1ZR2A

Structure of a synaptic gamma-delta resolvase tetramer covalently linked to two cleaved dnas
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination/dna
molecule keywords TCAGTGTCCGATAATTTAT
total genus 46
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00239 Resolvase Resolvase, N terminal domain
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zr2A03
1.20.5.40 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1zr2A02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1zr2A01
1BJZA 3QPLA 3JRDA 3BQZA 2E1OA 1BW6A 3BTCA 3TW7A 1TC3C 2K9QA 3PM1A 4ABZA 4L5EA 3JRAA 5J1YA 2LVSA 2YUSA 4Y52J 3PKZA 4D5CA 1R9TJ 1FIAA 1HCRA 2JJ7A 4JP0A 1RR7A 3LSPA 3ZQHA 5GPCA 3JRCA 4W1UA 3ZQFA 4RDUA 1JKRC 4D7NA 4D5FA 1RETA 5EZHA 2M9HA 5C31A 3CDLA 3B6CA 1Y1WJ 3FISA 4IHVA 4A3BJ 2EBIA 3IH4A 2JK3A 5IOYA 3NAUA 1BL0A 2HXOA 4Y7NJ 3G13A 1X58A 2K40A 3BR2A 1PUFA 2DA1A 3S1RJ 1Q1VA 1QVUA 1I6HJ 4BY7J 2KT0A 3M4OJ 2EZHA 1Z77A 3TP3A 2CQXA 3GBGA 4FCYA 1WI3A 4A3IJ 4BKXA 3TEDA 1TWAJ 3QPSA 1B72A 3BTIA 3HOVJ 2O7OA 3JRFA 2NOGA 5EG0A 3BR6A 2CRGA 1DU6A 1LFUP 3ZQGA 1P7IA 3BG5A 1RKTA 5EDNA 3QQAA 2Y31A 2Y0SN 1U9NA 2VI6A 4UUTA 2M34A 3B6AA 1TWGJ 1JJ6C 2ME0A 4QIWN 1GVDA 5FKMA 3A03A 4CYCA 2LR8A 1S7EA 1YRNA 3S2HJ 4XK4A 2WV1A 1HDDC 2MSYA 3HM5A 1WH7A 4M3DA 3SFIA 4A93J 3BT9A 3ZOBA 1GT0C 2L7ZA 5M3MJ 2JA8J 5EGOA 2NVXJ 3LNQA 3S17J 4IEJA 2XB0X 2WB1N 3OOUA 3UKGA 4A3CJ 3RZDJ 1AU7A 1OJLA 2FQ4A 1ZGWA 4HNVA 1LFBA 2NVYJ 1IGNA 5BNGA 3A01B 5JLWA 3ZQIA 1IJWC 2XPUA 3G1MA 3ZQLA 5IP9J 3JRIA 2DN0A 3Q0UA 2XGDA 2HOSA 2XGCA 5K7HA 2KDZA 3WHCA 4A3FJ 2FD5A 5IYCJ 4V2FA 3C2BA 3Q0VA 1F36A 1GHTA 1IC8A 1IV6A 1JUPA 2EH3A 2LK2A 5J1UA 1MSEC 2QCOA 1ZR4A 3K7AJ 4MLOA 1ZR2A 1ETQA 1BW5A 1SANA 2ECCA 1Z0XA 1JTYA 5M5XJ 1ORKA 1RESA 2EQRA 1UHSA 2NS8A 4A3KJ 1NK3P 2M8GX 2XRLA 2ID3A 3F0CA 2GM4A 2DMPA 5EGOB 2TCTA 4NDLA 3JRBA 2GLOA 3HOUJ 3S15J 1A5JA 4BBRJ 3BR0A 5E3LA 2X9DA 3JRGA 1MBEA 3BR5A 2R7ZJ 2MHCA 1JKQC 4C2MJ 2EZKA 1I50J 3JRHA 4IHXA 3FKIJ 4S0HB 3FIWA 2HXIA 3MVPA 1VNDA 2DMQA 1JUMA 3RQIA 4B3AA 1HX7A 1OFCX 2R92J 2JA5J 4JX6A 3Q0WA 3HOXJ 1ZK8A 1MBFA 3IH3A 1ETOA 3FK6A 3PO3J 1H8AC 2DMUA 3HGYA 3H3VK 5C34B 5DTDA 1LE8B 2O8KA 2Y9YA 4CYCB 3HBLA 1JT6A 3HDDA 5K7ZA 1QPIA 2DA7A 5IPAA 5JLXA 4B1RA 2HOTA 2RSLA 4I76A 1OCPA 1X2MA 4V2GA 3BTLA 2LP0A 1RKWA 5IYBJ 1JTXA 1JGGA 3D1NI 2RAEA 4XRSA 2NVTJ 1ITYA 1WCMJ 2P81A 1W0UA 4XICA 2HDDA 1SFOJ 1D5YA 4JX4A 3JREA 1U78A 2JWTA 4JYKA 4FTHA 3S1MJ 4A3DJ 1JT0A 3PO2J 3BVPA 1ETWA 2R93J 1GUUA 1T33A 1FEXA 2R0QC 3HKZN 2X6OA 1DU0A 4XIDA 3O8HA 1WH5A 2ELKA 1B8IB 3DEWA 4D7MA 2W48A 3O8GA 1YRNB 4JX5A 4M6VA 4BBSJ 1WGXA 1CQTA 4XRMA 3HB9A 2AO9A 2Y2ZA 1XS9A 1ETXA 2NS7A 2XPVA 3UJ3X 2VKVA 1RPWA 2IEKA 1LE8A 4XRSG 4AC0A 2DMTA 5EG0B 4FE7A 2PMZN 2E19A 4A3MJ 1TWFJ 5F27A 3GTPJ 1JKOC 2DA4A 1ETYA 1VFCA 5C44J 3A01A 1MSFC 3G1OA 5IYDJ 1EF4A 5DS9A 2H8RA 3I4MJ 2ZB9A 2WAQN 1H88C 3ILXA 1ETVA 1B72B 3S1QJ 4B4CA 2MGQA 5M5YJ 2ECBA 5FKKA 2Y30A 3DCFA 4LOCA 2K9NA 3CQZJ 5C32A 1MH4A 3SJMA 3CCYA 2LLKA 3LSRA 3HEFA 5C3EJ 2VUMJ 1ETKA 2DA6A 2LD5A 1IDYA 1X2NA 2LFBA 4AUXA 1FTTA 2GM5A 1AKHA 3RZOJ 4A3LJ 4QSHA 1TWCJ 5E3NA 2R5ZA 4DYQA 3BG3A 4RBOA 2CJJA 5F0CA 1GV5A 5GP9A 3GTMJ 3S1NJ 3LSGA 4X1EA 2MW8A 2DA2A 2OF7A 1MBJA 4DYRA 4A69C 5HODA 2CU7A 1Y1VJ 2MG4A 2QF7A 3M3YJ 1FTZA 1MH3A 4A3GJ 2DA5A 1XC5A 2H1KA 2YU9J 5EYRA 5EF6A 2HOAA 2FJ1A 2HYJA 4C3HJ 3LSJA 5EZGA 3LHKA 3IH2A 1APLC 3S16J 2JMWA 5F0FA 3WHBA 3BQYA 1AHDP 1E3OC 4C3IJ 2JA6J 1GV2A 1XG1A 1MBGA 5IP6A 1JKPC 1ZQ3P 1UMQA 4I6ZA 4A3JJ 4MO7A 2DMNA 3TW6A 5E3MA 2O9LA 4IHWA 3MN2A 1HDPA 5F04A 2M2EA 5EEAA 5C35A 3HOZJ 1B8IA 3GTKJ 3GTJJ 1NK2P 2E2IJ 2R5YB 2L7FP 5F0HA 2I10A 1IUFA 2JN6A 1WPKA 2VPRA 3MKLA 2VKEA 2TRTA 1IRZA 3LHFA 2B63J 2Y9ZA 3FK7A 1A6IA 2G0EA 4FE4A 2CUEA 4IHYA 1PUFB 1IDZA 3SDGA 1IG7A 3GUVA 3E7LA 1VF9A 2DA3A 3BR1A 4X6AJ 2M0CA 3VPRA 1HLVA 3NARA 3RKQA 4DZPA 5GPAA 4DYCA 4M3GA 1HF0A 3TP0A 2DTZA 1GDTA 3HGGA 1ZTRA 2IBDA 2K9SA 1QRYA 3OSGA 1MBKA 5M3FJ 1I3QJ 4EEFG 5FLVA 3BR3A 3JR9A 2HI3A 5FLMJ 2FX0A 4UUSA 4M3FA 2DJNA 3BG9A 3G1LA 4W97A 2ME6A 4MFEA 2N8GA 3BTJA 2CUFA 3K2AA 4M3BA 1NTCA 1AKHB 3GTLJ 3W6VA 9ANTA 1T56A 1G2HA 5F08A 1QVTA 1VI0A 2HQ5A 4DZJA 1H89C 2JA7J 2EZIA 2XB5A 1FJLA 3IV5A 2ID6A 5F1JA 3I4NJ 1ZKGA 3A02A 3S2DJ 4UUSB 2X48A 2GBYA 1U8BA 2CQQA 4AYBN 2IAIA 3Q3SA 1U9OA 1JUSA 2XSDC 2E2HJ 2LTPA 4QTRA 1OCTC 5C4JJ 1JJ8C 3OIOA 2COBA 1W0TA 2XGEA 1K83J 3GTQJ 4MFDA 4DW6A 5J1RA 2R5YA 2NVQJ 3GTOJ 1HOMA 1K61A 2R5ZB 3S14J 3HOWJ 3CMYA 2L9RA 5FKOA 4BXXJ 1UG2A 4GFBA 4BQQA 5E3OA 1FIPA 2XPWA 5M5WJ 3HOYJ 4MIMA 2YS9A 5K7FA 5IOZA 5FKNA 1ENHA 1BA5A 2LY9A 4A3EJ 1F43A 2AHQA 4M3EA 4G12A 5IP7J 3GTGJ 2LKXA 3LOCA 4BY1J 2D5VA 2L7MP 1MBHA 2E2JJ 4J19A 2OPTA 5J3LA 1MNMC 2EZLA 5FKLA 1POGA 4FISA 1P7JA 2L0KA 4C3JJ 5FJ8J 3H0GJ 3ZQCA 1O4XA 5C4XJ 3L1PA 1TWHJ 3OSFA
chains in the Genus database with same CATH superfamily
