1ZR2A

Structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination/dna
molecule keywords TCAGTGTCCGATAATTTAT
total genus 46
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zr2A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zr2A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zr2A01
4IHYA 1B8IB 3GTJJ 1TWHJ 2AHQA 3HB9A 3TW6A 5GPCA 1JKQC 1JKOC 3BQZA 4HNVA 5C31A 1IJWC 2DJNA 4DYRA 1VNDA 1I50J 2K9SA 4S0HB 1S7EA 3ZQHA 1WPKA 3JRAA 3HDDA 3BG3A 4BY1J 4A3GJ 2XB0X 3C2BA 1XG1A 4A3CJ 1ETWA 5C44J 1IDZA 3BQYA 3TW7A 1GHTA 1GDTA 1ETVA 1IGNA 3LHFA 2ECCA 5F0HA 5M5XJ 2NOGA 2FD5A 2HXOA 1ZR4A 2NS7A 2X6OA 2HI3A 3JRBA 5C4JJ 5EZHA 4ABZA 1MH3A 5EG0B 2EZHA 2XSDC 1GT0C 2COBA 3S14J 1ZGWA 1VFCA 5FKNA 2TCTA 3TP0A 3HGYA 3PO2J 1JT6A 2JJ7A 3F0CA 4BBSJ 1I6HJ 3JRDA 4BQQA 4DZPA 4RBOA 3M3YJ 3G1LA 4A69C 3S1QJ 4MO7A 1E3OC 1TC3C 1MSEC 5EZGA 3PKZA 5C4XJ 3IH2A 3FISA 1ETQA 2Y9ZA 4B3AA 1MNMC 5IYCJ 5IP6A 3HOZJ 4I6ZA 5GP9A 2ELKA 3I4MJ 4B4CA 2HOTA 2NVQJ 1MH4A 3B6AA 3K7AJ 1IV6A 4IHVA 3GBGA 5FLVA 3TEDA 1FEXA 1D5YA 3JRGA 2CUEA 4AUXA 1BA5A 1RKWA 3LSRA 1H88C 4QSHA 4M3EA 1BW5A 2XGCA 2P81A 2LY9A 2I10A 5JLXA 5DTDA 1AKHA 3IV5A 3HM5A 3HOYJ 2CQXA 3A03A 4EEFG 3HOXJ 1JJ8C 2LK2A 2JA5J 4JYKA 2HDDA 9ANTA 3BG9A 2M2EA 4C3IJ 1LE8B 1BW6A 3GTLJ 1JTYA 2E2JJ 1F36A 2W48A 1F43A 5IYDJ 2OF7A 3RZOJ 4M6VA 5IOZA 1MBFA 4W97A 2G0EA 5EEAA 2LR8A 1JTXA 4I76A 1JUMA 1TWAJ 3IH4A 2VPRA 4B1RA 3S2HJ 3UJ3X 2CQQA 1IRZA 3LSJA 2DA1A 2WV1A 4J19A 1PUFB 2LFBA 3BR5A 4D5FA 4XRSG 3E7LA 5F08A 5EG0A 2JK3A 5IPAA 5K7ZA 1H89C 1B72B 3PM1A 3A02A 3DCFA 2FJ1A 1LFUP 5JLWA 2D5VA 3O8GA 5BNGA 1HX7A 4A93J 2HOAA 3ZQGA 1DU6A 5K7FA 4DW6A 1W0UA 1MBEA 4A3EJ 2LKXA 5C32A 4A3MJ 5F27A 1HDPA 1ZK8A 1DU0A 3Q0VA 1A5JA 1GVDA 3RKQA 2PMZN 3D1NI 1EF4A 1U9OA 3G1OA 3LSPA 1JKRC 1QVTA 1WGXA 4GFBA 5C34B 2NS8A 4C2MJ 5EF6A 1R9TJ 4M3GA 5M3MJ 3HGGA 2MG4A 3S16J 2EBIA 2M8GX 1XC5A 1UHSA 1BJZA 1PUFA 5GPAA 1MBGA 2L7ZA 3CQZJ 1Q1VA 3O8HA 4DYQA 3H3VK 1GUUA 3HKZN 2R93J 1WCMJ 5FKOA 4DYCA 2L7MP 3S1RJ 1QPIA 5J1YA 2R7ZJ 2CJJA 5M3FJ 4A3IJ 2ID6A 1OCTC 4W1UA 2E2HJ 3Q0UA 1ZR2A 4FE7A 3VPRA 1K61A 4A3JJ 3ZQIA 3LNQA 4MFDA 4IHWA 4CYCA 3BTLA 4L5EA 3SFIA 4V2FA 2LP0A 2DMTA 2X48A 3BTIA 2LD5A 4Y52J 4JX6A 2HOSA 3I4NJ 2FQ4A 3OSGA 3HOWJ 2DA6A 1K83J 1ORKA 2ZB9A 1LE8A 2GBYA 3JRIA 3HEFA 1VF9A 1FTZA 5F1JA 1FIAA 5FKKA 2VKEA 1UMQA 1Y1VJ 1IDYA 3JRCA 4A3FJ 3WHBA 2R92J 5IP9J 2K9QA 5EGOB 1JUSA 1WI3A 2WB1N 5IOYA 2DA5A 2R5ZA 4QTRA 1CQTA 1JKPC 2MHCA 4BBRJ 2Y30A 3GTPJ 1P7JA 3OOUA 1NK3P 4MLOA 4BKXA 1FIPA 4UUSB 2OPTA 3SDGA 5J3LA 3LOCA 1W0TA 1U8BA 2K9NA 1B72A 4BY7J 1IG7A 2KT0A 3DEWA 3FK7A 3MVPA 3TP3A 5C35A 2JMWA 2ME6A 2AO9A 3FIWA 1ETKA 1IUFA 2M34A 2JN6A 3S15J 1FTTA 4JP0A 2GLOA 2DA3A 3BTCA 1X2MA 2YS9A 3GUVA 2FX0A 2Y31A 2DTZA 2XPWA 4LOCA 4D5CA 5M5WJ 1NK2P 2GM4A 3BT9A 1XS9A 3QPSA 5K7HA 1VI0A 2DMUA 1YRNB 2E19A 4XRMA 2KDZA 3SJMA 1MBHA 3GTMJ 2XB5A 3BR6A 3GTGJ 1Y1WJ 1WH7A 3UKGA 1AKHB 2R0QC 2QF7A 2O8KA 4G12A 3S1MJ 4M3BA 2HQ5A 4QIWN 4BXXJ 5F0CA 5EGOA 2NVXJ 2JA6J 1WH5A 2DN0A 3H0GJ 1ZTRA 2O7OA 3S1NJ 1H8AC 2YU9J 3PO3J 1QRYA 1HCRA 3ILXA 3MN2A 1U9NA 1MBJA 3FK6A 5FKLA 2X9DA 3L1PA 1Z0XA 2RAEA 2HXIA 2IAIA 1AU7A 1SFOJ 2EZKA 3JRFA 2HYJA 2GM5A 4MIMA 1OFCX 3A01A 1BL0A 3B6CA 4UUTA 1APLC 4FE4A 3BR0A 2Y2ZA 3BR3A 5E3OA 2DMPA 1ITYA 4M3DA 4NDLA 5C3EJ 3S17J 2MSYA 2XGDA 1HLVA 1OCPA 3JREA 1HF0A 2ME0A 2TRTA 1A6IA 2M0CA 5HODA 3QQAA 1POGA 2EZLA 4X6AJ 1JGGA 1O4XA 2DA4A 1ETXA 1RKTA 3Q3SA 3JR9A 5F04A 5EYRA 3RQIA 1T56A 3WHCA 2VUMJ 2N8GA 3MKLA 3OSFA 3NAUA 4FCYA 5FKMA 1SANA 2EQRA 2NVTJ 2NVYJ 2WAQN 4XICA 1YRNA 4FISA 3K2AA 2B63J 2JA8J 4UUSA 2R5YB 2XPUA 1RETA 5DS9A 4AC0A 5FJ8J 3CDLA 3Q0WA 5IP7J 2MGQA 3S2DJ 3OIOA 4X1EA 4D7NA 1B8IA 1OJLA 3NARA 3M4OJ 1MSFC 4MFEA 2XRLA 1ZQ3P 3ZQFA 1P7IA 3GTQJ 2EZIA 4A3DJ 4IEJA 2VI6A 2L7FP 1U78A 2DA7A 1LFBA 5F0FA 1ETYA 4D7MA 1UG2A 1RPWA 3JRHA 2DMNA 2O9LA 2JWTA 2H8RA 1AHDP 2M9HA 2XGEA 4JX4A 1MBKA 1HOMA 1TWGJ 3BR1A 1ZKGA 3W6VA 3ZOBA 1G2HA 1TWFJ 3BVPA 3BTJA 1GV2A 5M5YJ 2L9RA 3CCYA 4DZJA 1TWCJ 1RR7A 2E2IJ 5E3NA 2Y0SN 2ID3A 3FKIJ 3G13A 3BR2A 2LVSA 2EH3A 1IC8A 1X58A 2JA7J 3BG5A 1HDDC 3LSGA 1I3QJ 4AYBN 1ETOA 4A3BJ 4V2GA 2CU7A 3A01B 1NTCA 1QVUA 2YUSA 2CUFA 3RZDJ 3G1MA 1JUPA 4M3FA 2IEKA 5IYBJ 4IHXA 5EDNA 2H1KA 2K40A 2L0KA 4C3JJ 2DA2A 4FTHA 4XIDA 1GV5A 2IBDA 4JX5A 1ENHA 2LLKA 5E3LA 3CMYA 2QCOA 3HOUJ 3LHKA 2VKVA 3HBLA 2CRGA 1X2NA 3IH3A 2Y9YA 3ZQCA 5E3MA 2ECBA 4Y7NJ 2DMQA 4XRSA 4CYCB 4RDUA 2R5ZB 2E1OA 4A3KJ 2RSLA 1JJ6C 5FLMJ 4A3LJ 1Z77A 3GTKJ 1JT0A 2MW8A 2R5YA 2XPVA 3QPLA 1FJLA 3GTOJ 4XK4A 5J1RA 4C3HJ 1RESA 3ZQLA 5J1UA 1T33A 3HOVJ 2LTPA
chains in the Genus database with same CATH superfamily
