD 4I7ZB 3B4SA 1YJ9P 2P7JA 4ASVA 3UIAA 1YQ3C 1DEEG 3CCJP 4IL6X 1NTZG 3H1KD 2E75D 5AVVB 3H6PA 1HBWA 1H88A 3A0HE 1BE3J 1KC8Q 1EDKA 1PV3A 3TDKA 1QEXA 3K5BA 1NH4A 1RF1B 5AVYB 1HVVA 2R3CA 3O8ZA 2I1JA 1OVUA 1KFNA 2IBZD 5GTIH 1VQNP 2E75C 1L0NK 3HD7D 2GUSA 3FXEA 1SQXJ 3H32A 3MIWA 4AYCA 2GM4A 3AE4C 1L0ND 3M9QA 2P58A 4H44D 2WSEH 3TYYA 3KPEA 2YKQA 3TK1A 2BCCE 4A7PA 2W6BA 1OX3A 2WITA 1JY2O 2Y9YA 4H13B 1NTKK 4DZOA 1M90Q 3A0BH 3L73J 2FYUD 5DJTB 2O01N 3L70G 1KD1Q 2QG4A 1SQQK 2ZXXA 3I5CA 1NTKD 1GMJA 1LTBC 2IX7C 4YTPC 1SQPD 3MHVA 4PD4H 1SQQD 1PGPA 4D6TG 3HD7A 1GTWA 2WQYC 1Y9BA 2O1JA 2H88C 1VL2A 1X9VA 2YIUC 1JMBA 3CX5I 4NPEA 3E1RA 1SVFA 3TGUJ 1PZQA 3KZIE 1H0TB 2W27A 1M7LA 1N86A 1SQVJ 1YTZT 2BASA 3M9BA 2JJLA 3LIDA 4Y28J 1YTZI 4GOFA 3JC22 1S9KD 5KLVK 1CW5A 3WMM0 3Q3DA 3N4XA 1FS0E 4LC1A 3H32B 1JY2N 1K73Q 1NTZJ 5KLVD 1RQVA 2M8RA 1MFTA 2E76C 3L72E 3RK3B 3A5TA 1RE4C 1J1DC 5B5EE 2HYNA 1IC2A 2FXPA 2NPSD 1KILE 4C7NB 4DOJA 3IFMA 1WMKA 2L5GB 4MN4C 1RE4A 2WT7A 1KQFB 3L75D 3P8CE 2PP6A 1NTMG 1J2JB 2G3AA 4WBAA 3RK3E 2KNCB 2WSSH 2FXMA 1S2EA 2NPSC 2K1AA 1YI2P 2JWAA 1NYHA 1SS1A 2FYUJ 2Q5UA 1PPJE 4M3LA 1KQGB 5H2FH 3B5NB 1WRGA 1SQPJ 1KYOE 5KTBA 1S5LX 5APXA 2NRGA 1ZLLA 2NPSA 1VQMP 1URQD 5B66E 4EIJA 5AW9B 1LP1A 3L74G 3HE4B 2SPZA 1PP9D 3CXHE 3PHLA 4RJTA 4HYTB 3IF4A 3H1IG 5AVTB 1BGYD 1U57A 2YO3A 3RL0B 3V4QA 3AECC 5APUA 4Z1MH 1L4AC 2WWWA 4UB6E 5CJ0A 2ZAEB 2ZVOB 1AVOA 1JY3P 1EQ7A 2GA1A 1QGKB 2E42A 2LR2A 4EOTA 2KP8A 4YXWH 1L4AA 3L70E 1SFCB 4NPFX 5E79E 2RH0A 3LW5J 3GHGB 3KQGA 1VDFA 1IK9A 2FKWB 5GTHH 1PL5A 3KDPB 2HODA 1G2CA 5TISH 4D6TE 1X79B 2QM7A 4OVNF 4N78D 3QWOC 3HUSB 2A06D 2QSIA 2E5TA 5AVUB 3MGNA 1G1JA 1FZCC 1OW7A 1NAYA 4EI2A 1D7MA 5CMZA 5AW2B 4WY4C 3BRVB 1ZOYC 3WUVA 3CCEP 2KS1A 1LP1B 1Y8AA 1FZCA 1RE3C 1YIJP 4IFFA 1N7LA 2KYVA 3NTNA 2K9YA 2H43A 2IPPA 4WY4A 1SQBG 2IBZI 3W67A 4NPDA 1P84H 4GKGA 1VF5B 4GDOA 3ABVC 1RE3A 4OGQB 1HUCA 2FFDC 3OA7A 2K9JA 1KB9I 1K9MQ 3L74J 1YBKA 2N1TB 1J1EB 1VQ6P 1BGYJ 3IAOA 4LLHA 4BRYA 5CHXA 2Q3EA 1VQLP 1HGVA 3G71P 1KN7A 3BVHA 1ZRTD 2B88A 2B89A 1NGMB 1TU3F 2FFDA 1BE3G 1NTME 2V4HA 5KKZC 1CZQA 1NKZB 2KLVA 3HTKA 2E74C 3SSUA 4U3FE 1JM0A 1LWUC 2BCCD 1LT9B 1T8ZA 3EQ2A 2KZIA 4TT3H 5GTIE 1SQXG 3FXDA 3L35A 4H0LB 2YMYA 4ZKPA 2Z5HA 1IZNB 1LWUA 3L71D 1T2KD 2XDJA 2AEFA 1IFIA 2KSEA 2QJYC 1KFMA 3H1IE 1W2EA 1FZEA 4U7JA 1YQ4C 3FWLA 3L73G 3D70A 2OYHB 3H1LG 3A0BE 3BCCD 2K3RA 3H1HE 2KK7A 1PFIA 1L0LD 4KT0J 3AE5C 1GW3A 1YHQP 3NXSA 2JWDA 1T2KC 3GF7A 5CBOA 2YO2A 3ZDMA 1LTAC 1NU1D 4PD4E 1E79H 4BRYB 4OWFA 3PTZA 4B86A 1M1KQ 3LW5H 3V4WA 2Z4EA 1K05A 1SQBJ 1NVOA 3TGUG 3CWBG 1BCCE 1VQKP 1EZVG 3AEAC 1KILD 3H1KG 1DD4A 5AVRB 5CCHD 4PV1D 1GD2E 2E74B 2P2UA 4XA4A 1T3UA 3P8CD 1JY2P 1MKMA 1YYCA 2WPQA 