1ZR2A

Structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination/dna
molecule keywords TCAGTGTCCGATAATTTAT
total genus 46
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zr2A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zr2A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zr2A01
3A02A 2XPUA 3JRDA 3K2AA 1GHTA 2N8GA 1WPKA 1JT6A 2WAQN 3LHKA 1IRZA 1PUFB 1HDPA 1RKTA 2DJNA 3MN2A 1RKWA 3GTMJ 1BW5A 3A01B 2NVXJ 2VI6A 3FK7A 3A03A 5GP9A 2NVTJ 3GTGJ 3SFIA 1B72B 5GPAA 3I4NJ 1VF9A 1TWFJ 3Q0UA 5EG0A 2D5VA 5C4JJ 4A69C 3OIOA 3M3YJ 3F0CA 3GTLJ 4XICA 3WHCA 4MFDA 5HODA 5K7ZA 3BTLA 3GTJJ 1FIPA 5M5YJ 4L5EA 1JKPC 1MBFA 2XPVA 4B4CA 2DA1A 1A6IA 3GTQJ 2JMWA 2CJJA 2PMZN 2MW8A 2R5ZB 1GT0C 2NOGA 3S17J 5M3MJ 2HQ5A 3HB9A 2ID6A 2DA5A 5FKNA 2FD5A 3G1MA 4CYCA 2QCOA 3TP0A 4CYCB 1W0TA 1FEXA 1A5JA 2EH3A 2R7ZJ 2YU9J 4X1EA 1X2MA 2O7OA 4V2GA 5IP7J 3OSGA 3S14J 1ZQ3P 3O8GA 1H8AC 1JGGA 2DA7A 3UKGA 1Z0XA 4UUTA 1TC3C 5FJ8J 1ETKA 5C4XJ 1I6HJ 3C2BA 3RQIA 3ILXA 2M34A 2LLKA 2OPTA 2DMPA 4C3HJ 5F08A 5EZHA 1HOMA 4X6AJ 4MLOA 3CQZJ 3Q0WA 2MGQA 2HXIA 1JKRC 2XGCA 1E3OC 1IDYA 3S2DJ 4DZJA 9ANTA 1MSEC 1JJ8C 4FISA 4W97A 1LFUP 2M9HA 3RZDJ 3DCFA 2DA3A 1P7JA 4RDUA 4FCYA 4BXXJ 4J19A 4JX5A 4M3FA 4Y52J 1O4XA 1OCTC 1ZKGA 1I50J 3GBGA 3BG5A 4QTRA 1Z77A 1FIAA 2IEKA 2KT0A 1NK3P 1SFOJ 1POGA 1B72A 3BR2A 5C3EJ 1DU0A 2CU7A 1OJLA 3ZQIA 3G13A 3IV5A 2E1OA 2ECBA 2W48A 2Y2ZA 1ETVA 1QVTA 1HF0A 2L7ZA 4BBRJ 2EQRA 4NDLA 2JN6A 2LP0A 2R5ZA 2FX0A 3UJ3X 1YRNA 2XB0X 2DN0A 4BY7J 2LK2A 1JTXA 1ITYA 2EBIA 4DW6A 5M5XJ 1ZGWA 2X9DA 2LD5A 2VUMJ 1R9TJ 5C34B 3B6AA 2M0CA 4IHXA 1MSFC 4D7NA 3IH4A 1QRYA 4V2FA 5M5WJ 2JA6J 3JRAA 3OOUA 2ME6A 1CQTA 2R93J 1ETYA 1X58A 2X48A 3BG9A 1HX7A 1ZR4A 4IEJA 1LE8A 2ID3A 2VPRA 2HYJA 1RR7A 1ETQA 2O8KA 4UUSB 3DEWA 2L0KA 1VFCA 1VI0A 1MH4A 2YUSA 5E3OA 1T56A 1JUMA 2CUFA 5F0CA 5JLWA 1OCPA 2XGEA 4BY1J 2DA2A 3FK6A 4M3EA 5K7HA 5E3NA 5BNGA 2FQ4A 4W1UA 1BL0A 2HOSA 4HNVA 4A3FJ 4DZPA 5DTDA 3LSRA 3NARA 3PO3J 1QVUA 2R5YA 5C44J 4M6VA 3LHFA 2TCTA 1MNMC 2GLOA 1LFBA 4I6ZA 1TWGJ 2DMQA 2IBDA 1K61A 5FKOA 4IHVA 3RZOJ 3TW7A 1IG7A 2GM4A 5F27A 1IJWC 3GTPJ 3GUVA 2QF7A 4FE7A 3VPRA 2TRTA 4XRSG 4IHYA 4A93J 5J1UA 4JX6A 1JTYA 3SJMA 3ZQGA 3JRHA 3BTJA 3PKZA 2NS8A 1JKQC 2DMNA 1TWCJ 3JRBA 1YRNB 2LFBA 2XGDA 2YS9A 4FE4A 4B3AA 3HOYJ 1MH3A 1HDDC 5E3LA 2MSYA 3D1NI 2ME0A 3QPLA 1HCRA 5EDNA 1AKHB 2HI3A 4I76A 1JT0A 1NK2P 3IH2A 2MG4A 1IDZA 1ETWA 4A3MJ 1AHDP 3OSFA 4M3GA 2E2IJ 5J3LA 4A3KJ 1H88C 1SANA 3B6CA 5EZGA 2CQXA 5FLVA 1GVDA 1MBGA 1FTZA 4AUXA 1Y1WJ 1U9NA 1F36A 4A3CJ 3WHBA 2ECCA 2GBYA 3JRCA 4B1RA 1ETXA 4LOCA 3HKZN 1APLC 1WCMJ 3LNQA 5IPAA 3H0GJ 3BR6A 1H89C 1T33A 2R0QC 4C2MJ 1I3QJ 2AO9A 3S1RJ 1U8BA 1Q1VA 3PM1A 3BG3A 2EZIA 3BR5A 3K7AJ 1MBJA 4RBOA 4MIMA 2H8RA 2EZLA 1HLVA 4M3BA 3S2HJ 2K9NA 2I10A 3HM5A 1BA5A 5FKMA 2COBA 3HEFA 1ZTRA 3A01A 2XRLA 2DMTA 3I4MJ 2JWTA 4XRSA 3HGGA 1FJLA 2O9LA 1XG1A 2JJ7A 3BVPA 1XC5A 4G12A 2Y0SN 5C35A 4DYRA 3TEDA 1FTTA 2EZKA 4IHWA 2LKXA 1OFCX 2M2EA 2XSDC 3ZOBA 1F43A 3QPSA 5J1RA 3JR9A 1Y1VJ 2NVQJ 1VNDA 2B63J 1JJ6C 3HDDA 5IP6A 3FKIJ 1RPWA 4C3IJ 3L1PA 3W6VA 3S16J 1B8IB 2HOAA 1U78A 1UMQA 5EG0B 4MFEA 4DYQA 4AC0A 2RAEA 4FTHA 1DU6A 1B8IA 5K7FA 3BQZA 2LR8A 2E2HJ 2WB1N 1WGXA 3FISA 3ZQLA 2AHQA 4JP0A 3O8HA 1WH7A 4AYBN 5C32A 2X6OA 3GTKJ 2M8GX 3LSPA 2NS7A 1WI3A 3BR0A 3M4OJ 1G2HA 3S1NJ 1JUSA 1UHSA 5IYBJ 4A3LJ 5EEAA 1X2NA 4XK4A 4A3IJ 5C31A 4BBSJ 5EYRA 1GUUA 2MHCA 5DS9A 3SDGA 2K40A 2E19A 4QSHA 3TW6A 3S1MJ 1NTCA 3Q0VA 5EF6A 3ZQCA 3GTOJ 4A3JJ 3BR1A 2HDDA 2WV1A 1RETA 2L7MP 3ZQFA 1QPIA 2JA7J 2P81A 2DTZA 4DYCA 4A3BJ 3HGYA 1ENHA 2XB5A 1JUPA 2VKEA 2E2JJ 1IGNA 1P7IA 1EF4A 3CMYA 1MBHA 1RESA 4XIDA 4GFBA 4XRMA 2R92J 3JRGA 5JLXA 5IYDJ 3NAUA 2GM5A 2OF7A 3CCYA 1WH5A 1XS9A 1TWHJ 2EZHA 3FIWA 5IOZA 1PUFA 3LSGA 2DA6A 1BJZA 4QIWN 1GV2A 3S15J 5IP9J 1IC8A 5J1YA 1U9OA 2RSLA 4Y7NJ 4C3JJ 1AKHA 2G0EA 4D7MA 3S1QJ 2CQQA 4A3DJ 3MKLA 5FKLA 2DA4A 4JX4A 4ABZA 1TWAJ 2Y9YA 3MVPA 5F04A 2CRGA 2Y30A 3ZQHA 1JKOC 1UG2A 3BTCA 2KDZA 4A3EJ 5M3FJ 1ORKA 2CUEA 1BW6A 3CDLA 2HXOA 5IYCJ 1K83J 5FKKA 2K9SA 3BR3A 1AU7A 1GV5A 3H3VK 1ZK8A 1W0UA 5IOYA 4S0HB 1ETOA 2K9QA 2LY9A 3BTIA 3G1LA 3QQAA 4BKXA 2JA5J 1MBKA 4MO7A 3E7LA 3HOUJ 1IUFA 3JREA 1S7EA 2NVYJ 3JRIA 5EGOA 2VKVA 1IV6A 1GDTA 3HBLA 2HOTA 3G1OA 5EGOB 2IAIA 2FJ1A 3Q3SA 1ZR2A 4JYKA 3LOCA 4M3DA 2L7FP 1MBEA 2JK3A 2L9RA 2LTPA 4D5FA 3LSJA 4EEFG 4UUSA 2R5YB 3HOWJ 1D5YA 3BQYA 3PO2J 5FLMJ 1LE8B 3RKQA 4D5CA 2XPWA 2Y31A 3HOVJ 2DMUA 3TP3A 3IH3A 5F0HA 5F1JA 4BQQA 3HOXJ 2H1KA 4A3GJ 3JRFA 3BT9A 5E3MA 5GPCA 2ELKA 2JA8J 2ZB9A 2Y9ZA 3HOZJ 2LVSA 5F0FA
chains in the Genus database with same CATH superfamily
