1ZR2A

Structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
b'MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCAGTGTCCGATAATTTAT
publication title Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination/dna
total genus 46
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zr2A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zr2A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zr2A01
1W0UA 2RSLA 1NK3P 5FLVA 1IGNA 4UUSA 1FIPA 3HDDA 2JMWA 1LE8B 4M3FA 3HKZN 5IOZA 2M2EA 2WAQN 3S16J 2KT0A 3UKGA 1CQTA 2P81A 3Q3SA 1RESA 4L5EA 1TC3C 3FISA 1IDYA 3G1LA 3GTMJ 3CCYA 2DMUA 3OIOA 1IDZA 1OCPA 4DZPA 3C2BA 5IP6A 1HOMA 2DA1A 2W48A 1OJLA 4A3FJ 3HB9A 4CYCA 3WHBA 4UUSB 3JR9A 1B72A 2NVQJ 3GTQJ 3BVPA 3WHCA 3S1QJ 3IV5A 3HOXJ 5K7HA 1B8IA 2X9DA 2R5YA 4MIMA 5FKNA 5J1YA 1HX7A 2E1OA 3ZQGA 3HGYA 2HQ5A 3Q0WA 2NVYJ 2LY9A 2GLOA 4V2FA 2DA3A 3LOCA 4BQQA 2AO9A 1RPWA 4Y52J 3S15J 3ZOBA 1T56A 1JT6A 4CYCB 1B72B 4V2GA 1P7JA 3ZQFA 2JA6J 3JRGA 2CU7A 2Y9YA 3DEWA 1RKTA 4ABZA 3IH2A 2EBIA 4IEJA 4C3JJ 1B8IB 2R5YB 3HEFA 4D5CA 3S2DJ 2E2JJ 2CJJA 2EZHA 3JRCA 1ZQ3P 4QTRA 1FTZA 3IH4A 3OSGA 4JX4A 5M5YJ 3B6AA 1O4XA 2VUMJ 3I4NJ 2NVTJ 4XRSA 4Y7NJ 2R7ZJ 1GHTA 2DA5A 2DA6A 5F27A 2K9NA 5C44J 2EH3A 1QVTA 4XK4A 4D7MA 1E3OC 1H8AC 2L7FP 4MO7A 1JT0A 2HXIA 4M3GA 4M3EA 5EYRA 1FTTA 1QPIA 2HOSA 1ORKA 4DYQA 4AYBN 2PMZN 4FTHA 1Z77A 1ZK8A 3RQIA 4B4CA 1PUFB 1Z0XA 3LHKA 2NS7A 4BXXJ 5C34B 4B3AA 2O8KA 2HI3A 4DYRA 3ZQCA 1ZGWA 1JKOC 3FK6A 2GM4A 3S14J 4A3MJ 1D5YA 1H88C 2QCOA 4XICA 3M3YJ 4LOCA 2IBDA 3ZQLA 2QF7A 1IJWC 3QPSA 1VNDA 5EZHA 4BY7J 1AU7A 1ETQA 2R5ZB 3NAUA 2R92J 1A5JA 3OSFA 4GFBA 3G1OA 4A3JJ 2JA8J 2D5VA 4M3DA 1AKHA 4DYCA 1MSEC 3CQZJ 2FQ4A 4I76A 4EEFG 2TCTA 5DTDA 1RR7A 4BKXA 3HOUJ 1K61A 4JX5A 2X48A 2COBA 1QVUA 1MBHA 4DW6A 3QQAA 2JA5J 1HDPA 3MVPA 2LK2A 2XPUA 1XG1A 2LD5A 1U78A 4JP0A 3DCFA 1TWAJ 2R0QC 1GT0C 3BR6A 3RZOJ 2EZIA 3A01A 3LNQA 1ETVA 2EQRA 4XRMA 3CMYA 5F08A 4A3BJ 5F0CA 3F0CA 2XGEA 4DZJA 1LFUP 4W97A 3VPRA 1FJLA 2YUSA 1YRNA 1Y1VJ 2CQQA 1IUFA 4XRSG 2MW8A 4QIWN 3D1NI 5K7FA 2DA7A 1WCMJ 3Q0VA 3K7AJ 3G1MA 1W0TA 3BG9A 1GDTA 1IRZA 2OF7A 1BW5A 3JRBA 3MN2A 2E19A 1TWFJ 5F04A 4A69C 4M3BA 2M8GX 4IHVA 3A01B 5EZGA 3RZDJ 3B6CA 5FKMA 4MFEA 2L7MP 1X58A 5IYBJ 1F43A 3JRAA 1ETKA 4W1UA 4J19A 4A3LJ 3FKIJ 1YRNB 4A3DJ 5EGOA 3ILXA 2LLKA 3FIWA 3NARA 3G13A 3O8GA 5C4JJ 4MLOA 5E3OA 3S1NJ 1HLVA 1S7EA 3BR3A 5DS9A 2I10A 4MFDA 2ECBA 4BBSJ 2JWTA 1ETYA 1FEXA 3OOUA 3K2AA 1P7IA 2JK3A 3GBGA 5IOYA 1F36A 4A3KJ 2GM5A 2B63J 5FKOA 4FE7A 1MSFC 2JJ7A 3LSPA 4FISA 1U9OA 5IYCJ 2YU9J 3LHFA 5EGOB 4IHXA 4JYKA 1U8BA 2Y2ZA 5EG0A 4A93J 3HGGA 5EEAA 3TP3A 5F1JA 1MBKA 3CDLA 1JKRC 1RKWA 2NOGA 3HOVJ 2WV1A 3HOZJ 2DA2A 2ID6A 5C3EJ 2LKXA 3S1RJ 1WH5A 2L0KA 4D7NA 1HDDC 2Y31A 2LP0A 1MBEA 3SJMA 2NS8A 4AUXA 3SFIA 3GTOJ 4B1RA 3BTIA 2XB5A 5M3MJ 1Q1VA 3BT9A 3PKZA 2DA4A 2HOTA 1LFBA 4G12A 4C3HJ 1MNMC 4FCYA 4A3IJ 3QPLA 5EG0B 2AHQA 1NTCA 3HBLA 2MG4A 3S17J 3LSRA 1MH3A 2XGCA 4M6VA 2N8GA 5K7ZA 2ME0A 2KDZA 1BL0A 3BR1A 2HYJA 5J3LA 3BQYA 1K83J 3TP0A 1DU0A 2RAEA 3BTCA 1POGA 3JREA 2HXOA 1ZR4A 3H0GJ 2HDDA 3LSGA 4IHYA 1H89C 1AHDP 2E2HJ 4A3EJ 5IYDJ 2LR8A 5J1UA 2FD5A 1RETA 1JTYA 2IAIA 3UJ3X 5JLWA 4AC0A 2YS9A 4C3IJ 2HOAA 5JLXA 3RKQA 3HM5A 1APLC 5C32A 1DU6A 4FE4A 5M3FJ 2M0CA 1I50J 1A6IA 1WI3A 3ZQHA 2L7ZA 1JUMA 1AKHB 2NVXJ 4BY1J 1GUUA 3BQZA 4I6ZA 2E2IJ 1SFOJ 2IEKA 5GPCA 2ID3A 5GPAA 3JRHA 1WPKA 3TEDA 3W6VA 3GTLJ 3GTPJ 2VI6A 3HOWJ 4S0HB 5HODA 3GUVA 4JX6A 4RDUA 2K9QA 5BNGA 2DMQA 3BG3A 2TRTA 1FIAA 5M5XJ 2VKEA 1ETWA 2MGQA 1MBJA 1I6HJ 1GV2A 5IP9J 2XB0X 1WGXA 1EF4A 2Y9ZA 4D5FA 3A03A 2GBYA 3BTJA 4RBOA 2H8RA 2LTPA 4C2MJ 4XIDA 2M34A 3PO2J 1OFCX 2EZKA 2XPVA 1JJ6C 2JA7J 1JTXA 1IV6A 3HOYJ 3JRDA 1IG7A 2O7OA 3BR5A 1JKPC 1UMQA 3BR2A 2VKVA 4X6AJ 1MH4A 3Q0UA 5C35A 5E3NA 5FKLA 5C31A 2K40A 3BTLA 5F0FA 2CUEA 1MBFA 2CRGA 3S2HJ 4BBRJ 5E3MA 1I3QJ 4QSHA 1IC8A 9ANTA 1GV5A 1Y1WJ 1VI0A 1SANA 2CUFA 1ETXA 1ZKGA 2Y0SN 5FJ8J 5E3LA 2G0EA 1VFCA 1ZTRA 1TWCJ 5GP9A 1HF0A 1OCTC 3JRIA 2DMTA 2X6OA 4A3CJ 3GTKJ 1NK2P 1UHSA 1G2HA 1TWHJ 5C4XJ 5EDNA 2DJNA 2XRLA 2O9LA 3H3VK 3I4MJ 1JJ8C 2XSDC 5FLMJ 2M9HA 1JKQC 2MHCA 1PUFA 2FJ1A 1U9NA 1QRYA 2R93J 2ELKA 2LFBA 3A02A 3BG5A 3FK7A 2MSYA 3MKLA 2DMNA 3TW7A 4UUTA 1JGGA 1JUPA 4IHWA 1BJZA 1WH7A 2JN6A 4HNVA 3BR0A 4X1EA 3E7LA 1GVDA 2DMPA 2L9RA 2Y30A 2CQXA 5FKKA 4NDLA 1UG2A 3GTJJ 1ZR2A 2DTZA 3IH3A 3TW6A 1R9TJ 2R5ZA 4A3GJ 2XGDA 2OPTA 5M5WJ 1XS9A 1ITYA 2ECCA 1TWGJ 1X2NA 1XC5A 2ME6A 1JUSA 3O8HA 2FX0A 2WB1N 3JRFA 2LVSA 2K9SA 1LE8A 2ZB9A 2DN0A 3LSJA 3SDGA 3GTGJ 1X2MA 1ETOA 3S1MJ 1ENHA 3PM1A 5J1RA 5IP7J 5IPAA 2EZLA 1BA5A 5EF6A 1MBGA 1BW6A 1HCRA 2H1KA 1T33A 3ZQIA 2VPRA 3L1PA 3M4OJ 5F0HA 2XPWA 3PO3J 1VF9A
chains in the Genus database with same CATH superfamily
