1ZR2A

Structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/dna
molecule keywords TCAGTGTCCGATAATTTAT
publication title Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
pubmed doi rcsb
source organism Escherichia coli
total genus 46
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zr2A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zr2A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zr2A01
5IP6A 2X9DA 4FE4A 4W1UA 2M34A 1FEXA 2MSYA 2ME6A 2KDZA 5C34B 3HBLA 1TWFJ 3I4NJ 1VFCA 2N8GA 1UG2A 2E2JJ 1FIPA 1XS9A 1RKWA 2O7OA 5GPAA 2P81A 1ENHA 2D5VA 1QVTA 3JRHA 5EG0A 1MBJA 5K7HA 4JX5A 2R93J 3GTGJ 1JGGA 1HCRA 3A02A 2L7MP 1G2HA 3GTQJ 1MBKA 2TRTA 3CCYA 5EF6A 5E3NA 4XRMA 2Y9ZA 1HDDC 4AUXA 2Y31A 2LK2A 3ZQGA 2YS9A 5FLMJ 2LP0A 1FJLA 4GFBA 2HI3A 3BTIA 1E3OC 3S16J 2WV1A 1ZK8A 4MO7A 5JLWA 3S1MJ 5IOZA 4MFEA 5E3LA 2MGQA 4B3AA 4M3BA 5M3MJ 3LHFA 1HDPA 2CQQA 2LY9A 1JKQC 2HDDA 3D1NI 2PMZN 5EZHA 4B1RA 1ZTRA 2H8RA 3HGGA 2G0EA 3LSRA 4L5EA 3HDDA 2DTZA 3K7AJ 3BG5A 2YU9J 2LLKA 1I50J 2JA7J 1ZQ3P 4DYQA 4MIMA 2OF7A 4A3MJ 2WB1N 4DZJA 1K61A 4A93J 4W97A 5C31A 2GLOA 1I3QJ 3TP0A 3JRGA 1JUMA 5J1RA 1AKHB 2L7ZA 4XRSA 1TWGJ 4DZPA 2XPWA 2NVXJ 2NVTJ 4DW6A 3UJ3X 1P7IA 1SANA 3E7LA 3BVPA 1IGNA 1YRNA 3BR6A 5F1JA 1LE8B 1MBFA 2DA2A 2XPUA 3IH2A 1X58A 3VPRA 3S2DJ 4MFDA 5J3LA 3NARA 3GTOJ 3H0GJ 4A3DJ 4UUSA 2HYJA 1JJ8C 5BNGA 1TC3C 3IH4A 5E3OA 1U9NA 2Y30A 3WHBA 2AO9A 3M4OJ 1Y1WJ 5EDNA 3GTLJ 3OSGA 3QPLA 2TCTA 2LR8A 4DYRA 5EGOA 1JKOC 4IHXA 5K7FA 3Q0UA 5FLVA 3QQAA 1A6IA 3BR5A 4J19A 5GP9A 1RESA 3JRBA 4D7MA 2LD5A 3BG9A 2L9RA 5FKOA 1S7EA 1JT6A 1RKTA 1PUFA 1B72A 1XC5A 5C32A 2NVYJ 3Q0WA 4QTRA 2OPTA 1JKPC 5IYBJ 4AC0A 3OOUA 3SJMA 1MH3A 5FKMA 4B4CA 5FKKA 2LTPA 3HOXJ 3OSFA 3L1PA 1APLC 1VI0A 1VNDA 5FKNA 1QVUA 2WAQN 3RKQA 1ETYA 1BW6A 4XIDA 1FTTA 2JJ7A 1X2MA 1NK2P 3BQZA 3G1MA 4M6VA 2O9LA 3M3YJ 3PM1A 1WI3A 3HOZJ 1R9TJ 3Q3SA 2JMWA 2XB0X 5C44J 5F0HA 1P7JA 3DEWA 3RZDJ 1T56A 2H1KA 2E2HJ 1IRZA 1MBHA 4RDUA 2KT0A 3ZQHA 4A3FJ 1BA5A 1WH5A 1ETKA 5EEAA 1RPWA 1O4XA 2XB5A 1BJZA 3A03A 4JYKA 3CQZJ 4A3EJ 5C3EJ 3S1RJ 3UKGA 1NTCA 3O8GA 1JKRC 3BR3A 3G1LA 1Z0XA 2HQ5A 1ORKA 2HOAA 3ZQLA 3FKIJ 4LOCA 2O8KA 1B8IB 2X48A 2CUEA 1VF9A 4M3FA 1QPIA 2MHCA 3C2BA 5M5YJ 5IPAA 2XGDA 1T33A 5IOYA 3S14J 3PO2J 2COBA 2QCOA 3WHCA 1AU7A 2Y2ZA 3HB9A 1BL0A 4G12A 1GVDA 4FCYA 3A01B 1AKHA 5FKLA 4Y7NJ 1HLVA 1ETOA 1AHDP 4BQQA 1IJWC 3LSJA 4I6ZA 1A5JA 3ZQIA 3JR9A 1SFOJ 2R5YB 5F27A 2EQRA 2LVSA 5J1YA 4M3DA 2GM4A 1DU0A 1LE8A 2ELKA 1OFCX 3HOVJ 1BW5A 1MSFC 5FJ8J 2E19A 1HF0A 1CQTA 2ME0A 1FIAA 4QIWN 1ZR4A 3HEFA 1GUUA 4A3KJ 1UMQA 1OCPA 2I10A 5IYDJ 2NS8A 2FX0A 3LHKA 1GV5A 4XICA 3MKLA 4IHVA 2JA8J 2IBDA 3S1NJ 2DA5A 1HOMA 3MN2A 5C4XJ 3BR0A 4A69C 3G13A 2DA3A 2DMPA 4D7NA 5DTDA 3TW6A 3GTKJ 2ID3A 2XSDC 3GUVA 1RETA 2FD5A 4V2FA 1F36A 1GV2A 2AHQA 2VKEA 4NDLA 3SFIA 2ZB9A 5IP9J 1YRNB 2QF7A 3LOCA 2JN6A 3HOWJ 3HOYJ 1QRYA 2NOGA 3I4MJ 4CYCB 3PKZA 5M3FJ 5HODA 3RZOJ 4RBOA 4S0HB 5F0FA 3BR1A 4UUSB 5JLXA 1IG7A 5EZGA 1ZR2A 4X6AJ 2CQXA 2L0KA 1GHTA 4M3GA 2M2EA 5IYCJ 4IHWA 3IV5A 2B63J 4FTHA 3TW7A 1DU6A 2DMTA 3BT9A 2K9NA 1IUFA 5DS9A 3JRCA 2R5ZB 1D5YA 4BKXA 1LFUP 2RSLA 3JRFA 3S17J 2HXOA 1OJLA 1JTYA 4XRSG 1Z77A 5IP7J 4A3CJ 2DMNA 3LSGA 2ID6A 3S15J 1I6HJ 2HOSA 2CJJA 2ECBA 1H8AC 2ECCA 2W48A 3HM5A 2DMUA 4M3EA 4DYCA 5GPCA 1W0TA 1MH4A 1PUFB 3GTPJ 2R7ZJ 4A3JJ 4C3IJ 3JRDA 1F43A 4C3JJ 1LFBA 3H3VK 2DA1A 4V2GA 3IH3A 1NK3P 1K83J 1JT0A 1ETWA 3BG3A 4JP0A 3S1QJ 3SDGA 2EZKA 2VKVA 2NVQJ 1ITYA 4D5FA 1WPKA 3OIOA 3RQIA 3JREA 4EEFG 2E1OA 3GBGA 3BR2A 3LNQA 2IAIA 2XGEA 2GM5A 3B6CA 4C2MJ 3BQYA 4FE7A 3S2HJ 1B8IA 5EYRA 3F0CA 1GDTA 3HGYA 2EZLA 2JWTA 1ETQA 4A3LJ 1HX7A 3CMYA 1IC8A 1WH7A 1XG1A 1MBGA 1GT0C 3DCFA 5EG0B 4D5CA 2EZHA 2MW8A 3B6AA 3QPSA 4BY7J 3FK6A 5F0CA 3A01A 2CRGA 2DA7A 3GTJJ 3BTJA 5F08A 5C4JJ 3TEDA 2EBIA 3G1OA 4UUTA 4BBRJ 9ANTA 1U9OA 2R5YA 3HKZN 1ETXA 1TWCJ 3BTCA 2VUMJ 1FTZA 2VPRA 3CDLA 3FISA 4I76A 2M9HA 3ZQFA 3JRIA 2EH3A 1UHSA 1X2NA 1ZGWA 1H88C 1ETVA 2GBYA 3PO3J 1JUPA 2YUSA 1POGA 1U8BA 2Y0SN 4BBSJ 4BY1J 2JA6J 4JX6A 2DMQA 5C35A 3TP3A 3O8HA 1JUSA 2K9SA 1RR7A 2X6OA 2LFBA 2DJNA 2XPVA 4IEJA 4QSHA 2FJ1A 5K7ZA 2CU7A 2R92J 3MVPA 1H89C 2EZIA 4JX4A 1MNMC 1EF4A 2K40A 2XGCA 1MBEA 2M0CA 1TWAJ 1WCMJ 2MG4A 5M5WJ 3ILXA 4Y52J 3GTMJ 1WGXA 3W6VA 3LSPA 4A3GJ 4HNVA 1OCTC 1Y1VJ 4CYCA 4ABZA 2HXIA 2XRLA 3ZQCA 1W0UA 1IDYA 2FQ4A 2HOTA 2E2IJ 2L7FP 2R0QC 2JA5J 2M8GX 1IV6A 2RAEA 1JJ6C 1ZKGA 2DN0A 3NAUA 4AYBN 3ZOBA 2CUFA 2Y9YA 2R5ZA 1U78A 2K9QA 2NS7A 2DA6A 1MSEC 3K2AA 5F04A 2LKXA 2JK3A 1JTXA 2IEKA 4MLOA 4IHYA 1IDZA 1Q1VA 4A3BJ 5EGOB 5J1UA 4XK4A 5M5XJ 4A3IJ 3HOUJ 2VI6A 3JRAA 2DA4A 1TWHJ 4BXXJ 3FIWA 4C3HJ 3BTLA 3Q0VA 4X1EA 1B72B 4FISA 5E3MA 3FK7A
chains in the Genus database with same CATH superfamily