3EAGA 3OZCA 3MRXA 2FGJA 1BYIA 1D2MA 2N8GA 1U1FA 1FOKA 2V59A 1YI8A 3TTSA 3VSCA 3PEEA 2ZIEA 3A03A 5AVOA 2W4QA 4D82A 1L4UA 1P1IA 1DOZA 5JTTA 4R4LA 3WR5A 1G66A 1C1DA 2XMZA 3D5LA 4IIEA 1XK6A 2JBAB 2P6OA 1UBLS 3R8CA 2JJ8A 3VJRA 1YNOA 1AV7A 1X4PA 1H8AC 3DXXA 3WRYC 3E0JB 3NGXA 5K0ZA 3EDMA 5ESWA 2BFFB 1SHLA 2BBSA 3OD5A 3TCXB 1HOMA 3EPKA 4X6AJ 1H6DA 3ZW8A 4G36A 1L7AA 1KU6A 3BF7A 1UJ8A 4W97A 4LRXA 1M5UA 4PYMA 4W80A 3WWYA 3NFQA 2TRSB 2WTNA 2AXTE 4L27A 3RRFA 2J67A 3ZMTA 4BVFA 3VKGA 2IEKA 5CJ4A 3RYFB 2OM2A 1OY1A 1HZJA 4GHWA 4RS3A 2IXFA 3LUHA 1W46A 1I7LA 4WKPA 1JTXA 4GSLA 5H9VA 1MO5A 2B9EA 3PP8A 1SG6A 4B3JA 3A9RA 2R93J 2I4OA 1YQTA 1I2DA 3M82A 4K6GA 1FZQA 1RR7A 4PYQA 4Q3OA 3K6SB 3BBPA 1WQ2A 1UPXA 1FOEB 1EVKA 4FWTA 4KGDA 3URKA 2JTVA 4HDVA 3MBIA 4IIJF 3W7VA 3EZ9A 4AS2A 3WZMA 2V7UA 4U7TB 4YCSA 4B2YA 4X1YB 3PPWA 1M6VB 5FKOA 3ESQA 5KQMA 3MPUA 2QM0A 1RXCA 3JQPA 1NGSA 4HTFA 5DXAA 4GYYA 1HEUA 2C57A 1FDMA 1A8SA 1HMYA 4QAQA 2JAUA 2F4VB 5DJUB 5BT8A 4DIOA 2BFBA 3QQPA 3T7RA 2K7FA 3UR3C 2VF7A 5D3ZA 5CFOA 2CFTA 3VOEA 2DWUA 3H1LE 1UANA 5B5EE 3N0RA 3Q5GA 3NTNA 1WMBA 2IDMA 3PI7A 3H8WA 1LVAA 4B1RA 1NT4A 3P8ZA 2XF6A 1L5VA 1XKXA 2WI8A 3W4IA 1NU1G 2HNBA 5IKXA 2E9SA 3S27A 2E48A 5D6OA 4OWRB 1ML3A 4ZQBA 3O2SB 1E6LA 1JHXA 4RMJA 2CYAA 3H3JA 4U3FJ 3DW1X 1T9DA 3COAC 4GLLA 5KHOC 1PP4A 1T2UA 3H1IE 5CVEA 4MUMA 3U9TA 2FG7C 5IN4A 5FOQA 2W98A 5EJMA 1W7PB 3NIWA 1XKQA 4D0SA 1DWUA 3BUSA 3UWPA 4EF4A 5K99A 2V7FA 3V6IA 1J0RA 3FKSA 3O74A 1P75A 2F59A 3IRRA 2XGMA 1BEEA 1ZM9A 4Y2HA 2AOVA 1RI3A 4LHXA 4DN6A 2JDIA 1MEOA 1EVQA 4GKKB 2UAGA 1C0IA 5JS6A 5LYJF 3GZNB 2FOXA 3ZQJA 2HFHA 4AZ3B 3TZCA 3VM6A 4QEKA 3W1WA 2QEXI 2JLZA 1J4AA 1GTZA 2Q3HA 4EY8A 1D1CA 2OC9A 4ZAWA 3ROGA 4EHIA 2A45G 1TAUA 4JFRA 3PYMA 4HLQB 5E0OA 2DUUA 2BEQD 4ZV9A 2EZHA 5LIRA 4MPRA 5G1PA 5C8ZA 5DDGA 3MOSA 5F04A 5EHQA 5A6VA 1WPRA 3TMYA 4KLRA 1PJ4A 1HDOA 1ORKA 3FXAA 1QQBA 4EJ6A 5IYCJ 5DT2A 3GLFB 4C7MA 2ZFCA 1AU7A 4CEJB 4RPIA 3IFMA 3CLTD 3CUUA 1IUFA 1TEZA 5I9TA 2LOOA 4XJTA 2ZU0C 4QGHA 3IJRA 2L7FP 2X22A 2IGNA 1LE8B 1A96A 3N2YA 3A0HC 3DYIA 4BQEA 3FWNA 1X87A 3BREA 3N86A 1OF1A 4XQ9A 1LTJA 4ZAYA 1LJ9A 4IXAA 4CKEA 4X63A 2O01N 1QRSA 2HVSA 1BHJA 3B3JA 2OC6A 4PG7A 2G3YA 5I9IA 5EG5A 2OBPA 2ZKIA 1YQQA 1EWTA 1SXQA 1NTMG 1JG7A 3HC7A 3MLAA 1GTVA 3OC6A 2HMAA 4IR7A 3WK8A 4GP7A 4XLNF 1OH8A 1R9MA 4YRZA 5LZ8A 2OHHA 1RXWA 2L69A 2QCOA 3DJFA 4YCLA 1HJ0A 3GGSA 3Q3GE 5IFKA 2VJLA 4BV9A 2H43A 5ERIA 3LW7A 4JP3A 3ILXA 3HO8A 4WUVA 5EZHA 5EVJA 2VQ3A 4MJLA 1P84D 3QE9Y 1OYIA 1WDTA 3LQRA 5EQFA 1V5GA 4LZWA 4II7A 2F1KA 4PSWA 1N57A 4KQFA 4JP1A 2NU9A 1RAIA 4RC9A 2OBYA 2DTRA 2Q3BA 3K9QO 3SHQA 4N5DA 1Y7IA 2YZNA 3ZQIA 2A0UA 4LFUA 3GDOA 2FNPA 4LWZA 1EUDA 3DXYA 4G6DA 2FLWA 2NRAC 1P61B 1ZL0A 4OSOA 5E20A 1XXHE 2D4AA 1WOYA 2AG5A 4EPVA 1H2EA 3OIQA 3OU2A 1BE3G 3KYCA 3A7OA 5LVAA 3M6FA 4ZVMA 3PFYA 1F9NA 4BNMA 5CM9C 4CMIA 1BCRB 5K7HA 5ADUS 5FXMA 2EQ5A 1A50B 4Q24A 1E9RA 4RE6A 3LLCA 3C7JA 5K3DA 3X2EA 4ZI7A 6AT1A 3KQWA 3R2PA 1HDZA 4RD2A 2DMQA 3BJ6A 5JSUA 4B79A 2X58A 2EWVA 4QEZA 2BCJQ 4X65B 3G9UA 2NTEA 4GRIA 4B3AA 1PW7A 3V6MA 3EGWA 1J9EA 3HR8A 1ZP6A 1E9AA 3CZ6A 5KJCA 2FMXA 1E2BA 3QUCA 1KP9A 2R85A 1W36B 3GNTA 3T3OA 4X60A 1UZUA 4PFKA 1VE5A 2RGDA 4DLSA 4QTTB 1CQZA 4CCYB 1A8IA 1GQQA 1XSEA 4UY8I 1KK2A 2GGSA 4C0BA 2F6CA 4LSGA 5IHPA 3DR5A 3VJKA 3Q7PA 3TM5A 1QGED 4LB6B 4YMUA 4PCAA 4HA8A 4Q4CA 1ONNA 4O4IA 1Y0BA 4RETA 3MUDA 3UW3A 4ZCPA 1VJGA 5DHPA 4FR5A 1A2QA 3WMGA 2EA2A 2JJ7A 1XZEA 4I08A 3CBGA 3HB5X 1CJKC 4E6PA 3TEDA 2W37A 3W6JB 4ENTA 4UULA 1B8IA 4G0OA 1O6CA 4BKQA 5EFWB 1KMCA 3X1MA 1U8ZA 4E2YA 4MQ9F 1AVOA 1UM9B 1U90A 1IZ0A 4MKZA 3B6IA 2IYPA 4RD4A 3L74D 5JD3A 3U7JA 1SB8A 2V0GA 3HJBA 5B5SA 1XEXA 2QY9A 3ELYA 3FJ1A 5CCGD 2F17A 1JSLA 2P1ZA 3V8NA 4PZYA 2XU6A 3MTGA 4CV0A 5IXYA 4W5WA 1ZW1A 2HGSA 4F6CA 1VLMA 1TGVA 4S2EA 2ZNZA 4CSWA 1X3LA 4DY4A 2FMTA 5K3BA 1IQUA 1W0JD 4JUAA 3WV4A 4F4CA 3QUAA 1YV9A 2EX0A 4OLAA 3N2KA 4W9NA 4XRFA 4BYYA 1XEWY 2H9AA 2KI7B 1TWAJ 2HEOA 2I34A 5F3DA 3AUFA 2VJNA 3BA6A 1VL5A 1V37A 5KSWB 3AHIA 3DG9A 3AF1A 3CX5I 4K6CA 4BYGA 1DQZA 3DE5X 3Q1LA 2P62A 4KB5A 3F6SA 4JLMA 1P18A 4B80A 4DWOA 1SVFA 1NJFA 4LPKA 1WABA 4KO4S 1NW4A 4MUXA 1JQAA 5K8JB 2HXYA 4R2WA 5I4CA 3KJHA 3JVUA 3L2UA 4OJNA 5IS2A 2GXQA 4B34A 4PY2A 2B35A 1JQDA 1UZMA 4GT1A 1MABB 3G73A 1YK1A 2GZSA 1KI6B 2ZJ3A 4CM4A 3RK2D 2GOYA 3W2HA 2PLFA 3FPGA 3Q2IA 1F38A 5E4TA 1K4SA 3NHMA 3GTMJ 4YFKF 1EWQA 3VR4D 3WMXA 4BJHB 5K0NA 4RH3A 3RJZA 1FZAA 1YE8A 5JBNA 2B7LA 2ZRPA 1V4NA 5EHZA 2I4TA 3MRTA 1CUWA 4FEYA 1E1RD 1II9A 4I7HA 3R1IA 4X91A 2DDBA 5GAHJ 3MTIA 1FMVA 3H1GA 3LX5A 3IBGA 4BLUA 3H1ID 5CFZA 1R0WA 1HOXA 3DOFA 3L06A 1SBQA 2ZVOB 5L8VA 3Q3JB 3DWLE 1POXA 2IV2X 5B3SH 4LNUA 3MZ0A 5C8YF 2I9KA 3GRRA 2VHTA 2BOLA 5G2OA 3PTLA 1NFRA 3PSIA 5L7TA 2Z0MA 4CKWA 5BR8B 3TR0A 1AKTA 3T4EA 2RHOA 1A4IA 1DD3A 1N5LA 1IK9A 4M83A 1Q16A 4MV8A 4EL0A 3IOEA 1SC3A 1G8HA 4AP9A 1NNEA 1Z7WA 3RSZA 4CQMA 5DBIA 1TCBA 1JJAA 5D5VB 5KPJA 2Z4TA 3N76A 3H16A 1S72P 2V3WA 3KL2A 3GIWA 1W2HA 1RRKA 3GHGB 1MR3F 4Q4DA 3CEAA 2XNKA 3M4NA 3CNQS 2E4XA 3K1AA 2PQMA 2J33A 1GL2C 2HDHA 3HS3A 2ZRAA 2O7NA 3H0DA 3TQQA 2D2VA 2QI9F 1FZPB 2VDWA 4R31A 1K78B 4GVXA 2D2CD 1BNCA 5B4VA 3UC5A 3D6MA 3B8EB 1CUFA 4OLJA 2VKDA 1FDSA 1KJ8A 3UGJA 2DFLA 5ILGA 1NTKG 4IDEA 3PCTA 4JOQA 5AW9A 1E66A 3A1NA 2FXMA 1KAHA 1EXNA 2JFVA 2WJYA 3VYVA 3I37X 4B3XA 1WT6A 3E18A 1QGDA 1R5NA 3P97A 1N32B 3HOYJ 4QREA 2VQGA 2MYSA 2VBWA 1XMKA 1HCRA 3FHNA 2ST1A 2D8AA 4I1SA 2IIPA 4NENA 1QUFA 5INTA 5IJWA 