2K9JB

Integrin alphaiib-beta3 transmembrane complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
43
structure length
43
Chain Sequence
b'PESPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb light chain
molecule tags Membrane protein
source organism Homo sapiens
publication title The structure of the integrin alphaIIbbeta3 transmembrane complex explains integrin transmembrane signalling
pubmed doi rcsb
total genus 16
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2008-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2k9jB00
4PD4D 3FWLA 2QG4A 4EDFA 2Y0DA 5KKZB 2Y0EA 2QJPB 3CXHD 2K9JB 1NTKD 3GW6A 4U3FD 5KLIB 2JWAA 5KLVD 3H1HD 1BE3D 4D6TD 1NTZD 1BGYD 2FYNB 1L0LD 2IBZD 2YIUB 3PRJA 2RN0A 2KNCB 2L91A 3VMAA 1SQXD 1SQVD 1KB9D 3PLNA 3CX5D 1SQQD 2BCCD 3L70D 2Q3EA 1ZRTD 3H1LD 5TJHA 1SQPD 3GG2A 3TGUD 2QJYB 3PTZA 1NTMD 2Y0CA 3L75D 3TF5A 1BCCD 2O3JA 2N9YB 1PP9D 2QJKB 2FYUD 3CWBD 3L73D 4RJTA 3L72D 2KS1A 3BCCD 4A7PA 3PHLA 1NU1D 1KYOD 2A06D 3H1JD 3L71D 3ITKA 1P84D 1EZVD 1PPJD 3H1ID 3TDKA 1SQBD 3L74D 2RMZA 3H1KD 3KHUA 1L0ND
chains in the Genus database with same CATH superfamily
2B9BA 4UB8H 5AVSB 4C7RA 1KILA 4ZMDA 1GW3A 1OVVA 2M5AB 2LXCB 3H25A 2OYIB 3CXHD 5GTIH 4LLHA 2NRGA 3Q5PA 1KZUB 1IFDA 1KB9E 3BRTB 5M1BA 1GK6A 3EQ2A 1FZCA 3GHGB 3L71G 3U1AA 1S72P 1G1JA 2N1TD 3ZDMA 3CCQP 1ZMEC 2E76B 1NTMJ 1T6AA 2GUSA 2O1JA 2W8ZA 2V7QJ 3CXHH 3NMDA 1SFCC 3V2RA 3D6ZA 1HF9A 1FAVA 2W90A 1SQQK 2PAJA 1NKZB 3II6A 1N7SB 1PGOA 3L75G 1SQPE 3B8EB 5E79H 1DEEG 2W6BA 1N8RQ 3F5HA 2YXQB 2KS1A 1CI6B 3CX5H 2FYNC 3CPWO 3HD7C 2OTKE 1NTME 2GUVA 2B88A 2ZFCA 1K73Q 2A45G 2OYHA 1ZLLA 1NVOA 3M9QA 2J59M 2RMZA 1IFNA 4RESB 4JPZB 2QJYC 5TISE 4GOEA 4YPCA 1J1DB 2VRSA 1KORA 2N9BA 1L0NG 1LTIC 1PFIA 1JUNA 1WT6A 2JJLA 4H0LB 5GTHE 1IC2A 3LIDA 5AW6B 1L4AB 1L4AC 1PGPA 4BWNA 2OQQA 4H0LC 3BATA 4MN4C 3VTPC 3WMM0 1KTMA 4PD4H 3H1LE 5APXA 1SQBK 4U3FE 4EIJA 1EC5A 1U7JA 1QX8A 2D2CB 1M1KQ 1SQXG 3VMZA 3D70A 2QJYB 4GDOA 1EZVE 5CHXA 3L75D 3G3ZA 3NTNA 4UB6H 5CCGC 1M1JB 3A0HH 5AVRB 2AXCA 1R8EA 2AEJA 1GU5A 1DH3A 3CWBJ 3LIEA 3L70E 4PD4I 2H7HA 1EXJA 2A06E 2E74D 2H88C 3L71D 3ITKA 1NH4A 3L72J 1GDTA 1L0NE 1NJIQ 1EZVI 1KYOD 1SQXJ 2C0XA 1URQB 2QSIA 2B87B 1FDOA 1SQVE 5AW5B 1MZ9A 3AEDC 2QJPB 4PJ0H 2BCCJ 3RBXA 1PIXA 3SWYA 1LP1A 3WUUA 4JYBA 1H89A 1UIIA 1SFCD 1RF1C 1KMIZ 1NTKE 1IK7A 3V5BA 4YXDC 4IFDK 1N7SA 2W6JH 1ZW0A 1SQXE 3A0BH 2HR3A 3H1IJ 2WPRA 3M0DA 5APVA 4D6TJ 4EYYQ 2N1TB 2J58A 1E5WA 4GODA 2E74C 2FYUK 1FZCB 2FXOA 3L70J 2KZIA 1BCCD 1OXZA 1MKMA 1NGMB 1PP9D 5AW7B 3CXHI 3Q5RA 4WY4C 3GHGC 1IZNB 1JY2N 2YMKA 3B5NA 1IFPA 1KILE 4RKUJ 3V6IA 1RQVA 1KC8Q 5CJ4A 1N73A 1Q86Q 3CC7P 1NU1D 1GW4A 3H1JD 1OVRA 1J1EC 1BGYJ 2E75B 1OIPA 1H88A 4L76A 2P1JA 1NO4A 4H0LD 2BEQD 2Q3IA 4I7ZB 3GF7A 5AVQB 2Y0EA 1XTCC 1ZXGA 1RF0C 5KLVJ 1JY3P 2WVRA 1VQ9P 1X22A 2R3SA 3L74J 3RK2C 4XA4A 2WSEJ 1WRGA 2QEXP 1RE4A 4NPDA 2XNXA 5AVVB 5AVXB 5E79E 1H0TA 2LXBA 5AVUB 2IYOA 3P8CE 3KZIH 1VF5C 3NXSA 4U7JA 3L37A 1L0LE 2JO1A 3CWBD 1SQPJ 2QA4P 1PP9G 