2PT7A 2CEAA 4K0RA 1N4AA 1GU5A 2WAFA 2O61A 4UM5A 2HTFA 4DA7A 2JLRA 3MRVA 3UKGA 2VAXA 4L5EA 2WJJA 4I3FA 1BDDA 3AG4H 4ABYA 4MULA 4C6RA 2D5AA 3NWTA 1N6LA 3N2KA 1QL1A 4GCVA 1X9HA 3IERA 3LFKA 3CCJP 3H9UA 3JSXA 3ZWYA 2EBHX 4UBLA 1TX4B 3SEZA 3KAQA 3MWDA 3HHHA 2VT2A 2JIRA 2ZB4A 1STZA 1RRGA 1F20A 4FJ1A 4KPGA 3F6YA 5TPZD 4FXPA 4P33A 4KDCA 3E1KA 3ZBQA 3R2PA 4BBAA 1K6IA 1NC1A 3NEUA 1E4OA 4MW1A 4BVFA 3ASNH 3RYPA 4DIFA 4D8WA 4A7PA 3W5BA 2JCGA 5IC5A 4F2HA 5AW4B 2DMRA 2JJ1A 4EH1A 4EY5A 4PNZA 3KHTA 3OLZA 1ZMEC 3ZVRA 1UBJS 5BO5A 4F52A 4G37A 4B0PA 2WWGA 3OEED 1XU7A 2CVPA 3TLMA 4P3YA 4BO7A 1OTYA 4LNUA 2UWMA 2J5UA 4J16A 1QTIA 2PZMA 1T2KA 5LA6B 4QXOA 1TFUA 1JG7A 2YX7A 2E5WA 4B6FA 1TIPA 2A86A 3GH1A 2X1MA 4NAHA 3U4MA 1C0IA 3HTKA 4CM9D 4PAQA 4YONB 2Y27A 1C3OB 1NAHA 1SZCA 4XIFA 1K2WA 4II2A 2ZSFA 4FLFA 3RZOJ 3QK7A 2QM3A 1JBEA 3COAC 2QSGX 1RE3C 4B3TB 2X5KO 5AVVA 3GF2A 3WICA 3TCKA 2OYSA 3AI3A 1E1YA 2OHOA 4DSUA 2QD2A 2L3DA 2ZBKA 1VRCA 3G82C 1O58A 2Y05A 2CHFA 3HXOA 1NU1G 3LW8A 1BW5A 3MN2A 2M4KA 3A01B 3JWEA 4WY2A 2L7MP 1L4MA 3IDZA 3CKMA 4YDQA 1CUIA 4AF6A 5APYA 4KXQA 5K5GB 3LF2A 3ZTWA 5JV5A 1U94A 3IAS2 2IW5A 1J2EA 1EIZA 3K9QO 1II9A 5AVRB 2R85A 2YHAA 4X1IA 5D5UB 5JPIA 3DA8A 2XRMA 3T4EA 3Q2KA 3K9BA 3GFMA 4I7HA 2NO0A 3P71T 1EXMA 1K2VN 1CZKA 3LHDA 1ON2A 5BSUA 4RTQA 1S9HA 3H0KA 4MDFA 10MHA 1QQAA 4KIFA 2I71A 3D43A 4J0DA 5ALLA 2P62A 4FHZA 5EG5A 3C0KA 2KIKA 3ORSA 4MXDA 3HP1A 2PXHA 1ZJ6A 1S0UA 4IUBS 3TEJA 1EAMA 3BORA 4OBXA 3ZGLA 5K5QA 3CPSA 2XGJA 2ZJ6A 3GFPA 4GKAA 5EJ6A 4R8RA 4W80A 3H16A 3NIFB 5DHPA 1RPAA 3H35A 1LSOA 4JI3B 5HFJA 2HTJA 2FBKA 1SHKA 1CIJA 1EFCA 1PEYA 1T5OA 4S1NA 4UUAA 4II7A 1HO3A 5DYYA 4BZWA 3PFNA 1JR6A 4G7HF 1TT0A 1LJ2A 3VKVA 1U81A 3P0JA 2LBFB 1SD7A 2BGWA 1TQMA 2J6HA 2PX4A 3OYEA 1FIAA 1JYEA 1LFAA 4GLOA 3M4JA 1OI4A 4CFSA 3AFNA 4EGCB 3ODGA 1X8JA 1YF3A 3OCXA 1U5TA 1V4BA 4INPA 3A4VA 3LXXA 5AM5A 3U4AA 2X5XA 1KJQA 2ZRKA 1OR8A 3UK6A 1FPQA 1BWPA 4UUPA 1LUAA 2K7FA 2VWGA 2CRGA 2WMOB 4QU8A 2NUPB 4XX1A 1ZVVA 4M72A 4UAJA 1JEOA 2Y1WA 1SBIA 5L3CA 1LP1A 4IHKA 2X6OA 2H9YA 1U8ZA 3UJ6A 4BTVA 1Z21A 4YJDA 3BHJA 1OILA 3FK7A 4BQRA 2OM6A 3RGGA 1P61B 1ISRA 2E4UA 2VI5A 3WIUA 3VA7A 3L00A 4G26A 1NUAA 2JN6A 4OU0A 1USUA 3L2OB 5CJ2A 3OU2A 5AKHA 2GUVA 3LVBA 1GL9B 4M0DA 5FPYA 4Q9KA 3SHVA 2OOSA 3Q10A 3IUJA 2EKDA 3EEIA 1P3Y1 4IF6A 1FRZA 2XGGA 3AJAA 3QV2A 1J75A 4QYSA 1Q2UA 3C85A 1SPBS 1EZVE 4Y13A 1T13A 3GDFA 1XEAA 4TGLA 2WUDA 4JYAB 4C7BA 4Z54A 3L05A 2Y1KA 2LDXA 1USGA 4PLZA 1ZIDA 2EOAA 4LQDA 2DHEA 4OJTA 2DECA 4I8XA 2W2KA 2V6JA 2GN9A 1CWUA 1H4SA 2HHLA 4CE6A 4EJSB 4PLWA 2JGNA 4E5UA 1BJRE 3Q7QA 4WACA 1RRVA 2FPOA 1K78B 4U0WA 2YJZA 1SBNE 5JFTA 2LNBA 2VPTA 3KV3O 2WWIA 1O0BA 2XBMA 4O33A 5EHXA 1G1IA 1W85A 4EM2A 3SQNA 4KAJA 5LMNB 1FTQA 3DCIA 4ER6A 1MO4A 3NHMA 4U0YA 4HNAB 2ADOA 3O9ZA 1JTEA 2IYQA 1LSUA 3NOXA 4LV5B 3NFRA 4HNSA 2KW5A 4C3JJ 4CKCA 3UVEA 2CHUA 1LPOA 2W8BA 3TF5A 5H9VA 4OXNA 4CL2A 2PGLA 1K7YA 2GQQA 1KDYA 1O4XA 3UH0A 1U2EA 4C06A 5C4MA 4ASWA 1X7XA 4R83A 3J81K 1CS0B 1I80A 4LRYA 4XYEA 2I76A 1E3OC 2JFUA 4TLDA 1DKMA 3AVPA 2WNSA 1V1RA 2QIOA 5BXQC 5LGTA 4M55A 1ORKA 5A1TA 1FLDA 2R751 3CCVP 2GAJA 3D5RC 3ZQCA 1E2HA 5KNCH 4F5ZA 3UWOA 4N65A 2EFPA 4CCWA 1HW5A 1DIGA 1MC5A 3HGQA 4FX5A 1QRTA 5JDCA 4H1HA 4OVKA 3CW8X 4RFLA 2JA8J 3OZSA 1ISSA 2GRJA 4IPAA 2JT1A 3KK0A 4J07A 1TOAA 2F5CA 1NP6A 2MFZA 2M45A 3E58A 4RYLA 4EFNA 1HKHA 4H6PA 3CUKA 4ROTA 1EE9A 4BDTA 2VTVA 3THXA 4G1CA 2AG0A 3UMGA 2Q2QA 1EK5A 3L0DA 1QQ5A 2IGBA 3AR2A 1THTA 3D8SA 1R6AA 1N2DC 1E5LA 5AVSA 4NBWA 4NYJQ 1D0SA 3KVYA 4QU5A 1R1VA 4EATA 1KOFA 3CCCA 1JDVA 1V48A 1UOQA 1OBVA 5KOYA 3E2PA 1V9CA 1OKKD 5I7VA 3ETCA 1FJPA 2KLVA 2L02A 4RTOA 1KQ3A 2FZWA 1KA8A 3DHWC 2PZGA 2YL2A 2RGXA 2O8CA 1BQ3A 3K4MA 1PR0A 3V4RA 2XF8A 4JBZA 1ZW0A 1DP7P 4HRIA 3GDOA 3ZZ1A 4IHAA 4B34A 3OPXA 2JF0A 3CDIA 3AWDA 3WB9A 4Q24A 5CCHD 2VRSA 5G40A 2OORA 1NTCA 1REPC 2WSSD 3V7FA 3DUFB 3J80K 1IHDA 3PP8A 4AY6A 2X19A 3AVXA 3OMLA 2J3IA 4ENNA 3UN1A 2Y0BA 3ZOZA 1FFBA 1ZAKA 4IHYA 4LQLA 1I5RA 1QFMA 2PKRA 5LM3A 2GD1O 1THGA 1DJMA 2FD5A 4ZAYA 3AVOA 4DUZB 4JD5A 4Q9LA 5TEWA 4LS3A 3R9XA 1WPKA 3HE5A 4DMLA 3H1KD 1Z6YA 4EA9A 2EEZA 2ZT9B 1T43A 4E33A 4KLCA 2GK4A 1IWOA 4HGYA 2YUTA 2LZ0A 4B4KA 3PO2J 4WASA 3ADOA 3KFXA 4TT3H 1QL2A 3H3FA 4PG4A 2WMYA 1ZXBA 1VLZA 4AKIA 4CZZA 1JZSA 3H3JA 1BCSA 1LNWA 1X0XA 2WM8A 2PZKA 5FJ8J 2B7CA 3CLSD 4RY8A 4BKPA 5KAIE 1WCIB 3IGFA 1I1QB 5K5EA 1T08B 3OEHD 4N3AA 4UUQA 2IOFK 4UAGA 1EXIA 4Y99B 4BQSA 2QPTA 1X3UA 1KO1A 1O96A 1AS2A 1HKUA 1XZQA 3FR7A 4RHUA 1R9TJ 3OQOA 5HILA 3I5AA 4LHVA 1NQUA 5J63A 4RD6A 4YAOA 4J4BA 3DAHA 3RTDA 3AF4A 1RLOA 3RRZA 4GOND 3I6YA 1OH6A 3VJMA 2YV4A 3DKYA 1EUZA 1BA3A 1X39A 4HAOA 4PSDA 3H1HJ 1IN5A 2HA4A 1Z05A 1MA0A 5CB6A 5FUVA 4CUKA 2IP1A 1TCBA 2JMWA 2AQFA 1GR1A 1B8UA 5IM4F 4LFAB 4OUKX 1QVFO 3KQLA 1PQYA 3E70C 1NPTO 5AW9A 2PRZA 2GYWA 4BVJA 4IGEA 1S2IA 1FB5A 1SAYA 4F6CA 1A8PA 4RA2A 2ODPA 4HEJA 5KWSA 5FBLB 4BMPB 4UHTA 5BN5B 1IK4A 1COWD 1I4DD 4Q7EA 4EG4A 1GW3A 2HSGA 1N0UA 3L1VA 3FHZA 3HUGB 2NZJA 4C4ZA 4XJXA 3CINA 5HPYB 2DETA 4CEHA 1U6JA 2ZI6A 3HGTA 1UELB 2PMZA 1U7DA 1J2JA 4U6NA 4BMVA 3FJYA 1IQPA 1PFKA 4FZ5A 4OPMA 3VYVA 1ATZA 4ZZ1A 4HWTA 2H09A 3BHIA 5DW0A 2JK1A 4XLPF 3B85A 4P3XA 1S9KD 1X7WB 4XFKA 4W5WA 2P9JA 1I36A 3IF4A 1I6WA 4YRBA 4EV0A 4D6TE 1JR3D 2PT5A 2QXUA 1W36B 1NVTA 4D0NA 4GMXA 4EJOA 5JALA 1TW3A 3HJUA 3VO1A 1YR7A 2CWWA 5G0SA 1N9GB 3RFVA 2QV0A 