3H32A

Crystal structure of d-dimer from human fibrin complexed with gly-his-arg-pro-tyr-amide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Two families of synthetic peptides that enhance fibrin turbidity and delay fibrinolysis by different mechanisms.
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 20
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08702 Fib_alpha Fibrinogen alpha/beta chain family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3h32A00
1RE4A 1FZCC 2A45H 1JY2N 2OYHC 1N73B 1FZCB 2FFDC 1N86A 1RF0A 1N73A 2A45I 1FZGA 1FZCA 1LT9A 1LTJC 1RF1C 1FZAA 2HLOA 2H43A 2OYIC 1RF1B 1LWUC 1FZFA 2Q9IA 2FFDA 1LT9B 1JY3N 1LTJB 1LWUB 1T3UA 1FZBA 1W2EA 2HODA 3H32A 3BVHA 1N73C 1JY3O 1LTJA 1FZEA 2HODB 2XNXA 1RF1A 1JY2P 1LWUA 2FFDB 2OYIB 3H32B 3HUSB 2OYHA 3GHGC 1RE3A 1M1JA 2OYIA 2HPCA 3HUSA 1RE4C 2OYHB 2Z4EA 3E1IA 2A45G 1M1JB 1JY3P 3GHGB 2HPCB 1JY2O 1RF0C 3GHGA 1RE3C 1M1JC 1LT9C 3HUSC
chains in the Genus database with same CATH superfamily
2FYUK 3AEEC 1NTZD 4IOIH 1EZVE 2I8DA 2YNYA 4C46A 2YXRB 1KV4A 2Q7CA 2KZIA 3AEDC 2V4HA 3W68A 1KN7A 2E74C 1PP9G 1K05A 1VF5B 3R4YA 1USDA 3B5NC 4K35A 1K8AQ 5KAIE 1L0NE 2P67A 2GA1A 2Q9IA 5K5GB 1W2EA 3L73J 4ASVA 3BVHA 1WMKA 3SWKA 1Y47A 4CPGA 1HJBA 1VQ9P 4I6MC 3RK3C 1SS1A 1JY2P 2E74D 4NPFX 1SQQE 3UIAA 3CWBG 1NTKJ 1N7SC 5AW3B 2WITA 2OYHA 3RBZA 1LTSC 5KJ7A 1NWQA 1IO4A 1RE4C 1GTWA 2OYHB 1OVVA 3KXDA 3B4SA 4L73A 1VQ5P 2IBZI 1QVGO 5B66H 2KK7A 1CI6B 1FJKA 3NTNA 1NU1G 2HPCB 3MUDA 1RE3C 4OGQB 3VOPA 2IZ0A 3II6A 1NU1D 3CCQP 2QVAA 1EDLA 1RY3A 1L4AA 2RH0A 3H1KE 1HTLC 2KB7P 1WRGA 3H1JD 2HFED 2Z5IA 2K9JA 5TISE 2N1TC 1EZVI 2WPRA 2WVRA 3HRNA 2ZFCA 1JTHB 1N7SA 1IK9A 1LWUB 1L0LD 1QX8A 1R5SA 2IFNA 2O1KA 1IC2A 1S5LE 2SPZA 3AE7C 3L75E 3QH9A 4OWFA 4UB6H 3W67A 5AW7B 5AVWB 1VQNP 1BGYG 3LW5H 1NU1K 2B9BA 4ZKUA 3V2RA 1GW4A 2BASA 1VL2A 1DH3A 2ZVNB 1RE3A 1GU5A 1DEBA 3VMAA 1KFNA 3IR9A 2LKMA 3GLMA 