3BCCD 2ZT9D 3R2PA 3AE4C 3VN0A 3RK2B 1LTGC 1OWAA 2W6AA 3KYQA 4DJGA 1JMBA 1HVVA 1KB9I 2BCCG 3MGNA 3MTUE 4OGQC 4W7YA 3MUDC 5AW1B 5KAFH 1U7MA 1BDCA 3VP9A 1K9MQ 1KQGB 1QLED 1GK4A 2XV5A 5AW3B 4ZKPA 3H1HG 2E5TA 1VQ7P 1K04A 4N6JA 4U3FD 2FXMA 3V4QA 1CZQA 1YQ4C 2P10A 3HE5B 3RL0C 2HYNA 3RL0B 4D6TD 3RK3C 2N1TA 3IFMA 1RHZB 1LTJA 1SQVD 2HFED 3P8CD 1SP4A 5B66E 3BVHA 2YKPA 3TDKA 1FZCC 1LTJB 2H8PD 1YTZI 3GLMA 5AVYB 4OGQB 3CD6P 3O6QB 3RK3E 3RL0g 2NPSB 2IZ1A 3HE5A 2QJKB 3L73E 3MHVA 2YXRB 4TT3H 3AE9C 4Y28J 3L71J 3L72D 2HODA 2I1JA 3K5BA 3CCSP 5C39A 3D6YA 1H8AA 2ZVNB 3BRVB 1DIPA 2MJZA 1NKNA 1JY2O 2WSFH 5AVTB 5KAFE 2Y9ZA 1YIJP 2Y0DA 3FXDA 1LWUB 2O01J 5AW0B 1PGQA 2GA1A 3QH9A 2KLUA 5KAIE 1LTAC 2NPSD 4BXLA 1QGKB 4D6TG 3H1KE 5B5EH 1LTBC 2WSFJ 3L74G 1DD4A 2LKMA 4U3FG 1PZQA 3JSVC 1BSNA 2WT7B 3HUSB 3NFQA 1M1JC 1KB9D 1RE3C 2FBWC 2PP6A 2QVAA 1L4AA 1Y47A 3KZIE 1CW5A 1PV3A 3KQGA 1SQPK 2Q7CA 5BU5A 1GZLA 1NTKG 3I5CA 1QL1A 2ZT9B 1LT9C 1EQ7A 1HH0A 1L0NK 1LGHB 4YXWH 3CMAP 1OX3A 4RO0A 3AE6C 2KOGA 3JC22 2KYVA 4KJMA 1EDKA 1NAFA 1R5SA 2KLVA 3B4SA 1NHLA 1GL2D 5DJTB 3H1HJ 3L36A 4L75A 5AVWB 1SQXK 1L0ND 3V2QA 1PGJA 1MUUA 4W7ZA 3G4SP 1FBMA 2KIKA 3OAKA 5CMZA 4Y99C 2HLOA 1LT1A 1JOCA 1OVUA 3T97B 5KLIB 3S4RA 1RF1B 1N7SD 1DX7A 4BRYA 1FJPA 5APUA 2FYNB 3UIAA 2MKVA 2G3AA 2AEMA 1SQXD 3MP7B 3H32A 3GMAA 1NU1K 1Y8AA 3N7NA 1OW7A 4DT0A 1HGVA 1JCDA 4BRYB 3SFDC 1G1IA 1URQC 2IFMA 2RKLA 1LP1B 1M7LA 2AEFA 3AEAC 3AE3C 3H32B 3PTZA 4EI2A 5CCHA 3M9HA 2OYHC 2E76C 1GL2C 3OA7A 3U1CA 2FYUD 3HTKA 2P67A 3MD0A 2WSCJ 4WBAA 4GKGA 3TNUB 2WTYA 2FFDB 1S2EA 2IBZG 1JY3O 1VQ6P 2B87A 2YNYA 4H13C 2R5DA 1JY2P 2LR2A 1TU3F 4N78E 4PJ0E 4WY4A 4Y99B 1OW8A 1AVYA 1SQQG 2ITAA 4AQRD 1BCCJ 2Z5HA 1JM0A 5BVZA 5B66H 1AVOA 1N2DC 2A45I 5KKZB 1AQ5A 1NOHA 4NPEA 3HRNA 1YJ9P 2IYPA 3M0AA 2FXPA 1NU1J 1UIXA 2I8DA 3H1JJ 5AW9B 1SQVK 3TYYA 1RQUA 2R44A 1BGYD 1N86A 2K37A 1M90Q 3E1RA 3KXDA 3PRJA 2E76D 2YKQA 3AE5C 4R4LA 2BCCD 1ZRTD 2JP3A 1QVFO 1LJ2A 3CWBE 5KJ7C 1JTHA 1NWQA 2POHA 2QM7A 4I2LC 3GF3A 3U59A 4ASVA 3TGUJ 3HUSC 1NTZK 3QWOC 1HTLC 2FYUE 3PH0A 1IO4A 1PPJE 1SQQE 2WPVB 1LWUA 1SQBE 3A0BE 3JCUH 3TK1A 1VQKP 1VQNP 1FDMA 2KSJA 3W67A 1VF5D 3CC4P 1GL2B 1AA0A 1VQLP 1N7SC 2HODB 2KS1B 2M8RA 2OYHB 5TISH 1L4AD 2FFDA 3IN6A 3V4WA 3S1KA 3M9BA 1NTKD 1BE3G 1LTSC 2E42A 2CPSA 3AECC 2NPSA 4GT1A 1DEBA 3O8ZA 4I6MC 1D7MA 1L0LD 2IBZD 3VMAA 3GHGA 2M3BA 2QJKC 5KLVG 2ZXEB 3AE1C 3PLNA 3L75J 1S9KE 2BEZF 1T3UA 2K3RA 3C8VA 4UB6E 3A7OA 3IF4A 3GG2A 3WUVA 2OTJP 1N7LA 1P84H 3AE2C 1BGYG 1JEKA 1KILB 3AE7C 1NTMG 2O3JA 2ZJSE 1HJBA 4NPFX 4RJTA 2FY8A 1Q7YQ 1VQ4P 1L0LJ 1JMMA 4HJGH 2YO3A 1HGZA 3IR9A 2OYIA 2RN0A 2OTLP 3L75E 1FJKA 3G9RA 3LW5J 5CCGD 3CCUP 1KD1Q 2Q1KA 1OMIA 1YQ3C 2QE7H 3IAOA 3A3YB 1KFNA 4B86A 1DD3A 2KSEA 4PD4D 3HE4B 3LW5H 4EDFA 2I1KA 1OFCX 4ZKUA 3OW2O 3Q2YA 2SPZA 2G8YA 5KLVE 3H1IG 1GD2E 1J2JB 2JWAA 5KLIC 1BE3D 1H0TB 3AEFC 2WQYC 4H44C 1SQVG 2QM8A 2KNCB 1PP9J 2IPPA 1SQPG 2KNCA 2M0BA 1XTGB 1R5LA 2HG5D 1BGYE 2IBZI 3L70D 3N4XA 3I56P 1S1CX 1SQBJ 2ZYAA 2WITA 3EFGA 3L73G 4R4MA 