4XH9B 3CH5A 3IUOA 2HQAA 3HL2A 4L9WA 4XBFA 2P8TA 1R5NA 3HBMA 4J07A 4MW0A 4DV6B 4KP7A 1EFAA 5A0VA 4OXXA 2VOOA 2PSDA 2XVMA 3K1YA 4XFJA 2WR8A 2QPTA 3FRHA 3WQQA 1EH8A 4GOEA 3F4LA 5CX4A 3O4HA 2OGZA 2HV9A 1YKGA 4CKBB 4TS9A 1SG9A 1DXQA 3PV0A 3CX6A 2OD9A 4Z5XA 2OR3A 5I6DA 1O08A 1RXVA 3GHGA 1D3AA 2X9NA 3BMXA 4HGQA 1RE4A 3F3SA 3WVNA 3HS3A 1HEIA 2EJCA 1MNQA 2ZQZA 4D6TG 4KVAA 1N73C 1E9VA 4Q0MA 3U7QA 5K3CA 4KQ1A 2JFWA 3B82A 2ZOSA 2RHTA 3L1JA 4EECA 2H7VA 3ZOZA 3LNTA 2VUHB 2C9ZA 1DT5A 5LQAA 1NKVA 1CFJA 5IJ0A 1WKBA 1E3DA 1HBJA 2JEOA 5CDFE 5JAPA 4XX1A 4G01B 3VPFA 2XVYA 3DFMA 1HQDA 2LD5A 2EK5A 3ZGZA 4GXNA 3DZGA 4IIGA 1WXIA 2DFLA 4R9RA 1BTOA 4JIGA 1EXJA 4AG5A 1V35A 3WRXA 3QA3E 1C9JA 4LBZA 5BNIA 4C5BA 3SJMA 1BGYD 4OOFA 3OE4A 1G8FA 4HUTA 2J0VA 1GQRA 4LW8A 1DS6A 1TI7A 1VZ2A 3AE3C 2AMFA 2BELA 1VA5A 2P0YA 4LF4B 2BVMA 1ODKA 4QRHA 1E1NA 1BXZA 5FWYA 1GL2C 5KO2A 4LF9B 4PX5A 5JYEA 1LI7A 2QTVB 3C3EA 1KEEA 1P4WA 1G3RA 3FWKA 4HB3A 5LU8A 4IQGA 4Y8VA 4JC4A 2CUZA 2Z3WA 2V1NA 1TM2A 5AVVB 1T33A 1RMYA 3HFSA 5EZSA 2QTTA 3V34A 3AUJB 3BWVA 2NIPA 3PC8C 1YB4A 2VKDA 2RHDA 4EYSA 5L7WA 1JY3P 4X6YA 1NQVA 1CB0A 3IO5A 1EUCA 5E79E 1C2TA 4FI3C 3G71P 1JY3N 5C8YA 2ZRLA 4U3JB 4WY4C 2HMUA 3W5DA 3FNRA 3C85A 2YN2A 1PFWA 1BMQA 3MNFA 2CXSA 4C7OA 3UJ8A 4DLLA 1KY5A 2GO7A 5DYIA 2BH2A 1G9XA 3DW1X 4HVCA 4UBLA 3BK1A 2XSDC 3KEQA 1GV2A 1J2EA 2WYVA 2R6DA 4LGWA 5LLDA 2WJ4A 4TLEA 1NU8A 2GB4A 5AHWA 1EZ4A 1INLA 1IG7A 2RAPA 4AG3A 4FMCF 3IJEB 4D0NA 5AFSA 3HA2A 3JU3A 3N86A 4YFKF 4UREA 3CF4G 1VI5A 3IURA 3RKYA 1SA0A 1LJUA 2IH4A 4A9AA 2EFHB 2JK1A 2O8NA 2JAQA 3E2PA 3PPWA 4DCNA 5H1YA 1LTSC 3NKLA 5J2UB 1H2AS 3GZ4A 3NH9A 1A2KC 3O3MB 5CXSA 1XNRB 4RCYA 4V0SA 1T91A 1XZCA 3HGQA 3BQYA 4RD6A 3IP6A 5CH5A 3IE2A 4WUTA 3HI4A 1TQPA 3SR4A 2JWTA 1Q2UA 4Q1BA 2JTVA 3OX4A 1H6BA 3FK6A 1WG8A 2VBIA 2QZPA 4WERA 4OREX 3AZQA 4GNKA 3WLFA 1BDBA 1TQ6A 4XLNF 1QVWA 3A7DA 1IRGA 4INJA 3VXKA 1F6BA 3FDIA 1TA4A 5FWDA 2A9OA 1STZA 2FX2A 3TTWA 4DXAA 5LYYA 2ZYTX 3M91A 4N5LA 3G2BA 4MYTA 2GDZA 3FXOA 2X1EA 3IV6A 3U7QB 1XF9A 2FMXA 1S29A 4TMKA 3JATA 2OBFA 2YUTA 4RIIA 1JVNA 3QKUA 3RIXA 2WG0A 5IWAB 3MWLA 5DXAA 1ZRCA 1PGOA 3EZYA 5IJ0B 5CLIA 2JIOA 5F1OA 3SFEC 1W581 3BK7A 1GAQA 4N5MA 3TCKA 1WCIA 2F5EA 5LZ2A 1PX2A 3F7MA 4CM6A 2DFVA 2DA4A 2EV0A 3DCIA 3HR4A 4TS1A 3QEBZ 2CK3D 1A8UA 2PQ2A 2ODEA 3JX9A 4M89A 3C6YA 2ZRIA 5D3MA 3LL4A 2BV3A 1HTLC 1IZ8A 4Z0TA 4YP1A 2LPMA 2QRJA 5GJWC 3IP4B 2PUFA 5E3NA 4I7ZB 2G7MC 3GA7A 1BAPA 4F72A 5ELLA 3WLJA 3NIDB 5FWYB 2PJZA 3ZD7A 4LOIA 2NTVA 2PSHA 4IZHA 3E5UA 2EZ4A 3GJ0A 1SUIA 2PSJA 2EKBA 1KEEB 4INOA 3TTVA 4DSNA 1MDMA 1KO1A 4OQNA 4RB0A 4GR5A 3O4JA 2R7VA 1NVOA 4LDPA 3ZLUA 1YI8A 1WJBA 2EFNA 5TXGA 4D8VA 1W7AA 3Q40A 2Y1KA 1X4PA 4G56A 2O4CA 4IV8A 3I6IA 1U04A 2J6HA 5HE8A 5DGDA 1ADYA 4YCJA 3N97A 2DPLA 3L0YA 1D2RA 1EUCB 4A3DJ 1QO0D 2GNAA 5GONF 3SX4A 5C8YB 2FXMA 5A9RA 1NZJA 3H5AA 1GFSA 2JVKA 4UVAA 3SBDA 4LVUA 4ER7A 5B66E 4RD4A 2WYIA 5E18F 5IP5A 3WQSB 5AHKA 4RPHA 5BRAA 2P9ZA 3C7DB 1G8SA 1SQVE 3OMXA 2A9JA 4LDAA 4LXQA 2WSSA 2NV2B 1QH1A 4HNSA 3C3PA 2PAAA 1AK1A 1Q1BA 3R6WA 4KWHA 1JSCA 5BSVA 2HTFA 5HTKA 2PS1A 2JUGA 1SA0B 1VJRA 1GPDG 2IBZI 4US2R 3JQQA 1VFNA 4RMJA 1PT8A 4MA0A 4NYMR 5KKZC 3EGWA 4WWHA 2QYOA 2P3QA 3OSUA 3RS5A 4ZGWA 2ZK7A 2EX1A 1UBRS 2FW7A 3SJ7A 4BX8A 1D04A 2BVLA 1WMBA 1Y9EA 2H2IA 3H83A 2VPTA 5GM2A 4QOEA 4IXTA 3LIDA 1SXHA 4BUCA 3OIWA 1L3CA 2QCOA 3U3RA 3FDJA 3L49A 4KNYA 4MRMA 1OW3B 4MW5A 1OH8A 1GPBA 2WUFA 4WBAA 2XQGA 5DI3B 1SC1A 1URPA 1OILA 2JAOA 3LMMA 4TGLA 3R3SA 4K9DA 5LWQA 3CS3A 3R6LA 2YYYA 4O02B 2H57A 3ILSA 3UUWA 1LJ8A 2MINA 2OCXA 2D0IA 1ZM2A 3IEMA 3BZUA 1OH5A 5IAOA 3IRUA 2Y92A 3JATB 5EMMA 3F4KA 3UMGA 1W47A 5EIHA 4C0BA 1NX6A 4BFZA 4NU5A 3LUBA 5HWSA 3MAAC 3UA3A 1TMYA 1T10A 2VRSA 3JSXA 4KN9S 3A3OA 1WCIB 3W2FA 3I05A 2J7PA 3NQ41 3ELUA 2AS0A 1EDJA 1VMKA 5IXSA 3KZNA 2UZ4A 5GV8A 4G67A 1KILE 4ZRMA 1A98A 3LSKA 3BHMA 1KDZA 5DISB 2NXEA 2X7JA 1SKUA 4PQRA 3ZE0B 3ABUA 3R09A 4LOKA 1K7XB 3KZOA 3DDHA 4IDHA 4CVNA 3KZCA 2JCGA 1MT3A 3K8YA 5LD2B 2JL1A 3RK3B 3SFDC 5ADHA 2ACVA 1ENOA 4QPQA 2C7BA 5KQLA 3FHLA 4KZKA 1RI1A 3STXA 1M1YB 2RBKA 3SHWA 3F5SA 3AHFA 2PP6A 3F8CA 1PJ3A 4II3A 1ID1A 4RY8A 4LMBA 1KZ1A 4GMHA 5K7ZA 2OCLA 3PIOF 5HFJA 5LB2A 4UHKA 2I2WA 2QGUA 3DE7X 1S9KD 3W79A 1VE1A 1TCBA 5AT1A 2BMEA 4BC0A 2YY5A 1M33A 5CVVA 4WEQA 1R6UA 1Q86Q 5BT8A 3ND8A 1AK9A 3LLUA 4YRPA 2BY4A 3Q5RA 3WYFA 1ZRTD 2JH3A 3IAHA 1F8FA 4OGLA 3ROFA 1ESCA 1ELOA 2UZAA 1P7CA 3EFOA 3EWNA 3MJDA 4FN4A 3W6NA 2IHBA 1CDZA 1TTYA 5IAEA 2G5TA 2C1XA 4DXDA 9LDBA 4PICA 4BFXA 1QH1B 4QXAA 1CZUA 1SUPA 2IPXA 1MX1A 4HF1A 2ZFCA 2IEAA 4BVGA 3PQ2A 2E18A 3UMJA 1DV1A 2ASVA 3NNNA 3H1BA 2VOPA 4L4RA 3FCSB 3MCZA 5K3AA 4ALIA 1O0SA 4Q4HB 2O50A 2XJ4A 1W0CA 5LP1A 1E5TA 1SQQD 2O2YA 4OJKA 3ROTA 5C8XA 3QEKA 1YBMA 2DR3A 4H4DA 1N5OX 1BR4A 1IXCA 1NVXQ 3RFTA 4NC9A 4BQFA 1P18A 2ODWA 4V39A 2JEYA 4MRMB 3IDQA 1KRXA 5E7MA 3PEFA 3VO8A 2I8CA 3ABLH 3W6UA 3LSYA 3DXXA 1L7NA 3OSZA 3TMOA 5E8JA 4UBNA 4AJ2A 2CV0A 3UJ9A 3B3QA 4IGIA 3L7JA 1GL2D 2Q1WA 1RM4A 4PLCA 5K7FA 3IP3A 4JLSA 1OPRA 5CHXA 4G0YA 4N40A 2MINB 4BACA 2AZXA 1S1MA 3NKFA 1SUWA 2ZJ1A 2JJ8A 5HM6A 3TXYA 1T2UA 5ALZA 1FDRA 2VK2A 3D3JA 3IT0A 1E89A 3TD6A 3D6VA 4X92A 4XB1A 5F9HA 5IJZA 2E6UX 1IQRA 3PRKE 3HRHA 3G1MA 2HBZA 2Y0EA 2X6WA 5K0ZA 1T1JA 2Q3FA 3F6VA 3NLLA 3OQHA 1YJ9I 3R7SA 1MBHA 3OLXA 3R5JA 4BCCA 3PDHA 3LQ2A 3HJAA 1VE7A 3R74A 5D6OA 2Q5QA 3HKEA 