2K9JB

Integrin alphaiib-beta3 transmembrane complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
43
structure length
43
Chain Sequence
PESPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Integrin alpha-IIb light chain
publication title The structure of the integrin alphaIIbbeta3 transmembrane complex explains integrin transmembrane signalling
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2008-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2k9jB00
3KHUA 1BCCD 2FYNB 2L91A 1ZRTD 2IBZD 2Y0EA 1SQQD 2KS1A 2N9YB 1SQBD 1KB9D 1NU1D 3GG2A 1KYOD 2QJPB 3ITKA 5KLVD 1EZVD 3L71D 2Y0DA 3L72D 2KNCB 1SQXD 1NTMD 3H1HD 2K9JB 2RMZA 3PRJA 2QJKB 4U3FD 4EDFA 3H1LD 4PD4D 3BCCD 1P84D 1L0ND 3H1ID 3VMAA 3H1JD 3PTZA 1SQVD 4RJTA 2FYUD 3L70D 3H1KD 5KLIB 4D6TD 3TDKA 2BCCD 1NTZD 1L0LD 1SQPD 3L75D 3TF5A 1PP9D 1PPJD 3GW6A 2A06D 3L73D 3TGUD 1BGYD 2O3JA 2QJYB 3L74D 3PLNA 3CXHD 2JWAA 2YIUB 4A7PA 1BE3D 3CX5D 2Y0CA 3FWLA 5TJHA 5KKZB 3PHLA 1NTKD 2Q3EA 2RN0A 2QG4A 3CWBD
chains in the Genus database with same CATH superfamily
3TGUE 2VRSA 4NPDA 2P10A 3VN0A 5GTHH 2O01J 3MHVA 3CWBG 3H1KJ 1DEBA 2HR3A 2P58A 4WB4A 1L0LJ 1U7JA 1BDDA 3L73G 2WPSA 1X22A 2JP3A 3WUTA 2YO2A 1ZR4A 2KLVA 1PGPA 2YMKA 1UIIA 1Q86Q 2K9YA 3L74E 5TISE 1CW5A 2PGDA 4OGQB 3H1LD 2QJPC 3Q5RA 1XTGB 2WSEH 2P2UA 1OVVA 2I1KA 3V4WA 4I7ZB 1RE4A 1DD4A 1NTME 2HPCA 1IC2A 3CXHH 3CWBJ 2QEXP 2A45I 1S3JA 3M9BA 1XTCC 4I1LA 1LTTC 4WY4C 1NKZB 3KZIH 2FFDA 1H8AA 1P84E 1T6AA 2FXMA 2YXRB 3S4RA 3KZIE 1SQXE 2NRGA 3SSUA 4PV1B 1BGYD 1E5WA 2V4HA 3NTNA 2FBWC 4YPCA 1BSNA 2YKOA 1EDKA 2H7HA 4ZKUA 1GL2B 1HJ0A 4H44B 2XNXA 1A02F 3RL0B 2Z4EA 4D6TG 2XNDH 2HLOA 3OW2O 2QA4P 1VQ7P 5L8RJ 2JJLA 5GTIH 1KMIZ 2IYOA 1OW7A 2RH0A 5CCHC 2W6BA 1BCCE 2RMZA 1S9KE 1GU4A 1P84I 2ZT9C 2C0XA 2R5BA 1L0NK 1CI6B 2MJZA 2ZYAA 1GL2A 4PD4D 1SQVK 3CCSP 3I55P 3KDPB 3RK2B 3BRVB 1KB9H 2N1TD 4HJGH 4JYBA 3H1KD 4IFFA 3G4SP 3JCUH 3FX0A 2AEJA 4Z1MH 1KB9E 1FZAA 1L0LD 5AW2B 3Q1MA 2ZJSE 3HUSC 3JCUE 1SQVG 4AQRD 3M0DA 3GLMA 2B87B 3L70G 4ZNCA 2KIKA 2G8YA 2C9NY 1SFCC 1X79B 4DCKA 5CMZA 2KS1B 1JY2N 4LC1A 1CI6A 1WT6A 1N7SB 4OH8B 3CWBD 3FWNA 1YJWP 3G3ZA 3CPWO 3BCCJ 2E74B 1OWAA 1RE3A 3ZDMA 2BCCG 1L0NJ 2E75C 2Z5HA 1ZRTD 2IBZD 2N1TA 1SQVJ 1JY2P 3LIDA 1VDFA 5APSA 4HH2A 3L70J 1G2CB 2LXBA 2I8DA 2B87A 4IL6E 2PAJA 3H1HD 3KPEA 3AEBC 1WRGA 2H43A 5AVVB 1RHZB 2H8PD 4U7JA 3PH0A 3L74J 1KN7A 4IL6X 2BCCJ 1IFMA 2QSIA 3MGNA 4BWNA 4W7ZA 1AVOA 2ZXEB 1K9MQ 4L75A 3VMXA 2FYUD 1K8AQ 2WSEJ 1K04A 1G2CA 3AEDC 1L4AB 3F5HA 2E76D 2KB7P 4W7YA 5CJ4A 2KZIA 3V5BA 4WVZA 3HD7B 2Q6QA 2K37A 2XDJA 1KQFB 1MZ9A 1NVOA 1LTGC 3H6PA 1VF5C 2R32A 5TJHA 2AXTH 5AW3B 1ZXGA 1N7LA 5AVRB 3L75G 3CCMP 1KQGB 1PPJG 3GG2A 3CC7P 1JMBA 2C0WA 2R3SA 4H13C 2WSCH 1GDTA 1VQ4P 1RE4C 1USDA 1T3JA 3LW5J 3AE2C 3HD7A 2DW3A 1W2EA 1T2KC 3BCCD 2C9LY 3N4XA 3R4YA 1FC2C 2AEFA 1L0ND 1IO4A 2WSFH 1RH5B 1SQVD 5H2FH 1NHLA 3L70D 3CI9A 4OGQC 1MUUA 3TDKA 4C7RA 1ZMEC 4EOTA 1S2EA 4I7ZC 1EZVE 3M06A 3CLQA 2M3EA 1LTJB 3IAOA 3C1LA 3H1LG 3L74D 