2WINI 5JDCA 5A3SA 1N32B 3K0KA 4FLEA 4PNZA 4D5CA 3B70A 4GWKA 3WGKA 3H6KA 3TW4A 3ZQHA 1YQDA 1F60A 5CBPB 2QXUA 5JZVA 1T24A 3KP3A 2L17A 1V39A 2IGBA 4URHA 2QTVA 4JQFA 1ES9A 5L3BA 5F1RA 3IRVA 5JCPA 4BNDA 2QVGA 2BGRA 4IJUA 3FBTA 5HR5A 1M1NB 4E7LA 3QXHA 4PSUA 4U9UA 2NG1A 1KEUA 1JU4A 4OAPA 5L3SB 1P31A 2IYZA 2JPDA 3OO1A 4IVPA 2VA8A 2ZQ5A 3TLMA 1CBUA 2QY9A 4AYXA 3LUHA 2HTJA 2L02A 4I4LA 5B3JC 5C8DA 1G5HA 2R6AA 3QE3A 2GEBA 4KN7X 3GJ0A 1XZDA 2WB1N 4AW9A 1UCRA 4BVHA 2FPOA 2IYYA 4EPWA 3KKLA 4HNVA 4HN4B 3W6PA 4UB6H 5AK6A 2HBYA 1HSZA 5EE3A 5B5SA 4LYEA 2KDZA 1H8ED 4QO8A 3QRWA 2NWQA 3HKBA 1BOFA 2IFTA 4H3HB 3KG2A 4BLQA 3AL0B 3OTQA 5TISC 3BB1A 2IHBA 2D5LA 4HUQA 3D4PA 5SV2A 3FNHA 4WBNA 3RRZA 1C0PA 5EHGA 4M83A 1CRPA 2H6EA 3WGMA 1R0KA 4BWVA 1GILA 1SOMA 1MBFA 3CXHE 2R1TA 1GRQA 1RRVA 1T26A 4RW0A 2JD0A 2JK1A 1T1EA 3IOYA 3R3ZA 4R8SA 1QPIA 1U04A 4AVYA 1W2HA 2IT0A 5T57A 4WI1A 3JQ9C 3NATA 1SFOJ 4EKDA 2WHXA 4HDSB 2IYPA 1KU7A 3VU8A 3ZU4A 4NR0A 4TLCA 1LS6A 2OKGA 5AVYA 1BMFA 2IPLA 2XNDH 4UTXA 3GBPA 4Q12A 3BVHA 1HDZA 1YRYE 4IKEA 2V26A 2A9QA 5L8VA 5L7WA 3STYA 1P84H 4FYWA 1O3SA 1VLQA 2GBLA 3LKDA 2YXQB 3AVXA 3KLMX 4YMSA 4EG8A 2WV0A 2B1RA 1ORRA 3DLPX 3HYSA 2QL5A 1BE3E 2ATIA 2XTJA 4FYIA 1DC4A 4AUKA 3UZUA 1TU3A 1I3OA 3UKDA 4HZUB 3TPCA 3A6PC 3C5VA 3ZTYA 1BG6A 3KHUA 3LUFA 1GV5A 2ZB2A 5AW5A 3ZKWB 4R0NA 4CLHA 1WMSA 2VQDA 4RKWA 5I6DA 5AHOA 1SQVG 1YBMA 4ZVNA 2AG5A 2X4DA 4Q4AB 3ICQB 2EP8A 1QG2A 3DJYA 4E08A 2AN4A 3AJ8A 2WU8A 3OYJA 1XQ1A 2BI8A 1XMVA 2G6BA 2Z99A 4GDFA 3GLRA 2RKHA 3PX3A 4TYNA 2WEKA 3I64A 2WMNB 4CF3A 2EG5A 3DR5A 3NHPA 3R0VA 5AW0B 1VSBA 3WISA 4RJJA 1ONBA 3KZYA 2M0CA 1HE8B 1I2AA 3MB5A 1BDHA 1KA9H 4LZJA 2AXEA 3PS9A 4BGUA 5C4GB 3K70D 4IOLA 1M1KQ 3D59A 4L76A 1Z4JA 4FZVA 1K06A 4PX9A 3SLRA 1Q14A 3OOPA 4ZHQF 4GOLD 3CT6A 3LYAA 4NC8A 4YCMA 2R3CA 4W5JA 3RPQA 4JCCA 1XDGA 3LSIA 3W5HA 2MSEB 3A5TA 3LECA 3FROA 1CR0A 4CG2A 4C7JA 2OARA 4BE1A 4I0AA 1T25A 3NWJA 4RY9A 2ZIXA 2F6RA 3PNMA 3I58A 2LE0A 3S5UA 2WT7B 4KFRA 1BC8C 1BI3A 3KFLA 5EMKA 4QAJA 5AXCA 4CQMA 2BTQA 4EW6A 1P4SA 1Z0FA 1SOAA 3NETA 2OHIA 1XTBA 3MD2A 4BXFA 3ZY6A 3H11B 1MNEA 4JBGA 1EZZA 1BA5A 4NE2A 4GX5A 3CZAA 2QR5A 3ESXA 4KJXA 4MR9A 3SEAA 3U44A 3FBNB 3VMZA 4ZI7F 3QNWA 1UAYA 3SR3A 3HZJA 2CH0A 3A25A 4C2TA 2E1PA 2V7QA 3NP9A 4CBVA 2JPCA 3PGLA 3RCBA 3WI7A 3OE4A 4IGKA 2DETA 5EE9A 2A1TR 4LQCA 1PPJD 1M67A 5KVQA 3OPYA 5I4KA 2IX9A 4XLCA 3O2QB 4BU0A 3DQZA 4L51A 4QPPA 1U11A 2G0NA 4KICA 3D7NA 4FNMA 5HF5A 4BRYA 2NX2A 3MSXA 2HXOA 1Z2EA 2EBFX 1M34E 4OFZA 3Q1KA 1SG9A 4F4DA 4JQ0D 1IWOA 2YMPA 1H3FA 2BY3A 1OKRA 1EFRD 4NBLA 1RZRD 4JLMA 1NF2A 3EPZA 2IEAA 2CMFA 4UU0A 3OPXA 3HA7A 1ZVJA 3LPAA 2BAGA 3ZWDA 3MTDA 1A97A 3QF4A 3NHLA 1QSGA 2HZ7A 3G0BA 1LBHA 3I9V6 3PQCA 4G0XA 2J5UA 4X84A 5FROA 1P18A 4GPBA 1Z38A 2I99A 2O07A 5D5PA 2W83C 3FDZB 1F6WA 4DANA 2E4XA 2YKGA 1YR9A 3PPIA 3NNSA 4LIUA 4O2BA 3THWA 3VP8A 3JCUC 1KQLA 3A0BC 4HS4A 3ZY4A 3PWTA 2DN0A 1ONNA 4XYEA 4KP7A 2H85A 2KM1A 4LI0A 3W77A 1SZJG 1RAAA 1KIFA 2FZLA 3DAOA 5SYAA 3DBOB 5JQGB 3GEZA 4V19K 2PRZA 1RWMA 2Z6UA 3DE4X 2BR5A 3ZWWA 1REPC 2DQ4A 3L72G 4K6HA 2Q5UA 2ZWMA 3SGLA 3FIWA 1GA6A 3SVLA 2ZDGA 1TEXA 4E2YA 5JNTA 5AVZA 3K94A 4JC8A 2GAFA 3GJYA 4M0MA 5J5CA 2JDIH 2MSKA 2CW8A 1DPGA 5JVDF 1XA3A 1IBRA 3WJ7A 3C39A 4AJEA 3K69A 1NN0A 4JDPA 4O1HA 1ND6A 1E3EA 4NVRA 5EL0A 3CW8X 2QTVB 2J8ZA 3TIFA 3H11A 3IUEA 3FBIB 5JWOA 3CLRC 1PP9E 4KVGA 3TG8A 4UDXX 1OIVA 3UAXA 3W6JB 3RC7A 4LZZA 2WT9A 1EP3B 2E19A 4NZPA 2FHSA 3D3WB 3ZDCA 1E6UA 3NOOA 2JAUA 2JA2A 4BLPA 3A01A 1CJKC 2WD9A 2RAVA 3J7AY 3O92A 4P5OA 1DADA 4IZ6A 3ZIDA 1XMAA 2Q6OA 1CYDA 4LITA 1P1FA 2JGFA 5CPBA 4M46A 3CP8A 3WU2E 5H8WA 3ZWOA 3W3CA 4JYCA 5BV0A 4B6RA 4JNCA 3C0KA 4WIAA 3DNFA 2R8BA 4EY5A 1BE0A 4ZI3A 1WS6A 1DHTA 3S1NJ 1PZNA 2WF9A 5I5EA 4F4UA 1Q21A 4E07A 2WZCA 4XGNA 1Z4KA 2GUSA 3V1TC 4MQVA 4EATA 2O7SA 1V43A 4IIDA 1N25A 3V2RA 3QU7A 3A7EA 4BFZA 2XLCA 2QIWA 4JB0A 2HRZA 4MH0R 4MV3A 3TIXB 5KUTA 5F0FA 5ALFA 4IP0A 4HYTB 3T3HA 1NVVQ 1JKPC 2XRNA 4ZVKA 3OOEA 1LTQA 1L7OA 1CF2O 4D0PA 2A6HF 3NKVA 3ASOH 3SDZA 2YYZA 4I81A 4K6CA 1TKBA 1EDBA 3VKWA 4R1QA 2QRVB 5T41A 2CJWA 1CCWA 4BBJA 1JE1A 1M2EA 4C0JA 2EW8A 2VWHA 3DT6A 2K2QB 3SDGA 3KD2A 4FNAA 3PC8A 2BIFA 5JMPA 1ZARA 1LWUA 5C52B 2GPWA 2WIAA 5HE8A 3UHPA 2P2NA 4MCJA 4M76B 4ALIA 4OK3A 3WX0A 3SJZA 4GX2A 1KDPA 2OZPA 1VJRA 4M1TA 1NTCA 2J0UB 2Y66A 1US8A 1JQ5A 3DAGA 3LXUX 3E8MA 2LZ0A 2Q99A 4DZJA 1TVKA 5K3AA 1EWVA 4LA4A 4Z99A 1HXDA 2VTBB 4EG1A 4QHTA 4HKTA 4AZ3B 1U8BA 1PFGA 2Z1MA 4WY4C 2ENUA 4CT4B 3RSLA 1WSDA 4MW9A 2JW5A 2FUG6 4ND4A 1XAGA 1P1RA 3H3UA 2FUG1 1OROA 2XEDA 3RTDA 1Q1ZA 1AQIA 5DCFA 5M5WJ 2E49A 2ACEA 1LK7A 5DHAA 3DXYA 2ZAGA 1LUJB 3ABOB 1W5TA 3Q2KA 3O1LA 1GGEA 1DXOA 4XR9A 2CD9A 3F8MA 4NDNE 1P3Y1 1CVRA 5JS8A 3AEAC 2J9GA 5CJ4A 3L73E 2RKLA 3FNQA 3AEKA 2CCKA 2O3JA 2IRWA 4K3VA 1N75A 4P84A 1EBUA 1TC2A 4ZOEA 3KLPX 2O8FA 1RR7A 1RWWA 1R1TA 1ENYA 4UNNA 1AA0A 4AS1A 1CHNA 5LUBA 4P3PA 1AKYA 2HZTA 1U8UA 2WIGA 3A1WA 5H2FH 3ZV6A 3PLRA 1O3QA 1K5PA 1D0IA 5I7UA 1F14A 3I9MA 2J5XA 3AU9A 3MWDB 2B89A 2STWA 1BU8A 3JSOA 3VR1A 2NUAB 1BE3D 4LVCA 4BACA 4JJ6A 4XKWA 3HOVJ 4IXNA 3CMCO 3V8JA 2BGIA 4OHWA 2CD7A 4K1XA 5FNZA 1MU0A 5FOXA 2R6FA 1L9XA 1JMVA 5AW3A 4C88A 1P29A 4JF7A 4BFTA 6NULA 4OG2A 4M8SA 4H4EA 3OYEA 1KFBB 4WUTA 1L6RA 5FGMA 3O9ZA 3SYKA 3L74D 2E1MB 1AQUA 5JIBA 1HGXA 