1ZR2A

Structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCAGTGTCCGATAATTTAT
publication title Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination/dna
total genus 46
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zr2A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zr2A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zr2A01
3FKIJ 5EYRA 2GM5A 5E3LA 4GFBA 3Q0UA 3LHFA 2L9RA 1XG1A 3MVPA 5F27A 2JA5J 4DZJA 2LK2A 3ZQCA 3TW6A 1ZR2A 4A3KJ 1VF9A 2XB5A 4W1UA 2FD5A 5FJ8J 1AKHB 2HOAA 2LLKA 5BNGA 2L7MP 3Q3SA 1LFBA 1FEXA 2XPUA 3G1LA 2K9NA 1RKWA 4UUSB 3PKZA 3G1MA 2E19A 5C35A 2K40A 1QRYA 2TCTA 2AO9A 1RETA 4BKXA 2JN6A 3WHBA 3I4NJ 1RESA 4HNVA 5F0CA 5E3NA 2DA4A 2Y2ZA 2OPTA 2ECBA 1BA5A 3SDGA 2WV1A 5HODA 3LSPA 4M6VA 1ETOA 3A02A 5DS9A 5E3OA 5FLMJ 3BTLA 5C31A 3FK6A 4FE7A 1JKQC 4M3BA 1TWAJ 1R9TJ 4IHYA 4CYCB 3S16J 2NS8A 3HKZN 3MKLA 5EEAA 2L7ZA 3JRIA 1GT0C 3D1NI 2IEKA 2JWTA 1IDYA 4MLOA 4A3IJ 2R92J 1RKTA 3LSRA 5C44J 3TP3A 2ID6A 2XB0X 2K9QA 4W97A 1LFUP 2M8GX 1AKHA 3HEFA 1U8BA 4JP0A 3M3YJ 5FLVA 3IH4A 3BT9A 3K7AJ 4UUSA 5K7FA 1GV5A 4QTRA 2NOGA 3LOCA 1BJZA 4X6AJ 2YUSA 3HBLA 1ZKGA 2ID3A 1HDDC 5C4XJ 1T56A 3SFIA 4AC0A 3S1NJ 5K7HA 5FKOA 1IGNA 3Q0WA 2HOTA 4CYCA 1OCPA 2N8GA 2NVYJ 1NK3P 2ME6A 3HGGA 4V2GA 2HXOA 4B3AA 3F0CA 2JK3A 2E2IJ 1F43A 4D7MA 4I76A 1FTZA 3JRAA 5FKMA 3QPLA 5F04A 2DJNA 4IHXA 3BR1A 5FKKA 2E2HJ 2MGQA 1BL0A 1I3QJ 1APLC 1MBKA 2CUEA 5FKLA 2RSLA 2VI6A 1ETQA 3GBGA 5EZHA 1HF0A 1IRZA 2EZKA 1IDZA 3IV5A 1ZK8A 1I6HJ 4C3IJ 2W48A 2O8KA 5J1RA 3W6VA 2NVQJ 2VKEA 2MG4A 4FISA 4A93J 4L5EA 3RKQA 4A3FJ 1BW5A 3QQAA 3CDLA 1OFCX 2XPWA 1HDPA 2O7OA 4MFEA 1TC3C 2FX0A 2DTZA 4Y7NJ 3CQZJ 1T33A 4NDLA 2YU9J 1JTYA 3K2AA 3ZQFA 4M3GA 1JUSA 1Z77A 1HLVA 3UJ3X 4Y52J 4RDUA 2XRLA 2DA7A 3B6AA 1MH3A 1TWGJ 3GUVA 3JRBA 4I6ZA 2VUMJ 2CRGA 3BQYA 1AU7A 5F08A 1JTXA 4C2MJ 1UMQA 3NAUA 1JJ6C 2LD5A 2DA2A 4IHVA 1JT6A 1SANA 3BG9A 2XGEA 5EGOB 2DMTA 1FIPA 4IEJA 3PO3J 4BY1J 5J1UA 4ABZA 2GBYA 4A3MJ 1OCTC 2FJ1A 3HOXJ 1ETXA 1GVDA 1RR7A 5C34B 2EZIA 3OSFA 4DYRA 5IYBJ 2Y30A 2M2EA 3RZOJ 2LR8A 1K83J 1Z0XA 2OF7A 1ETYA 3JR9A 3UKGA 1GUUA 2MSYA 1O4XA 2GM4A 5F1JA 1SFOJ 4QSHA 3JRCA 2HOSA 2Y31A 1TWCJ 3QPSA 3GTJJ 3S1RJ 3C2BA 1FTTA 2XPVA 1MBJA 3OIOA 3HOYJ 2LFBA 5EGOA 2VPRA 4M3DA 1X2MA 3S14J 5IOYA 2ECCA 1WH7A 3L1PA 4BQQA 2WB1N 1XC5A 5M5WJ 3PO2J 3H0GJ 1QVTA 2CU7A 4AYBN 4MIMA 1DU0A 4IHWA 1YRNB 1U78A 1JUMA 1X58A 5JLWA 3BR3A 3JREA 2LKXA 1PUFB 2XGCA 5M5YJ 3BTJA 2XSDC 3GTPJ 2EQRA 3FISA 3HM5A 5EDNA 3G13A 4BBSJ 5IPAA 4JYKA 2DMUA 2NVXJ 4JX4A 3TW7A 2FQ4A 3SJMA 1JUPA 2VKVA 3M4OJ 3CCYA 3PM1A 1X2NA 2AHQA 3JRGA 3MN2A 2Y9ZA 4BY7J 4B4CA 2I10A 3ILXA 1ETKA 2KT0A 2DMQA 4FE4A 3ZQLA 1W0UA 1P7IA 4D5CA 5M3FJ 2JA8J 4A3BJ 2PMZN 3IH3A 3BTCA 1YRNA 4DZPA 2D5VA 4A3GJ 4DYCA 2EH3A 2HXIA 4MFDA 4A3EJ 4A3DJ 3H3VK 3S15J 2EBIA 1PUFA 3BR6A 5M5XJ 3B6CA 4QIWN 2CJJA 5F0FA 3VPRA 3GTMJ 1ETVA 1F36A 2ZB9A 1MBHA 2LTPA 1VI0A 2KDZA 1D5YA 3HB9A 3O8HA 2ELKA 1U9OA 3Q0VA 3HOZJ 1QVUA 5M3MJ 3S17J 1IC8A 3HGYA 1E3OC 3LHKA 1JKPC 1TWFJ 2Y9YA 4AUXA 2IAIA 2LY9A 3A01B 1WI3A 2X9DA 5E3MA 2IBDA 3GTOJ 2CUFA 1EF4A 2JJ7A 3O8GA 4C3HJ 4DW6A 3LNQA 3HOUJ 4BBRJ 3A03A 1POGA 3LSJA 1Y1WJ 2X48A 1IV6A 1HOMA 1ZQ3P 2QF7A 1GHTA 3E7LA 1JKRC 2M0CA 1B72B 2DN0A 5C4JJ 1JT0A 2DA3A 4V2FA 2K9SA 4UUTA 3DEWA 3I4MJ 3RZDJ 5EF6A 1FJLA 1G2HA 1ETWA 1MBFA 1OJLA 3LSGA 4A3JJ 2GLOA 2R7ZJ 5IOZA 5DTDA 2L7FP 4FCYA 2O9LA 1MSFC 5FKNA 1ITYA 1S7EA 2E1OA 5IYCJ 1W0TA 1ZGWA 1JGGA 1MBEA 3A01A 4C3JJ 5J3LA 1GDTA 2H8RA 2M34A 2HYJA 2ME0A 5JLXA 3BQZA 1GV2A 1MNMC 5EG0B 3BVPA 1RPWA 3BR2A 5F0HA 2R5ZB 3GTLJ 3IH2A 4JX5A 2HQ5A 1A5JA 4FTHA 4JX6A 5EZGA 1IG7A 2R5YB 4MO7A 1B72A 3S1MJ 4M3FA 1JKOC 3OOUA 3HOWJ 1LE8B 1B8IB 2X6OA 3JRHA 1VNDA 1ZTRA 4LOCA 1WH5A 2JA7J 1IUFA 1A6IA 2M9HA 1WCMJ 4XRSG 1JJ8C 1TWHJ 1UG2A 3BG3A 5K7ZA 1UHSA 3TEDA 1P7JA 4EEFG 3CMYA 2E2JJ 1WGXA 4RBOA 2DMPA 2HI3A 2CQQA 4J19A 5IP6A 5EG0A 4S0HB 3DCFA 3S1QJ 3OSGA 9ANTA 2MW8A 2R5ZA 2JA6J 1XS9A 3ZQHA 2JMWA 3FIWA 2R5YA 3RQIA 2H1KA 3BTIA 1I50J 2EZHA 1NTCA 1MH4A 2P81A 3HOVJ 2TRTA 1LE8A 1ORKA 2L0KA 1B8IA 1HCRA 2B63J 3S2HJ 2Y0SN 2CQXA 4X1EA 1U9NA 1BW6A 3BR5A 5GPCA 4D5FA 3S2DJ 1FIAA 2MHCA 5GP9A 4B1RA 1H8AC 2WAQN 1IJWC 2COBA 2QCOA 2YS9A 2EZLA 4XK4A 3ZOBA 4BXXJ 4XRSA 4XRMA 3NARA 2HDDA 2R93J 1ZR4A 5C3EJ 1MSEC 1K61A 3G1OA 4XICA 3GTGJ 1DU6A 5IYDJ 3FK7A 5IP7J 1H88C 1CQTA 3JRFA 2RAEA 5GPAA 1WPKA 4DYQA 2NS7A 2NVTJ 1QPIA 2LVSA 4A69C 4D7NA 1AHDP 2DA1A 1MBGA 2G0EA 2DA6A 1H89C 1HX7A 2XGDA 4G12A 3ZQGA 3HDDA 5IP9J 4A3LJ 2LP0A 1Q1VA 3BR0A 5C32A 2DA5A 3BG5A 3JRDA 4A3CJ 1VFCA 1Y1VJ 3GTQJ 3TP0A 3WHCA 3GTKJ 2R0QC 3ZQIA 1NK2P 4M3EA 4XIDA 1ENHA 5J1YA 2DMNA
chains in the Genus database with same CATH superfamily