1FBMA 2WZ7A 1PP9G 1VQPP 2H88C 1VQ8P 2WQYC 3VMYA 4MN4C 2Y0CA 4KHXA 1URQD 1MKMA 2WPRA 5E79H 4PV1C 1YQ3C 1SQBK 2V7QH 3L73E 1NGMB 3R2PA 2E5YA 2E75B 2WMMA 1RQUA 1GL2C 3Q3DA 1G1IA 2CK3H 4JPZB 2WT7A 4H44C 3WU2E 1QVGO 1AA0A 1HF9A 1BGYG 2Y0DA 2NPSB 1NAYA 3RL0C 1SQXD 3MZWB 1PP9J 1NJIQ 2XU6A 1LTJA 3CCVP 5KAIE 1KQLA 4LGDE 1FS0E 5KJ7D 3VMZA 4K35A 2P7JA 5AW4B 3M0DC 2KOGA 3B5NB 1NOHA 1AQ5A 2N9BA 4I6MC 3CL3D 4ASVA 3N7NA 4I2LC 2HYNA 3W67A 3VP9A 1SQBJ 3B71A 1IZNB 3MUDA 5DJTB 3M0AA 3RK2C 3L4FA 2NPSA 1RE3C 3CCUP 3L71J 1H88A 4OVNF 1S4XA 3KQGA 2ZXXA 4PJ0E 1M1KQ 1SQPE 4Y28J 5KKZC 3A2AA 3B5NA 3H1KG 5KTBA 3CCJP 1NU1K 1L0LG 3H1JJ 1KB9D 1DIPA 2A45H 2KYVA 1EQ7A 1N7SC 2GA1A 3SFDC 5APVA 2E74C 4JBZA 5CHXA 1Y8AA 1PL5A 2HPCB 1W5CE 3FGAD 1AJYA 3SWYA 1YBKA 1SQQE 1USEA 2WSCJ 3CCEP 4EDFA 1JM0A 1FDOA 1GZLA 2FFDB 1NTKE 1DH3A 5CCGA 3V4QA 2IBZG 5TISH 4W80A 4IFDK 1T8ZA 3IFMA 3L35A 2WSFJ 1IK7A 1PP9D 3H1HG 3VTPC 3KYQA 3RK3D 1NU1J 2FYUK 3BATA 3HE5B 1LT9B 2AXCA 2PP6A 2QJYC 1KILD 4KJMA 2O3JA 3P8CD 2W27A 1H89A 1P84H 2Q5UA 1L4AC 3I56P 1UIXA 3MD0A 1FOSE 4XE5B 4JF7A 2FYUG 4BRYB 4EYYQ 2Q1KA 3BRTB 4GOFA 1FZFA 2FYNB 3HD7C 2D2CD 3H1HJ 1SQBD 3V2NA 3CX5E 1E79H 1QL1A 2V7QJ 4UB8H 1M1JB 1J1EB 3L71D 3HE5A 4UB8E 1LT9A 3WMM0 3M9HA 1OW6A 2QJKB 3B4SA 1KILA 1DD3A 4L76A 3AE7C 2IFNA 2FYUJ 2O1JA 5KLVE 1QLED 2Q3IA 1M7LA 1R5SA 4BRYA 2HFED 1W2BO 3H1JD 1LTAC 1Q81Q 1NTZK 4HKZH 3MTUE 3P32A 3SWFA 2OTLP 3EQ2A 1Q7YQ 1M1JA 3E1IA 3SFEC 2OYHB 4ZMDA 3CXHI 2Q9IA 2YKQA 1CZQA 3GW6A 3L72E 2CPBA 1FDMA 3CX5I 3V2RA 3NXSA 4NPFX 4O9BA 5AW1B 1VQMP 2N1TB 2YIUB 3BCCG 4A7PA 2A45G 3II6A 1LTSC 1Y47A 1L0NG 2P67A 3L75E 1M56D 5KAFH 1SVFA 5KKZB 2B88A 2RN0A 3D70A 2RKLA 4N78E 4DOJA 5KAFE 1QEXA 4L73A 1X8YA 1LTJC 1KYOI 3JSVC 3H1IJ 4H0LD 1D7MA 2ITAA 5APQA 5AW9B 1NU1D 1NTMK 2JEEA 2OYHA 2E43A 3TNUA 1NTZJ 1EZVD 2POHA 2IZ0A 1HBWA 4UB6E 3L74G 1YYCA 1HJBA 3HE4B 4LLHA 3TGUJ 4IL6H 3T97B 2OYIB 2R44A 1FE6A 1SQXK 2W83C 1AQTA 1L2PA 2NPSC 1EXJA 1S1CX 1S5LE 2Q7CA 2ZYDA 2M8RA 1U57A 1AV1A 3AEGC 3TSIA 3SWKA 1JY2O 1JCCA 3CC2P 3LIEA 1CSBA 1SQXG 1JY3N 1SP4A 3B5NC 1K73Q 1FJKA 1S5LX 2KLUA 1QVFO 3HE4A 1KQSO 2A06D 4WWIA 2ZYGA 1FZBA 2QM8A 1VQKP 1IFDA 2JKVA 2QJYB 3B8EB 4U3FE 1NTMJ 3WUUA 3VP8A 3T97A 1SLQA 2OYIA 5CJ0A 2W8ZA 3TK1A 2HODB 1JCDA 1JY3P 1OX3A 3D71A 4WBAA 3KHUA 1BGYE 2E76B 3O6QB 3AEFC 1WMKA 2FXOA 1IFJA 2WVRA 1SQXJ 4Y99B 2N9YB 1M57D 3PJSK 4WY4D 1RQVA 2K1AA 3A0HH 1HGZA 1HWTC 5CCGC 1BCCG 1EDIA 2BEQD 1BSHA 3A0HE 1ZLLA 5AW5B 2K9JB 3U1CA 3CCRP 1YTZI 3P8MC 3M9QA 3Q5PA 1RF1B 3AE5C 3A7OA 5AVQB 2ZFCA 1BE3E 1FDIA 4YXDC 2HODA 2PFXA 2SPZA 1JB0J 3H1ID 1R8EA 3VMAA 3O6QA 1IJDB 5KLIC 1Q2NA 1VQ5P 4ASWA 5CBOA 1BCCJ 2AEMA 1NTZD 3A0BE 1GK4A 1N86A 3GF3A 4PD4E 2E5TA 2FFDC 5CCHD 2QIWA 3D6YA 4GIFA 2O1KA 5BU5A 4K3AA 3AE8C 2K9JA 2ZT9D 3TGUD 4N6JA 1RF1A 2IX7C 1L0LE 5AVSB 2KK7A 2WT7B 1NTKD 3U1AA 1LT9C 3CCQP 1FZGA 1JO5A 1HGVA 1EC5A 4N3YB 2Y0EA 1EDLA 4C7NA 4QMAA 3HTKA 3CWBE 2LKMA 2GUSA 1NTMD 1URQB 5EFWB 2FYNC 1SFCD 5APUA 4PD4I 1G1JA 2IBZE 1NAFA 2WITA 3WU2H 2L5GB 4RKUJ 2B89A 