4MW7A 2BJWA 5ELMA 4GG1A 1BD4A 2Q1SA 1FLDA 4OHPA 3CNQS 1S9KD 1H9BA 4TZTA 4FYPA 4C2AA 1P2VA 1UANA 3AHFA 4JLUA 4W80A 2BLLA 3N2ZB 1VL5A 5BT9A 2DTRA 2H6BA 1NK3P 3EXG2 1XJQA 5EAIA 4KUMA 3GAZA 1NOJA 4KI0A 2TMGA 4JB2A 5EXDA 3KTAB 4CVNA 5CT9A 2FEKA 5HDQA 3L2CA 2WSEH 1CUSA 4DWJA 4RJKA 2N42A 4ZEWA 1Z5OA 4Y6RA 3JWIA 4JOQA 4BL0B 4PZAA 4ZAVA 4JOMA 3KKZA 1ZGGA 2O3FA 3BGDA 3K9QO 3ER8A 2HRRA 1AV1A 2P2YA 3RPUA 5JOQA 1M76A 5KWJA 2Y1CA 3U4QA 2DG2A 3OFSA 4U2KA 2JZCA 5LQSA 1E94E 2WTBA 4HX5A 2C0CA 3VQTA 1M56D 3KWFA 3WKAA 5L3FA 3LX5A 4WINA 1B8IB 1P6QA 1WDLA 2C2WA 4LD5A 2PCLA 1FOXA 4XRMA 3A04A 4V38A 1U7OA 4GS5A 1FUYB 1K2WA 4JLPA 1L8XA 2OZEA 3DKWA 3L73D 4GD3Q 4CM1A 3FBWA 2OGTA 4ZYUA 3SLKA 1FP2A 1Q7BA 1JS1X 3P5SA 3U4MA 4AIRA 4HNSA 3X0DA 4NCAA 1O08A 3EVFA 3LBAA 1B72B 2JRLA 4KQCA 2W6QA 2XIJA 1IU9A 4O6VA 3ETDA 4KIWA 5EPEA 4Z3OA 3R0XA 1NBMD 1W1WE 3B9QA 1HNXB 3RZOJ 1WW8A 2JEEA 1L8LA 5LMZA 1QQ5A 4WL0A 1X3LA 4E1VA 2AI3A 2DA2A 1SKUA 2VC0A 3R5TA 1NYQA 4PLTA 4HR7A 1BN6A 4FCTA 4MRNA 3AQ4A 5FEMA 5ARCA 4K2AA 1ZOOA 4TVBA 1NN3A 2GYVA 4IFBA 2P4HX 2HA7A 3K2IA 1R9GA 1ZH0A 2Y69H 2GTPA 4ZXFA 1DBQA 5AM0A 5DSXA 4D9IA 3KQOA 2B4QA 1J1EC 1JIUA 4ISCA 2C8JA 3TTWA 4OHVA 3T4XA 1TK9A 2W93A 3V1UA 4F5EA 2HVRA 2Q21A 1ZP0C 1N2CB 2XDQB 2E6KA 3Q2IA 4X6AJ 1GUZA 1VTKA 2GCGA 5B3LA 1PUEE 2I1VB 3H42B 4UTNA 1O95D 1KARA 1Z17A 4G9EA 1I0LA 1ULUA 4KQ6A 1EFPB 1WAMA 1FCJA 4HDMA 4GP9A 1O57A 1OX4A 2EIXA 1Z0JA 3MWGA 3AJRA 4MFEA 1ODCA 3VO1A 1JMKC 7MDHA 1SUSA 5K0BA 2PR7A 1LJ9A 2Q5QA 3DL4A 3R76A 2P5UA 5IF9A 1LTBC 4IBOA 4KXUA 3LPDA 4KQ2A 2C54A 2XB5A 4FDUA 1IVYA 3AKDA 3O8QA 4A0ZA 3DO5A 4YCSA 5HS9A 2D1TA 4DCSA 4EJFA 1H0RA 4E33A 3IOCA 5ILQA 4MW0A 2IW5A 1SXGA 3PSFA 2HODB 3S14J 2WY7Q 2A69F 4LDAA 1IK7A 1VKRA 3C16C 4CR8A 4EJSC 1QONA 5EMJA 3CUEF 4GZ6A 4AZ0A 4Y2YA 4OHRA 3IQZA 1IZNB 1P62B 1XA0A 2XVMA 5DTEA 1NUUA 1KGDA 3ZN0A 1S8OA 1XZPA 1J1DB 3E2MA 3KZIE 2VBCA 3MWLA 1QU3A 4Z1MH 1P2TA 3R3VA 2OGSA 5L4LA 4II2A 4QELA 3LL7A 4TTVA 2LUOA 5DHQA 5G3YA 1DIAA 3GHHA 1NU1E 2IXGA 5HM6A 5DE3A 4GM0A 4XOPA 1EGVB 4QU0A 3PV0A 2MBFA 3QUSA 2PG3A 2EBIA 1F4LA 3ROKA 2HBQA 1IHOA 2E7ZA 3TEDA 1O6CA 1U9YA 2QJTA 4ZMBA 2BDUA 5K5QA 1GHCA 3RVSA 3PPYA 2V0CA 4RCVA 3UXEA 4K6OA 4I6EA 1SQPJ 2O19A 3NKLA 1Y4ZA 4H7IA 3KHKA 5IG2A 4CIAA 1EUDB 3CNBA 1ZD9A 4RAQA 2CMKA 3VYWA 1YE8A 2I7DA 4LSWA 1LDGA 1GUFA 1Q1EA 1UBCA 2NO7A 3O38A 3UPDA 2AOUB 3DOOA 4TKMA 1QQ7A 4TL6A 5F9MA 2HPHA 4GE0A 3K1PA 2AG0A 2F9LA 4S05A 2YIVX 3I72A 4LRTB 3JZIA 3UNXA 3P0RA 1UPUA 2QAIA 3EXHA 2KBFA 1G16A 4UM9B 5G0TA 2LCQA 5AM5A 3C1UA 2V7UA 2BFFA 2NSHA 4D6YA 1VMIA 3PNYA 4KWCA 3ZMUA 2GEVA 3W7AA 5JHFA 1NBME 3RL0g 2P5SA 3ABRB 4B2IA 4Z4QA 1O97D 1RS0A 1EZ4A 3WODF 4WZBA 2IIPA 2PMUA 4WOBA 2RSLA 5IXYA 4R41A 1J8FA 1RNLA 3ZMDA 1X7ZB 3NRJA 1GNLA 1JHMA 4BAYA 3H1LG 3A3PA 3F97A 4HTFB 5BS6A 4UEQA 4HRYA 2Z2YA 1VQ1A 4AKSA 1AQLA 1ND5A 1OW8A 3OHPA 3HO6A 1EDKA 1VXRA 4J1TC 1DGQA 2CXQA 4HWGA 4DA7A 2QUFA 5A0TA 3INTA 2IHVA 4EJWA 2WWXA 3LRPA 1LE8A 1PP9D 4D6TG 4RE5A 5JC8A 4C30A 3DF9A 5KKZC 4HDAA 3AW9A 3CE6A 3SZPA 5ALYA 3RVJA 4AG6A 2WWIA 3IIIA 2PMFA 2B37A 4JBXA 4HB2A 1Z7WA 1YDGA 4RHXA 3IDZA 4KFCA 5IDYA 2BJHA 1E7WA 4FK8A 1I7LA 3TZLA 4Q9LA 1G5QA 2P9EA 5KX5A 4W5HA 4IJWA 3TAUA 1WSAA 1M1ZA 2R6ZA 4Z0TA 4BZPA 2WHQA 5B1SA 4DVGA 4I1LA 5HBGA 2R4UA 2WU0A 4NHOA 3RC2A 1XPXA 1ETUA 1SD5A 1QXSA 3R5JA 3H32A 4EF5A 1JJIA 3N87A 4KN6A 4KFTA 3ZN1A 4BXUA 2OE2A 3DZGA 5AIBA 4P38A 3WFJA 4YCBA 2RGEA 3IAS6 1U5BB 2HFHA 1VF5C 3GYHX 5EMHA 2PSFA 4G8BA 1QU2A 4FYHA 1JLMA 3TN7A 3VGPA 4B7AA 3U80A 4P34A 3LWBA 4U39A 4ZQIA 1DPRA 2R1ZA 1OB5A 1J5YA 3LSTA 2BPOA 3VPRA 2QMHA 1I7DA 2EFYA 4BMOB 3THXA 2ZS7A 2E9SA 4PLZA 2H1IA 2F5EA 5LR6A 4GLJA 3FE2A 1JIXA 1NNEA 5E1XA 2PDAA 4GRAA 5IUNC 2HVQA 3WMWA 1I24A 3D3NA 2KYVA 1GDHA 3RK3D 2XU6A 2NO9A 4NG5A 2OBLA 3ZXUB 2FRHA 4W9MC 3E6MA 2WJAA 1BSHA 5ICCA 1QYRA 1XMXA 2A9KA 3OWHA 3GJRA 5L3QA 2E5ZA 3OFKA 2JAQA 1U9OA 4PHGA 1S7AA 4ZD6A 3RS9A 2PU5A 4AF6A 1L7RA 3KQKA 4YAOA 3SDBA 1JU3A 1IY8A 4OGWA 3BL6A 2K9JA 2NAPA 2G9ZA 3PNKA 3K05A 3IJ5A 3GRZA 1IY9A 4Y2HA 2A1IA 2ADFA 4JN6B 4IFEA 5ILOA 2W2LA 1ZLKA 2D5VA 2BEUB 4Q3NA 3ZXXA 5A4KA 5HKLA 1ZZGA 3PCXA 2F4VB 3CVXA 3AMVA 3B78A 3KPJA 3QPLA 4GOOD 4MS4B 1SQGA 1GD2E 4IZIA 4O5OA 4UNQA 1PL5A 1NURA 4Y3UA 1L0NE 1DQRA 3ZZUA 1Q7EA 2BFCA 2CLDX 1BW9A 1NJ1A 4B4VA 4KMOA 1TO2E 2M4KA 3PHLA 4KL8S 1P5HA 1U5TC 1OHHA 4HGYA 2GUWA 2ESNA 2QMYA 2JATA 2B94A 3FXLA 1DUIA 2FPUA 3EODA 2Z8XA 4LWQA 1Z77A 2ZT9B 3GBGA 2W57A 4HI0E 4XLLA 4E5KA 4B33A 1G3WA 3K8QA 2BFCB 1A31A 5FFFA 2GJ8A 3VPFA 1PV4A 1Y4UA 1RLJA 4OU4A 1MG5A 3LK6A 5GVRA 3HACA 4M1YA 3I1JA 13PKA 2PMWB 4WY2A 2OLEA 5DBHX 2XRYA 1XMOB 2EPFA 1SQBE 1NJ6A 1RPAA 5KWVA 4MVJP 3WUVA 2GN2A 3KZIC 3CLOA 2OYIA 3ABUA 5JY1A 1Q7CA 4H60A 4AVPA 4V2FA 2D0PB 3MOIA 4DREA 4P7KA 3FX3A 4DOMA 1RXIA 3VUFA 2YS6A 4G5QA 2QKMB 3IAM6 1R1UA 1RXVA 3PL1A 3VHLB 1V4NA 1QYIA 3SQWA 2OBPA 1RRKA 2P6MA 2BH9A 1N0VC 1GSOA 1COWA 4JLJA 2H4ZA 3F47A 3MUOA 3JRHA 2H54A 5K9ZA 4NBVA 4DDWA 1BTOA 1M66A 5JW6A 4B81A 2HXYA 2H0RA 4RADA 2P6UA 1VJ5A 3CIOA 4UKDA 4OHKA 2HT1A 4AZVA 5K1YA 2EGHA 1NRJB 4DBVO 2XE4A 3TMOA 1CUEA 4QOJA 