3MLBA 4DT0A 4LBZA 3M1CA 1BN5A 3MJ4A 4DR6B 2HX1A 5HGXA 5FCDA 2IS6A 5TPWB 1UMBB 5DTMA 2G36A 2I2BA 3I0NA 4FD2A 3NTRA 5L6LB 4C89A 2NS7A 1WOYA 5C4JJ 5LZ2A 1II9A 3OAAA 1SD6A 4IOCF 3M4ZA 4NC9A 4HDUA 2PUEA 3X44A 3U4QA 4ROSA 1ST3A 4CLRA 2UV1A 5CQGA 1PS9A 4DZPA 1XDZA 2RQPA 3VH1A 4YDSA 3MZHA 3UOGA 4HYTB 3KWFA 4IDAA 2XZRA 1C7EA 1KYIA 1KXZA 4B4DA 2ISQA 4CTMA 3ASVA 2RGRA 3FRIA 1I7QB 2VKHA 1O8BA 2IS1A 3CU5A 3AF2A 4O5AA 2PUHA 3L0CA 5H82A 4Q02A 4QE3A 2JANA 2SKEA 1ZW1A 4DR1B 4MAAA 2B5WA 4FGWA 3VO1A 3U60B 2E2JJ 1RS0A 1S01A 5L3DA 3HNOA 5L3QB 4MYSA 3KFWX 2FEAA 2CXTA 3CURA 4Y99C 3NEYA 1J8QA 3OZWA 2RKLA 1X8XA 2PT9A 4G0VA 1SBNE 4BVJA 3NTOA 1LDYA 2CNNA 5T8KA 5A4JA 4FWTA 1Z5UA 4GBGA 1ZRNA 4DVGA 4RM2A 1UFOA 4MW2A 5DM70 2WT7B 2Q3FA 1G8HA 3EF1A 1XTIA 1NTKD 4IL6E 1MPTA 5F1PA 3A4VA 3BSSA 2MSLA 4W8OA 4O4LB 2IZ1A 4AUNA 1KETA 3RSZA 3BX1A 1QZTA 1NSYA 1AF4A 1KZ1A 1L8OA 4BVEA 4FOTA 1JIQA 1B0ZA 4KLCA 4UHCA 4AJ4A 3QX3A 5E3HA 2HSEA 2ZIAA 4MHOA 4OHBA 1XZEA 2A07F 3MBOA 3QP6A 2ITAA 4GGPA 1XKXA 4DSAA 3VR5A 1SUAA 1Y82A 3T3MB 1JH8A 1NMEA 2AXTC 4NPFX 3WGZA 4B7AA 5EFOA 4KSYA 3NHUA 2PBIA 2HA4A 4ZYDA 5KLVG 3THWB 2DETA 3GLRA 3L8FA 2OM6A 3KP1A 3TYXA 4OGWA 3S32A 5FAXA 1ZL0A 1MC4A 2MSKA 7AT1A 1VL2A 5CYGA 2R4GA 2CUNA 1XZAA 1AUVA 3OOUA 4BO8A 2DFTA 1M6EX 4BX0A 2BE5F 3CDHA 4CKBA 5DYYA 4OHZA 4N65A 4IFEA 4RY0A 1VZ0A 2VNJA 2PJZA 2CV2A 4H3HB 1P72A 1NTZE 3HMKA 4AY4A 5C1DA 3AIMA 2Q0QA 1P92A 1XPUA 1IW7F 1X8YA 3J7AO 1JU9A 1SBIA 3PNBA 4EYOA 2ZB2A 1Z2PX 1MNEA 1N2CE 3UKGA 1PWYE 3QOXA 3RODA 4ZT6A 2CB0A 3RUIA 1M1JA 1KD1Q 4LSMA 2VP6A 4BBJA 1KH2A 4BWFB 1KZ4A 1JLHA 3R3JA 2HYJA 2PANA 4MW4A 1M2EA 3F3MA 2O3TA 1P39A 1QM5A 3RK4A 1H93A 5FUWA 2IQIA 1OYOA 3PQ4A 4BQEA 3AGPA 1L0LJ 2VWGA 1HT3A 2H9AA 3CEMA 3ZW9A 3CC2I 3HB1A 2H92A 1DCMA 1QSGA 1W1UA 1E2NA 3NRVA 2OGSA 2WBLC 1PK7A 3F8MA 1D9ZA 2WYWA 3I59A 5COAA 3GBVA 2HOQA 3MRTA 4D98A 5HMMA 1XRLA 3VB2A 4RF4A 4KQEA 3DEZA 3G5TA 2AQ8A 5AUNB 4JUDX 2Y8EA 1E2LA 3E53A 4M9RA 5CNIA 4GOFA 1OIXA 2YXPX 3LC2O 2I7DA 2UUCB 1T0HB 1FU1A 1O7FA 3KWJA 3WADA 4TSFA 3GO4A 4G1MB 1UPFA 2BFCB 1AHIA 4TT8A 2J7PA 1T0BA 5ECWA 5KU7A 1RJEA 3PIRA 2OTLP 5EJGA 1XRRA 2P1JA 1QWSA 4O4HA 2M4KA 4IFTA 1QLWA 2JI4A 5IYBJ 1V41E 4JB2A 5JNUA 2HDNB 3WB2A 2FJ0A 2Q1WA 4YRLA 4Y9RA 3VQTA 3HBLA 2WMYA 1ADJA 1QAMA 3W8FA 4OMUA 3T1QA 1SD7A 2GFIA 3GEZA 1XZMA 1JSLA 3C5HA 3DLBA 1KI1A 4PCAA 4W5NA 1GRNA 4D80A 1VXOA 4CR8A 3FTQA 3HB4X 1P0MA 2ZBUA 1BFUA 1T3JA 3ZHSA 3GZ4A 1Z05A 1L7EA 1CRLA 1VPVA 1XOIA 2FB9A 2DVMA 1H0KA 4AUKA 4C29A 4IJVA 2WWRA 3DT8A 3PGJA 3AEQA 3HH8A 4A73A 2X6XA 4TWIA 1FBNA 4G0QA 4RQAA 1TUBA 4DV5B 3CPHA 2AN3A 4IL5A 1Q50A 3DXXA 4JGGA 4XSXF 3B7PA 4NHEA 1WJEA 1ND5A 3ZK7A 3ESRA 1Y7TA 3M0DC 4AFNA 4NC7A 3E22A 2Z2YA 5IJXA 1ENOA 1NX6A 2JI6A 1D3AA 1L5KA 4F4JA 1UPBA 3ESDA 4FX5A 5EJ4A 1ZI8A 5IC5A 3WK9A 1IN1A 3G2QA 1SQFA 2GEBA 3G8BA 3IQGX 3R4CA 1E5VA 3T4EA 3FXDA 4AYWA 4H17A 3KJNA 4OL9A 1BS1A 3H9GA 4PU0A 1PJAA 3L2UA 5FBQB 3K0KA 2HQOA 5IW8A 2Y75A 5A71A 4JLMA 1NC1A 4MHSA 5EXEA 3B8EA 2QX8A 3K9BA 1MHTA 2CQXA 1L9KA 2Y71A 4F6LA 3NBQA 1IBLB 3QVJA 2EX1A 4J90A 2Y68A 4MRVA 2QTHA 3DOCA 1LWUA 2MLKA 3E82A 1XU4A 2HI0A 3JZIA 4BMCA 1Q81Q 4BMZA 4IZHA 4OJKA 1H2FA 5JMWA 4JH0A 4GOOD 1QHHD 1Q44A 4AJ1A 3SWYA 2PLWA 3OOEA 3FSGA 4HF2A 1DU6A 3JSAA 1NHWA 5FFMA 1NBAA 3P71T 3AIOA 2D1HA 4AYBA 3JYQA 1RF0A 4XYEA 1Z7EA 3F71A 5BSFA 3WTXC 3MTUE 4U2EA 2PGNA 3D3EA 2IBZD 2OCKA 2WPVB 3PV0A 4KYIB 4DOMA 4BE4A 1I5RA 5IHPA 5AJVB 2ZTVA 1I1OA 3NYQA 1Z37A 1G4HA 4X44A 5F4BA 2GEKA 3O95A 4RD0A 2VPWA 3A0RB 5FV4A 3ML1A 5JD6A 3HYIA 1ZELA 2G6BA 1H3FA 3ZG6A 4AIKA 4MUGA 5TY0A 2J7KA 3ES9A 4MITA 1XCBA 3W2WA 5LZ9A 2Z43A 1ZARA 2RIRA 5E1OA 3RBZA 3V4OA 3DVSX 1QL2A 4UM7A 2Q9IA 5LKRA 3I0MA 1GAEO 4X90A 1KZGB 5G0UA 4PVCA 1ELOA 3IP8A 1XTKA 2IODA 1S7AA 3GLUA 4C04A 1HSJA 5TXGA 4H08A 2HPAA 1DADA 2F62A 4WOJA 1PFWA 2WSYB 3I76A 4W6ZA 2B99A 4R84A 3B5NA 5JCPA 3JATB 3AEZA 5LQMA 4EG1A 5LC1A 1GPH1 3CC4I 3TMOA 4QLAA 4TLEA 2FYUJ 4P0TA 2M45A 3M49A 5LL6P 3IT3A 2ORWA 2UXCB 3H8JA 3LGAA 2ISZA 1DBQA 2CK3A 1AKTA 1PPJD 2VUMJ 2QQ9A 5EWMB 2B61A 3G9RA 4HLCA 4C9BA 3U3DA 3QAHA 5AW1A 3PHGA 1KJZA 4HV6A 4BVLA 4UVCA 3OIPA 4L9WA 2Y1FA 2YASA 9ABPA 1ZD8A 4AF7A 1K7CA 1L4EA 5F0FA 2Y1DA 4R68A 2IPAB 2GBLA 2EZTA 2VOEA 1Z6YA 1Z8NA 5ERXA 2EZ9A 2G4VA 3M5CA 1YYVA 3O3MB 2FNAA 3MUDC 2NZXA 2Z5LA 2WFLA 2BVLA 1SQ6A 4IXWA 2XIGA 1I94B 3AR4A 3KFVA 2O52A 1G8GA 1N1DA 1XTPA 5LMCA 4IIXA 4B3BA 2I2AA 1YKFA 4HP8A 5DTRA 4QXRA 1IE3A 4R8SA 2WITA 1X2NA 1F48A 2P65A 3HB0A 5JNSA 2JWAA 1XMPA 1NG1A 3TTVA 5TMDA 2NGRA 5AW0B 3LO5A 3N74A 3PEWA 1TI7A 1U3CA 4Z86A 1Y8RB 3M8EA 1W30A 4E4TA 2YC4C 2PKRA 2SCUA 1FC3A 1CSEE 1T5DX 1SQPD 1PR3A 3V7CA 3DKRA 3GVCA 1H2ZA 1MF7A 1U9JA 3TKAA 4LZAA 3IEVA 4KYVA 721PA 4MW7A 1EA3A 1C1DB 1TO2E 1SQXJ 1IQRA 3S2ZA 1U0BB 3BWBA 1VM6A 4F9EA 4DTIA 5EG0B 4QLOA 3EIOA 1L5YA 4YRNA 4RA6A 2DT5A 3N87A 1YZUA 4EJTA 1HEIA 3NDIA 2FP3A 4X61A 2BBWA 3CSUA 4BQQA 2LKSA 2MT9A 4XXHA 2DLNA 1SD4A 3UAXA 5EN4A 3E27A 1SFCD 1YTLA 2HR1A 3ILYA 4CM7A 2GASA 1RI2A 1MX9A 3WYAA 2ONJA 2BFMA 5FEMA 4DCKA 4HS4A 3H2BA 3VFZA 1YULA 2FQWA 2P0WA 5FOQA 4LKRA 2DULA 2VI5A 2HSDA 2R8XA 1G7SA 4XYBA 3PXXA 4JBGA 2KQUA 2PKWA 1GQFA 1K3UB 1BDDA 1RYDA 3L7LA 9LDTA 4F4HA 1N7SC 2H5IA 1S2OA 3QPVA 2Q50A 1ZY2A 2WIFA 2ZBFA 3AYXB 3L92A 4DDKA 4WK8F 4AJHA 5EEAA 2KS6A 3I83A 4FSXA 3B3AA 1NVVR 3HE5A 1MZ9A 1E1QA 3TTXA 1W94A 5E95A 4OYRA 5FIUA 5K3SA 4UE6A 3I9FA 4H0LD 1CVLA 1OC4A 5ARBA 2JIOA 3EZNA 3IV6A 2QRKA 1QH1A 2QAGA 4TLLB 2KISA 1BFKA 1PG0A 2PDAA 2H1LA 1R0CA 