1M1JC 1J1EC 1P84D 2UWJE 1GU5A 5KAIH 2E75D 2JDIH 1SQBG 1IFNA 2QJKC 1GD2E 4R4MA 5B66E 1GMJA 1OFCX 1HUCA 3L71G 2XKMA 2OTJP 1YI2P 3JC22 3BASA 3GHGB 1URQA 3A5TA 1JTHB 1PGOA 5M1BA 1OW8A 2IZ1A 3G9RA 3AECC 2BEZF 2OYHC 4JYCA 3H1JG 2IBZI 1OXZA 4AYCA 4GOEA 4PJ0H 1BCCD 2L91A 3PP5A 1S9KD 2OARA 5BU8B 2N1TC 2YIUC 4D6TE 3D6ZA 4YXWH 5KJ7A 1GTWA 1FU1A 1AFOA 3GHGA 3L72D 1J2JB 5AVYB 1JTHA 3PRJA 3E1RA 2OTKE 3CMAP 1VF5D 1RF0A 4HB1A 1NWQA 4RESB 1BE3J 1A02J 1QL2A 2H89C 4N78D 1NU1G 2KP8A 5KLIB 2Z5IA 2OYIC 5AVTB 1EZVG 5K5GB 4H13D 5APYA 4XFJA 3OAKA 5CBNA 1L0NE 4GKGA 1LJ2A 1N73A 2NZ2A 1SQVE 2PRRA 2Y9ZA 1DEEG 1KV4A 1HH0A 3L70E 1NO4A 1OMIA 5GTHE 1T2KD 3FXDA 1H0TB 4NPEA 4HYTB 2R3CA 1X9VA 1GK6A 2W90A 3P7KA 3W68A 1ZP0C 3HRNA 3RK3B 3RL0g 4OGQD 1PGQA 1EDJA 2XZRA 1KILB 1LWUB 2BCCE 2JO1A 2A06G 4CPGA 3UIAA 3H32B 4EI2A 2R5DA 2E76C 1Q82Q 3BVHA 3OA7A 5APTA 2WPQA 4U3FD 3CX5H 4Y99C 3CXHE 1GW4A 1PZQA 1R5LA 3L73J 3IF4A 1H0TA 2D2CB 4PV1D 3H25A 2W6AA 3M91A 1K05A 5AW7B 5B5EH 4TLFA 1VQOP 1RF1C 1SQPK 5B5EE 1KYOH 1KZUB 3V2PA 1LWUA 2J58A 1GL2D 4H44D 1KYOE 1FZCB 3RL0D 1IK9A 1QX8A 3H32A 1Z56A 1ZN5A 1JEKA 1SQPG 3L36A 2ZAEB 1JNMA 2YMYA 5AW6B 2FXPA 1BE3D 1NH4A 3LW5H 4L74A 3H1IG 3MP7B 3PHLA 3TNUB 2FYZA 5GTIE 1JOCA 1SQQK 4DZOA 3RGUA 3NFQA 1NTZG 2K3RA 4TT3H 4XA4A 1AVYA 2KI7B 1NTKK 1VPCA 5AVZB 2QE7H 3ITKA 3RK2D 4D6TJ 1FZCA 3TGUG 1SQPJ 1PPJE 1SQQG 1M8OB 1KTMA 2GM4A 1FAVA 2JR8A 1MV8A 1NTKG 3QWOC 3RBZA 4H0LB 1X0TA 1YIJP 4UB6H 2OGUA 2XV5A 3IR9A 2J59M 4B86A 1IFPA 1URQC 3ABVC 3PTZA 4C46A 4GDOA 1OVUA 1HVVA 1YTZT 2BASA 1VQ6P 1N7SD 1J1DB 1SQQJ 4DT0A 3TF5A 1NTMG 1S5LH 3K5BA 3AE6C 3MUDC 2E74D 1LTIC 1GW3A 3CC4P 1NTKJ 3L73D 3FXEA 3E7KA 3GF7A 1ZV8A 3O8ZA 1JMMA 3H1LE 2E42A 5KJ7C 3NMDA 1EXIA 3AEEC 1PP9E 2Q3EA 3RK3E 3VYIA 3Q5SA 3GHGC 1KB9I 1U7MA 1KILE 1SS1A 5KLVK 3P8CE 2KS1A 2I1JA 4GT1A 1RF0C 2KSEA 3TYYA 1N7SA 1N8RQ 2QJPB 1ZW0A 2HG5D 3AE4C 1KFMA 2CPSA 1QGKB 2IYPA 1KC8Q 3S9OA 1N2DC 5KLVG 1SQBE 1L4AD 3GMAA 1JY3O 1YJNP 3AE9C 4WY4B 3L71E 2FY8A 2B9BA 3CMEP 1N73C 3HD7D 1NKNA 4RJTA 2IDBA 3V6IA 3Q2YA 4D6TD 1IFIA 3WUVA 2G3AA 1S72P 1MFTA 4KT0J 2LR2A 1JUNA 1SQPD 3L72G 1T3UA 3G71P 2ZVNB 3MIWA 2OYOA 2Y9YA 4EIJA 5KLVJ 3H1JE 2AXTE 4OWFA 1VQLP 3A0BH 1MFZA 2IFMA 2J5UA 1YJ9P 4PD4H 2W6JH 2JWAA 1YITP 4C7NB 1L4AA 2O01H 4WY4A 1PFIA 2M5AB 3HTKB 2QM7A 4JQ0D 3EFFK 2P1JA 2M0BA 3L72J 3H1KE 1SQQD 2ZT9B 2QVAA 2QRXA 3EFGA 4BXLA 1LNQA 2IPPA 3A3YB 1FZEA 2WTYA 3L75J 2KXPB 1ZR2A 3RBXA 3RK3C 5AW0B 3EWKA 2O01N 1KILC 1LWUC 1OIPA 5H2FE 2YO3A 2WWWA 1NU1E 2GUVA 3C8VA 1VL2A 2M5AA 1ZOYC 3HUSB 3AE1C 5CCHA 4M3LA 1TU3F 1PIXA 4YTPC 1FOSF 1YQ4C 1ZRTE 1LTBC 2YXQB 1SFCB 5BVZA 2BCCD 1Q90D 2D2CC 1NYHA 3OJAB 1LP1B 2OQQA 4RO0A 4U3FG 3H1HE 5B66H 1OZHA 5E79E 3CCLP 3CXHD 2WSSH 1YHQP 3CX5D 2K88A 2LXCB 4R4LA 1FZCC 2NPSD 3HUSA 3QH9A 5APXA 3H1LJ 3IN6A 4IOIH 2A06E 3AE3C 1VQNP 1LT1A 5APWA 2FYUE 1EZVI 1SFCA 1FJPA 1HTLC 3I5CA 3C9IA 2JWDA 5AW8B 2FKWB 4U3FJ 3B5ND 2M3BA 3V2QA 1KYOD 4DJGA 3CD6P 1LP1A 5KLVD 2KNCB 2YNYA 1OVRA 1BE3G 3F89A 4ZKPA 1BDCA 1BGYJ 3S1KA 4IFMA 3VOPA 5AVXB 2ZVOB 5AVWB 1VQ9P 1KFNA 1M90Q 2YKPA 1N73B 1L0LK 2KSJA 4GODA 4H0LC 1KD1Q 3G6EP 5CCGD 2KZJA 3L75D 3U59A 1VF5B 3KXDA 5DJUB 1PPJD 2KNCA 3H1IE 3USSA 5AVUB 1DX7A 2KUBA 4AUWA 1RY3A 3PLNA 3L37A 1KORA 2WPVB 1LGHB 1NTZE 1J1DC 3FWLA 2MKVA 1PV3A 1PGJA 3BCCE 3AEAC 5C39A 2QG4A 4H13B 1Y9BA