3W68A 3SFEC 4WB4A 3RK3D 3MD0A 1X22A 3G6EP 3ITKA 1HF9A 2IBZG 3O6QB 1BDCA 1KMIZ 2D2CD 5CCHC 2QM8A 2Z5IA 1PPJD 3WU2E 5CBNA 1RHZB 1QX8A 3CCRP 1KORA 4ZMDA 2OTLP 3L71J 2QJYB 1KYOD 2CK3H 2IZ1A 1ZR4A 1KB9D 1ZR2A 5CCHA 3MP7B 5APSA 3CXHD 4W80A 2JKVA 3MTUE 2QJPC 2FYUG 3HD7C 3M9HA 3B8EB 2KIKA 3BCCJ 1FAVA 4JYCA 5AW4B 1L0LJ 3H1LJ 1BE3E 4XFJA 1SQPG 5H2FE 4H44C 1AJYA 1LTSC 4Y99B 1NU1J 1OMIA 4L73A 1LTJC 5BVZA 2FY8A 3CCLP 1SQXE 4K3AA 3CD6P 1QL2A 2XNDH 3RL0D 2I8DA 3CC7P 3IR9A 5AVSB 2WTYA 2WSCJ 3AE1C 1M57D 3H25A 2MJZA 1HTLC 2KXPB 3CWBJ 1LTJA 3CX5H 1HGZA 5APWA 4UB8H 5AW6B 1FDOA 1FOSE 2IFMA 2Y0EA 2LXCB 3D71A 1IJDB 2M5AA 1SP4A 1AA0A 3L73E 1XTCC 3H1KJ 1S4XA 5C39A 3AE3C 2PRRA 2AXCA 3CMEP 4ZNCA 3EFGA 2W6JH 1LTIC 5GTHE 3PP5A 2E75B 5TISE 1JCDA 4LGDE 2M0BA 4HH2A 3P8MC 1FC2C 1A02J 2KLUA 3CPWO 1L0NJ 5AVXB 3IN6A 3T97A 3H1JD 1SQVE 3II6A 2YNYA 3HD7B 1EZVE 2OTKE 1NTMK 1NTZE 3VN0A 3JCUH 1K04A 2M3EA 3RK2D 2YXRB 4KHXA 1NTKJ 3GMAA 2HLOA 1FDIA 1VF5D 1P84E 1N7SD 2OYOA 4U3FD 1AFOA 1LNQA 5CJ4A 1VQ4P 1SQQJ 1KQLA 4OGQD 5APTA 2HFED 1PP9G 1RF0C 3VMXA 2YIUB 2A45I 2ZVNB 1PIXA 1BGYG 4JQ0D 1DIPA 3MZWB 1U7JA 2QRXA 3N7NA 1EDLA 1QVFO 2Y0CA 2QVAA 3CLQA 3BASA 5AW5B 3RK2C 1USEA 3M91A 2IDBA 1FOSF 2H8PD 1IFJA 4RO0A 2FYZA 1AV1A 1RF0A 2LKMA 3V2QA 1M8OB 1URQC 1EDJA 3H1ID 1X0TA 3KHUA 2YXQB 3VOPA 4DT0A 1S3JA 4IL6H 1MV8A 2FYUE 1R8EA 1VQOP 4JPZB 3D6YA 2E76B 2ZYAA 1GL2D 1N7SA 3H1HD 1ZN5A 5KLVJ 2WT7B 1J1DB 1URQA 1SQPE 1N73C 3T97B 3MUDC 1JO5A 4CPGA 2Q7CA 1KZUB 1LTGC 2A06G 3SWFA 3VYIA 1JTHA 2WSCH 4GODA 2OYIC 1IK7A 1N73A 2R5BA 2KUBA 3P7KA 3MUDA 4IFDK 1DD3A 1KQSO 3L75J 2YMKA 4HB1A 4W7YA 3H1JJ 1FJPA 5DJUB 4K35A 1BCCD 2FXOA 2ZT9D 1Y47A 5APVA 1VQ9P 2NPSB 4PJ0H 3AE9C 4IOIH 2OYIA 1GL2A 2QJKC 2XU6A 1ZV8A 3G4SP 3I55P 3WUTA 1MZ9A 1N2DC 2ZT9C 2KSJA 2Y0DA 4WVZA 1U7MA 3PLNA 1SQBK 3AEFC 2B87A 1KYOI 2HR3A 1PP9J 1IFDA 1YJNP 2IFNA 5KLIC 3C8VA 1KTMA 2OGUA 2L91A 1L4AB 3CXHI 1KB9H 2PGDA 4JF7A 1LGHB 2N9BA 3EWKA 2GUVA 2HODB 1G2CB 2Q6QA 3G3ZA 2E43A 1ZXGA 2BCCG 2Y9ZA 4I7ZC 2O01J 2LXBA 4O9BA 5BU5A 3LIEA 2MKVA 2WVRA 1JTHB 3V2RA 2FBWC 3V6IA 2K37A 1FDMA 3U1CA 1T6AA 3L71G 2A45G 1VQ5P 3RL0g 5KJ7D 1SQXK 2ZYDA 2KS1B 1RF1C 1FZCB 1ZP0C 3L74E 3S1KA 1Q2NA 1BGYE 2KB7P 2Q1KA 5APQA 2KI7B 1GW4A 1FZBA 3JSVC 4N6JA 4WY4B 4ASWA 3BCCG 1YITP 4H13D 3F5HA 2BEZF 5K5GB 1FU1A 1L0LG 2KOGA 1FE6A 2ZFCA 1RF1A 1EDIA 2POHA 2QJKB 1R5LA 5KAFH 4QMAA 2B87B 1NU1G 3V2NA 2K9JB 3A2AA 1Z56A 1XTGB 4RKUJ 3FX0A 1FZAA 1T3JA 2JP3A 2VRSA 4H13C 1OWAA 4JYBA 1PGOA 2JO1A 1OFCX 2FFDB 3Q5RA 2W90A 3L72D 1S5LH 3TSIA 3HTKB 3CCSP 5KLIB 1VQ8P 4N78E 4GT1A 3CX5E 5AVQB 1MUUA 4UB8E 3M0DC 2BEQD 1UIXA 1SQVK 4EYYQ 2P67A 4HJGH 5KKZB 1NWQA 1LJ2A 2QEXP 4AQRD 1W2BO 1VPCA 1OVVA 5CCGD 5APYA 3NFQA 1SQVD 