1ZR2A

Structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination/dna
molecule keywords TCAGTGTCCGATAATTTAT
total genus 46
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zr2A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zr2A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zr2A01
1LE8B 4A3FJ 2CQXA 2Y0SN 5IP7J 3H3VK 3G1LA 3UKGA 2EH3A 1UMQA 5EGOA 1Y1WJ 2XB5A 1IV6A 1MBEA 1HCRA 1ETWA 2R5ZA 2NS8A 2X6OA 1BW5A 1AKHB 4X6AJ 5IPAA 1MBJA 2JA6J 2X48A 2DTZA 2LK2A 3G1MA 4A3JJ 3TP3A 1RKTA 2FQ4A 2WB1N 3SDGA 2GM5A 2CU7A 5GP9A 2M9HA 3NARA 4BY7J 1ETQA 3E7LA 4DYRA 1JGGA 5E3OA 1Q1VA 1IRZA 3BTLA 1MBHA 1IUFA 2LFBA 1PUFB 1IG7A 4J19A 3BR3A 1SFOJ 3HDDA 3S1NJ 3TEDA 1K83J 2MW8A 2L7FP 3GBGA 2R5ZB 4DYQA 5F1JA 1ORKA 4BBSJ 5F04A 2JWTA 4IHXA 3BTCA 1ZGWA 3S14J 5J1UA 5EF6A 4JYKA 5F08A 2E19A 4MFEA 1IDYA 3GUVA 4JX4A 1IDZA 3TW7A 3GTMJ 5K7FA 5C44J 1JTYA 2FX0A 5EDNA 4UUSB 2DA5A 5EGOB 4M3FA 1IC8A 1RR7A 4A3MJ 2NVYJ 4XICA 5DS9A 1I50J 4A3IJ 2XRLA 3DCFA 1FTZA 2GBYA 2HXIA 3I4MJ 1HF0A 2VPRA 4M3BA 3D1NI 1TWFJ 3CDLA 3RZDJ 2MG4A 2E2HJ 3M3YJ 4M3EA 5J1YA 4FISA 4D7NA 3OIOA 1JKOC 1ZR2A 3FIWA 2I10A 3DEWA 3FKIJ 3JRHA 2QF7A 1VF9A 1HLVA 1ETOA 1G2HA 3S2HJ 2JK3A 3BQZA 3JR9A 3OOUA 3M4OJ 2R7ZJ 3JRAA 4UUSA 1GVDA 3LHKA 1Z0XA 2IAIA 1B72B 1MBKA 1LE8A 4IHYA 2DMTA 4LOCA 1MH4A 3I4NJ 2Y9ZA 4DZJA 1MSFC 2NOGA 4W97A 3S16J 1OCPA 2NVTJ 3WHCA 4JP0A 5FKNA 4MLOA 4NDLA 3ZQIA 2NVQJ 1JKPC 4HNVA 1JTXA 1F36A 3FISA 3JRGA 3IH3A 3JRCA 5E3MA 1QPIA 2M0CA 2X9DA 1VNDA 4D5FA 2H8RA 1TC3C 2HXOA 4CYCB 2Y9YA 1U8BA 2DJNA 3HOVJ 2EZKA 4MO7A 5E3LA 1RETA 2JA5J 1H89C 2AO9A 3B6CA 2Y31A 5DTDA 5EYRA 3S1RJ 2XGCA 5K7ZA 1NK2P 4M3GA 3ZQFA 1GUUA 2COBA 1QRYA 2IBDA 1E3OC 4G12A 3GTPJ 2DA6A 4M6VA 1DU6A 1WH5A 4GFBA 1LFBA 1SANA 2L0KA 3HBLA 2LTPA 5FLMJ 3TP0A 2HOTA 2NVXJ 2KDZA 1ZR4A 3PO2J 3MVPA 3CMYA 1ZK8A 5M3FJ 1ETVA 1APLC 2P81A 3RKQA 2ZB9A 5F0HA 4M3DA 2ID3A 5F0CA 3S1QJ 4DZPA 4A3EJ 2DA7A 1EF4A 3BR2A 2K9NA 4JX6A 2H1KA 4A3KJ 2QCOA 1YRNA 3HOZJ 2XPWA 5IOYA 5M5XJ 3ZQCA 3F0CA 2DN0A 3BG9A 4A3BJ 5M5YJ 1H88C 3HKZN 4S0HB 1IJWC 5IYCJ 2HQ5A 1FJLA 1HOMA 2DMUA 4D7MA 9ANTA 3CQZJ 2VUMJ 3HOUJ 5JLXA 2N8GA 2LVSA 2O8KA 3GTLJ 4B3AA 1HX7A 1P7IA 2D5VA 4QIWN 5C4XJ 3O8HA 2YUSA 1X58A 3LOCA 2K9QA 1WPKA 3RQIA 1HDPA 3BG5A 3GTJJ 1PUFA 2MHCA 4IHVA 4L5EA 2CRGA 4RDUA 3IH4A 1D5YA 3S17J 5IYDJ 2E1OA 1Y1VJ 3A02A 2JA8J 1POGA 2XGDA 1MBFA 3GTQJ 3BG3A 2EZLA 1JUSA 1NK3P 1VFCA 3PO3J 1JUPA 1X2NA 2DA2A 2FD5A 4A3LJ 2MSYA 3FK6A 4A3GJ 3UJ3X 4QTRA 2LKXA 2ME6A 1B72A 3S2DJ 4A69C 5FKLA 5IP9J 2R5YB 1CQTA 3LHFA 5E3NA 2KT0A 2CQQA 2OPTA 3JREA 1AHDP 2VI6A 3BQYA 3LSGA 4C3IJ 4XIDA 2L7MP 2YU9J 3ZQGA 2WV1A 3CCYA 4RBOA 2XB0X 4ABZA 3A01B 1OFCX 4BBRJ 4I6ZA 5C34B 1U9NA 3IH2A 1WI3A 2R5YA 1ZQ3P 2HI3A 4XK4A 5BNGA 3HOXJ 5FJ8J 1T56A 2JN6A 5FKOA 1A5JA 1K61A 2PMZN 2GM4A 3HOYJ 1GV2A 3LSJA 3QQAA 5K7HA 3S1MJ 3ILXA 5GPCA 1ETXA 1GV5A 4Y7NJ 5F27A 2CUEA 3BR6A 5C4JJ 3FK7A 3ZOBA 3MKLA 5GPAA 3Q0UA 2IEKA 1ETKA 5FKMA 1ZTRA 1MH3A 3JRIA 3BTJA 3L1PA 3S15J 1Z77A 5M5WJ 3PKZA 2HOAA 2ID6A 2VKEA 2Y30A 2R0QC 2M2EA 2ME0A 1T33A 1U78A 1TWGJ 5J3LA 3HB9A 1A6IA 2E2IJ 3HEFA 1UHSA 1WGXA 1H8AC 4MFDA 4W1UA 1JUMA 2AHQA 5EG0B 4DYCA 3JRFA 4C3HJ 2DMNA 2ECCA 3Q0VA 1GT0C 1XS9A 3BR5A 2JJ7A 3BTIA 5FLVA 1ZKGA 2CJJA 3HGYA 4EEFG 4I76A 3BVPA 1BA5A 1QVTA 1ETYA 1MSEC 2LLKA 5IOZA 3QPSA 1MBGA 2RAEA 1W0TA 3BR1A 3GTKJ 4B1RA 2TRTA 5IYBJ 4XRSA 4C3JJ 5F0FA 3Q0WA 5C3EJ 2R92J 3K2AA 2GLOA 3G13A 5FKKA 3A03A 1QVUA 3SJMA 2G0EA 2XPUA 3MN2A 4FTHA 5C32A 1RPWA 1TWHJ 1GDTA 4JX5A 2HDDA 5JLWA 3GTOJ 3QPLA 5EZGA 3IV5A 2LR8A 2CUFA 1JKQC 1XG1A 3PM1A 1DU0A 3Q3SA 1B8IA 1RESA 1BL0A 3BT9A 2ELKA 4BQQA 1RKWA 3GTGJ 1YRNB 5EZHA 1S7EA 2DA3A 2LY9A 1JT0A 5EG0A 1JJ8C 2DMQA 4FE7A 2L9RA 5C35A 2W48A 2EZHA 1FIPA 3K7AJ 1BW6A 4AUXA 5M3MJ 2HOSA 4MIMA 3SFIA 3LNQA 4D5CA 4QSHA 1ENHA 1JT6A 1XC5A 1OJLA 4FE4A 3O8GA 1MNMC 4X1EA 2O9LA 2LP0A 3TW6A 3HM5A 5C31A 2DMPA 2YS9A 3BR0A 3JRBA 1JJ6C 2JA7J 1FEXA 2O7OA 3WHBA 4FCYA 4B4CA 4CYCA 1TWAJ 1FTTA 3LSPA 1IGNA 1ITYA 3H0GJ 1OCTC 2ECBA 3LSRA 3OSGA 1W0UA 1JKRC 2EQRA 3JRDA 3HGGA 4AC0A 2VKVA 1HDDC 5J1RA 3ZQLA 1FIAA 1B8IB 5IP6A 2DA1A 2DA4A 1BJZA 1WH7A 2MGQA 4Y52J 1X2MA 2Y2ZA 3NAUA 3HOWJ 2HYJA 2TCTA 2OF7A 2XGEA 1AU7A 1AKHA 2M34A 1WCMJ 3G1OA 2E2JJ 4BY1J 2EZIA 3W6VA 2B63J 1I3QJ 3B6AA 2NS7A 4XRMA 1UG2A 1O4XA 3C2BA 4A3CJ 4IEJA 2L7ZA 4V2FA 1R9TJ 2RSLA 2R93J 2K40A 5HODA 3VPRA 2WAQN 4UUTA 2XSDC 3OSFA 3ZQHA 4IHWA 1VI0A 4A93J 1GHTA 2JMWA 3A01A 2XPVA 1LFUP 4BKXA 2K9SA 4BXXJ 1U9OA 1NTCA 2EBIA 4AYBN 3RZOJ 1P7JA 4XRSG 2LD5A 4C2MJ 4DW6A 5EEAA 2M8GX 1I6HJ 2FJ1A 4V2GA 1F43A 1TWCJ 4A3DJ
chains in the Genus database with same CATH superfamily