4R2XA 2Q3JA 2DPGA 2X1EA 2R8BA 5BU5A 1S8NA 2PH7A 4KC0A 4NOLA 2FRDA 5AVZB 3G6WA 4B2LA 3U7EB 5CMZA 1ODTC 3L71G 1OFTA 4O4LA 1S3FA 2ZSIB 2E4WA 2VT2A 3OX3A 3OY7A 3A6EA 2CJYA 4B4DA 1F17A 1RLMA 1IU9A 2NTNA 5AM1A 1SCUB 2GNPA 2PLWA 1XQYA 2AXQA 1CCWA 5TS2A 1Q84A 4NCXA 1DX9A 1LUAA 4L9VA 5GP1A 4R3NA 1XD9A 1BN7A 3OOSA 4JIMA 3VOBA 2K9YA 3PKJA 3EVDA 4PVDA 4FETA 1CB7A 1ZHFA 2ZBEA 1YBVA 2NUAA 5ITZB 2JW5A 1TFRA 1CLUA 3EDRA 3UJAA 2KHMA 1IW7F 2YYZA 4KQ1A 3DQPA 5HLTA 1NYHA 1SC4A 1AF7A 4BL0B 4QUJA 5AVQB 1I0ZA 3IDFA 4EJMA 3KNZA 4LRUA 2GM3A 4KSCA 5HZGA 1B14A 2W2KA 2Z58A 3PXBA 4ON9A 2Z2IA 4UOEA 4L74A 2YWCA 1TUEA 4CM8A 1RI5A 4UU0A 4B82A 3RSNA 4GFBA 2X1VA 4XRMA 1PLJA 4HPWA 1U5TA 3CX5E 3CTMA 4GBED 3PD1A 3KQOA 2H08A 3FNBA 4AZTA 1QGKB 1SQVG 4IILA 3AE9C 1G3TA 1YZKA 4X6UA 3KPJA 3MN1A 3IWZA 1M6HA 3W2GA 4P84A 2OZPA 1B0UA 3RYRA 3IAUA 2RAFA 2FBKA 2CEKA 3NNDA 2VJIA 5CKTA 1AWCA 3FKSD 2WMDA 4GGMX 3FBIB 1P9WA 5GMOA 4PAOA 4FFWA 3AF6A 2QU7A 2YDYA 4D5FA 1GQRA 1SQBE 2CL7X 1U0SY 5DULA 5ECDA 1KYOI 5JVTA 2YXDA 5LLDA 1QHXA 5LQJA 3PF9A 2OCPA 1CE8A 5KX5F 5ALKA 4ESEA 4JS0A 1ECCA 2QLFA 5JG7A 4GR4A 5HRAA 2GHRA 3G2HA 1NVMB 4X3PA 3DV0B 1WCIB 4U2EA 1TUIA 1E99A 3DWEX 4HQMA 1R4MB 1LLCA 4M1EA 2KIKA 3QOYA 5K0GA 5IDVA 3LFUA 4DOMA 2NPSA 1FFDA 3MKZA 4A27A 1IN7A 2VQCA 1ZH6A 2C5HA 4MIOA 2DR3A 4XUCA 3OM1A 1XU9A 2KJBA 5AHXA 1GTL1 4OLHA 1U9IA 3CRVA 1CWUA 1V16B 2PL1A 2XXAB 4D97A 2R7QA 1NZFA 2C00A 4LGDE 2UUPA 3ROZA 3FMSA 3AJRA 2UU9B 3S2DJ 1HYHA 1Y6FA 3PXUA 4PPQA 4WXMA 1PT8A 4P7JA 3C98A 4WY4C 3B4SA 2QXUA 1RF0C 2XT9A 3ND8A 1XCLA 1CJTC 2HDOA 3IRUA 3U3DA 1PJ2A 3LYHA 4RXMA 1HL7A 5K0EA 2QQBA 1CZKA 4RANA 4JJIA 3WGJA 2C5SA 4TKMA 4Q7JB 1F0NA 4BO6A 3I42A 3AB7A 5HOOA 5JO0A 1AKMA 2XCQA 2KP6A 5BNZA 1X58A 1N2HA 2B25A 5DTQA 1ZM4A 2WV0A 1OVGA 3OZVA 4BXOA 5IKEA 5DP2A 4MP6A 2YMYA 2XE4A 1M66A 5UKDA 3CJNA 2WB4A 4IHQA 2P0AA 2JH8A 2HCJB 1VOTA 3MJTA 2JF0A 4JJ8A 4P0QB 3QTLA 4QUIA 2NVOA 2FPGA 4CTOA 2MU1A 3L05A 4L5JA 2L18A 1T0UA 2JPDA 2R5WA 5SZJA 3SWYA 1G19A 3LC0A 4MR8A 1CQXA 3ZGYA 1LPPA 4IHVA 1PLKA 3DPLC 1VG1A 4DDMA 1KI7A 8AT1A 2B69A 2G7HA 1C2TA 2OK7A 5B12A 5TMDA 1OB5A 1RQ7A 5AH0A 1O08A 1PHRA 1QE0A 3OESA 4K9KA 3MXOA 4I76A 3A0BH 2A68F 1KDZA 3B1JA 2W6QA 4Z4GA 1Y63A 2C5GA 1N8TA 2EV5A 1F2VA 1Q91A 3EZ6A 1NUSA 4G8BA 5FRDA 3BR6A 2Y69H 3OP1A 4D99A 4LF7B 4DVJA 2IA5A 2QJWA 2P5VA 3D7MA 4PRLA 1GVHA 1FRQA 3CX7A 3BE8A 3GX4X 4UVHA 1EBUA 1TCUA 3HTKA 1XZAA 2AXTC 3TTXA 2IIQA 2HZDA 3DHWC 3TECE 3GLHA 1NJ1A 4GF5A 1J5PA 4UM8B 3LRPA 3VDNB 8OHMA 4P58A 4Z5XA 1ZD2P 4QHYA 4W5HA 3IVMA 4ZODA 1U7PA 2VQSA 5I7AA 4FMDF 3QPSA 2QAGC 3CW8X 1JG3A 1YDEA 1Z5PA 2GF0A 1UXKA 3GJSA 1VBMA 1FX7A 4YUXA 3ZIDA 2GAUA 3I01M 4KUMA 3OQIB 2XA2A 5LC1A 2BY0A 4IDHA 3EQLF 3L70E 3O6QA 1ZC4A 3UYLA 4HATA 1VIAA 2A5DA 4TYQA 1IWOA 4ACBA 1GA1A 1NMQA 3BR0A 2WY7Q 2VDJA 1NPTO 5IYBJ 4GM4A 3UMSA 1FVHA 2GBLA 1FFEA 1C4WA 2B83A 3D0RA 3WKAA 1PX2A 1WHSB 1UK6A 1EQAA 4DNQA 4IJQA 3U3OA 3GU3A 4DSAA 1EH7A 1P84E 4P5OA 3CN9A 1KK0A 1VKRA 4OIQF 1LFPA 5EJ6A 3R8FA 2JJQA 1DP4A 1UHMA 1R9NA 3BM5A 3KD3A 4ZOQI 1AQTA 2GD1O 3S1QJ 4JX4A 5TV2A 2EP5A 2C2GA 3CVXA 2Z8XA 2Z04A 5DDIP 1SOVA 4ZANA 3UMYA 3KEGA 1DWOA 3LZ6A 2D74A 3TX6A 4D79A 3H8VA 4QHTA 4NZNA 1JY2O 3QYFA 3B9BA 2OESA 4FLMA 2EBWA 5T41A 1G20A 3A04A 2BZGA 1UJMA 4Q7MB 2G76A 4Y17A 5HUQA 5ALIA 3MTDA 1ZRDA 3DQQA 5I47A 4E46A 2XMSA 4RHFA 4RF2A 2IFMA 5KSYA 1Q12A 1D1AA 4S0ZA 2ZB9A 3IP4B 3QEMA 5KINB 5K4HA 3STYA 1FJKA 2RHLA 3H1HJ 1KI2A 5DI3B 3I8OA 4OATA 4G84A 4HXFB 3RJMA 2HSEA 1IY9A 13PKA 3ZK9A 4NZZA 4YPVA 4YXWA 3W8DA 1VQ7I 2Q4EA 1OSNA 1K1EA 2ZGVA 1QYIA 3VQTA 2XCRB 5HYVA 4YGYA 4W7IA 1BAPA 3HUSA 1VSVA 1Q44A 2I4MA 1FEXA 1J1DC 1FRZA 3ST7A 4FBLA 4KACA 3HOSA 5SY9A 4BQOA 1G8YA 4EYGA 3THSA 4QTYA 3L7CA 4D8YA 3VRHA 1RE0A 1YMVA 1SUAA 1PVEA 2Q45A 3H19A 3RVJA 1HF3A 3HA3A 1YR2A 1TT5A 1OKKA 3AG2H 1UBOS 1JZQA 4C7JA 1SAYA 5A0TA 3IDOA 3OCWA 3KU4A 4M9RA 2HMYB 3C1OA 4BNTA 2ZT7A 1KGSA 4RHYA 2E1OA 5HRUA 2ASEA 4NV3A 2I6SA 3UJNA 1M1JA 4N9QA 1ETVA 3DHYA 5LRSA 4Q9JA 2PD3A 3V8RA 3PL8A 4R2JA 5LOVA 5BMZA 3BWXA 2ETXA 3M6IA 2CVQA 3TMAA 4IFMA 5BOSB 5IDWA 2A0WA 3OIDA 3CXHH 3W5VA 5HCUA 2NUAB 5CNMA 1G5QA 3B6ZA 4RO0A 4QJBA 1BFDA 4IRXA 1HKTA 1C9YA 1QF7A 2IUSA 5G0WA 1EJ2A 3ILHA 3PC7A 2XKMA 3NHLA 3H1KG 3M6WA 1ISSA 4JR0A 2GJSA 4JEUA 1QVUA 1ZRTD 5A03A 1OILA 3NDBB 1L4GA 5JD4A 2P2SA 2JCVA 4YV0A 4HDQB 2PMCA 3UB2A 4G0ZA 3CMEP 3PTZA 1XZDA 3NP7A 1PIXA 1XAGA 1M2JA 3RPUA 4Q3KA 4D2IA 3LNTA 3C5WP 4WZBA 3BCUA 1ZRMA 4X44A 1UQTA 2P4HX 3H84A 3B5NB 5EAIA 4Y1RB 1M10A 1DDGA 1X7XA 5KDOA 1YGYA 1TMKA 5DW3A 1BOAA 1NW3A 5TISE 4IXMA 3KLMX 3HZRA 3PDCA 1U0LA 4OVKA 1KOLA 1VZ2A 1LNZA 3G0GA 4U02A 1Z5NA 3HL2A 3GFOA 1MBJA 3RHFA 3HD7B 4KLNA 1G8MA 2I10A 3OIFA 3B1WA 4UTZA 3C2GA 3HEFA 1AO0A 1XHEA 5BQOA 1OCZH 1GFWA 3M0DA 2Q46A 3K2EA 1KH2A 2VSOA 4YEJA 4OQNA 1EDIA 3AE2C 2QBYA 3X1ZA 1MH1A 2B0JA 2YO2A 2NWQA 4RSHA 3VU3A 5D5UB 3HCRA 1UWLA 1JT9A 2HODB 4IICA 4UCFA 4IJAA 1K5DA 2NLOA 1BKDR 1QL1A 1NTZD 2BJWA 1W4LA 4D6TD 5EKSA 1E9EA 3L5OA 3K9GA 4ODIA 4U2GA 2DUMA 2C9ZA 3NTUA 3QLUC 1YVUA 2AOUB 1MAUA 5F76A 2BI4A 3L0CA 