3VOTA 1VJ1A 3IAUA 4ZMRA 2IZ1A 3P27A 2JGFA 2QTZA 2A7XA 4ZODA 1BDJA 1NLFA 4LNHA 2P6PA 3DC7A 3NBMA 4PZUA 4NMMA 5DTRA 1WETA 3ZLVA 3IULA 3I9V2 3CCEP 1TO2E 5GPBA 2GTIA 1L1EA 5BV7A 1XZPA 5DZSA 1QVRA 1MSFC 1KQSO 1CR4A 3O8OA 3GJQA 3WMFA 1RZRD 5BURA 2FX0A 2B1QA 4EW6A 1WFXA 4YJ2F 1GAWA 2ZS9A 1XMSA 1VE5A 4Z3KA 4EG1A 5ICMA 2VZLA 3IN6A 3GV0A 3ZWNA 5ADUS 3RYRA 1RE3C 4EB8A 1KDYA 5TGDA 3HLTA 2Q9BA 4UMFA 1KQNA 4H0NA 3HB5X 1DMSA 3ZIAA 4IH1A 2GN0A 1KB9E 3ROMA 2GEUA 4MVJD 3ADKA 4UMEA 3B7PA 3CVVA 3GAAA 2ZVOB 2DO7A 1G55A 1A9XB 1ZK4A 2ECKA 3ZGOA 4EO9A 3PFCA 1USWA 2PQMA 3QWHA 1T8UA 3KALA 2FCRA 3EFOB 4Q4CA 4H35A 2JBHA 4C0SA 1BC8C 3PE6A 3G17A 3N1UA 3AUAA 4HXGA 5NLLA 1SXJC 1Z8NA 3OIOA 1VQLP 3OY7A 3MRSA 4FB5A 2OCCH 5JC1A 2JK0A 4EJUA 3KQQA 3RIHA 2VF8A 1VQ6I 1I2BA 2E85A 3PJEA 3RK1A 2B9BA 1PF7E 3GG9A 10MHA 2LBPA 1OV6A 2YS6A 3IT3A 3STWA 3RK3E 4HQ0A 3WMEA 2I8LA 4IJMA 1ZISA 3EDOA 1E79A 5KS2A 1OB2A 1K68A 3VV3A 5KNCH 3JRIA 3II6A 3TGLA 1G60A 3QFFA 2OQVA 2FBHA 3K1MA 2WV7A 4HRIA 3WAKA 3TYYA 4Q9DA 1NU1D 3H9UA 3GLTA 1ZUNB 2LFBA 4L0QA 2Q3LA 2OZKA 2P4HX 3ZCSA 3INRA 4LTNA 3ZJ4A 4Y52J 1I1HA 1KORA 5FF9A 4HB0A 1QTIA 1TECE 3Q8KA 4N41A 4K9MA 1TUIA 1LV7A 1O9GA 2NZJA 3TIXB 3ERED 2JGLA 2WUGA 4LC9A 1MQ8B 4ND8B 1K1EA 4HLXA 1K4SA 3ES9A 4HATA 3W77A 3TQSA 1MKMA 1LF0A 1EIWA 1HJBA 2CNDA 2VEOA 4KK4A 1BGWA 2O14A 1PR9A 4BVBA 2NU6B 1TW2A 2FH5B 2C61A 2X8LA 2XHKA 3TZQA 3PUFA 1D5WA 4WUVA 3WS7A 3ETNA 1I32A 3L8DA 3JSVC 3D5EA 1ZI9A 1QIFA 2LYCA 4DLXA 1RCFA 2XF8A 2WWWA 1RZVA 1H8EA 4GYWA 5KIAA 3WYCA 2AMYA 3RYPA 1U7HA 2R93J 4EY8A 2HU9A 3Q87B 5B36A 5JI3E 1ZK3A 1FUYB 1OGYA 4QODA 3V1LA 5E3LA 2RH0A 1HKHA 4XE5A 2QX9A 3RVDA 3ORSA 2BRUC 2PX5A 2E75B 1WS6A 3W68A 1FFCA 2LCIA 2AXCA 2PSEA 1MX9A 4ER5A 3ZLTA 2VDWB 2DPMA 2OAZA 5IF3A 1C3EA 3NWSA 1XHEA 5HK8A 3UWKA 4R8LA 2CW5A 5BSKA 4MJLA 4YBRA 1P6QA 4ZOLF 4Z49A 2HFKA 2Y8EA 2J3EA 1EWTA 5EHGA 4C08A 2Q29A 2VR1A 3AFHA 1RI3A 3D4OA 3QNUA 4MDHA 3L2QA 4EF6A 1W48A 4B7ZA 3IH4A 5LMUB 1FDMA 1X87A 5EDNA 1TQ4A 5JASA 2OSVA 5TB5A 1BSVA 1IJDB 3H16A 4IOMA 2G06A 1KY2A 4LJ6A 4L9SA 3PIPF 4RK0A 4J1TC 3RYIA 2RDPA 4A23A 4ZDOA 4NBQA 3V2NA 1F3OA 3G9QA 4E32A 5BR7A 4PZ0A 2ZJ6A 4TTTS 4H31A 4ZCQA 2JD1A 4M6VA 1RR6A 5HA5A 4A5SA 2YHSA 2C96A 2G1JA 1R66A 5DLPA 2PMEA 5CB8A 4HWOA 1QDLB 1E2PA 1PKXA 3KSZO 1PIXA 2XKBA 2HLDD 3F21A 3ABSB 2GGSA 1SBQA 5LEKA 2H1VA 4ENRA 4WLVA 3H1HE 4XA4A 3O1HB 1WWKA 5EJ7A 3KZ1E 3C4QA 1Z2DA 1QF9A 2PY6A 4MYDA 1ESMA 3N74A 3S14J 1NL3A 3OIGA 5LEJA 4YY3B 5EI5A 2I2DA 4CR8A 4R8RA 5JISA 4CQMD 3KYCA 3SHTA 3WBJA 1RQVA 3D5LA 4CCLA 1VCMA 3CEMA 4MS1A 2VF2A 4FVTA 5ALGA 1IE3A 3TB4A 3TR6A 2E34A 1MG5A 4A69C 7MHTA 3VFDA 1DAPA 3W5VA 5L7TA 2XKOA 2QGFA 2WJPA 4DHEA 2E48A 4BNZA 1OGJA 5KNLA 1E5XA 5F0FA 5DMXA 2MR5A 1JJVA 4BHCA 1ABEA 4I19A 5KNBH 4M54A 3A6GA 3EFGA 3W7VA 3TEJA 2NYAA 3IUSA 4K81B 4P33A 5AK6A 4P34A 1NV9A 1XLWA 2GYVA 4TL9A 1L5KA 1RYMA 3CWBD 1TTTA 3DNMA 5KTPA 1KZ7B 2HMWA 3DM9B 4L5AA 2VKVA 2J30A 2P10A 1GYQA 1G1JA 4HSGA 1M1JB 3PUKA 5IBCA 5GTDA 1TLTA 5HPYB 4KO4S 2HG5D 3KTOA 2BM0A 3MTUE 1H05A 1XG1A 4DLYA 1DIAA 1W94A 5C4JJ 1JALA 5C1OA 4TN5A 3GU3A 3ZNOA 1OF1A 3WL5A 3N2LA 5FI5A 4XE5B 5ALKA 5JJ5A 1VHQA 3ZBUA 3DQPA 3ER8A 3KDAA 3HA5A 1NVUQ 4BMOB 1WU7A 4JKIA 2AK2A 2WWTA 4W63A 4XCQA 1JDZA 2ZTVA 1IWBB 1LUJB 3R4YA 4Z99A 1LUAA 3O95A 1IEXA 3Q0EA 4MUMA 3C1OA 1YCDA 1ENPA 2LV8A 1LH0A 2X58A 3HK2A 2PA3A 3OTHA 3VSCA 1O7LA 2UZIR 2YRWA 2YC2C 3TMAA 2FQ4A 3W9UA 4GX2A 3DU6A 2WICA 3AHJA 3P19A 2K27A 2V7UA 3O8CA 3MN1A 4ZJPA 3BCCD 4C20A 2E7WA 1E2NA 1Z68A 4OUDA 1QRRA 1EVQA 3NEPX 4IL6C 4UB8H 1P4HA 1T6ZA 3S40A 2AZTA 1R7JA 3LY9A 5REQA 2B7LA 4XQGA 4OB6A 4GC9A 2GXQA 3O1IC 3CUQC 3WC4A 4LRQA 2OVFA 3RS3A 1WJ5A 2GHRA 4HK4A 1GQQA 3OYGA 4R6XA 3H4MA 4FCVA 4HWKA 3UJBA 4EGJA 4LK0F 3ZH9B 4XKCA 2I80A 3RROA 1NBMA 2DLLA 1NJSA 4EA8A 2Z8XA 3CUTA 2BBSA 4TSFD 1KI1A 1U8YA 3A7OA 2JFPA 2REQA 3LVFO 1E3OC 3M9LA 2YTZA 1HPLA 1XYGA 3SXYA 5ITWA 4ZEMA 1S5LC 3LHFA 2B69A 4K26A 4N7BA 4PO8A 3RL0C 2WOJA 5IKOA 2R8XA 2D5BA 3I58A 3E7KA 2WHRA 1A9QA 3CUYA 2Z43A 2WHYA 1MN6A 4NMXB 5APWA 5BPFA 1HM5A 5KLVD 2NADA 5CLJA 1KZHA 5JSQA 2H4XA 1YI0A 3GRVA 3JQ6A 3Q3GE 3KYCB 2Q1TA 3W34A 4GEKA 4MQEA 1KXJA 2DAOA 4UXHA 3KJQA 2P4UA 1L8QA 1VJDA 3IMKA 4LGMA 4DJGA 2CLMB 5DHSA 4O1MA 4MWSA 2QA4P 2D1RA 5HCIA 1ISRA 4Q9NA 1YDEA 1DZ3A 3T7CA 3FPAA 2RKOA 2PL3A 3PQDA 2ORED 3EFHA 4NECA 3WWYA 4A8TA 4UNNA 1TRKA 1W1WA 2OV6A 4YAIA 1AF7A 5E3IA 4WX9A 1DIPA 3LO8A 3QENA 4N0DA 5FKNA 1RS0A 4JLMA 4EEXA 1ETYA 1E60A 5FQOA 2O9LA 4XWKA 2SECE 3L9XA 4BLQA 1GRRA 5F1RA 1DQNA 5DGHA 4KQFA 4YMHA 5AKZA 4Z4FA 1KQFA 1CPYA 2EXXA 1QGED 1QHNA 1VHDA 3RT9A 1YHQI 5AUOB 1TPYA 2WTXA 2YL2A 3HJHA 2VC2B 1ZD1A 3I5MA 4ATNA 4Z6KA 4XM0A 3F8NA 2IBZD 4ZO9A 5BV0A 4EJOA 3H1IE 5J4HA 4J4TA 4H7IA 3IYLW 4FKMA 3AIOA 2GBIA 3GJXC 1B0AA 2FX3A 4LFAB 4ANJA 1SFCC 4KUHA 5ARCA 1AHDP 1RVV1 1QVZA 5CB6A 1H2EA 1HSOA 3H1LJ 2J9ZB 2NVUA 4A2UA 4I8IA 4IL6X 3I4CA 3ZGNA 3CJQB 3LQYA 1Q0ZA 2EG5A 3ZUPA 1T36A 1GJRA 1NF2A 4LJRA 4NQWA 2YWDA 1NASA 2QT0A 1UG0A 4M9ZA 1ZELA 1MP0A 4V02A 1C3VA 1G8XA 1RETA 1O3RA 4MK4A 5E4JA 3FXJA 1Q84A 4MIYA 3ROXA 4CIXA 