1BDHA 1EFRD 3VSCA 1CUSA 3G71I 2JGFA 2NADA 3ZVLA 4B4VA 1VRVA 3AESB 2DFFA 1K3UB 4OQDA 5K45A 3QH4A 2CBGA 4NESA 1XA0A 2CS3A 3FSGA 4G0YA 5EVJA 1OXZA 4OP3A 4D6XA 5GVSA 1E3TA 5BSGA 3HY6A 4RTKA 4EMBA 4C7NB 3BGOS 3OQBA 3S2EA 1J2UA 1PR9A 4HS4A 2OYCA 5AI9A 1MAWA 1Z37A 1TL7C 2M9MA 3PL5A 3PUJA 2PSDA 5IU6A 4H60A 4N78E 4D98A 2HS5A 3CC8A 2NUTB 4RVDA 4NAUA 3O5AA 2VWPA 3FIWA 3V48A 3TLAA 4D3SA 4FETA 3N8NA 1PZMA 1XRLA 4PZAA 5ECYA 5CIYA 2PGDA 2VP3A 3VDNB 1AQIA 4GLBA 1WVGA 5ECWA 3IDQA 5K51A 4FONA 1ZI6A 2Z57A 1MDBA 4AX4A 3FVTA 1R74A 1TYAE 3H1LE 2B2NA 4ONEA 3HK2A 1PL7A 4L5IA 3RV4A 3K09A 5C3EJ 2OTCA 3OA0A 2BUBA 1XZNA 3T4PA 4PZYA 2PXAA 3CCEP 3RK3C 1KR5A 1HH4A 2YN4A 4LJ6A 2CYCA 5JDIC 2ZJ4A 1YTYA 3BEOA 3SCZA 5DNAA 2QT0A 3NTXA 5K7ZA 5HE8A 4MCJA 1YJXA 1PCXA 4JSYA 3GVAA 4JY7A 4NVRA 1L7BA 3MZYA 2QTVA 1TTTA 1OT3A 5E17F 1X8KA 1SXPA 1RXIA 2CLLB 3H05A 3DDNA 3T38A 3OOSA 4QNMA 1QYDA 2M3EA 4EM6A 2VTBA 2I1KA 4U0VA 3WLKX 1ND5A 3MQ2A 3OYBA 4I6ZA 4BJ1A 1IPHA 5FOWA 4JJZA 5KDDA 2IRWA 3ML1A 3N5CA 2Q1TA 1NXWA 1EB9A 2QGUA 5M5XJ 4DE5A 2IYUA 3KSBC 4JJ8A 2CK3D 4UVIA 4EO7A 3GPLA 1T8ZA 3BBLA 5LVAA 1DHRA 2VKVA 4UB6H 4XX0B 5J4YA 2B37A 4J0CA 2XE6A 4MQFA 5C31A 1VPLA 5D84A 1KFMA 3HCEA 4ZU1X 3Q40A 3IJ5A 3L1IA 4XGIA 3H13A 5FO0A 3G17A 4C22A 4BHPA 3DTIA 4PZJA 1P7WA 2Q9AA 2YIUB 4QD3A 1GUBA 5LRSA 1AXEA 2EJBA 1U9NA 5FI0B 2LFBA 2JUCA 3WTSC 4WBAA 3ESQA 4GX5A 2QY9A 4G0WA 4GSLA 4EJUA 1NW6A 2IEYA 3M33A 4HDCA 2IYZA 2BYVE 1DKNA 1A6QA 5E79E 2YZGA 4I4IA 1X2NA 1M83A 1FRNA 1LC3A 4XI9A 4K9PA 2XAJA 1WJGA 2FRVA 4I66A 3K71B 1RM5A 2XNCA 4NARA 4P9NA 4ESEA 3MKYB 4RULA 2IKQA 4JA0A 3KLNA 4EPXA 4KO2S 2XUHA 2OV4A 3MB5A 4QJBA 1DUXC 2C83A 3EXIA 2UZIR 4G5HA 3PL1A 3PIIA 4BIMA 3OS0A 1QQ7A 1EUDB 4QAJA 2ORED 1CSBA 1AH2A 3A10A 2VQDA 5B7NA 5ER6A 2F5VA 1MTZA 2YMQA 2M5AA 2YX1A 3KO8A 5JCJD 3IT3A 2D13A 1OX4A 3E9ZA 4YMIA 4KGVA 3BRWA 3IV5A 3LBHA 1XCMA 2X9DA 1JH8A 5FWAA 4B3SB 1IK9A 1GL2D 3L71J 2RV8A 5LZ8A 3NHBA 2LY9A 3GHGA 1BEUB 3UKJA 1Y0BA 5EKXA 1K4KA 3UIAA 4ZQFA 2QQ9A 1TMKA 1HI9A 4TRNA 2EJRA 3AE9C 4IRUB 4A0SA 3WTVC 3VV2A 3CX7A 4XTRA 2O6HA 2B5WA 4RNCA 4RPLA 3SIWA 3EZ7A 1CRZA 5JH7F 5FOUA 2ZYAA 3SYLA 1OLUB 1Q84A 5DGIA 3K32A 1MMNA 4IXNA 2HQAA 5HUQA 3A9UA 2OUKA 3NRJA 2C7GA 3BXHA 2ZXIA 5L7YA 3AUJB 2OQGA 2XU6A 1WHSB 3LVQE 4YJHB 4M9UA 3ETDA 3L6RA 4BJ5C 3WOVA 2Y9MB 3QPTA 4B6EA 4PBTA 2RKBA 1F1JA 1U1CA 4G8BA 4DPMA 2ZW9A 3I8XA 4AM3A 1Y9EA 1WPGA 4TLLB 4PSAA 3RU7A 3CX5H 1AUOA 1FYDA 1RCUA 3WNZA 3JQ7A 2FPIB 4JKIA 3MKWB 3GNTA 3KUKA 3DZIA 4MUEA 2PGAA 5DLDA 3MRTA 4ZYDA 1B43A 2PUHA 5E6RB 3OPYB 2ZT7A 5F64A 1ILWA 2HU5A 4NBLA 4JASB 3TGNA 3IP5A 1RQUA 3H1IJ 1J8FA 1VPEA 4MNTA 3I5XA 2PZFA 3C2QA 3OJFA 4JF7A 1JOCA 1ETUA 1YZFA 5AM2A 1XL1A 2Q50A 4AIHA 1BEEA 3BR3A 1DH3A 3U5TA 3RABA 1Z8DA 3MFQA 3IIKA 1IEXA 3E82A 2SECE 3NBKA 4OP1A 5AKIA 3I01M 2C77A 1TZKA 3IP1A 4BLWA 1KAQA 4WZAB 2EFOA 2FPGB 4PRYA 3OWHA 2GUSA 2RONA 1AGYA 3P9PA 3CNOA 2G1AA 5DJUB 1Z91A 1NAFA 1E4EA 4IO1A 4KDFA 2D8AA 1DAIA 2Q7DA 2V3WA 1S2EA 2OEPA 1USEA 1GGNA 4YMVA 3II6A 5C3UA 3HKZA 4LK3A 4FDAA 1TAQA 2P91A 2OCAA 2YR2A 3JQRA 3M8JA 3KKLA 3OM0A 1RWOA 5LWQA 4AKGA 2CXTA 2VJMA 2QTGA 2ID8A 4XORA 3CUUA 3ZWVA 2WU8A 4ZT2A 5I5EA 3BHNA 5IM4A 5BMOA 2WUVA 1UWKA 1NLUA 3JTGA 5AVZA 4LWOA 3P4UA 3O2JA 3QMWA 1VHJA 2O52A 2NVXJ 4GMFA 4E7LA 5IJWA 4KN9S 1J9EA 4K5QA 3C70A 4YV2A 1SVWA 3Q5EA 1GD1O 3P0HA 4S1TA 3VXKA 3S7TA 2WSYB 5IF9A 1KEUA 4XGKA 3B6IA 1E2KA 4ZEVA 1B6SA 4C2TA 1H0RA 1XMAA 3TM4A 2PIAA 4FT4A 3PLRA 3GCXA 2HDOA 4FFOA 3GFJA 1AGPA 1GLGA 4H0EA 3AY3A 5DM60 2EG9A 2C9LY 2HSJA 1LCIA 4WRRA 1IY1A 4WESA 2XHKA 1OW3B 2XSDC 2RBEA 2VPQA 4X7RA 1ZU5A 2Q4DA 1L0NG 5H6RA 4J1NA 3WLTA 3TW7A 5P21A 4ZJZA 1ZESA 3MGAA 2HCBA 5D1HA 2HLHA 5EJGA 2VH2A 3ZY2A 2EX1A 2R6CA 3DYVA 2IYRA 2PJZA 2R00A 3OH8A 4O2BF 3RRXA 1K1EA 3L8MA 4GGGA 1ORRA 4DVJA 3BM5A 4NQZA 3UUWA 1ECBA 1UK6A 1VPCA 3QKSB 2HUNA 3C1UA 3K0LA 3E8SA 5GADJ 4CN8A 1VF9A 3FMQA 2YWCA 2DPUA 1H4VB 5EE9A 4TPKA 1ZRHA 2EIXA 3GUZA 3L46A 3QI7A 1WJAA 5J5AA 4B45A 1PT5A 3WGNA 2RIRA 4DW8A 2Q07A 3I6BA 4JQOA 5BMVA 1Z18A 3BQNB 1T3ZA 1A1VA 4UJ5A 1SOWA 3ZWPA 5CA1F 2IF2A 1SC4A 5AHXA 3GVHA 1WSWA 1SVLA 4AS1A 1MZPA 3EQ9A 1L7XA 1YFJA 3CX5I 5FLYA 1QZEA 1G7TA 2IZZA 3HC7A 3FCAA 3QF7A 3K4BA 1BKYA 4AP5A 5K8IA 2WJZB 3FUCA 4RPGA 2NPFA 2I91A 4BC0A 2PCJA 2AEEA 2XAHA 1GUFA 2IHUA 1XSEA 1E2NA 4BE0A 1M54A 4TL6A 3AIMA 4OIFA 4PK4A 2PX5A 4D5CA 4CQMD 3D7NA 4H3VA 1N7SC 5KTMA 3EFBA 4Z4FA 1VKJA 3SSUA 1I2ZA 1Y63A 1A77A 1FBTA 1L5HA 4Z9FA 2PVCA 4A0RA 3CX4A 3OFND 1KXJA 4B7CA 2KE5A 4GR9A 1ELOA 1GZ6A 3ONWA 4IPTA 2G77B 3WBKA 1TM7E 2C58A 2NV2B 4BNDA 2DBZA 4PQYA 1D5YA 1JA0A 3MJ4A 4NZPA 3HL2A 4R2KA 1NF2A 1DB3A 4JC8A 3VOTA 5G0TA 2HVRA 2R7WA 1WLSA 4LYJA 3ABMH 4OFBA 1ZBDA 3H5AA 4C89A 2VF2A 1LTSC 1K86A 3JAMZ 3W9UA 5JXIA 4K1LA 4KOAA 4M3DA 1ES9A 5JAOA 1G63A 1K61A 4OL0A 3E1SA 5JZOA 1T1EA 1C30A 4WXDA 3HSYA 4D82A 3ET5A 2PGOA 2C9NY 3OIDA 3R7SA 1O3RA 3MWFA 1GT91 4NPCA 2TDXA 3AB3A 3OFSA 5A7GA 1LT9A 2H5EA 3W68A 2ZSEA 3FYUC 4MRPA 3EPPA 1LDEA 2XF5A 3F74A 4UAUA 1VQ9P 1UF9A 4QT0A 4DOZA 4MVYA 2Z2IA 1N77A 1W52X 1J1IA 2CUNA 4MFEA 5IYBJ 1VL8A 