4C9YA 5JCZA 3FCCA 4QPJC 3HKEB 1LJ2A 5IKMA 1JALA 3OO0A 1A77A 5IJ0A 1ENHA 2G63A 1P73A 2FQ3A 1RE3A 2JFYA 3KUDA 2CXNA 2DFNA 1PQUA 4PYNA 4I9NA 4IDDA 3LT2A 4DCJA 3KUUA 5K0CA 4R41A 3JWEA 1YBAA 3N9IA 4Y0VA 1II0A 3IF4A 1Q1QA 3U62A 5DOVA 5CLHA 1B4AA 5FKKA 4UASA 4I9UA 4E5DA 2VHXA 1X9GA 3P9NA 1CZNA 3E5MA 4TMFA 3X2SA 4N6GA 5JCXA 4GSKA 4UPEA 5JCJA 3HB7A 3KYLA 1CD5A 4KRGA 1WJ5A 1P1KA 3LF2A 3IQDB 2DMUA 2DR2A 3HM9A 1GSOA 3WL4A 2F4NA 1VLJA 3F6BX 4EABA 1YCGA 5FBZA 4YXWH 4YJ3B 1EFHA 2FP3A 5KYYA 1I4LD 5DRTA 3TAHA 3DPIA 5TT0A 1RKTA 3KDPA 4V0SA 2YZMA 2AGVA 1UZLA 4ZQIA 3UJ7A 3TGUE 2V03A 5KMGB 2OD5A 3TQCA 2AG0A 1FVXA 1B8PA 4CIDA 3EGXA 1W87A 1W1IA 4U7WA 1BMDA 4LYHA 4QXPA 1RP7A 2BM1A 3ZOKA 5CM8B 1CETA 5KYXB 1HK7A 3HUDA 1ZGAA 3T5CA 5IMSA 1BW9A 2FRDC 1CSEE 3Q9NA 5TQ2A 4AYBA 3FWKA 2P30A 1X0VA 2HJHA 2YXPX 2WVHA 3PNTA 5AW5A 2B4QA 1B6GA 2GCIA 3F1KA 5TPWA 4H7DA 3G5LA 1MZ9A 1UMCB 3RQSA 5KYWA 3CCRP 4CI0B 4NLLA 4EYKA 1X77A 1WBDA 2QTTA 4ZVUA 5HJ2A 4FISA 3U1KA 3SZUA 3AU9A 4PZAA 1P7YA 2ZB8A 3DCFA 3EFEA 2GRUA 3AHCA 2LW7A 2HY7A 2AT1A 1SCNE 4M54A 5JI2E 3B8HA 4CZZA 3GLHB 4AW9A 3ZCVA 2K5CA 1Y6GA 2GHTA 2DLLA 3WDSA 1OIPA 3ZP5A 5DGIA 2DY1A 2EL7A 3W6UA 2YMKA 4F2WA 2PN6A 2JGFA 5HZMA 3MLBA 3KYQA 2QYSA 3LIDA 2VH5R 4G7OF 3P9SA 4GX0A 1FW6A 5B53A 5BRJA 2NUTB 5IAJA 1PS0A 2PIAA 4K46A 4ANJA 2M5AA 3W6OA 4HH1A 3KBOA 1GGJA 4I2NA 4OM8A 2AI3A 1H89A 2DB3A 2JIZA 5B66C 1KP3A 2D6FA 3IOCA 1R00A 2GWHA 3PXGA 4MI6A 3ZWCA 3F8CA 4JGIA 1HJBA 3QOXA 4K81B 4DCNA 1D6SA 4JUFA 3HU1A 3SZGA 1F9AA 2QQEA 4YQYA 4UNNA 3HVIA 1X15A 2EIJH 4XASA 5BSVA 2H8KA 4K6FA 4NBUA 1N5DA 1P2VA 2NXCA 3LQ1A 2KSQA 3NR2A 3U1CA 1AKWA 5DFAA 2EX4A 4XE5A 4UU1A 3D1NI 1YQ9A 3JD3A 3RHSA 3JSPA 1N0IA 4MGKR 1JNXX 3KL4A 2Z98A 2DPLA 2H6EA 1MXHA 2XUKA 1KDTA 4CRWB 3FD8A 1UEXC 4OQDA 2CNWA 1U1GA 1WUYA 2H5EA 1L0NK 3PC8A 1D2CA 2R0QC 2RKBA 2RMZA 5I7WA 2YMPA 2PUFA 1FYWA 2FZ4A 2C4TA 1M8GA 3UV7A 2K9NA 3LY9A 1WMEA 2FYZA 3UO8B 2D00A 2J7KA 2TYSB 2H1HA 1E2JA 4EG3A 1OFUX 3G2MA 3HXKA 2HHLA 1ZH4A 1NVGA 5GY7A 4EH1A 4WAUA 2FSWA 5E2BA 5D51S 1XMOB 4DJ5X 4RBNA 4ESFA 2WKSA 1B93A 4OG2A 4PBRA 3NRVA 1ZV8A 1ADCA 1XZ8A 4G25A 1NHLA 4QD3A 5CRIA 4DDTA 1JFVA 3EIHA 2Z1NA 2OHVA 4DA6A 1U3FA 4MS3A 4Y2UA 3CCSP 3FCUB 1XTSA 1ZN8A 4K6MA 2A14A 3C5VA 1U2EA 2O2CA 2BELA 4BFZA 3TLBA 3TW8A 1QWOA 3JQAD 4AJ4A 4YJFA 3LWNA 1T3ZA 5C8XA 3SVZA 3TYXA 1J7KA 4RAFA 4HKTA 4KQKA 3EDQA 1MJFA 5DM6F 3TAUA 1SQFA 3U1VA 1PN3A 3C8HA 1GG9A 2OT3B 1JEDA 2CQ7A 1SQVE 1E2GA 2WTAA 4DA8A 2XRZA 4BLWA 2G9WA 2A0KA 3L5KA 4PGMA 1KD1Q 1A27A 1QE3A 4CM7A 2DYSH 4G1MB 1IONA 4G41A 1JILA 5DP1A 2V5VA 1RWBA 4WN9B 2K9SA 5D3MB 3BZCA 4A0FA 2QN2A 5DGTA 2GEJA 2NU6A 5BVHB 3WJ2A 4S35A 4I0AA 1P1HA 2ODPA 2DLDA 2IY9A 1RBYA 5T4BA 2BLNA 3L6DA 4N4NB 2VSQA 5CGQB 1N1MA 2BEOA 3F6RA 4E5NA 3ELDA 3AE1C 1XJCA 3W06A 1A8UA 1QO7A 2LKDA 3KM0A 1AQYA 3DMGA 5SYAA 2FWRA 2PTGA 3I0NA 1ESEA 1QGAA 5HM6A 1WKCA 2R5NA 3VISA 1PS8A 3LK6A 1WNFA 4F7ZA 3DEAA 3DDZX 4NNJA 4KDEA 3G5TA 4F3KA 3K1MA 3QUQA 4ETMA 3VR5H 3M3YJ 4PN7A 4HF2A 3B48A 3VR0A 4ZTFA 2I4RA 4PEVA 2C20A 4NG4A 5HKKD 2FPRA 2CLCX 4PGHA 5JC8A 4HVCA 4NE7A 5DHFA 3WRVA 1S89A 1E89A 4DRXB 1J90A 3PEYA 1XZNA 1VPDA 4BJ6A 3K0SA 1V7ZA 4D4HA 1SUPA 3A2MA 3P9ZA 1ZCBA 3NO4A 2R7LA 3JD4A 1X74A 1MV8A 2VP3A 4JAVC 2DHCA 4FUQA 5D84A 3AOEA 1Q6YA 3NW9A 1OROA 1X7ZA 2RBKA 4RLQA 2G9UA 3M91A 4N7BA 4QASA 4HQFA 4Q3BA 2XE8A 1WLYA 1D8KA 3FX2A 5KU1A 1L7EA 2NXWA 1DT3A 2QVOA 5IBPA 3JQDA 2JHGA 2GFIA 1ZMEC 4R3WA 1DC7A 3H2ZA 3LKVA 3H5NA 1GGFA 1XMIA 2Q4DA 3LRXA 1HNWB 2X7JA 2Q7CA 2WTMA 1DP7P 3KZYA 1ZR4A 3A1YA 3AP2A 3B73A 1KI8A 3DL4A 2R7WA 2VP9A 3EZNA 4ID9A 2GCNA 4J2OA 2VVTA 1IPEA 5A4IS 5DYNA 2D8MA 3DDSA 3EDYA 4HWGA 1OCPA 4JLAA 4G0XA 3ZHUA 5DM60 5F6FA 1NIPA 1WOMA 4LXXA 3FI9A 3ZHXA 5EXEA 2Q5LA 5AIPA 2O50A 4UMFA 2WQYC 3AR2A 1TX4B 1U7DA 4WCVA 5CBKA 2LCIA 1R9GA 3RUEA 5AVXB 2YOGA 3VZBA 3CGGA 5ALSA 4BU0A 1G2QA 3HB1A 1XPRA 3I1YA 5FBWB 1QGYA 2PZJA 4DIQA 2OBLA 1ORWA 1MDMA 1HDGO 3L1IA 1RJ9B 4N0QA 4JB0A 3ZTWA 2HO4A 2VI5A 1PQPA 4AKEA 3WYFA 7YASA 5DVZA 4J0EA 1LNWA 2YUIA 5BMVF 4OTZA 2RJOA 4G1FA 2Y75A 1O3TA 4LYDA 4P2BA 1UZAA 2WTUA 1EFLA 1HE2A 3S1RJ 4URYR 1U9IC 1Y4AE 4OIMA 4RSMA 3BG3A 1L7NA 4MYTA 4WLNA 4CE6A 1XVVA 1J0AA 3UM9A 1AXEA 2O5EA 3KZIE 4UQOA 5BWBA 1RDFA 3K9LA 1JR6A 3O1LA 2O9LA 5K5OA 5DXFA 3H7AA 2VXDA 1QH1B 5LUBA 1JX6A 4OLBA 1KMQA 3H1LG 3IVXA 2ICAA 3IAEA 3A11A 4IIBA 4OBXA 3W6VA 5K3SA 1QCZA 4WOPA 1LUJB 1UMQA 1JR3A 2ID7A 3UIAA 3UV6A 3VPCA 1UR5A 3W34A 1PT9A 2GYYA 2V74B 3IUPA 3KXIA 1EUYA 3GTKJ 4K3AA 3TN7A 2VOEA 5GTHC 4NCBA 2XGGA 5F4ZA 3OYLA 3ZJUA 1FBMA 3TKLA 3K4LA 2QJYC 3GBSA 4GECA 4O1IA 1OLSA 4L3VA 3VO9A 3N2EA 4K88A 2E19A 4OQLA 2CHEA 1CW5A 2MR6A 1QPIA 2I5PO 3ZI7A 4EI8A 3EB9A 5HF6A 1LBTA 3V7RA 1UM8A 1T6XA 3JS5A 3WLJA 2M3AA 4JK1X 5LB4A 3LA7A 2I2CA 4NOMA 3SX0A 3GT7A 1IC8A 2O7QA 4D6PA 1R88A 3I12A 3SC4A 2WWTA 3BWCA 5K0BA 1COZA 3MCZA 3I6YA 4C7RA 1OTHA 1E20A 4OHUA 2P77A 3ETNA 3EYWA 4BV3A 4ER6A 3DQZA 3CLOA 2MD0A 1E4OA 3B6EA 1AV6A 2B2XA 3SJUA 2MC3A 2HIMA 4CQNA 4M71A 4A6DA 4UUSA 4E2FA 1JTHB 2W00A 3E9ZA 1BCRA 5DI9A 1E2KA 3H6GA 3A2KA 3CDIA 