1QS0B 2CEAA 3C6BA 1T9DA 5DO9A 3BIWA 3PNKA 2GF0A 1H2WA 2GJ4A 2B7EA 3SBEA 4LV5B 4PTZA 1WRJA 5B37A 2PGDA 3TSOA 2JGJA 5DGXA 3JRCA 2AS5F 3L41A 4TKVA 2V3VA 3DF9A 3OBBA 3JRFA 4LHZA 4LZWA 3SWFA 5JRJA 1RHUA 3CLRC 4OUDB 2DSNA 2GNPA 2JFFA 4IJUA 3VPAA 4ZKEA 4IJ5A 1BI3A 1GXQA 5REQB 4LF6B 2RNGA 1TJPB 2X1VA 2GCIA 1S5LX 3SPXA 2OG2A 1OCOH 2X0NA 4PGGA 4GDFA 1KMNA 2OXEA 1IDN1 1Q11A 4HAXA 3H13A 1ILWA 2RC5A 3JQBC 3JREA 3U7FB 1E7QA 1SIUA 3LNQA 2VFAA 4C2MJ 1DFIA 2RKHA 4HDMA 3ZWMA 1ETQA 4H0LC 2Z2KA 3Q7EA 1E9RA 4DGWB 2KW5A 2F6RA 5F0CA 1NW3A 1L4KA 1VA4A 1SCAA 2HVRA 4E2WA 1HO3A 4J7CA 2C2ZA 1UP4A 5IJ9A 3ICQB 1G291 2W2MA 3FNGA 1RHZB 2DFNA 1DT3A 3JQGA 1CLEA 1WMAA 3WNZA 1G5QA 2C54A 2I4NA 4UDXX 3BH0A 4L3WA 5CGQB 1ZNXA 4FMDF 2YFQA 3WWEA 4M0KA 2EFGA 1NTZE 3QV1A 3OFKA 3I39X 3CPSA 3B9PA 1CDDA 3IIIA 2EA2A 5JV5A 3QF7A 1VQ4P 4L51A 1O57A 3RK2B 4MQEB 3JR3A 2QX7A 1T8SA 3KSRA 1ZKGA 2P9YA 2PZKA 1RKQA 2W6QA 4FDTA 2QRUA 3LPDA 1TF7A 2JS7A 3CH6A 4P4GA 2WWVD 4E5PA 4ACAA 1JFTA 3WK9A 4GNRA 2PXXA 1VKOA 4GKBA 3VR6A 2DHRA 4KFCA 4DWVA 3FTPA 3RTGA 2FSGA 4QU0A 4QPDA 3GLIA 4KPUA 2Q49A 4WBSA 4GGGA 4ZCTA 2DRIA 2UXNA 4NC7A 1T3HA 1FBNA 4OYYA 3S2IA 2GA9A 1CR1A 1KQPA 3GTGJ 2NSHA 1YK0A 3MGNA 2MBFA 1WHSB 1WAMA 2OZLA 1VRVA 1UZUA 2BEWA 3P71T 5LNK6 3AIMA 1FJLA 1JF8A 4W1SA 1FT9A 3FTNA 2H1SA 3QRFF 1QR6A 4G81A 3KKPA 2YUIA 1L0BA 2REXB 1NXXA 3IDSA 1PJSA 1SOMA 4UB6H 3S3OA 3RPQA 4YCSA 1I50J 3IEKA 2W98A 1LTTC 5HKKD 1T3UA 5AIQA 1OKKD 4MV3A 4GD3Q 4EM6A 4EYGA 4Z7QB 2OZUA 5LUBA 1KA9H 3P9YA 2XQIA 3DMPA 1P45A 4BNCA 4BQPA 3DDCA 3OCUA 1F0YA 2FU5C 5HLTA 2NVUB 1FZGA 2JZCA 4LMPA 2GBGA 1T36B 1BDHA 3UAVA 1WJGA 1UEJA 1ZSYA 3FVVA 4LJ8A 3EDCA 1XZKA 3R6TA 3GGJA 3UIAA 3Q4GA 3V48A 4FKZA 3TO6A 1PEYA 4IILA 4CMJA 1T8ZA 4PX3A 3NVAA 2HDCA 3EXFA 3DKYA 1PZNA 3WTZA 4UDNA 2V7TA 5ARDA 4DDUA 3H1AA 1OFHA 3UT5A 3PGVA 1S4XA 3UJCA 4TKVB 4AKSA 2VJAA 1JG3A 2XKJE 4LKOA 3AGQA 4CKEB 1WSDA 3KSAC 5LA6B 1EP9A 3B9QA 4IGFA 1VDFA 1GD1O 4L02A 5CA0F 1UJ5A 1E8NA 1NTKG 3RUFA 3R4VA 4IDCA 1Q3HA 4D0GA 1LPQA 5F1PA 5HQTA 4TXHA 1UWCA 3IUEA 2F1KA 1PQWA 2J8ZA 4PM4A 1N8RQ 1I9CA 3TH5A 5CIWA 1KMIZ 2C94A 2KZJA 5DHAA 4E08A 1A36A 4HDMB 4XUCA 1FBTA 5EMHA 3H3ZA 3T8RA 4RKEA 3D4BA 2DBVO 1MMAA 3WP0A 1PL5A 3DZ8A 4RM2A 2JDIH 4QSMA 1KYOE 1QV7A 3V4PB 3F72A 5CGZA 5IJ9B 4L57A 3COYA 5JY6A 3I9NA 4A3KJ 2FSWA 3JQGB 2BY0A 1U2DA 4EMSA 4TLBA 8GPBA 5BVGA 4U8HA 3G13A 2BZ1A 4YRTA 5EKTA 4RJTA 4A2WA 2ZJRF 2DOEA 4ZZ2A 4WADA 4CDNA 4DIKA 1LCIA 5ALIA 4MR9A 4H7DA 2P3SA 2F3PA 3TQHA 4DQ2A 2PLNA 4G86A 4ED9A 3QH4A 5TC4A 4F7ZA 1H2HA 2JAXA 2Y9PB 3I12A 2IITA 5AH0A 3DOHA 1TW3A 3LC0A 2DWOA 2P9JA 1NTRA 1FMFA 2JBWA 2OHXA 2VRWA 4U0KA 3DNPA 1BGYG 1L8LA 1PJLA 1DCMA 1P7YA 1N78A 4QU8A 3GLIB 4KPUB 3UCXA 3EPKA 4EQ6A 3QA9A 3RVNA 1ZP6A 4PGFA 4YAOA 3GHHA 4H3KB 5DW0A 4ODIA 1U5TC 1NBME 1U3VA 3WB1A 1LDDA 5GV7A 3FYDA 1HZZA 1AV1A 4J1SA 2L54A 2OZLB 2VLAA 2UU9B 2BEWB 2WUWE 3AUYA 3OQOA 2VKHA 3DULA 5ERGB 2M8EA 3H5TA 4JXKA 3ERMA 3LD9A 5DI9A 3WRWA 2RHWA 4ERXA 1UBNA 1XWFA 4NU6A 1UMBA 3BGIA 4Z8XA 3F6RA 3ZWOA 4JCOA 4BWFB 1LLQA 4IXDA 2WWYA 3VTKA 4AMBA 3TGNA 2EEPA 5E8RA 2VYVA 2BZ0A 4QASA 1L2TA 1WGXA 4BJ6C 5DDGA 3L3BA 2IPPA 5EE0A 2HXIA 4MR7B 1PR6A 2B0JA 2VUIB 4F55A 1AOYA 3MIIA 4GMGA 3DV0A 1IV6A 4EBBA 1ZOYC 1ULBA 5EXEA 2XTJA 3PTZA 2COMA 3G5AA 2W83A 1LBEA 1Z2PX 2P77A 4FONA 4X8MA 1NY6A 4BTLA 3RL0D 2OC9A 1E6KA 4B85A 3DAFA 4LY6A 3EXFB 4TXNA 3FKJA 521PA 1W1WE 2YOHA 3D54D 2WM3A 1CY1A 2JJMA 5AUQA 1GSHA 3WU2H 3NHJA 5D5HA 1T0JB 1ISFA 2FWAA 3UT5B 2RMKA 1GPLA 1PP9J 5JS2A 3PHCA 2GK6A 2FLVA 1FZAA 5K3EA 1VDZA 3E2IA 5FLMJ 2LP0A 3BHJA 5BW5A 4LRWA 2O7RA 1T5SA 1YQDA 3GAMA 4YI3A 3OIYA 1OVMA 2CXRA 4E0BA 1B41A 4BNTA 2ISZA 1Q5PA 5EXSA 1JKQC 4UVEA 3IAS1 4E6PA 1IAQA 5THQA 2ZTUA 2JWDA 2R6GA 3N4MA 5KOIA 1HQYE 3KQPA 1HH4A 2UUPA 1HDEA 1F60A 1Y6GA 3DXJF 1M1NA 1K61A 5DRTA 2DBRA 2GD0A 4R01A 1XVVA 3N07A 4GKVA 4FFDA 1SKMA 2BI4A 3AIIA 3VR0A 2H3EA 4C89A 3R3YA 1JI8A 1CW2B 2H5JA 4P82A 4ZT4A 3B02A 3B6EA 2ZM5A 1HXDA 2RB5A 4TZ0A 2R1VB 4RGSA 3UHJA 5KUTA 1ZVMA 2OTJP 3VZSA 4JX9A 1XJCA 5B53A 1ZJJA 3WFIA 4BXLA 1S7EA 4B1FA 4CDMA 4JUDX 4RVDA 2HXGA 1JKIA 2WY2D 2AOXA 4D4GA 3CDHA 3AUSA 3KE8A 4PAMA 5JZVA 4MR9B 3UNXA 2BF4A 4UQOA 2V6MA 1X7DA 2PXHA 3WDLA 3D0RA 1A6QA 1ZH6A 4UVIA 3K1TA 4PBTA 1SFCD 2VHJA 2OHOA 1O3SA 4B2PA 1G59A 4PFJA 2D0OB 2P3LA 4H6XA 4U6NA 1KMMA 3GG2A 1BE0A 2A6HF 3DCJA 4GBGA 1XMIA 1QYVA 1UFKA 2Y0CA 2WKQA 4HAVA 4J7AA 4JYKA 1GTZA 1XKLA 4NZZA 4UQPA 2CT8A 3R5TA 1IN5A 2EWMA 4RO0A 5E0OA 4EQ6B 1K3TA 2A78A 4YGYA 1V39A 1QPIA 4AJ1A 3HYTA 2BJWA 1EFVA 1CJBA 1SQPE 4OBXA 3BTOA 2ON6A 4QUJA 4MARA 2WPQA 2ZBRA 1MA3A 2XLBA 3CLRD 3HVKA 4DN6A 4GT1A 3EZ2A 5IVPA 1NAHA 4BJ1A 3MFQA 2ZXFA 1L0LJ 3MD9A 2DODA 1UMBB 1IO2A 4LDZA 1CJUC 1GPWB 1U1EA 1E3HA 2UYQA 1M8JA 4AK9A 1LEAA 1ZO8A 4TOIA 1YVUA 3V3KA 4OI2A 2FRDC 5CVDA 4HAZA 1J5YA 1VPLA 4JJEA 3WE2A 5IP9J 2Z1MA 3VPXA 1POWA 4CGZA 3OX3A 3LPAA 1P5HA 4BBZA 4GPTA 3CCCA 4IOAF 3EVDA 2V0GA 1FP7A 3DV0B 3LIPA 2VP0A 1Z37A 3AI2A 3R9KA 1OXXK 2C2XA 1MBZA 1D4FA 2CK3H 2DETA 3ZWWA 2C77A 1Q7BA 2E4AA 4CIBA 3WMXA 3P7KA 5GGYA 2PO7A 3C7TA 2NTYC 1MGTA 