4HDNB 5FA5A 3ZV5A 2AC4A 4M55A 2C97A 1UDCA 1ZGGA 3TD6A 1CU1A 2HOAA 3KEYA 4CPDA 4MWGA 1Q0TA 2PMKA 4F4DA 1V11B 1YZGA 1CRQA 2JGLA 4MPPA 2CWWA 1Z6QA 3I0ZA 1L0LJ 1I1QB 2JJ2A 1YULA 2A58A 4J01A 2L4MA 2OENG 3WGVA 1UMBA 4J0KA 2GK7A 3OA7A 3JVVA 1VQ6P 2NVBA 3OZGA 1AVOA 2WG2A 2OGZA 5T41A 3ENQA 3OX3A 2EL7A 4YVFA 1C0EA 2YUSA 2XUQA 2YFQA 5LKRA 3OYCA 4YUVA 3P2IA 1W73A 1XJ5A 2MABA 1X42A 2FSHA 2IDKA 5DJUB 4HD8A 3RUIA 5JTUA 2K3PA 1C0KA 2JK3A 3BD9A 3ZN2A 3KVYA 3AUSA 2F5CA 2H48A 5A4JA 1H2YA 2AXCA 3O4GA 2GMWA 1XCMA 3IIJA 4PHFA 3FCYA 4JB8A 2P6SA 3M6FA 4XARA 5BV2P 3D3KA 3NNDA 5BMVA 4RDIA 1E2LA 1ZDMA 5HLHA 3CWBE 1ZCBA 2WA0A 1MH1A 3SX2A 3QPUA 4Q3AA 2V1NA 5ISMA 1ADBA 4Z0PA 3B2QA 5LC1A 1UXGA 2FUG2 4LJ5A 3EQ7A 2UU9B 2O7OA 1C0PA 2DTZA 1C9DB 3IELA 4L28A 3GCWA 4JELA 4HEQA 4PGFA 2G7MC 4B40A 1SQSA 4IDAA 3GUCA 3GD7A 4UU8A 4HTFB 5HQJA 3G2BA 2VVTA 4OHKA 4GKVA 3W1EA 3SBEA 2ZYAA 2GK3A 3VJMA 1PZHA 2EL9A 3GNSA 3L7JA 1I01A 3IV7A 4KGZA 2VRCA 2AFVA 2LNDA 1N2CA 4HZIA 4TRRA 2BMFA 2G0AA 2LH9A 2LREA 5FGMA 3CB4A 3SZOA 2W6JD 4AYWA 3PFHA 3A6ZA 5IOYA 1RYZA 3OE4A 2QLTA 1D8TA 3FDZB 1X74A 4ZQCB 4E03A 4GXNA 1SHUX 4LN1A 2ZDQA 5JCJA 5AI0A 4LVNA 3EK2A 4AG3A 2J32A 4OAQA 5J3JA 1OXVA 4TMTA 1RZRD 2NVXJ 3WK6A 2Q5OA 2A61A 5EJ4A 3C7DB 2O7SA 2G72A 1D2CA 1D4AA 2CMGA 3THSA 1A50B 4CCSA 1T3SA 5FWNA 1Q14A 2C88A 4OH8B 1RF1B 4HF7A 2HUNA 2OHHA 2A5JA 2HMWA 2O05A 1RXEA 2KJQA 4L4UA 4JLJA 4UZSA 4B71A 2VT2A 1Q82Q 4BE1A 3FWPA 3FY4A 2V0CA 3PUBA 1HMPA 1FWZA 1SELA 3BRTB 4DT0A 4UHCA 4LV8B 3WYAA 2WF8A 3RVQA 1CPYA 4BB9A 4L0CA 5EMHA 4BO3A 4C7RA 1WRBA 1LW7A 1SXJD 4FDTA 4LBWA 2WD7A 4LWZA 1COWA 1G42A 3OTHA 2E0IA 1IHDA 3WQSB 3T97A 4FCYA 4DIUA 2B21A 4TN5A 3AQIA 3CF4G 2KPMA 5E4TA 1G1IA 1GQRA 2FJ0A 5C8YB 3V4WA 4IDNA 4GLJA 3AVYA 3L70E 4IRHA 1YQQA 5CM2Z 2G8YA 5DOVA 2C9CA 5MFZA 1TZLA 2XHKA 2WIKA 1VNDA 1LVUA 2CLFB 1QGPA 4UBJA 3W3AA 4M0FA 3WR5A 3LT5A 1ZA2A 1WIWA 1X13A 3A3OA 5EVJA 2H8WA 1RQ2A 3R3WA 2YRWA 5F9HA 4BS9A 2VAPA 4M1ZA 5G4KA 5JDIA 2M1BA 4G07A 4XUCA 4DCTA 4AVPA 1C1XA 3DOCA 2BP7B 4M9RA 3GNLA 1JSZA 3BR5A 2RDPA 4FMCB 4V0OA 5GAGJ 2YHSA 1V47A 1NTMG 3ZEAA 4TLAA 2NUPA 4CFYA 5IYZF 3N05A 3H6KA 4NK4A 3JATA 1GGEA 2BFOA 5CEJA 2YV1A 3E9MA 2KZJA 4ARSA 3BILA 5TT0A 4LIPD 4CODB 3PQ8A 1JQLB 3UKOA 2O7NA 2M1XA 3EFEA 1U81A 1SP4A 3ADKA 3CU5A 2C3YA 1G3WA 1SY7A 4FW8A 1EZZA 1JFLA 2VBZA 4AX4A 5E6UA 1HW5A 4CIXA 1U28A 1JQEA 1ZR2A 4A3KJ 4EX7A 3FM5A 1VF9A 3A70A 4DFDA 4J0CA 4EB6A 3E3AA 1G3TA 5JADA 5LGNA 4RKWA 1RE4C 4MO2A 3W6ZA 2HXYA 4R9RA 2EV5A 3EMBA 4J4HA 1XLVA 3GELA 3W7AA 4RESB 4BOYA 3GLLA 1PJBA 4PG5A 5TE9A 1UHMA 1T3GA 3Q41A 2W1OA 3RL0C 1G3MA 3FPBA 4ZRNA 3G17A 5CFQA 1C0WA 1XLTC 1IJKA 4S1PA 3HJEA 3T7EA 3NWBA 2R11A 3WLKX 1SCIA 3NATA 4I76A 2QVGA 2Q4OA 1AK9A 3U3JA 4RGRA 1UBSB 2C2MA 2R8EA 3IPXA 4HSGA 3RS3A 2VNIA 1IUKA 1M8PA 2P1ZA 5FKLA 2EU8A 4H4KC 3AY0A 1GUZA 2Y0BA 3T1BA 1C7QA 1HOTA 1LGHB 3RQSA 3TR6A 2XY4A 3EBPA 2NOAA 4JBYA 4DIOA 1OD6A 4R2IA 4BZZA 1NXTA 3FDIA 3MRSA 1M2VB 1W7PD 2Y99A 2VKHA 1UKAA 2FX0A 1AG9A 2OHGA 1NYTA 1PGOA 2E71A 3R6SA 2C54A 1EX6A 3C18A 2PLFA 4NZZA 1YJ9I 3HUSB 3JRBA 3LWFA 4FYKA 5LP6C 3M5DA 2KHZA 2OBXA 2R8BA 1BGYG 3DPLC 2XE6A 3EPPA 1OI3A 2Q3CA 1JYEA 3NHWA 4XASA 5AUNB 3FUXA 1KEUA 4QUDA 2QYHA 5FEUA 2OR3A 1U2GA 1Y8CA 1I1OA 4HA8A 4YRQA 1XMQB 2ZAOA 3G68A 3VR5H 4C06A 2L2OA 3HPHA 1S7OA 1GPH1 5KWEA 4C5CA 2P35A 3O8LA 3HOYJ 4WD3A 1JMVA 1R8XA 3B70A 3W2HA 5ITWA 3HB1A 3CRRA 4NC7A 3DDOA 5KYYB 4BWVA 3K4BA 1L0LE 4CM4A 1IHOA 5A71A 4LZWA 2ZDHA 1X58A 1CY2A 2B5WA 4XSGA 2XXAB 3I5UA 4OJKA 1R6UA 1KU9A 2P4SA 1BSVA 1UF9A 5HS7A 3E7WA 5IJ9B 1FPQA 4HX5A 2FNAA 4AN4A 1ZBQA 1FFAA 4MV9A 1UCFA 3S4RA 1VOTA 1U3DA 2BFBB 1WCYA 5EQJB 2OORA 1LNSA 4FE4A 2F6RA 3ZQLA 2P7CB 4BP9A 3DFUA 1E2QA 4EGZA 3DEIA 3EVAA 2B4KA 2Q62A 4YFKF 1NG6A 1C8VB 1P8JA 2EB7A 4M0UA 3RVDA 1QH1B 1UANA 3MP7B 2AGVA 3DL0A 3PNMA 1ECGA 4G1EB 3VWBA 4JSYA 1EP9A 3KE8A 2IAIA 2K4JA 1ODFA 3U3KA 4PNEA 1FXWA 2NRAC 2X3YA 4A8JA 4ZN6A 2FYNB 5A3RA 2GLUA 4DDMA 4M72A 4JX9A 3FXAA 3SYKA 3CH6A 3KQSA 1PN3A 1AV7A 1H0SA 1F4KA 2C83A 1LEAA 4Y4RA 1YAJA 3VYVA 4BMVA 2YC4C 4IHAA 2IU6A 4L07A 5B7NA 3K20A 2GJSA 2EW1A 1JVNA 1B8IB 3TOZA 2ZIFA 4FFPA 3HUGB 3D2AA 5TNXA 1J8DA 2FWJA 3RC9A 4HZUB 3CG0A 2EP7A 3H1KD 4EECA 4S0HB 3E5UA 3EGXB 1O96A 4DR5B 4BE2A 1W4LA 3TLKA 1AA0A 4I3FA 3IAS1 5IM4A 5JO9A 1C8BA 4CHTA 2F5DA 2SKDA 4ITUA 4CQMA 3SZ3A 2WT4A 3MHVA 4NL4H 4QGSA 2VTVA 3ZG6A 4FM9A 3NBXX 4DV7B 5IT3A 1CJBA 2W2KB 3FK7A 3JRFA 5E9WA 2P68A 4KPEC 3E6MA 4TLMB 3NTUA 2IGBA 2YVAA 4PLVA 1NBIA 2PX3A 1KYOE 1VFNA 1CF7A 3A04A 1DG3A 2ORVA 1Z5PA 4FS8A 4H0NA 5F7JA 3KXKA 3PHGA 1ZOLA 3DCIA 4JC5A 3NBMA 5ILOA 3GB9A 4LYFA 1ONSA 2GM5A 2WIBA 3O8DA 3QPWA 1ZGZA 3ONNA 4J7UA 4NJMA 3BRVB 2YMQA 2YWXA 1QHEA 1EB8A 3HU5A 4L22A 3M0EA 4FFSA 3V32A 2NU6B 1Q1NA 2DEUA 3SDGA 3H1IG 4O3FA 2OXRA 3QLTA 1XZIA 4MQ6A 4MLOA 4WV3A 3OU7A 4F5WA 4NDAA 3NDRA 3NEPX 3VODA 4PC6A 2NTVA 3B6KA 2P69A 1WLSA 1JV2B 3AUXA 4KHPB 5AW9A 1QMGA 2RAFA 4F06A 5EZYF 5HTKA 3K0AB 3ZK9A 1IMJA 1XTSA 3PXUA 1VG1A 3S93A 4ZO8A 4OSOA 5LB2A 4CMEA 3WMXA 4NCBA 1D6NA 5CDFA 3TNDA 1Z2CA 2YDXA 2M4GA 2QPTA 2HQOA 1QV6A 2W2LA 4F4UA 2BFEA 4GAEA 4R7GA 3ED5A 2JD1A 5BUSA 1ODDA 4J75A 1WU8A 2JRTA 4G8CA 2EX0A 4GRDA 2DWPA 3CT6A 3V6IA 2R85A 3ST7A 3IOEA 4GIFA 1YDFA 1F17A 5GZ6A 1T8YA 1USIA 2FFQA 3AEYA 3B9RA 3BMNA 1KYXA 4QICA 5KVVA 1BMTA 3DEUA 3VSAA 3D6AA 1IDOA 2P0AA 4M3GA 1DAOA 1LJLA 4Y52J 3AW8A 2BRUC 2DRIA 3FMQA 4A2WA 5JAMA 3HGQA 4QXAA 1R16A 2FW1A 4OGQC 1ON1A 1VXRA 