2XDJA 3JCUH 4HJGH 1M1JB 3H1HJ 3IF4A 2FXPA 4IL6E 5APWA 5AW9B 3VP9A 3Q3DA 4TT3H 1MFTA 1GL2C 1SQVJ 2OYIC 3PRJA 2OARA 5CJ0A 4AUWA 5B5EH 4RJTA 5AVXB 1GL2D 1PL5A 2FYZA 1L0ND 5CCHA 1NOHA 1PPJE 4IFMA 3PJSK 1S9KD 2AEFA 1GK4A 2KLUA 1VQ7P 1SVFA 4IL6H 3GF7A 1FU1A 1EDKA 3RBXA 1ZRTD 4YPCA 3H1HG 2ZT9B 2P7JA 2FKWB 2ZYGA 3TGUJ 1LT9B 1T3UA 4EIJA 1NTME 2E5YA 2O01N 3VP8A 3RK2B 5GTIH 1D7MA 4DOJA 1BGYJ 2PRRA 4WWIA 3C1LA 4XE5B 3A0HH 3HD7A 3U1AA 4QMAA 3GF3A 3H32B 3HD7B 5GTHH 2CPSA 3CL3D 4GOFA 5CHXA 3EFGA 3WUTA 3HE5A 1S9KE 4D6TD 2Z4EA 5TISH 1YI2P 3G71P 1KYOE 2R5DA 5M1BA 3TF5A 3BRVB 3H1KG 2W6AA 3G4SP 2W6JH 2Y0EA 1QLED 2XU6A 1Q7YQ 5KJ7C 1PGJA 2P2UA 1M8OB 1RE4A 1X8YA 3HTKB 4U7JA 4Y28J 1SQBE 2LXBA 3IFMA 3HTKA 5KJ7D 4C7NB 1N86A 3MUDC 1KMIZ 3O6QB 3R2PA 1EXJA 1IFIA 3O6QA 4TLFA 3V4WA 2R5BA 3BCCD 1SQBK 2OGUA 3AE1C 3HD7C 2N9YB 1MFZA 1SQXG 1OXZA 2Z5HA 3P32A 1JY3N 1L4AC 4YXDC 1G1IA 3A0BH 3BCCG 1VQOP 3B5NB 1OX3A 2Q1KA 3CXHD 1S5LH 5KKZC 3A5TA 1AFOA 2N1TA 1VPCA 2KS1A 3O8ZA 1FJPA 2YO3A 4K3AA 2OYIB 3RGUA 3BRTB 3RK3B 3H25A 2JWDA 1PZQA 3HD7D 3WMM0 3N7NA 3H1IE 3OA7A 3V6IA 1OZHA 1NTKD 3RL0g 1OMIA 4ZMDA 3V2PA 2E75C 2KLVA 1L0LK 3NXSA 5E79H 1GU4A 1DIPA 3AE4C 3SWFA 1NHLA 2P10A 4EOTA 1KB9D 1GL2A 1S3JA 1IFNA 2A45I 2B87B 2M0BA 2CPBA 3L36A 3M06A 1RF1C 1GL2B 1K04A 4MN4C 3EWKA 1K73Q 3JC22 2YKOA 5L8RJ 1CZQA 1E5WA 1PFIA 1ZP0C 1BGYD 1FDIA 2Y9YA 4EDFA 4L76A 5KLVE 1OFCX 2FXMA 1L0LG 2IPPA 3M91A 3FXDA 1W2BO 2FFDB 3L70J 2C9NY 3FWNA 3A7OA 1SP4A 5EFWB 3SFDC 2P58A 3OAKA 3TGUD 2WT7B 1JY3P 2B89A 2WSFJ 3CCSP 2B88A 2QRXA 1ZLLA 1P84I 3BCCJ 2WSCH 1T2KC 2D2CD 3CCVP 1LT9C 1OW7A 5KAIH 1EDIA 1KB9I 5E79E 1JY2N 3CWBE 5H2FH 2XKMA 5AVZB 2D2CC 2O3JA 2BCCG 3H1HD 2K9JB 4LC1A 1VQPP 5AVYB 3PLNA 3MTUE 3H1LE 4HKZH 3L37A 2YIUC 3AEBC 3FGAD 2FBWC 3PHLA 3CWBD 2LXCB 1N2DC 1LTJB 2V7QH 4OGQD 4AYCA 4C7RA 3H1IG 1LTJA 3IN6A 4BRYA 1EZVG 2G3AA 2W6BA 1YBKA 1NYHA 2PGDA 2CK3H 3TGUE 1M1JA 4WY4B 4AQRD 3D6ZA 