4XOIA 5E7IA 2DQLA 4F38A 2O5VA 2V55B 3L70J 5DCYA 5ENVA 5BV8A 4TYNA 2Y2VA 4UV8A 5LCXA 2W0MA 4KHPB 3GLIE 1KR5A 3SQWA 4CMAA 4HVTA 1KFKB 1QIIA 2HCTA 1GDTA 3GO5A 3RC7A 3OZAA 5JCXA 2H9YA 4LJ4A 3ANSA 3DKXA 3K2QA 2DA7A 3GYHX 3MT0A 3LWFA 3EPJA 2JG3A 1FJGB 4OYHA 1ZMOA 5C18A 1YFLA 3P9PA 5KVQA 5LIPA 1IFMA 3KKNA 3HGTA 3PGLA 1Y4ZA 2JA6J 1YI1A 4BNVA 3BDDA 4AQDA 3AILA 1VQPI 1M74A 4Z7JA 4LYJA 3D2BA 3SP1A 4H44C 4HAYA 1V54H 1CY2A 2Q7OE 1IEWA 3ELBA 1ZJ5A 2C5FA 2HOQA 1FNCA 5IC5A 1U0LA 5JBQA 4M1SA 1PVOA 3QPVA 3DWGA 3PVCA 3PTAA 1ZNYA 4YO8A 2XRLA 1FDTA 4KREA 4PYIA 2LH9A 4ER3A 3EXHC 3QMVA 4KL8S 2ONYA 1MC8A 3D02A 3BTVA 3SDSA 2RGCA 1KVSA 4JL8A 1PNTA 2PE5A 5D8LB 1U8ZA 2IEDA 1PS8A 3OOSA 4GU5A 1VQKI 2O9JA 5JSYA 2QEXI 5G0UA 1P2TA 4ND7A 5T3YA 1U81A 3OTIA 1DKOA 1EXIA 1TMKA 1RACA 2ME6A 4LHXA 3A6EA 3VH3A 1IZ1A 1ZMBA 4ACBA 2E2JJ 1FVXA 2GBLA 2PQ0A 5T67A 1WOMA 4Z0HO 1V5IA 4ARBA 4ITRC 2M30A 2JHPA 5YASA 1UH5A 3O91A 3DF7A 4MQ4A 4GOMD 3JASA 4GFBA 1TGYA 4V0OA 4AJ9A 3N8HA 3PFWO 2GSWA 3VMAA 4TLCA 1QHYA 4EIJA 4M3BA 1Z83A 1QOPB 3T95A 1L2PA 4IHKA 2F8SA 1H3FA 2OV4A 2HY7A 3F5FA 1YF3A 2ZT9B 3ESQA 1RQUA 4FFLA 4UAVA 1TQMA 1BIFA 1ORRA 3EETA 2XEXA 3OPYI 4KR3A 1EFVB 4XD2A 5DE3A 4PQEA 4K05A 1SQXJ 1CF4A 3QPWA 3OZTA 4Z7NB 5D84A 3WB2A 3TJMA 3W8NA 1MBFA 1OYOA 4OHPA 2XE6A 3QXCA 5JRZA 4DA4A 2CPBA 2P0EA 2NNYA 3FXQA 1DMRA 1BZYA 1RI4A 3FPSA 3LCRA 1GLGA 4Y2QA 3GF2A 3O4FA 1LBSA 3C3XA 3Q0UA 2JJ2D 3KLOA 2DPGA 2FN7A 1F4PA 1A6IA 1O3QA 1VHWA 3Q2YA 1YW9A 3D6ZA 1GNLA 4BMSA 1PUFA 1GGNA 4IFDK 2ZXHA 3VSKA 1EGHA 2MYUA 2IZZA 3Q8XB 5CB0A 4R8SA 1XU7A 4NPAA 2I2XB 3HKCB 1WXHA 5IUJC 2QV7A 4JNCA 4TVOA 3GBSA 2CDNA 5JZBA 2YV1A 1Z73A 1VGRA 1O94D 1PZMA 2HX1A 1KILB 3W8RA 5J8FA 1YWGO 3ZQHA 1TQ2A 2B88A 4DB4A 1PWHA 1TA9A 3SDBA 1MO5A 1Q83A 4IHQA 2R751 4JNKA 2C9LY 1NDUA 2JLZA 5BWLA 5KK1A 2PMKA 1PYOA 4ENJA 2JAPA 4EPWA 1C8KA 5EMLA 4C5AA 3ADOA 4B84A 4CW7A 5F35A 3H86A 5J63A 3EIEA 1TDJA 2RGXA 4GSKA 4J3FA 1SQQG 3E9NA 3L7DA 3FUUA 1BOBA 3GHGB 3GDHA 4AWAA 3EPLA 1TYZA 4BP1A 4F96A 1PCXA 3F49S 4YRQA 1T2EA 1U9JA 3MN2A 1QGDA 3VU1A 3BJEA 3PCTA 4NPCA 5J4VA 2MC4A 3WO0A 1VIVA 3OWOA 1X1PA 1QM5A 3R3ZA 3B78A 4MW9A 2ZIWB 4WFKA 2UYOA 1IZ7A 4GQBA 5CFOA 3CNEA 3JCUC 1QORA 2QSGX 4D56A 2WT9A 1Z34A 1T5HX 4ZQCB 3EASA 1MO6A 2VSNA 2C2YA 3ICCA 2C97A 1LNZA 1Z5GA 4RTPA 3S17J 3PRHA 1XWIA 3V33A 5ALXA 1B1AA 3U4AA 5IEJA 3C7KA 1XGMA 4X7BA 3EQ6A 3C3CA 4LZAA 3GJ5A 4ETMA 2HBRA 2AUNA 4M3EA 3OOYA 5EKUA 1B2LA 3R9WA 3RVSA 1B4AA 1VQ8I 2Y1CA 4H4EA 4I5DA 3P9ZA 2AN3A 3D1LA 1CWUA 2ASEA 4RORA 3EXEA 1JE0A 2W42A 3LDUA 4ARSA 4MHGA 4WLFA 4HSEA 2OTLP 4ALMA 3T7EA 3ZH2A 3V55A 2HAEA 3A01A 4I99C 5ESXA 3NUZA 2C9OA 5ENDA 3JASB 2VKTA 3ZU6A 2HWXA 3KB2A 2FN3A 1QKIA 3FXAA 3EXIA 4ITUA 3MWEA 4AIHA 2JFQA 1EUZA 5EJ8A 3TGUE 1FEZA 3GMIA 2WMMA 3MTBA 4JC8A 2X6OA 4NH4A 4WJLA 3V9AA 1YRAA 1TF2A 3E5QA 4OH8B 3K9QO 1Y8RA 4O2AF 5HOOA 2MG4A 2RAUA 3LSPA 5CCEA 2R2AA 1T95A 3HCNA 4V3CA 1RJ9A 5FRDA 2HKIA 3N0RA 4L6AA 1XLVA 4C7OB 2K9QA 2ZJPF 1KGDA 3RVKA 3HU5A 5SYMA 3BXFA 1LTQA 3FRIA 3R5XA 1KI7A 1TU0A 1BR2A 4BH9A 4I3FA 4O4JF 2JJYA 4ZRDA 3WRVA 3ABRB 3FXDA 4DIUA 4EB6A 3PQ3A 4FNOA 2RI0A 1E2LA 4MVJG 3KJEA 1GO2A 2CO5A 3WU0A 3S1KA 1TCAA 2QN9A 4RPKA 5JNSA 3FNFA 1YACA 4E31A 3CC7I 4Z9XA 3INNA 3EG5A 4AUXA 2PU5A 2P5YA 2GZ2A 2Z83A 1ECGA 3KXIA 4U2FA 1IN8A 2CQQA 4O4IF 3CMEP 2IYUA 2FR0A 3I9JA 5BSWA 5TQJA 6PFKA 4RCVA 3H9GA 4I1SA 2QD3A 2JA7J 3FOFC 1RIOH 2NOAA 3UWSA 3ZK9A 2FFDA 3TX6A 2ZR0A 3ZWBA 2P5KA 1NATA 2JFHA 1J2RA 3E5MA 2DQSA 1YH3A 3UJ3X 4ZP1A 1SANA 1QBJA 2J4FA 1TTPB 3KQUA 1T2KA 2E6KA 5EJ4A 2IOHA 3PPXA 5LR6A 3VBCA 2HO4A 1Z22A 4GDOA 4I6GA 1FSHA 4GVPA 1KFNA 3MCUA 3JD2A 1VZ0A 5K1ZA 2R7DA 4N1AA 2Q9AA 4E7KA 1C0LA 4J19A 2BBYA 2PLYA 1ONBA 2IU3A 1RWPA 1G3TA 4I7HA 4ZVNA 2EX0A 3LSMA 5CU7A 1EYZA 3WFZA 3FHTA 2H8PD 1ZN9A 1SUAA 2O20A 3I9FA 2AX4A 2XF7A 4EHKA 4HX9A 4GOOD 3S3MA 1JKMA 3C1DA 4IFEA 5GAHJ 3R8CA 1U28A 3KKEA 2P8SA 3F5HA 3WOVA 4RGUA 4U2BA 2H88C 2O3TA 3UYKA 5D3MB 1LD3A 2ADOA 1LX7A 4N8SA 1AU9A 3EXEB 3MGGA 1XEWY 4UEWA 4TXJA 4L8GA 4CIYA 3B5NA 2BTQA 1FX7A 1ISJA 3J7YJ 1P9QC 4DLUA 1GG9A 3A01B 3TCNA 2R6FA 2XUDA 1SHTX 3BSSA 3H9JA 3HVRA 5BNZA 1CB7A 1S1CA 4RIFA 2XSZA 3EXIB 2ME0A 2LD4A 5HR5A 3MWEB 1ZL2A 1MDMB 1FYWA 1FU1A 3E4DA 3H1PA 3M89A 2VXCA 1FFBA 1QZUA 1TYDE 3O4GA 2QL6A 1Y8RB 1TNDA 2RHHA 2MMCA 3SFIA 3AP3A 1SELA 4QX6A 4UM9D 1N57A 1RJ9B 1UP6A 3FFTA 5FO0A 3FRJA 1M5TA 1X6VA 4X6AJ 1MKYA 2GPJA 5EZYA 1EHCA 4W9NC 3TW8A 4ZI7F 1DDIA 5AW2A 3MGKA 5C8DA 4JOBA 3RGGA 2XVXA 1DAKA 2PXCA 3UKJA 2PRRA 3ZY3A 4XFDA 2GEBA 4DCJA 4OM8A 5AI6A 4EB6B 2WPRA 3MPOA 5H3CA 4DILA 3PHJA 3PFFA 4H44D 3CCJP 3JQ9A 1G9SA 4TSRA 4NYJR 1JAYA 4OQMA 3AF0A 5M5BA 4PFOA 3NNSA 3G8YA 4P86A 4GM0A 5F08A 2VODA 1UT8A 3V8JA 1QE0A 2DHDA 4KQIA 5EJ2A 2QMUA 2PLFA 3ZQFA 4BFSA 3P0JA 1WXFA 3PO3J 2GBFA 2NPFA 2OO7A 1WQ1R 1Y5RA 4YUXA 2JSPA 1U90A 4HZUA 3DQVC 3BZBA 2KMUA 3C5CA 5BWMA 5ES3A 2FFDB 3A9SA 5LMCA 4DCSA 4QOGA 2X4HA 5LN1A 5LJLA 5JJKA 4YRKA 2YIDA 3FBNB 4FHCA 4ND6A 4M1TA 4KXFB 1SG6A 2MA3A 3VR4H 2FA5A 3I1JA 1XNQB 3OYAA 3FCEA 4GP6A 3HCEA 4BJTA 1UIMA 2VLIA 3AK4A 3F74A 3K6RA 1JEEA 3EC7A 