4EA8A 4I99C 2ONYA 1YBMA 2BEOA 5CP8A 5ECGC 4RLSA 2E18A 3AHFA 3ZE6A 2R7ZJ 2KJQA 1MO6A 2PJRB 3WSTA 3V1MA 1B6RA 1CZLA 1CUFA 3OZXA 1L5ZA 1YVRA 2H29A 3V4QA 2H07A 2V0GA 2QUZA 1W34A 2JRTA 4N6JA 4IKEA 1QRDA 4IZZA 3A9WA 1GGKA 1NAYA 4BNCA 2K9LA 3CZAA 3QRWA 1TT5B 4MR9B 5CCEA 1RQXA 1YJ9I 1GVJA 3B82A 3P26A 4HDOB 3A58B 1BSNA 3DEKA 1J06A 4HH4A 3A2KA 5EJFA 3R5KA 3C3DA 2WM3A 1T91A 4KPYA 5TLSA 2E60A 4BQPA 4HGNA 1NTKE 3UQZA 4EYSA 3INYA 2LCFA 2GN8A 3G2BA 2EL9A 1X2MA 4PGGA 1YWGO 3IP5A 1X3LA 1SOAA 4I6JA 4KVFA 2NRGA 1Z91A 5ALNA 1P9LA 2NNWB 2H57A 4J0GA 2EEZA 2O8KA 1KDVA 3BXHA 3G3EA 3KT8A 4YRMA 1QNFA 3KAJA 5CB4F 1N6KA 2J41A 5HK8A 1TC2A 2BE7A 2JGNA 3PT9A 1SFOJ 5BQTA 3HHHA 4FETA 5THQA 1VQ9P 4HEHA 1QQ7A 4I4TB 3MOGA 1X94A 3BJ6A 1S72P 4A8JA 3R60A 2HHJA 4ITVA 3QQAA 1BCCD 3GXBA 1NVEA 1VE5A 2TECE 4HNAA 1A50B 4S1PA 4FYHA 4UDXX 2BH9A 3UJBA 2HPVA 4PD4E 3E9YA 5I8WA 5CVIA 4LHVA 5H5JA 4CBVA 4UUSA 4B83A 3GI1A 3IP3A 3C18A 1ZIYA 4HFJA 1EVIA 3JRWA 2KDOA 4PSDA 1WJGA 2G82A 1QVRA 1YG2A 5HBRA 4E5UA 1FRFS 2JLBA 4JBZA 2VI6A 3EIWA 1C9EA 1HURA 3GW2A 2QYSA 3OE7D 4GBJA 2YXRB 4EBBA 5ILGA 4I7ZC 5EI5A 4CCYA 2EWMA 3DTYA 3P32A 3FMPB 3F4KA 2F1HA 3L2QA 1A8SA 3DMPA 3PNLA 3KDSE 4MPDA 1V96A 1QDUA 3OZRA 4F91B 1KYOE 1RD4A 3HLTA 2O8EA 1U81A 1SBCA 4GZ3A 4LY9A 1JEQA 3L43A 4JYZA 3AE3C 2XOKD 3ONEA 3C5VA 3N97A 4V03A 3K5BA 2WZDA 3RQSA 1E3PA 3AJDA 1BO6A 1U7TA 1O3RA 1KO5A 1U9YA 2MYUA 2FQYA 4KQCA 3R75A 4DJGA 2YFQA 2H8WA 5ITZA 2XMRA 2K7ZA 1PL8A 4NBSA 3J7TA 3OQHA 4LEIA 3U49A 4XSHA 1BXRB 3PXBA 4CG3A 3LLSA 2DMRA 4YDQA 3BQYA 1QFYA 3EZ2A 1QFXA 4ZTZB 4BO7A 1HTBA 1RJ9B 3HUTA 3IDZA 4BZWA 3T0FA 3QKUA 2DT7B 2ODNA 4FP9A 1FJXA 3DV8A 3T34A 1DKUA 1N7SA 2DB3A 5ALSA 3L18A 3UEOA 4Y4RA 2V7GA 3ENZA 1NU1D 5EZGA 4Y0NA 2H4HA 3H17A 1I7PA 2NO6A 5D2CA 1XO1A 1EDIA 1L4YA 3GFPA 1RWKA 4N6OA 3PJSK 4XQ0A 3K1ZA 1VP3A 2Q1SA 1RI3A 1P0QA 1NLFA 1JJIA 3HD7D 2C2WA 3F5DA 1HO3A 2VYND 4C2BA 2E75C 3BXOA 4GD3Q 3F5SA 5BPFA 2I10A 1E92A 1MA0A 5ESWA 3ZV4A 1GUZA 3GEEA 4UBIA 3CF4A 3FG9A 4ICIA 4EHDA 1LPBB 4FOOA 2O01N 3RK1A 2DOKA 2VWQA 1OGJA 1ZK1A 1ZOLA 1QP8A 4W97A 4I76A 3VH4A 1JUMA 1M5TA 3DEFA 1BC8C 1M1UA 1MAWA 2FLKA 4CCSA 2DA1A 1QZ3A 1JI3A 1B72B 4RXMA 2FJPA 4OH8B 4TVBA 4YRQA 3UCXA 3QA9A 3CLRC 1FRNA 1YJXA 2QHXA 1GGMA 3AGQA 5D1NA 4QNNA 1QIEA 1S4QA 2JT1A 1R9TJ 4XWGA 2Z5VA 3DE6X 4RS3A 1K0UA 2G1UA 2VVTA 3MMZA 5DUIA 4BLRA 1VF5C 1MNQA 1QZXA 1IEXA 2VBXA 1CI6A 4HRXA 5L6MB 5BPDA 2AXEA 1PGNA 2P10A 4S1TA 3ILVA 1FB5A 2VLIA 1V25A 6PFKA 1UQRA 2CMGA 2BOLA 2Y0EA 3D3NA 4ZV4A 5AKKA 3TTTA 1OWMA 2WJAA 4IJKA 1Y7IA 4OHCA 3FPFA 1KQ9A 1JQKA 2ZCWA 5DN6A 1TP4A 2O8DB 4CG0A 4AMUA 3KR2A 3BCBA 1YS2X 4GKVA 4X45A 1EVEA 1XRQA 1DRKA 2P9QA 4PX3A 1YKGA 1WMKA 421PA 4YV7A 4P7GA 5D5PA 1TZJA 2JN6A 1N3LA 3PEYA 2VJOA 5DTEA 5BUQA 1V5IA 5LYJB 3FDJA 1KFCB 1KZ7B 4KUEA 4MVWA 4P96A 3UW3A 3ABZA 3GTMJ 1RZ3A 4JI7B 1MIJA 4HNHA 4QYIB 2ZXWH 4EPRA 2JA6J 4L3VA 2QUAA 1V11B 4AY3A 2HFJA 1R8SA 3KIPA 1WUTA 3EQ2A 2Z3WA 2CXXA 4BRYB 2X3UA 3TZLA 2EJBA 3IOMA 2N47A 3HRTA 4C4XA 1HEUA 1FE6A 3AWDA 3VDRA 2QPAA 4EUHA 1U2GC 2YVUA 2H6EA 3OMXA 1JGGA 2ZB4A 3NUZA 3TTSA 2ES4A 1Q2XA 3RIMA 4KQWA 4AJPA 2PUFA 3OZDA 3FDYA 1RRVA 1RWWA 2C1EA 3FYUC 1FOWA 1JDJA 4AQYB 3SIWA 2FMFA 5B53A 4G1VA 1JTVA 1U7UA 4QJ4A 2EGGA 1AURA 2WJVA 4ILKA 4KVGA 1GG8A 2BMAA 4I1VA 1KO8A 2XDWA 1O57A 4J2OA 1G64A 2BRUC 1DSSG 1QHHB 1M1YA 3H9BA 5ALXA 3IWZA 4IIFA 5BNWA 1JG3A 3EDOA 4JP3A 3ABVC 1WQ4A 2P78A 4S1NA 1T2UA 1EG2A 1PE0A 2GVDC 2ZYWX 4IZ6A 2OVBA 3CJRB 5FBLB 2VPYA 2WAYA 1WDWB 5DTJA 3LCMA 3T1HB 2CFXA 3INNA 2WFZA 2ZJYA 4HGYA 1LVUA 4Y99B 2IYRA 1G17A 1YCDA 2CWDA 3QEMA 4KLNA 2GD6A 1X4OA 1IRIA 5LMUB 4DLTA 4KDCA 1IUOA 3SS7X 4AN4A 3AFHA 3PD0A 2PZMA 3DUFB 4W7YA 1O2DA 2IYXA 3SLGA 5KWJA 1SAYA 5IDXA 3W5AA 1JLLB 1NN5A 3NCHA 2CZQA 3IHLA 3DR5A 1H2XA 4A3CJ 3LA7A 4Q12A 3BHIA 4E1AA 5D00A 2D8MA 4U8HA 4RY9A 1JA9A 3MJEA 4ZODA 3A1SA 1IJFA 1IQPA 3FTNA 1A9XA 5CA1A 2IV3A 1ZOOA 4D3FA 2JLUA 2BC9A 1YRAA 1EDBA 3NETA 2DTXA 2I66A 1TM4E 1T1SA 3O26A 2IV7A 2JCGA 3V7WA 1FJPA 2JEZA 3VP8A 3V55A 5DGXA 1P3JA 3PQFA 2SPZA 3AIKA 4P31A 4Q4ZF 4EMSA 1R88A 4MWGA 2NRAC 4DWJA 4ZOCA 3GCWA 2WFAA 4GR5A 3DT6A 4P34A 3U5ZB 4V02A 4W5WA 3C4JA 3JW8A 4LDPA 3LUBA 3RM3A 2OFXA 4YQZA 4ZAGA 4EW1A 1JI8A 3FGAD 4N40A 2UUOA 1KC1A 5JQGF 1G8YA 1D09A 2YINC 4RGYA 3E3NA 2BY0A 3SWKA 5LU8A 4YXWA 5ILOA 1Y9JA 5HMLA 1F4LA 1VL6A 3AEKA 4JIGA 1YAHA 5BMOA 1M2WA 1IEVA 2NT3A 4I9UA 2OV4A 2RI0A 1ZLXA 2R4QA 1RM3A 3DV9A 4JQSA 5EXPA 2D1TA 2PMHA 2HKXA 2VAMA 4N8DA 1E5TA 2P77A 2RHMA 4OLFA 4E2WA 3FPLA 1MT3A 3NDBB 1R12A 2WVHA 1K9MQ 1GLNA 3N5CA 1VLLA 3ZWCA 4M9CA 4DBZA 1BS9A 3IUJA 1FW8A 1PF7E 1ZPDA 2JLRA 3KAPA 2B8NA 3Q2KA 2VF5X 1YVEI 4G0PA 5E6UA 1S1CX 1MAVA 1TVMA 4R9RA 3BTOA 4IHWA 1Z35A 4ALLA 4LV6A 2HC9A 2NZ8A 3FX3A 1YHZA 3R8XA 4TVSA 4QPPA 2L19A 3CX7A 5BN5B 3RNOA 4IWYA 1Q0ZA 4NYMR 5GAJA 1C7FA 4E1BA 4TV8A 4MZDA 1L7BA 1YTZI 3WQQA 2E71A 5BUCA 2IYYA 1VYVA 3QEOA 2YVQA 4GU5A 5AW1B 3IAUA 3KAKA 3D8SA 4WCDA 3WRVA 3OFJA 3V4RA 3C1TA 4RB2C 1M8FA 5K7SA 3RYHB 5AJZA 1VF5B 3HY4A 5K0LA 1JE0A 2WA0A 1YB4A 3TIFA 2E19A 5G53C 3BE6A 4Z9FA 