2HA4A 4HPQA 3JATB 3GFTA 4Y2GA 3KZCA 3WIEA 1UBRS 2JARA 3CRZA 4BDSA 1VG9B 1I4DD 1WXHA 3QWBA 1MBEA 1C7IA 2IK8A 3H8WA 2OFXA 1TF5A 3PWKA 2QRPA 4OM8A 1NJIQ 5A0TA 1XVVA 3K1MA 1X1AA 2GLTA 3GF3A 5APSA 1I1OA 4CUJA 5J4KA 5KOHA 1A4IA 1X1DA 4Y98A 3R5KA 4JSYA 2OOSA 4BMZA 2GEVA 4MVJA 1EA7A 3EFEA 3M9AA 4X92A 3PC2A 4IRUB 4P3KA 1G8YA 1FBMA 1S8NA 1U2PA 3RRMA 3GCDA 1DIOB 4PX9A 1NG7A 1KB9E 1GQRA 4QJIA 3LJKA 2HEIA 1L7DA 1WB5A 1DBSA 1TQDA 4BFYA 4MITA 2GZRA 2VHXA 2WVAA 3D3EA 4PD4I 4J3NA 4BZZA 4C21A 3N6VA 4DSAA 4M3BA 3L74G 3DXXA 4K35A 2KYVA 3A70A 5BNTA 1PS0A 4RV5A 5K0LA 1GL3A 4EUNA 4ZAVA 5D5XB 1QV6A 4HWOA 1WWXA 2UVPA 3RB8A 3S2HJ 1HSTA 3Q8XB 2WT8A 2R5DA 5ECDA 4RTKA 1HT2E 1GILA 2O8FB 2NVTJ 3I12A 4UM5A 4YLYA 3I59A 2WTEA 2BONA 2WSYB 3VZCA 3LUAA 1ND6A 2HJRA 4JKOA 3LUBA 1Q1AA 4CYCB 1SUSA 2CFXA 4FZVA 2RAUA 2WF7A 4F4UA 5JC8A 4I2NA 5FAXA 1E5WA 2A45H 1AZTA 4JI3B 3F6EX 1VSBA 1EP3B 3BJEA 2MWMA 2M87A 5B36A 5B64A 4FUQA 2UXNA 4UATA 1IBMB 1P6QA 1W2HA 4U4AA 2ST1A 3UT0A 3WQQA 3S6JA 4PAOA 1S4MA 2WY7Q 1I0IA 3AIMA 2V7PA 1ZD5A 5A9TA 3BR2A 3DZKA 1XDSA 1E2FA 4G23A 3EEQA 4ID9A 4HP8A 4FONA 2VUMJ 4IOLA 4MVWA 1E9VA 2E1CA 1XA0A 2XAGA 4D43A 3O8HA 2WIKA 2CFOA 4JIGA 2HZBA 2L5GB 4XJSA 1Z6RA 2H1SA 2PYIA 2D4AA 4W6ZA 3H9UA 3BJ6A 4FFVA 4R0NA 2ZAOA 3FX0A 2E4ZA 2D7CA 4I1IA 4P54A 4QELA 3KHUA 2N1TC 3QEJA 4ILKA 4P84A 3L74E 1VGVA 5I8ZA 3URMA 3JC22 1I6LA 2EILH 2RNGA 4L9WA 2AZ4A 4M98A 4ZYZA 4NVRA 3MMZA 4KR2A 2FSHA 1Z4JA 1R6UA 3AFHA 1XVLA 3OKPA 2LIPA 3B7PA 1NVGA 4UFOA 3FHJA 4WXYB 3IAHA 3M4NA 2GD2A 3GGGA 1U8AA 4FS8A 4H3HB 4Z0PA 1MJNA 4XM2A 3GWGA 4M76B 5D3ZA 2RE8A 2VP5A 4NU6A 1KJYA 4XD7D 1SAXA 1V5GA 2HB6A 4BCBA 3THXB 3INTA 1QDEA 2I1KA 3I34X 3PHBE 5HKKA 1A36A 5BSHA 3U4HA 1Z17A 2QBYB 1IE3A 2Z8YA 3NW9A 1SXJB 1E69A 2XGOA 3DNMA 3EAGA 4P92A 5E8IA 3QK7A 1OCRH 3HI6A 4HQ6A 3IODA 3HYNA 5K8VA 5KVRA 4ZC1A 4FTHA 3R5SA 4RDIA 4OA5A 4BVJA 1SOAA 4NYMR 3VBEA 2O8NA 1VBKA 1BRMA 5MN6A 3O5AA 1G21A 4F3KA 2JUGA 1RKWA 2YWXA 1IXCA 4MO2A 2JAQA 1QR2A 4M71A 1BJAA 4BQEA 4OFBA 2W83C 1A7AA 3FFTA 4PXAA 1L5OA 3NONA 1HGVA 2W84A 3WMFA 2OORA 1NW6A 4NMWA 4II3A 2C61A 1FEXA 5B12A 4WI1A 2X0LA 5EESA 3QG5A 5D2CA 5FXMA 4YTEA 2AS0A 2DE0X 1SC4A 3I2YX 2CXUA 4LG0A 4D25A 3ORQA 1UP6A 3V1MA 1NTMJ 1GMJA 4XZ3A 4HGZA 2EL7A 2FUKA 5H0IA 4RGXA 2F4IA 3D4BA 3CF4G 2FPGB 3SZUA 1T2KA 2C03A 4BLWA 1A9SA 3OTHA 3WTXC 2OP1A 4C03A 4M0DA 1Z8HA 4HZGA 5ISMA 3L4FA 4LRSB 2IA0A 5B53A 3GCGA 5KAFC 4EUSA 4AYBN 1GD2E 4PLVA 1M0EA 5JBNA 1HG1A 4NEGA 3NBXX 3IF4A 2L02A 1J75A 4FYMA 1PR3A 4IIVA 3N2KB 3CCVI 4QBGB 1HLGA 3G1MA 4AIJA 3ZDXB 2QRNA 2IYOA 2M9HA 3UMYA 2HUNA 2EIXA 1AUPA 1DFHA 4EJFA 2QQBA 1G5IA 2M1BA 1K05A 4HYYA 2G9NA 3ZN2A 4DGWB 4L18B 2WWYA 2NIPA 4L8WB 2J67A 5HR5A 3OT5A 4KLAA 2N75A 2FX0A 1IK9A 2I2FA 3CUOA 4OMZA 3OX4A 1E2NA 4B1FA 2X3UA 2J0QA 2GVNA 4ASNA 4D9GA 1KERA 2UWMA 2B6HA 2OV3A 1XD2A 4C7OB 1SQBD 4X8OA 1K9VF 4NBSA 4AZ0A 4KO2S 4QQRA 4EQQA 3X2QH 2R7OA 4BJ3A 1B72B 1L5VA 1J4AA 3FUTA 4C1BA 1C9NA 2OO5C 3M49A 2BGWA 2YX1A 2B3DA 3QUAA 3NJRA 5EHZA 4EHLA 2JGLA 4JB8A 2V4UA 3E8SA 2V7TA 4MQ9F 3TVTA 3AQIA 3FKSA 4YDSA 2V03A 1ZEJA 2XKPA 4HNHA 3C18A 3HSYA 3CE9A 3USES 4LMYA 4BWYA 4UEQA 4A4DA 1W4BA 1QPMA 3H3XA 4GOKA 3UOWA 3HKEA 4PQGA 2AHRA 3VYUB 2P10A 5KREA 2D0PB 3RNOA 3GRZA 3ASYA 1SBNE 4Y9DA 4LYDA 2AMYA 2GBPA 1E77A 5TDHA 4R8SA 2PT6A 1O1YA 5I9NA 3L6UA 4RORA 4I02A 4MGYR 2ZYTX 2PL1A 4JLNA 4S0HB 3VKUA 2AQHA 1GZ5A 1G2QA 1RYNA 4MQVA 3AW8A 2Z43A 3ZHVA 3HBJA 4E1VA 2GZMA 4ALJA 4PJ0H 4DHEA 3I56P 3LHSA 4D42A 1NVWQ 4AIKA 1JCDA 1FBNA 4GXNA 3PGKA 2JA8J 3HYSA 1ZJ4A 1QRRA 4U6QA 1TUEA 1PP9D 1U57A 1Z8NA 2AOVA 1SLQA 4U7JA 3MCWA 4PF1A 1W0JA 2QBYA 1NVOA 2IIBA 4CM7A 3BPSA 2NVUB 3GHGA 2XA2A 2XE7A 1ZK0A 2FAXA 2I8DA 2WJ3A 5ITZB 2AXNA 4MRVA 4TKUB 3G0CA 1ZDMA 3OZCA 3A27A 1VE5A 1YUMA 2W0SA 2PFGA 1OPRA 4A8JA 2YIVX 4RESB 2BRUC 2V45A 4O4JA 1ILWA 5IF9A 2ZT6A 1YW7A 5M5WJ 3ROXA 1KU0A 2R0QC 3VSKA 2ZJBA 1RRVA 5LRSA 2PEXA 1XLUA 2WF6A 1YDMA 4BACA 1HUCA 1SD5A 2VUHB 3AFMA 3I09A 1ZM3A 1I5OA 4NCNA 3SIXA 3CEAA 2Q3IA 1II8A 3DW3X 3SZTA 3KSRA 5HVNA 3E6BA 3I1JA 4RELA 5ICSA 4ZZ1A 2XUFA 1OGIA 4H0NA 1Z47A 3PS9A 3G5MA 4D0SA 3I2KA 1YJWP 3HV2A 5SZHB 3A6EA 4B3FX 1W96A 2ZI6A 3EXAA 4UU1A 5DE3A 4Q34A 1OGJA 2O8VA 3IRUA 1D3YA 4ALIA 4N5IX 3QXXA 5FUXA 1JX6A 1GVNB 5CA0F 2G3AA 1M2HA 1PEAA 2R8EA 1MD0A 4OEHA 1DOAA 3KKQA 2CUJA 3PXBA 4DRYA 1ONPA 3TIFA 1Q14A 2V7QD 4JITA 3OFNA 1T0HB 5JS7A 2XCIA 1JHRA 4BRSA 1RZ3A 1FIPA 1TF7A 3ES9A 2RHHA 4UMFA 3G6KA 3L02A 1KPHA 3M82A 4NCBA 1VB3A 3DAPA 2DBBA 4CGYA 1YFZA 5JI2E 3H35A 5BSRA 3F3XA 3K09A 2ZAEB 4WADA 1HQDA 1OCTC 2F5EA 4YI3A 3DPSA 4JQYA 4UB8E 4PC7A 5J4HA 3SKVA 1XCJA 1Q91A 1Z45A 1CV2A 3RRZA 1QKJA 2OAQ1 1LTBC 2IDJA 2XTAA 6GPBA 1JTVA 2J9ZB 1A9RA 4TQAA 1WW2A 3OZSA 1NVAA 3Q1KA 3SDBA 2K40A 1T8ZA 3CVUA 1RM3A 2O8FA 1TTPB 4W5RA 4IHWA 4MYUA 1OI7A 2E5FA 2C5GA 3Q7SA 3RG8A 4CE6A 2C5LA 4WACA 3H5WA 3Q7TA 1N8SA 4A3FJ 4NBUA 1NIPA 5K1ZA 3LIEA 4RCVA 1UMQA 5EGOA 4YA6A 5D5VB 1Y8CA 4X61A 1Z18A 5JYBA 5EJEA 1A77A 1T3HA 3I8OA 5JANA 1TAGA 3W79A 2NP6A 3GNLA 3K09C 3FNBA 1N5IA 1U7WA 2GN8A 2HRBA 1CB7A 4BO5A 4Z3OA 3PRKE 1V7QA 1CQZA 8AT1A 3VP9A 4EUEA 1S1CX 4Z7QB 3V8EA 3N2EA 3BHIA 2PZGA 1F6DA 3E9EA 3ICEA 2R4QA 1YGPA 1SHUX 2YWBA 2QTVB 1BE3G 4Q1EA 4KE8A 4E13A 4HEA1 5FHQA 3LQRA 2QQ0A 1HWTC 1ETOA 5JLAA 3FPFA 3DM5A 3NDBB 2RJOA 3NGXA 2C54A 4R54A 3JAWA 3LH5A 1N3LA 4B8YA 1XZCA 2WBMA 5AR1A 3VO8A 1K4SA 4U2EA 5DEIA 1D03A 3ICQB 4WY2A 1PJ8A 2CW8A 3VR6A 3KWFA 4FVTA 3HOVJ 1M2VA 3BRQA 4CV1A 1E9EA 1H1DA 5DTDA 5IZ4A 5EIAA 