1LBTA 1Q2XA 3S29A 3FHOA 3QOXA 2PFKA 5ISMA 3I2KA 2I5PO 4UVAA 3HJGA 4RVCA 2C42A 1VQ9P 4ND7A 3X1DA 3IUPA 5FRMA 4I6MC 3TW8A 3GJ3A 3ECOA 4D97A 1HXHA 1R88A 2F9MA 3O4RA 2BXYA 3CCSI 4D26A 2VWQA 5BUQA 3A6KA 1UXJA 4FE7A 3EPPA 1XZ8A 1ZN9A 4HAUA 5TARA 1Z67A 3EF1A 3OFNA 4H6PA 5DTJA 1KILC 5I9NA 3B5EA 4UZEA 2COKA 3NBAA 1GU0A 2R79A 3SHVA 3NHJA 3Q7IA 4M98A 5FRDA 3K53A 5BSMA 3VSBA 1KU3A 4RLHA 3GLGE 4D02A 2BGCA 1NGMB 2EB7A 2F3TA 2WG0A 2Q6KA 3M6AA 2G36A 3U6BA 3PKIA 1GGJA 1NJFA 2I2BA 4X8HA 3VPGA 1J21A 3ZX5A 4NBNA 5CQEA 1MIHA 1UMCA 4YGYA 1QG6A 2P75A 4J0QA 1RCFA 1ZH8A 1MB2A 2Z09A 3PQDA 1ACJA 3DA8A 5K01A 2RGCA 3OYCA 2FYNB 4EM6A 5AW6B 1A4XA 5AXAA 4DMKA 1LT9B 2CPBA 4AF8A 1WE2A 2EV5A 1JAYA 4U2BA 5IASA 3N8DA 2ZRLA 1YFZA 2HKXA 2FF4A 1N3YA 4IW3B 2Q3HA 4P98A 5LSAA 3A06A 3R7WB 3T7IA 1RRGA 2OB2A 3NHYA 2VKEA 1ZQ9A 2JUCA 2Y77A 1IB6A 1XZLA 3QVJA 4OIMA 1RUNA 1MRZA 4E32A 1RXYA 4K8OA 3ZP5A 4TL7A 1ZNYA 2JKZA 4XWGA 5K8UA 2A0UA 4DXDA 3A7OA 1SS1A 5JCJD 3E9ZA 4NEGA 3VDRA 4ZVMA 2C84A 3K1AA 1N0WA 1UP6A 4MR7A 4JT8A 2ZIUB 3ELUA 3PSHA 2IYTA 2XOEA 5AK5A 2O2HA 4P22A 2O7NA 5K03A 4ZI5A 3SZMA 1SK9A 4C0BA 3P2MA 4KO3S 5AJZA 3OA2A 4ZO8A 1UPXA 3VAYA 2X48A 3DPUA 4P86A 3TX6A 1VE9A 1QRAA 2W6JA 3CX8A 3DQQA 3RF6A 1OCTC 1GRVA 3ELWA 1L7XA 3OLXA 1JSLA 2WZ7A 1N2EA 1FS5A 3IAXA 1E5LA 1TYDE 1B8UA 1V8PA 4GI7A 5I4IA 4R31A 1Z36A 2X6QA 2TMDA 1M1UA 5DBGA 3ORYA 2BMWA 5JJCA 3HCFA 3BXOA 4CE6A 3ZWMA 4B32A 1U1FA 2YO3A 1XCPA 4Q5SF 3RU2A 4GODA 1YCDA 4K88A 1EDZA 4A5MA 4Z7OB 2GZ3A 1Q3HA 2F1IA 1TJ4A 5DM1A 1SBZA 2PV0A 1Q7YQ 3O3CA 5TY0A 1A7UA 1QWSA 1E0AA 2VNAA 2YR0A 2RGGA 3RK0A 3AL2A 3GCMA 1E7SA 1F2TB 3GOQA 1SHTX 2O20A 2WAYA 4U7FA 3LFTA 5DWDA 1EBFA 2RHRA 4NV3A 4TQUS 3G13A 4X1YA 1O5OA 4XQ9A 5CA1F 2CBZA 1R36A 3I6MA 3QA3E 4ZT6A 1KKLA 2AVDA 4F97A 4WFKA 3THXB 2VCHA 2ETHA 2XZOA 4UNSA 3V00A 3TZQA 3MD0A 2CE7A 4UM7A 5IFKA 1KI3A 1EEXB 3DAPA 1S7EA 1PVVA 4Z1MD 1PE0A 3F8TA 3IO5A 3VFDA 2JGRA 4FW9A 1YI0A 4AM3A 4MTLA 1KEPA 4KPYA 4ZYZA 1ZGWA 5CFOA 3FHZA 3EYIA 3KSBC 1IXRC 4D9EA 2QTNA 2FZCA 2HA5A 2NNLD 5EIFA 5BOXA 3EXFB 3DOFA 4G5HA 4BQFA 1GVNB 3SIXA 3BJZA 2AJCA 4UAJA 4JAVC 1FOKA 4YP7A 2ZZNA 1LTJA 3E0QA 4PEVA 1MBEA 1CWUA 3OT5A 5A6SA 3GJXC 3QEJA 4JX6A 2BKEA 1QHSA 2X1LA 3SC3A 2ZBGA 4EVRA 3U7EB 5ITSA 2N1TC 1GIAA 2RKOA 2VOEA 5DNDA 4Q3LA 3RHZA 1ZGJA 3CIFA 4DR6B 4U8GA 4MEAA 2ZUWA 3F96A 4RZIA 4KE6A 3VNAA 4FYXA 2M3EA 5F5NA 1XJWA 4LK2A 5FHRA 1T0PA 2M4GA 2ZVDA 2PX4A 1K9SA 2IZ1A 1KFJB 4MWOA 1L7BA 2IYFA 2BEWA 4X93A 5AI9A 2FG5A 4PXYA 3G0DA 3L4JA 4IS3A 1Z7EA 3PICA 2JFBA 1QZEA 1NU1J 5HA5A 5BNZA 1SFUA 3NXSA 3ZGKA 2YUTA 4LJ7A 3SFEC 1FMJA 1GL3A 3LD9A 4LRUA 3WQBA 4R1HA 4YMVA 5AP9A 5I51A 5EE1A 3TRJA 3GRYA 2QUBA 3VOBA 4BEWA 3IEPA 1Y3IA 5F21A 1MMAA 2F4OB 1EINA 5EHIA 4RCYA 2PKCA 5FKKA 1P9LA 3E3AA 3QE2A 1MN6A 3ESDA 3KYCB 3MFKA 1M2NA 1GR1A 4MV7A 1O8BA 3E9RA 5ALKA 2I3GA 2OFXA 2OXIA 3R9XA 3QKTA 1KMNA 3SF8A 1YRAA 4X1EA 4MYDA 2AYXA 2R00A 4AG5A 4DC0A 4NARA 2Q3FA 4N3AA 5IJ9B 1VJ1A 2BUBA 3OTHA 3D8RA 4GICA 2RHLA 1CUGA 1NBEA 2FMKA 4AWBA 3R0IA 1WUYA 3IGFA 2ZBKA 2W2TA 1JDJA 3L01A 2Q0SA 3U3MA 1A9XB 1Y8RA 1BE3J 4KWEA 2QTRA 3Q3VA 3ULKA 4Y6SA 1ZN7A 1CB7A 2B83A 4C03A 3TK1A 2W6BA 4X71A 2PTGA 5EVCA 2D06A 5AI5A 1R74A 3GEGA 5IAGA 2QJFA 4FMDB 3RRYA 4DZPA 5B1IA 2RHCA 3I34X 3KEGA 2A45H 4XKBA 4YXWA 3RT1A 3PUXA 5KTRA 3BJOA 4A0GA 3QEOA 1T4MA 1DP7P 2E55A 4GXTA 5CBKA 1MFPA 3IMKA 4ND3A 4FM9A 1SXQA 3BL5A 3V48A 3U4DA 1D1QA 2Q1KA 2OQVA 2G70A 2MA3A 3D0KA 3BGWA 2ID4A 1HKHA 3RS5A 1E98A 3ZGNA 1AJYA 4RTQA 1MQ8B 4I0BA 2E6UX 2HSDA 1BCCG 1NTMD 4L6CA 5IYZF 1G2IA 2JGKA 3L6CA 2UXBB 1N1GA 4MZDA 1U63A 2BCCD 4IHTA 4ZODA 2AMLA 1NNLA 2Q5HA 1PV1A 5FLXK 2QL9A 2ON6A 2XXAB 4BFYA 3OZBA 1J8DA 2QN7A 2L18A 2QAJA 3BE6A 5HZGA 4EI7A 3WBBA 2H0QA 5TIIA 4GPIB 1CDZA 4IHSA 2JJYA 2PX9A 4CQLA 4FIZA 2XADA 2C9CA 4HGNA 2VF5X 4ZRMA 4WNYA 3BXGA 2JIZD 1I14A 3PU6A 1TCUA 1V5EA 3X2SA 1P19A 4W9NA 2ZAYA 5LA6F 3P0JA 3CF6R 1FTNA 4PQGA 2DKNA 3M5PA 5DD4A 2GA8A 3IPRA 1QGUA 3GDGA 1O4VA 2P8SA 1P84I 1UKEA 4R84A 2VUUA 2VQSA 5IX8A 1QGDA 1PUFA 1ZW1A 4YTPC 3DDWA 3UUGA 1P6UA 2AEMA 3EW7A 1P7PA 5LGNA 2O2JA 3W3AD 5AW4B 3GZTB 4RFSB 5HFAA 4LY0A 2HUPA 1HUQA 3OOJA 1I27A 5E18F 3H1HJ 2NQTA 3L7MA 2JHPA 2QLLA 1HSTA 3P4YA 1HH0A 4D6TJ 5HMMA 1YRNA 4DPMA 5CCHD 3FMPB 2X23A 1TAQA 3O3NB 4MX8A 4NU0A 1WH7A 2AKYA 4LRWA 4EPXA 3HJUA 4HATA 4IDDA 3E35A 1Q22A 4A26A 2RI6A 2M0BA 5JT1A 3HUGA 3O4GA 1CUYA 1C7JA 4HV6A 4AL4A 3ABKH 2VHWA 1ZXLA 1B0AA 1YUNA 2EGUA 4FUQA 3QXXA 2D2XA 1AA7A 4HAMA 4RKUJ 1YHNA 4BDSA 1X3WB 4EFDA 2C97A 2REQB 1EXJA 4IUDS 2VYNA 3HE3A 4K26A 1ZU4A 4CCAA 1E66A 1KQFB 4K9PA 2AQFA 2V97A 3QP5A 1BQ3A 3I56P 3TDUC 3M1IA 5LU8A 1UG0A 3Q0WA 3F6VA 5L7YA 1I30A 4ERNA 2KNCB 2ELJA 5IP5A 5HS7A 5KJ7D 4CYCB 4KO4S 3DPSA 4EHDA 4R6WA 4NQRA 4XASA 4X6UA 1XNRB 1BGYJ 4CUKA 2IS4A 3UJNA 1PR2A 1FC0A 3EZGA 4WEOA 2A5JA 3UF0A 4OXYA 1ETWA 2ADMA 1Y0NA 1UJMA 2QRVA 2JJMA 3ISJA 4WPGA 1AJEA 3E3OA 1YCGA 4RSRA 1NNSA 2G28A 2FE3A 4ZN6A 4CM8B 5ALDA 1BGYE 2H5IA 2OAP1 5E79C 3JRXA 4FX4A 2EA4A 4FJ1A 3DHVA 5H9WA 4BLRA 2VNHA 4YX9A 1JKJB 4TMFA 1X2BA 3DV2A 3U3XA 5HNFA 4PJLA 3V6MA 1AB5A 2NXNA 2H8RA 