2FYUJ 1JCCA 2W83C 1S4XA 1RE3A 2KP8A 4KT0J 1NTMD 3CC2P 1NTZG 2P2UA 1Q90D 2YKOA 2IX7C 3L72G 2WT7A 2PRRA 3JCUE 3KPEA 1VL2A 3P32A 5K5GB 2GM4A 4PV1B 2JEEA 5CBNA 3AEGC 1BSHA 4CPGA 3HE4A 4IOIH 1M57D 1FOSE 2FKWB 2RH0A 5B5EE 3P7KA 1PPJD 5KAIH 1NTZJ 3AE8C 1FOSF 3L74D 2C9LY 3B5NB 3KHUA 1A02F 3CI9A 3CCLP 5APYA 2ZXXA 3D71A 1LTJC 3H1IE 1KQFB 1NU1E 3H1JE 4EOTA 3A2AA 1SS1A 4PD4E 1IJDB 4LC1A 1ZR2A 3H1LG 4C7NA 1KV4A 1T2KD 1MFTA 2BCCE 3OJAB 3C1LA 1URQD 2CK3H 4OGQD 5GTHH 2YO2A 3O6QA 1BCCE 2UWJE 1NYHA 2ZAEB 3L35A 3CCJP 1LTTC 4JF7A 1GU4A 2R32A 1USDA 1L0NJ 1NTZE 1KILC 3CX5D 3V2PA 2H89C 3L72E 1Q2NA 1YYCA 2A06G 2XNDH 3TGUD 3RK3D 4H13D 3TF5A 1VQ5P 1G2CA 3RBZA 3USSA 2XKMA 1URQA 1EDJA 1AQTA 3R4YA 3M91A 1S9KD 3ABVC 1GL2A 1RY3A 1HWTC 1WMKA 1SFCA 1USEA 2R5BA 4IFMA 4K3AA 4A7PA 2AXTH 1Q82Q 3H1LJ 1L0LK 3B71A 3C9IA 1VF5B 1YITP 4L73A 4WVZA 1PP9E 3VYIA 3CXHE 4AYCA 2ZVOB 1S5LX 1NTKK 1M1JA 1X9VA 5KTBA 3CLQA 1HBWA 1BCCG 3HD7A 2KZJA 1VDFA 1JO5A 3GW6A 1A02J 1JB0J 1KB9H 2XDJA 1U57A 4H44B 4JBZA 4L74A 3G6EP 1AFOA 4OVNF 1K05A 5AVZB 1BE3J 3AEEC 4JYCA 4O9BA 1JTHB 1ZR4A 1VQMP 2E43A 3BCCE 3M06A 5APSA 2V4HA 3H6PA 2Q3EA 5KKZC 3H1LD 1X0TA 1ZP0C 3H1KG 1T2KC 2FYUG 4PV1D 2KK7A 3WU2H 1FDIA 1OW6A 2WSEH 2YMYA 3SSUA 2IDBA 4DZOA 2KUBA 2Q5UA 1NTMK 5KJ7A 2M3EA 1KILD 3SFEC 4K35A 1KN7A 1L0LG 1EXIA 1EZVG 2D2CD 2A06D 4WY4B 2P7JA 3TGUG 3VP8A 2JR8A 4C46A 3TNUA 1LWUC 1T3JA 1FZAA 3E1IA 5H2FH 3G71P 3RK2D 5CCGA 2Q9IA 2IFNA 1W2BO 3H1KJ 4GIFA 1X8YA 5AW8B 1IFIA 2Q6QA 1M56D 1CI6A 1KYOH 2WWWA 4HYTB 4JQ0D 3HTKB 4GOFA 3BCCG 5CCHC 2FFDC 2K88A 4HH2A 3RGUA 3CWBG 4XFJA 1RH5B 1P84I 4Z1MH 1VQ8P 4IFFA 1Y9BA 1E79H 3P8MC 4OH8B 5GTIE 2HPCA 2HPCB 5TJHA 1GMJA 2WSCH 3CL3D 2WPQA 3Q3DA 1RF1A 3L71E 1SVFA 2KI7B 4M3LA 1PPJG 1SQQJ 3L73J 2M5AA 3VOPA 1PL5A 1Z56A 1FS0E 3M0DC 5APQA 3TGUE 2JDIH 2O1KA 4IL6E 3T97A 1VQOP 2JKVA 3PJSK 5AW2B 3EFFK 2QRXA 4IL6X 1FC2C 1EZVD 1FE6A 1HUCA 1M8OB 1S3JA 1SQBD 1X79B 3L70G 1LT9B 3CX5I 3MZWB 2FYZA 4LGDE 2XZRA 2ZYGA 1KFMA 3L73D 1S5LE 3W68A 3HD7D 2WSSH 4WWIA 3B5NC 1HJ0A 2ZYDA 1YJNP 2O01N 1QL2A 3CMEP 1ZRTE 5KLVD 1KYOI 4PV1C 1IFMA 3A0HE 1KQSO 3HUSA 4YTPC 1JNMA 4W80A 1BDDA 4N3YB 2K1AA 1AJYA 2ZT9C 1RF0A 2K9YA 4DCKA 1JY3N 3SWFA 3Q1MA 3KDPB 3L4FA 3RL0D 2IZ0A 1EDIA 2E5YA 2PFXA 4H13B 1ZN5A 2K9JA 1GTWA 2CPBA 1RE4C 3HD7B 2B89A 5KJ7D 3A5TA 5L8RJ 3BCCJ 3VMXA 1FU1A 4QMAA 1QVGO 1NU1G 2P58A 1MFZA 2NPSC 2OGUA 2L5GB 1BE3E 2W27A 1KYOE 3H1JG 3H1ID 5APTA 2WPSA 3H1KD 3L74E 5CCHD 1W2EA 1P84E 1SFCB 1SQBG 1YTZT 2QG4A 1ZOYC 2IBZE 3FWLA 4OWFA 5CJ0A 2E75C 3PP5A 3Q5SA 2H43A 1CSBA 4DOJA 1IK9A 1W5CE 2V7QH 1G2CB 3AEBC 1NTZD 3CX5E 3F89A 3B5ND 3CCRP 2R3CA 2A45H 5KLVK 1YHQP 1SLQA 3H1HE 2QIWA 3MIWA 3BASA 1YI2P 2OYIC 1FZBA 1NAYA 1OZHA 5EFWB 1SQPD 3WUTA 3SWKA 3WU2E 4C7NB 4AUWA 3TSIA 2XU6A 1N73C 2N1TC 3FGAD 5BU8B 4ZNCA 2DW3A 4XE5B 3RK3B 1EDLA 2KB7P 4IL6H 3PHLA 1IFJA 2JWDA 5DJUB 1ZV8A 2C0WA 2KXPB 1P84D 2WMMA 2QJPC 4D6TE 1FZGA 1FZFA 4UB8E 4WY4D 1MV8A 4ASWA 1NTKJ 1AV1A 5CBOA 3CCMP 1FZEA 2C9NY 3VMYA 3E7KA 2WZ7A 1Q81Q 1SQVJ 2K9JB 2YIUC 2AXTE 1QEXA 3H1HD 4WB4A 3FXEA 2Z4EA 5APWA 1L2PA 2BASA 2YIUB 1VQPP 2O01H 2L91A 4HB1A 1YJWP 2NZ2A 4TLFA 3EWKA 1SQQD 1T8ZA 2Z5IA 2J5UA 3FX0A 4KHXA 3I55P 3CCVP 2Y9YA 5H2FE 1S5LH 3V2NA 2D2CC 1LNQA 2Y0CA 4H44D 4HKZH 4N78D 3CCEP 2OARA 2N9YB 1J1EB 1K8AQ 1VPCA 1KQLA 4U3FJ 3MUDA 2E75D 3FWNA 4I1LA 1N73B 2PGDA 1LT9A 5AW4B 4I7ZC 1J1DC 2E74B 3S9OA 1YBKA 2OYOA