5T67A 4CU2A 4QRIA 1HEIA 3CUVA 3MRVA 4ZOCA 1G0OA 2O2DA 1ZN7A 1OR7C 2GA9A 1JFFA 2LNBA 1EDOA 4TQAA 4ZOLB 4J4HA 5AOBA 4Z9YA 1R4AA 2BR5A 3LT1A 3PF8A 3T12A 3KQTA 1P92A 2UWMA 1CRZA 4KQ2A 2BFNA 4KMUX 2BCCJ 3N28A 2BGMA 4LXQA 1USIA 1R22A 1AZLA 4IYJA 4YRRA 5KX5A 3FM9A 3E5QA 2BTEA 4L4UA 3TCKA 1XGKA 5FWAA 3ZLJA 4J2TA 4MV0A 5CCHD 1B74A 2AJLI 3ASUA 2VYCA 3RE1A 1Z47A 1LP1A 2GR9A 2QM3A 3RIMA 4ZV7A 4AMZA 1ZJWA 1TM7E 3ZY4A 5SZHB 1U9CA 1O94D 4KT0J 1FQKA 1MP0A 1KMIY 4ZCTA 3O2QB 2ID4A 4I1RA 5HEKA 1CEQA 1X1BA 1VQ1A 3MJRA 4IJ6A 3ANYB 2GBPA 3TOCA 4MICA 3QVTA 4UD2A 3NT2A 4EGFA 3VODA 4TZ0A 1POGA 2Q3MA 3WYAA 3GPIA 3Q6NA 3F5DA 3ANNA 1OJLA 2XA9A 2VJJA 2E74B 5TR9A 4PNHA 1QVTA 4J1QA 4W82A 3ZE0B 1QIGA 1SUFA 4P08A 2O2IA 3E9RA 1JUNA 1IZ8A 3T8RA 2EBIA 4NJEB 1Z9CA 3PUFA 3OOHA 1HLGA 2Q99A 4H7KA 2JR8A 2OMKA 3W7AA 3GZ5A 3OYIA 2CGPA 2J4DA 3AT1A 3NWJA 1Z67A 3AE8C 4YMGA 2IY7A 1BS2A 4HB2A 3JWGA 4EHDA 2DA2A 1E6UA 1PFQA 4HX8A 4ZRMA 4MQ5A 1OAOA 3E7XA 4NRDA 3V2NA 4KR0A 5FLYA 2PUEA 2XKJE 4LQCA 4L0MA 3PFWO 5BNFA 2OFPA 2Q0QA 1TGYA 3V1UA 1MX1A 2BFCB 4JC4A 1Z0SA 4TQ9A 3GVHA 1NTKE 3LQ2A 1M1XB 2E4AA 4LBYA 3KOXA 5CVJA 1RAGA 3PSAA 2Z30A 3J7YJ 3FTNA 2JZOA 2VF2A 4W7SA 4PG8A 1CUVA 3B38A 3M1YA 4Q9NA 3I4PA 2WG1A 5LNK1 1YNSA 5AW4A 3V4PB 1YRAA 1CK4A 1ZU5A 1N36B 4GR5A 5IP5A 2XNSA 4I4TB 2QDXA 1J9GA 4RA6A 4BMDA 1QQTA 4BXUA 3S7ZA 5THQA 1EUDB 2POHA 4NCAA 4C06A 3T38A 3FJYA 4UUNA 1KV4A 1T24A 1RWMA 1SKBA 1CRQA 4D4JA 4KLZA 1QRUA 1W7PD 3JAMK 4AURA 4URZR 3OQBA 3E3VA 3F6EX 5CCEA 1JLKA 1NY5A 1LWNA 1TECE 1H9TA 1L6RA 1DXYA 3UBMA 4I3FA 4PZDA 4F5YA 1WJEA 1AUQA 3K7AJ 3CJTA 2P8JA 1ODCA 2FZLA 1WU8A 3L8DA 4IVPA 4JJ4A 1ZTRA 1L2PA 3ESRA 4RTKA 4RD6A 2E18A 1FJLA 4Q19A 1D4ZA 4UBIA 2J45A 3SDBA 1U0RA 1IG3A 2WFMA 1N2XA 2ZP1A 2IYLD 2YZ7A 5JVDB 3OL3A 3NWSA 4E31A 1U78A 3TTTA 3D6HA 5L3VA 3WTXC 2RBGA 2BMFA 1VQMP 3DOUA 3G0BA 4GL4A 3UHPA 4BWYA 1LVHA 1VB3A 3PTAA 3MD0A 4N12A 3QOPA 4M98A 1OFUA 4M22A 2EKQA 2Q62A 2Q9BA 3V2UA 2HGCA 1F0KA 1FZCC 3BIOA 4ZO6A 3FOEC 2ZBRA 3NBAA 1VHQA 4W99A 3CO6C 3CVWA 1HWYA 5JARA 3N07A 1L4KA 3JQFC 1MGPA 2AVDA 1PSDA 5I5GA 4E5KA 2QD1A 3PQDA 3ZZUA 2IBTA 2G28A 4E7HA 3N74A 3C14C 4BPRA 3OM9A 1F0YA 3A0RB 4OUDB 3RQ4A 2R44A 4KDFA 3NWTA 2J9ZB 5DNUA 4RVNA 3NUZA 4K8RB 4G5XA 1APBA 1SN7A 3T1YB 2Y1EA 1DDOA 2CDRA 2QN3A 4GLJA 1UQUA 4NG5A 5DV5A 2CK3D 2G04A 1EVZA 5FPPA 4G5YA 2EARA 2JGLA 4JGGA 1Y5NA 1SY7A 1SA0A 5LQUA 1H1DA 3I0TA 4HK4A 3JCUH 3CUEF 1H88A 1SU7A 3TVDA 3FWZA 2ZRFA 3LKBA 3L8EA 1J8YF 4GX1A 5JYEA 3FZEA 2FQ1A 2R1VA 2AX4A 4LISA 1BWQA 4QNMA 4CMEA 3T5DA 3IH3A 4MXDA 4XWYA 4YXDC 1XDZA 5A3QA 1DSSG 1VTNC 1AHIA 4O2BF 1GMJA 4YMLA 4IOAF 4LMYA 5E79H 4ENKA 4IDCA 3KPYA 2V6IA 1J09A 4IXTA 2E4ZA 5GVRA 3I4NJ 3AR8A 4G0QA 1K68A 3QAHA 1PYOA 5J4YA 1SHTX 2EBUA 3QYJA 4EJSC 4YJDA 1G3SA 3FJOA 1UKEA 1A6IA 1RYBA 4D4MA 2I22A 3PPVA 4KXMA 4OVNF 3TINA 5LPNA 4L95C 2JLRA 4PFOA 1PFKA 4YBRA 1IC2A 5F1YA 1BE3E 3I9V1 3L74E 2J9FA 4MA4A 2NOAA 4WRRA 2P5SA 4ZO4A 2QGZA 1P91A 1B0PA 4H44D 4BNWA 4LVOA 5BNIA 1RQXA 2XUPA 3ME5A 2C3OA 4F86A 5THXA 1GY8A 2YJGA 3ND7A 2WILA 2MBFA 1MG0A 4I19A 3DV0A 2ZBVA 1SVWA 5D5HA 2NP7A 2IW3A 2PXHA 3JAMZ 2QTCA 5TGDA 2LKSA 1FVFA 1NXWA 2DN0A 3H6HA 4BCBA 4K7JA 2J07A 4IL6H 2AI1A 3HYSA 2W6OA 3WOVA 3IAS1 3W8NA 1YCFA 3FPLA 4IHXA 2JJLA 3IH4A 1A9PA 1IUOA 5D00A 2VQFB 1AKVA 4UAUA 2H7YA 3D5TA 3NV9A 1L5RA 1JMVA 4GMDA 4M8IA 4ZK6A 1PT7A 4KO8A 3G2LA 1XRPA 2P3OA 3OYEA 3VYUB 1KFCB 2JAOA 4HTAA 1NVDA 1UP6A 2A4MA 3WBFA 1K3TA 3SIXA 3DP7A 4D4LA 1QF6A 3CURA 1Z2AA 4YFVA 5AVTB 3ZHVA 4EECA 1NTRA 621PA 1LDJA 5LOVF 5REQB 1QH9A 4U9UA 3GRCA 4JI6B 4L0ZB 2R8PA 2CLEB 4M0UA 1OXZA 1GW4A 3SFDC 1R5HA 3CWBD 2GM4A 4FC7A 5BSGA 1T95A 5DLDA 3J7AO 1A97A 2KYRA 1OAKA 2VF8A 2ZJBA 1B41A 4RMIA 3JRHA 3P2KA 2HCFA 5TF0A 5AONA 5ALFA 1TZLA 4FHDA 3EHEA 1BHQ1 3HVUA 3GFRA 4BNDB 2XY4A 2O7RA 5ADVA 4A3MJ 4M9QA 3BGDA 4HNAB 1SKYE 2C3MA 5D87A 4H7JA 2N46A 2E21A 1IFIA 5IPAA 2DBYA 4R9SA 5TMBA 2XKOA 1ESNA 1ZZEA 3I76A 4CMKA 2H27A 4F21A 2NGRA 5JI6A 4FIDA 1SFCB 4PFQA 1GAQA 4FCTA 3VSLA 1U5TC 1S9KD 3W5JA 4LK2A 4NCNA 4H7EA 1FTTA 4M0EA 1OOEA 1G63A 3VPAA 5FFXA 3AIMA 3C7AA 5JCOA 3U4QA 5CB4A 1U8UA 2UYHA 1NVUQ 4ZEXA 4IGKA 2HOEA 1TOAA 1DPUA 3CF2A 3BEOA 5F9MA 1C3XA 4LKOA 3EX7C 3R9KA 4DSTA 3SSUA 3D7SA 3PYLA 3VHXB 1KYVA 2HWKA 2NXNB 2C42A 5JANA 2B7CA 5DYGA 3CNHA 3QYPA 1BA3A 3O2JA 3B1XA 2YIUC 3AMVA 3THWB 5JD6A 3HNRA 2R6R1 4HDMA 3GZNA 5A4MS 5CIQA 4IQJA 3WS7A 2P9TA 3B20A 5L9AA 3ECOA 2OMEA 3IP8A 2YV3A 2JH9A 2I4LA 4WN3A 3P0FA 4BE4A 4WW0A 2OD7A 1CJVC 4AUWA 1RJFA 1N9GA 3GP5A 3F5FA 2ZKZA 5CCGA 1AB6A 4DA7A 4E08A 3H36A 3KR2A 2ZYVX 5AFSA 1PPJE 4HGOA 3RRNA 1F6BA 1O0BA 5EGOA 2I4NA 2V7PA 3BSWA 5HUHA 3ZW7A 2VOPA 5BUQA 1ECBA 4E70A 4ND5A 1E1DA 2M6LA 1U7ZA 4HNHA 3FHJA 3I56P 1FOSE 4BU1A 3GRKA 4HWRA 3USES 4R1LA 3NDPA 2OK8A 5AI9A 1QUEA 3TOSA 4RLHA 1NC3A 3LCUA 5JO9A 4RA2A 2ELHA 3UMFA 2X1MA 4ETWA 1KO7A 4ILKA 1ODSA 3K92A 2PEZA 2X6QA 3S68A 4LC1A 4ZO9A 3LSIA 2PBRA 1IXKA 4YFNF 4C88A 3EVTA 5CVRA 1D2RA 1O1YA 2E7WA 3ZIAA 2WD7B 2OAZA 3DTVD 4AJNA 2XI4A 1SQXD 3UAZA 3T9AA 4B73A 1XD8A 4HH2A 1BMQA 1K66A 2M1BA 1LQTA 