2ZDQA 4Y6QA 1EGAA 3RRFA 4UEWA 1Y5RA 3H75A 2CV0A 2OCPA 3BQNB 4X63A 2ECOA 2Z6VA 3U1TA 4KG7A 2PH5A 4ANFA 1TWCJ 3AR5A 2D3TA 4U7BA 3AFIA 2X8JA 2J0VA 4L85A 3R4KA 3PDUA 4TLDA 3PP8A 5I3CA 4BLTA 2Y0SA 3Q10A 4EMSA 1EX6A 4CM9A 4EB0A 5JO0A 2LW7A 5LGUA 4FC7A 4W7HA 4U0VA 5I7SA 3CTMA 4QDJA 2ZQYA 3U1KA 4YCNA 1GU5A 4TL9A 1GFSA 3HPHA 1XLUA 3G9ZA 4AY3A 1E18A 1E4EA 1UOPA 2R1UA 3SC4A 1KYXA 2FWPA 4WLEA 3LI2A 1WO8A 5JNSA 4JOSA 1JDUA 4OB7A 1PJRA 3IV9A 3KOZA 4DA4A 1PUFB 3B6KA 1SXJA 4Y15A 5K8TA 4DR5B 2IP2A 4YWHA 3V3KA 4ER3A 3QEMA 1QLHA 3HUSC 1ZH6A 3OZGA 4DCNA 4TWAA 1ONPA 1KU2A 1Z06A 4H0LD 1IAQA 3L9XA 4B3HA 1HYEA 2WKQA 4KQFA 4PD4I 4NV0A 4K6KA 1IEXA 2EFJA 3OCJA 2A94A 1RBMA 3EETA 2HH9A 1H89C 1YZGA 1G21A 1U0EA 3PDCA 3CKMA 4LFCB 2QSYA 1F5SA 3BCSA 2DUJA 2OORC 1CR2A 3R3XA 4YRZA 4CCMA 1E1QA 1QCYA 4DW6A 2XKBA 4I66A 5I7RA 1A02F 4MTCA 5J47A 2I2WA 4F5YA 5GONB 1P0FA 2BGLA 4F5ZA 2PL9A 3VHRA 3NUQA 4EA6A 4J19A 2W2LD 1P72A 3AVTA 4O4JA 3LC7O 3N2GA 4KSYA 2CMDA 2P4SA 2DWPA 2HSJA 3GYBA 3CNLA 4RMJA 3AUXA 3UBTA 2L4MA 1BFDA 1GZHB 4KAFA 4ZCMA 1Y56A 2QRNA 5C46F 5HS8A 2JGAA 1E63A 3LOPA 4EQ6B 2L82A 3DE3X 2A35A 5EZHA 3C7DB 1YS2X 2QLTA 4ZK6A 4X90A 2RDPA 1KZUB 1NE7A 2XGSA 3I37X 2CQNA 4A3BJ 2GFIA 4WLNA 3N0VA 1C3EA 4RPCA 1GVHA 1MDFA 1CF7B 4PSVA 3DHEA 4MQEA 4XIGS 4XOUA 1Z0KA 2GSDA 2WBLC 4YFNF 5J9FA 4BU1A 4FX5A 1GEEA 1G3MA 4NBQA 3VI4B 5K0ZA 5GAJA 3UH0A 3W5VA 2WILA 2JFOA 4PE5B 2DULA 3RYCA 1Z6AA 4DUGA 2DM6A 2AN9A 4NCHA 3D4NA 4N7MA 4AX8A 2PH7A 1KEWA 4KRGA 3M6MD 5B1HA 1QF9A 1YMVA 2I6TA 3RFTA 1G6HA 1E20A 1PVDA 3UA3A 1KO7A 4AP9A 1NIJA 121PA 1CEQA 4KPUB 1FP6A 1ZR4A 1S5LC 1YZUA 2NM0A 3BE5A 1QMPA 2WFMA 4D9HA 2K4MA 4YPCA 2M8GX 4EUKA 4FS8A 4O29A 1E2UA 2BHRA 2P9FA 3BTOA 5HK8A 2AR0A 3OM9A 1NXTA 2I29A 1O7JA 1XCGB 4GQBA 2BFDA 4IL6H 2B6HA 2PJZA 3AONB 5JSKA 1JCDA 3IQIX 3KPYA 2P5TB 2NZJA 2HGSA 3VSDA 1Y8QB 2J9RA 1JT6A 3ZU5A 2R8ZA 3DZIA 2ID8A 2BLNA 4YRAA 1ZCAA 3JD1A 5KWSA 5CG2A 3U09A 4JEUA 1WMDA 2Q07A 3NTNA 4XRSA 3HK2A 4CTMA 4QHSA 3U81A 5HKKD 3MA0A 3AOEC 5ERXA 3EGDB 1BC7C 5B1AH 3JS5A 2WIKA 1FXSA 2JS7A 2NPSC 3HSKA 3CCCA 3LWNA 5E6RA 4HDKA 1KPHA 4D9BA 4HLNA 4R1UA 4X00A 2I3BA 3UHAA 1Z2OX 2KLOA 1LVKA 3K5HA 1GNRA 3GZ4A 2CJYA 3PR1A 2VYCA 4I1SA 4WMLA 4JXKA 1MAVA 3ZQQA 1KXJA 1LWNA 3A6ZA 3VYUB 2N1TB 3HHEA 3LW7A 2NTVA 4H7EA 3I9V1 1FFGA 3RSSA 5KNLA 3E5RA 2XH8A 1AQ5A 2NO4A 2B7EA 4KH1A 3L09A 1A96A 2DTXA 2CZGA 2B7LA 2CYBA 2PYDA 4GH5A 3KU4A 1GPMA 4DQ2A 4JGGA 4AY6A 1XKXA 4QJ4A 4E7OA 2PXXA 8AT1A 2HPZA 2BMJA 3V4ZA 1I1QB 3A3YA 3VYRB 2AH5A 2HHJA 2K27A 1FYWA 2VL7A 2RK4A 5JWRA 3MTJA 3B3FA 1JSRA 2YMKA 1BXRA 5TNXA 1Z5UA 2YV5A 3SM3A 4NK4A 4PC2A 5FTWA 4H4CA 1T8RA 1J56A 2QD3A 5E1DA 5EUMA 4WXYB 3N7NA 4JVNA 1UOOA 4E5YA 4BMVA 3I5AA 1BC5A 1YLFA 2JA6J 2Q8NA 3UNGC 3M9BA 1NTOA 6Q21A 2V0GA 3DTVA 5M34A 2JJ2A 2AXTC 1ZELA 2ECPA 4P32A 2Q3MA 2UXXA 4NFHA 3IKLA 1UDXA 1UMDA 3E23A 1ZUD1 1LK5A 4E7HA 3UJHA 4O4HA 2MINB 3F71A 2I1JA 2EIHA 1LW7A 2C5AA 1DLIA 1AUQA 1T36A 5KYTA 5G1PA 7ADHA 3UVEA 2CWWA 1QKJA 4OHXA 2CKDA 3QYFA 3BH7A 4TWJA 2HI3A 2R7VA 2F4NA 3CP2A 1H65A 4OHMA 2JLRA 3OSUA 1SQVD 2E5WA 2FR0A 3DL2A 3E0XA 5CG1A 2JASA 4E1BA 4TTAA 4TXJA 2ID6A 2YVQA 2R6HA 1KIMA 5AI8A 2DSTA 4UUSB 3V32A 3VNVA 1H2EA 4I50B 5FH9A 4A0SA 3BG7A 2QT1A 1R6BX 1ONSA 3CY6A 2GAAA 2OYCA 4LOJA 2Y6UA 1YIJI 5FO1A 2G80A 3V4RA 4IRMA 1RWVA 3VR3D 2VJIA 4JB8A 2C03A 2XB8A 4HLUA 3F8FA 3NCHA 3OCCA 4ND8A 5DUKA 5DASA 5IKEA 2GM9A 1DBSA 3CWZA 3AF2A 4OMYA 2QD5A 3G3EA 4EJTA 4I5GA 5JDIC 2Y4OA 1L4AC 4RM2A 3I05A 2CKMA 2PUWA 2FA9A 4QJIA 1PGJA 2AOXA 3BDAA 4Q4DA 2JJ1A 4CPDA 1YX3A 4R5MA 1O94A 1W49A 1T0UA 3LUGA 5I3ZA 3S3OA 4O4LF 2GEUA 1U2PA 5J8CA 1JBKA 4I8IA 1OPCA 2PBIA 3JQ8A 4O4IF 3HZHA 2A14A 5EZYB 3HO8A 2E75C 2QQGA 1IBCA 3D4IA 4BX8A 4E88A 5ED4A 2BMFA 3HCBA 4FNOA 1GVDA 5HBRA 4UE6A 1WJBA 1X79B 2YC4C 4PXAA 4RM3A 3NW9A 4GOXA 4CH7A 2JEZA 5DCYA 1LFDB 4B4KA 4BMCA 4ED9A 3UAOA 4UVGA 2ZC2A 5HLGA 4UXIA 2X3FA 221PA 2QPTA 1XJ0A 4C3VA 4Q9HA 1TQ8A 1M1EB 5AO9A 1YIJP 4DQ0A 1KYOH 4WX9A 1MFTA 2YJ6A 3SP1A 3DQPA 4L0MA 1IHPA 1NV9A 5FOUA 2WTUA 1ZH4A 5JXJA 1VDFA 1Y1QA 1ZR2A 1S0UA 3SC6A 2LREA 3K5PA 5EESA 3BHMA 5KHLB 4GC5A 2XRLA 2Q4TA 4D9CA 2QA4P 1XSEA 3AERA 1AO3A 2QJRA 2K4BA 4CQJA 4PIMA 2R11A 5T4FA 2OP0A 5KKZB 1MTZA 2YFQA 3SS8A 4C3OB 4QPOA 4YBZA 3TLBA 5K7ZA 1PR1A 1N73C 2HIHA 5CH8A 5LHGA 4BASA 4DPLA 3TPFA 1VCHA 2GKSA 5FOWA 1ITYA 1LZLA 4C7RA 5DXFA 1RAFA 2JLXA 3IO3A 3PO2J 3SVTA 5IT0A 1G59A 1TEZA 4JR1A 2XNHA 1SCIA 2ZS8A 2PL3A 3LPNA 1U0SY 1FFEA 1X9VA 1I3AA 3GJ4A 2XQIA 1NT2A 3N5KA 2N47A 2XZLA 4MKZA 5DTQA 2Q1WA 3EVCA 1E6MA 5LOVB 4PLCA 1ZLJA 1DC3A 1HC8A 3RDIA 1RQUA 5MN4A 5JTUA 1OX5A 4C43A 2YDYA 4X1IB 1S1CX 5LYJB 5ECYA 2GKOA 3ZHTA 4XGKA 2R25B 1V7QA 2IHJA 3EQ2A 4DXHA 4KRFA 4ABYA 1JTVA 3DE6X 5JMWA 4QSHA 1N1MA 2RNJA 2O2DA 2FOLA 2KJBA 2O4CA 3CJQA 4DV1B 2OTJI 4Z9FA 4DNPA 3ZHZA 3BAZA 1UJ2A 1GTVA 1HGVA 1PS9A 1PDWA 2ADOA 4EM0B 4LOLA 2H1KA 3M3DA 2OQ2A 2V3WA 2KIFA 4I36A 1PSZA 3DBLB 4AIHA 4IQFA 1RBYA 5EZGA 5BQFA 3C2QA 4DZZA 2QBYA 4CLEA 5B58C 4XVHA 4CKCB 2FXPA 5F04A 1HEYA 4QLOA 5C35A 1T9GS 3CPWO 1T0HB 3BFJA 4E46A 3F78A 3CXHI 5LA6A 2ZCJA 4N7RA 2ZBVA 