4P4NA 4EAAA 5TNXA 1YQGA 4TWRA 3ZQFA 4YXWD 3ERCA 1NX9A 4XR4A 3WS7A 3H1KG 3D5EA 5KIAA 1HDYA 4D0NA 4GQIA 3O74A 4HDQB 5I7SA 3CCRI 4C14A 4INAA 3SXPA 5IKPA 3R0XA 3GYGA 2H1KA 1DRJA 1PEKE 3K2BA 3MEQA 3REOA 3WJAA 1YB7A 3Q3JB 3FM3A 3KKZA 1P7VA 2IYTA 4DJEC 4NU8X 2X6QA 4EGSA 5ALXA 1QL1A 2Y0DA 1W8DA 1KI4A 1W44A 4KPYA 3C7KA 5E38A 4MXDA 5ERYA 1BCSA 1S2DA 4L3WA 5HSGA 1MA3A 1YRHA 4YJDA 3AEQA 4XLFA 5HW0A 1THGA 4YRVA 4Q82A 4J16A 2AK3A 1SFCD 1NIJA 1H8HA 3RQSA 3PNQA 1P1KA 1HSOA 4EPWA 2RHWA 3G7UA 3D8BA 3CMAI 1GEEA 1SQ0A 1MVNA 1NI4A 4PZ9A 5L40A 3FZVA 3OPYI 3OR2C 4DMKA 4UPDA 3LE8A 5INTA 3L72E 3RC7A 3BJRA 3E3MA 3C24A 1X0VA 4OVNF 3K2ZA 2NUTB 4AN1A 2P1ZA 1KEPA 4M74A 4KDCA 1AF7A 3H36A 1DP3A 5DIFA 2GA9A 1Y8QA 4P0TA 4Y4RA 3KQVA 4TYNA 2WA2A 2BGCA 5F1PA 5EZYA 3PCRB 4QXAA 3BGSA 3NANA 1V96A 2WVRA 3TQRA 4G01B 5JJLA 3OQIA 1SK8A 2GN9A 1ULSA 5KZMB 5FLVA 4M2LA 1NTME 1T5SA 3V46A 4QGFA 4JP2A 4W5WA 1P9LA 2X6TA 4ETMA 1SD2A 1Y8RB 3OBIA 4GF5A 4BQOA 2OLJA 1PYGA 4DYHA 3KIOA 3O4GA 2ZATA 4I4NA 3FXUA 4BU2A 1QWOA 2WIBA 4TT3D 1KGSA 1PKXA 4QVGA 4GU5A 3PT5A 4BNNA 1OBHA 2J0EA 5MGNA 2CYCA 3VI4B 1NJ8A 1B76A 2GEUA 5KTMA 2I65A 4X6LA 3OYFA 2H1CA 2M5AB 2BSAA 4RPKA 1ONBA 1T13A 3QEAZ 1KBQA 1THTA 3OVMA 4RVUA 3I9V6 2WT9A 2HADA 3TGUD 2O7OA 3HI4A 2GJ8A 1II8B 1HT1E 2YBDA 3HVHA 4PZEA 5F9HA 3NHWA 1JBQA 1B3BA 2QGFA 2ZJ8A 3ZGXA 3WXMA 4YNBA 2K4MA 2YYSA 4FMDF 3PLNA 1CRWG 1WXFA 1PQWA 1SMKA 3ZCSA 1ZCJA 2FI1A 4CIVA 2I7DA 1WQ4A 4PZLA 5G0TA 4ZQCB 4QEZA 2OF7A 3UBMA 1NH3A 3W6VA 1G3YA 3KHTA 1L7PA 4E11A 1RFLA 3IO3A 1E8NA 2R93J 2PT7A 3MFKA 3NHSA 1QC5B 3VZRA 4N4OB 4BKMA 2JIZA 4YAUA 3CW2A 1OW3B 4XRSG 4EECA 1U8XX 3JAWB 4RY0A 1C0EA 3BT7A 1NOIA 1H5QA 3G2HA 1CDOA 4JXKA 5FRMA 4II7A 1VCMA 4K2EA 3SJCA 2OCGA 4O4IF 4XTCS 3IDOA 3R44A 2FZLA 3THYA 5APVA 2OILA 2WEKA 1HBWA 1R0ZA 3FPKA 1MBHA 4KN5A 3IAUA 5M2QA 4QT0A 2VJMA 2OORC 3QVXA 3HJCA 5B55A 4L5CA 3BFKA 2NPOA 1TTQB 1YZFA 5SZIA 4DMLA 1RCUA 5FUBA 4ARAA 4MFEA 2GA1A 4WKNA 5K7FA 3A4CA 5J4YA 4JLMA 3T3MB 4BHPA 2GZ1A 1TKAA 3UKOA 1XZPA 4II2A 3WIDA 1PJ2A 2E76B 3AL0B 5COQA 2FU4A 4QFMA 5B4UA 3Q2YA 4S3MA 1KI3A 3CZPA 3INRA 1LTAC 3EDPA 1LJLA 5FTKA 2JSPA 4G0OA 2HHCA 2EOAA 4F5EA 1E18A 2VJ5A 3PFBA 3JQDA 1VQOI 5LWQA 4E7KA 1F36A 4YRJA 2VN2A 4QUJA 1FS0E 4LISA 2BFDA 3COSA 2Q1ZB 3WJ7A 4FXOA 2EZ4A 2NG1A 1PFGA 3SCZA 4B3RB 4MR8A 5CLSA 2CNKA 1CSBA 1D2HA 3E5NA 2QTGA 3N86A 3JARB 3QRFF 5EEGA 1DWOA 2SCUB 3FZQA 5JFTA 5D5HA 4QOIA 1SQXJ 5K3AA 2HZ7A 1H8ED 2HQRA 1ETVA 2V6MA 1JY3O 2BSXA 2DHCA 2IODA 1NN3A 2AKYA 4ZU3A 1E3JA 3KYDB 2HODA 3BSWA 3UW1A 2DN0A 3O75A 3ZZUA 3K4BA 1E2MA 1NRXA 3VHLB 2JI7A 3FCYA 2PRRA 4WVFA 3G4SI 1KYOE 5D6NA 4BX8A 4WQMA 5KTYA 2OD9A 4KQJA 4WESA 1JP7A 1U8RA 4PM4A 3VC1A 5A7HA 4I99A 1VQLI 3MWDA 4UBOA 3VOAA 2BW0A 4MWSA 1O7LA 3TCXB 4DCUA 4U88A 1BYUA 4MMXB 5BMVB 4MPDA 1G5QA 2XKMA 3K8QA 5BP7A 3IIJA 4O8CA 4JROA 1XTQA 5EP2A 3RS4A 3SWFA 2QW1A 4ON0A 1RF0C 3H32B 1A5JA 3QFSA 2C2ZA 3BE6A 3C5EA 1JXAA 4EKNB 4M9UA 1NUSA 1ZHFA 1W93A 2G9WA 4I6GA 1S2IA 4H4CA 1G8XA 4A91A 5EJMA 2OZPA 1ZESA 1WXEA 5H6RA 5JDIC 3KVRA 1I3OA 1YZHA 4H7DA 1UCRA 5HGJA 3IUEA 2NZ2A 4X3PA 4F91B 4EB8A 4IX9A 4NXMB 5ABPA 3UO8B 2ZUVA 4TRMA 3OYNA 2QLNA 3N8IA 1E5TA 1EE2A 3L75E 4PLWA 4PBSA 4K6KA 1KBOA 1IOZA 3MSXA 4WCVA 4CM5A 2WHRA 4E5MA 2NVUA 1IMJA 1CBUA 5DTRA 1S02A 1XTZA 4DMMA 3TR5A 4O3MA 2K87A 3IDAA 3PB3A 2FZKA 3A2AA 4C0XA 1UBKS 1FYWA 3L70J 1NC3A 2R7MA 1JSLA 3P9YA 5B58T 2IYZA 2OK8A 2EZHA 3CT4A 4K3VA 4DR7B 1WULS 3BXOA 4LSWA 5KU1A 3D3WA 1ODJA 3EPZA 3ZI0A 3V7WA 4XIYA 4AP9A 4WK0B 3F8SA 2VQGA 1ABEA 4V0RA 1URQA 2G4CA 2LP0A 2AFVA 2IFTA 4KQWA 4CEJA 1CDEA 1WJFA 1ZBQA 3I6YA 5A5GA 4KDFA 3AL0C 3GLXA 1ZREA 3UMBA 1CVLA 1K68A 2DUWA 5BN3B 2O01H 3ZY5A 2QM3A 4MWDA 1Q6ZA 4MLDA 1BMTA 1NVVQ 3FZGA 1Z7YA 2KLHA 3BJAA 3W5DA 2BFCB 4OH8B 3CJNA 2CYYA 1JLMA 3CVXA 4QGHA 2HLDA 4ERNA 4E5NA 2PYZA 1JLKA 1BDMA 1VRVA 4R1UA 2QZPA 2P5SA 5B5EC 4F1JA 2C77A 2DXIA 4P9UA 4GOFA 3QI2A 4IL6H 4JC5A 4OQLA 3EIXA 2ENWA 5DOVA 1SK9A 1OJ7A 3TCNA 1P2FA 2R1VA 4C0LA 2LNBA 3P9NA 1SZCA 4OV6B 2TRSB 3BZBA 1YDFA 3ILYA 5B1DA 5FDFA 3VPFA 4AZ0B 2ZTVA 1WIWA 5A4AA 3ZJ4A 2J8ZA 4ASUD 1NVEA 1N78A 4C7OA 1A96A 1IPEA 2DTRA 1JR6A 4BQNA 1NTZK 3KPHA 5IABA 1ZY2A 1J5EB 3WUUA 2AN5A 3SBOA 3G79A 3RL0C 4C0QC 4DMGA 4B3MB 4WZ6A 3EOBI 4ZC3A 1ENYA 4I09A 1OWLA 4RHTA 4K88A 1YJ9P 5AM5A 1PZFA 2FDRA 2I03A 1IC8A 2YHBA 4FGKA 1K6IA 3LW5H 2IDKA 2IYEA 3EOZA 1RAAA 5B3JC 1ORDA 1N6OA 1UDCA 1CS0B 4YK7A 4HDVA 3GLFE 3RUPA 2FP4B 3OO0A 1J2JA 3D7RA 2WT7A 4D7NA 1DQRA 2JFNA 1AB6A 1JY3P 2OQGA 4IF6A 2G70A 2NV2B 3GX4X 1G2HA 1E9SA 2XR1A 3G6EI 3S3TA 3CLTC 5JUWA 1MSFC 4BRYA 4RAFA 3PC8C 1ISHA 5THKA 5ESWA 1YHYA 3FVVA 5TMDA 3CZ5A 4GKGA 2W90A 2H8RA 4R8HA 4UXHA 4AY2A 1R6TA 2QTTA 4I2LC 1U6JA 5K8LA 2B0JA 2JA5J 1ORTA 2EG5A 3GJ6A 4LVNA 5IT3A 1PPJE 3RG2A 3B6CA 1LX7A 1CEYA 3OIVA 4XKBA 1PIWA 2H3HA 3TINA 4O2AB 2G17A 2FWNA 2TDXA 1SANA 2VKDA 3ZP5A 4IDOA 1WI9A 3E15A 4BJ5A 4FHDA 1JW9B 2ZWMA 2ZIVB 3F3YA 1DEAA 1YKFA 1E6CA 3HVIA 1I01A 2R5NA 4TPKA 2OFWA 2ZJ7A 3O7MA 2E48A 2KLBA 1U1DA 1AHHA 3H1LD 4ER6A 3C6ZA 3E0QA 2GJ4A 2Q9AA 3W6UA 2VTBA 