3UB2A 1OCRH 3ETHA 1YHYA 1GZUA 3RRMA 4BCDA 3KETA 3LP5A 1JL3A 1RD4A 5C5CA 1X7YA 1ETYA 4F3NA 4RGQA 3DFZA 4P4UA 1JHQA 1NA5A 4MGHA 3MWGA 1KORA 5F3WB 4EHJA 3ZMUA 1CSEE 3CF0A 4JQYA 1I6KA 1Q91A 2W22A 1ZVJA 1VQNI 4GYWA 4AMVA 4AULA 1R0WA 2LKXA 3A1YA 3CXHD 3GLIA 4OMYA 1CFJA 3RS7A 3B20A 3KQGA 3AIKA 1TJ5A 3LLUA 4HDNB 1LJ9A 2AB0A 2JJ2D 3DWGA 3R74A 4DHWA 5CHEA 1XDGA 1QS0B 4N5MA 3UV6A 1YQQA 1Z8FA 2ID9A 5DBEX 4C03A 1AK1A 4YBZA 1T3LA 2Y4NA 3OM8A 1I7LA 2OKCA 3RK2D 3HM5A 4YLEA 1DDGA 4TXLA 4TLAA 3SR3A 4QDKA 3KDPA 1U0EA 3DLIA 4JVNA 3U1CA 3OETA 2ZWAA 4NG5A 4S1WA 1BRMA 1OLSB 1I6HJ 3TG2A 3Q7SA 1I4TD 2RNJA 1LDDA 3HKDB 4YFNF 4FOSA 2NNLD 4G1FA 1SB9A 4CDGA 4WGGA 1ADCA 2CC2A 5TQ2B 1J99A 3E2IA 1NNI1 5CCGA 2QRLA 4QBKA 5JH7A 2P6OA 1R9GA 1XGKA 4FWTA 3TG8A 3EEFA 2FEXA 1YO5C 4IOCF 3A0HE 1HF0A 1CUYA 5TQ0A 3LSKA 2H9IA 4DBZA 1WSDA 1GK4A 2NSDA 2WSBA 4B8XA 4BBPA 2JIZA 4BO4A 4XDGA 4IHTA 1VE1A 2BIFA 1YI0A 4MR9A 2R5WA 3NBMA 3KJGA 3WYEA 4F46A 2GLUA 3LJKA 1II8B 4DDVA 1E9SA 2RI6A 5MFPA 5CGQB 3RDPA 2D1HA 3IH3A 5EKSA 1PJBA 4H7EA 5D5WB 1R5GA 3ZDDA 3GUHA 3CCLI 3BGVA 2EFDB 2E76D 4JVLA 1GDHA 3PNPA 3G02A 2VKDA 2WV9A 2PT9A 1EUQA 3ZKWA 5HYVA 4F4FA 2GRUA 1U2RA 1BROA 1JTHA 4CCSA 1QC5A 3BMOB 4WDQA 3S2GA 1PO7A 1G3MA 3BFJA 3U09A 5L3VA 1KFBB 4RAZA 3C3WA 2K2QB 4ZYVA 1NXSA 4ANJA 2K9MA 3VVBA 2OD5A 1Z0AA 2LP4Y 4GC5A 3SWWA 2XDQB 4J1TA 3EZ2A 5CEFA 2X0RA 1HX7A 5FADA 3FW1A 4YV0A 1XPRA 5B36A 3NT4A 4W5JA 4UE2A 4L2IA 3RF6A 3F8NA 1MIOA 1P5RA 3BWYA 3KP5A 4LECA 2WDZA 1TEVA 2WICA 4L5JA 4Z0HO 5F7JA 3QODA 5BOSB 2O01J 1P8AA 3HI4A 3DEWA 2YX4A 4Q3CA 2FMKA 2MJLA 2B99A 2J9GA 1X70A 4PV1D 5EIXA 2PWPA 4HB0A 1WD7A 1T36A 3C18A 2YWJA 2K9NA 4XD2A 1LT1A 1O87A 1FOKA 3GEDA 3HHGA 1SCQA 3IULA 1E1QD 4DYQA 2DULA 3ZVMA 1T9HA 3RTCA 3LLVA 1PUFB 3GV0A 5A3JA 1S3GA 2ORWA 3VOEA 1LA2A 4M6WA 1VB5A 4CCOA 3CVUA 1Q0HA 4XIJA 1DAOA 2F2EA 2CLHB 3MJFA 1QZZA 2GZ3A 3IBSA 5KLVD 5LDHA 3SJBA 1V1MA 3H1KJ 2XGOA 2M5WA 1XD2B 3N05A 1JG2A 4KIBA 1YB4A 1Z6ZA 1Y5NA 3CC2P 2AA3A 1N3BA 4QOJA 1QVUA 2EP7A 1MB0A 3HVIA 4O2AB 1AF7A 3CNQS 1TFRA 3TZKA 4A3BJ 4J0GA 2XKOA 2VODA 3NVAA 3MUDA 3GFGA 1W0TA 3Q9SA 4CLHA 2NN3C 1W30A 3BMNA 3WLQA 1JUNA 1TWFJ 1F0NA 1FUKA 1AGRA 1V1JA 4MI1A 2R1VB 3LY8A 3C3EA 1ODJA 3RUAA 2YWDA 4CO8A 2VJDA 2G88A 2MSDB 4I9FA 2EX0A 1Q86Q 5C5IA 4MV1A 1ZW6A 3CUWA 4FKZA 5IBCA 4ZYAA 1NQTA 3L5KA 3ZN1A 5A7HA 2N1TA 1K6MA 1Y1SA 4CCAA 4GUAA 5DHFA 2XUKA 2GX6A 1G2OA 1J1DB 3X1ZA 2I2WA 9ABPA 4PPFA 3V5BA 3WIOA 4A1OA 1ENOA 1WH5A 1H8EA 2Q6VA 2B5OA 2FSSA 3NV7A 3JWIA 2QZ8A 2CL5A 4PIMA 5AI8A 1VHWA 2EZUA 2NRGA 1G1JA 4U2CA 1JFFB 3WDMA 4CA0A 3BYZA 3N86A 2ME0A 1KK1A 1L4AB 2EV5A 3PCXA 1KI2A 1UR5A 4EF5A 2ZYGA 4M1QA 1RRJA 4A3EJ 2XHEA 4ZI3A 5ALVA 3FKSA 1O5IA 2RD2A 5IW8A 4BGVA 1LX6A 5AW2A 1SXJC 2EK5A 4WA7A 4NV0A 3ZH9B 1ODKA 2JGMA 1SQXD 3KWLA 3H3UA 4KFRA 5IM5A 3AHDA 3NDBB 3H9EO 1ZEJA 4YELA 2HBYA 4W5RA 3L72E 5KVSA 1QKIA 4MR7B 1XJ0A 1RXWA 5JNUA 2V54A 4IL6E 4K2HA 2PJRA 3ZNNA 2WTNA 2O2XA 2DXIA 3UC9A 2XB0X 1PSDA 1U28C 4A03A 4QGAA 3RT9A 3O6VA 3NJRA 4L6IA 1O9BA 3EPJA 5FLXZ 5IVDA 3IKMB 2VPYA 1TJ4A 2MJZA 2M8RA 1AF4A 2VPPA 3FNRA 2JFZA 4JC0A 2G82A 2HMSA 4KNYA 4Y6QA 2Q1UA 2ERCA 2MYNA 1F6WA 3C98A 4NG4A 4X0GA 1Q81Q 3M4YA 4J2OA 5CAEB 2UZ1A 3O7WA 5HKKA 2FOXA 1XJCA 4ALJA 4DZOA 4GH5A 4BMXA 1O5OA 4CM4B 3H8JA 3ZK9A 1BE1A 5ED4A 3O4HA 2HFED 4JR2A 4HDSA 2JAUA 3L0PA 3GJ5A 4CU5A 1SQGA 5AW1A 4Q1EA 1J2YA 1B0UA 1V3TA 3WLEA 5NLLA 1JE1A 1UJ6A 3T4UA 2PH3A 2K9SA 3S4RA 2Y1DA 1XDDA 1O77A 3B6ZA 2FH5B 2ZFUA 1L0NK 2O3RA 1W46A 3GDGA 4Q1CA 4B4UA 5FIUA 5MFZA 2V7TA 4B2IA 2FY8A 4BVAA 2FPMA 2SPZA 1I1NA 4M37A 4QUAA 3ZHUA 2ZRMA 4MK4A 4XJTA 2VCYA 4JXZA 4R7GA 3OQPA 2GRAA 1D03A 3JQ9C 4CLDA 4AQDA 3H1CA 2FYUD 1LRLA 1HT1E 1OWPA 1NG7A 2QJYC 1ZNZA 4G5GA 2GFQA 1QMGA 3T3NA 1E18A 1I7DA 1NPDA 4UUVA 1SCUB 1TXGA 2WY2D 2DHQA 5JVDA 1TYEB 2AUMA 3HZJA 1HY3A 2GBFA 4CDRA 1NUPA 3GU3A 2C2KA 2DTDA 2XOKD 1C80A 2ECPA 3QWBA 4V2GA 3N76A 3GYGA 4MYCA 1LWUC 5B30A 4QYIA 2JFHA 2R1TB 2GZDA 4YXWA 4HGPA 4B7UA 1URQD 3FXAA 3ZDEA 4ZVVA 3EDRA 3LUCA 3Q8KA 1US8B 3VM6A 2LSOA 2E75D 1STOA 1ZH0A 2BFCB 4IXDA 4XASA 5AW0B 2P41A 2QVOA 5KIAA 4NCKA 4OH1A 5B3LA 1SQVK 2E9SA 3E5QA 5GTHC 4LFBB 2W6IA 5KLIB 3U56A 5APVA 1N5JA 2ZK7A 2IXSA 1AS0A 5LIRA 2FOKA 2YIDA 3M6XA 3G2BA 1HVVA 1A9PA 1CJSA 1YD7A 1CZLA 3TLBA 4TUYA 4IOIH 4ERXA 4B79A 1VQPP 1XCGB 2MU1A 5CCBA 4YHHB 2P2LA 3PHLA 4FC6A 3H5OA 1G8AA 5U1PA 1L8AA 1BSNA 4RKWA 3VC1A 3MMPA 1NJ5A 4ARZA 4N18A 3OBBA 3EASA 3CVXA 1IM5A 4IOJA 1UDBA 4UNRA 2DT5A 5HF6A 3RG2A 1QHYA 5I9LA 2ANBA 4YFYA 4ND6A 2NOAA 3UGTA 3KP3A 2C59A 3G7UA 1MB3A 1E98A 3M1LA 2DW4A 2JSPA 3MWEB 2DQYA 2A06D 3BJEA 1LSSA 3W7BA 3FWEA 1G3TA 2RG1A 3I9V6 1NVEA 1NVFA 4DYVA 5EY5B 3WWEA 3W6NA 2LDBA 2ECBA 1Z2CA 4X90A 4LVOA 1Q1AA 1KI4A 1LF0A 5YASA 4J29A 3TMOA 3W6KB 1E2DA 4BFYA 1RTKA 5DM4A 1P0MA 3E8MA 4LGCA 1NHAA 1SEPA 3SMQA 1SM4A 3I28A 4B1RA 3AV0B 1FJKA 3LXMA 1C3EA 1WEHA 5KTOA 3ECCA 1LTJB 5J2UB 6CHYA 2I2BA 2AUTA 3QMPA 1QPMA 5IHPA 4LMYA 1W4ZA 3HXQA 5DSTA 1YW8A 3LHSA 4COKA 3BR1A 4HXFB 3MCZA 4CLXA 5JO9A 2VDWB 4WNIA 3RU3A 1G8KA 3HUDA 5I47A 4P1ZA 3ZWQA 4TKVB 3O4FA 4IBOA 