chains in the Genus database with same CATH topology
3KHUA 1BCCD 2FYNB 2L91A 1ZRTD 2IBZD 2Y0EA 1SQQD 2KS1A 2N9YB 1SQBD 1KB9D 1NU1D 3GG2A 1KYOD 2QJPB 3ITKA 5KLVD 1EZVD 3L71D 2Y0DA 3L72D 2KNCB 1SQXD 1NTMD 3H1HD 2K9JB 2RMZA 3PRJA 2QJKB 4U3FD 4EDFA 3H1LD 4PD4D 3BCCD 1P84D 1L0ND 3H1ID 3VMAA 3H1JD 3PTZA 1SQVD 4RJTA 2FYUD 3L70D 3H1KD 5KLIB 4D6TD 3TDKA 2BCCD 1NTZD 1L0LD 1SQPD 3L75D 3TF5A 1PP9D 1PPJD 3GW6A 2A06D 3L73D 3TGUD 1BGYD 2O3JA 2QJYB 3L74D 3PLNA 3CXHD 2JWAA 2YIUB 4A7PA 1BE3D 3CX5D 2Y0CA 3FWLA 5TJHA 5KKZB 3PHLA 1NTKD 2Q3EA 2RN0A 2QG4A 3CWBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KHU A;  1BCC D;  2FYN B;  2L91 A;  1ZRT D;  2IBZ D;  2Y0E A;  1SQQ D;  2KS1 A;  2N9Y B;  1SQB D;  1KB9 D;  1NU1 D;  3GG2 A;  1KYO D;  2QJP B;  3ITK A;  5KLV D;  1EZV D;  3L71 D;  2Y0D A;  3L72 D;  2KNC B;  1SQX D;  1NTM D;  3H1H D;  2K9J B;  2RMZ A;  3PRJ A;  2QJK B;  4U3F D;  4EDF A;  3H1L D;  4PD4 D;  3BCC D;  1P84 D;  1L0N D;  3H1I D;  3VMA A;  3H1J D;  3PTZ A;  1SQV D;  4RJT A;  2FYU D;  3L70 D;  3H1K D;  5KLI B;  4D6T D;  3TDK A;  2BCC D;  1NTZ D;  1L0L D;  1SQP D;  3L75 D;  3TF5 A;  1PP9 D;  1PPJ D;  3GW6 A;  2A06 D;  3L73 D;  3TGU D;  1BGY D;  2O3J A;  2QJY B;  3L74 D;  3PLN A;  3CXH D;  2JWA A;  2YIU B;  4A7P A;  1BE3 D;  3CX5 D;  2Y0C A;  3FWL A;  5TJH A;  5KKZ B;  3PHL A;  1NTK D;  2Q3E A;  2RN0 A;  2QG4 A;  3CWB D; 
#chains in the Genus database with same CATH topology
 3TGU E;  2VRS A;  4NPD A;  2P10 A;  3VN0 A;  5GTH H;  2O01 J;  3MHV A;  3CWB G;  3H1K J;  1DEB A;  2HR3 A;  2P58 A;  4WB4 A;  1L0L J;  1U7J A;  1BDD A;  3L73 G;  2WPS A;  1X22 A;  2JP3 A;  3WUT A;  2YO2 A;  1ZR4 A;  2KLV A;  1PGP A;  2YMK A;  1UII A;  1Q86 Q;  2K9Y A;  3L74 E;  5TIS E;  1CW5 A;  2PGD A;  4OGQ B;  3H1L D;  2QJP C;  3Q5R A;  1XTG B;  2WSE H;  2P2U A;  1OVV A;  2I1K A;  3V4W A;  4I7Z B;  1RE4 A;  1DD4 A;  1NTM E;  2HPC A;  1IC2 A;  3CXH H;  3CWB J;  2QEX P;  2A45 I;  1S3J A;  3M9B A;  1XTC C;  4I1L A;  1LTT C;  4WY4 C;  1NKZ B;  3KZI H;  2FFD A;  1H8A A;  1P84 E;  1T6A A;  2FXM A;  2YXR B;  3S4R A;  3KZI E;  1SQX E;  2NRG A;  3SSU A;  4PV1 B;  1BGY D;  1E5W A;  2V4H A;  3NTN A;  2FBW C;  4YPC A;  1BSN A;  2YKO A;  1EDK A;  2H7H A;  4ZKU A;  1GL2 B;  1HJ0 A;  4H44 B;  2XNX A;  1A02 F;  3RL0 B;  2Z4E A;  4D6T G;  2XND H;  2HLO A;  3OW2 O;  2QA4 P;  1VQ7 P;  5L8R J;  2JJL A;  5GTI H;  1KMI Z;  2IYO A;  1OW7 A;  2RH0 A;  5CCH C;  2W6B A;  1BCC E;  2RMZ A;  1S9K E;  1GU4 A;  1P84 I;  2ZT9 C;  2C0X A;  2R5B A;  1L0N K;  1CI6 B;  2MJZ A;  2ZYA A;  1GL2 A;  4PD4 D;  1SQV K;  3CCS P;  3I55 P;  3KDP B;  3RK2 B;  3BRV B;  1KB9 H;  2N1T D;  4HJG H;  4JYB A;  3H1K