3L3BA 2J9GA 3C41J 3O8ZA 1E4EA 2QE6A 3EIFA 4B35A 3SX2A 3E61A 3FETA 4P9FA 2HNHA 1DLIA 4UATA 4F4IA 2JLQA 1NU1J 2F4MB 3AI7A 5IT0A 1U2QA 4ZCLA 3REGA 2GN6A 2X8JB 5L3ZA 1IDYA 3BZBA 5TJJA 5DE3A 1FUIA 2XROA 5H2FC 1LFUP 3V4GA 1K6IA 2BMVA 2WD9A 1H22A 4E4RA 2FK7A 4KH1A 3G2PA 2HU9A 4B83A 1E1RA 2Q1WA 3C1UA 4GQIA 5JE8A 4UMDA 4CQLB 1QPBA 5CH8A 1QGZA 3S5JA 3PFGA 2GARA 5AJHA 3TO7A 4JPZB 5FD8A 1TZCA 2X0LA 1Y89A 3DKRA 4Z4FA 1Z4LA 3H5AA 1QVVA 3JQ9A 4IQ0A 1OWNA 2ZT6A 3GEHA 3VN0A 3OIGA 4Q37A 2H9IA 4DDKA 3O6VA 3H9CA 4ZVLA 1MENA 4HSTA 2VNIA 1JU4A 1NLUA 1F2TB 4JKYA 3L7BA 2F9MA 1JLHA 4BTLA 1DXQA 3QXJA 3IILA 1TNTA 1H9GA 4Q4ZF 2QTGA 1GG5A 3TLGB 2WYIA 5CFQA 3UAYA 1TP4A 4GDOA 4OAPA 2QYOA 4DCKA 3OIWA 5D1HA 4F9GA 2CHFA 1ORHA 3LTNC 2JJYA 3N2LA 1VBNA 1UCFA 1E69A 2KJQA 3DKYA 3BVHA 2NS0A 3KKZA 4D9HA 1MH3A 4INZA 4N9IA 2CXHA 4HXEB 3SM3A 1QK3A 1EJ6A 4GZ5A 2B1QA 2QTVA 4I4LA 2PUDA 1A7JA 3UUFA 1KB9D 1W36C 5EMMA 4FDTA 2J9YB 2WM9B 1E3SA 2NUTA 2OWDA 4ENSA 1TA4A 1XQ6A 3GCWA 3PC4A 3W6NA 2E5LB 3MGKA 1J70A 2XUHA 1I6MA 4Y30A 3K9NA 5AJXA 1CC1S 3KVRA 4F0JA 1P45A 4Q1AA 1LJUA 3AEDC 3CRMA 3TIIA 1MEEA 4KWCA 2MSKA 1SEUA 1THTA 4KQ9A 2GETA 5KUTA 5DHQA 3OEEA 1LLDA 4HPJB 4LC9A 1T26A 1LC3A 4JT4A 5DPMA 5ELLA 5LUAA 4BXFA 1U2SA 1C8BA 2C58A 2NO9A 4ZV4A 1FSHA 2QJPB 4BZXA 2ZRIA 2CLKB 4Q47A 2X2FA 2DCEA 2PL3A 2DM6A 4F7DA 3UJCA 3LGXA 1EKXA 1T43A 1ZRHA 1DKQA 2HF2A 3LSPA 1V8PA 4P53A 1J8DA 3UFBA 2ZQ5A 2Z2KA 1IJBA 2A4KA 3T5PA 1KSJA 3OTWA 2MD5A 4IDBA 1GUUA 1JKJA 5ESDA 3ROPA 1I14A 3WU2C 5IK2A 1GCIA 2HLNA 2VJDA 2R751 3HR7A 3E8SA 4M7RA 2DTZA 1VE6A 5KLVK 1CR1A 3PL1A 4UV8A 1O6FA 2UZ1B 1X1DA 2JLWA 4NBRA 2ZXEA 4Y15A 4UM7A 3WAJA 3L01A 4GGOA 3MT9A 4Q4AB 2VP6A 3U4MA 2V4HA 5E6RB 4JJ6A 4GXOA 4E14A 1QZYA 1TM1E 4G67A 5AVKA 4GI7A 1M1YA 4BVAA 1L3CA 2DA4A 2NZXA 4ABZA 3VO1A 3SJCA 4RULA 4F72A 1JY2P 2WSLA 3H1IJ 5IRCD 1NOIA 4RVDA 1FX0A 4PD4I 3U48A 3U44A 1SCBA 3ETEA 2QM8A 1Z22A 3N39C 5KAIE 2DXIA 3PUZA 2C3PA 1G20B 3PXEA 1MB3A 3H5RA 1M5RA 3S2IA 3ER8A 1K75A 3TE6A 1GTRA 1IATA 3EWAA 2W6ZA 3E9MA 1KO1A 4BASA 1VLHA 3C8DA 2IUTA 4F97A 2WUDA 3HVKA 4QC2A 5DLYA 2PGNA 4EMBA 2WR8A 2RNJA 4JK3A 3X3HA 4GXTA 4MTLA 3O4FA 2W1OA 5DGDA 2FQXA 4GM1A 2C5FA 2V5AA 1PTKA 2VHJA 4D9KA 3KVVA 1JMMA 5ICCA 4C3ZA 5K7ZA 4HB4A 4BBZA 3D71A 2R8ZA 3L35A 1MA0A 1SC6A 4L3OA 5EXPA 4DZZA 2J59A 2QN1A 1G1AA 3J81k 1KI9A 5JW6A 2DA5A 2GAOA 2PRZA 4H7FA 2R7ZJ 4GI3A 3W1VA 3P7KA 3EUKL 5T8KA 4M6WA 2H48A 4UNIA 1IY2A 3CQ9A 3NYRA 1N7SB 4U9IS 2VWGA 1ZCZA 4E5VA 3T7AA 4D9FA 3IAXA 4IGFA 2GHQA 5AUNB 3PWSA 2H3EA 2HQRA 3LVQE 4UU8A 2MSNA 5FFZA 4N82A 1WP4A 1UELB 3TBFA 5EWJB 4BP9A 3TFOA 1KU9A 4HDSA 1ZMXA 1C3LA 3B1KA 1PJCA 2Z2JA 3H3XA 1JIKA 3EZFA 4EPYA 3RVQA 2WT7B 3BL6A 4RV4A 4TV7A 4C43A 1CUSA 3WISA 4MB6A 3PQ5A 1V8FA 3VVBA 5F3WB 3TMOA 3S3MA 4P32A 3CY6A 4OH1A 2WU4A 2HJGA 3QFSA 3AEGC 1ODJA 2BKVA 4U3JA 3TDMA 5AVWB 4QDXA 2VAWA 1ATZA 1KSFX 3QH4A 1CVIA 1IUPA 1AZTA 3DCNA 2X9GA 1CUIA 4Y6QA 1NWCA 1H66A 1OX3A 2QNIA 2YNYA 4I50A 3DLHA 5DHAA 5LD2B 3NIDB 3ESYA 3PJSK 1YO5C 4P3OA 4I5DA 2KKOA 2RHWA 5BNGA 3DUFB 2X3YA 4R1OA 2GS9A 4P80A 2OAP1 1OGIA 1PS9A 4ACAA 2WE7A 3S28A 3NWOA 1VF5C 2RK4A 3EG9B 3VX3A 4TWIA 3M0DC 1ODKA 3P8MC 3ESBA 2W7TA 5CA1F 2XPCA 1MLDA 3MAJA 3FUXA 1A5TA 2IXAA 3MC1A 1OXVA 5KYGA 5BUCA 2IU0A 2VPYA 2JIQA 3G7UA 3O4HA 1M6YA 4GC9A 1SK8A 2WG0A 4A3KJ 3KLBA 2GCEA 3E22A 5DZSA 2X23A 2GO1A 3PX2A 1D2NA 3BK2A 2GN9A 3WHBA 5FF9A 1U11A 5FYQA 4EO7A 4HWKA 4CKYA 5CQEA 1E79A 2XVCA 2GQQA 1FPMA 4I1IA 1HQDA 3JQ8B 3RW9A 1UF9A 2BR3A 2PNJA 2FPKA 5DXJA 4V0ME 4JJZA 3U0BA 1D8AA 2EKLA 1XPOA 1MC8A 5AWFC 3TR5A 3HCEA 4YAKA 1SQ6A 1BWPA 4HEQA 4M0DA 4GPEA 1I1NA 4UXIA 1XLTA 3JYNA 3PX3A 1FDIA 5J1RA 3L70J 2FPIA 1BCSB 3WNDA 1ZPDA 3OQ6A 3F2VA 4HX2A 4KN4X 2ACEA 2WYUA 1ON2A 1MN6A 1CFZA 4RZ2A 4OIFA 1Z82A 3UNXA 5DF1A 4M88A 3KZ1E 1B8VA 1Z0AA 2P6UA 4RIGA 1P6QA 2RCNA 3BIWA 2C5AA 3GFTA 3Q0EA 1NTMK 3KQYA 3K8OE 2Q5CA 4N5HX 5JEEA 3RBVA 3GLGA 3ZQCA 4IGIA 3ZZMA 1NRIA 2XF8A 1CUHA 1H0HA 2HXGA 4GU5A 3AIOA 1E3WB 1UFQA 1YUMA 4MNTA 1M76A 2XSZD 1AF4A 2D1SA 5CT4A 1M75A 4ZYHA 1L1RA 2E4VA 4Q0MA 1KZHA 1BIFA 2CNLA 1J2JB 1XGNA 2CRGA 1NW9B 3NALA 2KIQA 2O57A 3RUDA 3TZEA 2BFBB 2CJPA 3IA2A 3EODA 1OKRA 5AIAA 3NBXX 4NCJA 3VSDA 4PAWA 2ZBKA 1ZIDA 3TD2A 1KPGA 1TADA 4INAA 4YV1A 4DDVA 2CS3A 3QQAA 1Q7YQ 2EKZA 2JIRA 4CEIB 4PSAA 4L0CA 4AUKA 2ZJQF 3P4YA 5T4HA 4TTAA 1C80A 5BPDA 1JPJA 1JA9A 4IG9A 3CWBG 5ETJA 4B5KA 3PUVA 2VASA 3P0EA 4YDSA 2Y4NA 1QHFA 2RFLA 2HLHA 5K1YA 2XYGA 1JB9A 2FMLA 2Z5FA 5F0HA 5HE9A 4YECA 1N1DA 4JI1B 1GRRA 4M74A 4MGEA 2H18A 2UUBB 4FNOA 1DOHA 3ZE8A 3VC2A 1GHTA 3QXXA 2W6MA 8ATCA 4M9XA 1JYFA 3IQZA 2P8TA 1DAFA 5BN4B 1OZFA 3JW4A 3N5CA 3L2QA 2PRRA 3E4DA 4QXRA 3BICA 5JFOA 4BUJA 2ZT9B 1BR4A 1Q17A 4ZU3A 1DRWA 3CZAA 2FSPA 2XH8A 4IL6X 4YIKA 3ADCA 1B1AA 2OXIA 4OM7A 4ENMA 4BB5A 3A6ZA 1QCYA 2XCSB 1K88A 1Z0XA 4OAZA 1C7FA 2BSQA 3WKCA 2JGMA 4GZMA 1YFKA 2BY4A 4IFIA 2C95A 3E3AA 4KX3A 3R6GA 1YC2A 3HXQA 1KY4A 2N9YB 1NQXA 1DLJA 5A5DA 5E4YA 5CBOA 2RNGA 3LSTA 2B82A 2HK8A 3QPWA 5B2FA 3BRQA 5SY6A 2IYZA 1IIRA 4MQBA 2ZXHA 1NBMD 3AKEA 3TRFA 1BVHA 3AEZA 