3PP8A 2NPSA 4J94A 1KOFA 4PZCA 1YJQA 4MP8A 2AKEA 2NO0A 1LTTC 1GA4A 4TTAA 4PBRA 4BU0A 3JR9A 2HLPA 4C6RA 4RIHA 1PKEA 2ZJ3A 5C46F 3GO4A 4BP3A 3IAOA 4PGAA 1F6WA 1FTTA 5JASA 3W2TA 2V45A 4Y3OA 3OIOA 5A03A 3NKFA 3W06A 2O4CA 1NTZD 4UJ5A 4R81A 2XDQB 3QHAA 4M38A 1RPJA 3ZY2A 3G2NA 1EE1A 3K1AA 3L0OA 2HVRA 3KQLA 2CK3D 4RL4A 1WETA 4NYJQ 3R9XA 2DX7A 4Z8YA 2XGXA 2NXNB 3PD0A 4EYOA 1TIKA 3PH0A 3ISJA 5HLTA 4YFNF 3KXLA 2RNJA 2W0SA 3DA8A 2EH3A 3LLSA 2B25A 2Q2EA 3A0BE 2D0IA 1MAAA 3RAEC 3QELB 2IHZA 3WADA 1XQ6A 1TE2A 1K05A 4DM4A 5AOBA 3TW0A 3HP1A 1SWWA 1GT6A 4JU8A 5ECDA 3B8EA 1AGYA 2A5FA 2ZMEA 4PV1C 1EFKA 4J7XA 3F6YA 1VB3A 2GRUA 3SKVA 2CVZA 4Y9TA 3DMHA 4Q82A 3RF7A 2FWNA 4O4IB 4LZLA 2GLOA 3SHWA 4QOGA 2B34A 3ANSA 4KYTA 3E9NA 2Q3JA 1E2NA 4AS1A 1S6LA 4CL3A 3A37A 4BHBA 1YE3A 4WA7A 4WZBE 5GIPE 3V1MA 1VZ3A 2MH9A 3DHEA 3DU5A 4A2PA 3T3DA 4P4GA 1P2TA 1JIJA 1OVMA 2J9FA 4LECA 3F6RA 1L4FA 5DHUA 2R7DA 4BO5A 5JYDA 1Z56C 4J3JA 2PLAA 3UM9A 2EYUA 3S81A 3KVOA 2UYOA 3E8XA 2R6GA 1O7LA 2H6EA 2OLEA 3WU1B 2XWBF 2DUMA 4AVYA 1PWZA 3ZQUA 1QGUB 3URKA 1USTA 5HRCA 3HJTA 4CKBB 3QNUA 2WINI 3EWKA 2JFXA 1DOAA 4XLAA 3GZJA 1RF0A 2QKYA 5I9LA 1SUAA 1DU6A 2K85A 2AQHA 2BHSA 2P3SA 1KJ8A 4TYYA 4BKRA 5EIWA 3PHBE 1PV2A 2XD9A 2Z99A 5CW1A 2AC2A 4MCHA 3I73A 2IIQA 4ALMA 1SQPD 2XNSA 2VXBA 3OLXA 3ACDA 5KTOA 3NDPA 5EE3A 4X60A 1ORVA 2QE7A 3WHIA 3RSSA 2WUFA 2WB4A 1TQ4A 3ISPA 2JHCA 3BK1A 5JIBA 1MV8A 1X7WA 3NRJA 3REGA 3IRRA 5GTHH 3QKWA 2J59A 3ZD9A 4LOHA 3OSUA 1D03A 1E0KA 1H2XA 5E6SA 3CCJP 4ETMA 4BAGA 2HSDA 4OXNA 4MROA 3WB9A 3ANMA 4DA8A 3A0BC 3U9GA 1OH5A 1Y89A 1VL1A 3C48A 2E1MC 2AN5A 4GCVA 4BTEA 5HW0A 4PZLA 1H6BA 1AQNA 4Z1MH 1WUYA 4AYCA 5C4IA 3E2PA 4MCIA 4BKMA 4ETNA 2V6CA 4OLAA 4YAKA 3L8HA 2BJVA 4XDZA 1EFRD 1TKRA 4R31A 5DGDA 5FYDA 2FKWB 1T0FA 3W9BA 4R9UC 2PRKA 2I6GA 3IBSA 1ZI6A 4F85A 3MFKA 1LTJB 4F1WA 4EHIA 3EYIA 3GT3A 3IFMA 2V0NA 2BJHA 4I0BA 1JZTA 4MIOA 1P8AA 1XRLA 4HGPA 4EHJA 1HQKA 3B6JA 3R7WA 1FS0E 4MFEA 3WA7A 4E7LA 2NNLD 3RT7A 1J24A 4P86A 1UBEA 2YU9J 1OHHD 3CBGA 2AIRA 4KO3S 4D9BA 1HLVA 3TUZC 4TS4A 4N5HX 5T4BA 3TSAA 1UL1X 1P44A 3DUFA 1FOYA 3M4JA 2WWHA 2E74D 1H3NA 1GY8A 4TV9F 4JP8A 1VQKI 1O8CA 2LY2A 2H1SA 1QPZA 1N2JA 5DMHA 3CURA 4EHHA 4H60A 1QS0A 1XTBA 1C3JA 3VGJA 2PRZA 4CCAA 3MPOA 2JHPA 3O1JC 4O4HF 3AHIA 2J6HA 1T4BA 2PXAA 1DINA 4P8RA 3ROEA 4J03A 4ZU3A 3R40A 2F48A 4PHCA 1G6OA 4O0LA 2I4IA 1YK0A 3OYHA 4Q9IA 5L3QB 1RRCA 5AKHA 1RY3A 2W8BA 2D1FA 4TKLA 3TZEA 2QMHA 2JL1A 4ER7A 4TTIA 4RNCA 1KJIA 3JQ8A 1FFYA 4R2KA 1QQ5A 3PQ6A 3OZFA 1V95A 5JXGA 4JX4A 2EFGA 4RLFA 1CSBA 3GRUA 3FPJA 4I55B 3LY9A 5TEVA 2R79A 1QL1A 3HZRA 3DZFA 4O4JA 3ZD8A 4AKSA 4NJEB 5TXGA 2H51A 2XAUA 1CY7A 5K0LA 2ZRAA 1ADCA 1BXRA 3PYXA 1Z7LA 3BR6A 3NALA 5K8IA 4DANA 5JJBA 2ZB9A 1L5FA 3E05A 3ESCA 5FJJA 5TQVA 5DYMA 5IW8A 1N7SA 1HDZA 1WJDA 1RS0A 4I5IA 4DSOA 4K9MA 5A02A 4ZTUB 1E6WA 1QIFA 3K1JA 2GPNA 5LHIA 2QZSA 4O25A 4X95A 1VCIA 1ENYA 1POGA 5LGTA 4G5RA 3IH5A 5KAIH 4DJEC 3L7CA 1A5SB 3E7PA 3MUDA 4P5EA 3V2GA 5K2MA 1I4OA 2F4NA 4MLDA 5LMUB 4ILKA 3A2MA 1G5PA 1TC2A 3GARA 2EJUA 3U4QA 5FJIA 4Y18A 4KRYA 3U4IA 3H1JJ 5J3LA 4LGDE 4A0QA 2C58A 5KX5F 2X6XA 5TQ2A 1DKOA 3COPA 1L8XA 3X1MA 3VPSA 1F9EA 1JEQA 1NY5A 4N5DA 3KKKA 1WEHA 2ZBDA 3CESA 3NHUA 2QNIA 3HJUA 4MV5A 5APYA 4DBQA 4LXHA 3GEEA 2R44A 1ZK1A 2XRMA 1J8YF 3PKJA 4U8GA 1F8YA 1IL0A 3EYAA 4PBTA 4ZI3A 3I6YA 1Y5RA 2FOWA 1XRPA 1V1MB 2F43B 2CXHA 3OSZA 1VIYA 1XEFA 3DL4A 4CPGA 2M0BA 3EGOA 1VA4A 3OBIA 2DW3A 3ITKA 2NYXA 3OUZA 2ZS7A 4HC4A 4LXQA 2G8LA 2YNMA 3SIRA 4HYEA 4RNDB 5DTEA 3I0TA 4NPHA 2OXIA 1FRNA 3JQRA 5HKKA 5K8VA 2GYUA 3FDJA 2VA9A 5KAMA 3PQ4A 3IKMB 1EJ9A 3QJYA 4Q4AA 1KZHA 2P9TA 4FCCA 5MF6A 1TK2A 3JD0A 5C0OE 3AVWA 4PVCA 1MDFA 2IHKA 2RK4A 2YCLA 2H7XA 3MWFA 4BKXA 1DC6A 3FKQA 4FUQA 1BA5A 4UHJA 2RB4A 3ONFA 2IHNA 4ARVA 1TWAJ 3CR8A 4MWCA 3HKZN 4GM0A 5TSDA 4RD6A 3OX4A 1X0XA 2VPPA 2VBGA 3M9QA 1LVHA 1U1GA 3H8SA 4NQWA 2PMCA 4O5OA 2O3FA 2DODA 2VXZA 5HK8A 3AH8A 4LK1F 4R2WA 2KXPB 3DS8A 2FPSA 1NOHA 1EAMA 3E8SA 4IHXA 4MRMA 4PX9A 1DADA 1ZCZA 5F77A 1C30B 1J0DA 3G1UA 3BS4A 5KJ7D 4HAOA 2XZOA 5F7XA 1SKYE 2VDUE 4W9NA 1UZCA 3QUQA 3WJ2A 2EZKA 4NBUA 4L08A 2QLJA 4KHZA 4DLXA 4EZIA 4FCTA 3BWBA 3U4AA 4DOMA 3QQAA 3WLPA 3PHLA 4EKGA 1XHLA 4GMFA 3DAGA 3PUFA 5CIYA 3D8TA 3TKAA 2C6YA 3UG7A 3T61A 2G4CA 3SEAA 3K2AA 3MKWB 5I7VA 2DDAA 4CXFA 5FB2A 2XUGA 2DYKA 3V8EA 1F0YA 2HBYA 2OZ6A 2OLJA 2H7VA 4MMYB 3D3QA 3F89A 4CWAA 4C0XA 1UZLA 3NFYA 3OF3A 4IHQA 2WP8J 2JH8A 4WXMA 5LFAA 5FRMA 2VZLA 4UUBA 3AWDA 3T7KA 1BC7C 3GVHA 2Q1KA 1P7PA 3B3GA 4UUMA 4JOCA 3AEZA 4L9AA 4UM9D 4ZI2A 1VCMA 2IXFA 5DHSA 4IMRA 4CV3A 2XMGA 4GPTA 1NJFA 4EYYQ 2CU7A 4KYWA 1WNFA 2IUSA 3QYAA 3BR3A 5HGJA 2HLDA 1CUZA 3ZDCA 2NO6A 4NBRA 4B32A 1YB1A 1DV2A 3ASOH 4D97A 1JWLA 4MEAA 3HFGA 3A0HE 2V7QH 4C3ZA 1MX3A 3PUZA 3HR4A 4KFRA 1JEKA 1QHHB 4FYXA 2WHXA 1ZM4A 5GWXA 5ICFA 5G0WA 3RS9A 3A6KA 5LNK1 4M0KA 5ALOA 1QPMA 5AVWB 3EY9A 1JT9A 4OJNA 1BKYA 2BN4A 2ZT9D 3NM6B 1V71A 1PL7A 4L8GA 5K0ZA 4Q1FA 2O1SA 2M5AB 3PJDA 3Q7TA 2HCFA 2I66A 1MB0A 2NP7A 4PLTA 4BMPB 1EESA 2QEXI 1XMIA 2WAYA 3HZZA 3NVKI 2NZJA 