3GAFA 2W8BA 1Y98A 4Q01A 2TDXA 3OOSA 3D6ZA 2WWVD 1DRVA 3OSGA 2HC9A 3GA0A 4I5IA 4YNBA 4F96A 4LQDA 1FJKA 2I03A 1CF4A 3CWBE 2HLPA 3W6VA 1K6EA 3QP6A 2Q9CA 2HQ5A 4BMXA 5L3QB 4F45A 1FS6A 4J4BA 2FMHA 2WG2A 2H3HA 3TKAA 1L4FA 2VJBA 4I2LC 3U1VA 2GN6A 4X6XA 1UT6A 3RE1A 3B7PA 1O03A 3KCQA 1QDLB 3E97A 4BHPA 1OYYA 3FJ1A 3FPHA 1F2VA 4Z54A 1GCGA 3P8CE 3O2SB 1PCXA 4UU1A 2KOGA 4X62B 2JGDA 3KB6A 521PA 1O6ZA 4OVNF 1E4VA 2VBYA 4UXNA 5FKNA 1RABA 1NYLA 2SNIE 1V3QE 2YY7A 4Q1BA 4LFBB 1OPXA 4ENJA 1YMUA 4U7WA 4Z0PA 4YUAA 2E36A 2NACA 3B7GA 2JIPA 4MLPA 5FV4A 3EARA 3HDQA 4BKUA 2Q6LA 3N2EA 3R20A 5DGDA 3BQ9A 3TE7A 1SU7A 2JGDB 2I78A 3PPVA 3UY4A 2QQ5A 3AR9A 1Q16A 2QAGB 2O2CA 2COMA 3M6WA 3KJHA 4WE3A 2PMBA 5APVA 4QYMA 1QCCA 3OIYA 2AV6A 4PBTA 1NVGA 3HDYA 2YXBA 3EGXB 4DW8A 3CO5A 4CDNA 2AS5F 1BDJA 4A36A 3BTIA 2WD7B 1NUAA 3HU1A 3NTVA 3J7TA 1EZVG 4EHBA 2VI6A 1VJDA 1L3BA 1BSVA 3O4IA 2PS0A 1LA2A 3GMEA 4WBNF 3E7WA 5K6RA 3HM5A 4ZQFA 3SFIA 3ADPA 3QENA 5M3MJ 5LB4A 4JLSA 3TYYA 5C5IA 1DSSG 1M54A 3LX8A 2JGIA 3MQ2A 1MB4A 1DWPA 2ZCVA 4WZAA 2WC2A 4YJ3B 3FSGD 1G9TA 2UYCA 5FJIA 5DGHA 2C61A 3DUFA 5JZMA 1F0KA 1G66A 2CC2A 2P30A 2CVHA 3TRKA 4YBRA 3TQFA 2DWQA 1ESDA 2XSZD 4EA7A 4KHZA 4F6RA 4FXOA 1ODSA 4W8HA 3GA5A 3PE6A 1P2FA 1UH5A 2ZSDA 5DFAA 2ZSAA 2D2IA 2O8KA 1SQXE 3ZE8A 2HMYB 2I33A 4M9UA 3AKYA 4U3FD 2E2WA 1L4NA 2Y0MA 4L4SA 3AETB 1YNOA 1ZBQA 3DDOA 3PC7A 4RC9A 2HDDA 2J3JA 2X9VA 4KVFA 1UT8A 2O6LA 3TD2A 3OEEA 1JT0A 1EJ2A 2LKSA 2CHEA 5HGXA 2NVBA 1L2TA 2ASEA 1R15A 4MULA 1EWRA 1RI7A 4V2UA 3S8EA 2PYZA 5LRSA 2CFTA 1A98A 2ECQA 3EXEA 4YJ3A 1CDOA 1AC5A 3PUJA 4DQKA 5MGBA 1BXZA 5DWQA 1KMHA 1Y33E 4Q7MB 2VP2A 4MW4A 1PYDA 5K45A 1TM1E 4BYMA 2X5XA 3R77A 1X7HA 4YQYA 5EJ5A 1YZVA 3DPTA 4KNYA 3JWJA 1JJFA 1YVUA 4I14A 4CMGA 4TYYA 3E7PA 1QNLA 1H1LA 1VGRA 5CB6A 1GNQA 3GGGA 1Z7YA 3WIEA 4NXNB 3AESA 3W2IA 3P9CA 1TD1A 3ID6C 1M57D 3I52A 3BREA 5EWMA 2B99A 1V0JA 4LVOA 4BIMA 2EQBA 1LVAA 4X7PA 1XCOA 2P11A 3W2GA 1VL2A 4NH4A 3SR0A 1E6WA 5AVRB 3LY7A 2VZLA 2DYKA 5H3HA 2IYAA 3BMQA 4J9VA 1XZCA 4RVNA 3WIUA 2LPMA 2A4MA 1AOXA 2IDKA 4E2WA 2HL6A 4KR6A 2DHDA 3QXCA 1VMAA 1JN0A 5KMGA 3DF8A 4LZLA 4D9MA 4IFMA 3UR3C 1IC2A 2CUNA 1U2TA 4X8LA 4HLCA 5E1MA 4N1AA 2VXDA 1SQPE 1F17A 4LXHA 3KR9A 3U1BA 4XX0B 1AT1A 1ZOYC 4PN3A 2P6PA 3O8QB 2ZYSA 4EMUA 1XTJA 1KQ3A 4HNAB 3SR4A 3W5IA 4IHJF 4DT0A 3RYFA 5AQEA 2OPBA 4LI3X 2OM2A 1E0KA 1CGPA 2FN4A 3WTBA 3FMGA 1X14A 3CC4P 3B3JA 2EJUA 4YLYA 5F1KA 1CIPA 3H1EA 3AGQA 1UBHS 4PZYA 3MTBA 1B6GA 4ANJA 5KYGA 4L9NA 2E34A 1K7YA 1LSSA 4EW2A 2H2WA 2ZITA 2G5CA 4RGSA 4UTRA 4M9SA 1K97A 3GCDA 3H2BA 1JLLB 3JCUH 4OBWA 3V9AA 3OZWA 2A5WA 3HE5B 3HOYJ 1HM5A 2K9YA 4N82A 1HSOA 2AC4A 1GV1A 4ZC8A 1GG9A 4ZYLA 3VOTA 4UUNA 1C1XB 2WHPA 1T5LA 4AF7A 1ZC3A 1DH3A 4IOIH 1JSZA 1VECA 1I4TD 4EZIA 1ZUNB 2VUHB 5BSHA 4R5HA 1G8AA 1WF6A 2XF6A 5A4AA 2JLVA 3JRCA 3B51X 4B87A 4M8LA 2LXCB 1MT0A 2F6CA 2RGNA 4DMMA 3QVTA 5BYBA 3B6MA 2O59A 2I1QA 3NBQA 3SICE 5BOSB 3A4TA 3WOVA 1GPWB 2GPTA 2Q7OE 3TTVA 3ZY5A 3MUNA 3RG8A 1U1IA 4XSVA 3W7BA 4M38A 1D2EA 3FDYA 1XR3A 4LYFA 3S1RJ 4KIUA 4KTTE 3NDPA 2KT0A 1R3DA 1NDUA 3OTGA 5AW8A 3FYSA 3D5SC 4QYWA 1L5NA 1J2JB 2L69A 4MI6A 1Y5IA 2DAPA 4YHHB 2JCBA 4PPFA 3UXYA 4GQIA 2V7TA 4NFYA 2Z43A 4LX8A 4UATA 1U7TA 3LIDA 4O59O 2O2XA 4BATA 2IZ5A 1KJ8A 4O0LA 4E4TA 1KDRA 1P7VA 4O3MA 2XAUA 2VAPA 2FKNA 4BKMA 1LFAA 3DFKA 4KT6A 4UHJA 4G86A 3CVVA 2CQKA 1NE2A 5J2TF 3L5OA 5LBTA 3K4MA 1H2HA 4UQPA 2BHSA 2E75D 4HD8A 4XYBA 2VHYA 3GZNA 3U37A 3RIYA 3SPXA 4WX2B 1PNVA 2HSZA 1E3IA 1KVRA 4QLAA 4CQNA 3NX4A 3WE3A 3H5NA 5DYNA 3QKRB 3Q7RA 3QI7A 3K09A 3IERA 2VH2A 2BFFB 5TPWB 2K1AA 1A9RA 2MHCA 1XLTA 2EZKA 4B2YA 4BFLA 3NIGB 3ZVLA 3MVPA 4LIVA 3PA6A 2DU8A 2EV9A 3WLKX 2YC2C 2IFNA 4YC7A 4YV0A 3HGYA 4XR6A 1IM2A 1YA4A 3WLPA 5MFPA 2GJ9A 4Q3BA 4I4TF 4PJ0H 3DKIA 3WJ2A 2C5FA 3GCGA 4P0PB 5L3CA 2O7RA 3ANSA 5CDGA 2PL5A 2WUDA 2QXTA 3H1JE 3CWBD 1FBQA 2OO3A 3BATA 3QPTA 4NPFX 4UDNA 3MRTA 2AC7A 4OI4A 1T9ZA 4G4SP 2LKPA 3BXPA 1WV0A 1ZUWA 3H5AA 1JXSA 2CLIB 2PT9A 3D7SA 1B0UA 5B66H 4B6EA 1QRSA 2BFOA 3W6UA 1EK6A 5CCGD 9LDTA 2NNWB 4RVSA 3ESZA 2YKOA 3SNHA 2OYIC 3GVXA 4XB6B 2BY2A 3E81A 4JASB 2PQ8A 1D2CA 1Q91A 3PFWO 3J80A 3D8UA 2X58A 4QM6A 4MCAA 2ECBA 3ZN2A 4I55A 4ZFNA 3GAMA 1X1SA 2FFDA 3ONNA 3VC1A 1KPIA 4BVEA 5CFZA 5L45A 1F4PA 1E79A 2EJCA 2Z5HA 2JB9A 2CG4A 2XE6A 3WE2A 2DFDA 2BYVE 3RC3A 4G0VA 3H86A 3GUYA 4W5NA 3WLIA 3SXUB 1THZA 1ESEA 4RVUA 1PF7E 2YZKA 4G4SO 2RAUA 3D3JA 2BCCJ 4HJRA 1V3FA 4Y28J 1TYAE 1HT3A 2W00A 2ZWPA 5ALGA 1N2SA 2VK8A 2O5VA 3N7UA 3S16J 1MO2A 3SBDA 1LV8A 1K3FA 1TZKA 3CF4A 3SSOA 4FGSA 1QIKA 4R71A 4FQ7A 2XKOA 3W8DA 1Q0HA 2PKQO 3EVGA 2IYVA 3PC3A 4ZVQA 2CB0A 4RK5A 1IVSA 1KFNA 3Q5FA 3ZS9A 3SE0A 2W37A 3TD9A 4C9BA 1N3LA 5BQ5A 3RV3A 1WWXA 3I8XA 2CYAA 5APUA 4FFPA 1D03A 4TTIA 2LBFA 2LD4A 3BE4A 4RORA 3UTDA 1UZMA 3DWLE 3F6PA 3GFJA 1Z4MA 4TQGA 3UATA 2DWOA 2O7QA 2ME6A 4ZAXA 3FR7A 3H6GA 4AJ2A 1V7ZA 4L4RA 4OFWA 3OU7A 4K9QA 1FBUA 2FVYA 2YJZA 1HWTC 2P67A 2GYWA 2QNBA 1JDSA 4OLHA 1H2YA 2BHNA 1KBOA 2QTBA 1NVTA 1FSEA 2E2HJ 1F48A 5C8XA 3PSIA 1KFMA 1C29B 1E2JA 3UYLA 1XGMA 5U4XA 1PK8A 1PQUA 3E9MA 