1JAXA 5IZCC 3A4NA 3IV7A 1ZAYA 3WWCA 3KZMA 1O6BA 3CXHI 1HDPA 3IE0A 1S01A 4L5EA 3HB4X 4Z4HA 3R4KA 3A1UA 1G21B 3LSYA 4H7KA 3GFLA 5FNZA 2BMEA 5I6DA 1NQXA 4KWCA 3H1JG 5KHLB 1RACA 5ILVA 2P3LA 1LFDB 4Q18A 2E36A 1WMEA 3I53A 3HCWA 1FLDA 4GGMX 3HJBA 3GP8A 2YJZA 3K4JA 4BBRJ 3BTUA 3WRWA 4W80A 3LK6A 4MEBA 4BNUA 4GQBA 4LDZA 1EFRD 5EQDA 4MMYB 4XA8A 2PX8A 1B93A 2OMKA 1U0FA 2XEDA 4BLTA 4ERXA 4I5IA 4GXRA 3BTJA 1IL0A 2PGXA 2ZAIA 3MOIA 4MQ6A 3RVSA 5BVZA 2C8LA 2Z4TA 3W5BA 1CZHA 2PRYA 3KSAC 1EP2B 3R7DA 3SFEC 5FEMA 1IBKB 3HLKA 1GXSA 2AZMA 3IJ5A 2HCTA 1CY8A 3HXTA 5CCHA 2QQ9A 4XKJA 1HT0A 4AQYB 1IFMA 1J8QA 2ZYGA 2ZRPA 4DPMA 1P84D 3SJUA 5C80A 4PRZA 2EZ9A 1GG2A 2K2QB 3DWIA 2V9PA 4MAAA 2QN7A 4JX5A 4E7LA 4RPLA 3EQLF 3VDXA 4OMUA 4UVHA 1U04A 1XZJA 3U4CA 5JATA 4F0JA 2ANCA 1YBFA 1EVYA 3CNBA 3R3JA 3W8DA 3KELA 4J0KA 1OHHD 1N2HA 5DYNA 3EYAA 2QAJA 3ROZA 1T3ZA 4LYJA 1FDWA 1GL2A 1F1JA 1G4UR 3JU3A 4XIFA 2WSSD 3L4SO 3BCAA 4MWCA 3K8ZA 3DV2A 4DA6A 4I98B 5C4MA 1GCUA 1SMTA 1YJXA 4PPGA 3GO5A 1FFBA 3QHQA 2ORYA 4U0YA 5FP0A 3T3PB 1T8TA 1CE8B 1QFSA 4G5YA 3IAM1 1BHO1 1WDLA 1WH7A 2FYZA 4Q21A 3FZNA 1PJSA 5LGNA 5A05A 3WHIA 4JQZA 4M8NE 2YVUA 3CG4A 3EWNA 5CVRA 1YR3A 4FIZA 4RAGA 4IEJA 4HDKB 4JC0A 2R7XA 4ZI7B 3TD9A 4ODIA 2OYSA 1LPSA 3EQ9A 2HA7A 2F3PA 3B5JA 1TO6A 3CRW1 1VHJA 5AVOA 2RGAA 3BGOS 1KKMA 2ZRAA 5BV0A 1XK7A 5HG0A 2XXAA 1U0GA 2VXOA 1FJGB 3D2LA 1SHLA 4ZT4A 3KJIA 4R9UC 4DLYA 1SG6A 3MLAA 3MM4A 3OIQA 5DXAA 3N59A 3FPJA 3IMKA 4YIIA 3I55P 3CFYA 2XBUA 1K7FB 5KNBA 2P6PA 5AKEA 3JW8A 2R6GA 5DI3A 2F8LA 2CLIB 3DC2A 2IGNA 4C06A 2BVLA 4KN4X 3U26A 5F1JA 4IHXA 1KILD 4LX0A 3GUVA 3RI3A 1SXJA 3B6KA 4JOBA 1Q44A 3UKDA 2WR8A 4N6NA 4MPPA 1RJEA 2R9VA 4BU1A 5KOHB 4I1RA 1RMTA 3QV1A 2E89A 1B6GA 3THXA 1Q7TA 2YQ4A 3CDLA 3FMQA 2PX2A 4NK5A 2Y76A 2OCLA 4BWNA 2VEOA 2QV0A 4JC8A 2Q28A 1OXKB 3WLTA 2M98A 3GFOA 2XU6A 3I01M 2FJ0A 3OYEA 1MH4A 1DEEG 1GZUA 3K15A 5DULA 2VJAA 2F5DA 3OTQA 1ZARA 2FFBA 2FPUA 2IT0A 4TMTA 1JDZA 3RVPA 2Q21A 2I71A 1XGSA 3GEHA 2VF7A 2GRUA 5APTA 4TTJA 3QKSB 3V4VB 3UVEA 2BEWA 2P78A 3LBAA 2WUVA 3MXTA 3PFWO 4ZU6X 1DEOA 3SZPA 1RVDA 3KZOA 2FG5A 2X6RA 2FFDC 2WAAA 2OZEA 4EM1A 1FZBA 3K6JA 2F59A 2RGRA 1ZGGA 4KGXA 2M5AA 2B4KA 1F14A 3H9BA 5CQGA 1KDPA 2RDMA 4MGHA 4HDSB 4DLXA 3L4BC 4BC0A 2J3MA 5KNCA 4AS3A 3DQPA 1TEZA 1ZICA 4WNYA 2G72A 3BE5A 3RADC 3OJFA 1A04A 3ABTA 5JLJA 2ZYUX 1XCOA 1TE2A 4LN1A 4K6MA 5F6FA 4BNLA 1QVRA 1YTYA 3ROMA 3PSIA 5DK6A 4R9NA 1C7EA 3VR4A 2EPFA 4G0ZA 1B6AA 2IW1A 4BNZA 1GQFA 4KIUA 5TARA 2FETA 4ZV4A 3NTRA 3G2IA 3IPLA 1Q0QA 1KVTA 2NXNA 4JKYA 4IXAA 1EM6A 3OQIB 2Y99A 3CPHA 3D8SA 5ENDA 3KQGA 3LX6A 3L2OB 3SQOA 3H7AA 4WY5A 4BLSA 1WBBA 4A69C 1C1DA 1GL7A 5K3FB 5EY5B 3ER6A 5ADVA 5CBPB 2O7RA 4FT8A 1YZLA 3D70A 4ASVA 1QXSA 1T5HX 2CNOA 3O3CA 2HT1A 3L7KA 4PD4E 2YJ5A 2DYRH 1QX3A 1JECA 4RIEA 4I6MC 4RJTA 3L73E 4PYMA 1YCDA 2QL7A 4H15A 2IXSA 3BR6A 3JYLA 4UV9A 3PCTA 2JLYA 3MD2A 5BUZA 2FYNB 1Z74A 1KMHB 1NW4A 2CZQA 1J09A 2WZQA 3T0YA 1W19A 1J1EC 1M34A 1EXWA 2JBWA 1QQIA 2CHGA 1X14A 2G04A 2NOJB 1S3SA 2ZYWX 4RZHA 2YY5A 3LT2A 4KQ6A 3R0VA 1Z6PA 1N1EA 3W2EA 1VP9A 3TDZC 3GUZA 2ZUEA 4OINF 3IVGA 1OXTA 3MIWA 1VQ6P 1CQWA 1I14A 2GEKA 2GZSA 4UHEA 1Q15A 2PUGA 5AW5A 4KHXA 3VSCA 5TR9A 5JJIA 3P0FA 1GARA 4FX5A 3WNCA 1AKTA 2NSHA 2LR8A 4YCBA 4CLHA 3C8HA 3PFCA 2PUFA 5FRNA 1IB6A 4WZZA 4F86A 4XQFA 1JVBA 5EJ6A 1JJ8C 4JBHA 2CDRA 3GQVA 2GLUA 4HAZA 2OJED 3UMGA 2OENG 3K7AJ 3D4PA 2GDZA 2R4TA 2ZFWA 2VUSA 1H0KA 3QVKA 1HOXA 1J2XA 5FRDA 3AV3A 3AECC 1WZNA 3FPBA 3BCBA 5CVVA 3ZWMA 3WK8A 4J91A 3JRBA 4XWAA 2XUGA 3PKJA 3WHBA 5JNRA 2ZVOB 4G5XA 2Q4BA 1KH3A 3RL0D 4YRAA 3LO5A 2JANA 4KUHA 1E3IA 3OO1A 2Z2JA 3FFAA 4MUMA 3VNBA 4JB3A 1P84E 3C6KA 1XJWA 3MT0A 1BX0A 1GKLA 3FLMA 3PD1A 4GI5A 1HE3A 4NPFX 3BL6A 2HRRA 4RTNA 5CVUA 1YMQA 1P4RA 1JGSA 3DUFB 3CX5H 1EEXB 1JU4A 4I4IA 1JKXA 2X5XA 4IL6X 2ZAYA 4F3QA 5K2OA 5LIPA 2AQEA 2ZJ5A 4JHXA 2ZR7A 1JF8A 2H7XA 3PNVA 2BM0A 2QVOA 2WD7A 2NO7A 3NAQA 4JNCA 3UK2A 2CXXA 1NN5A 4RY2A 1AQYA 5M7EA 2WD7B 4XN3A 2VZ9A 2L2QA 2LXNA 2A14A 4UXJA 5HK8A 3LRPA 1ZQ1A 2E21A 4QGAA 4R2JA 1JLRA 5AHRA 3AKCA 5EGSA 3D0OA 4BNVA 3CMCO 3CLSC 1XMJA 4LOKA 3H5NA 3TOZA 4R1SA 3U1DA 1PUFB 4RV4A 4P34A 4UBKA 4I55F 3MT8A 3ZV6A 3C70A 2ODPA 1UPFA 1XGOA 2PMZA 5F3RA 1N2DC 4TKVA 1QGKB 4CRWB 1PL7A 4LZLA 4UUSB 4PLGA 1OX5A 3SVZA 1IQPA 1YQQA 3U0BA 4HAUA 1P31A 3U1BA 4PUSA 5ICCA 3UAGA 4TS1A 1PNVA 4MV1A 3QHAA 3IA2A 3NIDB 4C9YA 2HHLA 3LZCA 4RQUA 3WTUC 1L4AC 4LOCA 5L3SA 4EHAA 1X6VA 1XAIA 1UBTS 5AW8A 1DO0A 3AEZA 3VKWA 4D5FA 1BVHA 2ID4A 2PU5A 2R6JA 4UQPA 5LA6A 5EJ4A 3WK4A 3UXYA 3HZHA 2FOLA 3N1UA 1TOAA 1SU4A 2WTBA 3FPEA 4MVJG 3MS4A 4OA8A 2COBA 1WSUA 1Z8FA 3C43A 1K3FA 4HVCA 2PX3A 2GQQA 2UKDA 2IS1A 1ES9A 5FL7A 5H9VA 3PH0A 1QK3A 3N70A 3CH4B 1XHFA 1OPXA 1JR3E 3Q0IA 2AB0A 1F9NA 2YWEA 2ZR0A 5BVGB 4FCTA 5GJCA 3BD7A 1RE4A 2IA1A 2XKAA 1GLNA 1J1UA 4DQ0A 3IA7A 3KQTA 5F78A 2D1RA 1T5DX 2VPPA 2E5NA 2YBEA 4DW8A 3ZC3A 1SQQK 4ICIA 3OIGA 3ETJA 5JZMA 3DMTA 5CHYA 2F43B 1WUTA 1DIBA 3F0TA 3NWSA 1TQIA 3AG4H 3OY2A 3IAS2 2IUYA 4EPYA 5E4FA 1NP7A 1G6Q1 3A2KA 3H1IE 2W6BA 4WZAE 