3NEJA 1IYZA 4FZRA 1PJBA 4IX9A 2DN0A 5ICCA 1Z5NA 3KHKA 1EXWA 3AERA 4K9MA 3JRFA 1EPUA 2RKBA 2QG6A 1X8JA 4A9AA 3QF7A 1DEKA 3NHFA 1HF0A 2R6ZA 2ME0A 1N5OX 5C7IO 3DVAA 3Q1KA 2I1KA 3H5VA 3QKWA 1A8HA 2IPOA 4GSLA 4L5AA 3ZHZA 1ZOPA 2VE9A 1QYCA 4P4LA 4OJYA 4OUDB 4BE9A 1TVKA 4EYKA 3AUJB 3IQDB 4N0DA 1KPIA 3II6A 3BZKA 3KU4A 2AN1A 1M2JA 1ANKA 2HJHA 2GHRA 3MTBA 3K9GA 1XLTC 2FPPB 1CB0A 2IPLA 4K28A 5CCHD 2OA4A 1EFVA 2H7CA 5AM2A 2ZRDA 2AFHA 4BFUA 3M8FA 1JY2O 1VQKP 1MTOA 4OAPA 2KUBA 3RGUA 4FHEA 3GFTA 1SBZA 1XVIA 3BZBA 4FQ5A 2OMEA 2I3ZA 3GJ6A 2OTJI 1M0SA 3L4BC 4CV2A 3PUVA 3I58A 1L7PA 3L8DA 3RZDJ 4AZVA 4J00A 4RS8A 1RYHA 2ZSKA 4NKRA 2EKQA 4QTTB 5TE9A 5DYMA 1WSBA 3DVLA 2R5ZB 2NZ2A 1A98A 4A3LJ 3ZV7A 4G5RA 4DY4A 2GA8A 5K5RA 2NO9A 4MQ9F 2OUMA 4EPXA 2ALJA 5SY6A 2P8TA 1U0NA 3CEHA 3ZGKA 1VSBA 2X4IA 1BOOA 1JY3P 3HPHA 3GQBB 3L8EA 2FOIA 4XOPA 4BY1J 3RWMB 1KH1A 2I1JA 3VAYA 1PP9D 4ECAA 2R6R1 4EDFA 3CLHA 1JR3E 2V98A 3CWZA 3CCVP 4D0PA 4A92A 1B6SA 4EUFA 3T4UA 3CQ9A 1BVHA 4DG8A 2F3SA 1NNSA 5JHFA 3T9EA 1NULA 4GLFA 4CQJA 1Y4SA 2EC5A 4MX8A 5AVYB 4B7XA 5SV2A 1NRXA 3LLUA 1OTXA 3I09A 3D70A 3WLNA 2N42A 1U2GA 3RABA 3L4SO 3HOZJ 2QTMA 5AYVA 4MVXA 4AXBA 3PFBA 3TQSA 1PR2A 1FLDA 1J2RA 1MX5A 4Q4HB 4ONEA 2NU6A 3QHAA 4ESEA 3LLMA 1TYEB 5K0JA 3DAOA 4C4ZA 4QXMA 1LNZA 4RA6B 4AT1A 4FQ7A 3QU4A 2CLKB 3BQ9A 3QW2A 4Z8XA 5DUKA 4XR9A 1K7FB 1EUDB 1BN6A 3BCCJ 1V1RB 4WXYB 3Q3VA 4EGCB 4HNRA 2IEZA 1D2NA 3DCFA 4Y7CA 4FYXA 1KB9D 1NRJB 3G0OA 3PKIA 4RVCA 4TRRA 4FILA 5CD9A 5BSWA 3DEHA 3LP5A 4L4UA 3AI3A 2BJWA 1S6LA 1VPCA 2VNSA 2WF5A 2A4MA 4LVOA 4NX2A 4YQEA 5FOVA 4WK2B 5JWHA 4I1UA 2B4AA 5JFGA 2O1WA 3HRSA 2B4TO 3R2JA 2DFLA 5E8IA 1L5WA 5LMZA 1UF9A 4D5GA 2IW1A 4Q7JB 3JSPA 3G5MA 4FHFA 2GN0A 4Q48A 3L75G 4M21A 2QSGX 1R74A 3BTLA 3MTJA 2VF2A 5DLDA 3JTMA 3CH5A 2WPNA 2XDVA 5EE3A 3T3IA 3LPDA 3RVDA 3H32B 1K83J 4Q1EA 4Q3NA 4XJVA 2UVPA 4LB5A 4W5JA 2AFHE 3RRXA 4KPFC 4J0HA 4TS9A 4JK1X 5IJ0A 1JGTA 3LW5H 3DFIA 4Y30A 4TMWA 2KWIA 2X0RA 5KC8A 2WSLA 4HJRA 3JYPA 1Q0LA 2O8FB 4ZDLA 1JYSA 1OBFO 5AJXA 4BACA 1FYMA 1V3QE 5IEJA 4PV7A 4CLXA 4KQJA 3OY9A 4KDEA 4EARA 1IVYA 2DPLA 4XGRA 1FOYA 1URQA 3WKBA 5JW6A 4HGRA 1DS6A 3H19A 1JPNA 3KD2A 3DEUA 1BZYA 3D0OA 2MH2A 1YHNA 2ZOSA 4OXRA 1K6XA 1CF4A 3ASOH 2HPHA 1ZTRA 1P0CA 3GY0A 5SY4A 1QP4A 1VL8A 3Q5DA 1U0HC 5A4DA 1EFVB 2JFNA 1R36A 3H1EA 2VXZA 1IN4A 1CDOA 3LXMA 3UBMA 2HZ7A 3CCQP 4Q1DA 4E14A 3ETHA 3QBDA 2QJPB 4HAUA 1E79A 2C4HA 1CV2A 4XICA 1T6BY 4Z3DA 3MYRA 4LSZA 1BNCA 5ALQA 1TQMA 4X1EA 5T4HA 4DDVA 4HO1X 2I33A 3I62A 4DNFA 3VDMA 2DF8A 3VJLA 5CFMA 2X6TA 4W1SA 1DPRA 3DMHA 4BATA 1IOZA 3VKGA 3ZWKA 4RZXA 4BNIA 5HDKA 3ZWWA 2CHEA 3Q6MA 1R9MA 2OZVA 2P6UA 3H5NA 1RXVA 2WOJA 1ESNA 3C97A 1Z4IA 4BLOA 1SCNE 2E6KA 3ZXUB 4ALKA 4DV6B 4KR9A 4WLFA 4RA2A 3L0ZA 2ZATA 4HB0A 4RB1A 4PCLA 2P4EA 4K6KA 2V59A 1WA5A 3ZDYB 4TKLA 1O3YA 5KTOA 3JQAB 3CCRP 3ST7A 1IK9A 4M37A 2J5QA 1W5CC 2CXQA 1V5FA 3RF6A 3IO3A 4PIPA 3LOQA 3LSTA 3COPA 3RFXA 3Q7SA 1OAOC 3WSWA 3GN2A 3NP7A 2YJ4A 3OCYA 3EXG1 4R1NA 3R7FA 5EA2A 1NQUA 5TVGA 5IM4A 3H2GA 5FRNA 3DULA 1OCZH 3GFOA 4HQRA 3ZQKA 5AVRB 5D5XB 4H4EA 1NV8A 1FZGA 3GLKA 5F0HA 2Q4EA 2X6OA 4UD2A 3L1UA 4WA7A 2YKPA 1A2QA 3ZCRA 4DMHA 1E3WA 1JCDA 1FDUA 5EP4A 1V4BA 5AIAA 3DM9B 1PAUA 2YOFA 3B6MA 4RXUA 3OS2A 1CLEA 2P62A 5ICSA 3L8HA 4HGQA 1DKMA 2WY2D 4IDPA 4MPJA 3OHSX 2ZU0C 4MA4A 4LLLA 4WJLA 1PWHA 4TZTA 3MP7B 4OMCA 3T5CA 2R7FA 1ORHA 3ZUPA 3L00A 5MFZA 5EPUA 1BG6A 1Z0KA 3HZRA 1L0OC 4BB6A 5DU2A 5A02A 3LXUX 1T5HX 1YR8A 5DMHA 4E7OA 2O9JA 3K4BA 2H0QA 2J9XB 2R00C 3EFOA 3ZQ4A 1Z4KA 4RHXA 2P6SA 2GEUA 2G67A 2AZDA 4IO1A 1JKXA 2XBUA 3RS7A 2IW3A 4XGNA 3K9TA 1H22A 5HBGA 1IRZA 2QX9A 4B79A 2M30A 1CP2A 2DCMA 4PCQA 1CJCA 1P6UA 3GDFA 5JQGB 3EBPA 5FWYA 5G4KB 2HOAA 2C82A 1WHTB 4OI4A 4DW6A 1ZVKA 3L4EA 1JUNA 3BH0A 3EZ7A 3LKZA 1Z82A 1M1KQ 3QFTA 2CFTA 4D46A 2JPBA 2W84A 3VYUB 3SR3A 3JAMZ 3WA6A 4BU1A 3RYIB 2X3FA 4IDGA 3U4GA 2ETXA 3O2JA 4DJDC 5GP1A 4F97A 3N4MA 4HXFB 1H88A 4D8UA 4JLUA 4KRFA 4IIEA 2BN4A 1ISGA 1YFHA 4P7KA 5TQJA 4JX6A 4DOZA 5FLXA 2MYPA 4HWPA 4LY6A 1GFWA 3PZBA 3QBVA 3C74A 1GTRA 2DZDA 1THTA 1P4HA 5FYDA 3W9UA 4KWEA 2F5DA 3NWSA 5CDGA 1AOXA 3NORA 2YJTD 2ZSUA 1ECCA 2ZYGA 2BI7A 1SIUA 1K8QA 3NGLA 4OJNA 4FFPA 3L7YA 3RC9A 3C3KA 2OAEA 1EFAA 3SM3A 3TP3A 1E99A 1OI2A 1I2AA 2IITA 3QE0A 5HHTA 1LSUA 4YRRA 3FKSD 4R0VA 1AQLA 2FG5A 3R5HA 3K5WA 4F5YA 1EDZA 2C4VA 1YRNB 2IBMA 2JFGA 4XRMA 1TA0A 4B74A 3E9QA 5F3WB 3B1YA 3GRAA 1PJSA 3EUKL 4QIWN 5ADUS 4L4SA 1E9FA 4G0MA 2O1JA 3WHIA 1BWRA 1PJ4A 2PFKA 1BL0A 1NTRA 4TWBA 2EHDA 1BIFA 2ORIA 3M2PA 3DEAA 1LEAA 4KGDA 3TUIC 3ONFA 1POXA 1FNDA 4YIKA 4LGDE 1GNVA 2GXSA 1ZGGA 2Q2EA 1Z4NA 5HUQA 1XGSA 1KTMA 3JV7A 2XUJA 3K3PA 2P79A 1OLSB 1DC6A 3V5NA 4O0MA 3IOCA 5KTKA 3F73A 4UKDA 3UMCA 3QPTA 1CF2O 1E0JA 3HJCA 3OYAA 4CTJA 2WKPA 3HY3A 121PA 4K7JA 3JD2A 3C1AA 2Q9AA 4KJMA 1SHTX 4R9NA 4P7JA 5IAKA 1T9AA 3DONA 1ZHOA 2AN4A 2Y93A 1WBJB 3U1VA 1N7JA 4M9XA 4P1WA 4G7HF 4MLCA 4FW8A 4HYQA 5BW5A 1LUJB 4C3UA 4MDFA 2ZIVB 4BAZA 1K8XB 2K27A 1XD9A 3FVTA 3QVSA 4A1FA 3IE1A 2LTAA 2Z30A 3QMMA 3P9PA 4ESJA 3L0DA 4PPGA 