D;  4IFF A;  3G4S P;  3JCU H;  3FX0 A;  2AEJ A;  4Z1M H;  1KB9 E;  1FZA A;  1L0L D;  5AW2 B;  3Q1M A;  2ZJS E;  3HUS C;  3JCU E;  1SQV G;  4AQR D;  3M0D A;  3GLM A;  2B87 B;  3L70 G;  4ZNC A;  2KIK A;  2G8Y A;  2C9N Y;  1SFC C;  1X79 B;  4DCK A;  5CMZ A;  2KS1 B;  1JY2 N;  4LC1 A;  1CI6 A;  1WT6 A;  1N7S B;  4OH8 B;  3CWB D;  3FWN A;  1YJW P;  3G3Z A;  3CPW O;  3BCC J;  2E74 B;  1OWA A;  1RE3 A;  3ZDM A;  2BCC G;  1L0N J;  2E75 C;  2Z5H A;  1ZRT D;  2IBZ D;  2N1T A;  1SQV J;  1JY2 P;  3LID A;  1VDF A;  5APS A;  4HH2 A;  3L70 J;  1G2C B;  2LXB A;  2I8D A;  2B87 A;  4IL6 E;  2PAJ A;  3H1H D;  3KPE A;  3AEB C;  1WRG A;  2H43 A;  5AVV B;  1RHZ B;  2H8P D;  4U7J A;  3PH0 A;  3L74 J;  1KN7 A;  4IL6 X;  2BCC J;  1IFM A;  2QSI A;  3MGN A;  4BWN A;  4W7Z A;  1AVO A;  2ZXE B;  1K9M Q;  4L75 A;  3VMX A;  2FYU D;  1K8A Q;  2WSE J;  1K04 A;  1G2C A;  3AED C;  1L4A B;  3F5H A;  2E76 D;  2KB7 P;  4W7Y A;  5CJ4 A;  2KZI A;  3V5B A;  4WVZ A;  3HD7 B;  2Q6Q A;  2K37 A;  2XDJ A;  1KQF B;  1MZ9 A;  1NVO A;  1LTG C;  3H6P A;  1VF5 C;  2R32 A;  5TJH A;  2AXT H;  5AW3 B;  1ZXG A;  1N7L A;  5AVR B;  3L75 G;  3CCM P;  1KQG B;  1PPJ G;  3GG2 A;  3CC7 P;  1JMB A;  2C0W A;  2R3S A;  4H13 C;  2WSC H;  1GDT A;  1VQ4 P;  1RE4 C;  1USD A;  1T3J A;  3LW5 J;  3AE2 C;  3HD7 A;  2DW3 A;  1W2E A;  1T2K C;  3BCC D;  2C9L Y;  3N4X A;  3R4Y A;  1FC2 C;  2AEF A;  1L0N D;  1IO4 A;  2WSF H;  1RH5 B;  1SQV D;  5H2F H;  1NHL A;  3L70 D;  3CI9 A;  4OGQ C;  1MUU A;  3TDK A;  4C7R A;  1ZME C;  4EOT A;  1S2E A;  4I7Z C;  1EZV E;  3M06 A;  3CLQ A;  2M3E A;  1LTJ B;  3IAO A;  3C1L A;  3H1L G;  3L74 D;  1FBM A;  2WZ7 A;  1PP9 G;  1VQP P;  2H88 C;  1VQ8 P;  2WQY C;  3VMY A;  4MN4 C;  2Y0C A;  4KHX A;  1URQ D;  1MKM A;  2WPR A;  5E79 H;  4PV1 C;  1YQ3 C;  1SQB K;  2V7Q H;  3L73 E;  1NGM B;  3R2P A;  2E5Y A;  2E75 B;  2WMM A;  1RQU A;  1GL2 C;  3Q3D A;  1G1I A;  2CK3 H;  4JPZ B;  2WT7 A;  4H44 C;  3WU2 E;  1QVG O;  1AA0 A;  1HF9 A;  1BGY G;  2Y0D A;  2NPS B;  1NAY A;  3RL0 C;  1SQX D;  3MZW B;  1PP9 J;  1NJI Q;  2XU6 A;  1LTJ A;  3CCV P;  5KAI E;  1KQL A;  4LGD E;  1FS0 E;  5KJ7 D;  3VMZ A;  4K35 A;  2P7J A;  5AW4 B;  3M0D C;  2KOG A;  3B5N B;  1NOH A;  1AQ5 A;  2N9B A;  4I6M C;  3CL3 D;  4ASV A;  3N7N A;  4I2L C;  2HYN A;  3W67 A;  3VP9 A;  1SQB J;  3B71 A;  1IZN B;  3MUD A;  5DJT B;  3M0A A;  3RK2 C;  3L4F A;  2NPS A;  1RE3 C;  3CCU P;  3L71 J;  1H88 A;  4OVN F;  1S4X A;  3KQG A;  2ZXX A;  4PJ0 E;  1M1K Q;  1SQP E;  4Y28 J;  5KKZ C;  3A2A A;  3B5N A;  3H1K G;  5KTB A;  3CCJ P;  1NU1 K;  1L0L G;  3H1J J;  1KB9 D;  1DIP A;  2A45 H;  2KYV A;  1EQ7 A;  1N7S C;  2GA1 A;  3SFD C;  5APV A;  2E74 C;  4JBZ A;  5CHX A;  1Y8A A;  1PL5 A;  2HPC B;  1W5C E;  3FGA D;  1AJY A;  3SWY A;  1YBK A;  1SQQ E;  1USE A;  2WSC J;  3CCE P;  4EDF A;  1JM0 A;  1FDO A;  1GZL A;  2FFD B;  1NTK E;  1DH3 A;  5CCG A;  3V4Q A;  2IBZ G;  5TIS H;  4W80 A;  4IFD K;  1T8Z A;  3IFM A;  3L35 A;  2WSF J;  1IK7 