2BFBB 1SUDA 1TVKB 3V3KA 4PGGA 3CURA 1N9ZA 3DKKA 3H5TA 4YV2A 2ENUA 3A01B 3KLMX 2J3LA 2FDXA 3C74A 2JRCA 1MUUA 4HX2A 4FSHA 4BLVA 1TQ8A 1Q0HA 4EA7A 1BCRB 3H1LJ 3NFQA 1FDVA 2EG9A 3CIFA 2FYUD 4LZAA 4WECA 3OD1A 4HGPA 3WOVA 1MQAA 2NZXA 2OCIA 3M2PA 2JJ8A 4NOJA 3DKWA 1O96A 2WHPB 4U7WA 3UT6A 4W1UA 4ZQGA 3CEPB 4EO7A 4X44A 2H89C 3W6JB 4O4LB 1SFXA 3KLPX 4G0PA 4KWTA 3CCSI 4Y2JA 2YZNA 1XPXA 3R6GA 2XF7A 3H0KA 5KHDA 3V1UA 5B57C 5HDNA 2VRBA 4YRMA 2PDAA 4MW1A 5FKKA 4RD1A 2KI5A 4A2CA 1GZSA 3R5FA 3HNPA 2I1LA 2ZNZA 1UC5B 4D0GA 2RH0A 3GZJA 2AG6A 1RPWA 1KAHA 2BHLA 1S2EA 5CCGD 2VYFA 2PANA 2KIUA 1JHOA 5BSFA 2QI9C 4CMEA 2PYDA 4PG7A 5LKRA 3FY4A 5GJVC 4IHJB 1GR0A 2AG1A 2ZYRA 4UAUA 4X91A 5G3ZA 1CJUC 3BREA 2E1MC 4KR3A 2XYVA 1H0MA 2P69A 5JISA 1MW7A 3L1KA 1XC5A 2GBLA 3QVGA 4PW0A 5HUJA 1OOEA 4LZJA 1X9HA 6PAXA 3PDHA 3AI7A 4M9SA 1E1RD 1JAZA 4RF2A 1MMNA 3VTZA 1YOVB 1OGYA 4DV4B 5EJ7A 2QUAA 3GEBA 2I4OA 5K2MA 5JJKA 4QDTA 4DG5A 2G8LA 3AEUA 5EIXA 2QL6A 3KEQA 4TZKA 4PYKA 1F48A 4DWOA 3KQQA 5JTTA 3EXHC 4P2GA 1TM1E 1IOWA 1BS1A 3SY8A 4IHKA 3R3VA 2LDUA 4HCJA 3VPRA 2VQ3A 1N1MA 4GS5A 1WZEA 1H4VB 1V6SA 1PS9A 4LE2A 2BEJA 1ZGJA 1RR8C 5TISH 4XARA 2WTAA 5GZ3A 4ZHQF 3LKVA 1EFUA 3LLUA 1NHAA 1WS6A 4X62B 3A2NA 2Y0SN 4WK6A 4O4HB 2ZS8A 1GZDA 3CWBG 2KUBA 1YHNA 1UXGA 2BLLA 5HQ3B 1L7XA 4I1OA 2NSJA 3SN6A 2HIHA 4ZOLA 2M5WA 3O47A 4ZI7F 3UHJA 3CLRD 3CCLI 3A28A 3CLOA 2ZCJA 5IVHA 4PZCA 1RYFA 4LC9A 4QEDA 3T1VA 3C2GA 1L6RA 2HPAA 3Q6MA 4MP3A 2R5ZB 2A92A 2OK7A 3TQHA 2IVMA 3S14J 1U9YA 2Y0PA 4RFSB 5FUVA 3V2GA 1ZZGA 2AC7A 2A5LA 4ZDKA 3MAGA 3SOPA 1L7BA 3WNDA 2GA8A 1TD1A 4YWJA 2FPRA 1TWFJ 1PGPA 5EERA 4FMDB 2Q1WA 2IW3A 3AYZB 5HNHA 1E61A 4FN5A 4AMYA 3B9QA 1Z08A 1ZKMA 4IRXA 1POXA 1FMJA 6LDHA 3GLGB 1LE8A 5TJJA 4EARA 1B8PA 3MYRA 2V0CA 4RZUA 4O6JA 4W97A 3S16J 3UN1A 2NYVA 3CUEF 1ZMBA 2RIPA 1BE8A 3TNUB 2PS9A 1X77A 3PV0A 4JODA 2H27A 4DILA 4W9MC 4EB0A 3K1YA 3LCVB 1D1SA 4YCLA 3BFPA 1HH0A 2H9AA 2PIAA 3ZHQA 4MN4C 2C1ZA 4G25A 5I5EA 3SK0A 1FTYA 4JCOA 4ONEA 3L43A 5B5EH 3BMCA 4GG1A 1BDBA 2DK8A 3GLSA 3H17A 1WMSA 3LZ6A 3PUVA 5FPSA 1YL7A 4E6PA 1LSUA 3PE3A 1T9AA 2P2YA 3HJUA 4C07A 2WT4A 3ROUA 4FJ0A 2CZCA 3LY9A 4QQFA 4RD6A 3T3GA 3U13A 5H1YA 3PIRA 3CQZJ 4G26A 1Y47A 3CE6A 4D57A 2A06G 1N5MA 4H44B 3K30A 1VJ0A 4AF6A 3E8XA 2X19A 1WVMA 4NYJQ 4PTYA 2QKYA 1I51A 1KILC 4WTOA 4LZOA 5SY4A 5LQDA 4H4EA 1OZAA 4R4JA 3JD2A 5F7JA 1XTIA 4XQEA 3IULA 3PO3J 4OH7A 1PP8F 1BYIA 3E5MA 2E4VA 4JP3A 4N6GA 4JLUA 4XIDA 2H4JA 4LJ9A 2BP7A 1ZJJA 3A1VA 1NLUA 3TZ6A 3IBCA 3TG2A 3QBEA 1MB4A 4NBLA 4TWIA 1XN7A 1O5IA 2Y1EA 1AMUA 1YHZA 1PL8A 3SYKA 3TEMA 3W77A 2VTBB 1L1EA 2M4GA 5IT9A 3BHMA 2OEPA 2H94A 1X8XA 2NZ8A 2W8BB 4A23A 1NU1J 3OLCX 2ID6A 5JZSA 3R5TA 1SAYA 2W2VA 3ZE1B 2JT1A 1ACIA 2KXPB 5AMXA 3KTAA 1PFIA 2PLWA 2KS1B 4R6XA 1KPIA 4XRRA 5LQUA 3BRVB 1CUAA 2RK3A 1NR1A 3GJ5A 4MP8A 2DFTA 1SD7A 1JQKA 1W48A 1JOCA 1SELA 4TS4A 1TM4E 1R37A 1X8KA 4DABA 2J87A 1UEIA 1N7SB 1WXGA 4IFDK 1N9KA 3CLHA 3WZ2A 4IX1A 1WZCA 2VHVA 4DWVA 1R6VA 3D6ZA 1CQJA 1OYVA 4CDGA 5DXFA 1E79H 3OYKA 1E9AA 1UAAA 4QLAA 1X22A 2JAHA 1OR7C 2QSZA 3CCJI 4RMIA 3SC2B 1QZEA 4M4SA 1VA4A 3JVVA 1SQ6A 2AEEA 5I45A 1XHEA 1T39A 4BE1A 2MH2A 2ZRQA 4ZJUA 2C82A 1A9XB 2XGXA 2VHUA 2Y2UA 5DYTA 1EK5A 1Y1RA 1ZG1A 1CLEA 2NTVA 3FOFC 2EKPA 3DO5A 3ZXIA 2DW3A 4BY1J 5EJ2A 4Y6GB 4TVKA 4FEAA 4FD3A 4N0QA 1K1EA 4Q3CA 5CT9A 2WWRA 4F2HA 1FYMA 3AY3A 4YQYA 1L2PA 2HSEA 1IZZA 3TOVA 3MJTA 1J70A 3OUTA 2JQ7A 4NTZA 1KZGB 3WTYC 4HAMA 3PEWA 5LJIA 1Z4IA 1O3TA 1U5TB 5THXA 3JWIA 2WMDA 1M2NA 3GA0A 3DE5X 3CSDA 2QZ9A 3TR6A 4OXRA 2NZJA 3EQ6A 3KPYA 2Y0EA 3I01A 2AOXA 3RYHA 1UIXA 4ZYHA 2XEXA 3MOGA 2JHFA 4RACA 1GQSA 2PZFA 1W25A 4HBLA 1PT5A 3BC1A 1KETA 4P2BA 2R32A 5H2FH 1SC3A 1XF9A 1OROA 4FZ5A 2WK1A 5DM4A 3KO8A 3Q7PA 2PX4A 4R0MA 1DPUA 1VIYA 4LY3A 2LR2A 2HO4A 4HZIA 3TL4X 3L0DA 1DKUA 4H0EA 1IBSA 2MC3A 4BQIA 2WD8A 3I6QA 4ZARA 5CBPA 2VODA 2NU6B 4HRVA 2O0HA 3D3WB 1XDWA 2PX6A 5GM2A 2IBSA 3CC2I 5G40A 2L7KA 4XASA 1SA0A 3M8KA 2GXQA 4MGKR 4HBGA 3TCKA 4OQEA 3PLAE 5AOVA 3D6TB 4ETWA 3IVMA 1L5YA 5AVSA 2H2WA 3FYDA 1T4GA 1XB2A 2C5FA 3NBQA 2XZRA 2EZKA 3S2GA 2Z9OA 1TVCA 1G8AA 1TZLA 4INOA 3B20A 2YXQB 3ZLTA 4BQSA 3D6HA 3MUNA 2V7UA 2WMOB 4C7NA 4HDMA 3MAJA 2QGUA 3EGXA 4TMYA 3X1WA 4A2PA 1VL1A 4NE9A 1ZK4A 2E43A 4AK9A 4PN7A 1KAGA 1EC5A 3P9IA 2DFIA 1IIRA 1OXUA 5EIFA 3QP5A 3KWJA 1T0JB 4YN3A 3GQBB 4U9HS 3F46A 2E55A 4N9IA 3MN1A 1XK6A 2Z4RA 4BO8A 5C52B 5JXWA 1GT91 1UM9A 3EGCA 5L3QA 5T64A 4M9ZA 3D6AA 2BFOA 1UKBA 2WHPA 2MYSA 4EW3A 3F21A 5JALA 3R24A 4K9QA 3ZGNA 1P7IA 1LS1A 4DJTA 5J59A 2W22A 5JD6A 2VR1A 1VZ0A 2HFJA 2QXTA 3ZDBA 2E2WA 3EA5A 3KAPA 2IA5A 4OP3A 1NV9A 5COBA 3KUKA 4X1KA 5BMVA 2FJUA 4MA5A 2VDMB 5FKLA 1EDBA 3G02A 2CQQA 1YB2A 3M70A 2XVYA 2PM8A 2WJ4A 2YOGA 5ECGC 1K73Q 2UVDA 3UAYA 4UQLA 4G6ZA 1C1HA 3KHSA 4HKZH 2GASA 5FOQA 3TLMA 3BRSA 1QANA 2ZR8A 2ACJA 5SYMA 1SM4A 1Z4NA 2HLNA 1V43A 5D5QA 3W90A 4HDRB 2W7NA 3DO8A 4OQNA 4KIGA 1W2EA 3U7QB 1ZH4A 2I9KA 4BE9A 2QZZA 2J59A 2YFQA 1MU0A 2D1FA 3ND9A 4GBJA 5CVTA 3DTVA 1BXGB 5AM1A 2AF3C 3OZGA 4K8OA 4H44C 4EYYQ 2FQ1A 3CNQS 3ZX4A 