4Z4GA 4Q4JB 2AQIA 5HDQA 4JI8B 2R7QA 2FXIA 4OXIA 2BUBA 3HUDA 5AJHA 3W5CA 4KRXA 3X44A 1JF8A 5D3MA 5JNUA 3SHVA 2PUBA 4RGQA 2K1AA 3I23A 2NVUA 2UWMA 3UCEA 2MYUA 1BEUB 1SMTA 4M3FA 2EA2A 3OY7A 4INAA 1JIIA 3IQHX 5FWXA 5HNFA 1AQTA 2JLZA 4R1MA 1SH7A 1XBTA 4B48A 1VLVA 2H7CA 5ECWA 4IF4A 3KU1A 2FYUD 3EXEA 1IZ0A 3C0KA 3QTLA 1XCGB 4DA9A 2HO4A 5FAKA 3N4MA 3SF8B 3AL3A 3OIUA 2XSJC 1ZNWA 2CDBA 3V1UA 3CW9A 2B36A 3S2IA 2XMRA 3E48A 1ZLYA 2OKGA 4ENWA 2X9QA 4GXRA 7MHTA 1VJGA 4YDHB 1WMDA 4LXTA 4YRVA 4BXLA 2COBA 2XNDA 2JJMA 4D8TA 3I5MA 5JH7A 2AOWA 3ZQKA 2OU2A 2DFPA 2Z33A 2HMTA 3MKZA 2VDLB 3DPIA 3KWMA 4PG6A 5C7OO 3BBPA 1GKUB 5JATA 4CETA 5LMZA 5SY9A 3IUQA 3BR0A 4RIFA 1YOBA 2GXQA 3MMSA 2ZSDA 4NH4A 1HE2A 1IRFA 3K4MA 1N6LA 1C7EA 1VI2A 3KE2A 1P45A 3PHJA 1CY0A 3O0TA 8MHTA 1E7WA 1VJRA 4A0RA 3CR7A 1OBCA 3I8OA 2PIAA 3WOHA 2R1TA 1LRLA 3V4VB 3A0HC 1UKBA 1T2EA 4AJJA 2Z3YA 1KYWA 1OQAA 3GHHA 4KIWA 2ZBUA 2ID6A 5JROA 4LF6B 3IV6A 4GECA 4H44D 3V8KA 3SSOA 2VBWA 3RD5A 2P1RA 4XJTA 5F98A 3H1JE 1FOKA 3PPXA 3TQTA 3WA6A 1CJVC 1D4OA 3M1IA 1NYHA 5E0KB 1K92A 2AZDA 4BNCA 3VB2A 2O2JA 1MX9A 1ZOOA 4CYCA 3JD2A 3ZI4A 5CITA 2E2IJ 4DC0A 1DI0A 5B7PA 1E20A 5KJ6A 3K70D 1LK5A 2RG1A 1Q6ZA 3A27A 4JUFA 3OPYB 2W22A 5C1PA 4DUYB 4L0ZB 1K79A 2FYUJ 3CMEP 2BASA 1W94A 5FL7A 3PA6A 3ROTA 3GLIA 3PE6A 2FQYA 3WRVA 2DH6A 4BWFB 3A4LA 3GZTB 4U00A 2GUVA 2GFHA 2X2EA 2VKEA 1DQNA 3TE7A 2FQWA 1OV4A 3SD7A 2WU4A 1ZONA 3BXOA 4N9QA 4N54A 1TCVA 3V2UA 2IHYA 4TQUS 1TEZA 2PL9A 1YRYE 3AGPA 5TMPA 3BVHA 2C9MA 3BFPA 4BUJA 4ZQHA 2TMDA 4EI8A 2MIIA 4KPGA 2HBRA 2J09A 3CW2A 2QQFA 2ZP1A 2OAEA 2X13A 2IP4A 3AG5A 2PD6A 1P6RA 4D4JA 4YI3A 2QLNA 1IBRA 3UNXA 3O8ZA 1S9DA 4RFSA 1CY6A 1N0HA 1T9DA 3VU0A 2VTKA 4DA6A 2Y1XA 5DO9A 3VUEA 3U3ZA 4RD4A 7AT1A 3LVQE 2GHRA 4E5VA 2H1CA 2I8AA 4EB0A 1ESZA 2W7NA 2ZSBA 4NU6A 3RQ4A 1YC2A 3TL6A 2QKLB 3B7PA 4CYMA 4PCVA 2VH5R 3GVIA 2VPRA 1R8SA 4P3YA 1E1QD 4P31A 2YJ3A 1E69A 4GFDA 3DEYX 4F92B 1XWWA 2A57A 3FF4A 3TNUB 5DI9A 1AA6A 3D4PA 3D0SA 2PX8A 2JK1A 5DNEA 4GSKA 4BE0A 1N2GA 3CEPB 2QUBA 3MN2A 3R3SA 1AB6A 1OMOA 4BIIA 1ETKA 3CT4A 3QQPA 4R9NA 5B3LA 2HXIA 4LY3A 1G4HA 4OOFA 2BW3A 4CGZA 5JLJA 1II0A 3IDOA 3X1ZA 1BCCE 3WG7H 4F9TA 3QXCA 4R6WA 2Q5QA 5KOJA 4ZMDA 4DN6A 1AKTA 2COEA 4Q9DA 1T2NA 1IY9A 5JCJD 3WIUA 4KI7A 4R0VA 4D57A 3ELUA 3KV1A 3BMCA 3ONDA 1RWQA 1HOMA 5AW8B 1QAMA 4MJXA 3DU6A 2A84A 3ZCPA 3MW8A 3O26A 4LSZA 4HDAA 4E6KG 4NICA 3IIKA 4FT8A 5J59A 3SS7X 5JMPA 2JC3A 2ZI3A 5IJZA 2Y67A 2W71A 3R4KA 2PUVA 3IEKA 1Y39A 4ER0A 3RI3A 3W5JA 4O1HA 4RFLA 3U3OA 3F2IA 2ZS8A 4L74A 4IFFA 2ZWIA 4TT3A 2EIHA 1JZQA 5LQNA 1MDMA 1XRQA 5KLVE 3EZYA 3QSGA 4GL4A 1TOAA 1XAIA 4PCUA 1COWD 3BL8A 4WN9A 2IBZG 3ISTA 1LSJA 4K6CA 4CU5A 2YWBA 1FW8A 2E6KA 1B41A 5FFFA 2BY3A 2ZNZA 2BD0A 3G8YA 1Z5GA 4QL3A 3JVUA 1QXSA 5J5AA 2N1TB 5FL3A 4I9NA 2CHVA 2QK4A 2XB6A 4B43A 1NUUA 3EEQA 3ETEA 3FG9A 1IXKA 4H1UA 5DT2A 2LP0A 5DE3A 5JHFA 2ODBA 3L8GA 1JBEA 2XQVA 4JNCA 3Q8XB 1GTL1 5B1IA 5IFKA 3C9IA 5J2UA 2Q5UA 1VFPA 2M0MA 2YIUC 1E1DA 4JFAA 3A2AA 2XOEA 4ZVLA 3Q1KA 4LXXA 1LFBA 5GJVC 2Y92A 3BWCA 1Q0RA 4AK9A 3CVYA 4HNUA 1OB2A 4RLQA 2Y8EA 3D5RC 1KQNA 1U31A 5JZ9A 3I6ZA 1BD4A 4LXIA 2EZ9A 3PFKA 1N8NA 1E99A 4QLCU 3VSBA 2FR1A 3HFRA 4PHTA 3WKBA 1QAOA 4LE2A 4GF5A 4UMEA 3QW4B 3OM0A 3WGLA 2F1HA 3EF3A 2YC2C 1T8UA 4QFBA 2PIDA 4KWTA 2H43A 1ESDA 3CZRA 1SC4A 5JR3A 3NKVA 3N0VA 4M6XA 4YRRA 2ID3A 4ZT7A 1ECBA 2AR0A 5CDUA 4LZNA 4IMJB 4H59A 3DC2A 1PP8F 4B3AA 3DKXA 1QIIA 1XQWA 1KH1A 3L7BA 3K0KA 4EUKA 2KZIA 3VOSA 5CCHC 4AIJA 2X0FA 3A4IA 1YQWA 1YTLA 3VOPA 1VTKA 4BGEA 4A12A 2FDCA 5ICEA 1E6CA 1XKQA 3ZWWA 3VPHA 1U9IA 3IP3A 3MHTA 1G63A 3AVUA 4NP6A 1BW5A 1ZHFA 3G5UA 4DLAA 1Y6GA 2O7RA 3BFXA 1IC6A 3FXEA 3L75G 1C80A 5BSFA 3N2EA 5B3JA 2BKEA 3SZLA 3AM4A 2C31A 3CKKA 4FTWA 1DKLA 4ZO4A 1Z2AA 2BMWA 3HVKA 4KMSA 3HSFA 4UAJA 2DA2A 1B3RA 1RHKA 4JLPA 3UFXB 3IE1A 4IIJF 5IXJA 1I2AA 1JS1X 4GM1A 4UREA 5KU7A 5K3FB 1ST2A 3GDOA 2BF7A 4WLEA 2LR8A 3LDAA 4LV5B 3MZ0A 2YXPX 2OV8A 1OFVA 1F0NA 5L3SB 3GBSA 3FDXA 2XPVA 5THXA 4DLLA 2VDKB 3CRNA 4BMOB 1DMSA 1RLMA 1ICEA 1Z6YA 2X1CA 3PR2B 5CGZA 5M5WJ 5LSAA 4JBAA 2AFIA 1LTGC 1Z08A 2EW2A 2C57A 1NF3A 4GPIB 3PQEA 2G7HA 1W0JA 5AI8A 3Q0TA 3GUZA 3VR3D 1BWSA 5TVGA 4E5NA 4Q7MB 3RDPA 2W8ZA 2GAFA 3WQHA 1WZEA 3DP9A 3IS3A 4QDTA 1Z8HA 3JC22 4B4CA 1HWYA 2I10A 1MUUA 3FZVA 5KNCH 2VK1A 3BHMA 2PS9A 1Y6ZA 1D8JA 1A7AA 4DMUB 1WXXA 4HDCA 2O5RA 1IK4A 2PT6A 2Z9OA 3VH3A 3TDUC 1C14A 4WB4A 4ZOEA 1DEOA 1WT6A 2MSLA 1OLUB 3IUEA 1CDOA 3C1TA 3GTOJ 1EF4A 2HIAA 5JMOA 4QGHA 2X15A 4RH0A 1X77A 5K6TA 5BRAA 4PQEA 1NXOA 2C2WA 3OIQA 2W4QA 4LJ6A 1CUUA 4UUTA 4OVKA 1U8AA 3FLEA 2HK9A 3EGDB 2X5XA 4HNAA 2PT5A 4O8ZA 1E1RD 4FP9A 2ZIZA 4FMDB 3K4NA 1EQ7A 3BQZA 3N2ZB 4D6TE 3ZCSA 4UBOA 2JGIA 1JAHA 1T9ZA 4JV5B 3VYRB 1VSBA 1LUAA 2WMYA 3A26A 1T26A 3JRXA 1HDOA 1YZQA 3H25A 3R5KA 4U0WA 3L0DA 5HM8A 1H0RA 4I4TA 4RHUA 1O6CA 2UZIR 2QN6A 3G0BA 3HJNA 3DTNA 4ZREA 4RSRA 4KFTA 3EH2A 4N9IA 1NY6A 1F6BA 4NG5A 1KQLA 3JPYA 1WW3A 1ISRA 4LV6A 4JLAA 2ONJA 4EGFA 4BBPA 2Q99A 3PDIA 1NE2A 1GL2D 4IEEA 2FSFA 3H99A 4FZRA 1V9SA 6GPBA 4N39A 1LPPA 2IV7A 