3QYPA 4F56A 4FR0A 1YI1A 1OT5A 2XPWA 3EQ6A 5DHUA 3E3VA 4PIVA 4P4LA 3W6ZA 1NAFA 3QLUA 2X9GA 3H8SA 2NGRA 1T3TA 3K5WA 1NI5A 3FPBA 2Z9CA 3FI0A 5CFRA 4W5RA 1J70A 3IAM1 1UMKA 1G20A 1H2XA 2JFXA 3UW3A 3W9SA 3EMVA 3HCAA 2I4IA 2VAVA 2AR9A 4DAEA 5IUKC 2O1JA 3GO4A 2KRCA 2BZ0A 2G82A 3AR2A 3C5WP 1R4NB 3LDFA 5HOOA 3EZNA 5B53A 1G8MA 1AY0A 2BJVA 2CL6X 3E7KA 1BL0A 3FTPA 1W46A 3CO0S 3UAYA 4A0RA 3KQYA 3TJZA 4HYEA 2ODWA 4AO8A 3C7KA 3Q6IA 4PAOA 1DKPA 1EUQA 5ALVA 2XMCA 3W9YA 1UJ6A 1W7PA 3NBZC 1Y3HA 3W05A 1JEEA 2CV2A 4DN6A 1KI1A 4OHUA 2PD6A 4D9NA 3FGAD 4CU5A 5FL7D 3N2LA 3OJFA 4O2AB 4EW1A 3M1CA 1EVKA 4D41A 4C6SA 1USTA 1C8KA 2B5WA 1AB6A 3I6ZA 3DVQX 2DCUA 3E18A 2WB2A 5COBA 1AGRA 2M6KA 4L0CA 4F3QA 1W85A 1PJTA 2ZMEA 1E5XA 4XORA 2H1HA 5I9IA 1MJGA 4ZDIA 5JSZB 5E3HA 4UB8E 5JO9A 4GZMA 5BW5A 5AK4A 5K20A 5J1UA 3PEWA 1B6SA 5KHOC 2EHJA 3QPBA 3PJEA 3AE1C 3L04A 3KQUA 5IMSA 1BCCD 1LJLA 3ASVA 4PCUA 3EC7A 1QAQA 2O1EA 3S2SA 3N39C 4FFOA 1OZ0A 4UV9A 3R2JA 1E99A 1O3TA 3TMKA 1FX0B 3NRBA 1QGUB 5SY6A 5IBCA 2LR0A 1ETOA 2JFWA 4WKCA 3J81k 3GFQA 4QJ5A 4RZXA 4ZNCA 4PLVA 4H6VA 2JCSA 3H36A 3IC7A 1DI0A 3LHIA 5CHYA 3VR3A 1SFCD 4DYDA 2R85A 2HMUA 3FYTA 2JVJA 3AF3A 4CV1A 4P4GA 5EHZA 2NU9A 1DRWA 2V03A 2ZR9A 3GLIE 1CJTC 3ST7A 1JNXX 3DEKA 5J59A 8GPBA 1OW7A 2NTNA 2XQVA 3R3WA 1QYXA 4UZFA 2M32A 2HEGA 4IM7A 1OAAA 5C7IO 3ECCA 3MWDA 3SQDA 1SKYE 2BRUA 3S55A 4KUGA 4MVJD 3FOAA 1HE4A 5DW3A 1SC7A 1XF1A 4CODB 3HPQA 3TIVA 3L74J 1R5OA 3VTPC 5U4QA 3A3KA 2A06G 2LDXA 3OPMA 4HB0A 3LRTA 1FW6A 3AL0C 4M3LA 3OV8A 5GP9A 1ZN2A 1U28A 4TUYB 1RYYA 2YL2A 2X8LA 4YMUA 3PFKA 2QTCA 4NPHA 4TN5A 2B82A 1V25A 3Q9LA 2ZBQA 2OGUA 4C04A 1DX7A 1CRZA 3ECAA 4L5AA 4FLFA 1MV8A 1WX1A 1S2LA 1J23A 1Z68A 3NM6B 3STVA 1R37A 5J4LA 1RCUA 2A57A 2D4AA 3DMTA 2EIKH 3M83A 3DCNA 5K8VA 1O95A 1QFJA 4J0KA 1HE2A 2AE2A 2IKQA 1NM5A 1I3LA 1XHFA 4UUOA 3H2GA 3D1LA 3ZV5A 3ZW7A 1QHNA 5DEIA 1D5VA 3VZDA 1LEBA 1AQJA 1HBXG 3UHFA 2QVCA 5CFPA 4LJSA 3IRQA 2QKLB 2OXRA 2WUFA 2CMHA 3B4SA 4PO9A 5FOVA 2V7FA 3VODA 1KH2A 1HT2E 4QUIA 1EP9A 3EG9B 1V1RA 1BHO1 1XGKA 4C7MA 1RR6A 1L5WA 1PUIA 3BTSA 3WP0A 4G41A 1G2HA 1K78A 3CX3A 4L5BA 3KX2A 1NUPA 2MSLA 1QA6A 3NTRA 5LMUB 4WF2A 3QXSA 4ID3A 1JA9A 1W85B 2PGJA 4OXKA 1TYBE 4PFQA 5EJ8A 1OYOA 4C7OB 4OBBA 3KKKA 1ESCA 5TJHA 3NASA 1QG4A 4HQLA 5TT0A 4US0R 1XEXB 4INPA 5IBQA 4X1KA 2XNXA 4MIMA 4IINA 1IFXA 1XOIA 3R5XA 5TX7A 2O03A 5KSOA 5F3WB 4XPZA 1DDIA 3VVCA 1M2WA 1UXHA 3SHQA 2PUHA 3G1WA 2B3DA 3T4UA 4EKNB 4QOGA 2GILA 3ELBA 3CRRA 4TKUA 1GAWA 4ND6A 3I3OA 1UPFA 3LY9A 4DCKA 3D6TB 3I59B 2VUTA 4D9KA 2H94A 1EEHA 1I4WA 3FX2A 4NRDA 4X61A 3ONFA 1Z22A 4KSCA 1HDCA 4UCXA 4ACBA 3ZV3A 2NPOA 4G1UC 4ZRDA 1E2FA 3WS7A 3IHKA 2JIBA 5JNWA 4UUPA 2QY6A 1ZJ5A 2WM3A 4G97A 2EYUA 3IBCA 4HF7A 4JWKA 2HF7A 1XTTA 4CLDA 1T6XA 2BW3A 1ZD2P 3M81A 4LF8B 3JVEA 5CT6A 2YW9A 3FNRA 4YRKA 2EIJH 2QL7A 3EWIA 5HXAA 5CNKA 3HB0A 2FE1A 1IXZA 1WD5A 5A3QA 1AMOA 1IJFA 3DEZA 3JQ9A 2D5CA 3QQAA 2EU8A 1AMUA 2VZ8A 5ALRA 5KTPA 2DE0X 3RW9A 1VG1A 2CVFA 1UWLA 3WYEA 1BN7A 4I99C 4ZYWA 1VHDA 2B2CA 1RJFA 1TTYA 1YQWA 1K7CA 3CF0A 2NXJA 2F8MA 4ASUD 2Q7XA 3TQRA 4IEEA 4CZCA 4POAA 1H5UA 4Q00A 2VZ9A 3NIWA 2WFLA 1W47A 2P9CA 1SCAA 1LGHB 4TOIA 1ZLYA 3KL4A 2ZVQX 1W93A 3PD1A 2Q1TA 2QR2A 5SYMA 3Q0UA 1WCXA 1I80A 2PG4A 2H1FA 3BIWA 3GNTA 2V98A 4MUIA 3F98A 2LSOA 2ACWA 1KMHB 3AK4A 2YJ3A 2DMPA 4DTIA 1LNSA 3TI7A 3ROUA 5JCXA 1E96A 3N0WA 3O4VA 3O47A 9LDBA 1XQ9A 1G8SA 3I55I 1KH3A 4CM5A 2BFBB 1P8AA 5AW9A 4LRSB 1BEZA 3DHWC 1FFWA 3EA0A 2YIUC 4G63A 3GZ6A 2IS2A 2DQLA 3G6WA 3WBFA 5APWA 4LYGA 2XNDD 2IGMA 1XK7A 3CCUP 4NCKA 5TS2A 4KNWA 1ZD3A 3QF4B 2X6OA 1KZ6A 5EXXA 3T34A 4XVQA 2XROA 2H59A 2YHIA 3G4SI 4JP3A 3WIVA 1SC3A 3B5NC 5A2GA 3BLYA 4DHEA 1RPWA 1J75A 1A3CA 3I30X 1EDEA 1IC6A 3MGGA 2YWRA 4GRDA 1KN7A 2J31A 1VRCA 1ZIXA 3GTPJ 2RHOA 4ESHA 5TC4A 4IFDK 5D5XB 2HV8A 4OFBA 1K5DA 1PKXA 3HH8A 2G7UA 4B73A 2QE7D 2ZUCA 3SE7A 1TJPB 1UPCA 2VJCA 3TEMA 5ICSA 4AY4A 4UCQA 5TLSA 1B6TA 1I6KA 3LPMA 1Z21A 3RASA 4JP5A 1MZBA 4LLHA 4KQIA 3RL0B 1HT0A 4GNRA 2ZJ2A 5ARDA 1AGYA 1GZVA 4PYMA 4IQJA 3MLEA 2UWJE 5CAEB 1X3UA 4AKGA 4LJRA 4QTUB 5CVJA 3BBLA 4XEHA 2E37A 1N3BA 1L8OA 4D9FA 3DE5X 2OG2A 3BCCE 2FQQA 3Q85A 1NTKK 4OA8A 3H05A 5BRJA 3CURA 1XD2A 1FTWA 3KD3A 2G8YA 1GRCA 3HE4A 2ZRAA 2W4QA 1Y5LA 5ITWA 4GZ5A 3RWMB 1IB0A 2ZYWX 4QXAA 2W2MA 1QHIA 3DVSX 3PI7A 3FPAA 3ZDXB 4XYLA 3T7KA 2G71A 3RWBA 4DYHA 1EZVE 2JRMA 3RTRA 2FFRA 1KRWA 5C8VA 3X2QH 4DZOA 1N5JA 3OWXA 2GLUA 2Q0XA 4NQZA 3CCSP 2WJ4A 3KQQA 4HNHA 1TRHA 4EGJA 3P27A 1WQ4A 1G6NA 4R3NA 3RLFA 4LB5A 2PX3A 3KU1A 1YHYA 3H3XA 4RGBA 4R3WA 1RQXA 2QG9A 1IZZA 5LKAA 3KUKA 3F5FA 1DXYA 4ZVTA 3SX0A 3DEYX 1L0ND 3WQSB 1YZHA 1MA3A 3CNNA 1O3YA 1M7HA 3NAGA 2B7BA 4R4MA 1GQQA 2WV9A 2DERA 1VQPP 5ER9A 3J81K 1YJAA 4BX0A 3IXLA 2OMEA 3FSJX 4KQ1A 3ME5A 2Y9PB 4WK6A 2C4KA 1SQ5A 2WTAA 1Z6ZA 1MX1A 3AM3A 2R1VA 4GFBA 4A0HA 3ZNOA 1SCNE 5C7YA 3N8GA 1WZ2A 4YRFA 1WG8A 3CZ9A 3R0AA 1KDOA 5DF1A 1S3GA 1EUCB 3ZQCA 1LTTC 3OSFA 1BX3A 1WNFA 2WM9B 1NXVA 2I66A 2M5AA 3I0NA 1X7YA 1N2IA 1XDZA 3JXEA 5WRFA 4JR2A 1JCCA 5JMOA 3O7WA 1WJCA 4JD5A 3AE9C 1K73Q 2H3EA 4RK4A 2MKVA 