1LWUB 3OAKA 3M0DA 1NTZK 2QIWA 1EZVD 2BCCJ 2RMZA 1OXZA 1KILC 5L8RJ 2RKLA 1PPJG 3A7OA 1NTZD 4JBZA 4PV1C 1SLQA 1SQBE 1G1IA 3CC4P 1X8YA 5CCGC 1H0TA 2AEMA 1L0NG 2IYOA 1P84D 4GIFA 4R4MA 3V2PA 3RK3C 2WPVB 1KILA 3A3YB 2QA4P 2JEEA 1CI6A 3F89A 4AUWA 2O3JA 2JR8A 3AEDC 1PGJA 1GU5A 2WSFJ 1FBMA 2D2CC 1NAFA 5KAIH 1HJ0A 5CCGA 1FZGA 1JOCA 1ZRTE 3CCVP 1NJIQ 3JCUE 1IFNA 2ZXEB 2C9NY 1JNMA 1JMMA 2V7QJ 3GLMA 2WPRA 1NTKG 2R44A 2O01H 1S1CX 2FYUK 3B5ND 3Q2YA 1SQQG 2I1KA 3AE6C 1S72P 1OIPA 3PRJA 2J58A 4C7NA 3C1LA 4IFMA 1SQPK 2UWJE 3I56P 3C9IA 1WT6A 4PD4I 3PJSK 1L2PA 3AE2C 3L70D 1Q86Q 3R4YA 1CSBA 3L71E 1W5CE 2ZYGA 3Q1MA 3L72J 3V5BA 1OZHA 1AQTA 2KNCA 3R2PA 3B5NC 5AVZB 4D6TD 4I6MC 1R5SA 2K88A 2C0WA 2AXTH 4XE5B 3BCCE 4IL6E 1L0LE 3H1LE 2E76D 3B5NA 3RL0C 5KLVG 3CCQP 1SFCD 3SWYA 1EXJA 1KILB 1NU1E 3S9OA 3HE4A 1E5WA 1CI6B 5M1BA 3HRNA 4PV1B 2HPCA 2HG5D 1USDA 1VQPP 2PAJA 2YKPA 3A0HH 2OTJP 1Q90D 5AW3B 2OARA 3AEBC 2PFXA 3L37A 1H8AA 1SFCC 3L75G 3TGUE 3H1JG 3CWBE 3GHGC 1KV4A 4W7ZA 3AEEC 2H89C 2D2CB 1DEBA 1NKNA 1M1JC 5AW7B 3WU2H 1JCCA 2QJPB 4L76A 4PJ0E 3HUSC 3H1KE 1SFCA 3OJAB 3GHGA 2J5UA 4H44B 1UIIA 1FJKA 1M1JA 1NTMD 5EFWB 4U3FG 3B71A 1LTJB 4ZKUA 4C46A 2J59M 3HUSA 1JB0J 3L36A 4WWIA 1OW6A 3KXDA 2IBZE 1NHLA 2XZRA 2JDIH 2IZ0A 3GF3A 4HKZH 5AW0B 3Q5SA 1AVYA 2M5AB 2E5YA 2N1TD 3SFDC 3L70J 3HE5A 4GOEA 1L4AD 3S4RA 2A45H 2W83C 1L0NE 1KB9E 1FZFA 1LTTC 2KZJA 5AVWB 1VF5C 1N7SC 4D6TJ 2WMMA 2HPCB 2WSFH 3L74D 1QLED 4OGQC 3VMAA 2XV5A 1IO4A 2Q9IA 2N1TC 1J1EC 1IFMA 3CI9A 1ZW0A 2V7QH 3H1HG 3KZIH 4L75A 3TNUA
chains in the Genus database with same CATH topology
2KS1A 3L73D 1PP9D 3H1LD 3PHLA 4RJTA 1BGYD 3PRJA 2QJPB 5TJHA 1L0ND 5KLVD 5KKZB 3ITKA 4U3FD 2Y0EA 4PD4D 3FWLA 1BCCD 3L70D 1PPJD 3GG2A 2YIUB 3BCCD 1SQVD 2N9YB 4A7PA 1L0LD 3TF5A 1NTMD 2Y0CA 1EZVD 4EDFA 2RMZA 2QJYB 1KYOD 4D6TD 2FYUD 1BE3D 1KB9D 2QG4A 1NU1D 1NTZD 3TGUD 1NTKD 3CWBD 3CXHD 3CX5D 3L75D 1SQPD 2Q3EA 3PTZA 2Y0DA 1SQQD 1ZRTD 3H1ID 2QJKB 3KHUA 3PLNA 2KNCB 1P84D 1SQXD 2K9JB 3H1KD 2JWAA 2O3JA 2L91A 2A06D 2BCCD 3H1HD 2FYNB 3L74D 3H1JD 2RN0A 3TDKA 3VMAA 3GW6A 3L72D 5KLIB 2IBZD 3L71D 1SQBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KS1 A;  3L73 D;  1PP9 D;  3H1L D;  3PHL A;  4RJT A;  1BGY D;  3PRJ A;  2QJP B;  5TJH A;  1L0N D;  5KLV D;  5KKZ B;  3ITK A;  4U3F D;  2Y0E A;  4PD4 D;  3FWL A;  1BCC D;  3L70 D;  1PPJ D;  3GG2 A;  2YIU B;  3BCC D;  1SQV D;  2N9Y B;  4A7P A;  1L0L D;  3TF5 A;  1NTM D;  2Y0C A;  1EZV D;  4EDF A;  2RMZ A;  2QJY B;  1KYO D;  4D6T D;  2FYU D;  1BE3 D;  1KB9 D;  2QG4 A;  1NU1 D;  1NTZ D;  3TGU D;  1NTK D;  3CWB D;  3CXH D;  3CX5 D;  3L75 D;  1SQP D;  2Q3E A;  3PTZ A;  2Y0D A;  1SQQ D;  1ZRT D;  3H1I D;  2QJK B;  3KHU A;  3PLN A;  2KNC B;  1P84 D;  1SQX D;  2K9J B;  3H1K D;  2JWA A;  2O3J A;  2L91 A;  2A06 D;  2BCC D;  3H1H D;  2FYN B;  3L74 D;  3H1J D;  2RN0 A;  3TDK A;  3VMA A;  3GW6 A;  3L72 D;  5KLI B;  2IBZ D;  3L71 D;  1SQB D; 