4IDFA 4U3JB 4XJXA 2GN1A 3E7XA 3FX0A 3UWMA 3ZNNA 3JSVC 4JYBA 2X5JO 2GDZA 5IP9J 4A3LJ 1A27A 3GJTA 4ZH4F 1HM5A 3UTDA 3G7UA 4Q24A 4XB6B 2O59A 4Y7DA 5DH9A 3EXIA 1PJLA 3D8UA 4QFDA 2UDPA 1PYGA 1RZ3A 1K8ZB 1FBNA 4X8MA 3PUKA 4Q4LA 4W7HA 1L5GB 3RFCA 5EWJA 3MQFA 2XTMA 3SKXA 4CQMD 3R60A 3OBBA 3HHHA 3ZV7A 3SXYA 2CL0X 3MEXA 4ZOCA 1R0WA 4MSUA 3IV9A 4R1SA 2IUYA 3CF5F 3F3XA 2CCGA 4RE6A 2P11A 1T6SA 2XOKA 1MVOA 3PD7A 3B12A 4HUJA 2ZXXA 2HHAA 4LB6B 1SFCA 5TQ0B 4PM4A 4XKWA 4RXTA 3RRMA 2ZR0A 3PG5A 1K7SN 5FB3A 5TVKA 4JJ6A 1DEAA 4KE6A 5BWCA 1EH5A 2NYAA 4M9CA 5KOHB 1PHRA 1BJZA 3TMOA 1XQYA 4ZTFA 4MQEB 4HLNA 1T9AA 4JHXA 1DAEA 3OPXA 2WD9A 1OCPA 5YASA 2VSNA 3JAWA 1RSZA 4G6DA 4N6NA 3HA2A 3PFYA 1WZNA 5CT6A 2PV7A 2B0CA 3DDUA 3F98A 4MR8B 4N12A 1WLYA 4U2FA 1D7OA 5ALWA 5COAA 2X0KA 1UZMA 2R47A 1TUEA 3ZNOA 5AW7B 3E1SA 4PYOA 3EQLF 2O8KA 4GPD1 5LA6F 4BQRA 2CYYA 2YXBA 4DV2B 5F78A 4JT9A 1OYOA 4EABA 4MVJP 5HA5A 1GARA 2QTZA 4MI1A 4AYBA 2WSMA 3B6AA 4EGQA 1E98A 1T15A 4D3SA 3E5MA 1RCUA 1WDLA 4C2MJ 3ZY4A 4OO3A 2RBEA 2FXAA 2DU9A 2I6SA 1RHUA 1SBTA 5FADA 5EGOB 1XPXA 4NMHA 4BY1J 1TNTA 3QKTA 4Z3DA 3TTWA 4DR4B 5DP2A 2X5KO 2JEOA 1GAEO 3RAJA 4MZDA 4PNPA 4L7QA 1DIHA 3FWLA 2Z5GA 3QFRA 1ZRMA 1J5PA 1O7FA 3SSMA 3T4UA 2K9JB 3CJRA 5B1AH 5I8WA 3IUOA 4B46A 3MJRA 3T34A 2FUEA 1B0ZA 1SXIA 5AVZB 4D2IA 2B8TA 2GXAA 1JUPA 1X3LA 3W78A 2VDOB 2NPSD 4AMVA 1O97C 1G7RA 4AL4A 2JIZA 2AZXA 5C7IO 3PXAA 3I62A 3H19A 1MJNA 4QJ3A 3KSBC 4YV1A 4LNHA 5ITZB 2JVIA 4H16A 1CR0A 2VPWA 3GRZA 3CNHA 5GONA 2WYVA 4U02A 1MQ8B 4MGKR 3R8XA 5CBPB 1B1CA 4IZ6A 4AJLA 4OK3A 1FQJA 4B3XA 4PVDA 3HE5A 4FWBA 5KNDH 5BPFA 4TTTS 3U19A 3LGSA 3OZVA 1G21E 2A35A 3M3DA 3FLAA 4CCNA 5L51A 2VUIB 4TUYA 4XYMA 1CI6A 5MDHA 1U65A 2PZ8A 4AT1A 1SUIA 2MSNA 3U40A 3DOUA 4V24A 1ACMA 1NVOA 5A0VA 3E61A 2PJDA 1RPTA 3WYBA 5AKJA 4Z9AA 4DHEA 2HA5A 4MTCA 1QYIA 2JPDA 1XA4A 1WO8A 5AM0A 3NIDB 4BB5A 2V5UA 4G1MB 3CCSI 3FOBA 4MLCA 3M83A 1SEPA 1VBFA 5D5QA 4FEEA 2OYHC 4IO9F 3COWA 2VJIA 1MFZA 1ADJA 2IYPA 5LXTB 3GZ5A 4RXMA 4QBKA 8OHMA 3Q11A 2FN9A 3R74A 4JHLA 3A8TA 1TMGE 3T12A 1GSOA 1EBFA 1LE8A 1ORKA 2EERA 3ILSA 4ZZLA 1V54H 4M3NA 1BN5A 5ENZA 3S2DJ 2VT6A 3DXXA 1SOUA 2Q5FA 1BE8A 3RSFA 3TINA 4Q4CA 3RWBA 1DEKA 4ZVPA 1KU7A 1YA8A 1ENPA 2O2XA 2B8WA 4ZQBA 3QLVC 4URVR 1G0NA 4PO3X 4P7BA 1Q22A 2PJRB 2XIGA 1E9BA 1VG9B 2GZRA 5ILGA 1GA6A 4J76A 2PX2A 2Y68A 2G0EA 3UZUA 4PJMA 1UT6A 4XRRA 1K3UB 2J5QA 4AC9A 1KI2A 4O63O 2X1DA 2VHEA 4FOLA 4UY8I 3AL0C 2R0QC 3Q85A 1I0IA 4WZAA 4DEVA 2XJ9A 3CZ9A 3DQPA 3KL4A 5HZGA 4IEIA 3NW9A 4KV9A 1B74A 3ANLA 2ORWA 2HJRA 1PJ4A 1YCHA 5DGTA 4B6GA 2OBMA 3ENWA 1RYEA 5DS9A 4NU5A 2XT9A 1J1DB 1VHDA 3WJ1A 4LBZA 3AC0A 4JLOA 1IK6A 1LDMA 1GSAA 1STOA 1GZDA 1XRNA 1KI9A 2ZT8A 2D3TA 1W19A 4N0PA 1HJ0A 3FGPA 3GMSA 4Q15A 5FLXA 5FULA 1K7CA 3SHOA 1CZLA 1E5DA 2RDMA 4LDAA 1N2ZA 3L09A 4DCNA 5CT9A 1E0JA 3P0IA 2O8CA 3E3OA 2NPFA 4B2IA 3HEBA 3QHPA 3R7AA 5EJ6A 5GADJ 3ADCA 1QIHA 2OO7A 2BZ1A 3O8QA 4F9GA 4YXWA 1FU4A 3WK5A 1BL0A 2QTHA 3E9CA 4ZCQA 4HB0A 2FZCA 1WP9A 1YJBA 2FZVA 1HTTA 2CL5A 3U17A 2ZJOA 2POHA 2MG4A 5L7TA 3PCTA 3ZMZA 4UVDA 4LJ7A 4BMXA 3C4JA 1SKAA 1ORRA 3ZH2A 4XDYA 1AUPA 4KH1A 4DSZA 1LJUA 2QT1A 4ASWA 3ZQFA 1EK6A 4P38A 3W8NA 1QF9A 4WY8A 2WSFJ 3NAUA 1LEHA 4WVLA 1GHCA 4R6XA 2XGEA 4LZOA 4TS1A 2F3TA 2MC3A 4H7KA 3TQRA 2G4LA 2IS4A 2N9UA 4B1FA 1R5HA 3OYKA 2BGGA 1S89A 3TRHA 3OJCA 4C29A 4RIIA 2PKCA 1QCDA 4X65B 4UDXX 4Y98A 4WWCA 4MB6A 3OZ7A 1E4EA 1KI6B 1HOXA 3ETJA 2OHJA 2ELJA 4JI0B 4YCDA 1K2VN 1SO8A 2EZ4A 2JAQA 1UWKA 1I3LA 4AZ3A 3AUJB 4BX2A 3NHBA 1JIVA 2IW3A 1PUFB 1GKYA 1LKXA 2CWEA 1IJFA 3LO8A 3H2ZA 5AW1A 3DOOA 1NUSA 2O7QA 4UEOA 1CUEA 4RY8A 2ZRNA 3AVOA 1T35A 3DKIA 3Q3VA 1MC4A 5CA1F 3LCVB 3QOFA 1CULC 2CE2X 3ABKH 1TQMA 4I46A 5GTIH 1WQ1R 5KAFH 1Z0AA 4P0PB 1ZM2A 4IKEA 4HATA 1XLUA 3WYCA 4JUDX 4OXQA 2RG7A 4ZCIA 3L9XA 4B82A 3M6VA 1FJHA 3F8FA 1JB9A 4DW6A 4FMPA 1W46A 2JLCA 3A1SA 1YR7A 4P08A 4WJLA 3GRVA 3NRCA 3N74A 2ZPTX 1IHYA 3CC2I 1YBMA 1LGYA 1BR1A 4G81A 1IFMA 3RSGA 2PZAA 1YJXA 4L8WB 1J33A 1V96A 2ZAMA 3IOMA 3LNCA 1EBBA 3GR6A 1BMFA 3AVVA 1ACIA 1JDVA 4IVNA 1N9GA 4GPAA 4PG7A 1NVGA 2FK8A 2KRFA 1EE9A 3VPFA 5ECYA 3H2SA 1KL7A 4CL2A 3RBZA 2PX5A 2IWHA 2HIMA 5EFWB 1YC5A 3GGDA 2YIVX 4XXHA 3LYUA 5KSOA 1RQNA 2GXSA 2MW8A 1OFUA 4F91B 2WF5A 3V8VA 2WWRA 4FFLA 1NTCA 2B2CA 3L07A 1Z0UA 4NENA 2CEKA 3LQQA 2A9OA 5AVXB 2V6JA 4UOQA 3IWFA 3CWZA 3V8JA 3H3FA 2R68A 1PSZA 1ZWKA 1L5LA 5K3EA 3H1KJ 4MPTA 4P92A 4WY4C 4ZEOA 3RHFA 2PL5A 3ONVA 3KLBA 4FGUA 3TM4A 4MYDA 4WNAB 4V0SA 3RK3B 2FW9A 4MNUA 1FSHA 2PUTA 5I9SA 2O8EA 4NZOA 4W9MC 4OYHA 2HPCA 2E36A 1GTVA 1WHUA 4D9JA 1YA4A 4MV7A 3FPGA 3PCXA 4AJEA 1KI1A 4LMPA 4F2GA 2D1RA 2VP6A 2V97A 1YJWP 4UUAA 5BMVF 3WK8A 3WE3A 3KPVA 1SC3A 2NTJA 3E0XA 3H2HA 3GMEA 1R1DA 3BZUA 1EGQA 3QVKA 3RRJA 5SYAA 4X00A 1U02A 4XIGS 1ESEA 3T3MB 4ZI7B 5K5EA 3OWHA 5CYVA 5C44J 4G23A 5HKKD 1DHTA 2J5UA 5FLXK 3KZNA 5IFLA 2QXTA 4YP9A 3OEEA 2ICAA 1CZOA 3RAPR 2GN8A 4BN0A 5EJ8A 2EW8A 2XNCA 4F5EA 4UBLA 3CCBA 2JZYA 2GEFA 3ZHQA 1XGOA 4BYYA 3RH0A 3TR0A 1P3DA 4D4MA 4LTDA 1XZQA 2JCSA 1MNEA 3A25A 1RMYA 4K9LA 