5J1UA 1EESA 1J1DC 3EE6A 1UBUS 4C7JA 1HMYA 3F89A 1E3MA 3E5RA 2FR0A 2PEZA 1PPJG 1T35A 4M9QA 3PJGA 1CYDA 3W6JB 1ZK2A 2ZTLA 4HPQA 1J0CA 3ROMA 1X22A 3MILA 3I45A 3BTVA 4H31A 2V7TA 4P3PA 3I04A 1UQUA 3FUUA 3ER8A 2B9VA 2FWBA 1ZH5A 1M76A 1TA4A 4ZQBA 5A7HA 3DV0A 2IWHA 5HDQA 4LJAA 1UQTA 4Z99A 1KZYC 2XMDA 3P9YA 1IONA 4NAUA 1PV2A 2CNWA 2PP6A 4CU2A 1KI2A 1YI8A 4O5OA 4PFQA 3EBLA 4EZEA 5J5VA 1W7PD 2CHGA 2VDOB 4MWTA 3TOCA 1CERA 4HX5A 3CSDA 5J2UB 3QLJA 2DFIA 1E8DA 4ZARA 2FZCA 4LVNA 1L3IA 5ELXA 4ZVUA 3EUFA 1F36A 2VDNB 3Q4GA 1Z3XA 2OC6A 1JDNA 1VKZA 1B76A 4MVJE 1BI3A 3OOHA 2X9QA 5BQFA 1DO2A 1Q20A 3NGXA 3AJ8A 5AVKA 3X2EA 1T8WA 4HEA6 1FAVA 1TNSA 2GYWA 3E5NA 2QSHX 1A8UA 2JA2A 4OMZA 5BVGA 4XWTA 1XXLA 1VL5A 2Q3EA 2A7XA 4ZOBA 1TD9A 4N9QA 2VDRB 3P9XA 3VR4H 1MO3A 2PMEA 4RPJA 2QR3A 2Y0CA 1H42A 4IQ8A 3HL2A 2FMTA 2OT3B 1R00A 3G82C 4ZVOA 3B1KA 1ND6A 5EHGA 3SFDC 1IZ9A 3GAMA 3DBVO 4DJAA 4GG1A 4JYCA 2VNHA 2CLFB 4GI7A 4L6IA 1LTGC 3PQCA 2V4ZA 3WGQA 4B82A 3HEFA 1OFHA 2FX3A 3TMYA 2ZCJA 1YC5A 2C2ZA 2QTTA 4GNKA 4JUCA 2ESHA 3AW8A 3GUUA 3R0IA 3PNMA 4D26A 3GF7A 1GL2C 1HXHA 3BG6A 3NW9A 3SZRA 1WKMA 4D4LA 2BHLA 4TMVA 4HEQA 5DBIA 4NJMA 4J49A 3PXDA 3OE7A 2OHIA 4Y18A 1CY4A 2X1CA 3EDMA 4ESVA 1QUFA 1S8AA 4RH1A 4KR0A 1ZNXA 4ZO6A 4EYYQ 3L06A 1Z2OX 3MMYB 2FN9A 3E8MA 3ZCOA 1LF5A 4BZPA 1XS9A 1KU2A 2XUAA 4MO2A 3TLCA 3M70A 4AS2A 3HZOA 3SJUA 1PL0A 5EJCA 1KMQA 1P7WA 3TL4X 2WUEA 1JEJA 3GA7A 2WVAA 2F90A 3ZKWB 4ZO8A 3RT7A 1N75A 3STUA 2DECA 4NRDA 1E96A 3RGWS 3CN9A 2C7OA 3TB6A 2WM9B 2ZS7A 3AVYA 2I2DA 3O84A 3LX4A 1GPKA 3RIEA 3F23A 1D1SA 3D6HA 2WU3A 3NDPA 2Z1DA 5AWFC 5EQJB 3THXA 4NEGA 4RGQA 3LSYA 3ASZA 1V1MA 2VTKA 3IIEA 4U2KA 3GLFB 3H5IA 3SZLA 1W7PA 2B21A 4OAQA 4M73A 3E7FA 1DB3A 3GMEA 4UVIA 1NE7A 1I1SA 4K9QA 2UXXA 3U1CA 5H9WA 1ZSYA 3CN7A 4TTQA 3CG4A 4DPLA 4HQLA 3KZNA 4PWZA 5ARDA 4L57A 4K05A 2RH8A 1L7DA 1G2HA 4YCCA 1VHWA 5AOVA 1U0LA 1YVPA 5B1SA 3HLYA 5K4GA 2B4KA 4D96A 1KYZA 3S2IA 2YHAA 4YIHA 4WCFA 4PLGA 2W0SA 4AYBN 5AI0A 1ETOA 5JANA 2QLTA 3LTEA 3UPUA 1W5EA 2E5FA 1G0OA 3M1EA 1EYZA 4WJKB 4W7SA 1FX1A 3DV0B 2JEOA 1KMHB 4MRPA 1DDGA 1COZA 1Y6QA 2YV1A 3S29A 1JHMA 3HDYA 3V33A 2PVSA 1LPMA 3D43A 3LUKA 4BZZA 3R8FA 1NNUA 3M9XA 5JHUA 3DHWC 3U44B 2YFKA 1A88A 1W0JD 1JEQB 1VNDA 2ZVPX 2W85A 4G9YA 2BD0A 5ANRB 2VKDA 4BYYA 3AL2A 1JJAA 2IU6A 2GS9A 4ARVA 2P5KA 1L5VA 4XEUA 1Q7TA 2MU1A 1ZEJA 2ZJ0A 1IPEA 4ZTUB 4FEGA 1Z4LA 5JPCA 5FORA 1LSJA 2G9UA 5AVSB 3BSFA 2ECKA 4CLHA 4XONA 1ZUIA 4LF5B 3AF1A 3UAYA 2AZ4A 1P4JA 1U11A 3NRJA 2A06E 2V58A 4S1WA 1KAQA 2PLYA 3EDPA 4N6GA 2X6RA 1NXVA 3LQRA 2YWHA 3FXEA 2AX4A 1U3GA 2H5JA 3CP2A 2ADOA 2KPOA 2IHUA 5FI5A 4GXTA 2HXGA 3LK7A 2ZUUA 2NPSC 1UJ6A 3U6KA 4B4WA 5I5GA 1LP1A 1SQQD 4AM3A 3GN1A 4HAMA 4A8JC 4FCVA 1G98A 5IFKA 1ZC4A 4E7ZA 1SEVA 4BLSA 5GZ6A 5TPZD 1EFRA 3AINA 4TKUB 2WG2A 2A45I 1BSHA 4TXLA 3WTZA 4B3HA 4NLLA 1GGJA 2KIMA 1R1TA 1QRRA 2FUEA 4N48A 3NYWA 3O4RA 3KQQA 1XJWA 2W98A 3IH4A 2P2DA 3VGPA 3HXPA 3DAGA 4GYYA 3Q6IA 1RXIA 2XCTB 3BJMA 4A8JB 3O3OB 4KQIA 5DBOA 3EWKA 4IUDS 3WO0A 3V4WA 3C2GA 3CR8A 2A67A 1HDPA 4MI9A 4HRYA 1U9CA 3JU3A 1RLTA 4UEWA 1SPBS 3DDUA 3T7IA 2EZ8A 3QWLA 1QVTA 1YFKA 3EG5A 5D01A 4ZQHA 4LDAA 4UAVA 4H1VA 3BYZA 1KJWA 3NWPA 3N4XA 3A32A 2H9YA 4Z0HO 1L1RA 4OG2A 5FXMA 5B37A 2RCNA 2C3MA 5BV2P 4NG4A 1IZYA 5FA5A 4RQTA 3E9MA 1IZZA 2VUHB 4O4LF 2ID6A 1YRHA 1U4NA 6LDHA 1Y6IA 1JHQA 1USSA 4LDJA 1JMVA 1ZP6A 1S8NA 2Z3VA 1W76A 3PGLA 3P0IA 3QUCA 5DNVA 4D92A 2RHHA 2BTOA 3FDZA 1IJDB 3JQ8B 5E6SB 1V55H 4RVOA 3LRXA 1GCIA 3HVUA 2VC2B 2MH9A 3GJZA 3B1WA 3ZU4A 5BXYA 3K70C 2I1WA 3HM2A 3JRXA 1VGVA 2IDZA 2C83A 4K9RA 1L4GA 2GLOA 2HG5D 3WTCA 1M5RA 3I56I 1CQIA 2G63A 4B3SB 2IX9A 3K9FC 1MFPA 3C8MA 3F47A 4HZFA 1ZUD1 5JYEA 1FXUA 3SLKA 4FFDA 2O6HA 2YS7A 2ASEA 2GA9A 4J7UA 5DW0A 4U87A 3UATA 4Z8YA 3NDRA 2V5UA 1QCDA 4R1TA 3C0KA 3KJHA 2ZI5A 4DR4B 1QRYA 4B46A 4MRRA 3M1IA 1CS0A 2PG3A 3LW8A 1XMVA 4YAUA 1HOTA 1IAVA 3JCUE 3B5ND 2IXFA 1RWPA 5C4GB 4I55F 2V45A 2UYYA 2K88A 3WKAA 2RAPA 4UOZA 4NBLA 3S68A 4UDNA 2RHLA 2OSBA 3RWOA 5EPEA 4BCCA 5TMBA 3KE8A 3MWEA 1F3OA 4PC2A 2H52A 2ZT7A 1KU0A 3X1MA 1FFXA 2X23A 1MZVA 1BDHA 1U4OA 5J58A 4INAA 1RADA 1Z34A 4D6PA 1Z4JA 4YMLA 2R6CA 3FKSA 5J6XA 2NSJA 5FBHA 4JBYA 4BVAA 5FBKA 2PT7A 3GNTA 1JTEA 3FSGD 3L0IB 3SQMA 4CDGA 2EILH 3OX4A 2BFAA 3I5CA 2RD2A 3TKYA 2O0JA 3ZOBA 4HDRA 2KNCA 4Y2TA 5KDOA 2PYIA 2WVGA 1HNZB 4PLYA 1VG0B 3UCEA 1XF9A 3KD3A 2P67A 1R0ZA 2ZIGA 5K0CA 3Q7QA 3OBBA 1Q0SA 3GVPA 2VFAA 3FPSA 4Q1CA 3DFUA 4DKXA 4G37A 1CQWA 1VIVA 4K1LA 3ASNH 3F9CA 1W581 4MQVA 1RIOH 4AKHA 5K5QA 4ENWA 1KILE 4M1KA 3FROA 4E08A 1C3EA 4LRYA 3ENQA 1K7XB 9ATCA 4RAFA 1R6XA 2AN9A 1B8IB 1IM8A 2QN1A 3CNOA 1OAKA 4YN3A 1JEYA 2DPMA 3D6UA 4GMHA 2H08A 4TSKA 3BD9A 1C7IA 2RQQA 3I2JA 2Q9CA 2A88A 3JQRA 2IOFK 1LWUC 3FCUB 2QMHA 1TVCA 1EAMA 2WTUA 2WV9A 1EGQA 2HYNA 1ST2A 1V1RA 3EXIB 4B6EA 1XNHA 3LV8A 1CUBA 4ZZDA 2K4JA 4B33A 3KQLA 3CLVA 4MH0R 1EVLA 4JLOA 2H88C 1YZFA 3COAC 1EQUA 5I9SA 3Q5SA 4U6QA 1DUSA 2ODTX 1FMLA 2VATA 4M86A 4ZEOA 1Z4QA 3A11A 4HQNA 4W9MC 2Y1OA 1EDEA 3FJ1A 4C30A 5IP6A 4MEXF 4DL9A 1R4MB 3EK2A 