4TYQA 4NJMB 2MMGA 1IV8A 4OAYA 2PLYA 4J29A 1FOWA 5K0ZA 4BVHA 5EWMB 4JOCA 3GOQA 5JY6A 1G9TA 1SEUA 1KMQA 3VC7A 1NL3A 1PZEA 2FU5C 2JAOA 4RKQA 2Z5FA 2QTAA 1P1CA 3ICOA 4BVBA 1E6UA 3KCNA 3DG9A 1UR5A 5K3FA 3SFIA 3IMCA 3CMEP 5F1YA 4HDCA 4LQLA 1SUCA 1CJCA 4WH0A 4OHCA 5DD8A 3BAZA 4FGZA 4WY4D 1HW2A 3AE8C 4AKTA 3Q5GA 4KNVA 2FZWA 3ZVMA 1LEAA 5H3HA 4IHJA 5K5OA 1CE8A 1CQPA 5LP6C 5EHNA 2L42A 4TLMB 4P1ZA 2QZSA 3I1YA 1P4WA 3I5UA 3U44B 3IT0A 3PR1A 4QICA 5ITWA 1EXMA 5F33A 1CUWA 1M54A 3GV0A 4D9KA 2HYJA 3RYIA 5IJAA 4EM2A 4RDXA 1ND5A 4H27A 2HSWA 2QRUA 4O9BA 2WIFA 2ZWVA 4WCFB 4WBNF 2Q1XA 4WB4A 4ENTA 3ZXYA 2A0YA 1HOTA 4D79A 3WA6A 2BISA 3NETA 3SXYA 1QRAA 4LY0A 1RZRA 2XPVA 1XTJA 1WEKA 4DNCA 4Y2YA 5BSGA 2FX2A 1FDTA 4PBTA 2E74D 2AYYA 5FBLB 1DAOA 2P6RA 4XVRA 4MI3A 4YCMA 1I1NA 3OIPA 5DV5A 3A0HH 4UM9D 4U8HA 5HJ5A 2IZ5A 4P4GA 1LTJB 2WJPA 1IHUA 3A1DA 1K83J 4QLBA 3TAXA 4N8DA 3M6XA 1S1MA 1KGDA 2IF0A 2E19A 3O1IC 2H2HA 4JX4A 2CW7A 3O8LA 4ITRC 2ZITA 4MKRA 4YAOA 5DSTA 3OFSA 3L0PA 1N4AA 1BM9A 1W76A 5KHOC 1J07A 2HXYA 4G6QA 3BFXA 4WZAA 3P9SA 5DLPA 4PLZA 1H2YA 4DZJA 3OI7A 3CUUA 4NDLA 1C81A 3DF9A 3I28A 2VQ6A 2QEQA 2VNAA 4HXEB 1N7IA 5E1MA 1TGVA 4F6RA 5FNVA 3L93A 2K27A 1C2TA 2DJNA 1A1SA 3KP1A 1XI2A 1UXKA 3FG9A 4NAHA 1OYOA 3I9KA 4N8SA 4RK5A 1K0UA 4ZVQA 3MRTA 3QYPA 2XZPA 3GFJA 3ZDAA 3AERB 2WOOA 2O3UA 1WJEA 5H7XA 1I2AA 1GTL1 1TIPA 2XF2A 4R2MA 3EF3A 1JHQA 1Z67A 4XDGA 2YOHA 4ZN6A 1D8AA 4GI3A 1C30A 2XPWA 1P91A 3OE7A 2RMZA 2O1XA 4ZXPA 4L76A 2FXMA 3L0CA 9ANTA 4O59O 3NPAA 3B78A 2P4HX 5K9ZA 4QUGA 4X1KB 3ZMDA 1PP9E 4IHVA 2H7VA 4RDUA 1GITA 5B5EE 3STVA 4RM3A 1Y6IA 4HGYA 3VOTA 1XDBA 4HDOB 4R2KA 3EK2A 2I55A 2P5KA 2BVNA 4QO8A 4EB3A 3ZVKA 3AVOA 1Q7EA 4QRDA 1K9SA 4M7WA 1ZQ3P 1ICEA 1YH3A 1WJ5A 3QU5A 3RL0g 4PAMA 3PD7A 4ZKEA 2FP4A 2PMZN 5C5IA 2JVKA 3TSCA 4LLHA 2OMEA 4E5DA 2KP6A 5AW4A 4XB1A 3MKLA 1N33B 1DKRA 2OTCA 2L9VA 2CMFA 5B1AH 1GTZA 3K92A 4UCQA 2JLZA 1N7SA 3DHNA 4GM4A 3TW0A 4H0CA 1V3FA 3NTOA 2C8JA 4G09A 4J0FA 2Q8NA 5JI3E 5APUA 3LAPA 3NYQA 1IXZA 3B8EB 2YN2A 1U9JA 4GZ5A 1OKRA 2JJ2A 1KP9A 2XQKA 2CWDA 3OY9A 1YZGA 5D3KA 4TVOA 4Z1MH 1GUAA 1M2VB 4JJFA 4JB0A 1S8AA 1X1BA 5FTJA 5E4YA 3IV5A 4QIHA 1RESA 3EXG1 1AKWA 1F4KA 5TXGA 1Y48E 4JJ8A 2BGTA 3EEFA 2ETHA 4BKOA 3QKSA 2WM9B 5D4RA 1W7AA 3DF8A 3C6BA 3H9CA 2QX7A 2WU8A 1Q19A 1ZL0A 3UMJA 5REQA 3ASOH 2W42A 2DMRA 3IEVA 1FSFA 2O1EA 4DVJA 4E7JA 5KLIB 5KWEA 5EQFA 2MCFA 2YXDA 5TISE 3A1YA 1P9RA 5K0NA 4FOPA 3UFXB 3V4GA 4BJ5C 4TUYB 3IKVA 1Q50A 4U9IS 5FWXA 1NGSA 2Y77A 2E2JJ 3ZBPA 1H9CA 1E7MA 3G8AA 3H1GA 1BOFA 3MGBA 2A1IA 1HFWA 1JH9A 3UJBA 1RWVA 2MC4A 1GTJ1 5B2FA 1IJFA 1LPOA 3O93A 2JASA 2VOJA 2YWCA 3PPVA 2ZRFA 3ZHTA 3B71A 2W2PA 3ABOB 1W85B 1D6JA 4XQ0A 2QA5A 2PO7A 2A6PA 1JIIA 3BH7A 3BMCB 4HBZA 5FI1B 2OTJI 3IQZA 5LSAA 2C00A 3ZUGA 5L3VA 4FMCF 3OKFA 4QPZA 2W8ZA 2GXAA 2YL2A 1JSRA 4ZC8A 4DARA 3RTRA 2GK6A 1W73A 2KZGA 4GSKA 4BY7J 3AEBC 4PAWA 1HYEA 3BXHA 3VO9A 4NPCA 2XROA 3FIJA 3E7WA 4EHIA 4NIMA 1MZPA 4NDNE 4BZQA 3E9ZA 2OYRA 1UL1X 2QNBA 4UUQA 4ZI7A 3VYRB 2YWRA 4IPAA 3GFBA 2HW8A 4EYQA 3PEFA 2V59A 4DYDA 4H0LC 3A1WA 1DQPA 4PFPA 3HSEA 1QU2A 4I46A 1S7OA 3J81A 3HO1A 2O14A 1D8KA 3ZHBA 3IP1A 2RONA 4B31A 4Z4CA 3GW8A 4OX9Y 1DD3A 2OC6A 2BGIA 4Y9SA 3JRHA 1QNFA 3L1HA 5FNVF 2HSJA 3BSSA 1ORIA 4PQYA 4ZICA 1LSJA 1B41A 4J6EA 2IHJA 2HD4A 1R16A 2QTRA 3BSFA 1OFHA 4K9DA 2ECKA 3BG7A 1YG2A 4QHTA 1Z62A 4ALMA 2P6TA 1Z0KA 2XAFA 3ENVA 2YNMD 2K6GA 3LU1A 1H88A 1NRJB 3QPUA 3A1CA 3UXEA 5ALUA 3CC7I 3T1TA 1XCLA 3GLTA 1NKZB 3BORA 5LPNA 1FJHA 3TO9A 1LS6A 4FFLA 5A9RA 5HCNA 3E7DA 3OYMA 5GTHE 2AOUA 5BY2A 1NBME 2V9KA 1XSDA 2J5PA 1VE6A 3FNQA 4G85A 2HBRA 4NCIA 2X1DA 1X8LA 2FBKA 4L73A 4HOBA 4RZSA 3VR1A 3CZ9A 4IAOA 3P9QA 4KTTE 1J6UA 4Q4HA 3U09A 4E6KG 4YJGB 1MIOA 4LLNA 4GZMA 4P31A 3PXEA 3QUBA 5KLVK 2PUEA 3B89A 1ZJ6A 2XZOA 4EQZA 1R5ID 2QPTA 1W29A 2VJLA 3BGIA 1VL8A 4ECAA 5IP9J 2C4MA 2WPDA 5DCMB 5E3NA 2Q9UA 3ERMA 3DXJF 5CK5A 4EM0B 2AGVA 1E1CB 1XKTA 3WUTA 3KB6A 3ZGYA 1RE3A 2DHEA 3WYFA 1PZQA 2H4XA 3PRHA 3I39X 5B1YA 4BJTA 1HF9A 3AUXA 3PVCA 3S1AB 1NKNA 5HKBA 5KNDD 5FR1A 3H97A 1QBJA 4PSXA 5BPIA 2C3OA 2H8WA 1FP4B 2UDPA 1LNQA 4YP9A 1ZP6A 3TTYA 1UK9A 3NVDA 4L7QA 3VZBA 5DTIA 2HWXA 2X8BA 5EP4A 4KFTA 2RI1A 2E76C 1UIIA 5K0TA 3DBHA 1Z4MA 3MA0A 3OX3A 1Q84A 4PGHA 1L6IA 5AW7A 4NAVA 3FOZA 2JJ7A 1T0PA 4PYLA 4RB0A 2M4KA 1RKBA 4X1IB 1PK7A 4TRRA 3H19A 1XP5A 5B58C 3HBFA 1IK7A 2C98A 2P2LA 4KR0A 3RJMA 1GPH1 1M2KA 5HRAA 1TQ2A 4DQVA 2C0CA 1SKBA 4PWZA 1AOYA 4PZ0A 2CUFA 1DU0A 3WNBA 3H32A 2B0CA 2UYHA 3D6JA 2DMQA 2ERCA 4MWOA 5TS3A 4CXFA 4LOAA 4QU9A 4NBNA 3DLPX 3C3DA 5F76A 4BYMA 2Z56A 1PJLA 1NC1A 1SD1A 2GYYA 3LVBA 1DAHA 3EFHA 1Q5PA 1ZJ5A 4UD6A 4AJKA 5DMXA 1JLLA 2O07A 3PFYA 1RQVA 3COAC 3FDXA 1J2JB 3UA3A 3CLUD 4EG1A 2BCEA 1I5EA 1WFXA 2PPLA 2AG5A 4WLEA 3IPXA 2F9MA 4OB6A 4QT4A 2XUZA 1OY1A 4MRNA 4AWAA 4PC1A 2NNWB 2XX3A 1ZELA 4OY3A 2Z04A 4KBGA 4PTZA 1Z0SA 4HRYA 2L7ZA 1H4SA 3M4YA 1KQGA 1CP2A 4FX2A 3NWOA 3ZQHA 4G63A 5DBFA 1DKQA 4DL9A 1JMBA 4MRAA 5DT2A 8ATCA 1J59A 1EDEA 1LRLA 3T5GA 3V4OA 1XU9A 5K03A 2OG2A 4DSNA 4A3DJ 1JU3A 1FTGA 