3AEGC 2E74B 2KUBA 1P84D 3V4QA 1N8RQ 1K9MQ 1J1DB 1P84H 1BCCJ 1NTZG 2NPSC 1NU1J 1RF0C 2NRGA 2R3CA 3H1JJ 3E1RA 2KXPB 1SQBG 1LTAC 4PV1B 1KQFB 4BWNA 1SQPD 3I55P 4RO0A 2BCCJ 3GW6A 1H89A 1LTJC 3KPEA 2PAJA 1FZAA 1SQVD 4PD4I 3S4RA 1BDCA 5AW1B 2KSEA 2KIKA 2FYNC 1NTMJ 3S1KA 2O01H 1IZNB 5CMZA 2E76D 4PJ0E 3CCRP 1N7SD 3H6PA 1OVRA 1W5CE 2W90A 3TSIA 1RF1A 1JUNA 2RMZA 3B71A 4H13D 1AVOA 2WSEJ 5DJTB 1SQVE 1L4AD 2QJPB 1HBWA 2FXOA 2KSJA 2I1JA 3AEAC 1Y8AA 3HUSA 5APYA 3KHUA 5APUA 3S9OA 1AA0A 2M8RA 2NZ2A 1FBMA 1EXIA 3AEFC 3B8EB 2ZVOB 1EQ7A 1H0TB 1NTMG 2JEEA 4JYBA 1NAFA 2FYUE 2BCCD 1IFJA 1XTCC 2KOGA 2Q3EA 1SQQJ 2Y9ZA 1GD2E 1OWAA 2A06E 2FFDC 3HE4A 1SQPG 2DW3A 2FYNB 1LT9A 4I1LA 1WT6A 5AVUB 3HE4B 4EYYQ 1Q81Q 1NKNA 5KLIB 1KQLA 2KNCA 1NKZB 5H2FE 1YQ4C 2H8PD 2XNDH 1LTTC 5BU5A 1Q86Q 1ZR2A 3L72D 1EDJA 3CXHE 3CX5E 3H32A 1X22A 1LTGC 3L74J 5AVQB 1FOSE 2QJPC 4PD4E 1CW5A 1FS0E 1DD3A 4N3YB 3GMAA 5DJUB 1H8AA 4O9BA 3ITKA 4LLHA 1HVVA 1URQD 1JMMA 3RL0C 1AQ5A 5CBNA 3GHGC 1T6AA 2KZJA 1J2JB 4WVZA 3P8MC 1QL1A 3BASA 1A02F 1AV1A 1NO4A 1OW8A 5APVA 5AW6B 4GT1A 4ASWA 1SQBD 3ABVC 4Y99B 1QL2A 1L2PA 1JY2O 1T8ZA 2E75B 2JKVA 2R44A 4WBAA 1M1JC 5AW0B 5AW4B 4I7ZB 1BDDA 3U59A 4C7NA 3T97B 1KQSO 1L0NK 4L74A 2WMMA 2NPSB 3T97A 2B87A 3V5BA 1J1DC 1SQPJ 1RF0A 1MZ9A 2IFMA 2JP3A 2NPSA 3E7KA 5KAFE 3VN0A 4HB1A 5CCHD 1VQ8P 4U3FE 4WY4C 3LIEA 5AW8B 1L4AB 2WTYA 1FZFA 2N1TB 1YJNP 1SQXJ 1IFPA 4JQ0D 4H44B 4YTPC 1YYCA 1EZVD 3TK1A 1T2KD 3H1IJ 1FZEA 2GUVA 2YMKA 2HODB 3KZIE 1JTHA 1N7SB 1KB9H 1ZN5A 2E76B 2HR3A 2O1JA 1GW3A 1GDTA 1U7MA 2UWJE 3VTPC 3L70E 5C39A 2WT7A 2FYUG 2PFXA 1SQVK 3G6EP 3EQ2A 1G2CB 3CXHI 2QEXP 1KB9E 1PP9J 2A45G 4A7PA 5APQA 1NVOA 2M5AB 1R8EA 4OGQC 2RN0A 3CMEP 3TGUG 2WZ7A 3PP5A 1FDMA 3CX5H 3HUSC 3QWOC 1L0LE 4R4MA 4ZNCA 1JCDA 4H44D 3L71E 2WSFH 4N78E 3RK2C 3TNUB 2ZXXA 1YHQP 2XV5A 1Q82Q 1BE3D 2H88C 3TNUA 2FYUJ 4H44C 3H1JE 3CC7P 4WB4A 1BE3E 1KILE 3AE9C 2YKPA 3H1LJ 2QM7A 2NPSD 3CLQA 