2Y0DA 1FSFA 2CXOA 3QYJA 3AKYA 3R0AA 1E4EA 4YXDC 4CIDA 3BULA 1PJ2A 2FK8A 2BW3B 1GQ2A 1PT8A 2D45A 4DJJA 1DV2A 1P4WA 3I54A 1M9NA 3TI7A 2AOTB 1TQPA 2VCYA 3AB8A 1OVUA 3F5FA 1KI9A 5IYDJ 2DOAA 3KKQA 4FNAA 3BVHA 4FOLA 3Q72A 3CD6P 4FSDA 3FVRA 4KO8A 4F4IA 1BMTA 3ROFA 5K7FA 3GLIE 2YRFA 4WCFC 1SCKA 1DQYA 2PZFA 3N59A 1MHPA 4J4TA 2FEKA 1WPGA 4QBKA 1YRLA 4KR3A 1VOTA 3WJAA 1YL6A 1IXZA 1PU2A 4UV8A 2FVYA 5F7ZA 1XQ6A 1WCIB 1A5AB 4HBZA 2DBBA 2R7DA 2HL6A 1Y4UA 3EEBA 4QPZA 2MMGA 4B3CA 5D4SA 3A1DA 2O2IA 5LBTA 1RBZA 2WYOA 3R24A 4B6RA 2M1BA 4M1TA 4L5IA 2J67A 3H1FA 2G83A 2PS9A 2X14A 3HOWJ 4WXPA 5CEFA 3PC8C 1TL8A 4PSKA 5AM0A 4KQFA 4AKEA 4WQMA 3K4PA 1E2QA 3M0DA 3CTPA 4ZYAA 3F7NA 2AJLI 5IVIA 4IHJA 5E3IA 3T7TA 1MW7A 1BDJA 4FYYA 4MLOA 2ADFA 3KTDA 4ON9A 1JDZA 4TLAA 3MNFA 4I7HA 4GLBA 2Q6IA 1IG7A 4RXTA 1YB1A 1UKCA 5LXTB 1QYRA 3BE4A 1CJTC 3L93A 4M0LA 3N7AA 1ACLA 2QGUA 2ETHA 3SX0A 1I2ZA 2IYQA 4JP0A 2AYZA 5CM9C 1M34A 1VXRA 4OQ4A 1NBME 4JQFA 2K9JB 2QVLA 4LIVA 1UXJA 4MUBA 1ENZA 5KMGA 3TLBA 4W63A 3AE7C 5A62A 4CT4B 1E32A 1U04A 3HR8A 3K9LA 1H8AC 4C4RA 3LQKA 4EJVA 1NLMA 2LV8A 3U9SA 2MBFA 4FGUA 5KHDA 4XKWA 2RBEA 2P2GA 5H1YA 3RRFA 2PSJA 3K9WA 3GVIA 4PC3A 3L7WA 2BSXA 1WG8A 1JNXX 2PX9A 1D1QA 1FSHA 5CCGD 1U8RA 2EJUA 2H0RA 2ZXXA 3AP2A 1SB8A 3CXUA 2FDRA 3WDMA 2VJKA 3AVQA 1YRNA 3K2AA 1N57A 1X70A 3T3EA 4YVFA 3KQVA 4E31A 3GFFA 1RHJA 4Y1RB 4A8PA 2P2ZA 3NTVA 1XTUA 4YCAA 1H1TA 1REQB 3G2OA 5KVQA 2HFED 2ZXIA 3K4QA 4WECA 4ME6A 4DUYB 3WMWA 2QX6A 3FUXA 4GVLA 4WY4D 1MBKA 4S24A 3VMZA 1BE3G 4QUEA 3WG7H 3NYIA 5BWLA 1RP7A 3HJHA 4C20A 5BN3A 3EHDA 3FKIJ 2AOWA 1VQPP 4DG5A 1OIWA 1E3WB 3ZHXA 1P84I 1Z22A 2W22A 3A27A 2YUTA 4N4NB 4Q19A 3WNDA 4I9GA 4JOQA 1EWTA 2WKSA 1OLSA 4M1SA 3LAWA 4KWTA 4FYKA 3BC8A 4WKBA 4JX5A 1C0WA 2NXEA 1NI5A 2MABA 1NRIA 3VTZA 1IWOA 1OXTA 3UNXA 1WVMA 3Q10A 3T35A 3ZHYA 1Y3BE 4X7MA 2OYIB 5I9MA 1UODA 4EK9A 4QDTA 5CH5A 1D07A 1Y9ZA 1FYDA 1E2DA 1CDZA 3ZHBA 3C6XA 4UEQA 1U2ZA 2FE3A 2O8CB 4D25A 1AO3A 3LUCA 3RRBA 3L75D 1YW7A 2E5NA 3O3KA 4Q7QA 3T3GA 3C6MA 2XA2A 5M5XJ 2JAQA 1NR1A 2BVNA 2GZ1A 2XNDH 2AOTA 1QR6A 1AT1A 3KTAA 4G0YA 1DG9A 1UT5A 1XRSB 3C6ZA 2RGNA 3V8JA 1UBFA 3A9UA 3DAFA 4YCLA 1S1CA 3TBFA 1SQPG 4NY1A 4EGFA 1UEXC 2O5VA 4HWTA 2Y9ZA 2IYZA 1MNMC 3TJMA 3KZXA 1RRGA 4PJ0C 4PJMA 3HTKA 4QDXA 4I99A 1NJ8A 2KSEA 4R8LA 5B3LA 3TEDA 3IBCA 1WXWA 1RYEA 2LNDA 4DJ5X 3RVKA 2OJED 2YTZA 4BIMA 2DUWA 2ZBPA 4ZO7A 1F0PA 1FEZA 3AVPA 4I0BA 2IKQA 3IDSA 2D59A 2WWTA 3L79A 1ZCJA 1S2MA 2VAXA 1XAIA 1NT4A 2PO7A 2OU2A 2N1MA 4HRIA 1TMKA 3E8SA 5GONB 4M53A 2NXJA 4DCOA 3JXEA 3JD3A 3CH4B 1FSEA 3OBIA 3R5TA 4XZ3A 1N8RQ 1Y48E 4DLPA 3P0FA 3BA6A 2J3IA 2NYAA 4DMKA 2ZSIB 2RGWA 1TCAA 3U61B 1K4KA 1BD4A 2Y1CA 4IHJB 3OVMA 3D1NI 5DHRA 3B1JA 3P0HA 2WQ6A 1TJ3A 3QXHA 2YW2A 2QW0X 3FYSA 2IJGX 4MRMA 2IYLD 3E6DA 3NWOA 3PUHA 4HB2A 1RXEA 5F5LA 3DEJA 5ESRA 4HWKA 1H9BA 3PSFA 4RVHA 4NONA 5B7PA 1AQTA 3IJEB 2DAPA 5KLIB 3VSKA 3B3FA 3ZBUA 4PTYA 2W43A 5FL7A 2VQCA 4RA9A 2HTJA 2FUG2 1LTJC 2XOEA 5A2QK 4KR7A 1MH1A 3PR1A 3FPJA 4ARAA 5LDHA 3K92A 3MJFA 4WD3A 5D85A 4ZYZA 5DH9A 1Z6TA 3DS8A 5DJTB 1WI3A 3AEXA 1YQQA 3SK0A 4FUQA 2FF4A 2XQJA 2D0DA 3MCVA 3L7JA 4LF7B 4TS4A 1XT6A 2AYXA 2AHOA 5APSA 1BE3E 4PZAA 3P8CE 4HJGH 3GFRA 5TB5A 4G5XA 2FFDC 5FI1B 3WSVA 4X66B 1E3QA 1PP9G 1IMOA 5JFOA 3ZU2A 2W2KB 4PC7A 1Y8QB 3H86A 1WQ3A 3L7DA 3RUHA 3SNKA 3GLGE 2QD3A 4TV9F 1NJ1A 3GROA 1T9ZA 3CT6A 3SG0A 3BJIC 4HNAB 3U1BA 2ZYDA 3SSUA 5H16A 3TBKA 2WSBA 4BC1A 3GELA 5E79C 3KE2A 2BGMA 4MGKR 1IOLA 3M6FA 5IRCD 3HKBB 4W8HA 1GADO 1JLMA 2WSCJ 3GGOA 4UUTA 1CUZA 3V7SA 2O7QA 3L70D 3H9CA 2Y92A 2YW9A 3QVVA 7GPBA 2MC3A 1HXDA 1PR6A 3WBJA 4X6AJ 1SBTA 4FIZA 4Y1GA 1LNWA 1AD2A 1CUHA 2HTSA 1N86A 3SZPA 5EYRA 3TB4A 2XRMA 4Q16A 3PEUA 5CGZA 1V7ZA 5BU8B 3H4TA 4UCWA 3B2EA 3B2QA 1CD5A 3NEAA 1RQRA 4ZRMA 4MFEA 1AE1A 2X0IA 4DMMA 3WMRA 3ZQFA 3EVAA 4BEHB 1AHPA 2XQKA 4GX1A 4YJKA 3OZAA 5ALIA 3K2QA 4BQFA 2I5UA 3GZJA 1LI7A 5JNTA 1V6SA 4A5SA 3RVLA 4G6ZA 3I2HA 1U4SA 5AM3A 4QM7A 1J9EA 2B6HA 1RQPA 3U3OA 3GLFA 4ER6A 2FGKA 3HPQA 1AXEA 2CUFA 3T7SA 1ZVJA 1GG2A 1V16B 1Z8DA 3HJAA 4WL0A 4G4SP 2LCQA 2FV8A 2CV1A 1I4EB 3P9SA 2XKPA 2YHIB 4M8IA 1SVIA 4MQBA 3ZIAA 3ZHOA 4JCCA 4PTZA 3SEZA 4C4YA 1OXXK 5CEEA 4KACA 2E7ZA 3SX4A 2GT1A 5JUWA 1PG2A 4XLHA 1RYNA 4OKNA 4WLEA 4RF5A 4HBGA 1PT9A 1H3NA 2FU5C 1XAHA 1AGPA 1O7JA 4ISCA 4RL6A 1ZRFA 4R4JA 2YFHA 1TDJA 4G9EA 4ZOLB 3E7PA 3FX2A 5FPHA 3NV9A 4EELA 1Y5LA 4CYMA 2R8RA 3AEDC 2C7BA 2PKXA 2PWZA 2UZ0A 4JBIA 2NOGA 2WU1A 5JSUA 3VZPA 1BQEA 1M3SA 1MB2A 4B2IA 3SQXA 1T98A 1MMDA 3PNYA 4AG5A 3CPEA 1X1EA 1AGXA 2Z57A 2IPQX 8AT1A 3P52A 4IDBA 4X60A 3CX5I 2FW1A 2D2EA 2GBFA 5IJZA 1MJGM 2B6NA 3KYCA 1X0XA 2QT0A 3V97A 3I6MA 1HSOA 3GCGA 2J5PA 3WWCA 5I7RA 2YJ5A 1QGYA 4YRDA 1KEUA 1XK6A 4I1LA 3TQTA 2XUHA 5CR9A 1KILD 1YIAA 3GHHA 2HA7A 1R0SA 3FFXA 2ST1A 5FLVA 4QD3A 1SQPK 3ZGLA 1JHAA 1IDN1 4PSCA 3T38A 4M1MA 5G4LA 1I10A 3Q0TA 1U1GA 1TIPA 2PS1A 3ZWNA 3AKDA 2PVPA 4IDOA 1S7CA 4MRMB 2FYUG 2FAXA 1G3IA 3NVDA 3QLUC 2IUYA 1XX6A 1A96A 1N4DA 3G6EI 1ZXGA 1Z6QA 1R5OA 3Q8LA 1G2PA 4KOAA 3RARA 3H25A 1R71A 2WYUA 