chains in the Genus database with same CATH topology
4PD4D 3FWLA 2QG4A 4EDFA 2Y0DA 5KKZB 2Y0EA 2QJPB 3CXHD 2K9JB 1NTKD 3GW6A 4U3FD 5KLIB 2JWAA 5KLVD 3H1HD 1BE3D 4D6TD 1NTZD 1BGYD 2FYNB 1L0LD 2IBZD 2YIUB 3PRJA 2RN0A 2KNCB 2L91A 3VMAA 1SQXD 1SQVD 1KB9D 3PLNA 3CX5D 1SQQD 2BCCD 3L70D 2Q3EA 1ZRTD 3H1LD 5TJHA 1SQPD 3GG2A 3TGUD 2QJYB 3PTZA 1NTMD 2Y0CA 3L75D 3TF5A 1BCCD 2O3JA 2N9YB 1PP9D 2QJKB 2FYUD 3CWBD 3L73D 4RJTA 3L72D 2KS1A 3BCCD 4A7PA 3PHLA 1NU1D 1KYOD 2A06D 3H1JD 3L71D 3ITKA 1P84D 1EZVD 1PPJD 3H1ID 3TDKA 1SQBD 3L74D 2RMZA 3H1KD 3KHUA 1L0ND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PD4 D;  3FWL A;  2QG4 A;  4EDF A;  2Y0D A;  5KKZ B;  2Y0E A;  2QJP B;  3CXH D;  2K9J B;  1NTK D;  3GW6 A;  4U3F D;  5KLI B;  2JWA A;  5KLV D;  3H1H D;  1BE3 D;  4D6T D;  1NTZ D;  1BGY D;  2FYN B;  1L0L D;  2IBZ D;  2YIU B;  3PRJ A;  2RN0 A;  2KNC B;  2L91 A;  3VMA A;  1SQX D;  1SQV D;  1KB9 D;  3PLN A;  3CX5 D;  1SQQ D;  2BCC D;  3L70 D;  2Q3E A;  1ZRT D;  3H1L D;  5TJH A;  1SQP D;  3GG2 A;  3TGU D;  2QJY B;  3PTZ A;  1NTM D;  2Y0C A;  3L75 D;  3TF5 A;  1BCC D;  2O3J A;  2N9Y B;  1PP9 D;  2QJK B;  2FYU D;  3CWB D;  3L73 D;  4RJT A;  3L72 D;  2KS1 A;  3BCC D;  4A7P A;  3PHL A;  1NU1 D;  1KYO D;  2A06 D;  3H1J D;  3L71 D;  3ITK A;  1P84 D;  1EZV D;  1PPJ D;  3H1I D;  3TDK A;  1SQB D;  3L74 D;  2RMZ A;  3H1K D;  3KHU A;  1L0N D; 
#chains in the Genus database with same CATH topology
 2B9B A;  4UB8 H;  5AVS B;  4C7R A;  1KIL A;  4ZMD A;  1GW3 A;  1OVV A;  2M5A B;  2LXC B;  3H25 A;  2OYI B;  3CXH D;  5GTI H;  4LLH A;  2NRG A;  3Q5P A;  1KZU B;  1IFD A;  1KB9 E;  3BRT B;  5M1B A;  1GK6 A;  3EQ2 A;  1FZC A;  3GHG B;  3L71 G;  3U1A A;  1S72 P;  1G1J A;  2N1T D;  3ZDM A;  3CCQ P;  1ZME C;  2E76 B;  1NTM J;  1T6A A;  2GUS A;  2O1J A;  2W8Z A;  2V7Q J;  3CXH H;  3NMD A;  1SFC C;  3V2R A;  3D6Z A;  1HF9 A;  1FAV A;  2W90 A;  1SQQ K;  2PAJ A;  1NKZ B;  3II6 A;  1N7S B;  1PGO A;  3L75 G;  1SQP E;  3B8E B;  5E79 H;  1DEE G;  2W6B A;  1N8R Q;  3F5H A;  2YXQ B;  2KS1 A;  1CI6 B;  3CX5 H;  2FYN C;  3CPW O;  3HD7 C;  2OTK E;  1NTM E;  2GUV A;  2B88 A;  2ZFC A;  1K73 Q;  2A45 G;  2OYH A;  1ZLL A;  1NVO A;  3M9Q A;  2J59 M;  2RMZ A;  1IFN A;  4RES B;  4JPZ B;  2QJY C;  5TIS E;  4GOE A;  4YPC A;  1J1D B;  2VRS A;  1KOR A;  2N9B A;  1L0N G;  1LTI C;  1PFI A;  1JUN A;  1WT6 A;  2JJL A;  4H0L B;  5GTH E;  1IC2 A;  3LID A;  5AW6 B;  1L4A B;  1L4A C;  1PGP A;  4BWN A;  2OQQ A;  4H0L C;  3BAT A;  4MN4 C;  3VTP C;  3WMM 0;  1KTM A;  4PD4 H;  3H1L E;  5APX A;  1SQB K;  4U3F E;  4EIJ A;  1EC5 A;  1U7J A;  1QX8 A;  2D2C B;  1M1K Q;  1SQX