#chains in the Genus database with same CATH topology
 1NTK E;  2R3S A;  3G9R A;  4H0L D;  1BSH A;  1SQQ E;  5AW1 B;  5TJH A;  1OW8 A;  2N1T A;  1LT1 A;  3AEG C;  4PD4 D;  4TLF A;  2ZJS E;  1GZL A;  2W8Z A;  1LT9 C;  1BSN A;  4DCK A;  1AQ5 A;  3GG2 A;  2N9Y B;  4C7R A;  3BAT A;  4WY4 D;  1GU4 A;  1GL2 C;  2C0X A;  3USS A;  1GK6 A;  1M1J B;  5B5E H;  4EDF A;  1Q7Y Q;  1JUN A;  4H0L C;  2DW3 A;  1BCC G;  4N3Y B;  1Q82 Q;  1M56 D;  3KYQ A;  3VP9 A;  1N8R Q;  1LT9 A;  3CX5 D;  5KAF E;  2FYN C;  2ITA A;  3E1I A;  1S9K E;  2XNX A;  2W6A A;  1EZV I;  3HE5 B;  2XKM A;  1JY3 O;  3VTP C;  3BRT B;  1H89 A;  5KLV E;  4I2L C;  1IFP A;  1QL1 A;  4KJM A;  2OYH C;  2CPS A;  1NTM J;  1HH0 A;  3E7K A;  2O1K A;  3U1A A;  3VMZ A;  3CL3 D;  2AEJ A;  4U3F J;  1S5L E;  2M3B A;  3M06 A;  5AW8 B;  2WZ7 A;  3RBX A;  3GW6 A;  1NO4 A;  1P84 I;  3SWK A;  3RK2 B;  1A02 F;  1NOH A;  2OYH A;  2B9B A;  3QH9 A;  4BXL A;  1JEK A;  1SQB D;  3TNU B;  1KYO H;  1N7S B;  3L75 E;  5B66 H;  1URQ B;  2E74 D;  3H1J E;  1VQ7 P;  3VMY A;  1RY3 A;  3CXH H;  4YXD C;  1OVR A;  3AE8 C;  2WSE J;  3P32 A;  4YPC A;  3RBZ A;  4I1L A;  3H1I J;  2CPB A;  3U59 A;  4RES B;  1EXI A;  1RH5 B;  3TF5 A;  1N73 B;  3H1H J;  1RQU A;  4UB6 H;  1JY3 N;  1BE3 D;  1PGQ A;  2YKO A;  3FWN A;  2Q3I A;  3OW2 O;  1EC5 A;  1GDT A;  1ZME C;  3Q5P A;  5BU8 B;  1PP9 E;  2IYP A;  4DJG A;  2OYI B;  1GL2 B;  3CCM P;  5E79 H;  3L4F A;  4BWN A;  1SQX D;  5KAI E;  2WPS A;  4OH8 B;  1QVG O;  1K8A Q;  2FYN B;  1DH3 A;  2RN0 A;  2NZ2 A;  1BCC J;  5KJ7 C;  3RGU A;  2R5D A;  1L0L K;  3O6Q A;  2C9L Y;  1BDD A;  1YJW P;  3L73 D;  3H1L D;  3AE7 C;  3WUU A;  2OQQ A;  1NU1 K;  3D6Z A;  2ZT9 B;  4R4L A;  1DX7 A;  1MFZ A;  2H7H A;  5KJ7 A;  3L72 G;  3M0A A;  3FGA D;  2P10 A;  2G8Y A;  1HWT C;  4L74 A;  3PH0 A;  3CMA P;  1HJB A;  4Y99 C;  2A06 E;  3EFF K;  3VP8 A;  1GK4 A;  1Q81 Q;  2P1J A;  2AXT E;  3CC2 P;  2QE7 H;  3CCU P;  3NMD A;  3TGU D;  1SQV G;  2R32 A;  3CWB D;  4I7Z B;  3B4S A;  1YJ9 P;  2P7J A;  4ASV A;  3UIA A;  1YQ3 C;  1DEE G;  3CCJ P;  4IL6 X;  1NTZ G;  3H1K D;  2E75 D;  5AVV B;  3H6P A;  1HBW A;  1H88 A;  3A0H E;  1BE3 J;  1KC8 Q;  1EDK A;  1PV3 A;  3TDK A;  1QEX A;  3K5B A;  1NH4 A;  1RF1 B;  5AVY B;  1HVV A;  2R3C A;  3O8Z A;  2I1J A;  1OVU A;  1KFN A;  2IBZ D;  5GTI H;  1VQN P;  2E75 C;  1L0N K;  3HD7 D;  2GUS A;  3FXE A;  1SQX J;  3H32 A;  3MIW A;  4AYC A;  2GM4 A;  3AE4 C;  1L0N D;  3M9Q A;  2P58 A;  