4ZHSA 2GAIA 3K7EA 2IYQA 3EVFA 2P7VB 4A82A 1OYVA 2E76B 4CN8A 3OV8A 3SSNA 3IJ5A 4B4VA 1P74A 2E35A 3DBHA 4D7AA 2LBPA 3MVEA 3N8KA 2CWDA 4MKRA 1QRDA 2ACJA 4P7GA 4AO6A 1VKOA 3OOUA 2ME6A 1Z0FA 3L7IA 4LY9A 4JV5B 2A84A 4X85A 3FCXA 2O8KA 2EQBA 5BWNA 2DFTA 3W9UA 3LFTA 4ZEWA 1GZSA 3L6OO 4UXJA 1U3VA 5DCWA 1RRJA 3CCRI 1I24A 1AKNA 1XIVA 4JGBA 1DDIA 3BGOS 3E3LA 3X2FA 4JXKA 3Q7TA 2IBDA 2XMQA 4C0WA 2PT6A 5EEGA 4R40A 3TAXA 4FHZA 5HDKA 4M9CA 1STOA 1SG0A 3V7UA 1W0CA 2HT6A 2DDAA 4XRRA 1IZZA 4PXSA 4RDCA 4DR4B 3DBLA 1ZSYA 4H1UA 3JYHA 1GU1A 1N5RA 3G8YA 2QTHA 3PUXA 4PSUA 1FDWA 1KNQA 3B70A 2HREA 4EYQA 4ZDLA 5B6JA 2XEXA 3U4GA 2H92A 1YYVA 3A27A 2CH0A 1F8GA 4DQUA 5G40A 3WUTA 4GUDA 1FZBA 1IB6A 1C9KA 3SOPA 4N47A 1W96A 2P5UA 2VQHA 2COBA 1BFUA 4HQLA 3HZHA 3O94A 4IH4A 5E7IA 3L00A 5H1YA 2ADMA 1TK3A 3RADC 4ENUA 5CIWA 4GXQA 1HNZB 4WXDA 1MX3A 3M7GA 1NIJA 1SXHA 3FH0A 3NOVA 2ZIXA 2QZJA 2VSFA 1S2OA 3BP8A 4JX9A 4DV2B 3O38A 1Y1VJ 1VNDA 2VPLA 3LLSA 3RHZA 1U7JA 2P41A 5AIBA 4BEBA 1NVWQ 4K6OA 3M8FA 3F1LA 3KKKA 1JMKC 1VGRA 1YS2X 4JB2A 3REOA 3NS7A 3M9HA 3GJ6A 1XMQB 4WCDA 4YH1A 1UK8A 1GQSA 3NCHA 1P7CA 4A3LJ 3SSMA 2WZDA 3GGPA 4HKZH 5EYRA 1E1QD 3G23A 1FJHA 4WK0B 2H51A 1VQ7P 1IAQA 2BMAA 1TNSA 2LXCB 2ZZNA 3CFYA 4DYCA 2X8WA 4AF8A 3ASYA 2E2JJ 4FWBA 5T3YA 1L1FA 1ABFA 1W85A 1EF4A 1Z15A 1MQSA 4N78D 2EJRA 1BDDA 3WQSB 1W7AA 3N0TA 3JZIA 4EHHA 4L15A 2JVIA 4YDHB 1U5BA 2RD2A 5H2FE 4D3SA 5TQ0A 3RAEC 3AP1A 1T1JA 2OOKA 5CAEB 1BCCG 4I4CA 1VE7A 1RZRD 4WLEA 3T5MA 3CDLA 3LMKA 1UPBA 1L5LA 3CVUA 2Q6IA 4FXPA 1ZONA 1GG8A 6GPBA 3PCXA 3SR4A 4CEIA 3R40A 3V2RA 2WC2A 4AYXA 5L3EA 2EXXA 1TO2E 2XPWA 1AS3A 1RKXA 2P4UA 3DCJA 1H2ZA 5F1JA 1EX6A 4RIEA 4QELA 5EXXA 4EZEA 3S8MA 3G4SP 4JC8A 4BOYA 2WVRA 3DZDA 5FTJA 2VHQA 3A6FA 1SBNE 4Y0NA 1AC5A 3TTYA 4PLTA 1L5QA 3H1JD 1U7MA 2I4IA 3ZXIA 3ASOH 1PUFB 1H3EA 5BR1A 2WAAA 5CVTA 1ZXXA 3DHNA 1FU4A 4BBPA 1ADFA 3ABVC 2A3SA 5IBRA 4BLOA 3WGOA 4EUFA 2Z3ZA 1B8NA 4YRGA 2PMZN 3KT6A 2Y1XA 3RREA 3HRUA 2KNCA 5IZCC 3ESWB 2X1DA 4QUKA 3NM6B 1AQNA 2HCRA 1U57A 2YHBA 2XDAA 1SEPA 1E8MA 1VI2A 1TT7A 3PL5A 1BQ3A 4BDSA 5BXYA 4I50F 1R1UA 4F1WA 4FM9A 3LOPA 3RFFA 4NKRA 4NFHA 2C2KA 1SWVA 2QW1A 2DSNA 5P21A 4TMZA 4R79A 4I14A 4TS3A 1JKRC 3CC4P 1X38A 3VR4A 1RPAA 2VA9A 2FYUK 4CH7A 2ODNA 5A6SA 2GVDC 4DIUA 1CUAA 3ORSA 4P4LA 1R37A 1MIOB 2FP4A 5LQDA 3GJZA 3I9V6 1OD6A 5C3EJ 5EKUA 4OP3A 1O57A 3K6JA 3QVVA 2N42A 1ZJYA 2XB0X 5ALJA 2RHMA 4YCBA 1Z5OA 2CBZA 4D7NA 1K3FA 2JA6J 4L4XA 2XAFA 4WXYB 1F1JA 3VU1A 4YTEA 1GOTA 4WLUA 1C8LA 2FYUG 3P19A 1RWWA 5C18A 3AFNA 5H20A 3W5AA 1D4FA 1HE1C 5CCHA 3UWOA 4Z4IA 1JY3O 1N0HA 2PK3A 1BDHA 2Q50A 2R5YA 1TKBA 1RPZA 1FYFA 3ELUA 2B99A 4PANA 2DPUA 2GH1A 2R84A 4Y99B 3SEFA 2QF7A 5IJXA 4FFNA 4R2IA 3USZA 5B5EH 1GAXA 3AE3C 4OHFA 3CNOA 5AOCA 5LQMA 4HFMA 5C39A 4I81A 2RHRA 4GGGA 5IUJC 5AM5A 4PS0A 4WDRA 4C4AA 2XVXA 2PFBA 2W0MA 1IY0A 4QZVA 2XV4S 3GFLA 4C4ZA 3QWAA 1KJZA 1AJYA 2ZI6A 5IVPA 3VC3A 1NQWA 4WFQA 3HXTA 1KHTA 1CIJA 1ETHA 4N0MA 1I3QJ 2J5BA 4GOFA 4D02A 1BH2A 5KAFC 4GPZA 3Q5SA 3KLPX 3DKIA 4IV8A 1T4GA 2HBQA 5ALZA 3LK7A 1DIOB 1HRKA 4G12A 1UC8A 3QVKA 2G08A 1J1EC 2K4MA 4ZDWA 3LBIA 4LHEA 3QVMA 3ZHTA 1DBVO 3N75A 3ZOBA 5F77A 1TUBB 1JDZA 2YN0A 2ZW9A 3DC7A 1DZ3A 2XWJI 4JXXA 2R1TB 3T7EA 1I80A 2GTPA 4FTHA 3AUJB 5HDNA 3IKTA 4DMHA 2CDNA 1QTQA 2HZ7A 1T6ZA 3QLVC 3L4BA 5B7PA 1KE1A 4LG1A 1XTVA 2YQ5A 2FAXA 4N0PA 3B12A 3H1PA 1KA9H 1N6OA 1UBRS 4BQSA 4X66B 1Q19A 3HYNA 3E70C 1W2BO 5KZMB 3C3MA 5ECGC 3RF6A 2EOAA 2AR9A 4IKEA 3T5XA 1USEA 2FUG2 5EZ6B 2ZDQA 5J4VA 1YH3A 2D59A 5APSA 5C52B 1LTJC 1BGWA 5J2TF 2PZKA 3CWZA 4CETA 2ZJOA 1IK4A 4EHNA 1M83A 5EE3A 4DIEA 3QI2A 1GZ5A 3MJCA 1Q11A 3R7WA 2XD9A 3C7KA 1ULBA 1VJ5A 4HX9A 2QRKA 3CJQA 3A05A 3D4IA 1V25A 2B8NA 3OEWA 4M8SA 3GJYA 3LIEA 1DIAA 3TOZA 3SWKA 4ZPJA 4CBVA 3MG9A 4CV1A 5K0TA 2PKQP 2ZUUA 4OOFA 5C3MA 2EFYA 3ZDXB 1BSNA 2LTPA 4JUCA 4AICA 3A6JA 1EX1A 5FIUA 3W2FA 3RM3A 3V7NA 3JRFA 1FFBA 4WBNA 1J06A 2YBEA 2NAZA 2JD0A 2DOFA 2BBWA 3BJZA 5BN3A 2ZAGA 4EZIA 3TLMA 4YXFA 3K72B 3K1ZA 4WY5A 1PR5A 3GMDA 2IYOA 4WKBA 4A69C 3PC6A 3T15A 4V1CB 1XTZA 4ESHA 2DFVA 4L6AA 1K78A 2MH2A 1T8RA 5DBGA 2P7IA 3KP7A 3SHFA 2MJZA 3HB9A 4JR1A 1O87A 3GOHA 2QB5A 1TQ4A 3Q98A 3H42B 1KOFA 2RQQA 4FOLA 2PE5A 2H8GA 2Y4OA 1KYYA 4ME6A 2LBFA 5FJ8J 4MQMA 3VR6A 2C9CA 3TSIA 2P9HA 4E12A 2Q2NA 3ZDFA 2I3DA 4S12A 1D5VA 1B6RA 3H92A 2QPOA 3M2PA 1SWWA 2DKNA 4QOFA 4BXXJ 3ZWOA 1DAOA 3W05A 4B8XA 4CDNA 3E3OA 3U7HB 5APTA 4CCNA 1ZEJA 5A2QK 5EFZA 2RH8A 1G4DA 3PNYA 3HPQA 2XGJA 2RHHA 2R65A 2NPSD 5K3CA 3W5UA 1WXDA 2V7QH 4CQJA 1R0YA 1TRKA 4DQ2A 1LH0A 5JSFA 4MW9A 3CE6A 1ZGWA 1BCSA 2MYTA 4DLZA 1E5QA 2PSSA 5FTWA 4RTQA 4KYUA 4HAXA 1XEXB 1UJ2A 3FWPA 1EFPB 4GSYA 4WN9A 2J32A 3ZV7A 1JKXA 4XFDA 1T9AA 3CP2A 4JYCA 1GL6A 5B1EA 2ONZA 3UPTA 5DTJA 3LY5A 2PAJA 2O52A 2OENG 4IKFA 5JLWA 2IU6A 3ZPLA 4CDMA 3G5MA 1WAMA 3EXG2 5G41A 3CX5D 1JJBA 1XYGA 2UVPA 3BRWD 1QP8A 4KT5C 1H0TA 4OGQC 1VJCA 4EG0A 2VJAA 4HBGA 4QTUB 1JIVA 1IG7A 5F27A 2O2SA 4Z3DA 2PU5A 1VECA 3H04A 4A5OA 5CXXA 5FPSA 2OV3A 2YINC 2HRBA 2LFBA 1UBEA 3ICVA 3QW2A 1IM8A 5BYAA 2WWGA 