2XNKA 4NBTA 3PEYA 1KERA 4L9JA 3D5TA 5M3FJ 2XVAA 4R4MA 5D8KB 3EIWA 1U8RA 4HFRA 2QTHA 4ZKPA 5GONB 3AUUA 5TMEA 4RK4A 4FYIA 1WGXA 4J0FA 3CN9A 1EWKA 3E7WA 4BJTA 4GL2A 5ES3A 3UKDA 1JKPC 1H6AA 3C6KA 5WRFA 2NVOA 1QUFA 3PFCA 3TOAA 3WQRA 1W7PB 2OCBA 4U3JA 3HYRA 1ZJ4A 3G5LA 5AIPA 1XSXA 3K20A 3VP9A 4BUCA 3K35A 5ITZA 1ZTRA 1NUUA 1W5BA 2DR0A 2X0DA 1SQBE 1C7FA 2FB9A 2XPCA 2G9ZA 1BWSA 5KKNB 2O7SA 3MQFA 3LW5H 4RCYA 4WOCA 1FYEA 2FYNB 4RAGA 1XQ9A 2V7QD 2HU7A 4KQ6A 1MZBA 5A2QZ 2JAHA 3WFZA 4OBBA 2NPSD 3NXSA 3NEAA 4FS3A 1XG5A 4Z3KA 2FRDC 3C3DA 5JEDA 1QYWA 1NWQA 3QPUA 4QDUA 1JXAA 2RK4A 3FTFA 3E48A 2Q9BA 1NMZA 3O6BB 5JAQA 3B8EA 3D2LA 4D5EA 4KJXA 1N2HA 2IBZE 2BW3B 1ZOOA 3PICA 2NYUA 1W0UA 2P4WA 3K0EA 5D6FA 2JUGA 3RYIA 2LR2A 1G9SA 2K9LA 4QODA 5GAJA 1W76A 2Q4BA 5LQJA 3CCJI 3I9V1 1LPAB 4HV5A 3NRBA 5H8WA 5BV1A 4NP6A 1TM1E 3H97A 1MNQA 1ONNA 2I6GA 3ZOKA 3BXOA 2I65A 3T3EA 4AKTA 3HEAA 3TPFA 4RGBA 3E3LA 3MBOA 1O6BA 3HABA 2X23A 4MI9A 5DDGA 4ABZA 2EX4A 1OI2A 5F23A 2JLYA 4GPEA 5F1RA 1H9BA 2XMBA 1Z7UA 3PNYA 1ZNWA 1JB1A 4IJUA 3PVSA 3VDQA 1FTZA 2FU4A 4UZFA 1DX7A 1RCTE 2XW6A 2VUMJ 4XTCS 3VGPA 2VZ0A 2VZ8A 1MVLA 5H3HA 1CT9A 4AJ1A 3M89A 1BAPA 4LLNA 4NENA 3IAOA 3I9V2 1YZVA 1TUIA 4H0LD 4N0PA 1KQNA 3QMVA 3GCMA 4IX9A 1U7WA 2JLVA 4BY7J 1UL1X 1KI1A 3I23A 2IIPA 2AFRA 4YDHB 3WDLA 3MM4A 5ALXA 1DO2A 1MIHA 1TD9A 1F1ZA 1RJ9A 4MWCA 3ZUPA 1QIEA 2VATA 3VDMA 3TX6A 2XB6A 4XJVA 4FMCF 3Q3VA 4HZFA 1U0BB 1TVEA 1R0XA 1IWPB 3MERA 3Q0VA 1GTWA 2IYEA 3LNTA 2HDHA 1NBMA 2GPSA 4KE8A 3LLMA 3KPYA 5BWMA 1W5TA 4DR2B 2R7NA 1Q2XA 3TQCA 1OXTA 3AF0A 2XROA 3W34A 4Y2QA 2YQ4A 1MO6A 3ENQA 4BHBA 4R1QA 2CXRA 4DNPA 4NULA 2MSNA 3GMSA 2NU8A 1OMOA 1P84E 1XRSB 1RYDA 2PMFA 1AKUA 2A5GA 4F9TA 5AUQA 5BNIA 2P0YA 2YIMA 4TKUA 3QNMA 1Z13A 3EQ2A 4EF6A 2I9PA 2PGJA 1Z7YA 3LKZA 1P2DA 2OXIA 3OZUA 1Z4PX 3G79A 1FZQA 2J9RA 1R1DA 3LCUA 5EIBC 1NY5A 4DG8A 1E7MA 3F2VA 2A9OA 4WADA 3K1YA 3M9HA 2VDPB 1DQPA 5L3FA 2ZVJA 5IYDJ 4EECA 3IB6A 4KREA 4I8DA 4XLZA 1M1JB 1LLFA 4QSMA 3ELUA 1KILC 1A6IA 1D1SA 5A6SA 5LEKA 1KY4A 4BRYA 3AEKA 2JD1A 4O08A 4I55B 3MCVA 3R6SA 2JCSA 1YU6A 2MMCA 2ZXXA 3E9YA 4HX2A 5EJ4A 3LQ2A 2VVTA 5ETJA 3AONB 1N2CA 2JVJA 5EJIA 4TYPA 3NHPA 5L3QA 2YKPA 1EGQA 4B46A 2EP8A 3DEUA 4Q47A 2WOOA 3P5JA 3JAMK 4MKGA 1UQUA 2JHFA 4QUEA 2QEXI 1MPTA 1V3VA 3UUGA 3I2JA 1II0A 3M1EA 4ZC3A 3KZCA 4WY4C 2QOEA 1UC5B 1WV1A 5L8VA 2Z99A 3PC7A 2D7CA 3KKPA 2W71A 3A3KA 2B9BA 3G2MA 1Q5PA 2JFVA 4IHWA 2MC4A 3VU0A 2V1NA 2JFXA 4WZBE 1UMCA 1KJ8A 1IXKA 2ZJ1A 1T35A 5FA8A 2DQSA 1HPLA 2NXNA 1K88A 5JZBA 4YMGA 1RF0C 5IT9Z 4HCJA 1MX9A 4TVBA 1EJ0A 4G65A 2X6TA 4HX4A 2NACA 1GTMA 2A6TA 1KYXA 2JGDB 1YDEA 3OIVA 5KMGA 2OENG 1BE3D 3HD7C 3JQ8B 2DYSH 2G71A 2OGUA 2VF4X 3IDOA 3IDFA 3CRQA 3UJ8A 1OI3A 3K1PA 3J7ZI 1CIPA 2IYXA 1AFOA 2JFBA 4DLNA 1GGEA 3NH6A 4FW8A 3PEUA 4QQNA 3EUEA 4DUGD 3QF4A 3V4SA 1M1YA 5HGXA 4TLEA 4HV6A 1ZD5A 5KOHB 3FMSA 1HNZB 3K2QA 3ST7A 1SCNE 5F5NA 4OLAA 1Z0IA 3HJNA 2IPXA 3PNBA 4AJ4A 3QY0A 2H0QA 4RFSB 5GOTA 1S2NA 3B70A 2A1IA 4ZAGA 1CUHA 1ZN8A 4C4OA 4KPFC 3NMDA 1JPJA 4GE0A 4GD3Q 3RC9A 1GNLA 3CCQI 1OYOA 2BW0A 3UJAA 1FYXA 2WC1A 3CCVI 3HIFA 1VE7A 3FZQA 1QRRA 2CZCA 3REGA 4UQLA 2EATA 1VQ6P 3QPHA 3LW7A 3UAVA 3R8FA 2O4UX 4MPJA 5C1BA 4LG1A 5CP8A 3GZ4A 3IAAA 1NXPA 3W2FA 5KAMA 4OMFG 3V8LA 1COZA 5JRDS 3QPSA 2WWRA 1LGYA 4IGIA 2EJTA 1IHOA 4CKBA 3AETB 1R5SA 2HMAA 1RFGE 3HNOA 1C9NA 4WJKB 2W9XA 2GZ1A 4CCYA 2IFMA 2MDTA 1NN0A 4F3KA 5IJ0B 3UTDA 3JVVA 3LKDA 4BN0A 4EBFA 1FRQA 3GLMA 4N48A 1Y1VJ 5HNHA 2DZDA 2ZJSE 1J06A 4Z6YA 3SQWA 1S5LX 5F04A 4E3ZA 1IJBA 1GGVA 4LNAA 3IVMA 4BWNA 4E5SA 2WD7B 1CNEA 1G8PA 3DMNA 2VQCA 1LJ8A 1QTRA 3H0EA 3VO2A 3NBUA 2N47A 5DS9A 8ATCA 3E6CC 4EKDA 1P2SA 2HH9A 1S6YA 3GLGE 4R2IA 3DPLC 2VDLB 2QT1A 1AXGA 3DD1A 2QZ4A 1YKFA 1DBVO 4K2AA 4X61A 3KTFA 4JVOA 2XDJA 4REMA 1UXHA 4A6EA 1X1TA 2XQGA 2R3CA 1PQPA 4I3GA 5K4HA 3KIOA 3H5IA 4F38A 1YR2A 3FWLA 4E5VA 3GLIE 2OWDA 2V1UA 1QP4A 3AEZA 1MNMC 1MNEA 2VBGA 3KHSA 2WJGA 4L9VA 2VNAA 4E7HA 4XQ0A 2OV8A 4R9RA 4RMNA 1JQBA 5KTNA 3KVVA 1I6LA 1UZUA 4DWJA 4TX1A 3FX2A 5ADWA 3ERMA 1CI6A 3VKHA 1FWZA 1I13A 4D0GA 1JHUA 3OJAB 3KP2A 3O3OB 3P9XA 3FB1A 4L75A 4B6RA 3KZIH 2LY2A 1WZ2A 2QYSA 1I0ZA 3BQZA 2NIPA 5BNTA 2WU1A 3CZMA 4NU8X 1QHFA 1SOVA 4I6JA 2H88C 2Q3MA 5EUMA 4E7SA 3D0OA 3ZMZA 2AN9A 1TMGE 1V8DA 5BU5A 1KBOA 3D0RA 1JYFA 2X7JA 1ULHA 4X54A 3F6SA 2G8YA 1BN5A 1SB8A 2CLDX 1KRHA 1E94E 5E8GA 5E3MA 2QBYB 3EF0A 3TLJA 3EFHA 3ZY4A 5KQGA 4ZDKA 2YRWA 5KLVJ 4F3CA 4RQAA 1T91A 5DHSA 3QWAA 2R7AA 2UUZA 3I4MJ 5FLMJ 3ZDQA 4I2VA 3KC2A 2YNYA 4L8VA 3MKLA 4ZICA 3LZ6A 1SAXA 2VRBA 2JVGA 3ZU4A 2J59M 1N2OA 4UY8I 2EW1A 3QU9A 3P27A 2JGIA 3O8HA 3USES 4OQQA 1G8GA 3CKKA 1L0OC 3SDGA 4XVRA 2WWFA 4OIMA 2R4UA 4DG5A 3IPYA 4Y7DA 3SP1A 2BI4A 5ITSA 1NBOA 3GG9A 4D4MA 3D3JA 3R7NA 3FLEA 3W9SA 1ZKMA 1X77A 4HDMB 1NJSA 1ZRSA 1JKXA 4RA6A 2CXQA 4AY2A 4JJFA 3BWXA 1XYGA 3MPOA 1VA4A 1Q3HA 4E6PA 5BXYA 3U3RA 1UIIA 2RREA 2EDCA 3ZBUA 1AKYA 4KMOA 4M9QA 5KJCA 1T4BA 4B2PA 1GZSA 4EQZA 5BMVF 4UM7A 2ZR9A 4EG8A 3R7BA 2DLDA 3GGDA 4KYWA 1QZ3A 3I5CA 4RKFA 3N2IA 2EBWA 3C3MA 5AH0A 2J5KA 2P2SA 1N6IA 