4H44 D;  2WSE H;  3TYY A;  3KPE A;  2YKQ A;  3TK1 A;  2BCC E;  4A7P A;  2W6B A;  1OX3 A;  2WIT A;  1JY2 O;  2Y9Y A;  4H13 B;  1NTK K;  4DZO A;  1M90 Q;  3A0B H;  3L73 J;  2FYU D;  5DJT B;  2O01 N;  3L70 G;  1KD1 Q;  2QG4 A;  1SQQ K;  2ZXX A;  3I5C A;  1NTK D;  1GMJ A;  1LTB C;  2IX7 C;  4YTP C;  1SQP D;  3MHV A;  4PD4 H;  1SQQ D;  1PGP A;  4D6T G;  3HD7 A;  1GTW A;  2WQY C;  1Y9B A;  2O1J A;  2H88 C;  1VL2 A;  1X9V A;  2YIU C;  1JMB A;  3CX5 I;  4NPE A;  3E1R A;  1SVF A;  3TGU J;  1PZQ A;  3KZI E;  1H0T B;  2W27 A;  1M7L A;  1N86 A;  1SQV J;  1YTZ T;  2BAS A;  3M9B A;  2JJL A;  3LID A;  4Y28 J;  1YTZ I;  4GOF A;  3JC2 2;  1S9K D;  5KLV K;  1CW5 A;  3WMM 0;  3Q3D A;  3N4X A;  1FS0 E;  4LC1 A;  3H32 B;  1JY2 N;  1K73 Q;  1NTZ J;  5KLV D;  1RQV A;  2M8R A;  1MFT A;  2E76 C;  3L72 E;  3RK3 B;  3A5T A;  1RE4 C;  1J1D C;  5B5E E;  2HYN A;  1IC2 A;  2FXP A;  2NPS D;  1KIL E;  4C7N B;  4DOJ A;  3IFM A;  1WMK A;  2L5G B;  4MN4 C;  1RE4 A;  2WT7 A;  1KQF B;  3L75 D;  3P8C E;  2PP6 A;  1NTM G;  1J2J B;  2G3A A;  4WBA A;  3RK3 E;  2KNC B;  2WSS H;  2FXM A;  1S2E A;  2NPS C;  2K1A A;  1YI2 P;  2JWA A;  1NYH A;  1SS1 A;  2FYU J;  2Q5U A;  1PPJ E;  4M3L A;  1KQG B;  5H2F H;  3B5N B;  1WRG A;  1SQP J;  1KYO E;  5KTB A;  1S5L X;  5APX A;  2NRG A;  1ZLL A;  2NPS A;  1VQM P;  1URQ D;  5B66 E;  4EIJ A;  5AW9 B;  1LP1 A;  3L74 G;  3HE4 B;  2SPZ A;  1PP9 D;  3CXH E;  3PHL A;  4RJT A;  4HYT B;  3IF4 A;  3H1I G;  5AVT B;  1BGY D;  1U57 A;  2YO3 A;  3RL0 B;  3V4Q A;  3AEC C;  5APU A;  4Z1M H;  1L4A C;  2WWW A;  4UB6 E;  5CJ0 A;  2ZAE B;  2ZVO B;  1AVO A;  1JY3 P;  1EQ7 A;  2GA1 A;  1QGK B;  2E42 A;  2LR2 A;  4EOT A;  2KP8 A;  4YXW H;  1L4A A;  3L70 E;  1SFC B;  4NPF X;  5E79 E;  2RH0 A;  3LW5 J;  3GHG B;  3KQG A;  1VDF A;  1IK9 A;  2FKW B;  5GTH H;  1PL5 A;  3KDP B;  2HOD A;  1G2C A;  5TIS H;  4D6T E;  1X79 B;  2QM7 A;  4OVN F;  4N78 D;  3QWO C;  3HUS B;  2A06 D;  2QSI A;  2E5T A;  5AVU B;  3MGN A;  1G1J A;  1FZC C;  1OW7 A;  1NAY A;  4EI2 A;  1D7M A;  5CMZ A;  5AW2 B;  4WY4 C;  3BRV B;  1ZOY C;  3WUV A;  3CCE P;  2KS1 A;  1LP1 B;  1Y8A A;  1FZC A;  1RE3 C;  1YIJ P;  4IFF A;  1N7L A;  2KYV A;  3NTN A;  2K9Y A;  2H43 A;  2IPP A;  4WY4 A;  1SQB G;  2IBZ I;  3W67 A;  4NPD A;  1P84 H;  4GKG A;  1VF5 B;  4GDO A;  3ABV C;  1RE3 A;  4OGQ B;  1HUC A;  2FFD C;  3OA7 A;  2K9J A;  1KB9 I;  1K9M Q;  3L74 J;  1YBK A;  2N1T B;  1J1E B;  1VQ6 P;  1BGY J;  3IAO A;  4LLH A;  4BRY A;  5CHX A;  2Q3E A;  1VQL P;  1HGV A;  3G71 P;  1KN7 A;  3BVH A;  1ZRT D;  2B88 A;  2B89 A;  1NGM B;  1TU3 F;  2FFD A;  1BE3 G;  1NTM E;  2V4H A;  5KKZ C;  1CZQ A;  1NKZ B;  2KLV A;  3HTK A;  2E74 C;  3SSU