4AF8A 1IWBB 4AWBA 4IDQA 2DHRA 4MR8B 4S1OA 1SWVA 3KAQA 5IPAA 2FPIA 1PDWA 2DTZA 4FR2A 3TP3A 2RMKA 3Q6IA 2P0EA 3G7NA 4CH7A 2VAWA 3GK3A 3U4QA 4JP1A 3CGWA 1BSVA 3SHWA 2BMAA 1I6MA 1Z68A 1JEDA 1YJ8A 3RK1A 1I3NA 2O3QA 1V5EA 4KQ2A 5EZYB 1S1CA 3CBQA 5EWJB 4UV8A 2CKMA 3RI4A 1CSEE 2CXPA 5JQGF 4AZTA 4DZOA 4RGSA 1OIVA 3AF5A 4UXIA 2DU9A 4QSMA 1U0BB 4GI1A 2D5IA 4BUPA 1HT3A 1GUDA 1WPQA 1OVRA 1Z0JA 3P0HA 3IKJA 3QOPA 4PQEA 3B9PA 1XCBA 2YCLA 3BJIC 2F3RA 4AF7A 5H4HA 2UUAB 2H88C 1FTQA 4UUSA 4CMIA 3FUUA 4BMXA 4N0EA 1KAQA 3E7PA 1J2TA 2ZJ2A 2Y9ZA 5GTDA 5JO9A 2JGEA 3R0QA 2RHMA 4Y2HA 1MNQA 2STWA 4BFXA 1JWAB 2VSFA 4QUHA 1GW3A 2DULA 3R60A 2EATA 1IJEA 2OQQA 4ISBA 3EQ7A 4YCAA 4UTRA 3BZWA 2GRJA 2BGLA 5AXAA 2JVGA 2Q3FA 3FNFA 1VIMA 1JDJA 2WFAA 5BN1A 3NPMA 2AZDA 1OVVA 3BRTB 3DULA 1P19A 4PHTA 4QVKA 5H4GA 1JFVA 3EWIA 3AEXA 2H1IA 4ISCA 4B80A 3AR8A 9LDBA 2W25A 1LW7A 2Z98A 3O6VA 2E85A 1P4SA 1BI2A 4A3KJ 1GNSA 2FQYA 1VHQA 2J85A 3BXPA 3ANLA 3WL4A 4G0YA 3ML6A 1Z6XA 2DHDA 1HURA 5AUQA 1TUBA 1TVKA 4HEA2 3NRBA 4GDFA 2KISA 4M1QA 4OLJA 2QJWA 2O3TA 1NURA 1Q16A 3DKXA 4WNCA 3NEYA 4QBKA 4EV0A 2N46A 2VLAA 3HXLA 5IYZF 3SHOA 1Q1BA 5K0GA 3F6PA 4GC9A 3ON5A 3KEFA 3KPJA 1G291 1XLVA 3DPLC 2RB5A 3NAZA 1N5KA 4ER5A 5FJ8J 3A1NA 2IT1A 5K0BA 3VJKA 5IM5A 3JZDA 4FI3F 2AW5A 5KKNB 3JQ9A 5AXCA 2POCA 3AUTA 3ZIAA 2IEKA 2GM3A 1ZTRA 3HWX1 1OPCA 2GPWA 4OFWA 3MXOA 1LX6A 3IDQA 2M2EA 5CXSA 1UQTA 1UMBB 1XMIA 2CYBA 5ILGA 1UG0A 2EP5A 3WRYC 3AJDA 3ELUA 4Y67A 1NPYA 4IOJA 1HMYA 1J1DC 1TYDE 2GWRA 2BEUB 4GPZA 5ECYA 2F8MA 4EI2A 3FRIA 5IT0A 5HNKA 5BQ3A 2C3YA 2J7PA 5CDYA 5JW6A 5BSWA 4CNQA 5CTJA 1D0ZA 4IIFA 5LQAA 1P81A 4H13C 4BNTA 1I3LA 3TQTA 1TU0A 5JZBA 1Y3IA 5A4DA 4ND8A 5DGHA 5H68A 4HNUA 4B9AA 1J5XA 2CCGA 3WRVA 4JA0A 4QG7A 3S8YA 3PHIA 2JKZA 4IX7A 2VZ8A 1HZZA 3L7LA 2VQCA 3I9V1 1GG9A 3DTYA 1JT6A 4F3CA 1DV2A 4IV5A 3WAKA 4FE4A 4YAJA 1X7GA 1EFRA 2JCVA 1OT3A 1PQ4A 4BATA 4EFDA 4RQBA 4HMOA 1ZKDA 4C0BA 1TWAJ 2RAPA 4FWIB 3QBDA 2Q5LA 4CQJA 5KVAA 1Q95A 4K28A 5HDQA 4IQ8A 6REQB 3JZFA 1QCCA 5IEJA 1EKXA 2A6HF 1P0PA 4GECA 4H31A 2H09A 2FFHA 5JAQA 3NBMA 1NPTO 5P21A 3EXFB 2W6JH 1XTRA 1XU4A 2X13A 2BYVE 3BJOA 2JPBA 3ISJA 4JPZB 4RTLA 2VNIA 3CN7A 5CVCA 1DBWA 3NFYA 4JFAA 3L1JA 1T9BA 3I04A 4OGGA 3Q5SA 3FHNA 3B1JA 1JHAA 4Y6SA 1TWCJ 1U5AA 3A0BC 2HX1A 4MZDA 5TMBA 1DO8A 1BIFA 5FHRA 2IQIA 3VXKA 3JYHA 5K4HA 2JFPA 4NMMA 2PP6A 2G0NA 2HTSA 2R1TB 2CF6A 2HTFA 2MTBA 1RBMA 5JVGF 2VQFB 4EJWA 2I3BA 4RS4A 3G2JA 3FMIA 4XLZA 1D4ZA 2H31A 5J47A 1IDZA 4G67A 5LQMA 3P52A 1W7PA 4YRFA 5DBGA 3RTGA 3ZU6A 4DA9A 3ZW7A 4BE4A 1RLMA 4TM8A 2ZYHA 3GAAA 3OCVA 3IQHX 4MMZB 2XMCA 4FISA 3AEEC 1KZ1A 5K6AC 1AV6A 2DG2A 4IIGA 3A0BE 3UY4A 1ZNZA 1SKQA 1YC5A 1QH0A 3UIEA 3H1ID 4Q3DA 1B7GO 2PFBA 3VPHA 2P1DA 3KCCA 4UARA 5LKAA 5AW4B 3WGKA 3BYZA 4YP5A 1L3CA 1WVRA 1I9CA 3JRCA 2I4LA 2HIGA 4LJZF 1KMIY 2CUNA 2LKMA 1OT5A 4JI8B 4RD3A 4WKBA 2Y31A 3EIHA 2EKZA 5LJLA 4M3GA 1SU6A 3V8MA 2I6FA 3SX2A 2WHEA 3A31A 3WQSB 3RYIB 4MRPA 3SWYA 2QD4A 3VVLA 4IQ4A 1AURA 3TP0A 1QP4A 1Y9ZA 2XRYA 4M0LA 4E46A 5IT9K 1NI3A 2HJVA 1T10A 3O4JA 2HKOA 2EXXA 4Q4DA 3DE3X 3VV3A 4L4ZA 2ZB9A 2JCGA 4G8DA 1NBMD 8MHTA 4R6WA 2FK7A 3DTTA 1X7DA 4EGQA 3KD3A 3KZVA 3PWTA 1KAEA 1YGYA 4PYIA 5HJ2A 5I9SA 2Z9CA 4BNFA 2AYXA 5DOZA 3KBBA 2X85A 3IN6A 3S7TA 2P3QA 3SSNA 4ZU1X 4OMYA 2OYIC 4PRYA 1ULHA 4N18A 2PJUA 5H2FE 3TI9A 1TBXA 1ZOOA 1DJLA 1RF1C 5KOJA 2OQRA 2PKWA 1B9MA 2RC5A 4XSVA 1OLXB 3ER9A 3K70D 4UU7A 1ZN8A 3UFBA 3AETA 3DDOA 1QRUA 1F2VA 1RQXA 4ZKDA 3L72D 3DO6A 3QQAA 2XGSA 4F38A 1FW6A 2WE8A 2V5UA 3I58A 2F1KA 1CY4A 1MMGA 2VH5R 4RV9A 3F5SA 1ZV8A 1GZ6A 3FAKA 4AB1A 1WJCA 3WVNA 2ALJA 3U7QA 3VR3D 3G2BA 3LBIA 1K08A 4NC6A 1KYWA 4J16C 5J3LA 2YMYA 5DKFA 2AHQA 5E0KB 3T4UA 1NOHA 4F9GA 1P0MA 3BR5A 3GGPA 2E74C 3O3KA 2HYIC 4XFDA 3VDNB 2L17A 4PPFA 1J0BA 2J5UA 4H59A 2ESRA 3CWBE 2C4KA 3MWEB 3N2KA 1MPTA 2DETA 4ZK2A 2P9ZA 1EH8A 5KKZB 2X7HA 1LT9A 5I9IA 1QGAA 1PRYA 3OT1B 4MAFA 4OGKA 2HWKA 4QUKA 3AT1A 1PYVA 1GQYA 1PT7A 3WB2A 4QFDA 2XRMA 1OWMA 1CUGA 2J9XB 2VBFA 1G3IA 2Q29A 2ZGVA 1E7QA 2EJTA 1I0LA 4JC4A 4FJ2A 1YVDA 4ZTZB 4XVHA 3NWJA 3TTWA 4LG0B 2QJPC 1OBFO 1GUFA 2X0KA 1VQNI 3TDUC 1RYBA 2JLSA 1RFGE 3LYUA 3CUQB 1W0KA 1XD9A 3R3YA 3ZDFA 2QUHA 3IESA 1WCMJ 5HS7A 1XR3A 3OJLA 2EWMA 4D4KA 4GKJB 3EXFA 1FJKA 2DY0A 1KQ3A 1GXPA 5E18F 5HILA 2VJKA 2CBXA 2PN1A 1ID8A 3OZEA 2JG3A 5DHPA 5GTIH 5BSTA 5L7YA 1RE3C 5EHIA 4WN9A 4I6EA 3V8NA 1MGOA 3OZAA 1BRTA 1BVUA 5KSOA 2HQAA 2BKXA 4D9BA 1MJGA 1ZNXA 5G4LA 1QZ3A 5L3GA 3SOZA 4LYGA 1IUOA 5JROA 4NB5A 3U4QB 1AJYA 1KILE 5DDGA 1HM5A 3L9FA 4EMTA 4Q4HB 4V3CA 4J0HA 4O4JF 4EL0A 3WGLA 3M3PA 2IS2A 5L6LB 3H75A 5HF9A 5EIBC 3QX8A 2J9GA 4CDNA 5LBTA 3TLBA 1YRBA 2QLLA 3D1NI 3ZD7A 4CG1A 1K88A 3L46A 4QPDA 1YK1A 4JQCA 4OQXA 2RGYA 3BICA 3RSFA 1ZR2A 2AX3A 5DT9A 2L0XA 1DB3A 2XRZA 3HUUA 3F67A 3PQCA 1XVUA 1W36C 3GPCA 1SQQE 1PP4A 5JC1A 1IN4A 3KVVA 2RK6A 1A5SB 2WY8Q 4YPOA 1MVLA 2B8NA 3QYEA 2BTQA 2G0AA 3NNDA 5KSPA 4RHEA 1XNGA 3C5VA 3S1LA 1TTYA 3OA2A 2IHVA 1O94A 3M9BA 3R3ZA 1F8XA 2FZVA 4E51A 1AG9A 1G5HA 3W6OA 2HA3A 3KEOA 4DQXA 4AJEA 4LMPA 4IIDA 