G;  3VMZ A;  3D70 A;  2QJY B;  4GDO A;  1EZV E;  5CHX A;  3L75 D;  3G3Z A;  3NTN A;  4UB6 H;  5CCG C;  1M1J B;  3A0H H;  5AVR B;  2AXC A;  1R8E A;  2AEJ A;  1GU5 A;  1DH3 A;  3CWB J;  3LIE A;  3L70 E;  4PD4 I;  2H7H A;  1EXJ A;  2A06 E;  2E74 D;  2H88 C;  3L71 D;  3ITK A;  1NH4 A;  3L72 J;  1GDT A;  1L0N E;  1NJI Q;  1EZV I;  1KYO D;  1SQX J;  2C0X A;  1URQ B;  2QSI A;  2B87 B;  1FDO A;  1SQV E;  5AW5 B;  1MZ9 A;  3AED C;  2QJP B;  4PJ0 H;  2BCC J;  3RBX A;  1PIX A;  3SWY A;  1LP1 A;  3WUU A;  4JYB A;  1H89 A;  1UII A;  1SFC D;  1RF1 C;  1KMI Z;  1NTK E;  1IK7 A;  3V5B A;  4YXD C;  4IFD K;  1N7S A;  2W6J H;  1ZW0 A;  1SQX E;  3A0B H;  2HR3 A;  3H1I J;  2WPR A;  3M0D A;  5APV A;  4D6T J;  4EYY Q;  2N1T B;  2J58 A;  1E5W A;  4GOD A;  2E74 C;  2FYU K;  1FZC B;  2FXO A;  3L70 J;  2KZI A;  1BCC D;  1OXZ A;  1MKM A;  1NGM B;  1PP9 D;  5AW7 B;  3CXH I;  3Q5R A;  4WY4 C;  3GHG C;  1IZN B;  1JY2 N;  2YMK A;  3B5N A;  1IFP A;  1KIL E;  4RKU J;  3V6I A;  1RQV A;  1KC8 Q;  5CJ4 A;  1N73 A;  1Q86 Q;  3CC7 P;  1NU1 D;  1GW4 A;  3H1J D;  1OVR A;  1J1E C;  1BGY J;  2E75 B;  1OIP A;  1H88 A;  4L76 A;  2P1J A;  1NO4 A;  4H0L D;  2BEQ D;  2Q3I A;  4I7Z B;  3GF7 A;  5AVQ B;  2Y0E A;  1XTC C;  1ZXG A;  1RF0 C;  5KLV J;  1JY3 P;  2WVR A;  1VQ9 P;  1X22 A;  2R3S A;  3L74 J;  3RK2 C;  4XA4 A;  2WSE J;  1WRG A;  2QEX P;  1RE4 A;  4NPD A;  2XNX A;  5AVV B;  5AVX B;  5E79 E;  1H0T A;  2LXB A;  5AVU B;  2IYO A;  3P8C E;  3KZI H;  1VF5 C;  3NXS A;  4U7J A;  3L37 A;  1L0L E;  2JO1 A;  3CWB D;  1SQP J;  2QA4 P;  1PP9 G;  3BCC D;  2ZT9 D;  3R2P A;  3AE4 C;  3VN0 A;  3RK2 B;  1LTG C;  1OWA A;  2W6A A;  3KYQ A;  4DJG A;  1JMB A;  1HVV A;  1KB9 I;  2BCC G;  3MGN A;  3MTU E;  4OGQ C;  4W7Y A;  3MUD C;  5AW1 B;  5KAF H;  1U7M A;  1BDC A;  3VP9 A;  1K9M Q;  1KQG B;  1QLE D;  1GK4 A;  2XV5 A;  5AW3 B;  4ZKP A;  3H1H G;  2E5T A;  1VQ7 P;  1K04 A;  4N6J A;  4U3F D;  2FXM A;  3V4Q A;  1CZQ A;  1YQ4 C;  2P10 A;  3HE5 B;  3RL0 C;  2HYN A;  3RL0 B;  4D6T D;  3RK3 C;  2N1T A;  3IFM A;  1RHZ B;  1LTJ A;  1SQV D;  2HFE D;  3P8C D;  1SP4 A;  5B66 E;  3BVH A;  2YKP A;  3TDK A;  1FZC C;  1LTJ B;  2H8P D;  1YTZ I;  3GLM A;  5AVY B;  4OGQ B;  3CD6 P;  3O6Q B;  3RK3 E;  3RL0 g;  2NPS B;  2IZ1 A;  3HE5 A;  2QJK B;  3L73 E;  3MHV A;  2YXR B;  4TT3 H;  3AE9 C;  4Y28 J;  3L71 J;  3L72 D;  2HOD A;  2I1J A;  3K5B A;  3CCS P;  5C39 A;  3D6Y A;  1H8A A;  2ZVN B;  3BRV B;  1DIP A;  2MJZ A;  1NKN A;  1JY2 O;  2WSF H;  5AVT B;  5KAF E;  2Y9Z A;  1YIJ P;  2Y0D A;  3FXD A;  1LWU B;  2O01 J;  5AW0 B;  1PGQ A;  2GA1 A;  3QH9 A;  2KLU A;  5KAI E;  1LTA C;  2NPS D;  4BXL A;  1QGK B;  4D6T G;  3H1K E;  5B5E H;  1LTB C;  2WSF J;  3L74 G;  1DD4 A;  2LKM A;  4U3F G;  1PZQ A;  3JSV C;  1BSN A;  2WT7 B;  3HUS B;  3NFQ A;  1M1J C;  1KB9 D;  1RE3 C;  2FBW C;  2PP6 A;  2QVA A;  1L4A A;  1Y47 A;  3KZI E;  1CW5 A;  1PV3 A;  3KQG A;  1SQP K;  2Q7C A;  5BU5 A;  1GZL A;  1NTK G;  3I5C A;  1QL1 A;  2ZT9 B;  1LT9 