3EYYA 3TEMA 2NU9B 3BSYA 4WA8A 3H1JE 2BFPA 3QLTA 3WL3A 1XD2B 3UK6A 3I1FA 3FPCA 2VPXA 2J0EA 3H1LE 2HK9A 2WNIA 1R27A 2B8JA 1XXHB 3N3BC 2J3JA 3WBKA 3WYDA 1DU0A 1SQXD 3HE4A 1VKRA 1OMOA 4PINA 3ZDAA 1BXGA 3SSAA 3RIGA 1H5NA 5HIAA 4WK6A 2XTZA 4BEBA 2DEUA 1E20A 3O1JC 2PY6A 3H1LD 3PRJA 4QOHA 4U4AA 2GZ3A 3TGUG 4OX9Y 3D5SC 5EIHA 2I2XB 1HORA 5G4KA 2FFDA 4LXXA 2LUOA 3CTAA 3C6QA 1KK3A 4OI2A 4EO7A 1QZUA 2BCEA 3GZNB 2JB9A 2YOGA 4OB8A 1RF0C 3A2AA 1EP3B 1UIMA 1VKOA 3D7MA 4JLAA 2LXBA 1H9AA 1ULSA 3GGDA 4L18B 2JCVA 5D6OA 1R4NA 1Z7UA 4N9WA 2QP9X 2LCIA 4EZBA 5DNEA 1HUQA 1WJDA 4PXAA 1FFXB 4PTLA 5FUQA 4K6OA 2FDXA 3N8GA 4Z2YA 3FIWA 3D4BA 1PJCA 2E5ZA 2WNSA 2DGDA 4OHOA 2DA3A 1XR3A 4YR7A 3LQYA 2YS9A 2XPWA 2EFWA 4H15A 2W90A 5AHWA 4GI1A 2BY2A 3SMQA 1K4TA 1YZNA 5IYZA 4YRVA 3CXHH 3IXLA 1HCRA 3MN2A 1U9NA 1WDLA 4DBQA 2QRGA 1EXVA 2OZLB 1YE8A 2YFYA 4YRTA 3ECAA 1IQ0A 1QX3A 1TL7C 2F17A 1VHQA 3Q5GA 3DVRX 1NUUA 4DTCA 1XIVA 4YP5A 3UO8B 4JLKA 1BRMA 1FJKA 2JLXA 3ESCA 2E87A 3CBGA 3EGCA 2P11A 3CW9A 2AC4A 5L3FA 4IPAA 1TQ8A 4KVAA 4K9LA 3G8YA 2HQSA 4XQFA 3QKSB 1G9TA 2UDPA 3GZ5A 3G49A 3THRA 1STZA 3BH7A 4NMXB 4WGGA 3JASB 4C05A 5JISA 3RVBA 5H59A 1DEOA 2HNHA 4Q3OA 4EM1A 2OYOA 1KGDA 2RK4A 4PIVA 2B78A 2IHYA 5GJCA 4IILA 2Q7DA 1U8ZA 5LSAA 4FC7A 1ZYRF 3MJRA 3BJEA 1XTAA 2Q28A 1AK9A 2XTNA 4BFVA 1NYLA 3IAXA 2W9XA 2R7AA 3WIEA 1HT2E 1UAGA 1H6CA 4BWYA 4P98A 4FMDB 2WU8A 2ZB8A 4ZDJA 5JAHA 2B0JA 1EINA 3LVQE 3GOHA 3DW3X 1NTCA 4RNDB 3P94A 5CFRA 1P84H 3VKFA 5A9SA 3VDNB 1KYVA 4WN9B 2YCBA 3UMGA 3BFXA 2OOKA 1SQXE 3ICPA 2XNDA 4YY3B 1QF9A 1FNMA 3HKZA 4US1R 4U02A 2ECBA 3H4MA 3TSOA 5D6EA 3CHYA 3F7TA 2XDQA 1E63A 4GQIA 1NVKA 3BL8A 1LA2A 4UM5A 3UOAB 1SQVD 3GTJJ 2GZAA 4L02A 5TJJA 2BFDB 1EGHA 2QE6A 4UEKA 4DLAA 1FZAA 1MJGA 3H99A 4JDUA 4KFTA 3X3HA 1A36A 4GX5A 2WFMA 1Q1AA 1EIWA 4E11A 1SCUB 3TSWA 4LJZF 3I1JA 2UZKA 2NVOA 1LQUA 3OW2O 3OYNA 1T39A 2Q27A 2II6A 3C1LA 1F5SA 4LA4A 1E2GA 3NALA 1DQRA 4M49A 1V5GA 1ADBA 2D4HA 1NQOA 3IQXA 1T2KA 3CJQA 3GW6A 5TR9A 1TQIA 1EE1A 2GK7A 3GLMA 4RD1A 2CXHA 1WMSA 3PPYA 4R8KA 5B30A 1B16A 1S9KE 2PUWA 1CUYA 4FEEA 2DW4A 2LZ0A 5ALZA 4Q9LA 4CVNA 4JI4B 3JWHA 2Q3IA 1YZKA 3H11A 5IG2A 3QU5A 1KAHA 1YOVA 1XEAA 4BFYA 3WFIA 1ZLKA 2XDYA 3O0DA 3UHFA 3VKWA 4UFPA 3TAXA 5F2KA 5KAIE 3GA5A 3O7MA 1Y9DA 5KYXB 2IHZA 3EQLF 1P9NA 1WW2A 1H5UA 3NT5A 3TG8A 3OZCA 1YITI 1SXGA 5DGDA 1Z7WA 4DMCA 4L8GA 3LX6A 1QGED 1DXQA 1DTWB 4WEQA 1MBEA 5F27A 3ZU6A 1RXSA 1XMJA 4I9FA 3K7EA 1JP7A 2R1TB 3L6BA 1Z16A 1XZDA 2HIHA 3S1AB 4S04A 4OGQB 2PRKA 4N03A 1QTNA 3WA7A 4BNTA 4B3XA 3PE3A 3TQCA 3TDKA 3V6MA 3RK3C 1Z56A 1P80A 2LD5A 1KYWA 2HIMA 3F74A 2OTKE 1E3TA 5DCUA 4UQPA 1YRYE 2DO7A 2AK3A 2QR5A 5K8JB 1Z0DA 1JTFA 3UIAA 2WHRA 2G7MC 5L3QA 2XYHA 1ITZA 4G9BA 2A0XA 2XAQA 2WTBA 2IOQA 3OHMA 2P2CA 5ALVA 2Z6VA 2HU9A 4NOLA 3GFBA 2PQ0A 3GH3A 3U1KA 4Q7EA 2SECE 3D6ZA 1GM5A 5CNJA 3MG9A 3ISJA 3MEQA 2J0SA 2HRQA 3ODPA 4BO6A 4N4OB 1LU9A 3GLHE 2QAGB 5B58C 4KNWA 4YAEA 2ZTHA 3H42B 3Q2IA 2BCCG 4Q4HA 4N7RA 3HOSA 3CWBE 1VQ5P 3I55P 3DQPA 2ZUWA 3PUZA 4JJEA 5DDGA 2XHEA 3AKZA 2GD2A 2CW0F 5BVZA 3IRVA 4DLZA 1P7YA 1Z33A 3P7KA 3GMIA 1ZZEA 4CF3A 4A0ZA 4BDZA 2BFFB 2EL7A 3NVMB 3B6CA 1Q82Q 5GZ3A 1U5CA 1KS9A 1VKJA 2VA9A 4BGEA 4YJHA 4G1EB 4HSEA 3TQHA 2FN3A 4WEOA 1RXYA 3HU2A 1XZLA 1ZIOA 3H7AA 3WO1A 1JAIA 3PG5A 3UAOA 4DR5B 2FMXA 1Y4ZA 2ODEA 3IMFA 4DNQA 4FJ0A 1ZVMA 4D42A 1FZTA 1QH8B 1X1AA 2GHTA 1EM6A 4AD9A 1T5OA 4G4GA 4A6PA 4TYYA 3HKEB 1GYRA 3EZ9A 3C7JA 1S96A 3L1KA 1A71A 1SELA 2XGEA 4GECA 1G41A 3QYFA 5TISC 4B09A 3A4LA 4Y17A 4EEKA 1AM4D 4AVYA 3N6VA 1HYEA 5J23A 2I6QA 5LRSA 2HHCA 5IK2D 4YHBA 4ZC3A 4IWNA 4XGKA 2H8PD 3EXEA 1FYLA 1ZRCA 5E1DA 5FTMA 4OGQC 5AW3B 3B1VA 5DEOA 1PW7A 4GXQA 4UNPA 1ULZA 5NULA 4UJ3A 2CVQA 4QYMA 5HJ2A 3ZQQA 1TWHJ 2IE8A 4AECA 1R3UA 1RCTE 4OM7A 3SYKA 2D6FA 1K6EA 3BM5A 1KR5A 3E03A 3DTKA 1W5FA 4YJ2A 5EIWA 4YI3A 3GLHB 1X1BA 2EBHX 2J87A 4J1SA 5BWMA 1ZG1A 3I34X 2DSNA 3JYLA 4DJFC 5DM60 3T52A 2LVBA 1QL1A 3ZGXA 5GAGJ 3UGTA 4DV0B 3DJYA 3FETA 3UFXB 1VG9B 5EKUA 1L4MA 1ZCFA 4MO7A 2ZRQA 1WUYA 3AFNA 5GTDA 1OFTA 3GIDA 5HILA 2FXMA 2NPSB 2IUUA 1PZEA 1DE0A 2OPBA 3WL4A 2CVPA 4G2NA 3I55I 1M6NA 2AFVA 1I0ZA 3O7WA 3EULA 4YNBA 5HNKA 3H0DA 4IFBA 1FDWA 2QRXA 1IUPA 4Q7MB 4NYJQ 1F4PA 4OQPA 3FNHA 4JI1B 2XEXA 4CJXA 1P1HA 4DCJA 4DDUA 3ZKWA 4DDHA 2Q6LA 1RRFA 3MWDA 4Z0TA 2R6FA 5D4RA 1E6LA 2OF7A 5KUTA 3L75J 1SD1A 4RB0A 4RAGA 5EWLB 1LFAA 2EKDA 4IS2A 1Z56C 1RU3A 1QQBA 2WV1A 4M0CA 2RAVA 4XM2A 1X7XB 3OY7A 3IOBA 4AO6A 2BM1A 1T6SA 3IHWA 1GLVA 4KH0A 2Q5EA 2ZYSA 3CMEP 4G25A 5HRAA 4E7JA 1BR4A 1WGXA 3DAYA 1ZGBA 2P5LC 2PKEA 1QCCA 1QO9A 1M6YA 1OF1A 3VODA 1KHHA 5ALKA 2X0DA 4HA8A 1I30A 3SBDA 1Z29A 3UTDA 4FX4A 2H7YA 3BILA 2WKRA 1T8UA 1OCTC 1O9BA 4HNTA 4A10A 2DLCX 2QVGA 2VXBA 2JD2A 3KPUA 4I0AA 5JC1A 4MV6A 1U5BB 1HE5A 3ANSA 2R86A 3IP7A 1XRPA 2O2DA 3G68A 1PEAA 2QS9A 4NSNA 1CNMA 4Q9DA 4YAKA 4BGVA 4O6JA 2YR2A 3FE2A 3RS8A 5AKZA 3M34A 3K4MA 2I65A 1T1IA 2RG1A 4W7HA 2B2XA 4Z9BA 1JJFA 5KLVK 3BJZA 3JQBC 3CKLA 3I71A 1U8BA 2K9NA 2FXVA 3ZLVA 3FKJA 4CO8A 4HADA 1R58A 5EHQA 4C4TA 4JP8A 4P3OA 3FLAA 