4Z1MH 1YJWP 1VQKP 2ZT9C 1SQVG 3LIDA 2FFDA 2BCCE 3KQGA 3M9HA 1H88A 1FZCC 1HWTC 2XNXA 1FE6A 1HGZA 1PIXA 3U1CA 3Q1MA 2OTLP 3NMDA 3CCEP 1RH5B 2WWWA 4I7ZC 1SFCD 2JDIH 3VYIA 2HPCA 1MV8A 2AEJA 4IFFA 5GTHE 2OQQA 4LGDE 2R32A 2KP8A 3AECC 3A0HE 1URQB 1NTKK 1RHZB 1SQQD 1LTIC 1NU1E 3L71D 3L73G 1M7LA 4JPZB 1URQA 1BCCE 1J1EC 3GHGA 5GTIE 3FX0A 1VQMP 1YIJP 2W8ZA 4EI2A 1YJ9P 1IFMA 4IL6X 1VQ6P 2A45H 2D2CB 2QSIA 1NTZK 5KLVG 2K88A 4GKGA 1FZCB 1M90Q 4GOEA 4H0LC 3WU2H 3G9RA 4DT0A 1FZCA 3P8CD 1FC2C 3RL0B 1E79H 2PP6A 2W83C 1SFCB 2I1KA 2ZYAA 3GG2A 4RESB 1BSNA 1LWUC 2K1AA 5B5EE 4BRYB 3M9QA 1SQPE 3ZDMA 1G1JA 4HYTB 4KT0J 1PGQA 2QJYB 2KI7B 5KLIC 4U3FJ 2OTKE 4WY4A 5KKZB 3Q5PA 3IAOA 1HUCA 3D70A 4GODA 1IK7A 1LJ2A 2IX7C 3HUSB 1MUUA 3JCUE 4N6JA 3D6YA 3P8CE 1PPJD 1PGPA 1S4XA 3H1LG 3EFFK 2GUSA 4H13B 3M0DC 1OW6A 1UIXA 2ZYDA 4ZKPA 4GDOA 1JMBA 3CX5D 4YXWH 1BE3G 2IYOA 4XFJA 2FY8A 5KLVJ 1X0TA 3CD6P 3V2QA 1R5LA 2E76C 3L75D 2IBZG 2JJLA 4BXLA 2J58A 1BSHA 1YQ3C 2KNCB 2C0XA 2Y0CA 3H1HE 2A06D 2RKLA 2WPSA 1X79B 4L75A 3CI9A 2ZXEB 3H1KJ 1SQQK 4PV1D 2A06G 1JNMA 1OVUA 3VMXA 1QEXA 2YKQA 4U3FG 2ZAEB 4D6TJ 3KZIH 2BEZF 3B5ND 3HE5B 3Q2YA 3CWBJ 3CCUP 4PV1C 1Y9BA 2OTJP 3G3ZA 3L70G 1KZUB 3CC4P 1U57A 1HH0A 1S5LX 3KDPB 3H1KD 1XTGB 4HH2A 4WY4D 3M0AA 1JM0A 1NAYA 3CCJP 3Q5RA 2ITAA 4OH8B 3WUVA 1N7LA 4GIFA 1ZOYC 5KLVD 1JB0J 3Q5SA 3M9BA 5AW2B 1JEKA 4D6TG 2E75D 1RQVA 1BGYE 1DEEG 1CI6A 5BVZA 2L5GB 1VQ4P 4NPEA 2AXTH 2YMYA 1URQC 5AVSB 2M3EA 2WSCJ 3MD0A 3RL0D 1VQLP 1CSBA 1J1EB 1KFMA 1YTZI 1ZXGA 3I56P 2IBZD 1SQXE 5APSA 4DCKA 4DJGA 2IZ1A 3MZWB 1UIIA 1Z56A 2HODA 3C9IA 5CCGD 3H1JG 4JBZA 3KYQA 1SQPK 1AVYA 4W80A 1KORA 3RK2D 1SQBJ 3CPWO 1NGMB 3VMZA 1LWUA 2K9YA 2WPQA 2J5UA 5APTA 1PPJG 3A0BE 2V7QJ 2Y0DA 4U3FD 3CX5I 3CCMP 1NTKE 2ZT9D 4XA4A 3SWYA 1NJIQ 1KC8Q 5KAFH 2QA4P 2H7HA 3L73D 1Q90D 4I2LC 2YO2A 3A3YB 3L75J 4M3LA 5APXA 3USSA 1HF9A 4KHXA 2AXTE 2W27A 2WPVB 4OVNF 1NTZE 4B86A 3D71A 1FZGA 