1GA4A 3L36A 1GKUB 2NWQA 3PLRA 1Y5MA 3FIWA 1GYRA 4AW9A 4E7JA 1T13A 1XRRA 3M82A 2G1KA 2JRLA 2MSYA 1LRJA 3K9BA 1JIQA 1FIPA 1C3JA 2DW4A 1STOA 3K5PA 4M8NE 3PQ7A 1B0UA 2EF0A 2L2OA 4QWWA 4FN5A 1DC8A 1PWEA 3FHJA 1TZMA 1SBZA 2JZYA 5CJPA 4G0XA 1DLIA 1GN8A 3VPSA 4DT0A 3QWFA 3HPHA 1LDNA 4I50F 1QHHA 5SY4A 3W7BA 1E5WA 2Q21A 3D1NI 4PUSA 3M1CA 2WIJA 3G2JA 1FMVA 2DTZA 1KZUB 1KK0A 2C5GA 4BO7A 3VTAA 3DFGA 3B5NB 3P2OA 4YP5A 2BTQB 3WYDA 4R4MA 1MNEA 1XN7A 2B2XA 3LLCA 1NZFA 4L9VA 3UY4A 4N4OB 1AQNA 1AXRA 5FCDA 3PWKA 2IYRA 5LQUA 3ABTA 1U1FA 1TC2A 1R5ID 3A1SA 2W1OA 1FOYA 1VL0A 4A0XA 4PC3A 3TSAA 2ZVJA 3MKZA 1XPJA 2B8NA 1BIBA 5B7GA 1HE4A 2OUKA 1V8ZA 1IN7A 3QWAA 1XZLA 4H1WA 2MYPA 3L71E 3PXEA 5D00A 1EFHA 4LQDA 3P2IA 1R8YA 3UWDA 2HU8A 4EPVA 1S8FA 1BX1A 2ACWA 5DBIA 3BCCG 5SYNA 3BEDA 4I55F 1W52X 1UOQA 4IZOA 5EZYB 4PLHA 3I2IA 5F7JA 3TW8B 1AS0A 4NYMQ 2IPNA 2FGJA 5AW2B 4WY5A 1HBXG 4UHFA 1SFUA 5CYPA 3OF3A 5INTA 1EB9A 1XK7A 2JMWA 1X9IA 1S2NA 4R51A 1G4AE 1FOWA 1VQ9I 4J7XA 2AZ4A 2VHXA 3FI0A 4FWIB 5DASA 2RKBA 1RTTA 4QXQA 1EE9A 2YWJA 3GPDG 1JQDA 4L0DA 3WHCA 3WY9A 2YNMC 4I8DA 2W70A 1RABA 1RXCA 2Z57A 3C7CB 1UPAA 2HMTA 1X1EA 3H7AA 3QF4A 5AIAA 4YMTA 1JJAA 3VJLA 3JVIA 3DHVA 3E9RA 1I7QB 2RC4A 2G36A 5AQ1A 1ZNQO 3L01A 4BFUA 3AR6A 2ZSEA 5KLVG 1A76A 4HZUB 4EZBA 1S2OA 3BR0A 2DA3A 1A02J 5TARA 2OO5C 2A84A 1RLTA 3DPLC 2I65A 2R8PA 4XIGS 3IR5A 2ZUBA 1NVVR 4QUIA 2A1TR 2FYNC 4RPIA 3DMFA 4D3XA 4POOA 3C39A 1PFYA 3IAAA 4EHIA 3ZDXB 4JVOA 2DWQA 3F23A 4X41A 5DP2A 4X97A 3TDZC 1LF5A 4L73A 3OZRA 3O4RA 4XGNA 5AI4A 3CJTA 5FKJA 2ZIVB 1U5BA 2JNWA 3B70A 1V8OA 1PR4A 4WZ6A 2Q3CA 3I5UA 3I54A 1J1EB 4GKGA 3FXMA 4I9GA 3ITDA 4L4YA 2PG3A 1HT2E 1W2GA 3NBKA 3F7NA 3IOEA 3EVTA 1N8NA 3WKDA 221PA 3OE7A 1U3EM 5DLDA 3X2FA 5FBVB 3CBQA 3ESDA 3OO0A 1Q1NA 2DKFA 5KNDH 4AIDA 4NEGA 2LF7A 3M4XA 3OCCA 4DY4A 2FPWA 3Q8WA 5AW3A 3BTJA 4M21A 4O63O 1X3UA 2WAYA 2MSNA 1TM4E 3GP5A 2PGJA 4ZALA 2RJ3A 3NP9A 5L51A 4IFBA 2C7OA 4PPQA 4F4JA 1U8AA 3HKEB 1QHHB 3I8XA 4EG6A 4C0AC 3OIPA 1JG6A 2IBZG 4U87A 1BKSB 4IKFA 5JARA 1CVIA 4ZVPA 4MHOA 1KXZA 1F0PA 2J9FA 3LQQA 1XLTC 2NYRA 2A06E 4ZXPA 3SYRA 3KJIA 3P5JA 2D1YA 1MBEA 1HWTC 2QTGA 5FA5A 4XN0A 2I1VB 1K9MQ 1E6UA 5AHXA 3O8OB 1CF7A 3GEGA 4MWTA 3OLQA 2ELJA 1GKIA 3A25A 5K3BA 2WYOA 3GRUA 4Y99B 5CBOA 1DDNA 2WVAA 3AI1A 1J07A 4XA8A 1GU7A 2WB4A 5GIPE 1R5OA 1DAEA 4IFMA 3S68A 3K1NA 1E3WA 1FNSA 1KO7A 1DU4A 4RPJA 1C14A 1HTTA 3AI7A 1PVDA 3FUCA 2XMBA 1FEXA 2PX3A 1NXSA 5IH3A 3I4NJ 2KDOA 5D4SA 1WPQA 3FETA 5P8WA 2AXQA 2IDKA 1JEJA 3NHUA 1XMVA 3OV8A 2W85A 5A05A 4MTDA 3THRA 1A50B 3DGFC 4HX8A 4HHEA 3DFFA 4L27A 3IPXA 3VNUA 1GRQA 3BC1A 2V6BA 2F55A 1FW6A 2ZYVX 5E95A 4MNTA 3T5MA 3I45A 5ALYA 3IDAA 1TQ8A 3B53X 3WRYC 1E7RA 4G0ZA 4AYWA 2NMVA 4EVRA 2BFOA 1RUNA 5EEHA 3UUGA 3OOHA 1I3QJ 1FBMA 2QG9A 1WA5A 2QYSA 3K72B 4W5WA 4BQAA 3EEQA 4FYMA 1IUOA 2G9VA 1Y7PA 3QF4B 3IH2A 1JDJA 1I3KA 3G0GA 1WB6A 1JB9A 4MWDA 1I27A 3QSYA 4D9IA 3AMVA 3H25A 3IFSA 3V8LA 4Q39A 4YMVA 2CLCX 5GZ6A 4RY0A 4ZV4A 3D6FA 1JFRA 4TLDA 1Y6FA 4W5QA 4ZAVA 3LW8A 2C57A 3HDTA 2LW7A 5C3MA 1ZXGA 4XLAA 1KL7A 2CXHA 4XD7A 1VMAA 4LPKA 2KLHA 4IVPA 3HRUA 5JJIA 5FKMA 4EITA 1ZHOA 4OHZA 5F98A 1PP9D 3FGOA 4HEA2 2E1CA 4YCLA 3ZDCA 1KO8A 1IN4A 1DD3A 1MJHA 3KDPA 3CJTB 1MVNA 2C4WA 1U5BB 1AZSC 3AOEC 2ROQA 1UK8A 2N0SA 1T9BA 2FHPA 4YT2A 1FFWA 1JSZA 3VNBA 2BEVA 2IUUA 1DI0A 2QNBA 5FA8A 1Q90D 1SD5A 4E2ZA 2FXOA 3UG7A 3U4QA 1U1IA 1AA9A 1P29A 1XNHA 4IG4A 1IIRA 3CCVI 5LIRA 3OHPA 2JJQA 1OVRA 2VPPA 1GGVA 4EM0B 4OI1A 1NBEA 3RJ9A 3C2BA 2O7QA 1O95A 3DKVA 4EGYA 2XGDA 4DA7A 3U6KA 3UK6A 4TUYF 5G41A 4DTCA 4XLEA 5AW3B 4YIKA 1QG6A 1HLVA 3B3FA 2CLEB 4XPZA 5CLFA 1DX4A 2AG5A 1E77A 2BKVA 4TVSA 3J81K 4DC1A 4EV0A 4N3YB 4Y98A 4DBZA 4WA7A 5HBGA 4KIUA 3MB8A 3TI9A 1MGPA 4F8YA 2J9FB 2CBGA 2XGGA 3OMYA 3GH1A 1WXGA 1H2BA 4E6EA 3VU3A 1EM6A 1QGZA 1Q2NA 1X1RA 2X22A 2J31A 1KYQA 3PXCX 1GCIA 2Z5LA 4KJMA 1KIMA 2LBFA 2AG6A 3ICVA 3IMEA 2ZTLA 1Q2XA 2A9VA 3L93A 3ZR8X 4YFYA 4LN1A 2B63J 1WRBA 1USUA 1O89A 4LI3X 3PHBE 4MTEA 4OEHA 2QU8A 4I4CA 4BKXA 1KMQA 3U26A 1O4WA 3I73A 3BWXA 3K15A 5I48A 2H52A 4A0GA 3HA3A 1JHQA 3SG0A 2NUPA 5EQJB 2JFXA 1UBCA 2ECBA 2E74C 2R7QA 2BM8A 1DQUA 3R9IA 1WXQA 4MKZA 4NU0A 1E3WB 3RYIB 2DTDA 4QG3A 4HTAA 3AE7C 3RYHA 2E4YA 3DZKA 1PR3A 2R97A 1II0A 4U5XA 1TD9A 1FF9A 2WA2A 3BD7A 1S0UA 1YU6A 2O61A 1SWWA 1R2QA 2ETXA 4CHUA 1GRCA 4RVFA 2PMHA 4C0JA 5BNFA 1TWCJ 1SVSA 3V8VA 2E1PA 1WI9A 1ZRSA 1L0LD 3I6ZA 4MYRA 1DX6A 3MSXA 3TP3A 3Q0TA 2NZUG 1HYGA 5ITVA 5EE9A 4R81A 1ISIA 3LLSA 3P52A 2DKNA 2XCSB 4X62B 4EZIA 4MGHA 3GDOA 2DQ4A 3GTMJ 4QYIA 4CYCA 1NI4A 3DEHA 2ZBKA 2C03A 2CVOA 2D4AA 3A0BE 4M36A 3QE0A 4Q66C 1E8DA 4MS1B 4BLWA 5AVJA 1GW3A 2J3JA 4JP1A 4Q1DA 1RRCA 3UMVA 1GKLA 4TXLA 4B3FX 1R37A 4P98A 4IOKA 4CMCA 3BFVA 4ZOAA 3U3OA 4KO3S 3D2AA 5JNRA 3L70D 2EJBA 2H2AA 3H5VA 1FRVA 1V48A 3RUHA 1Z4KA 5DWVA 1V5EA 2RB4A 3F8WA 3N39C 3Q5SA 4DZRA 4FQ7A 4K7JA 3H1GA 5FWAA 5E3MA 5L8VA 3AECC 1MO3A 3E5NA 4RANA 4ZGBA 4J16C 3AJAA 5DK6A 4TLLB 2NXWA 1RRFA 3NGXA 1NNI1 4NK4A 1JR6A 3I6YA 1UPFA 3U2RA 2P11A 3KDPB 1BOOA 1UINA 2LK2A 4M7WA 1HA3A 1RHMA 