4N12A 8ABPA 2Q1KA 4CUZA 2JGRA 5E7IA 1ZS9A 1DXHA 3BFJA 3D2LA 2DMUA 5FTLA 4QZVA 2OXIA 4HG2A 3TRIA 2WB4A 2H2IA 4IIBA 4RPCA 1UXIA 3PNPA 2AOUB 1AMUA 4ZCMA 1VQMI 1NN3A 5JI3E 4E5PA 1YS1X 5REQB 4W6QA 4XVQA 4B6PA 4XSVA 4UBMA 1CUSA 5KVSA 4EJOA 1WF6A 4JELA 2JP3A 2E21A 4Y6SA 3K96A 1A6IA 1UC8A 2PFSA 3KLNA 1V16A 1MOZA 3ORYA 1TAUA 2ZIZA 3GIWA 3SJBA 4GYJA 2PJUA 3OIQA 2BM0A 3GF4A 3ZMZA 1YJAA 4NBTA 3AYZB 1XHEA 2UZ1B 4NBUA 4PYQA 2D3WA 3EZLA 1S89A 1SU6A 2XVYA 4JOBA 3HXTA 6REQA 3FPHA 3OZSA 2DW3A 1AZWA 5BRJA 4IEFB 2O3JA 5CLQA 4IIJB 2BEVB 3B6ZA 5E1MA 4G26A 4KCGA 3TZ6A 2M9HA 3OAKA 3BD6A 5HZMA 4PV1D 3EMBA 3H16A 2PUVA 1YIJP 4E6KG 1UP6A 1YI0A 3AEBC 1UR5A 3O8QA 3VR4D 3CXRA 1PSWA 4H2DA 2AS0A 2L4MA 4UXNA 3I61A 1XCOA 4JZKA 4Z5XA 5D5WB 5FA6A 1Y33E 4DUGA 1OD6A 2XKBA 4HEA2 1DEHA 4DDWA 2CXRA 5DXJA 3COSA 3DOFA 3MXTA 1DC7A 1U5BA 2C59A 3PU6A 5FBVB 2O5EA 1O77A 3CH7A 4B3FX 4BEHA 3UUWA 3AE9C 1J6UA 1LJ8A 1H8ED 1SU7A 4YPVA 4V0OA 5J1RA 3TG2A 1T33A 4H1HA 5AW8A 2G40A 4FOPA 1ZN7A 1JDBC 3RVNA 3LY9A 2FPWA 3FOFC 4N0QA 3PGKA 1O08A 4TV9A 4KRGA 4JEUA 2ZWVA 1JAXA 5C81A 2H4XA 2QX4A 1DCFA 1S5PA 4NNPA 2RGBA 4H4KC 3BPSA 2PMFA 1C30A 3ABMH 4ARZA 4TM8A 4P4GA 4TWJA 4BXOA 1VYUA 4JB3A 2VR1A 1YBVA 2ZE7A 1LT9C 1P2GA 3N2GB 3TRHA 2R7QA 1NVXQ 4PYOA 3BROA 5D1HA 1MB9A 3RAGA 2H59A 2P30A 3MJSA 4LMBA 1I4OA 1MR3F 2J5XA 4A6DA 3EFOB 3K1TA 2EARA 4AN0A 4YJGA 3RSQA 5EIOA 1TPZA 4H77A 4W5TA 2CN1A 4UBKA 1H88C 5LQNA 1ZKMA 1FLAA 2NUPB 1WWXA 4G5OA 3HOYJ 3K94A 3T3DA 1QH8A 2I7XA 4LI3X 2VN2A 5IVPA 3GPCA 2LBFA 1WNTA 2X8BA 1QC5B 1VHLA 4J1TA 3IMCA 1F51E 3HA2A 1EH5A 1KERA 3EYAA 3I4CA 2Q2QA 1OX4B 4CI9A 1C1DA 2H1OA 4KKVA 1MIOB 5KREA 1U94A 2B4RO 4Y67A 3ZYZA 1PUEE 3REOA 1N5MA 3LF1A 3QWIA 2PBZA 1H2HA 1IJKA 1G5IA 1EF4A 4D45A 1JMMA 4U1RA 5IBCA 2FW6A 2KMLA 2IP1A 3SXUB 2L2OA 5BNTA 4P4TA 1NA5A 1GUUA 1KP9A 5T3UA 4KKXB 4EHNA 1ZQ1A 4FZ5A 4AZTA 3ZQIA 4K88A 4LMPA 1B73A 3I30X 1AJEA 1RKQA 1NWQA 2O0HA 1LE8A 5G1OA 1OB5A 4BO0A 3Q8KA 3GP8A 3H1ID 1ZJYA 4JKYA 1YW9A 2O06A 1C7QA 3ONVA 3GL9A 4N0MA 4C1BA 4PQRA 2EU8A 2VJYA 2VSNA 3HBNA 4ZQGA 1MIHA 1MDMB 3GGGA 1AKMA 1THGA 3OIFA 3M9AA 4G0NA 1IDOA 1I3MA 3ZDEA 2XE6A 1KU3A 2X2PA 1WPRA 5KLVD 2R5WA 1NKZB 2IOHA 4O2LA 2NS0A 4NQWA 5JARA 3TLMA 4KMMA 3JYHA 2B0LA 2H9IA 5EFWB 3VPCA 3RKWA 4CXFA 4DSNA 1MJ5A 4KI0A 3H0GJ 3HJNA 3ILXA 4JWKA 3UB4A 4F85A 2PJRA 3RPEA 3SC2B 1RF1C 1E1LA 4PDKA 4AKSA 1EGMB 4M7OA 4MS1B 5HIJA 1QXSA 1DAKA 4X20A 4UU0A 3DKPA 1W2HA 4IHJF 3FD8A 2X5KO 2B1IA 5EE5B 1L5RA 3D8RA 4E51A 4QARA 1QPGA 3SYLA 1HTTA 2O8BA 3JALA 4QU9A 1Z2DA 3NXKA 2L4AA 1E7WA 1TLFA 2R7MA 4R0MA 1T4MA 3OJ0A 1PHRA 1IUYA 2B0CA 1OKKA 3R3XA 3LC0A 4AO7A 3KK0A 5M5BA 2VBYA 4MQLA 2R7UA 5TJ9A 2B69A 5GTHE 1BCCJ 2GBLC 1WJFA 2ZBEA 2WPDA 5ILSA 3IS3A 5DGTA 3W6UA 1KMMA 4UMEA 3OURA 3UJ8A 1G19A 1W4LA 1C2TA 1RRCA 3HSYA 4WKCA 3QKRB 3BRWA 3FFAA 1GDDA 1LLDA 4YBZA 4EHJA 3O2SB 5K3EA 3Q41A 2JZOA 3D31A 2H3EA 4K6MA 1P0IA 4X7PA 1E1RA 3UHAA 3UMVA 1C8KA 2XB2A 2XMGA 2PEXA 1LVGA 3FRJA 2Z0MA 3GJRA 1GZHB 3ZGYA 3IBGA 5CK4A 1GDHA 3IH3A 1JR6A 1KRWA 3V8RA 3EJ6A 1QWOA 3A1FA 2BXYA 1NTZG 2RHBA 4LK2A 4FT8A 1W4RA 3RYPA 5BV7A 2JD0A 4NENA 4PLPA 2ZI3A 3NWEA 3S0JA 3MTEA 3TW6A 3OYHA 2WNHA 3LDUA 2HT6A 1XMQB 3JAWA 4NE7A 3P2YA 2C7RA 1OX6A 4FHDA 3OCWA 3EWIA 1NDHA 1MDMA 4LCJA 2K3FA 4RK4A 2QB5A 4MJXA 1KFKB 3R5XA 2C4KA 2O2XA 4WW0A 5E4TA 4WWIA 5ECYA 1J8YF 2RHTA 4FQ8A 1PR1A 4M3NA 4WWCA 4MROA 5DEIA 2IDMA 1ZH0A 5IH7A 3OJEA 4UXJA 5REQA 1SQSA 3RRMA 3B13B 1X42A 4P7FA 3UJPA 2ZSHB 5EL0A 3F5HA 1RJGA 2ELKA 4J1NA 2O6LA 3GO5A 3ED1A 3TD2A 1WMDA 4DQ0A 3IJPA 3RKXA 4X5OA 1J8FA 1HKQA 2VXCA 4PAMA 3B1XA 1F7VA 3AE1C 4GC5A 1Q77A 1Q91A 4ZYTA 4W7ZA 4NBWA 3SSOA 2F8LA 2VQ6A 4QFBA 1G16A 2YQ5A 2PPVA 3UWOA 4D6XA 2C5GA 3WTUC 4MVJF 3ZWDA 1KY3A 1KZ6A 1VTNC 3E0XA 2V9KA 2G1KA 2VHXA 1WEKA 4ETSA 2CL6X 2P3QA 4JLNA 3FF1A 3RK0A 1CZOA 1O3QA 3U4AA 3C1OA 1O9GA 3ZK9A 1LPQA 2WJ3A 4JL8A 2HFKA 4B3MB 4JP2A 2X0FA 1U0FA 5CLHA 1NQVA 2P4HX 1UZMA 5IMSA 2OCGA 1HGVA 1TFRA 3BK1A 1GKYA 1F1ZA 2UZ3A 4D0LB 1LVHA 5GPAA 3E7DA 1P4AA 3WLTA 3OPYI 2QJPC 2JGMA 2WJGA 4KXUA 4OLJA 2N1TD 1DIBA 4D3YA 3LOUA 5IY5H 1T0PA 1E1CB 4NQWB 4Y3OA 5DT9A 3NRBA 3GVAA 3D6TB 3CCMI 3C9IA 2W93A 3OQIB 1EWYA 2H65A 1IVNA 4PO8A 2HPZA 2DPHA 5U4QA 2AQFA 1XI2A 3TWOA 5CBPB 5SYNA 4JR2A 4C06A 2PX8A 5KVAA 3O2NA 5TRDA 4DYHA 4Q82A 1LNSA 1UC4B 3DPUA 3CCEI 5IMBA 1JVNA 2FKWB 1MB3A 4V1CA 4PPQA 2J1LA 4XJTA 1V8ZA 1J70A 2YN2A 2ZULA 1IFPA 1YL7A 3F46A 1E2EA 2O2YA 3UIEA 4XD7D 2DHDA 1LKXA 3AEQB 1KYTA 3BR6A 1ZHFA 1LZKA 4RVFA 2VQEB 2ZM5A 3KZIE 4E2YA 5CJPA 1W5BA 2C4TA 1E7RA 2BGWA 5K0FA 2I4NA 1VDMA 2QPOA 4QFCA 1FDSA 3BIWA 3AOEA 3QFFA 4WIAA 4NIMA 5A9SB 1WCXA 1RRMA 3EDCA 3KTAB 1ITYA 5ENDA 3MLAA 2I3GA 3GEIA 3KPVA 2X4HA 3EFBA 3VVBA 5KWEA 2DA4A 1R9GA 3PC3A 6ADHA 2RC5A 2O8FA 4NESA 2H2DA 4XSZF 2WAQN 1K8YB 4HL6A 3ZI4A 3RV3A 1U8UA 4GVXA 2IA2A 1T8IA 1BOAA 3VOEA 2SBTA 4X71A 4UB6C 1ZXLA 1OA1A 4CETA 4N3AA 4N3CA 4J9UE 5JBNA 1Q3TA 3U13A 2DA7A 1EVZA 1SWWA 3TKLA 4TSRA 3H97A 1A4RA 1Z8FA 1HNWB 3ZHQA 2ZPAA 5TGZA 1D2GA 1KY4A 2WV7A 3OJCA 3LT4A 3DAHA 5AKYA 4QUKA 4WGFA 1OZAA 3N7NA 1USGA