A;  1PP9 D;  3H1H G;  3VTP C;  3KYQ A;  3RK3 D;  1NU1 J;  2FYU K;  3BAT A;  3HE5 B;  1LT9 B;  2AXC A;  2PP6 A;  2QJY C;  1KIL D;  4KJM A;  2O3J A;  3P8C D;  2W27 A;  1H89 A;  1P84 H;  2Q5U A;  1L4A C;  3I56 P;  1UIX A;  3MD0 A;  1FOS E;  4XE5 B;  4JF7 A;  2FYU G;  4BRY B;  4EYY Q;  2Q1K A;  3BRT B;  4GOF A;  1FZF A;  2FYN B;  3HD7 C;  2D2C D;  3H1H J;  1SQB D;  3V2N A;  3CX5 E;  1E79 H;  1QL1 A;  2V7Q J;  4UB8 H;  1M1J B;  1J1E B;  3L71 D;  3HE5 A;  4UB8 E;  1LT9 A;  3WMM 0;  3M9H A;  1OW6 A;  2QJK B;  3B4S A;  1KIL A;  1DD3 A;  4L76 A;  3AE7 C;  2IFN A;  2FYU J;  2O1J A;  5KLV E;  1QLE D;  2Q3I A;  1M7L A;  1R5S A;  4BRY A;  2HFE D;  1W2B O;  3H1J D;  1LTA C;  1Q81 Q;  1NTZ K;  4HKZ H;  3MTU E;  3P32 A;  3SWF A;  2OTL P;  3EQ2 A;  1Q7Y Q;  1M1J A;  3E1I A;  3SFE C;  2OYH B;  4ZMD A;  3CXH I;  2Q9I A;  2YKQ A;  1CZQ A;  3GW6 A;  3L72 E;  2CPB A;  1FDM A;  3CX5 I;  3V2R A;  3NXS A;  4NPF X;  4O9B A;  5AW1 B;  1VQM P;  2N1T B;  2YIU B;  3BCC G;  4A7P A;  2A45 G;  3II6 A;  1LTS C;  1Y47 A;  1L0N G;  2P67 A;  3L75 E;  1M56 D;  5KAF H;  1SVF A;  5KKZ B;  2B88 A;  2RN0 A;  3D70 A;  2RKL A;  4N78 E;  4DOJ A;  5KAF E;  1QEX A;  4L73 A;  1X8Y A;  1LTJ C;  1KYO I;  3JSV C;  3H1I J;  4H0L D;  1D7M A;  2ITA A;  5APQ A;  5AW9 B;  1NU1 D;  1NTM K;  2JEE A;  2OYH A;  2E43 A;  3TNU A;  1NTZ J;  1EZV D;  2POH A;  2IZ0 A;  1HBW A;  4UB6 E;  3L74 G;  1YYC A;  1HJB A;  3HE4 B;  4LLH A;  3TGU J;  4IL6 H;  3T97 B;  2OYI B;  2R44 A;  1FE6 A;  1SQX K;  2W83 C;  1AQT A;  1L2P A;  2NPS C;  1EXJ A;  1S1C X;  1S5L E;  2Q7C A;  2ZYD A;  2M8R A;  1U57 A;  1AV1 A;  3AEG C;  3TSI A;  3SWK A;  1JY2 O;  1JCC A;  3CC2 P;  3LIE A;  1CSB A;  1SQX G;  1JY3 N;  1SP4 A;  3B5N C;  1K73 Q;  1FJK A;  1S5L X;  2KLU A;  1QVF O;  3HE4 A;  1KQS O;  2A06 D;  4WWI A;  2ZYG A;  1FZB A;  2QM8 A;  1VQK P;  1IFD A;  2JKV A;  2QJY B;  3B8E B;  4U3F E;  1NTM J;  3WUU A;  3VP8 A;  3T97 A;  1SLQ A;  2OYI A;  5CJ0 A;  2W8Z A;  3TK1 A;  2HOD B;  1JCD A;  1JY3 P;  1OX3 A;  3D71 A;  4WBA A;  3KHU A;  1BGY E;  2E76 B;  3O6Q B;  3AEF C;  1WMK A;  2FXO A;  1IFJ A;  2WVR A;  1SQX J;  4Y99 B;  2N9Y B;  1M57 D;  3PJS K;  4WY4 D;  1RQV A;  2K1A A;  3A0H H;  1HGZ A;  1HWT C;  5CCG C;  1BCC G;  1EDI A;  2BEQ D;  1BSH A;  3A0H E;  1ZLL A;  5AW5 B;  2K9J B;  3U1C A;  3CCR P;  1YTZ I;  3P8M C;  3M9Q A;  3Q5P A;  1RF1 B;  3AE5 C;  3A7O A;  5AVQ B;  2ZFC A;  1BE3 E;  1FDI A;  4YXD C;  2HOD A;  2PFX A;  2SPZ A;  1JB0 J;  3H1I D;  1R8E A;  3VMA A;  3O6Q A;  1IJD B;  5KLI C;  1Q2N A;  1VQ5 P;  4ASW A;  5CBO A;  1BCC J;  2AEM A;  1NTZ D;  3A0B E;  1GK4 A;  1N86 A;  3GF3 A;  4PD4 E;  2E5T A;  2FFD C;  5CCH D;  2QIW A;  3D6Y A;  4GIF A;  2O1K A;  5BU5 A;  4K3A A;  3AE8 C;  2K9J A;  2ZT9 D;  3TGU D;  4N6J A;  1RF1 A;  2IX7 C;  1L0L E;  5AVS B;  2KK7 A;  2WT7 B;  1NTK D;  3U1A A;  1LT9 C;  3CCQ P;  1FZG A;  1JO5 A;  1HGV A;  1EC5 A;  4N3Y B;  2Y0E A;  1EDL A;  4C7N A;  4QMA A;  3HTK A;  3CWB E;  