A;  4U3F E;  1JM0 A;  1LWU C;  2BCC D;  1LT9 B;  1T8Z A;  3EQ2 A;  2KZI A;  4TT3 H;  5GTI E;  1SQX G;  3FXD A;  3L35 A;  4H0L B;  2YMY A;  4ZKP A;  2Z5H A;  1IZN B;  1LWU A;  3L71 D;  1T2K D;  2XDJ A;  2AEF A;  1IFI A;  2KSE A;  2QJY C;  1KFM A;  3H1I E;  1W2E A;  1FZE A;  4U7J A;  1YQ4 C;  3FWL A;  3L73 G;  3D70 A;  2OYH B;  3H1L G;  3A0B E;  3BCC D;  2K3R A;  3H1H E;  2KK7 A;  1PFI A;  1L0L D;  4KT0 J;  3AE5 C;  1GW3 A;  1YHQ P;  3NXS A;  2JWD A;  1T2K C;  3GF7 A;  5CBO A;  2YO2 A;  3ZDM A;  1LTA C;  1NU1 D;  4PD4 E;  1E79 H;  4BRY B;  4OWF A;  3PTZ A;  4B86 A;  1M1K Q;  3LW5 H;  3V4W A;  2Z4E A;  1K05 A;  1SQB J;  1NVO A;  3TGU G;  3CWB G;  1BCC E;  1VQK P;  1EZV G;  3AEA C;  1KIL D;  3H1K G;  1DD4 A;  5AVR B;  5CCH D;  4PV1 D;  1GD2 E;  2E74 B;  2P2U A;  4XA4 A;  1T3U A;  3P8C D;  1JY2 P;  1MKM A;  1YYC A;  2WPQ A;  3W68 A;  3SFE C;  4WB4 A;  3RK3 D;  3MD0 A;  1X22 A;  3G6E P;  3ITK A;  1HF9 A;  2IBZ G;  3O6Q B;  1BDC A;  1KMI Z;  2D2C D;  5CCH C;  2QM8 A;  2Z5I A;  1PPJ D;  3WU2 E;  5CBN A;  1RHZ B;  1QX8 A;  3CCR P;  1KOR A;  4ZMD A;  2OTL P;  3L71 J;  2QJY B;  1KYO D;  2CK3 H;  2IZ1 A;  1ZR4 A;  1KB9 D;  1ZR2 A;  5CCH A;  3MP7 B;  5APS A;  3CXH D;  4W80 A;  2JKV A;  3MTU E;  2QJP C;  2FYU G;  3HD7 C;  3M9H A;  3B8E B;  2KIK A;  3BCC J;  1FAV A;  4JYC A;  5AW4 B;  1L0L J;  3H1L J;  1BE3 E;  4XFJ A;  1SQP G;  5H2F E;  4H44 C;  1AJY A;  1LTS C;  4Y99 B;  1NU1 J;  1OMI A;  4L73 A;  1LTJ C;  5BVZ A;  2FY8 A;  3CCL P;  1SQX E;  4K3A A;  3CD6 P;  1QL2 A;  2XND H;  3RL0 D;  2I8D A;  3CC7 P;  3IR9 A;  5AVS B;  2WTY A;  2WSC J;  3AE1 C;  1M57 D;  3H25 A;  2MJZ A;  1HTL C;  2KXP B;  3CWB J;  1LTJ A;  3CX5 H;  1HGZ A;  5APW A;  4UB8 H;  5AW6 B;  1FDO A;  1FOS E;  2IFM A;  2Y0E A;  2LXC B;  3D71 A;  1IJD B;  2M5A A;  1SP4 A;  1AA0 A;  3L73 E;  1XTC C;  3H1K J;  1S4X A;  5C39 A;  3AE3 C;  2PRR A;  2AXC A;  3CME P;  4ZNC A;  3EFG A;  2W6J H;  1LTI C;  5GTH E;  3PP5 A;  2E75 B;  5TIS E;  1JCD A;  4LGD E;  2M0B A;  4HH2 A;  3P8M C;  1FC2 C;  1A02 J;  2KLU A;  3CPW O;  1L0N J;  5AVX B;  3IN6 A;  3T97 A;  3H1J D;  1SQV E;  3II6 A;  2YNY A;  3HD7 B;  1EZV E;  2OTK E;  1NTM K;  1NTZ E;  3VN0 A;  3JCU H;  1K04 A;  2M3E A;  3RK2 D;  2YXR B;  4KHX A;  1NTK J;  3GMA A;  2HLO A;  1FDI A;  1VF5 D;  1P84 E;  1N7S D;  2OYO A;  4U3F D;  1AFO A;  1LNQ A;  5CJ4 A;  1VQ4 P;  1SQQ J;  1KQL A;  4OGQ D;  5APT A;  2HFE D;  1PP9 G;  1RF0 C;  3VMX A;  2YIU B;  2A45 I;  2ZVN B;  1PIX A;  1BGY G;  4JQ0 D;  1DIP A;  3MZW B;  1U7J A;  2QRX A;  3N7N A;  1EDL A;  1QVF O;  2Y0C A;  2QVA A;  3CLQ A;  3BAS A;  5AW5 B;  3RK2 C;  1USE A;  3M91 A;  2IDB A;  1FOS F;  2H8P D;  1IFJ A;  