4EHJA 4BB0A 4OH1A 2BEVB 2WJJA 4JI5B 4F71A 2LTAA 3Q5EA 2Z6AA 3DNFA 2OYHC 2L17A 3R60A 1NTOA 3SEFA 2H8RA 3CD6I 1JQKA 3HGGA 2PGOA 4HXEB 3DMNA 3H0DA 3BRVB 1DWQA 4YECA 1JQAA 3QVMA 1IO4A 2B87A 4FEAA 4XRFA 3JW8A 4EL5A 3RI4A 1Y33E 4DZPA 4KI0A 3P94A 4FZ5A 5HYVA 5CIQA 3VPRA 1TYCA 1DOAA 1KBQA 3H04A 4M73A 4IM7A 4JJZA 1J0BA 2PL5A 1SUFA 5K05A 4YALA 3TTSA 4HTFA 1KEPA 3L7CA 4EZEA 1M6VA 2OMEA 5FL3A 2PFGA 9LDTA 2NZ8A 1LB2A 3UO8B 3B73A 2LBFB 3DVRX 1MH3A 3C7AA 4KI7A 5JROA 4RLSA 2YNMD 2OB2A 5A4FS 3H65A 2YXNA 4KISA 2A5FA 4B5KA 4O5AA 1YJCA 3WDMA 2NUPB 1LWOA 1QG0A 3R4CA 4K6OA 3DAHA 2BL4A 1KJQA 2OYSA 5AUNB 1IN1A 3E0XA 1LFPA 4D98A 3Q1KA 1L7AA 2R7LA 1NQ5A 3VSAA 3IL2A 3AVQA 3K4MA 2XUIA 2B4KA 4LXIA 4PD4E 4TVKA 1AKWA 5EAIA 4IIBA 3KCNA 2GJKA 1MMDA 2V7QJ 3AYXB 3I3LA 3HC7A 4OGGA 1FL9A 2OORC 4C07A 5A06A 5DXJA 4IL6H 5TR9A 3Q7PA 2CBZA 3V1MA 4PDKA 3STVA 1SQXD 2REQB 1TKAA 2NNLD 2PUEA 4BEBA 3S2SA 1USKA 3I23A 3IRVA 3M6XA 1RNLA 2TMYA 1O1YA 3DL7A 4R83A 1XTPA 2FSIA 4EM1A 1N6NA 2B8EA 3WBKA 2XE7A 4JB2A 2GZHA 2P0AA 3SQMA 4FILA 5AJYA 2NS8A 1UQRA 2NPSC 4WX2B 2JA8J 2XR1A 4UBJA 2XVZA 1OROA 4IOJA 2ID3A 2GK4A 1PL7A 3H8VA 3TTYA 2IYFA 1QRYA 4L3OA 4CYCB 3T5CA 5JE8A 1AG9A 5THXA 1S5LH 1JVSA 1DBWA 2Y68A 2IP4A 1ORHA 4KDFA 2PWAA 2I3DA 2HU7A 1D5YA 4RDHA 4Y9SA 4Y9DA 2W2PA 1C9MA 3ANTA 1ZESA 2IH2A 4MVJP 1ZRHA 4S35A 2IC5A 1E1LA 3A10A 1YZVA 4MQ5A 1I7SB 3GYBA 1L4MA 1SD1A 2I99A 2EZTA 3SQXA 3AEYA 3U3MA 2GZRA 4PLPA 3UMSA 3D6TB 2DMRA 2N1MA 3TOVA 3QYEA 1R4AA 3GFLA 1P72A 1LKXA 2B83A 1KQFB 4JFAA 1JA1A 3EGOA 2H29A 2BFWA 1RZ3A 1E9DA 3MS2A 3FBGA 5DCFA 2IKSA 1BROA 4YRBA 3U60B 4A10A 5FO1A 2DDAA 3U0VA 4CIDA 3WL3A 3O03A 2H16A 4PJ0C 3K4BA 4WOBA 2VUUA 2P2CA 4DAOA 3VTFA 2B87B 4UU1A 3UCFA 1WL8A 3I52A 4FXOA 2CMHA 3AE6C 3IOYA 4E15A 4NZYA 3GLFA 3RJPA 3OT4A 3W2VA 2C6YA 1D1AA 5FRNA 4QAQA 5B5EE 1Z4QA 1RAIA 3J80K 3CO7C 2PFKA 3ZWVA 3ZOBA 1CRPA 4NQWB 4R8VA 4EG3A 2B0CA 4PHTA 5CA1F 5ADWA 3A0HE 3I1FA 2OKCA 4OIFA 3DMHA 5EQFA 5EMKA 3CLSC 1P9NA 2ZR9A 3HUEA 2BMAA 4ENQA 4ETWA 2IGBA 4WCFA 1R0ZA 2OA4A 4FKBA 1QJ4A 4M53A 1Z75A 1YBKA 3OFNA 2R5DA 1YJNI 3LL7A 2CHUA 3LA6A 5JFTA 3JRHA 4WWCA 1UDRA 2N1BA 5JJCA 5KZMB 4UU0A 5K0BA 2WF6A 1ZG1A 2K9JA 4GP9A 3OS2A 2C7RA 4C3VA 4GXQA 3DWIA 4K1XA 3WL7A 4MYUA 4Q48A 1FE6A 1IJFA 3WYBA 1N4DA 2WTNA 3K7AJ 1YRYE 4Z4GA 3REGA 4MIMA 2FYTA 3A32A 4Y17A 1VHLA 1KS2A 1R58A 2JFOA 1NIPA 3DC2A 4GZLA 1WDLA 1NNUA 3E7LA 5AMXA 4LZNA 3WADA 2C8JA 1O94C 2WINI 4X85A 3E15A 5C81A 3N76A 4M83A 1NBOA 1L3LA 3GA0A 1P0CA 2A6EF 2X0JA 3U4IA 3N0XA 1H4QA 3WQHA 4D92A 3FPEA 1R0BA 2R32A 1BE6A 5D3QA 4F85A 3E6MA 2OV1A 3U3DA 3AVYA 2H17A 1OVUA 4Z4EA 1M2NA 1FTYA 1CY0A 5DV9A 4E7OA 4BATA 4ZTBA 1TVEA 1DP4A 1SQBJ 4MLCA 4AMYA 3OVMA 2Z33A 3IAS6 4BVJA 2F5VA 2W22A 1EFTA 3C5WP 2G3AA 1YL7A 5LYJF 1FTTA 1UBJS 1S02A 5EIEA 3C1UA 4A8JC 1P7ZA 1EH6A 1RP7A 2B4AA 1W5BA 4D96A 4CM5A 3RZDJ 3HU1A 4ZAFA 5DCUA 3ND6A 4D9FA 3ADDA 3QBDA 3QXSA 3H5LA 2FA9A 2ENWA 1S2EA 4LBWA 5TMPA 5ESDA 4DUPA 4P83A 1Q0PA 2ZNYA 1Z2EA 1BWQA 3SEAA 1DKPA 3MSCA 2XB9A 4DJAA 1Y5LA 5K99A 2ZDHA 1XEXA 2YRXA 1RWBA 3K4HA 2J59A 5JS8A 1QQTA 2ZJFA 1SK9A 2GJAA 2JCVA 1ZD2P 3TDMA 3PR3A 1QZ3A 3GC6A 4C21A 4H2DA 3CFYA 4OLBA 4OFZA 3M9AA 3KB6A 1MVOA 3FYTA 1NRJB 2E74D 3S6JA 2CE7A 5BW4A 1FJXA 4G65A 4GZMA 4YJDA 5AXAA 1WDKA 3GTKJ 3ZTWA 1RM3A 3TLBA 4WBNF 1FXWF 4QMAA 2VDKB 3HOWJ 2LIPA 4DLAA 5FFMA 1JFSA 6GPBA 4YQYA 2PFSA 2ZATA 1X3SA 3NTXA 3DLHA 5L3ZA 3MYYA 3HKZA 4D4LA 2WU4A 3BE4A 5TSDA 1QQ6A 1HL3A 3W8FA 1G20A 1U2QA 4WK6A 5IP7J 4UUPA 1SH7A 1EFRA 4RIEA 5LQSA 1VQOI 5ES4B 3IA7A 2F4IA 1XSVA 1K83J 1I4TD 3FI9A 4WCFB 1GADO 1OVVA 3M5CA 4LWPA 3B6CA 3X0DA 5AIBA 5EYRA 3RYFA 2OKGA 2VT3A 3MS7A 1CIJA 1KZ6A 2MW8A 2C4KA 1FU8A 1EM8A 2M0BA 3DWEX 2Y1FA 1AVTA 3OZDA 4EENA 1QG2A 2D5IA 4RTRA 4G85A 2GBYA 1ST2A 3PUWA 2YYSA 2GILA 2C9BA 2QBYA 2QTRA 4LTDA 1XZNA 1VXOA 4K3UA 1LTJA 3ZZUA 1SEPA 3I8OA 5C7LO 5B6JA 2HQSA 4ZCSA 2WHQA 2NOJB 3DTNA 2YZKA 2XGCA 4AICA 2AR9A 1LLFA 4PO1A 5EXTA 4M8IA 4DMGA 1W29A 4M7OA 5EIAA 2WAFA 4RVNA 3SJZA 1Y9AA 1XCVA 3K2ZA 3H5IA 1CQWA 2RAEA 1GR0A 3FPJA 3ZI0A 5JDCA 4CQJA 3ROKA 4Q7QA 3S99A 3N75A 3C6XA 3HVJA 2Q6LA 1YVDA 4RY9A 5BVGB 4TTVA 1USTA 4NBLA 2ODAA 2VNAA 4UATA 2QW8A 4P4SA 3N59A 2C3OA 2P4QA 4BN4A 1BC7C 4US0R 5C53B 3LWNA 2QLMA 3ZCPA 2NT4A 4AJJA 3KL2A 4LD5A 1NTKK 3AYZB 2CXTA 1UXGA 5KAIH 5FI1B 3RLFA 3C3BA 1RHRA 2P2LA 3K7EA 1LPAB 1FOSF 1XPXA 1Q12A 2OBLA 2UVDA 4Y9RA 4ZA2A 2NSJA 4M0EA 1DRVA 3E7PA 1JI0A 4WZBA 4K6HA 4A2QA 1WUIS 2OENG 4JK1X 1MRSA 2ATXA 5TDHA 1M8OB 2YS9A 3OPXA 5GTIE 3P2JA 3GDGA 3EGEA 1M1ZA 5JLWA 1Z45A 1HURA 5JDIA 2AI2A 5J5VA 1UFRA 2GKSA 2YXBA 1WABA 3M2PA 3L2OB 2PYIA 3AFMA 3RT1A 1QRTA 2VCYA 1OIVA 1O7JA 2HA2A 4CKXA 2O8BA 3LXRA 1JTEA 1JN0A 1XEXB 3DW3X 1KMHA 4YA6A 1NSFA 1N7LA 3GRYA 3A6PC 4KN4X 3NONA 1V8PA 3QKWA 2WAQA 5CH8A 3BREA 1P7IA 4NICA 2CVQA 5BWCA 2PZGA 4FMCB 4OYRA 3ECAA 3H9CA 1XCBA 1XI2A 2HTJA 3AKCA 5BV2P 1I3LA 4HRAA 1SK8A 2Z2SB 4KFSA 2RGAA 1AT1A 3D2CA 3M70A 1DRJA 1ZY2A 2E71A 1MB4A 2BLLA 3NRVA 2CMFA 2KQRA 1C7IA 1M2GA 3ZX5A 4D4JA 3Q0WA 1P2SA 3HRNA 1I3OA 5HDQA 4V03A 1ANKA 3X1MA 2AW5A 4KPGA 1MIHA 