3CONA 4G9YA 1SXJE 1NHLA 3S29A 1TECE 1P39A 2RFLA 2DLLA 1FZPB 1QIJA 3GGPA 4BJTA 1KP2A 4LDPA 2IA5A 4PPNA 2HGCA 3LXMA 1UZNA 2I2XB 4KMRA 4RTOA 3JQGA 4ZDIA 4DLSA 2WDZA 3ZWXA 2X14A 1SCNE 3D5LA 3LGXA 5JVDA 4L9VA 3DWFA 2A7QA 3FSGD 4MV1A 1ABBA 2XYVA 2H4HA 5E95A 1L4AB 7GPBA 3CB2A 2V5VA 4EA8A 4P1ZA 2ELHA 1DD3A 1AKYA 2RE8A 4XOPA 3H5AA 5A1TA 5AW0A 2O1JA 3EMKA 5F08A 5JE8A 2F9FA 1UMCA 4TLCA 1G3QA 4IHVA 5K3SA 5J63A 2H2FA 1XDDA 4EDHA 5JXJA 3E3MA 2P5TB 3M9LA 5B1EA 2VKTA 3IHTA 4OQNA 3JWEA 3QXSA 3H87A 5DM6F 3HLTA 4TYMA 5KAPA 1K83J 3KXIA 5BSTA 1FOSF 2ZVJA 1QIGA 4W6ZA 4FK8A 4CM9A 5HRUA 2XUFA 1WUIS 1FP6A 1DEBA 3V4FA 2RH4A 5IAAA 1ID8A 2JFQA 5DLPA 2YMPA 4WXHA 2E75D 3B1KA 3C6ZA 4ZMBA 4L2IA 2A8YA 3R3YA 4FYYA 3STTA 5KYNA 3B9BA 3JQ9C 2DPUA 3PD1A 4P84A 1NMXA 3PEVA 3PGXA 5IJAA 3VMYA 2XNJA 3N4XA 2VXDA 5CVCA 4E51A 1LJ8A 3JRGA 4LJRA 4BY7J 4TKVB 4DQ2A 1QGYA 3GK3A 4IO1A 4DMCA 3TDZC 2WSSA 4B3MB 1NTZJ 1E9SA 2OAP1 3QMVA 1GNQA 4G0XA 3X0DA 2MH2A 5HNKA 1U5CA 2IRWA 3BE8A 3AEXA 2ZETA 2P2ZA 2HRDA 3DLPX 3ZJTA 4JQSA 3S17J 1EFVA 5CJ2A 3OV8A 5DSXA 2OZLB 3FOAA 1U4OA 3L8FA 5F64A 4PGGA 4GE0A 5A4IS 3BXZA 1E1KA 4MV4A 4W63A 1N2XA 3RZDJ 2AQEA 2MINA 3MSCA 1MBZA 4J0EA 3F9KA 4FT2A 3D8HA 5CEEA 1SXJC 1JHHA 2FWBA 3OKAA 3GIWA 2PSSA 1O0BA 3UWSA 4Y2HA 4CV0A 1R6TA 4LJAA 3PL1A 2VQFB 4WBNA 2JDIH 1IG7A 2VP0A 4LEIA 1NHGA 4ZEWA 1OLTA 3KV3O 3OKPA 2DW4A 4QE3A 3RSLA 1TTTA 2CQ7A 4CXMA 1YDGA 4RGVA 3PRKE 4D8VA 3CCCA 4K9SA 4MVJG 4RVHA 2Z2XA 1KYZA 3UGQA 4NMMA 2OGUA 4I8XA 3GT0A 1AUQA 1ZJ6A 1M2GA 3CF4A 1OZFA 3FOFC 4OH7A 2IZ1A 4X7PA 4NRDA 3RL0g 1HE8B 1D5CA 4L73A 3EE6A 5D2CA 1XOIA 2WJ3A 1A4UA 4NYMQ 2H59A 3K8ZA 3K2ZA 3OAAA 1J5YA 4EM6A 3D1JA 4M8NE 3WNCA 2FEZA 1M1YE 3RG2A 2A67A 4TKZA 1HWTC 3V2PA 4FOOA 1XO1A 4NB5A 4EJFA 2VJKA 2NGRA 4QT4A 5JWOA 1EUZA 4QJ4A 3K9BA 4A3CJ 3GTQJ 4YJKA 3ZQIA 1YJ8A 4X63A 2HPMA 1KY4A 3PGJA 2CVQA 1G20B 2J0SA 4C4OA 1G8KA 2C2HA 5A9SA 2DSNA 3H1AA 4MKHA 2B88A 4EG1A 4KNYA 4ZVTA 3SC6A 1DAKA 1RP1A 4G0UA 2Y1KA 3TFOA 2WP0A 1VE7A 3ZIAA 4K86A 1SQPJ 3DV0A 4TKUA 1DP3A 3FR7A 2SHKA 4ZVOA 4KN7X 2OM6A 3GGCA 1RKXA 1AS2A 2RHJA 2CXTA 1MB2A 3B9QA 2OQGA 5EE1A 4URYR 3C14C 2K88A 1M1KQ 4F04A 3IUBA 2WQZA 1N4AA 1ZKGA 2G1KA 3BFVA 3AG2H 1NWCA 1Q92A 2G9RA 2WW8A 2CS3A 7MDHA 2F3SA 2DULA 4BNTA 5F7OA 2ZIXB 4WK2B 2WJVA 3RYFB 3TJMA 1R12A 1ZRSA 4KEAA 2GPAA 4HMPA 1QHIA 1RWVA 1H8ED 4N3GA 2R48A 4EL5A 4XQ0A 2JEEA 4EHDA 1QC5B 2A0YA 3F9IA 3J7TA 2QL7A 4MUBA 1JA0A 3CMAP 3ZC3A 3WIVA 2BFDA 2OQRA 1L5HB 1RI5A 1WS6A 3FTDA 3QVSA 2QP9X 4RXUA 4BGIA 5IZ4A 3U1AA 3SP1A 1T8RA 2DBQA 2UZ3A 1QP0A 3OYIA 3TCXB 3DQZA 2XAGA 4HDQB 3WGTA 721PA 1CQJA 1JUDA 1JTFA 3OJEA 2BEZF 1YL6A 5GAJA 5ENDA 4LJ8A 1TQ8A 3FROA 2J7PD 4KX3A 3GUVA 3H1KE 3BE6A 1I2CA 2Q3LA 1F20A 1IZ7A 4GL2A 2X6RA 5L3GA 5AVTA 1NUTA 4KLZA 4A15A 2GAIA 4HGYA 4YBRA 2X77A 2C8JA 1NQXA 3RYRA 1QORA 3GFIA 2WLSA 4EKYA 3DF7A 4AAYA 2IKQA 1WWXA 2WIDA 5KYVA 1WH7A 4BNFA 4HEA2 4NPEA 1NVBA 3HD7D 2WB1N 4HXYA 1FXWF 1WPXA 3VR0A 2Y93A 3IMKA 1EHCA 2IZ6A 4EVQA 3UJ9A 3G2JA 4FDMA 3TPCA 2JLVA 3R09A 4P4SB 2HU5A 3CUQC 3W8FA 3HA3A 2IYEA 3F74A 3JSPA 1IUNA 2CN1A 5EP1A 2ESRA 2HK7A 4YCBA 1QVRA 5K8JB 5K99A 2JLUA 4PG8A 3FMIA 3VPAA 4BNZA 2I1JA 3V7YA 4QRHA 1YIJP 2JF0A 4FZVA 1U2ZA 1S5PA 1T6YA 2B92A 3TL4X 1VLQA 3V33A 3T99A 3PZRA 2KJBA 5LN1A 3L1VA 5E9QA 3C1OA 2KL4A 4W5OA 1NGSA 2MLKA 2O8XA 4D4GA 3QMWA 3KALA 1DC7A 1FMJA 3EDOA 5HFJA 3DMDA 3Q3EA 5IM4F 1E3JA 3ND8A 1FS6A 2QVAA 3LY5A 4LQLA 2CEAA 1M34B 2ZBRA 4Q3NA 3T15A 2KZGA 3P45A 2Z9CA 3ND5A 3CSDA 2Z2SB 3F9CA 5IOZA 4HDUA 1KVTA 2P5VA 1FS5A 2DBRA 1KY3A 3REQA 1F14A 2O0JA 1YE5A 3QE0A 3C2QA 3OT5A 3I5AA 1ZESA 4PC1A 3JTEA 1KIMA 4AO7A 2VDJA 2AQ8A 4RVFA 1F12A 1IN5A 3VC7A 4M1TA 3HG9A 3C3EA 3IUYA 1PG5A 2DMPA 3H4MA 3DLBA 1JHFA 4Y8VA 4YGXB 1UJNA 1SFKA 4EUSA 5TISE 3PDCA 3U44A 3W8RA 2WV9A 3BJOA 1ISFA 2PK3A 3NIWA 4E7HA 2BV3A 2C1XA 2IYAA 1U0JA 4FBMA 3CY6A 3SJUA 2AOUB 2MJLA 3RSQA 1U0TA 1G6Q1 1DZIA 4FDAA 1MSEC 3IBTA 5CCBA 3HDGA 3ODPA 3VQTA 5BP7A 2D8MA 5J9FA 4M9UA 1N3LA 3JZAA 3ZWOA 1WPKA 5JC1A 2DA1A 2Y75A 1YL7A 4V0MA 3AG6A 4NONA 1U7JA 3MSXA 1NTMK 4LX0A 3M1YA 2ZJYA 1VSTA 1NTZE 1NXVA 1I36A 1CF2O 4LSGA 3HU1A 4QJ5A 4CEJB 4ZDOA 4Q7LA 2FFDB 3AO0B 4N0DA 2ZB2A 1QZ3A 3ZZMA 3EYYA 2G5GX 1VSQA 2XB5A 3FMPB 2MSDB 1KA8A 4RPHA 3Q3SA 2K9NA 3LW5J 3VYTB 3T7IA 1W4RA 4WLVA 4JC4A 4CMHA 1TQHA 4NBQA 5DTMA 1OX3A 2CJWB 4EGYA 4BN4A 3VN0A 2C4WA 3SWWA 2QT9A 2H9YA 3HWX1 4IQ0A 3ZJUA 1JEYA 2C5EA 2IK8A 4CKYA 2PH7A 4RO0A 3WWDA 1ZIDA 5AO9A 3PNOA 1G4DA 4GW3A 3HVHA 4ZEXA 2RHDA 2QVYX 1P5ZB 2OVFA 4KACA 1UFVA 5HE9A 4YPOA 2ISCA 1V35A 1H9BA 3IVMA 2HDWA 2IYOA 2IY9A 3GQVA 3R7NA 4B8WA 5D3KA 1GFWA 3K72B 4CA0A 1SIOA 5FCDA 5KTMA 1U0HC 3B1XA 1LTSC 3SLRA 1O7JA 4X9XA 2CLEB 1TJ5A 1A97A 5HOEA 1U8CB 5JCPA 2PL1A 2P27A 4I14A 5CT4A 1P72A 1UINA 2GJAA 3ZE6A 1PBNA 4B75A 4G0PA 1P9QC 3BMQA 3UYKA 4RJIA 2N0SA 5EIHA 3P20A 3H1GA 1R0KA 3LAJA 2QL9A 2XGMA 2W48A 3KQQA 1RE0A 4XWOA 1UBRS 1B23P 1QL2A 4WXCA 4RS8A 3LPCA 3E9DA 4RBNA 2BHZA 2QLBA 4Z4IA 3HEAA 1LBSA 1MCZA 4CCKA 1DUXC 2C7QA 4HMQA 2ZXFA 4JUCA 3DE4X 1XTVA 3UG6A 2Q5LA 4QNNA 1UPXA 4OXXA 2YY5A 3LU1A 