1D1PA 1AXEA 4G67A 1QGKB 3S3NA 3GPCA 3KJGA 1OW3B 1ZL0A 2ZDHA 5L3EA 2V4MA 1RIOH 1HJBA 3GMDA 4FI3F 1NPDA 4WB4A 3BSYA 4BWYA 3ABVC 4P3XA 5BPIA 3FCXA 3RV4A 4F5DA 5LQUA 1IZ9A 1ISGA 3CUYA 5TXGA 1GKLA 3K71B 4LNUA 3FIUA 1WVGA 4X6YA 3PP5A 3TDNA 4Z4IA 1Z8DA 1YC2A 4KDPA 4FKZA 4JVOA 1RQRA 1S1MA 1F7VA 5MN5A 2PUBA 3ZU3A 3MUEA 3C18A 1K4KA 3BASA 5L7TA 2CNLA 2EQ5A 3MCZA 1CXZA 2OAQ1 3Q5EA 1C9YA 1DKUA 3ELYA 3VU9A 1RIFA 3M1AA 1RVDA 2WAOA 2Y92A 5TGZA 4XSHA 1KEKA 3G71P 4O2BF 1OCRH 2FSSA 1R0RE 3BPSA 2BMDA 3BTUA 2D1FA 2YVKA 1FSHA 3E1SA 3OHSX 4QNNA 2D1SA 1P8JA 2FPPB 3MCVA 3H6PA 4PCQA 4Q6WA 5JRZA 3ZWNA 3JVIA 4HHEA 4FFBA 4Y6GB 1PLJA 1KS2A 4MS4A 4PZLA 2DH5A 2OUMA 2QMEA 4RU1A 4KVAA 3WB2A 4A12A 4OBXA 4DUZB 3HO1A 4B48A 3HWX1 4OB6A 2WJGA 1W5CC 3L70D 4CF7A 5C5CA 1U1DA 3HWSA 4QO7A 1FOYA 3F5SA 5B3KA 1Q7GA 4EYOA 4PVCA 1PVOA 3G85A 4FX2A 1V1MA 4UVDA 3JREA 4C7KA 4AD8A 2ZB8A 3AJ9A 3L71G 2DTDA 4HX4A 4UUQA 4R79A 3CCRP 2O8DA 2HXSA 3ISTA 2R5NA 1VL1A 1FY7A 1Y3BE 3LJKA 3BXXA 5JR3A 4L18B 2V55B 3N6VA 2NNYA 1ISRA 1L4AB 4F86A 3EVZA 3MGKA 1F0YA 4C6TA 1FYVA 4B3RB 1KQPA 2YZNA 4LNAA 3LSYA 1G21B 1IDN1 5BR4A 3PTLA 1ETVA 3C4QA 1YJNI 1WJGA 5IKPA 2W24A 3GEEA 1TQDA 3FYCA 1FFSA 1ELOA 3ZCXA 3SC2B 3V46A 1TQ4A 2ZP1A 3SQLA 1SFXA 1I13A 2PLNA 3GBSA 5ENZA 1XPRA 4DR1B 1DQNA 2A1UB 5HM8A 3O95A 1USUA 1CQZA 1EP1B 4DBLC 2BW0A 4K9SA 4RO0A 3FVVA 1FQJA 2G0AA 1CY0A 4D9GA 2F59A 4F6LA 3CB2A 2DOAA 1PDVA 3Q40A 2IX3A 5A2QK 2STTA 2QJPB 5BO5A 5FHQA 1GG2A 3B2QA 1E3OC 2C00A 4BBZA 1XG1A 1XVTA 3CTPA 2CUTA 3DBHA 7YASA 2X0NA 3ZI4A 1YF3A 2RG1A 5JH7B 4E7JA 4XLNF 3CUQC 2C8VA 2VH5R 4C9YA 5DM7F 1XXHA 2DMRA 3ACBA 3HCDA 3UEOA 3JARB 3WDMA 4BZZA 3RHFA 2PJDA 3TP0A 4BNUA 3D5EA 4HL6A 1TW2A 3BY6A 5FPHA 3RIGA 4GSKA 4PJMA 1SCUB 2HA0A 4W6QA 3TXXA 2D0IA 1Z4LA 3AOGA 4EO7A 2XYHA 4XWWA 4C0AC 1WUHS 4E6EA 4EYEA 3RRMA 3ORFA 4UEKA 1JGTA 3H04A 3UUFA 5JANA 4NKRA 2HNHA 4IWXA 5BNTA 2AEFA 1E1YA 4WGFA 2EFNA 1N6PA 2I55A 5HDGA 3UWMA 5C4JJ 1XEXA 1E1CB 5AUPB 1FIUA 1T36B 1W5AA 5E79E 1S2DA 4RZ3A 1QFMA 4EYKA 1KEEA 1Y4AE 5C80A 1M5UA 4M54A 2G1UA 3C87A 1FMTA 3IB3A 4FGUA 1X70A 3Q3CA 2LY9A 3AT1A 1BGXT 3CZRA 1CDEA 5F3RA 4M73A 1YRHA 1RM5A 5M04A 1IF1A 4F12A 2Z4EA 4J6EA 4ECAA 2BEUA 3RKSA 4YJ2F 3KELA 2DUUA 3L6DA 4Q16A 3SXJA 5HIAA 3GOHA 1ZJ6A 4Y52J 4UD2A 5E7JA 5IK2A 4BQRA 3EFHA 1HKTA 2CO5A 3KT0A 1NFRA 5K4AA 3ELKA 2GJKA 2YV2A 1SQBG 3ZD6A 1Z33A 1OE0A 4CM7A 2QPAA 3INRA 3I62A 4E7IA 1M2JA 5F76A 1SKQA 1R58A 3Q3HA 5E6SB 4IV0A 3NC0C 5F3DA 3CMMA 2JBWA 2IOQA 5FBKA 2K40A 1RPNA 4QGAA 1GOTA 3M4OJ 2O01H 2G63A 3MHVA 3V1MA 2KL4A 3IL2A 3IOMA 2NUPB 4RMHA 4LXQA 3AI3A 2Z3VA 2DFEA 3EX7C 4WY4A 5EE0A 1KAQA 1YQEA 4Z4EA 3JC22 1DE0A 2QKYA 5FL7A 1A35A 1Z0IA 5JAHA 3AEQB 3PPWA 1SQQE 1NJ2A 2VP0A 2Q5IA 3NM4A 3E5HA 4FWBA 3G7UA 1HF3A 1NI4A 3H1LJ 3PF8A 1X3SA 3NEYA 2P1DA 1PWEA 5JD3A 3X1YA 1G0OA 3N0RA 2EJBA 1K2VN 2SKCA 5CB4F 4ALMA 2FU5C 5FD8A 3WHCA 2NAFA 3OVMA 1B8VA 5AVOA 5LPNA 3MINA 3PIDA 2FJUA 3QBDA 4LOKA 1OXMA 1XZHA 2QVLA 4Y1EA 2P65A 2VJPA 4Q4JB 4MYTA 3UTCA 1VQLP 3AE2C 2W6PA 1XRPA 3CPJB 3WUTA 3VO8A 3KQPA 3ZZ1A 3CO7C 3UUWA 2O2EA 3KTOA 4TVSA 4DWOA 5BN5B 1QRTA 3NYRA 3DU5A 3UQYS 3NFQA 3FXOA 3WMRA 1JXOA 1QH0A 4B7XA 4DSUA 2OHFA 4I76A 2Z5FA 3V4PB 1NZDA 2ZR0A 2O5CA 1RAGA 2FZWA 1TU0A 2EDAA 4PAMA 3GPLA 4BJ1A 1Y4DE 4WXMA 3HYIA 2E3JA 4JUAA 2EINH 2F1HA 4QARA 4KFSA 3GZ5A 4JUBA 1THMA 1MPTA 4M6VA 3ZHSA 4RULA 3CF5F 1JP7A 5FWYB 1DO0A 3EGOA 3ZI0A 4C5CA 3RUAA 1HDYA 1QAOA 2R7AA 1QTIA 1DTWA 4Y7DA 3ZLBA 3MCTA 4CN9A 2IF2A 3T3NA 5H70A 1I4OA 4BE4A 3ZIAD 3ILXA 2QSFX 1P9NA 2PKEA 4EJ0A 3T97A 2RCYA 2X3YA 3M6VA 4AFNA 4ZZ1A 3GLFE 3UT5B 1UKAA 2ZYIA 2AUMA 3CX5D 1W35A 4HGZA 3AFOA 3JYOA 1KB9I 3IA7A 1QYDA 3ABQB 5IDQA 4PWZA 4IX1A 2XF8A 1YS7A 3OYAA 1YO5C 2I8LA 1AVTA 1PFWA 4BGIA 3NUGA 4I08A 2FPXA 4A3GJ 1NVEA 3EK2A 2NAZA 3F3YA 4LMRA 3QHPA 5H83A 5ANRB 3CH4B 4PZZA 2O3RA 1LVGA 1A6QA 1ZCBA 3S40A 4A5SA 4Y4RA 3ORRA 5CA0F 1N2XA 4O4IB 3IAFA 4QU9A 2G83A 4MO7A 3FF5A 5HSGA 2X7JA 1KD1Q 1FRVA 4F84A 1J7KA 3DONA 4CEHB 3WL5A 4DRXA 3ZHOA 4WN9B 4E5NA 3VR2A 2YYYA 1IUFA 3IJEB 5CCHA 1JY2N 1D2HA 4KDCA 4D8TA 1RYZA 5CB8A 2Y71A 3U1CA 4G37A 1S29A 4HZGA 4TS1A 5IF3A 3SNKA 1M2OA 5CX4A 2YJ5A 3AEFC 1C4KA 4QGFA 4LV8B 4CMBA 3OYBA 3LSMA 2M6SA 4KQWA 4JJ8A 1ST2A 1ORDA 3RYIB 1W4LA 2FYUD 1SXIA 1LNWA 2K88A 2QVXX 2GX6A 1R50A 3R7LA 2L4AA 3ZGVA 4JSTA 1KJIA 1WHUA 3VDXA 2OT3B 2VQ3A 4ZJPA 4WJZA 2REOA 4LSGA 4PR0A 1G5FA 4N8SA 3SXUA 5JHUA 1VI6A 4H0LC 2FE4A 1PJ3A 3U9TA 5DNYB 1N5MA 3C6ZA 2QN9A 1CP3A 5EWLA 1SMYF 1SCQA 5E7IA 2AYZA 2DFNA 4CCNA 2AEEA 1XYGA 3L0CA 3AEGC 1PJQA 1AKNA 3DTVB 2IPQX 4RXTA 1POGA 5G0SA 3L1PA 3VA7A 4KDEA 2IQ5A 3I4CA 2HTFA 4Q24A 2PXCA 3VVMA 4N3GA 3HLYA 2LBFB 1P4GA 4LK3A 4G6QA 2JKYA 4HF2A 3JATB 3OR2C 1U2SA 1E9RA 1W5FA 3GRRA 4GW3A 2FSUA 4YXFA 3RYHA 4RLSA 3WRXC 1ZN8A 3Q5GA 1FZEA 2YWGA 2A06E 1A77A 2FQ3A 1JFFA 1JJ6C 1XC7A 1V11B 3GV0A 1WBDA 2VAMA 4YQFA 4ZU6X 2J5BA 3TRIA 3T95A 2GRUA 5EXTA 2XPCA 3ZOBA 4D6XA 3M8JA 1U1GA 4F85A 2Z08A 2QM8A 1N2BA 3OQIA 3EW9A 3H87A 1ZMXA 1LT1A 2WJWA 4N6GA 5BQTA 5LJIA 1SD2A 1L3IA 4IRXA 4WDQA 3PQ2A 1SPBS 3PDHA 1ZK3A 4BAGA 3FDZA 5GTHH 2VP5A