2LKM A;  2GUS A;  1NTM D;  1URQ B;  5EFW B;  2FYN C;  1SFC D;  5APU A;  4PD4 I;  1G1J A;  2IBZ E;  1NAF A;  2WIT A;  3WU2 H;  2L5G B;  4RKU J;  2B89 A;  1M1J C;  1J1E C;  1P84 D;  2UWJ E;  1GU5 A;  5KAI H;  2E75 D;  2JDI H;  1SQB G;  1IFN A;  2QJK C;  1GD2 E;  4R4M A;  5B66 E;  1GMJ A;  1OFC X;  1HUC A;  3L71 G;  2XKM A;  2OTJ P;  1YI2 P;  3JC2 2;  3BAS A;  3GHG B;  1URQ A;  3A5T A;  1JTH B;  1PGO A;  5M1B A;  1OW8 A;  2IZ1 A;  3G9R A;  3AEC C;  2BEZ F;  2OYH C;  4JYC A;  3H1J G;  2IBZ I;  1OXZ A;  4AYC A;  4GOE A;  4PJ0 H;  1BCC D;  2L91 A;  3PP5 A;  1S9K D;  2OAR A;  5BU8 B;  2N1T C;  2YIU C;  4D6T E;  3D6Z A;  4YXW H;  5KJ7 A;  1GTW A;  1FU1 A;  1AFO A;  3GHG A;  3L72 D;  1J2J B;  5AVY B;  1JTH A;  3PRJ A;  3E1R A;  2OTK E;  3CMA P;  1VF5 D;  1RF0 A;  4HB1 A;  1NWQ A;  4RES B;  1BE3 J;  1A02 J;  1QL2 A;  2H89 C;  4N78 D;  1NU1 G;  2KP8 A;  5KLI B;  2Z5I A;  2OYI C;  5AVT B;  1EZV G;  5K5G B;  4H13 D;  5APY A;  4XFJ A;  3OAK A;  5CBN A;  1L0N E;  4GKG A;  1LJ2 A;  1N73 A;  2NZ2 A;  1SQV E;  2PRR A;  2Y9Z A;  1DEE G;  1KV4 A;  1HH0 A;  3L70 E;  1NO4 A;  1OMI A;  5GTH E;  1T2K D;  3FXD A;  1H0T B;  4NPE A;  4HYT B;  2R3C A;  1X9V A;  1GK6 A;  2W90 A;  3P7K A;  3W68 A;  1ZP0 C;  3HRN A;  3RK3 B;  3RL0 g;  4OGQ D;  1PGQ A;  1EDJ A;  2XZR A;  1KIL B;  1LWU B;  2BCC E;  2JO1 A;  2A06 G;  4CPG A;  3UIA A;  3H32 B;  4EI2 A;  2R5D A;  2E76 C;  1Q82 Q;  3BVH A;  3OA7 A;  5APT A;  2WPQ A;  4U3F D;  3CX5 H;  4Y99 C;  3CXH E;  1GW4 A;  1PZQ A;  1R5L A;  3L73 J;  3IF4 A;  1H0T A;  2D2C B;  4PV1 D;  3H25 A;  2W6A A;  3M91 A;  1K05 A;  5AW7 B;  5B5E H;  4TLF A;  1VQO P;  1RF1 C;  1SQP K;  5B5E E;  1KYO H;  1KZU B;  3V2P A;  1LWU A;  2J58 A;  1GL2 D;  4H44 D;  1KYO E;  1FZC B;  3RL0 D;  1IK9 A;  1QX8 A;  3H32 A;  1Z56 A;  1ZN5 A;  1JEK A;  1SQP G;  3L36 A;  2ZAE B;  1JNM A;  2YMY A;  5AW6 B;  2FXP A;  1BE3 D;  1NH4 A;  3LW5 H;  4L74 A;  3H1I G;  3MP7 B;  3PHL A;  3TNU B;  2FYZ A;  5GTI E;  1JOC A;  1SQQ K;  4DZO A;  3RGU A;  3NFQ A;  1NTZ G;  2K3R A;  4TT3 H;  4XA4 A;  1AVY A;  2KI7 B;  1NTK K;  1VPC A;  5AVZ B;  2QE7 H;  3ITK A;  3RK2 D;  4D6T J;  1FZC A;  3TGU G;  1SQP J;  1PPJ E;  1SQQ G;  1M8O B;  1KTM A;  2GM4 A;  1FAV A;  2JR8 A;  1MV8 A;  1NTK G;  3QWO C;  3RBZ A;  4H0L B;  1X0T A;  1YIJ P;  4UB6 H;  2OGU A;  2XV5 A;  3IR9 A;  2J59 M;  4B86 A;  1IFP A;  1URQ C;  3ABV C;  3PTZ A;  4C46 A;  4GDO A;  1OVU A;  1HVV A;  1YTZ T;  2BAS A;  1VQ6 P;  1N7S D;  1J1D B;  1SQQ J;  4DT0 A;  3TF5 A;  1NTM G;  1S5L H;  3K5B A;  3AE6 C;  3MUD C;  2E74 D;  1LTI C;  1GW3 A;  3CC4 P;  1NTK J;  3L73 D;  3FXE A;  3E7K A;  3GF7 A;  1ZV8 A;  3O8Z A;  1JMM A;  3H1L E;  2E42 A;  5KJ7 C;  3NMD A;  1EXI A;  3AEE C;  1PP9 E;  2Q3E A;  3RK3 E;  3VYI A;  3Q5S A;  3GHG C;  1KB9 I;  1U7M A;  1KIL E;  1SS1 A;  5KLV K;  3P8C E;  2KS1 A;  2I1J A;  4GT1 A;  1RF0 C;  2KSE A;  3TYY A;  1N7S A;  1N8R Q;  2QJP B;  1ZW0 A;  2HG5 D;  3AE4 C;  1KFM A;  2CPS A;  1QGK B;  