1J0EA 1VG1A 3PH0A 2WC2A 3STTA 4TKMA 2Q1ZB 1BFDA 1LSUA 1G20B 3RRJA 4PRYA 3UANA 3ZBQA 3J7AO 1FDVA 1P9WA 1KH3A 1BHQ1 1Z1DA 4P93A 2IDJA 4PLFA 1HDIA 2NPSD 4D9GA 3SVTA 1M2JA 1R18A 2YFYA 4ZYUA 3K9HA 4ZEVA 2ZB8A 1W35A 2EERA 1B1BA 3BR3A 4WY2A 2KS1A 3RYFB 4I9HA 1NN0A 3K0BA 4E5UA 5I7UA 4R2JA 1EZVI 4NCIA 4N39A 1Q82Q 3DMTC 5DV5A 2PAJA 2X13A 4C6TA 1EM8B 1PZFA 4OAQA 3OIVA 2IZ0A 3IQXA 5JSUA 1CEXA 1VDMA 1P8JA 3ZDAA 3T97A 1T08B 3KUKA 2RH9B 1SULA 1XA0A 4Q3DA 1M1NB 1LTJB 3OS0A 2JIQA 1ADFA 1OQYA 1TLLA 4KQJA 1EK0A 1XBTA 3EBOA 5KYTA 4RGBA 4D4MA 3GLFE 3K94A 4BN5A 4TL7A 4RE6A 1UKVY 4X60A 3OM0A 1UBSB 3D8BA 4F06A 3KCCA 2YZGA 2K9NA 1E1QD 1K9VF 2CMDA 2HZDA 3G0HA 4MB6A 4G89A 4CF3A 2IRFG 4BVKA 4RVOA 3QJYA 4JBWA 4EH1A 2PJPA 5DFAA 1DIOB 1DBIA 3E9MA 3OYDA 3DEYX 1YJWP 3AG6A 1N0HA 4HVAA 1NR7A 2Q28A 5CJ9A 4CWAA 2FOKA 1HDGO 1WD5A 4WXRA 1UJMA 1RAAA 2CV1A 5FYDA 2ZFWA 3PFHA 1MRNA 4R9NA 3ZU3A 4IKOA 2RONA 3CEJA 1M6YA 1E6MA 4PIMA 2VOJA 3HUFA 2EFDB 3TL6A 1DDOA 4LJ7A 4EI9A 3N9IA 2X2OA 2FZCA 2V7PA 3UV3A 5H80A 4D1QA 4JDPA 4M1MA 5CVRA 1SKAA 3GXBA 3JD0A 4X44A 5H2FE 3KP1A 3CLSD 4TWZA 1CRLA 3I55I 2I33A 1B74A 1T9ZA 2O8BB 1ZD5A 4WEOA 3KK0A 3A6DA 3L7OA 1FNBA 1KMHB 3U40A 3NMUF 1KERA 7GPBA 3QITA 4B4OA 2HM7A 2Z4SA 2OE2A 5FLXK 2LDBA 3PHIA 2C0PA 3CPWO 1IBLB 3HRKA 1GZDA 2WIAA 4IWNA 2WVHA 1FVOA 2NZYA 3ETGA 2DN0A 2X4GA 1U78A 3T1VA 4MGIR 4N0BA 1BE3E 3GPLA 5F04A 1QWSA 1KPGA 3LZDA 3GJ6A 1CXZA 4M6XA 3T3IA 3R75A 3PPVA 2EW2A 3ZHRA 4QLCU 3IELA 2FFBA 2GFIA 3ZCQA 1PZXA 2H6BA 1KAOA 5G3YA 2GN2A 4QPPA 4EGCB 3C3AA 1VIAA 3AAFA 2QT1A 4HZIA 3HZHA 3HBLA 5IT9K 3EZGA 2CPSA 5FUVA 2XBLA 2LXNA 2XLCA 4UNSA 4HX7A 3EYAA 1RQLA 1TBXA 3ZE9A 1TNTA 2EJRA 2YMYA 1VQMI 4EJTA 3HTSB 4YIFA 1FFHA 3AR8A 2VEDA 4HG2A 4OJQA 4TM7A 2B3TA 2PNJA 4ZT6A 2Z8ZA 3UFXA 1H4VB 4NHOA 2JIBA 1MW9X 1KVUA 3CX5I 2KS1B 4F11A 4HGRA 1RQ7A 1QK3A 4NE7A 1HEYA 2O0KA 3QWBA 4LRYA 4JBGA 4HWRA 2PRSA 1JEDA 5HUQA 1XGKA 3H1JJ 1E2QA 3TBIA 4M98A 1EXWA 2CL5A 1EJ0A 4LJZF 3K16A 4RK4A 1FYXA 4FX2A 3JQCA 4IZZA 2B9VA 1APBA 3L72J 3T97B 5F2NA 3GT3A 4BUZA 3LHIA 1CYDA 5JAQA 3N8KA 1PJTA 3QUCA 3OSGA 3ROPA 1YTZT 3E3MA 1GT91 4HB4A 1URQD 2FQYA 3RS8A 4BTEA 5IANA 2EATA 4GWKA 4HDRA 4ZK6A 4Q24A 4F2GA 1EWRA 1BXGA 1M6WA 1Z12A 3WLMA 2I4OA 4HPWA 4P81A 1AFOA 2J9XB 2XAUA 3QU6A 4FEYA 5CVUA 1G20E 4N48A 5AJTA 5D87A 4HGYA 4P6VF 4QL3A 3BMCA 3KEFA 3WMGA 1Z0DA 1WUTA 3FMRA 5AW1A 4L15A 1AUVA 4DLSA 4K9QA 1ZDMA 3B6KA 4WVZA 1PLJA 3FKIJ 3PF8A 3MHTA 1I0LA 3RG8A 2LWIA 5JVDF 3KZKA 3G2MA 4JHXA 1C0PA 1OI4A 3D0OA 2QR2A 2ZE5A 3TQRA 1YJ9P 1QVVA 1KPHA 1ZBQA 3K20A 3VA7A 2PZMA 3HD7D 3HOVJ 3AKZA 3MUEA 1KA8A 4I2OA 2RJNA 5K8JB 3MF4A 3PSIA 3WLHA 2PTHA 5EL0A 2ZCUA 2QE6A 3GVAA 1P33A 1HF3A 2P30A 2FD5A 1XMOB 4C7KA 3UTDA 4NJMA 1XAGA 4AN0A 1PT7A 5K3FA 3HADA 1TKRA 2AE2A 4Y30A 4CLOA 1YTLA 5CTAA 1GHTA 4C6HA 4ZQHA 4UY8I 3T7RA 2FFQA 2L01A 5AD1A 1OCEA 4ZXFA 4B3SB 1N3LA 2ID6A 3ESZA 2HLOA 4B9AA 2PKQO 1GGFA 3SY8A 3K4PA 1E3LA 3KLMX 4X0GA 4UPEA 1PUFB 2D2VA 4V2UA 2KZGA 3HWSA 2G82A 4HRXA 4ZARA 4UEKA 3OUZA 3ZWXA 3IJRA 2OK7A 4LF7B 3GEIA 4Y33A 1FZBA 4M3LA 2V6GA 2ZSJA 1ZLLA 4UFPA 3GMSA 2QMQA 4QPCA 3F0CA 3HGYA 2YX1A 2X6XA 1LGYA 4HKZH 4BAYA 4E5SA 3CC2P 3OCJA 1YA4A 1MENA 1ZAKA 2VQGA 1OXTA 3CJRA 3FN4A 1F2VA 2P9TA 2QD4A 3EWAA 2EFQA 2OV8A 1BFUA 1QFZA 2H31A 2Y6VA 1MV5A 1QLJA 4II2A 3IAM2 4YPCA 4BY1J 3I6MA 3UFXB 2IWRA 1BC5A 4IL5A 3ILVA 3IQHX 2IEGA 4EY6A 1U7ZA 2RC6A 2XMRA 2C84A 3LRXA 3IQGX 1R5JA 1OIXA 1TIPA 1NU1G 2MJZA 1H2FA 4W9RA 4YGXB 5A2QK 3USSA 5B3JA 3UHFA 3A31A 1CEQA 2HL6A 4PFKA 1ZK0A 5E9AA 2HNHA 2B1JA 2BBOA 1GUBA 2D2CB 1UAGA 4Q21A 2J9YB 3KYLA 1Z56A 3E9YA 4F4FA 4FLEA 4CMEA 4E5YA 4MUGA 1DKNA 4M55A 5EJMA 1C7FA 4WINA 4MVJH 4HDRB 4QG7A 3NTUA 5SYAA 3GVHA 8ATCA 1NPDA 3SHVA 1BXGB 4XOTA 3WTVC 4M6YA 4DLRA 1SZCA 1WB4A 3JCZA 1XRSB 4PZAA 1W9MA 5IPFA 4R1OA 4YMSA 1V9LA 2DSTA 1HE8B 1XMQB 2PUAA 3UATA 3GFGA 4H18A 2WADA 2D5VA 3JYPA 2YZ2A 1SP4A 2N42A 2XB4A 3EA4A 3ZVMA 3NV9A 1HKQA 1W6RA 1W4AA 4F3KA 2QXYA 2M3AA 2OILA 3GLMA 3KQSA 3JCUH 1DB3A 3VH1A 3MIWA 1SQQK 1HE1C 3V8BA 2I34A 4GG1A 1XVUA 5T4EA 4BRWA 1PUIA 1PV1A 1Y1RA 4P0QB 1G8JA 5C4IA 3ZQ4A 1U7XA 1X38A 2G07A 2H27A 3OZUA 4QEKA 3AFOA 4XJTA 1JGTA 1A7JA 1RTKA 4UOEA 1VPDA 2EAUA 3S2WA 4DCTA 4JZYA 1Q81Q 2O52A 1GZLA 2XYGA 4PPYA 2X9QA 3SOPA 5L3FA 3TPFA 3F47A 5CIYA 4FX0A 1SRRA 2FMTA 3VU8A 3DLIA 3UWPA 3C1TA 3VR1A 1S7CA 3KVVA 2Q2QA 1F2TA 2QRMA 2XGMA 5K3FB 1WULS 4QUEA 3L2RA 2OA0A 2GZ1A 4RH0A 3KZIC 1Y3FE 3W78A 5BR8B 2B89A 2HFED 2OAGA 3RODA 3V4OA 3L7KA 2WWHA 1S6LA 1X2MA 2XNCA 4O1IA 1BDCA 3I0MA 4A1OA 3FCYA 2XBMA 2WNIA 4P7BA 4CLHA 1WCYA 5KWVA 1G5RA 2NXNA 4GE0A 5FEMA 4L22A 3TLAA 4PJMA 4OGQB 4HB1A 1CSEE 1M1KQ 5BR1A 1G4UR 3EZXA 1PYGA 1K6EA 4K9RA 1ISMA 2Z4RA 1S2LA 3KYDA 3KIPA 2WIFA 1T3ZA 4GR4A 2C7QA 4DTIA 3CJRB 3H1LD 3M3DA 1DOZA 1LC0A 3HFJA 1N2EA 3MQ2A 2YN4A 4R7GA 1X8KA 1N2IA 3PGKA 1MH1A 2O06A 1I4EB 2I6FA 3JYLA 1TQIA 1PNVA 3D43A 1OFUA 4PAWA 1XZMA 3S55A 1U0HC 3ZJTA 2BFAA 4XMYA 1HY3A 2I6SA 3NGLA 4RSRA 5KJEA 4OO3A 4B7AA 3WWOA 2LNDA 2OXFA 4KKVA 4IDPA 2F5FA 3VWBA 3ZC3A 3H1CA 4EJ2A 1P9RA 1JM0A 1UOPA 4YXWD 2L02A 2CZGA