4RO0 A;  2FYZ A;  1AV1 A;  1RF0 A;  2LKM A;  3V2Q A;  1M8O B;  1URQ C;  1EDJ A;  3H1I D;  1X0T A;  3KHU A;  2YXQ B;  3VOP A;  4DT0 A;  1S3J A;  4IL6 H;  1MV8 A;  2FYU E;  1R8E A;  1VQO P;  4JPZ B;  3D6Y A;  2E76 B;  2ZYA A;  1GL2 D;  1N7S A;  3H1H D;  1ZN5 A;  5KLV J;  2WT7 B;  1J1D B;  1URQ A;  1SQP E;  1N73 C;  3T97 B;  3MUD C;  1JO5 A;  4CPG A;  2Q7C A;  1KZU B;  1LTG C;  2A06 G;  3SWF A;  3VYI A;  1JTH A;  2WSC H;  4GOD A;  2OYI C;  1IK7 A;  1N73 A;  2R5B A;  2KUB A;  3P7K A;  3MUD A;  4IFD K;  1DD3 A;  1KQS O;  3L75 J;  2YMK A;  4HB1 A;  4W7Y A;  3H1J J;  1FJP A;  5DJU B;  4K35 A;  1BCC D;  2FXO A;  2ZT9 D;  1Y47 A;  5APV A;  1VQ9 P;  2NPS B;  4PJ0 H;  3AE9 C;  4IOI H;  2OYI A;  1GL2 A;  2QJK C;  2XU6 A;  1ZV8 A;  3G4S P;  3I55 P;  3WUT A;  1MZ9 A;  1N2D C;  2ZT9 C;  2KSJ A;  2Y0D A;  4WVZ A;  1U7M A;  3PLN A;  1SQB K;  3AEF C;  2B87 A;  1KYO I;  2HR3 A;  1PP9 J;  1IFD A;  1YJN P;  2IFN A;  5KLI C;  3C8V A;  1KTM A;  2OGU A;  2L91 A;  1L4A B;  3CXH I;  1KB9 H;  2PGD A;  4JF7 A;  1LGH B;  2N9B A;  3EWK A;  2GUV A;  2HOD B;  1G2C B;  2Q6Q A;  3G3Z A;  2E43 A;  1ZXG A;  2BCC G;  2Y9Z A;  4I7Z C;  2O01 J;  2LXB A;  4O9B A;  5BU5 A;  3LIE A;  2MKV A;  2WVR A;  1JTH B;  3V2R A;  2FBW C;  3V6I A;  2K37 A;  1FDM A;  3U1C A;  1T6A A;  3L71 G;  2A45 G;  1VQ5 P;  3RL0 g;  5KJ7 D;  1SQX K;  2ZYD A;  2KS1 B;  1RF1 C;  1FZC B;  1ZP0 C;  3L74 E;  3S1K A;  1Q2N A;  1BGY E;  2KB7 P;  2Q1K A;  5APQ A;  2KI7 B;  1GW4 A;  1FZB A;  3JSV C;  4N6J A;  4WY4 B;  4ASW A;  3BCC G;  1YIT P;  4H13 D;  3F5H A;  2BEZ F;  5K5G B;  1FU1 A;  1L0L G;  2KOG A;  1FE6 A;  2ZFC A;  1RF1 A;  1EDI A;  2POH A;  2QJK B;  1R5L A;  5KAF H;  4QMA A;  2B87 B;  1NU1 G;  3V2N A;  2K9J B;  3A2A A;  1Z56 A;  1XTG B;  4RKU J;  3FX0 A;  1FZA A;  1T3J A;  2JP3 A;  2VRS A;  4H13 C;  1OWA A;  4JYB A;  1PGO A;  2JO1 A;  1OFC X;  2FFD B;  3Q5R A;  2W90 A;  3L72 D;  1S5L H;  3TSI A;  3HTK B;  3CCS P;  5KLI B;  1VQ8 P;  4N78 E;  4GT1 A;  3CX5 E;  5AVQ B;  1MUU A;  4UB8 E;  3M0D C;  2BEQ D;  1UIX A;  1SQV K;  4EYY Q;  2P67 A;  4HJG H;  5KKZ B;  1NWQ A;  1LJ2 A;  2QEX P;  4AQR D;  1W2B O;  1VPC A;  1OVV A;  5CCG D;  5APY A;  3NFQ A;  1SQV D;  1LWU B;  3OAK A;  3M0D A;  1NTZ K;  2QIW A;  1EZV D;  2BCC J;  2RMZ A;  1OXZ A;  1KIL C;  5L8R J;  2RKL A;  1PPJ G;  3A7O A;  1NTZ D;  4JBZ A;  4PV1 C;  1SLQ A;  1SQB E;  1G1I A;  3CC4 P;  1X8Y A;  5CCG C;  1H0T A;  2AEM A;  1L0N G;  2IYO A;  1P84 D;  4GIF A;  4R4M A;  3V2P A;  3RK3 C;  2WPV B;  1KIL A;  3A3Y B;  2QA4 P;  2JEE A;  1CI6 A;  3F89 A;  4AUW A;  2O3J A;  2JR8 A;  3AED C;  1PGJ A;  1GU5 A;  2WSF J;  1FBM A;  2D2C C;  1NAF A;  5KAI H;  1HJ0 A;  5CCG