3WJ7A 2OLEA 3ABTA 3STHA 2NP6A 2W0MA 2KMUA 5B5EH 3WMEA 3FCOA 4I7ZB 3Q9NA 4W5OA 4I1IA 2YV3A 2J5PA 3C16C 2HPCB 4UXHA 4WUVA 4RESA 3RS8A 4TYWA 3E7DA 4IDQA 1JY3P 1DBQA 3CS3A 2PMDA 2IJLA 3N6VA 2GCEA 2L5GB 1JZQA 1R64A 1RQ2A 4DV2B 5LRRA 1W5CE 1WV0A 1M1NB 3O4VA 2L18A 1GK6A 3ZDZB 4JLNA 1RI5A 3LX5A 2HI3A 1SQXJ 4RA9B 5FLXK 2PGXA 2PVSA 4LBZA 2Y69H 2VHJA 1I3MA 3WQBA 3ZNQA 2P8JA 2AMLA 3T7RA 3I9JA 3PUIA 3M0DA 2PHZA 5B2ZA 4LB6B 3E5MA 2I8CA 1E9AA 3DHYA 2FRHA 2IPNA 1URPA 3VKGA 3GCZA 1FSHA 4RETA 3QQAA 3O3KA 2P10A 2FRXA 3FNGA 3CB2A 3M6LA 3AR5A 3VNAA 4BO1A 3F9CA 3PXGA 5TQVA 5DNEA 4W97A 2RARA 2JBAB 4Y8VA 2RH0A 3IOYA 4MV6A 3UXEA 2C9YA 3NWJA 4R40A 5T4EA 5EXEA 1NFRA 2C8LA 2QQGA 1RBQA 4DLZA 5JARA 3CB4A 2ZROA 2JEYA 3E05A 5ARCA 3PNQA 1RH5B 3O91A 5DCMB 3KR2A 2QTAA 5EWMA 4DLAA 1QZXA 1Y5IA 4LKRA 3HHPA 4IDGA 1YX5A 3PJDA 2ZTMA 4LC9A 1FOSE 1XMPA 5GINE 2BHLA 1E9RA 4QGHA 1QGKB 4PC7A 3TI7A 2JLQA 2CNDA 4FHEA 6ABPA 1YBHA 3EZ9A 5GAHJ 1D1CA 2XXBA 1TQPA 1TA0A 4GUDA 3CLRC 1A02F 3GRYA 2DTXA 5JZSA 4J03A 3U3KA 5A5GA 3CCEI 2V6CA 2Q45A 5IBPA 1G66A 2MINA 5EIHA 1E7WA 5GPBA 4V03A 1VP9A 2VNHA 2CCJA 3CMMA 3S1AA 3DEIA 4AXXA 4MCHA 1Y3AA 3VPGA 1CC1S 1F0KA 4U7DA 3OZFA 2OGSA 2FYUJ 1T24A 2E5TA 1P60A 4ZCSA 3QG1A 1BKDR 3FN4A 3HYNA 3PJFA 5GGXA 3G6KA 4GIBA 3HKCA 2DPMA 4XE5B 4NXNB 4PLGA 1TUGA 1E3SA 3LC7O 3L2QA 5IX8A 1EDDA 3VR6A 5L4SA 3T3GA 3U1BA 1JF8A 1YRLA 5CLLA 4RB0A 4WCFC 4NLLA 1UJMA 1VP3A 2R7SA 2Y9PB 2CUTA 8OHMA 5CEJA 4ZYGA 3SY8A 4JX6A 2I7DA 5CNMA 3HTXA 1MBJA 1I14A 3CZAA 2HOQA 5T3UA 3D6AA 2O1SA 1Z2NX 4HSTA 4MTEA 2XUGA 1SU7A 4YP1A 4BP1A 2R6DA 4D9IA 3HOYJ 2OQQA 2Q2NA 3FGZA 2NAPA 5E3NA 3PXUA 3CKYA 5AVUB 3OC6A 4JUAA 4GW3A 3D3QA 2CUEA 2BN4A 4F2WA 3U7FB 2I2FA 1WXIA 2VL7A 3R3WA 1L8XA 2ECKA 1JT2A 4C30A 1NTKG 2YRFA 2Y66A 4UBIA 3BF7A 1KSFX 3WIEA 2VTEA 1WW3A 3UT5A 2P5LC 2EKZA 5FXMA 3Q5GA 1CD5A 4GYIA 2EQBA 4AO6A 1G8FA 1L7AA 3S1KA 1FUIA 7YASA 5DEOA 5L4NA 3NWOA 3TYXA 4I3HA 2IIVA 2Z3VA 3V97A 1CR0A 1NVVQ 4Z1MD 2O19A 2J0EA 4LYYA 4FGUA 3H5LA 1CF7B 1ITYA 1GNVA 4ZO4A 5J4VA 2VP5A 2MD5A 1FDUA 2JJYA 1U2GC 1O94D 5L3GA 1UWLA 4DN6A 5K3SA 4UE3S 3WP0A 3VMFA 1R15A 2B30A 1RZ3A 2DSNA 2R62A 3HCFA 5FH9A 4G0MA 1FFXB 5B4TA 3MEXA 3EXEA 3DYBA 1BX3A 5JSKA 3LSTA 1KMIY 2VSFA 2O8EB 5ILVA 2PUWA 2O2SA 4DZPA 2WWVD 4RJLA 5HOEA 3TRDA 4A8PA 2UYOA 3ROKA 1ZNQO 2NTYC 1PWYE 4KVAA 5J3JA 1XNGA 2O4CA 3AOEC 5AM1A 2E1OA 3V4ZA 4JC4A 2Y3IA 4TTAA 1EH7A 2H3HA 4FP9A 1DPFA 3ZOBA 1KMHB 4FCCA 4NC6A 2L4MA 2WTBA 4CVNA 4M9RA 4DLTA 2EBIA 2WKWA 3GUUA 5HDGA 2ZDHA 4R01A 3OIGA 2VBCA 1VE6A 1E20A 3COYA 2JP3A 4Q34A 1A97A 3DBRA 3LMKA 4OAYA 4CUZA 1WG8A 4IJWA 4J6FA 1FZCA 3KXDA 4ACBA 1I94B 3UWPA 3VR2D 4BLRA 4EKIA 1OKRA 5FUQA 1WJCA 1KP3A 3HRIA 1W5AA 1HFJA 1HXDA 3QVKA 3B9BA 4WBSA 2ATXA 1SWVA 4ZHQA 3RAFC 1R6BX 5KAFC 1SKBA 1NPYA 2P0AA 2FPKA 4HR7A 3VWBA 3HTSB 1G6Q1 4JUDX 3N75A 2V4ZA 3TR0A 1NKZB 1R7JA 2Q5IA 1DE0A 3K5BA 4P3PA 1WS6A 3JRNA 4EWLA 1OAKA 2R3SA 1G59A 4A0YA 1Z73A 3U7QB 2EQRA 2FEWB 2I4MA 5CJ0A 1GITA 3W5IA 3OS2A 4L57A 5A2QK 5IS2A 3A1FA 4JU9A 2TS1A 3HDVA 4YJGA 2HY7A 3TK1A 1HGVA 1IRZA 4ZMSA 1ZK1A 5JJ5A 1XVVA 4JN6B 3K8OE 2PX6A 2PQ0A 3G1TA 2KI5A 1KH2A 4XVUA 2VTDA 1X7GA 1Q11A 3DS8A 1ADGA 1U0HC 2OJED 3FBIB 2GBLC 1VG0B 3PRKE 4HVAA 2QUJA 4PBSA 1FEXA 3O83A 5A5EA 1FBQA 4DGQA 2BTQA 4P38A 1SUBA 6LDHA 1BA2A 1FOSF 2CFIA 4LW8A 4E5NA 1KJNA 4BVKA 1FDMA 1UXOA 3L35A 3SJAA 4YIIA 2BL4A 2FFDC 1K0FA 1IRIA 1R5OA 3D64A 1M2NA 1P7CA 4WZBA 3TOVA 5CVVA 3F8MA 5ELLA 1E7QA 4K3UA 3T54A 4F3RA 3FLAA 4R71A 1N73B 3ROTA 3U60B 2CZGA 5C8ZA 3HKBB 4I4CA 1GQSA 3MJHA 1TJNA 5D3KA 3ZLTA 3JW8A 3L2UA 2ZRGA 4G8CA 1VE9A 1ZI8A 3BOSA 4I1OA 4BVHA 5H4HA 2QRPA 1PJ8A 4C7JA 2D1QA 1ZM3A 1ZK2A 3ABQB 5BP7A 1J56A 2E4WA 2Z6VA 4BO9A 2VHWA 3E5UA 4TMYA 1GN8A 3PNKA 2KSJA 2QL5A 2GEVA 1YRYE 2DVMA 5APXA 4YFKF 4JDUA 2ZRHA 4H7HA 1PPJE 3SQXA 5ALIA 1NTRA 2H1SA 3V7UA 1RZ4A 1W59A 5DGXA 2C4TA 2OAGA 3MT9A 4BNTA 3U7IA 1CUEA 5K2MA 4YUAA 5DCLA 2C0CA 1N6KA 5IF3A 3Q5FA 3NETA 4TSKA 1MD0A 3CTPA 3IXQA 1SQVG 3OQHA 2WHPB 3BX1A 2FW9A 3E1GA 1YGYA 3U44B 3GLUA 2VP0A 1HBJA 5FTLA 3HYTA 2HJSA 3U4HA 3MMSA 4TTIA 1X0TA 1LPBB 3NFQA 2ODQA 1EVLA 5DV5A 1WX1A 4FEGA 3VMYA 1E96A 3W6OA 4MQ5A 4XD7D 3QQPA 1LD3A 4FYXA 1P4AA 3GGSA 1V25A 3FWNA 1TYCA 2H1FA 5HJ7A 5C8YB 4MVXA 3BGWA 1OGIA 3EYYA 1DFHA 3DE3X 2AQEA 2IA5A 1AJYA 2A3SA 3QOXA 3FWPA 4RSHA 3FOAA 1KKMA 4V2UA 5DGDA 2NPOA 3CMAP 5JLJA 4P96A 2W2TA 3NEPX 2IUYA 4GDOA 3H0DA 2MKVA 3D4BA 3L82B 3RIMA 3HZRA 4RD1A 2IH5A 1OKKA 3ID6C 2XC7A 3CUQC 3C2BA 2G17A 3INRA 5HQ3B 4CYCA 2P7JA 3UJNA 4NQWB 3FD8A 4HOYA 1WJBA 3R20A 1XQ1A 1BHSA 3HVKA 4BAYA 1LPPA 3DB2A 4AM8A 2UV8A 5FWXB 2GAAA 5TS2A 2J9ZB 2LXNA 2PD3A 4J94A 5JVDF 5BU8B 2V03A 4EB8A 1QGZA 1S8NA 4TTRA 3GLGA 5CCHA 1PAUA 1PR6A 4XLAA 4R3WA 1T15A 2ELHA 4BVLA 4E21A 1FY7A 2WSSA 1DD3A 1LTHR 1O97C 4HTFA 4V1CA 4L5BA 1KJWA 2I33A 4EENA 5C44J 1T4CA 3ROUA 1Q1QA 1XP5A 4ZI7F 1CY8A 5HCNA 2OK8A 5CB4A 1SUEA 3TW8A 1X1BA 1Q83A 1MRNA 5E4TA 4DY4A 4LOKA 4FGKA 4BY9E 4BXLA 4HWGA 3DO5A 1EGMB 5BN4A 3OX4A 1ETQA 4LJKA 2R5ZB 5TRDA 3JTMA 2JHCA 3MW8A 3HGMA 4Q15A 2QUHA 2W2MA 4WBNF 1AQNA 4W7ZA 1DV1A 