2FEKA 3QYEA 5JSKA 5TISC 1UT5A 3EEIA 4AMYA 1ZNZA 1POWA 2ZIUB 4DIDA 3JTMA 4UCQA 4XIFA 3GUHA 1TM1E 1ILWA 3HPRA 2JPBA 1A1SA 1E89A 1ETYA 1HBXG 1CQZA 2DFIA 4IF6A 2I3BA 1P1KA 4BFZA 3A7DA 1KSHA 5HF5A 1PJ8A 1Q0LA 1JG3A 3C2GA 4GU5A 1QR2A 4HAUA 4IRMA 3NBAA 2JFZA 3DYVA 2QBYB 1SQPE 1N3BA 2HQRA 1FX7A 2AXEA 2FR8A 3NRBA 2PYZA 2R97A 2XMZA 2ZVPX 3AEBC 4AZTA 2DUUA 2XSDC 2FP3A 3U56A 3LL7A 4D5EA 1XU9A 3QFFA 4HQOA 1QUEA 3Q6NA 1TZBA 5EDNA 1H3EA 1HV8A 4KLAA 4MJLA 4AJ2A 3GLHE 2AXPA 5FRDA 2BR3A 2ZBVA 4EJSC 5BN4B 3BTCA 4B3FX 1F2TA 2VSQA 3KX2A 3GD5A 2QQEA 2EBIA 4X44A 2W98A 3IOYA 4JKOA 1WOMA 2JIRA 4YGYA 1WDMA 3TTTA 3VJKA 2OILA 4EA7A 4EEKA 1GTG1 3KVRA 4RQUA 2IZZA 3G88A 1RRMA 2CBGA 3LHKA 3HV0A 5CH3A 5L45A 1TRHA 5LU9A 1DG9A 2HTFA 3THYA 5EYPB 2C59A 3OD1A 2AI3A 1W0JD 5C52B 1VQ9P 1DX6A 5KBYA 4B83A 5GZ3A 2IH5A 3BOQA 2ATVA 3TSZA 1FFXA 5A5VA 4QIHA 4G89A 2IOFA 3DVSX 2C4UA 5JEEA 2QUKA 3G49A 4FONA 2HYJA 1NU1G 2UVPB 4TSFA 5DYYA 2D4HA 5C8VA 2F1OA 1QJCA 4MHOA 1PR1A 2PEXA 5AOVA 3NH6A 4FZ5A 3OG9A 5KJCA 4TVKA 3UXHA 1KZ4A 2HEGA 1SAXA 3EOAI 5IH3A 4YRPA 2GI4A 3I64A 3QBEA 2QVZX 2W5UA 1IOZA 3TIGA 3L2UA 2NG1A 3N2IA 1BDCA 4NLLA 1IQPA 1R0LA 3HL2A 1SCKA 4UPEA 2FETA 3UC9A 2EIMH 1XEXB 3CNQS 5GM1A 4POAA 5E9AA 5EC8A 4D80A 3T8RA 4AB1A 1K5GA 4BNIA 1AMUA 2CQXA 2QNBA 4YQEA 3G23A 4YUZA 4KPUB 5PGMA 4C6HA 1E0SA 2QGNA 4UW9A 1DNPA 2JJ2D 1D0VA 2GGSA 2DYRH 4EOTA 3HKZA 1X19A 2YQZA 1Q2XA 4HDSA 4ZZ3A 4WLFA 1E3MA 1H0TA 4H1TA 2G82A 2OQIA 3I5XA 3NT2A 4C2TA 2R8XA 5JT1A 4PG4A 2IEIA 4F71A 4EARA 1EKEA 1CQPA 5I48A 3PXGA 3D5QA 4K9OA 3T5DA 3P7KA 4OF4A 3ZLTA 2XTJA 1NW7A 4BVHA 4WF2A 2DT5A 4CQLB 3EFHA 2E42A 1XZEA 5HCUA 2JG3A 4U7BA 4HY3A 5E3NA 1CIJA 4DR6B 1WHTB 3LYHA 1G7TA 2J30A 1ODLA 4R71A 4ZO6A 1VRVA 4LHYA 2OYIC 4H3HB 2ZUBA 4G86A 3K53A 4EX6A 4FS3A 5D8DA 1SQQG 3D5EA 2CHQA 3V2RA 3IH4A 2ZRBA 1YRQA 5B6PA 5DYWA 2FUNB 4RTQA 3CUYA 2HHCA 1OLSA 3LT2A 1E5VA 5CFZA 4EG7A 4ZOLF 5KI6A 1E3WA 3KR9A 1JPNA 2KP8A 2R4TA 2DJNA 3NHMA 4HOYA 4NE9A 4IFBA 3D5TA 3SFEC 4LHEA 2OGWA 3HV2A 1YW7A 2VRCD 2X76A 4Q47A 3UJHA 2ZWOA 2DCUA 4I2OA 4C3UA 4HVAA 2A5LA 2DFNA 1JY3P 1SVSA 2WMMA 1BI3A 4X85A 2W27A 4XSXF 2OCPA 5GV7A 1KU2A 3ZD6A 4MMZB 1T0BA 4R5MA 3BDVA 2Z08A 3EA0A 2BKVA 4OKIA 1E0EA 1OU4A 1W29A 1I6KA 1GZ6A 3H11B 4PWZA 1NH4A 1BXKA 4O4JF 2RGUA 1W88A 3FTEA 4ZCLA 2RV8A 5E4JA 2OPBA 3N8GA 4KQKA 4BFCA 5EJ7A 4WESB 3DMTC 3W5UA 1N1DA 4OP1A 2E74C 4MRPA 3F73A 1YV9A 1Z0XA 1FMLA 1NU8A 2EZ8A 2QE6A 4F8EA 4LI3X 2PZEA 1UJ2A 2C0CA 3DBOB 1RACA 2CUJA 4AJPA 1KWKA 3U48A 3ORYA 1RQVA 2PZKA 4YMHA 5B2FA 1MW8X 5DLDA 4MNTA 3HLYA 4DOJA 7ABPA 4LITA 3DXJF 4BEBA 1Y8RB 2YRFA 2B7BA 2NOJB 4GI7A 3T4PA 2B30A 3DCNA 5K09A 3KKPA 4HH1A 4JNKA 1RI4A 5I7AA 4D79A 2XKJE 2EF0A 2FSUA 3PU6A 1WY5A 2XF7A 2JA8J 4A3BJ 1OTHA 4QQKA 1PZMA 4H6XA 5AHXA 3EZNA 1KQFA 1WUTA 1MJGM 4MUEA 3IE0A 4G4GA 3E22A 5HF9A 3UJNA 4YAJA 1ZBDA 2E1CA 4CLHA 3W3AD 1QB8A 3TTSA 4Q03A 2IBDA 3NYRA 2Q3DA 1OWLA 4RTKA 2RGBA 4ENTA 3L4JA 2Q6OA 2P10A 3C7KA 2EILH 1TUBA 1A9XB 2IOFK 3MAAC 5HLIA 3OIGA 3EODA 1PL6A 3T94A 2RGDA 1N78A 3II6A 5E3JA 4DB4A 4BJ5C 3OZAA 1QZYA 4RH1A 1Y8QB 1GSIA 1HGZA 3VDQA 3RC3A 3I56I 1G64A 1EJ6A 1GADO 2Y4OA 2MWMA 1Y8AA 1X7YB 2I3AA 5DT9A 3WAKA 1YR3A 3QPDA 3TO5A 4KQ6A 4DMRA 2OO5A 3OOUA 2G80A 2V4HA 1HTWA 2WPRA 1U4SA 4ESEA 3HKEA 3IEUA 3IPYA 2QJWA 1XNGA 2ZI4A 3BIOA 3HD7C 4A0FA 1ND6A 4GGMX 1E7YA 4WCVA 4AUMA 4RQTA 2QIWA 5GAHJ 3C7TA 3U4DA 1Z0IA 2OUKA 3HWWA 1PP4A 4C9YA 1X6VA 4BO8A 5BUZA 3N28A 4JC8A 1U5BA 3Q9UA 4YRAA 3JTGA 4H0LD 4DB2A 2EZLA 2HNHA 2FPIB 2OV6A 1N7HA 3A6JA 5IAKA 1WJ5A 4KWCA 1NMQA 1T2UA 5FXMA 3FZQA 3BEOA 3NNSA 3L7IA 1FBQA 2YFHA 3VDNB 1PJTA 4D26A 5EAIA 4HRIA 3VRHA 3QFCA 2DMNA 4MWOA 1X3ZB 1U2PA 5AXDA 1EKXA 2CGPA 4XCXA 5LDGA 4RWEA 3NTNA 1NT4A 1R9MA 5JRZA 2AN4A 3UR3C 3ESAA 2BGIA 1QFSA 2JGKA 1P18A 2E37A 3CDIA 4KDFA 1O3TA 4JYCA 4MYUA 4YAIA 2KI7B 1CT9A 4TPKA 1DXHA 2I1LA 1MIOB 1GT0C 2ST1A 1L1EA 2VBYA 1H0KA 5GV8A 4EQ6A 4HFMA 1Q86Q 3C5VA 4FDLA 4D25A 1YHYA 3JQ7B 4BCBA 5CTAA 1MC5A 4ILEA 1RW4A 2OZKA 3GLUA 2AEEA 2DHCA 4P3OA 2XF2A 3EVTA 1NATA 3O6QA 4BJ1A 4KJZA 5EMNA 1REQB 1JLMA 3UA3A 1LDKB 3KDPB 2JWAA 2VWQA 2C9YA 4NEGA 3WLMA 2X2OA 1ZN7A 9MHTA 1DP7P 2FZKA 3HHPA 1ZQ9A 4W5TA 4IX1A 1KB9D 2JEZA 1XJQA 2VJDA 3VTAA 4RKQA 1M9NA 3EXFB 4HYYA 5IY5H 4BFXA 3HUUA 1Z18A 5BSUA 3IMGA 3P8CD 1J25A 5T7BA 3WLIA 5KJ7C 1ZK8A 4R9VA 2GJ8A 4JMPA 3G2OA 3NDJA 1IRXA 2YV3A 1LNQA 4DGQA 3V1YA 3H1HD 4B86A 2FYUE 2WA1A 3QIVA 4B3SB 1Y6JA 2OAZA 3QPTA 2GM3A 4LYEA 1YRAA 5H1YA 1QK5A 2F2TA 2W84A 1MEJA 1GXSA 3BIJA 3DTEA 3QXJA 1ZUNB 2KS1A 2LKMA 2QPOA 4AZ0B 5ERXA 1CW5A 1EA7A 3FOWA 4DIQA 1NJ2A 3HWRA 4CKZA 1E2PA 1PEKE 3NGXA 1SFOJ 3CCLI 3ADOA 4NDZA 1DQRA 4CIWA 4IDPA 4OY3A 4XMYA 1FMWA 2RIPA 4JQFA 1E6KA 2XGJA 3C15C 5K4AA 4BVEA 5HG0A 1NP3A 3W5IA 4FYIA 4MS3A 1HEYA 2ID9A 1NJ1A 4XBFA 4YMGA 5FH9A 1GILA 1W35A 2QN2A 3FISA 3B3JA 4WGFA 1SZDA 3ERMA 1D9XA 2NO9A 4DXHA 3PM1A 2BKXA 1C9MA 4ENSA 1QB7A 3AF0A 4V0LA 1XPOA 1N1MA 5M3FJ 2O7VA 3P8MC 5MN6A 3H3VK 2CV2A 1IE3A 1EIWA 1ZLXA 3KP2A 4MUXA 1Z2EA 4MAMA 1SMYF 4ALNA 4MIYA 3WLNA 1QVUA 3KDSE 4PJ0H 1T6ZA 4LG0A 2ZT9C 3SNHA 