C;  1EQ7 A;  1HH0 A;  1L0N K;  1LGH B;  4YXW H;  3CMA P;  1OX3 A;  4RO0 A;  3AE6 C;  2KOG A;  3JC2 2;  2KYV A;  4KJM A;  1EDK A;  1NAF A;  1R5S A;  2KLV A;  3B4S A;  1NHL A;  1GL2 D;  5DJT B;  3H1H J;  3L36 A;  4L75 A;  5AVW B;  1SQX K;  1L0N D;  3V2Q A;  1PGJ A;  1MUU A;  4W7Z A;  3G4S P;  1FBM A;  2KIK A;  3OAK A;  5CMZ A;  4Y99 C;  2HLO A;  1LT1 A;  1JOC A;  1OVU A;  3T97 B;  5KLI B;  3S4R A;  1RF1 B;  1N7S D;  1DX7 A;  4BRY A;  1FJP A;  5APU A;  2FYN B;  3UIA A;  2MKV A;  2G3A A;  2AEM A;  1SQX D;  3MP7 B;  3H32 A;  3GMA A;  1NU1 K;  1Y8A A;  3N7N A;  1OW7 A;  4DT0 A;  1HGV A;  1JCD A;  4BRY B;  3SFD C;  1G1I A;  1URQ C;  2IFM A;  2RKL A;  1LP1 B;  1M7L A;  2AEF A;  3AEA C;  3AE3 C;  3H32 B;  3PTZ A;  4EI2 A;  5CCH A;  3M9H A;  2OYH C;  2E76 C;  1GL2 C;  3OA7 A;  3U1C A;  2FYU D;  3HTK A;  2P67 A;  3MD0 A;  2WSC J;  4WBA A;  4GKG A;  3TNU B;  2WTY A;  2FFD B;  1S2E A;  2IBZ G;  1JY3 O;  1VQ6 P;  2B87 A;  2YNY A;  4H13 C;  2R5D A;  1JY2 P;  2LR2 A;  1TU3 F;  4N78 E;  4PJ0 E;  4WY4 A;  4Y99 B;  1OW8 A;  1AVY A;  1SQQ G;  2ITA A;  4AQR D;  1BCC J;  2Z5H A;  1JM0 A;  5BVZ A;  5B66 H;  1AVO A;  1N2D C;  2A45 I;  5KKZ B;  1AQ5 A;  1NOH A;  4NPE A;  3HRN A;  1YJ9 P;  2IYP A;  3M0A A;  2FXP A;  1NU1 J;  1UIX A;  2I8D A;  3H1J J;  5AW9 B;  1SQV K;  3TYY A;  1RQU A;  2R44 A;  1BGY D;  1N86 A;  2K37 A;  1M90 Q;  3E1R A;  3KXD A;  3PRJ A;  2E76 D;  2YKQ A;  3AE5 C;  4R4L A;  2BCC D;  1ZRT D;  2JP3 A;  1QVF O;  1LJ2 A;  3CWB E;  5KJ7 C;  1JTH A;  1NWQ A;  2POH A;  2QM7 A;  4I2L C;  3GF3 A;  3U59 A;  4ASV A;  3TGU J;  3HUS C;  1NTZ K;  3QWO C;  1HTL C;  2FYU E;  3PH0 A;  1IO4 A;  1PPJ E;  1SQQ E;  2WPV B;  1LWU A;  1SQB E;  3A0B E;  3JCU H;  3TK1 A;  1VQK P;  1VQN P;  1FDM A;  2KSJ A;  3W67 A;  1VF5 D;  3CC4 P;  1GL2 B;  1AA0 A;  1VQL P;  1N7S C;  2HOD B;  2KS1 B;  2M8R A;  2OYH B;  5TIS H;  1L4A D;  2FFD A;  3IN6 A;  3V4W A;  3S1K A;  3M9B A;  1NTK D;  1BE3 G;  1LTS C;  2E42 A;  2CPS A;  3AEC C;  2NPS A;  4GT1 A;  1DEB A;  3O8Z A;  4I6M C;  1D7M A;  1L0L D;  2IBZ D;  3VMA A;  3GHG A;  2M3B A;  2QJK C;  5KLV G;  2ZXE B;  3AE1 C;  3PLN A;  3L75 J;  1S9K E;  2BEZ F;  1T3U A;  2K3R A;  3C8V A;  4UB6 E;  3A7O A;  3IF4 A;  3GG2 A;  3WUV A;  2OTJ P;  1N7L A;  1P84 H;  3AE2 C;  1BGY G;  1JEK A;  1KIL B;  3AE7 C;  1NTM G;  2O3J A;  2ZJS E;  1HJB A;  4NPF X;  4RJT A;  2FY8 A;  1Q7Y Q;  1VQ4 P;  1L0L J;  1JMM A;  4HJG H;  2YO3 A;  1HGZ A;  3IR9 A;  2OYI A;  2RN0 A;  2OTL P;  3L75 E;  1FJK A;  3G9R A;  3LW5 J;  5CCG D;  3CCU P;  1KD1 Q;  2Q1K A;  1OMI A;  1YQ3 C;  2QE7 H;  3IAO A;  3A3Y B;  1KFN A;  4B86 A;  1DD3 A;  2KSE A;  4PD4 D;  3HE4 B;  3LW5 H;  4EDF A;  2I1K A;  1OFC X;  4ZKU A;  3OW2 O;  3Q2Y A;  2SPZ A;  2G8Y A;  5KLV E;  3H1I G;  1GD2 E;  1J2J B;  2JWA A;  5KLI C;  1BE3 D;  1H0T B;  3AEF C;  2WQY C;  4H44 C;  1SQV G;  2QM8 A;  2KNC B;  1PP9 J;  2IPP A;  1SQP G;  2KNC A;  2M0B A;  1XTG B;  1R5L A;  2HG5 D;  1BGY E;  2IBZ I;  3L70 D;  