A;  1FZG A;  1JOC A;  1ZRT E;  3CCV P;  1NJI Q;  3JCU E;  1IFN A;  2ZXE B;  2C9N Y;  1JNM A;  1JMM A;  2V7Q J;  3GLM A;  2WPR A;  1NTK G;  2R44 A;  2O01 H;  1S1C X;  2FYU K;  3B5N D;  3Q2Y A;  1SQQ G;  2I1K A;  3AE6 C;  1S72 P;  1OIP A;  3PRJ A;  2J58 A;  4C7N A;  3C1L A;  4IFM A;  1SQP K;  2UWJ E;  3I56 P;  3C9I A;  1WT6 A;  4PD4 I;  3PJS K;  1L2P A;  3AE2 C;  3L70 D;  1Q86 Q;  3R4Y A;  1CSB A;  3L71 E;  1W5C E;  2ZYG A;  3Q1M A;  3L72 J;  3V5B A;  1OZH A;  1AQT A;  2KNC A;  3R2P A;  3B5N C;  5AVZ B;  4D6T D;  4I6M C;  1R5S A;  2K88 A;  2C0W A;  2AXT H;  4XE5 B;  3BCC E;  4IL6 E;  1L0L E;  3H1L E;  2E76 D;  3B5N A;  3RL0 C;  5KLV G;  3CCQ P;  1SFC D;  3SWY A;  1EXJ A;  1KIL B;  1NU1 E;  3S9O A;  3HE4 A;  1E5W A;  1CI6 B;  5M1B A;  3HRN A;  4PV1 B;  2HPC A;  2HG5 D;  1USD A;  1VQP P;  2PAJ A;  2YKP A;  3A0H H;  2OTJ P;  1Q90 D;  5AW3 B;  2OAR A;  3AEB C;  2PFX A;  3L37 A;  1H8A A;  1SFC C;  3L75 G;  3TGU E;  3H1J G;  3CWB E;  3GHG C;  1KV4 A;  4W7Z A;  3AEE C;  2H89 C;  2D2C B;  1DEB A;  1NKN A;  1M1J C;  5AW7 B;  3WU2 H;  1JCC A;  2QJP B;  4L76 A;  4PJ0 E;  3HUS C;  3H1K E;  1SFC A;  3OJA B;  3GHG A;  2J5U A;  4H44 B;  1UII A;  1FJK A;  1M1J A;  1NTM D;  5EFW B;  4U3F G;  3B71 A;  1LTJ B;  4ZKU A;  4C46 A;  2J59 M;  3HUS A;  1JB0 J;  3L36 A;  4WWI A;  1OW6 A;  3KXD A;  2IBZ E;  1NHL A;  2XZR A;  2JDI H;  2IZ0 A;  3GF3 A;  4HKZ H;  5AW0 B;  3Q5S A;  1AVY A;  2M5A B;  2E5Y A;  2N1T D;  3SFD C;  3L70 J;  3HE5 A;  4GOE A;  1L4A D;  3S4R A;  2A45 H;  2W83 C;  1L0N E;  1KB9 E;  1FZF A;  1LTT C;  2KZJ A;  5AVW B;  1VF5 C;  1N7S C;  4D6T J;  2WMM A;  2HPC B;  2WSF H;  3L74 D;  1QLE D;  4OGQ C;  3VMA A;  2XV5 A;  1IO4 A;  2Q9I A;  2N1T C;  1J1E C;  1IFM A;  3CI9 A;  1ZW0 A;  2V7Q H;  3H1H G;  3KZI H;  4L75 A;  3TNU A; 
#chains in the Genus database with same CATH homology
 2KS1 A;  3L73 D;  1PP9 D;  3H1L D;  3PHL A;  4RJT A;  1BGY D;  3PRJ A;  2QJP B;  5TJH A;  1L0N D;  5KLV D;  5KKZ B;  3ITK A;  4U3F D;  2Y0E A;  4PD4 D;  3FWL A;  1BCC D;  3L70 D;  1PPJ D;  3GG2 A;  2YIU B;  3BCC D;  1SQV D;  2N9Y B;  4A7P A;  1L0L D;  3TF5 A;  1NTM D;  2Y0C A;  1EZV D;  4EDF A;  2RMZ A;  2QJY B;  1KYO D;  4D6T D;  2FYU D;  1BE3 D;  1KB9 D;  2QG4 A;  1NU1 D;  1NTZ D;  3TGU D;  1NTK D;  3CWB D;  3CXH D;  3CX5 D;  3L75 D;  1SQP D;  2Q3E A;  3PTZ A;  2Y0D A;  1SQQ D;  1ZRT D;  3H1I D;  2QJK B;  3KHU A;  3PLN A;  2KNC B;  1P84 D;  1SQX D;  2K9J B;  3H1K D;  2JWA A;  2O3J A;  2L91 A;  2A06 D;  2BCC D;  3H1H D;  2FYN B;  3L74 D;  3H1J D;  2RN0 A;  3TDK A;  3VMA A;  3GW6 A;  3L72 D;  5KLI B;  2IBZ D;  3L71 D;  1SQB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...