2Q8NA 2IUEA 4ZHQB 4LRQA 1GLVA 10MHA 2QPTA 3W90A 4AKIA 4EI9A 1W4RA 4P0TA 1OYWA 2A78A 3UXHA 4IV5A 1SANA 2CDAA 2FMUA 3BRTB 3G71P 1HNNA 2NACA 3ASVA 3KKPA 2FWNA 4CTJA 4HGQA 3KB1A 4TZTA 5IBCA 1E7QA 2WF6A 1RBZA 2QRMA 3NM4A 5J59A 4CUZA 2J30A 5CDYA 3DP9A 2WHRA 1GTJ1 4H9GA 4HP8A 1GVJA 3T61A 1G7CA 2JC3A 2AMFA 1XU7A 2NTJA 2DMTA 1NTMD 4JI2B 3ZZTA 2BYTA 1B9NA 5DNYB 1XVTA 3RC9A 1WP9A 3HTUA 3SQDA 3V8EA 1MVOA 4OHPA 2Q6VA 4IWYA 4AXBA 9GPBA 1HQCA 3E9EA 1EE9A 4NZYA 3TKAA 4MVYA 3FNGA 4W9RA 2BDEA 2BTQA 4BNCA 1HTTA 1TVKA 3MQ4A 2XB8A 1S9KE 5DUKA 5A2QA 1AUOA 2HU8A 3N97A 2PFXA 4PLGA 1B73A 3CSUA 2B36A 4OHZA 4MCIA 1IO4A 3FSGA 4JSRA 2ZNYA 2QLZA 4HDNA 1RIIA 2VTEA 3W3AD 1U2TA 3NDJA 1KEEB 5JZSA 2NT4A 2G5TA 1H9AA 3N3BC 3IP6A 4YRNA 2KL4A 3B53X 3PD0A 3OWOA 4CFZA 3ZNQA 5BW5A 2IU3A 2YY7A 3DDNA 2PVPA 4E21A 2OCBA 4CM9A 1RVV1 1XZMA 4LBVA 1FZCB 4H7HA 3EJ6A 4QYXA 4TRRA 1Y8AA 1WWKA 1YXMA 3HM2A 4V2UA 1SZCA 2I0FA 3T34A 1I36A 2L7KA 1A02J 5DX0A 4JQZA 3RFCA 1Y48E 2PD4A 1EE2A 3I39X 4KQHA 4PSKA 2IEYA 3LOCA 2QG4A 2BIFA 3H83A 5AI6A 4D0GA 1BXKA 1YE5A 3KR0A 3RVRA 4RTMA 3NHWA 3RJPA 3OW2O 1A72A 2COEA 3A3NA 1BDMA 1YACA 1A76A 4Z49A 2JLAA 1IBLB 1U8CB 2KYVA 2P90A 3FBTA 1MW8X 4KDPA 4MPJA 1BXRB 5C8YA 2VI6A 1UP7A 2Q7XA 1TKCA 5KDLA 4HJXA 3ENNA 1ZNZA 2EL9A 2C29D 4OI1A 1UBUS 4DAEA 3K9CA 3KQNA 4RPCA 3VR6H 4J0JA 1N7LA 1QX3A 4E1AA 3HRKA 3AB3A 1HEYA 2H7CA 3SC3A 1SVIA 1XA0A 3OPVA 4IL6E 2O1SA 4HF0A 2DBZA 5IBQA 1T9KA 4X1KA 1RM0A 5FOTA 2F7SA 3FMQA 2C61A 5G0UA 1ZUIA 5BS6A 2KRFA 4NPDA 1AJEA 3SSOA 3ZCOA 1GAWA 1L7OA 1SQ5A 3AVWA 4ASUA 1IUNA 4M8NE 4DBZA 4DSZA 2FWMX 4GE3A 2PS3A 3L2RA 1V3QE 2LKPA 3BJMA 1O94C 1OTYA 2I8CA 2WU3A 1R64A 2A5JA 4L07A 3ZX5A 4J4BA 1MGTA 1V4BA 4MYDA 3RUHA 1PV2A 1MSFC 3KFXA 1GPKA 4G5SA 2OXRA 1CQTA 1V7PC 5KDDA 4HI0E 3OLYA 5AW7B 3NRBA 2JRMA 3MIZA 4KTVE 2YS7A 3VNVA 1W29A 5F0CA 2P9ZA 2XGEA 1P3DA 4IIVA 3WTUC 1BROA 1LRLA 1VQNI 3JPWA 1EINA 2HL6A 1U0EA 4C4SA 2VT7A 5HJEA 1G5RA 1GUYA 2TCTA 1GTMA 5JCPA 3A2LA 4M21A 1LKZA 2QIOA 1KYQA 4CLDA 5KWVA 5JC1A 4TTQA 4C76A 4QU5A 1ZM3A 4HDAA 4DLXA 1RW4A 1IDOA 2B9SA 2YS9A 1ZD8A 1HDDC 3OFSA 5DSXA 1FLAA 1YIAA 1JIJA 1MRNA 2FDRA 3DFGA 2XX3A 2DTXA 5ICGA 1UDRA 2OZEA 2CO5A 4FHTA 2PT9A 5IAGA 1RAFA 1A9TA 4BLPA 5LXTF 2QV7A 2E37A 3INTA 3EFOB 3JQAB 2Y77A 4Z9XA 2VFAA 2GMWA 2VNSA 1OCEA 3IHKA 3LT0A 4KJXA 1RCFA 5A9TA 4RD0A 1GL9B 2ZT5A 2CN1A 2K4JA 1NUHA 2E6KA 3VTPC 3RUCA 1E8DA 2YJTD 4KMFA 2Q5IA 5ABPA 3ZOZA 2FSIA 1N92A 1R8SA 1WZIA 4JENA 3PVSA 1GDHA 2H0AA 3AEQB 3QMPA 5F5LA 1JQ3A 5AW8B 1PWHA 4WBNB 1FNBA 2BE5F 4ESBA 4H6XA 1LRJA 5KOIA 2FPUA 2PPVA 2GUSA 3L1PA 2QUIA 3AJ8A 1XCBA 2GRJA 4RZQA 3RWMB 4XLLA 1X9VA 4QFCA 2AHQA 2QA4I 4RF3A 2IFTA 3VA7A 1LJ8A 2WA1A 2BTQB 2PQ2A 1ZLKA 1G6HA 1N8NA 1DBWA 3PDJA 1G2HA 1Y7HA 1NAHA 2O5CA 5TDHA 4FHFA 1A2KC 4V38A 2ZS9A 2EDCA 2BGKA 1P0PA 4HL6A 2J3QA 1Y0UA 3OLXA 4U7BA 4BAZA 4NCKA 4ZI7B 4O4LB 2HK9A 2E2WA 3TQRA 5JOQA 2GOXB 1Z45A 1E18A 3HHPA 2J5QA 2X0EA 3O8OB 1SQBD 4Q6WA 3F9KA 2C31A 5DYMA 3BMNB 1H23A 3NANA 2FW6A 4QA9A 1YDHA 4D41A 5A6SB 4Y7NJ 4ZKEA 2OB1A 3DAGA 3NQ41 4BNDA 1ZZGA 5L4LA 3GLKA 3IUQA 5CXQA 3LXRA 3FHZA 1AGYA 4J0DA 1EUZA 1JSXA 3H5IA 4EBFA 3HYLA 4KN7X 1KZ7B 1I7SB 1SOWA 3WWEA 3Q4GA 3BAFA 5GWXA 4GOXA 1LF0A 4EVRA 3U9LA 5BQTA 4JVMA 3C6MA 4NHOA 4QBKA 2VKVA 4LNAA 1FRFS 2LPMA 3S2WA 2CZQA 1TLLA 2AQIA 3NYIA 2KIMA 2DFKB 3GC6A 5CT5A 2CNKA 3M8EA 5BSFA 2ZUDA 5DN9A 1BEZA 2QRNA 3A06A 3TXXA 2OLJA 1HE4A 4B46A 2H1KA 4A3GJ 4OQ4A 5TX7A 2ZULA 2BGIA 4ZGBA 5KTKA 2G1JA 5DJ5A 4B1FA 2Y27A 5J2TA 1WEKA 3R8XA 4C0XA 3ND5A 5EHIA 2J5PA 2OTJI 2FA9A 3FK7A 2QEXP 4TM8A 2X0DA 1JY2N 3W1EA 3HE5B 7MDHA 1Z3CA 3D3EA 1L7DA 4L5YA 2Q8PA 3WLKX 1W6UA 5DM7F 5DJTB 2MTBA 4MLDA 1HSJA 2R2AA 3I71A 3G9ZA 3FOCA 4OQZA 2CLDX 2GVNA 4RVSA 2VPIA 2J48A 5HNKA 1SHUX 4WTOA 1Y7PA 1NAYA 1P0MA 4AY3A 1WXFA 2MH9A 5HQ3A 1V9LA 1XX5A 4MO9A 4QOHA 1ZGJA 1LFAA 4ZD6A 3W2TA 1TM5E 4Y6PA 4BVHA 3IALA 1JTFA 1GPLA 4MR7A 8ADHA 3HUEA 2C3UA 1U7TA 5FFNA 2V45A 2W24A 1B42A 4QNNA 4IOMA 1UZNA 4BX2A 2WWVD 4NONA 3AF2A 2CG4A 4ZTJA 2X8BA 3BH6A 2JK0A 1PVOA 5A4AA 1SQXE 4MV5A 3UJ3X 2B1JA 2VHYA 5BSMA 4UE6A 1BCCE 3LPMA 3TBIA 4FIZA 3ESDA 2CHUA 3ZCRA 1S4MA 2H8PD 3B5NA 1V7QA 4MI1A 5M5WJ 2I6GA 4MV3A 4LOHA 4MVJD 3L4EA 2JI7A 2O0LA 3HHEA 1U8TA 3M8KA 3HADA 4TZKA 4HEJA 2NADA 2ATEA 1AU9A 4JL6A 4IXDA 4P3KA 4M1MA 2BFFA 2LY2A 1P2DA 2Z56A 4OSEA 1PUEE 3D8RA 3AJ9A 2ZJFA 4RJJA 5LZ5A 3F78A 1N7SC 5LYJB 3VWBA 3I59B 4UDOA 4R51A 2GD6A 4Y3UA 2KB0A 5C5CA 3SC2A 3IIKA 1U6JA 1J59A 1GA6A 5IJ9B 2B3TA 3A9CA 2XCLA 2V6BA 3CF6R 3QWBA 1QZUA 4O8CA 2VXZA 3CJQB 2W4SA 1EFVA 3X43A 1P39A 3HN2A 4DG9A 3ZBUA 2L0XA 3RRJA 3ECCA 4G1CA 3WIUA 1GVDA 2GXAA 2K02A 2AKEA 1WQ4A 3SNKA 2ZJSE 2H2AA 3ENQA 1PR1A 1S7GA 5CH3A 1ECPA 1V39A 3T1TA 4C2MJ 4V0QA 4RIFA 3E05A 1SFCD 1HDXA 3RL0D 5FUWA 5E2IA 3RSGA 1ORTA 5IDYA 4NZMA 3OT5A 4W7YA 2O48X 3SVLA 1QXSA 3O95A 1VFNA 2AN3A 5EE5B 2MINA 2WSYB 5AW8A 1OXXK 3DXZA 1ZK1A 3VYWA 1VMEA 3NC4A 4MWEA 4A2PA 5B66E 4HX5A 2ODQA 4HLUA 3CG4A 3K6KA 3MT7A 3ACBA 2JUGA 5B2EA 3GH1A 4IWNA 2IT0A 4FQGA 4MQEB 2MINB 4Q1BA 4XIFA 1UEJA 2IXBA 1UBHS 4D44A 1U8FO