3N4X A;  3I56 P;  1S1C X;  1SQB J;  2ZYA A;  2WIT A;  3EFG A;  3L73 G;  4R4M A;  2FYU J;  1JCC A;  2W83 C;  1S4X A;  1RE3 A;  2KP8 A;  4KT0 J;  1NTM D;  3CC2 P;  1NTZ G;  2P2U A;  1Q90 D;  2YKO A;  2IX7 C;  3L72 G;  2WT7 A;  2PRR A;  3JCU E;  3KPE A;  1VL2 A;  3P32 A;  5K5G B;  2GM4 A;  4PV1 B;  2JEE A;  5CBN A;  3AEG C;  1BSH A;  4CPG A;  3HE4 A;  4IOI H;  1M57 D;  1FOS E;  2FKW B;  2RH0 A;  5B5E E;  3P7K A;  1PPJ D;  5KAI H;  1NTZ J;  3AE8 C;  1FOS F;  3L74 D;  2C9L Y;  3B5N B;  3KHU A;  1A02 F;  3CI9 A;  3CCL P;  5APY A;  2ZXX A;  3D71 A;  1LTJ C;  3H1I E;  1KQF B;  1NU1 E;  3H1J E;  4EOT A;  3A2A A;  1SS1 A;  4PD4 E;  1IJD B;  4LC1 A;  1ZR2 A;  3H1L G;  4C7N A;  1KV4 A;  1T2K D;  1MFT A;  2BCC E;  3OJA B;  3C1L A;  1URQ D;  2CK3 H;  4OGQ D;  5GTH H;  2YO2 A;  3O6Q A;  1BCC E;  2UWJ E;  1NYH A;  2ZAE B;  3L35 A;  3CCJ P;  1LTT C;  4JF7 A;  1GU4 A;  2R32 A;  1USD A;  1L0N J;  1NTZ E;  1KIL C;  3CX5 D;  3V2P A;  2H89 C;  3L72 E;  1Q2N A;  1YYC A;  2A06 G;  2XND H;  3TGU D;  3RK3 D;  4H13 D;  3TF5 A;  1VQ5 P;  1G2C A;  3RBZ A;  3USS A;  2XKM A;  1URQ A;  1EDJ A;  1AQT A;  3R4Y A;  3M91 A;  1S9K D;  3ABV C;  1GL2 A;  1RY3 A;  1HWT C;  1WMK A;  1SFC A;  1USE A;  2R5B A;  4IFM A;  4K3A A;  4A7P A;  2AXT H;  1Q82 Q;  3H1L J;  1L0L K;  3B71 A;  3C9I A;  1VF5 B;  1YIT P;  4L73 A;  4WVZ A;  1PP9 E;  3VYI A;  3CXH E;  4AYC A;  2ZVO B;  1S5L X;  1NTK K;  1M1J A;  1X9V A;  5KTB A;  3CLQ A;  1HBW A;  1BCC G;  3HD7 A;  2KZJ A;  1VDF A;  1JO5 A;  3GW6 A;  1A02 J;  1JB0 J;  1KB9 H;  2XDJ A;  1U57 A;  4H44 B;  4JBZ A;  4L74 A;  3G6E P;  1AFO A;  4OVN F;  1K05 A;  5AVZ B;  1BE3 J;  3AEE C;  4JYC A;  4O9B A;  1JTH B;  1ZR4 A;  1VQM P;  2E43 A;  3BCC E;  3M06 A;  5APS A;  2V4H A;  3H6P A;  2Q3E A;  5KKZ C;  3H1L D;  1X0T A;  1ZP0 C;  3H1K G;  1T2K C;  2FYU G;  4PV1 D;  2KK7 A;  3WU2 H;  1FDI A;  1OW6 A;  2WSE H;  2YMY A;  3SSU A;  2IDB A;  4DZO A;  2KUB A;  2Q5U A;  1NTM K;  5KJ7 A;  2M3E A;  1KIL D;  3SFE C;  4K35 A;  1KN7 A;  1L0L G;  1EXI A;  1EZV G;  2D2C D;  2A06 D;  4WY4 B;  2P7J A;  3TGU G;  3VP8 A;  2JR8 A;  4C46 A;  3TNU A;  1LWU C;  1T3J A;  1FZA A;  3E1I A;  5H2F H;  3G71 P;  3RK2 D;  5CCG A;  2Q9I A;  2IFN A;  1W2B O;  3H1K J;  4GIF A;  1X8Y A;  5AW8 B;  1IFI A;  2Q6Q A;  1M56 D;  1CI6 A;  1KYO H;  2WWW A;  4HYT B;  4JQ0 D;  3HTK B;  4GOF A;  3BCC G;  5CCH C;  2FFD C;  2K88 A;  4HH2 A;  3RGU A;  3CWB G;  4XFJ A;  1RH5 B;  1P84 I;  4Z1M H;  1VQ8 P;  4IFF A;  1Y9B A;  1E79 H;  3P8M C;  4OH8 B;  5GTI E;  2HPC A;  2HPC B;  5TJH A;  1GMJ A;  2WSC H;  3CL3 D;  2WPQ A;  3Q3D A;  1RF1 A;  3L71 E;  1SVF A;  2KI7 B;  4M3L A;  1PPJ G;  1SQQ J;  3L73 J;  2M5A A;  3VOP A;  1PL5 A;  1Z56 A;  1FS0 E;  3M0D C;  5APQ A;  3TGU E;  2JDI H;  2O1K A;  4IL6 E;  3T97 A;  1VQO P;  2JKV A;  3PJS K;  5AW2 B;  3EFF K;  2QRX A;  4IL6 X;  1FC2 C;  1EZV D;  1FE6 A;  1HUC A;  1M8O B;  1S3J A;  1SQB D;  1X79 B;  3L70 G;  1LT9 B;  3CX5 I;  3MZW B;  2FYZ A;  4LGD E;  