1XEFA 3FVQA 1Z16A 5CXSA 4KRFA 2DTRA 4TUYF 1MC8A 3TZEA 3GOHA 3SFVA 3G6EP 2C78A 1P7VA 1DBWA 1NRWA 3RQSA 3BQMB 4MVJD 4L3OA 3MPUA 1YB6A 1NF3A 2AX4A 4OJMX 3CH7A 4FU0A 1FS4A 3TS1A 1FDWA 5IT9K 3HU1A 1NBME 3WJAA 4KR9A 4YAKA 3HCBA 3A1CA 4OAZA 3B5JA 1YVUA 4FDUA 2JDIH 1PIXA 3LBAA 2C2XA 2AHRA 5DYGA 3OQMA 5CBNA 4EMTA 2Q1YA 1IJKA 1QU3A 2H4YA 3H7AA 2R97A 1XC7A 1P7ZA 4NATA 4D1QA 1MD9A 1YVPA 4HDQB 2HSEA 2K6GA 1FBSA 1FVXA 1KJJA 1BE3J 3HLYA 1RE4A 5FPSA 1G20E 3EN0A 1CZNA 4QIHA 2VDJA 3JYQA 3S17J 4PWZA 3B4SA 5FKJA 2PXCA 2V7UA 2FZEA 5CM9C 5ARDA 2AMJA 1GUAA 1GKLA 3C2HA 2E2HJ 3OYNA 4BNUA 1CUZA 1EXNA 1EDIA 2DUMA 3H2GA 1JXMA 1Z39A 2DLLA 5ILGA 4RZ3A 2LKSA 5BWOA 1K6YA 2HSZA 5BSTA 1YZLA 3RAGA 2ODEA 1YZUA 4B7AA 1GGMA 4UULA 3OFKA 4YP6A 1V4VA 1YE8A 2X5NA 5G1PA 4E70A 2R44A 4TMZA 1SR8A 1N2CE 3BIXA 4YR7A 5E9AA 1PJ4A 2OTLI 2AE2A 4AZSA 1BI0A 4A0GA 1JR3A 2IPPA 1KHTA 2GM9A 5IY5H 4LJAA 5EE1A 1DT3A 2CH0A 3GF4A 4HQMA 4ZO9A 1NY6A 3MJCA 2BEWB 5FD5A 3ZY3A 4QPDA 1EG2A 5BT8A 1NF8A 4REQB 4GG1A 5B66C 1E1RD 2Y6VA 2QKLB 4W1SA 2PZ8A 5I7HA 5JTUA 2X7HA 1U8CB 3CSDA 1K6XA 3ONDA 2HZBA 3V7WA 1Y8RA 3WFJA 1NTKK 3GA5A 1PHPA 1L4NA 4Z8YA 1LE8A 1S7CA 3UATA 3QLJA 4IUDS 1ETOA 1DDOA 3GLXA 2ZETA 3EXHB 1VBKA 2H1HA 2P0EA 3B8HA 1UMBA 3ITEA 3AEQB 4C4PA 5I48A 3MGGA 4A26A 1X9VA 2DM6A 4AI6A 4AJIA 2YNMC 4K6HA 2DCMA 1MJ5A 4DBLE 3OHPA 2JLCA 3H1HE 4U87A 1ST3A 5CFNA 1Z7BA 2ROQA 1T9GR 4W8HA 4O02B 4FKBA 2AZXA 3EBPA 5A9RA 1NMEA 1BDIA 3A6FA 5JC8A 3ZY5A 3CU5A 2KYRA 4GT1A 3OT4A 4FI3F 4X24A 1M1YE 1OXVA 3EE6A 4NMMA 3R60A 2G1UA 1EWVA 1CUVA 4MI3A 2F3UA 5FRNA 3BCSA 3RRFA 1V26A 1RVV1 4NAVA 3AFOA 4QLBA 2R25B 3HEFA 4P4LA 2BDEA 2P9EA 5HVNA 1U3TA 1FBMA 3QLUA 4LKOA 3M9QA 1Q1EA 4GU5A 5T5QA 4DRYA 2BCEA 3NNNA 1YC5A 3NTUA 3T61A 5GTIC 3N8HA 4M1OA 4OWRB 2ECQA 1XJWA 4RHYA 3CUOA 3WRVA 3PC8C 3LD9A 4WUTA 5B7GA 3B6MA 3N58A 2IBDA 2Z83A 3ONFA 3DZKA 3K9NA 3I9MA 2JA2A 2WJHA 2XKMA 3N8DA 5ALQA 3CC2I 1E5DA 4ZYUA 2CK3A 4WNAA 4LCEA 4JT8A 1W581 4RPCA 4JGIA 5IZCA 1VCHA 3PUFA 1P39A 3FGOA 3I9KA 1U0JA 4ZRNA 4ZTBA 4H6VA 1IV8A 2P2DA 1IZZA 2GN0A 1OCCH 3FAKA 1KA9H 3I2FA 4L28A 4DR6B 4ZOLB 3DOHA 3A6GA 3ANXA 5GY7A 1FVFA 4DCMA 3U6BA 4X84A 3VN0A 3VEPA 4G24A 2WPDD 4MA5A 3UAGA 4PJ0C 1L5RA 3IV7A 2XMZA 3D4PA 5AVXB 1Z88A 1EJBA 3VR4H 1FJXA 1NVMB 1BIAA 1S7EA 1TC2A 4MUYA 4UMVA 5L3ZA 1U7JA 2Q29A 4XUGB 3CG4A 2A57A 4IRIA 1Y34E 4K9OA 5IUKC 1ZM2A 1J09A 4XLEA 2G6TA 2QAGC 2Q21A 3WMRA 1F0PA 4INJA 2Y2ZA 1BE8A 1T2EA 4HQLA 1JVBA 3HXLA 2VA9A 5D5PA 1TA4A 3P0EA 1YWGO 3RJMA 2BHZA 3GMEA 4HB4A 4O4LA 2B61A 2IPOA 1VLQA 4RK6A 3SOPA 4LFUA 3VTPC 4LF6B 2CL0X 4HDRB 1SPXA 3ORFA 3R4YA 2WAQA 3QM1A 3TSOA 2QRXA 1FFYA 5H68A 2HXOA 1YRAA 3QJGA 2GEJA 2OK7A 4KSYA 2F1IA 1GL2A 3SOZA 2QUBA 7REQB 2OFOA 1WI3A 1BGYD 4AAYA 5TF0A 3C5EA 4BY1J 3CCSP 1QHHB 1CTQA 2GF0A 3A28A 1TEXA 2NTJA 3U4CA 5IDYA 1A9XB 2BGRA 2PGNA 4GOFA 4PLHA 5IP9J 3F5FA 4CKXA 1BNCA 1IHUA 3T0GA 1DEHA 2D62A 1NUSA 3DEKA 2NZ8A 2TRSB 1MH4A 3VU8A 1OXKB 4KT6A 2K40A 3BSFA 5F0FA 3ENWA 5LDGA 3QQ5A 3UMVA 1EZVI 3CLTC 3B60A 2G7MC 2UV1A 3GRUA 4O4HB 1PLJA 3OM1A 3EUAA 2FEZA 4KE6A 2OQ2A 5EYPB 3T1OA 3A6DA 3EAFA 2PS9A 2WYVA 1PZNA 4DSAA 1PN3A 4XWWA 2PMKA 4G3XA 3UYLA 4ZI7A 4OUDB 1L5YA 4TKMA 1FXUA 1Z22A 1RF1A 3OL4A 1JIIA 4BP9A 4PQFA 5FROA 1A5ZA 4A2CA 3VQTA 1FC2C 3HJHA 2BGUA 4WX9A 2YJ5A 2B7LA 2C95A 4X93A 3V6LA 3F21A 2HXSA 5AI4A 2FW6A 3AG2H 1TTQB 2EAUA 5AW3B 4AZTA 1X4OA 3TSYA 1MKMA 4WBNA 3VHQA 3PRJA 1A71A 1ZN9A 4GM0A 1NQWA 2KRCA 2AS5F 4JZYA 4FOTA 2FE4A 3OLWA 1N8SA 2ZG6A 2STWA 2YW2A 4Q00A 3JQGA 3E1IA 1Q1ZA 3DL4A 4O5AA 5TGTA 4C05A 2YSRA 2X5OA 1TM4E 3UGKA 4G6QA 5KWVA 3ND5A 2Y77A 4MLDA 3ZQGA 1ERDA 4ZTJA 3GQVA 3TUZC 3ZWKA 3FETA 4Y52J 5ABPA 3J7YJ 4JI6B 3B53X 4B17A 3L71E 2IS4A 1ZSVA 3V8JA 3DSRA 1VL1A 2YVAA 1SK8A 2AG5A 3I2HA 4JB0A 1C9YA 4BQPA 2BF7A 3BWEA 4L0DA 1NI4A 1T4DA 1EFVB 1D1PA 2SBTA 4Z49A 2REBA 3K5WA 4Q9DA 3B6AA 5JE8A 1U3EM 2ZSUA 4GYGA 4IOKA 3FRIA 3FMRA 1RWXA 4PS1A 3KVRA 1KOLA 4RD0A 1NW9B 4OYHA 5LYJB 1U0OC 3RK3D 1NVUQ 4C6TB 2Q8PA 2GYYA 4Q19A 4NE7A 3L6CA 4DCVA 4D9FA 4DQUA 3TJRA 4C5BA 1BC5A 4CM6A 4QUJA 2FR8A 5IJAA 1DC3A 4C4XA 1BDMA 3FZNA 1AHNA 3ZHXA 5H1YA 2LUOA 1PV3A 1G7RA 2B36A 1UFKA 4DLVA 1JI8A 3A0BE 2ZATA 3C9IA 2A0FA 3G9ZA 3PNTA 5D8LB 2ZJYA 3W2AA 5ICMA 1XTUA 3WXBA 1QEXA 3CUSA 4ENJA 1KR2A 1IO4A 4EFDA 4PCAA 4Q9IA 3ZCSA 1P4JA 2B4RO 3OQIB 1FOXA 4NC8A 1A96A 4A91A 3JX9A 1D2HA 3KZXA 2HDCA 2H0RA 4JI8B 3HWWA 3DEJA 4YMSA 1AK2A 3DONA 2Z58A 4QECA 2BMDA 3WTWC 1QO7A 3EVGA 3H1IE 3G13A 4OHMA 1DI0A 4MTLA 2O3FA 3S3MA 2QV7A 1L7RA 4EQQA 3T1BA 4GM1A 3PNVA 2DC1A 2R6HA 2HIMA 4P4SA 4X45A 1RKXA 3LXRA 4ZD6A 3CE9A 5THQA 1H94A 4WERA 4FE7A 2NRAC 2OYRA 4ZVOA 1Y1KE 3E7XA 4J8PA 1ZONA 5K7SA 3JSOA 2NT3A 2QG9A 4TL8A 4OB8A 4B9EA 3NVKI 2WV1A 4ZYHA 2HQBA 4FZVA 1GTSA 3RS9A 3FXKA 3NVDA 3L7MA 1L0LD 3SEQA 1WQ3A 2Q2VA 3BE5A 3H1JG 1K3FA 2IKSA 1PWZA 1QA6A 4JT9A 2QZJA 1L5SA 1P6UA 4R54A 1OXSC 4D3ZA 5J3LA 3TP0A 1PUXA 1QZUA 1WETA 4EG0A 4QDZA 5CFZA 2F55A 5LQSA 1I3CA 3GW6A 2CJWB 2M0BA 1V3QE 1DQNA 4GX0A 2BASA 2NS0A 3A36A 1ZHHA 4NMXB 1FX0A 3KPVA 1XMKA 3H1AA 3FTPA 5BYJA 5L45A 5HCIA 5ITVA 1K9MQ 