3QWOC 2GK4A 3C7JA 1RKVA 3EPLA 1W1UA 2IPMA 4HF2A 1BJAA 1DP4A 3K4PA 5IK2A 2FLKA 3RBXA 1N1GA 3H2IA 5ES4B 2B99A 3CUOA 1WSAA 5JH7F 5HDBB 1LPQA 4YCAA 4EMBA 1QWSA 3H1HJ 3MILA 1AZSC 3DPSA 5IC6A 4S2EA 3DL7A 3H8WA 1RPWA 4B45A 4D9KA 1A5JA 4YREA 2R6JA 2R5YB 1JKOC 3FBIB 1FYMA 5K01A 1DIAA 3OFNA 1W48A 3D2LA 4IMIB 1S1MA 1PFWA 5TPZA 4R3NA 2KDOA 4ZJZA 4CM8A 3V1TC 3AEKA 5H70A 3T8YA 4O3MA 2ZE5A 3UH1A 5E8IA 4Q1EA 1DEXA 4QYIA 2HMYB 4IL6C 3CXHI 1LZKA 3KETA 1L5KA 3N97A 3O2SB 4GVXA 4U88A 2GN6A 1GM5A 4UHDA 5ILQA 2XAHA 1BW6A 3PT9A 3TAXA 1ZELA 1BMFD 4GT1A 2P7HA 3WMFA 4I66A 1XYGA 3O1HB 3CIOA 5EEGA 5K51A 2VHTA 4QPDA 2CUZA 2IS1A 2QXUA 1R3UA 3S6JA 1JJBA 2FHPA 1DRJA 1PT6A 2P8SA 1Q7YQ 1MZVA 4GX0A 2I2WA 4PZPA 3PPIA 4N0MA 1PUJA 2IZ0A 4XWTA 5EEHA 3KYLA 1QYVA 4EP1A 5F7ZA 1P1CA 3J7AC 3B6IA 2E34A 5IZCC 1KDRA 3C3MA 2IV2X 1L2TA 1O0CA 2O01J 4NUBA 1R74A 2X23A 4X1YB 3O4VA 3E1GA 3IRQA 1HG0A 2PS1A 2W2LD 3GU3A 4XRGA 2OPTA 2ECBA 1Z29A 2XXJA 2J08A 1KAOA 3IDAA 4X1KA 1KQGA 1XN7A 3S16J 3QKIA 4B09A 1OSNA 2XZDA 3LA8A 5HCNA 5BSRA 1T5BA 4CJXA 2O1KA 3Q3DA 2XCOA 4AUWA 1PL8A 5J8FA 5ALVA 3V8RA 3ZRGA 2R7KA 2W0MA 3TVYA 5D8KB 3CZ6A 2ATXA 5EIAA 4CKEA 4H44C 3H36A 1KYTA 1FEZA 3PHHA 1QF6A 2YX4A 4IGFA 2CJPA 3NO4A 3HRIA 4XLCA 1YFHA 2BDUA 1HSJA 1TEHA 1BS2A 1TMYA 2RC4A 4OX9B 3K70C 2L91A 2QROA 4MWTA 3FMVA 3H9BA 3CX4A 4JOQA 3IVXA 1HT1E 3HCFA 2H5JA 5EXTA 5DM2A 1ACLA 1NTKK 5FTWA 2FZGA 1A9YA 4PO9A 3OEED 5DUIA 3V2NA 1IQUA 4LOJA 2QTWB 2FXPA 5LHHA 4QPJC 3PUJA 2IEYA 5D00A 1UFRA 3J7ZI 3SK0A 1QVGO 1T4DA 1A36A 4NNPA 4UCFA 4N3CA 2WC2A 4E5DA 1E7RA 3TB4A 4HQ0A 2GSDA 1G16A 1FK8A 2J3JA 2QAGA 4MAAA 3AU9A 4WK4B 3ZDQA 1JDBB 1GAWA 1J7JA 2FJ1A 4N78D 2H07A 4QUEA 4DJJA 3CO6C 3L73D 4RKFA 3OOJA 2PG4A 4GOLD 3I4LA 1HT2E 3IAM6 3NTQA 4ZV7A 2FFRA 2QYSA 4ABYA 3DTYA 3LA3A 1XT6A 4PXAA 3D6FA 3OX1A 3E1KA 1Y1SA 1XVAA 1DJPA 3DH0A 3IE2A 4YACA 3ERED 4C4TA 1TM7E 1V3TA 5KLIB 2XDYA 4YONB 4V1CB 1JPJA 3JQDA 3TQNA 4M4SA 3EBOA 3RHSA 4U3FD 2E9SA 4HSRA 5EY5B 3TNJA 3RR2A 4E08A 2A94A 3CVXA 3OZUA 3RKYA 2EG9A 3TBKA 5LM3A 3CCRI 3T0YA 4CM9D 4YP5A 1JLLA 1DV1A 5CCGA 4QBFA 4MUJA 2WR8A 4PSKA 4KK4A 1NPYA 4MJ7A 3WKAA 3C8HA 2JO1A 4LHVA 4CT0A 4ME6A 4CV1A 5A2QZ 3RODA 1CWUA 1E3OC 2ENWA 2VHYA 3BICA 1Z16A 3TL3A 2K9YA 1N5MA 1AA9A 2X19A 5EKDA 2COUA 2WSCJ 3E3VA 5CVRA 3I32A 2NU7A 3CRZA 3OL3A 5H2FC 1CZKA 2PCLA 5AKZA 3GY0A 3F5MA 1DJQA 3RTDA 4DUGA 5HKLA 4MV3A 1HKSA 1T98A 3HS3A 1DVRA 3QVXA 3T7DA 5JXHA 2E1OA 1PJAA 1KJ9A 3HHEA 3L04A 5BMZA 2TMGA 1UQUA 1V9LA 3CL3D 2X41A 4ND8B 4BHTA 1NQ5A 2QIOA 2QRKA 4B80A 1VE1A 3PXCX 4OJQA 5DM0A 1NXXA 1CVLA 4EBBA 4MQVA 3ZQQA 3TUJC 3LF1A 1XZMA 4LMRA 5J2UF 3EETA 3L73J 4YCNA 2ODWA 4I1VA 1JLRA 3O8CA 2PSHA 1GITA 2QE7D 3HYTA 4R3WA 4XL9A 2G8NA 1NYLA 3TK1A 3EXHB 2DGDA 3QU7A 1IATA 1J39A 3UT0A 2DY1A 4M0DA 3IMCA 1KB9I 5CM8B 2NUAB 4PZZA 1KHTA 4BB0A 3SG0A 1AKWA 3QUTA 2GR9A 4Z6KA 5FI5A 3ZCVA 2F55A 3A1TA 3FVQA 2E55A 4X45A 3AXSA 3IVGA 1NBEA 1T13A 3HCAA 5FLYA 4I9HA 3ZQGA 1EEXB 3IAS2 2IXEA 1NVAA 1M74A 3CJQA 2COMA 4BNLA 4Y0VA 1KJQA 2ZB3A 4UD6A 1MF7A 5IN4A 1E6MA 2CDCA 1CW2B 1XG1A 3GYBA 3M49A 1EDJA 4MYHA 1X1QA 5DCMB 1VLHA 2YXRB 3S55A 1O3YA 1EM8B 3IAFA 3LKZA 3NIFB 5JDIC 1II8B 3R0IA 3EUWA 1WRJA 2ID4A 1W5EA 3ETDA 3OAAD 2BGKA 3H3ZA 1PFIA 5JALA 3NIGB 3FH0A 1UZAA 3L72G 3UAZA 1R6AA 3NT5A 1YTYA 5AVQB 1JBQA 4LJYA 5AONA 2GRJA 4CMIA 1QHXA 4TT8A 4OINF 2Z9BA 4BAYA 3DO6A 3R9KA 1BI0A 2Q6LA 4QBHA 4O59O 5AJYA 3KCCA 1Y8ZA 3O4FA 5CLGA 3BC8A 1OH8A 1OOEA 1PTKA 4QPQA 4BGUA 4Q4HA 3RKXA 3GP5A 2NVYJ 4UVHA 1CEXA 3SSUA 4Y17A 2VBFA 4ZD6A 1WE2A 2IH4A 4R69A 1TT5B 3T9BA 1U28C 3ZWAA 1B0AA 2D0PB 4HO1X 1YNSA 3ZIAD 4UFNA 1AK2A 4W99A 3RLIA 2GEDA 1UEJA 2BEQD 1RQGA 1WMAA 3G79A 1ETQA 3FLBA 4O2BA 4RTLA 2PGLA 2FBKA 2P5SA 2D2CB 3W6VA 2I2FA 2WM3A 4TL6A 3EZ6A 1DFHA 2HFED 2JIMA 1RWOA 1R5SA 1Q0HA 4XGIA 2WPQA 3LX4A 2HU7A 1TC3C 5I6DA 3QEMB 3OOEA 3EVEA 3RAGA 1T33A 4LF8B 4NS4A 2IPAB 1E6UA 3DXYA 3ABVC 6YASA 3SYTA 1Z6AA 1CERA 4OGKA 2RHHA 4EVSA 3NMDA 1GQOA 4LZZA 1E59A 5LU8A 2O0LA 3UIAA 3TMKA 1JIKA 1SQVG 5AI4A 4DQXA 2FQ1A 1NJGA 1GVDA 1YZNA 4TROA 3MT7A 3OQNA 3RJZA 4L50A 3CC4P 4QSHA 3D64A 4V0QA 2IGTA 1RJWA 2VYVA 4TZKA 4ZVKA 2B3DA 1N7SD 3BGVA 3A9VA 2DE0X 4KUHA 1I5RA 3KPWA 2E4YA 2HSEA 3T3PB 3UT6A 3J7AO 1OVUA 4QELA 4K40A 5LWQA 4QTUB 1E3QA 1P75A 4UNRA 4OU5A 3T54A 4Q7JB 4X6YA 1ZW6A 2JD0A 5BSVA 2PX9A 5DUKA 3G8DA 3A1UA 5AUQA 2C00A 3K6SB 4TXNA 1RM5A 3B02A 4KQIA 2UYCA 2KT0A 1HG1A 2WZDA 2IX7C 5I7SA 2KJCA 4DM3A 1VE3A 3SWYA 3QE2A 4S0XA 1E8DA 4GYIA 1KSGA 4GKGA 1CUXA 2CUTA 4IV0A 2FCRA 5DXJA 4I4TF 2CYCA 4MAFA 3HGYA 2ZJ1A 1UC4B 1FLVA 2JBAA 2NZVG 3MUNA 4PX5A 5A62A 5H3HA 2VJ4A 4YAUA 4OMCA 1C7RA 4A1OA 1WXHA 4KN5A 1O94A 1QCYA 1R50A 5E79E 1VQOP 1L7VC 1OA0A 3KBOA 4KI0A 3W8EA 4IKOA 2H63A 1GGVA 3F8BA 4IFEA 3F8CA 4LVCA 1E2FA 3Q1MA 4YH1A 5JAZA 1QFXA 2XUAA 1ONVA 4NC6A 1J1EC 2H6CA 5JLXA 4Q5SF 5DM7F 1DMRA 5IH7A 2YNMD 3S3MA 2NU8B 2VUTA 4B4UA 2ZKZA 2WT7A 3H3UA 2J6BA 3ZHVA 1RXUA 3PI6A 3BCCG 1DAHA 3PSHA 1Z5ZA 4A10A 3CWQA 1ZRTD 2E4AA 1WUKS 3T95A 1ZZGA 4JJZA 1TT0A 2GZWA 1XRMA 2V6FA 4EUNA 2PUGA 3G5AA 5SZHB 4F38A 3CCUP 3G0GA