2XZR A;  2ZYG A;  1KFM A;  3L73 D;  1S5L E;  3W68 A;  3HD7 D;  2WSS H;  4WWI A;  3B5N C;  1HJ0 A;  2ZYD A;  1YJN P;  2O01 N;  1QL2 A;  3CME P;  1ZRT E;  5KLV D;  1KYO I;  4PV1 C;  1IFM A;  3A0H E;  1KQS O;  3HUS A;  4YTP C;  1JNM A;  4W80 A;  1BDD A;  4N3Y B;  2K1A A;  1AJY A;  2ZT9 C;  1RF0 A;  2K9Y A;  4DCK A;  1JY3 N;  3SWF A;  3Q1M A;  3KDP B;  3L4F A;  3RL0 D;  2IZ0 A;  1EDI A;  2E5Y A;  2PFX A;  4H13 B;  1ZN5 A;  2K9J A;  1GTW A;  2CPB A;  1RE4 C;  3HD7 B;  2B89 A;  5KJ7 D;  3A5T A;  5L8R J;  3BCC J;  3VMX A;  1FU1 A;  4QMA A;  1QVG O;  1NU1 G;  2P58 A;  1MFZ A;  2NPS C;  2OGU A;  2L5G B;  1BE3 E;  2W27 A;  1KYO E;  3H1J G;  3H1I D;  5APT A;  2WPS A;  3H1K D;  3L74 E;  5CCH D;  1W2E A;  1P84 E;  1SFC B;  1SQB G;  1YTZ T;  2QG4 A;  1ZOY C;  2IBZ E;  3FWL A;  4OWF A;  5CJ0 A;  2E75 C;  3PP5 A;  3Q5S A;  2H43 A;  1CSB A;  4DOJ A;  1IK9 A;  1W5C E;  2V7Q H;  1G2C B;  3AEB C;  1NTZ D;  3CX5 E;  3F89 A;  3B5N D;  3CCR P;  2R3C A;  2A45 H;  5KLV K;  1YHQ P;  1SLQ A;  3H1H E;  2QIW A;  3MIW A;  3BAS A;  1YI2 P;  2OYI C;  1FZB A;  1NAY A;  1OZH A;  5EFW B;  1SQP D;  3WUT A;  3SWK A;  3WU2 E;  4C7N B;  4AUW A;  3TSI A;  2XU6 A;  1N73 C;  2N1T C;  3FGA D;  5BU8 B;  4ZNC A;  2DW3 A;  4XE5 B;  3RK3 B;  1EDL A;  2KB7 P;  4IL6 H;  3PHL A;  1IFJ A;  2JWD A;  5DJU B;  1ZV8 A;  2C0W A;  2KXP B;  1P84 D;  2WMM A;  2QJP C;  4D6T E;  1FZG A;  1FZF A;  4UB8 E;  4WY4 D;  1MV8 A;  4ASW A;  1NTK J;  1AV1 A;  5CBO A;  3CCM P;  1FZE A;  2C9N Y;  3VMY A;  3E7K A;  2WZ7 A;  1Q81 Q;  1SQV J;  2K9J B;  2YIU C;  2AXT E;  1QEX A;  3H1H D;  4WB4 A;  3FXE A;  2Z4E A;  5APW A;  1L2P A;  2BAS A;  2YIU B;  1VQP P;  2O01 H;  2L91 A;  4HB1 A;  1YJW P;  2NZ2 A;  4TLF A;  3EWK A;  1SQQ D;  1T8Z A;  2Z5I A;  2J5U A;  3FX0 A;  4KHX A;  3I55 P;  3CCV P;  2Y9Y A;  5H2F E;  1S5L H;  3V2N A;  2D2C C;  1LNQ A;  2Y0C A;  4H44 D;  4HKZ H;  4N78 D;  3CCE P;  2OAR A;  2N9Y B;  1J1E B;  1K8A Q;  1VPC A;  1KQL A;  4U3F J;  3MUD A;  2E75 D;  3FWN A;  4I1L A;  1N73 B;  2PGD A;  1LT9 A;  5AW4 B;  4I7Z C;  1J1D C;  2E74 B;  3S9O A;  1YBK A;  2OYO A; 
#chains in the Genus database with same CATH homology
 4PD4 D;  3FWL A;  2QG4 A;  4EDF A;  2Y0D A;  5KKZ B;  2Y0E A;  2QJP B;  3CXH D;  2K9J B;  1NTK D;  3GW6 A;  4U3F D;  5KLI B;  2JWA A;  5KLV D;  3H1H D;  1BE3 D;  4D6T D;  1NTZ D;  1BGY D;  2FYN B;  1L0L D;  2IBZ D;  2YIU B;  3PRJ A;  2RN0 A;  2KNC B;  2L91 A;  3VMA A;  1SQX D;  1SQV D;  1KB9 D;  3PLN A;  3CX5 D;  1SQQ D;  2BCC D;  3L70 D;  2Q3E A;  1ZRT D;  3H1L D;  5TJH A;  1SQP D;  3GG2 A;  3TGU D;  2QJY B;  3PTZ A;  1NTM D;  2Y0C A;  3L75 D;  3TF5 A;  1BCC D;  2O3J A;  2N9Y B;  1PP9 D;  2QJK B;  2FYU D;  3CWB D;  3L73 D;  4RJT A;  3L72 D;  2KS1 A;  3BCC D;  4A7P A;  3PHL A;  1NU1 D;  1KYO D;  2A06 D;  3H1J D;  3L71 D;  3ITK A;  1P84 D;  1EZV D;  1PPJ D;  3H1I D;  3TDK A;  1SQB D;  3L74 D;  2RMZ A;  3H1K D;  3KHU A;  1L0N D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...