3ETEA 2DPDA 4MRRA 4OSOA 4URUR 4CQMA 4J4HA 4UFPA 3BERA 3L84A 2DQ4A 2E74B 2BAGA 4ZAZA 3V4WA 3DVLA 4RTSA 2CFRA 1PP9G 2YH2A 5I7SA 4J9VA 3EEOA 2DBYA 2R65A 2AOUA 1U0FA 4BBRJ 4LG3A 2ZB7A 1AZWA 2R7TA 2EFWA 3VSDA 4Z53A 5JSQA 4AC9A 4BIIA 4B85A 3CC7P 1AE1A 3I72A 4EYOA 1ZNXA 3AG3H 4NH0A 3FX3A 1JAIA 1YBMA 2HMWA 3F6OA 1NWCA 3LCMA 3MBKA 2RGNA 3KEQA 2QNRA 3IR6A 1CY7A 1BG6A 3SJUA 3VPSA 3U3DA 1YNOA 4P32A 3AUYA 5BVHB 1GR0A 1HEYA 3RIRA 2OZLA 4F45A 3O1IC 3DE0X 2G08A 1G55A 3S1SA 4LG0A 3HJTA 3LK7A 1YQAA 1FYVA 1LKZA 2AJLI 4M6YA 2IW3A 2ZMEB 3AO0B 4HUQA 1M0WA 2C6YA 3DKIA 1TVKA 1CQIB 1SXIA 2R2AA 1PVOA 2QB5A 3R23A 2HJRA 4EVRA 1HYQA 2G7ZA 4XWYA 3TQRA 1XNHA 1PEKE 4B87A 4IS3A 4UM8B 1R50A 4IKPA 2HTSA 3PO3J 4YRVA 5JYDA 3DXFA 1Y1PA 1ZQ9A 4JXKA 4AXBA 4W99A 5E79H 1DZ3A 2Z56A 2WAAA 1PG2A 5DULA 3OP4A 2QLBA 5FDFA 1LTTC 1QR2A 3VOBA 2RI1A 4CETA 2RHOA 5C8DA 1BVHA 3R3YA 1SD5A 1OX3A 1P2UA 2LREA 3V8QA 2HQ5A 1E6CA 3KEYA 3D7MA 1D0IA 1Q0UA 2ZCVA 4R41A 4MYUA 4PTLA 3JU3A 2V6MA 1Q7RA 1LZLA 4BEHB 1VQ1A 1PS8A 2XTNA 1SFCA 3I34X 4ZJPA 4V0QA 2A0XA 1N8NA 3RAEC 5B1DA 2TYSB 4U3FG 1KVRA 4PY2A 2JAPA 2B8TA 3IL2A 1LTGC 3R2JA 3NWPA 1MGTA 2A05A 4QU0A 3T1TA 4TLCA 4UAVA 2R7VA 2PSSA 2JJ2A 3LQYA 1QVTA 1GGJA 2PP6A 3UXHA 1H8AC 2AFIA 2P9YA 2YW9A 2FW8A 1MORA 4LJ8A 4KISA 2Z6UA 1G20A 4UMFA 3S14J 2OUMA 5EINA 4HBZA 2PMHA 4QQ8A 1FFHA 4LMAA 2WADA 4Q3NA 3U80A 3KYDB 1JIVA 3LWZA 4TQAA 3C6XA 4GX1A 2WBMA 1N5IA 4OP2A 3S29A 1PJ2A 2HK7A 2PM8A 2CMDA 3OHMA 3VU9A 1Q95A 1PK9A 4N4NB 4LBYA 1PFWA 3I2YX 2Q0XA 4YP5A 1BBYA 1FTNA 1R6VA 5IAKA 4OHOA 1Z0ZA 4KR0A 2B9VA 4JJAA 1ETVA 3AK4A 1B8PA 1RNLA 5EUBA 1R36A 3LQKA 3S55A 3QVSA 1JEDA 4C5AA 3GR6A 3KQWA 4FBMA 3ASYA 2FEPA 3MS2A 4RY2A 1S2DA 1L4YA 3QEKA 2XQFA 4YXFA 2BFBB 5SYMA 4K9NA 5LQKA 3OOYA 4EFLA 2YMPA 3SZRA 1MTOA 1XKXA 4D0LB 1O6ZA 1YRNB 3AY7A 4P2BA 5HRAA 3PEFA 5AI5A 4BRUA 2ZPAA 3CR7A 3AEYA 3HCNA 1W47A 4A3KJ 3WB1A 2AHOA 1RS0A 1G21B 5FKOA 4P3OA 2ZRBA 2KQRA 4KFCA 1LVAA 1VF5B 4AYXA 4KQWA 4AY3A 1IFIA 1APBA 2YZKA 1LWNA 5K3FB 5F1JA 4F97A 1WE2A 1KTVA 2JRMA 2EHDA 4XB2A 1W6RA 2NZXA 3EIHA 5J8CA 4NSNA 4ZQIA 2BVMA 5GM2A 1A35A 4TLMB 4TVSA 4XJSA 4RAYA 3HYLA 3BATA 4GI3A 3CNEA 2XXAB 4CM8B 3RE1A 1YC2A 2E5ZA 5C80A 4ZJUA 1NSTA 3BTCA 1XLWA 2ZJ5A 1BXKA 1E3DA 3RYCB 1ULSA 4UEJA 1JEYB 1FSSA 2ZYUX 5AVKA 5C8XA 5JLWA 1TUBB 3ONEA 1L4UA 3KJZA 5IKEA 3ABIA 2ARKA 2G4LA 4UTNA 1ZAYA 2CE2X 3L73D 4ZTZB 2A45H 4B3HA 1DJOA 3RRNA 1FUUA 3P2EA 6YASA 3BJRA 1M1ZA 4O5VA 1FFGA 1ZN5A 3CKLA 2C03A 3D02A 3LBYA 1CJCA 4IIHA 1MABB 4IDCA 1KSJA 1G4HA 1RBZA 5LXTB 3MCAA 3Q1LA 2O8FA 2HODB 1KVUA 4UKDA 4JBNA 1R8YA 2VNJA 1KFEB 4U2KA 1YA6A 4OK6A 3FMFA 4FMBB 4OGWA 1ETXA 3OCZA 1N7SD 4HYTA 1HE2A 3GVCA 5GAEJ 2ZTLA 3IBCA 3PDIB 3COPA 3L74G 4X91A 4U7FA 1QTQA 3WLSA 2FFQA 3DV0A 4E4TA 1SLQA 2ZRJA 4TSFA 2Z5HA 4YIKA 4HNVA 4K0KB 3G8YA 4ASUA 4BHTA 3TIVA 3MEQA 4XYBA 3IQXA 2JWAA 2WFAA 4I6GA 5IPFA 2R7DA 2UUPA 1OQAA 2JHAA 2CPBA 4CMEA 2NTVA 4WV3A 1MDMA 4BB0A 3QU6A 2W6CX 2D5BA 5DKFA 2BKEA 3S1MJ 4V0LA 2GPJA 2QJKB 2OZ6A 4XDHA 3M5WA 4OOIA 2RHRA 2FQQA 4ILKA 1HYEA 2R6R1 4AIJA 4H4DA 4M9XA 2W2OA 1EBBA 3SHWA 2V0NA 2VE9A 4YCBA 2KT0A 4QTTB 1G8JA 4EJSC 1RYNA 2QD1A 1RXCA 1FZTA 2ZJ0A 4HPJB 2DA1A 2XCLA 2AXTC 4JQFA 5HNFA 1VMDA 1V3UA 3S1QJ 1KZ9A 3ODPA 5EZYA 2WHXA 4ER3A 3L0ZA 1UG0A 5DCYA 3O0DA 1FFWA 3CUVA 4MA4A 2ZQZA 1BHQ1 4OFWA 5KJ6A 2OP0A 4ZZ2A 3SJZA 3E22B 1UQTA 3DLAA 3KVOA 2GXUA 4CN9A 3SXJA 1IG0A 4Y33A 3S2WA 1ZRNA 2FN3A 2WHYA 1P9LA 3ZHZA 1CDEA 3RI3A 1CRPA 1RXSA 2C3MA 2NU6B 4UB8E 3IOEA 2ZVOB 3QOYA 1J49A 3OCVA 1DIOB 3HRNA 4YJ3B 4A82A 1TF2A 4LTDA 1IUNA 4WOJA 5JVTA 4B3AA 1OAAA 4A4DA 2PFKA 4J1QA 4H44B 2Q4RA 4IH1A 4UBKA 4YH1A 5IAAA 5TJJA 1JKMA 4UVGA 2X4LA 4RD2A 4TZKA 1H9CA 4UM9B 1KK0A 4ZHQF 3IXLA 1E77A 5ALWA 3H1KE 1RRKA 1EZ4A 4MW0A 2GNPA 1C8KA 1DAHA 5BUZA 1NLYA 5GWXA 1P9QC 2GYUA 2W7TA 4IFEA 4HOBA 2XPUA 4RV4A 3PWTA 3VHXB 3EAGA 3WLLA 1EA5A 1S72P 1AUPA 2XGEA 1ULTA 1E92A 2VBYA 5IT5A 4NZ9A 1MN6A 4U7PB 3Q5SA 3B6JA 1T2UA 1UAGA 4QXRA 1Y8QA 3CSSA 2Y0SA 2B4TO 2ZQYA 1UFOA 3HB0A 4ZODA 3NJ8A 3KT6A 1FYMA 3OZBA 5FNZA 1IBMB 3SLGA 2RHBA 3DYIA 3RWBA 3AKZA 4A5OA 4YS6A 1OZGA 3BFVA 2FVXA 4PJJA 5JCOC 2ZTUA 5B55A 3W5SA 2HFHA 3EA0A 2A45I 4EIJA 3Q9LA 1N2XA 1USVA 5HS7A 2LDUA 3W5UA 3LFTA 3AJ9A 3B1WA 4OKIA 3WKAA 2MSKA 5IYCJ 4IHXA 3CEMA 2GXQA 3G2NA 2Z9OA 1SBQA 4IIYA 3ANNA 1V8OA 3LUDA 1IOLA 4NXMB 4DCSA 4F1JA 4RK1A 1K98A 2B34A 4ZOEA 3W4IA 3F7MA 3CWBG 4QTUB 2G4CA 1TTPB 1X7HA 4R2HA 1DWQA 1OOEA 1E9EA 5IC4A 3FM9A 1XEXB 3K9HA 4HA8A 4F4DA 4JFAA 3UXYA 2DAOA 2JZNA 1WXQA 4AL4A 4G5QA 1GPDG 1APLC 4IFTA 4QZVA 1YIJP 1XLTA 2XOKA 3NXKA 1E3WA 4Y3OA 4ZQBA 1DC4A 2G9QA 3FJ1A 4L9SA 4IRXA 5K0SA 3PFWO 2V1DA 4C9BA 2QMYA 2GKGA 4MVWA 2IZ6A 4MV5A 2YV2A 4JIGA 1AHHA 1URQA 5AKZA 1KZ1A 3EC7A 2OILA 2OYHA 4LGDE 4MB0A 2WV0A 3H2SA 3D81A 3G73A 2BJVA 3HBJA 1S9KE 4GPD1 1CQJB 3DNFA 3B1VA 1OH7A 4LITA 5FR2A 4XOIA 1Z5ZA 4Q4JB 3IKLA 1DIAA 4UCQA 2R7KA 3HP7A 1XFAA 3F5HA 4D9EA 3A3NA 1JR3E 2J3LA 1EXDA 5CFLA 1VHLA 3SKYA 4N8EA 4I6MC 3KE2A 3CLKA 3KP1A 2REQB 1VI2A 5KQRA 4MW2A 4RPHA 3H0CA 4Y99C 1WMSA 1BOBA 3ADPA 1BXRB 2VJ5A 2BOLA 1JHXA