2IYP A;  1KC8 Q;  3S9O A;  1N2D C;  5KLV G;  1SQB E;  1L4A D;  3GMA A;  1JY3 O;  1YJN P;  3AE9 C;  4WY4 B;  3L71 E;  2FY8 A;  2B9B A;  3CME P;  1N73 C;  3HD7 D;  1NKN A;  4RJT A;  2IDB A;  3V6I A;  3Q2Y A;  4D6T D;  1IFI A;  3WUV A;  2G3A A;  1S72 P;  1MFT A;  4KT0 J;  2LR2 A;  1JUN A;  1SQP D;  3L72 G;  1T3U A;  3G71 P;  2ZVN B;  3MIW A;  2OYO A;  2Y9Y A;  4EIJ A;  5KLV J;  3H1J E;  2AXT E;  4OWF A;  1VQL P;  3A0B H;  1MFZ A;  2IFM A;  2J5U A;  1YJ9 P;  4PD4 H;  2W6J H;  2JWA A;  1YIT P;  4C7N B;  1L4A A;  2O01 H;  4WY4 A;  1PFI A;  2M5A B;  3HTK B;  2QM7 A;  4JQ0 D;  3EFF K;  2P1J A;  2M0B A;  3L72 J;  3H1K E;  1SQQ D;  2ZT9 B;  2QVA A;  2QRX A;  3EFG A;  4BXL A;  1LNQ A;  2IPP A;  3A3Y B;  1FZE A;  2WTY A;  3L75 J;  2KXP B;  1ZR2 A;  3RBX A;  3RK3 C;  5AW0 B;  3EWK A;  2O01 N;  1KIL C;  1LWU C;  1OIP A;  5H2F E;  2YO3 A;  2WWW A;  1NU1 E;  2GUV A;  3C8V A;  1VL2 A;  2M5A A;  1ZOY C;  3HUS B;  3AE1 C;  5CCH A;  4M3L A;  1TU3 F;  1PIX A;  4YTP C;  1FOS F;  1YQ4 C;  1ZRT E;  1LTB C;  2YXQ B;  1SFC B;  5BVZ A;  2BCC D;  1Q90 D;  2D2C C;  1NYH A;  3OJA B;  1LP1 B;  2OQQ A;  4RO0 A;  4U3F G;  3H1H E;  5B66 H;  1OZH A;  5E79 E;  3CCL P;  3CXH D;  2WSS H;  1YHQ P;  3CX5 D;  2K88 A;  2LXC B;  4R4L A;  1FZC C;  2NPS D;  3HUS A;  3QH9 A;  5APX A;  3H1L J;  3IN6 A;  4IOI H;  2A06 E;  3AE3 C;  1VQN P;  1LT1 A;  5APW A;  2FYU E;  1EZV I;  1SFC A;  1FJP A;  1HTL C;  3I5C A;  3C9I A;  2JWD A;  5AW8 B;  2FKW B;  4U3F J;  3B5N D;  2M3B A;  3V2Q A;  1KYO D;  4DJG A;  3CD6 P;  1LP1 A;  5KLV D;  2KNC B;  2YNY A;  1OVR A;  1BE3 G;  3F89 A;  4ZKP A;  1BDC A;  1BGY J;  3S1K A;  4IFM A;  3VOP A;  5AVX B;  2ZVO B;  5AVW B;  1VQ9 P;  1KFN A;  1M90 Q;  2YKP A;  1N73 B;  1L0L K;  2KSJ A;  4GOD A;  4H0L C;  1KD1 Q;  3G6E P;  5CCG D;  2KZJ A;  3L75 D;  3U59 A;  1VF5 B;  3KXD A;  5DJU B;  1PPJ D;  2KNC A;  3H1I E;  3USS A;  5AVU B;  1DX7 A;  2KUB A;  4AUW A;  1RY3 A;  3PLN A;  3L37 A;  1KOR A;  2WPV B;  1LGH B;  1NTZ E;  1J1D C;  3FWL A;  2MKV A;  1PV3 A;  1PGJ A;  3BCC E;  3AEA C;  5C39 A;  2QG4 A;  4H13 B;  1Y9B A; 
#chains in the Genus database with same CATH homology
 3KHU A;  1BCC D;  2FYN B;  2L91 A;  1ZRT D;  2IBZ D;  2Y0E A;  1SQQ D;  2KS1 A;  2N9Y B;  1SQB D;  1KB9 D;  1NU1 D;  3GG2 A;  1KYO D;  2QJP B;  3ITK A;  5KLV D;  1EZV D;  3L71 D;  2Y0D A;  3L72 D;  2KNC B;  1SQX D;  1NTM D;  3H1H D;  2K9J B;  2RMZ A;  3PRJ A;  2QJK B;  4U3F D;  4EDF A;  3H1L D;  4PD4 D;  3BCC D;  1P84 D;  1L0N D;  3H1I D;  3VMA A;  3H1J D;  3PTZ A;  1SQV D;  4RJT A;  2FYU D;  3L70 D;  3H1K D;  5KLI B;  4D6T D;  3TDK A;  2BCC D;  1NTZ D;  1L0L D;  1SQP D;  3L75 D;  3TF5 A;  1PP9 D;  1PPJ D;  3GW6 A;  2A06 D;  3L73 D;  3TGU D;  1BGY D;  2O3J A;  2QJY B;  3L74 D;  3PLN A;  3CXH D;  2JWA A;  2YIU B;  4A7P A;  1BE3 D;  3CX5 D;  2Y0C A;  3FWL A;  5TJH A;  5KKZ B;  3PHL A;  1NTK D;  2Q3E A;  2RN0 A;  2QG4 A;  3CWB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...