4CUZA 2VIIA 4Q15A 1EUZA 1IJDB 3WODF 2KDZA 3IIIA 1Z5WA 5ESRA 4BVGA 1S4QA 4XQGA 2GHIA 3DT6A 2C4UA 2LXBA 2RC4A 4ZIRB 5LZ4A 3WA7A 3KB8A 4BLRA 2ETXA 2LBFB 4GVXA 4BQFA 2LV8A 1S96A 1V16A 1TPZA 2II6A 2BI4A 3V1TC 4JL8A 1KJZA 1T4CA 4DQUA 2IX3A 1QHNA 1G5PA 1XX6A 3LYHA 4HLCA 4ZDJA 5I7VA 1CGPA 3U7FB 5HRCA 2H7HA 1E0KA 2D5AA 2R6FA 1XO1A 3AFGA 5KTRA 1X2NA 1EHYA 4HDMB 4C7NB 4FS3A 5JVDB 5BORA 3BF8A 1P60A 4CI9A 1AD2A 4P86A 1VF5D 3HKCB 4RTSA 3E48A 4PY2A 1URQB 1X7XB 4EB6A 2R7DA 1QYRA 5F12A 3PNMA 3MQFA 5F3WB 2ZVJA 3DP9A 3CH7A 4WAUA 5T3YA 3ANTA 3MEXA 1DLJA 2GAUA 3NBFA 3H05A 1J0AA 4W5NA 4CZ2A 1Q7GA 5FOTA 3FRHA 4AO8A 1IQ0A 2MSLA 1QUEA 4F85A 2VHTA 3KTOA 1ZRCA 5A1JA 3TDKA 3DQVC 3MQ0A 2IIVA 3L04A 4RS8A 4I9HA 1LNSA 4BE0A 2FXIA 2Y1OA 2C97A 4BNHA 3OLXA 5CT4A 3IPAA 3IUSA 2P40A 4AY4A 1W34A 3S29A 1DPFA 3R3HA 4GO1A 1JXSA 3NH9A 5DXJA 2F48A 1LV8A 2NPFA 3QX7A 1DRVA 2K5CA 1XKLA 3B5NA 5EXSA 2AXTH 5AVWB 3OWOA 3Q1LA 2ZXIA 4HB2A 3UPDA 2LY9A 4A0SA 4J1TC 4NFYA 4IKFA 3QBJA 3AIIA 3LNQA 3KR9A 1T1RA 1PBTA 5E4JA 1QIGA 3ZOKA 1T35A 1N6RA 2BFEA 5JDIA 2VZEA 2I2CA 3GNQA 4C4XA 2JB9A 3NVKI 3HSSA 4P3OA 5JNUA 3A1EA 3QENA 3IERA 1W4MA 4L50A 4FDVA 2OB1A 2WD9A 3Q0TA 1E5DA 4RZXA 1W5CE 4F2GA 4NZOA 3L73G 4DLKA 2C9CA 3FPLA 4JBLA 3FHZA 4BYYA 1Q0ZA 3NNSA 3OEHD 4KSYA 4L6IA 2RKBA 3KOUA 1TKBA 3KZ1E 3ONFA 2N9YB 2GBFA 3JPWA 3IQWA 1UXOA 6Q21A 3WG9A 3C8MA 1TFRA 2QX4A 1PW7A 1VTNC 3I05A 1LE8B 1HH4A 3O1LA 4TS9A 1EYZA 1KQ9A 1KJ9A 1Y1WJ 4XB2A 3SDZA 2VWGA 2FSUA 1YDGA 4OXQA 2JVJA 3EWKA 2I3ZA 1QGOA 2P0AA 3CI9A 1W6UA 1Z4QA 3CXRA 4A8JB 1XYVA 4JR0A 4O5OA 5C1PA 1N73B 4MDYA 4EGYA 4WK8F 3GHHA 5ULLA 2LFBA 3GLIE 1IXKA 3FXDA 1JJVA 1E0AA 4R83A 3A6JA 2HO5A 1V48A 2JFUA 2EFQA 3VH1A 5EF6A 1FNNA 4LYAA 1IN8A 4HF1A 1IO4A 2DKNA 3HCEA 3BERA 5CA1A 3QU7A 4P4TA 2ZSFA 2PJRB 4GI2A 1QZUA 2GFIA 1PX2A 3CVWA 4PSVA 5F2OA 2FBHA 1V9SA 2NXEA 1MDBA 1U6GA 3OM0A 2QT1A 3THWB 3QHPA 2Z9BA 2R7ZJ 4BTVA 2C4TA 4OHOA 4L9AA 3I4NJ 5CLHA 2B7CA 1K5GA 1LWOA 4ENSA 3GBVA 4FR5A 1LI5A 5AW0B 4HNVA 2D0IA 1MT0A 4Y7CA 4CYMA 1M66A 4BX9A 2WINI 3CUQA 3CLQA 3TTVA 1E1QA 1PNRA 3GLHA 2QRQA 3ZGKA 2O50A 5JSYA 4D99A 2ZPUA 3ZGZA 1U5TC 4OIFA 4YLGA 2LDXA 2FYUE 2JLCA 2QTNA 1ZG3A 3QU6A 5KKCA 5AM0A 4CM8B 4UTZA 3GJ8A 2QN6A 4UCXA 1VSUA 4JS0A 2HJSA 5CLJA 1L1FA 4JVOA 3A37A 4Z54A 1QOPB 4RGVA 4N82A 2Q46A 4MV3A 2WE7A 2JS7A 3UGKA 3SBEA 1WL8A 2V4ZA 3SZ3A 4GYKA 1T8UA 2JWDA 2EU8A 4IFMA 3AOEA 2LNDA 1H88C 3IXQA 1IJWC 4GR4A 1L4AD 5LB4A 2SNIE 2N8GA 4G8BA 1KMCA 1NNLA 5JD4A 2D59A 4E09A 4BHBA 4NHOA 3FFXA 1P1IA 1U7ZA 3QKWA 1I39A 2O1JA 3TM4A 4BZWA 3S17J 3LUGA 3B1KA 1BWQA 1P9OA 3UC9A 4Z51A 1T91A 4P83A 4YVFA 2VDLB 2XNJA 4S0XA 4GOND 1MOZA 1NVDA 1CQTA 4GAEA 3SFVA 2QNIA 2HSDA 1P9WA 1U31A 4AJ1A 4PCUA 3ASZA 1U7TA 3C16C 1ESDA 3JTHA 1IHPA 2M1XA 3AM3A 1L5HA 2KL4A 3TIVA 4QOHA 4M9CA 1UKYA 2QG4A 2A2ZA 1CETA 2RHLA 1NKSA 1HFEL 1ZA2A 5DX1A 5HMMA 2R7VA 3OIUA 4C6TA 3GDGA 2H2GA 3E3OA 1G8FA 1J0CA 4FKMA 5L8VA 5EE3A 4NE2A 4PRLA 1COWA 3TSYA 1ZONA 4F8EA 1G2OA 3V4WA 3M0DC 4MEYF 1SVSA 2KBEA 1U99A 1CY1A 2E9SA 3H1PA 3VVMA 3QUSA 4ZAXA 1ULTA 1FYFA 3L0YA 3KSBC 4WEOA 5FBQB 1ISPA 1EX1A 1PR1A 2GPTA 4LWQA 4XLPF 3EWAA 2CUZA 4L3VA 5IYBJ 4RFSA 1ZISA 1NWQA 1WEHA 1DFIA 1TO1E 2YMLA 3PGJA 3UV7A 1P4JA 5CGZA 2B5VA 4GPD1 3ZCXA 3FR7A 1MNAA 1WMAA 1L2TA 3IXLA 3ESDA 4QG3A 3T6KA 3VYVA 3QYFA 3JWJA 5F98A 4ZOLB 5EZHA 3Q3IA 3CZRA 4KKXB 1URQC 5KAIH 3BWEA 4KV7A 3AERA 4YX9A 4Z0TA 5FI0B 1KR5A 1SQBK 2J3HA 3A0UA 1T2VA 4HGQA 2PRJA 1HEUA 1H2WA 3O8GA 4Q1DA 3GN2A 3OU7A 4BV2A 4NDAA 1IZ9A 1MOPA 3WLFA 2JIZD 4BGUA 4H4KC 2H08A 3J7AO 2J09A 3QZUA 2B0LA 1BMFA 1SUWA 3E5UA 3U2QA 3F6YA 1D6MA 4BMCA 2VKVA 1ZNQO 2KPOA 1UT6A 3L2WA 1JA9A 4LF7B 4WF2A 4P55A 2DYSH 5CB6A 1U6IA 2OC4A 3ZNOA 3HFJA 1ZWLA 3M5WA 2NS7A 2LIVA 2XBLA 4RM2A 4N9HA 2E60A 4UB8H 3IHLA 2WJVA 3G0HA 3FNEA 2E75C 4KZPA 4D8VA 3OSFA 3KSUA 5EUQB 1C80A 1ISRA 1IY2A 2G9UA 2ZBDA 2FUG2 5B7QA 2IDBA 2QD3A 4GYJA 5KYWA 5K3OA 4HKTA 3QVGB 3TNDA 4Z4FA 4GWGA 5FOXA 4Y2UA 2PL3A 2AN4A 1AKNA 4V0MA 4CTNA 1RF1A 3OC6A 3G59A 3B1WA 3PQFA 4TROA 2IYUA 5K0FA 1T5LA 3QVOA 2XA9A 2FOIA 3E4CA 2EINH 3R6WA 4HNAA 3DLIA 3QOFA 1XWFA 1GTMA 4D96A 4FWTA 2GXUA 5HE8A 5FV7A 2PS0A 4UHCA 3QKRB 4I81A 5K3EA 3C4VA 3IIEA 2D8MA 1XCVA 2XQVA 1QQTA 2PWYA 2CFRA 4DZZA 4X94A 3ZWVA 1JNMA 4DAOA 3ONQA 5DS9A 4CZZA 3BA6A 3L9XA 4QDZA 3V7SA 1S5LH 2YJGA 3AIKA 2R6CA 2XYPA 5E8GA 2DPXA 2A35A 2FP3A 4RB2C 3ECCA 4FCWA 4DTIA 3RAFC 4KX5A 5MN5A 5JCJA 3ZQ6A 1HLVA 1OBCA 2WFLA 3A7DA 4PO8A 5BQ5A 2BFWA 3H8VA 4ARVA 3GGSA 1AQTA 1Y8RA 3F7TA 3JASB 3VZDA 1M0SA 2ZBKA 4F4FA 3ROFA 3GLFA 2DQSA 5JAPA 1B8VA 4P35A 5KJ7A 5DTMA 2H6CA 4PONA 5A71A 2LG4A 1L0LK 5ES4B 5FPTA 2IFMA 3IQEA 3F6BX 2QUJA 4PSUA 2ZYIA 1DZ3A 4QRIA 5C3MA 1DTWB 1Q3TA 3N0XA 5FTNA 4L6AA 4AU1A 1NK2P 5A0VA 2QD2A 1DCMA 1LQ1A 1OAOC 5F73A 5EZQA 2OHJA 4DNXA 4QDKA 2Q2EA 3QXJA 5E2IA 2Z5VA 3D0QA 4L27A 3QVMA 2CHFA 1Q1HA 1ZR4A 4LW8A 3HHEA 1XZKA 1BQ4A 5AVYB 5HDGA 5KTKA 1OX4A 2JBHA 3AVWA 3H3JA 2ZT9B 2N42A 1JHZA 3V2RA 4B83A 2BKAA 2HPIA 3DOOA 1VG1A 1EX9A 2C94A 2IYNA 3TLXA 2R8YA 4X9XA 3CLRC 4HWSA 1OU4A 1Z5GA 4IGEA 4IMRA 4OLAA