4KJMA 3L4FA 1ZR4A 2WSSH 5AVTB 1VF5C 2J59M 2Q5UA 3AE5C 3L71J 3M0DA 1YITP 2N9BA 1AJYA 2P1JA 3L74E 3SSUA 1IFDA 2H43A 2C9LY 2L91A 3VMYA 1USEA 2QG4A 3LW5J 1L0NG 2KYVA 2MKVA 3AE3C 4PD4D 1DX7A 2GM4A 1N73C 1GK6A 1JY3O 3FWLA 3CXHH 2AEMA 1DD4A 3L72E 3PTZA 2H89C 1G2CA 1AQTA 1KYOH 1NH4A 1KYOD 1SQQG 1FDOA 2M5AA 1EC5A 3H1LD 1KILC 1LNQA 1M57D 3JSVC 2JWAA 4D6TE 3P7KA 1KTMA 1Q2NA 3E1IA 3RK3D 3F89A 1OIPA 5CJ4A 4PD4H 1JO5A 3WUUA 2WSEH 3GHGB 1VDFA 4JF7A 5CCGC 1KD1Q 2FYUD 2LR2A 2QJKC 4UB8E 3SFEC 5CBOA 2E42A 1BE3J 1IJDB 2N1TD 4RKUJ 1NTMD 1A02J 1H0TA 5AW5B 2XZRA 1N73B 5BU8B 2IBZE 3TDKA 1PV3A 1ZRTE 1SFCA 1FAVA 2R3SA 3L73E 2QM8A 1N73A 2YIUB 3AE6C 2VRSA 3F5HA 3L75G 3CC2P 1TU3F 2C0WA 2M3BA 1HJ0A 2OYOA 1PP9D 1BCCG 1NTZJ 2MJZA 2ZJSE 4W7YA 3V2NA 3CMAP 2OYHC 2JR8A 2K3RA 4UB8H 1X9VA 2BEQD 3NFQA 1S72P 1PP9E 1BCCD 1KYOI 3K5BA 4UB6E 1S2EA 4NPDA 1SQXD 4IFDK 3L71G 3FXEA 2QIWA 2IDBA 3AE8C 5CCGA 1ZV8A 3C8VA 5TJHA 1LP1A 1ZW0A 1JOCA 3H1ID 2KS1B 3N4XA 1MKMA 1VF5D 2K37A 4R4LA 1LP1B 3AE2C 3L35A 2POHA 3WU2E 1L0NJ 1U7JA 4W7ZA 2WQYC 3PH0A 1LGHB 4PJ0H 1SFCC 3L74G 1S1CX 3I5CA 4H13C 2Q6QA 2AXCA 1KQGB 4H0LB 2G8YA 2IYPA 1P84E 3RK3E 1KILD 1SQXK 1M56D 2JO1A 2O01J 2QJYC 3BCCE 3L72G 3MGNA 1FOSF 3CCLP 1QGKB 1JCCA 2HLOA 1RF1B 2E5TA 3TYYA 5KLVK 1M1KQ 1HGVA 4N78D 2E43A 1FZBA 1ZMEC 4DZOA 2YXQB 1GMJA 3OJAB 3B5NA 1L0LJ 1QVFO 5B66E 1T3JA 1NTMK 2Q3IA 2QJKB 2HG5D 1NTKG 1LTBC 5AVRB 3MIWA 1GZLA 1PGOA 3L74D 2OYIA 3L72J 3OW2O 3L70D 2QE7H 3MHVA 2HYNA 4JYCA 1RQUA 5CCHC 5AVVB 1KILB 3MP7B 5KTBA 3BATA 3A2AA 1SLQA 1KILA 4Y99C 4H0LD 1YTZT 1LT1A
chains in the Genus database with same CATH topology
2FYUK 2YNYA 4C46A 2Q7CA 3B5NC 2P67A 2Q9IA 1W2EA 3BVHA 1HJBA 4I6MC 3RK3C 1JY2P 3UIAA 1N7SC 5AW3B 2WITA 2OYHA 1LTSC 5KJ7A 1NWQA 1IO4A 1RE4C 1GTWA 2OYHB 2HPCB 1CI6B 1FJKA 3NTNA 3MUDA 1RE3C 3VOPA 3II6A 1RY3A 1L4AA 1HTLC 2KB7P 1WRGA 2HFED 2Z5IA 2N1TC 2WPRA 3HRNA 2ZFCA 1JTHB 1N7SA 1IK9A 1LWUB 2IFNA 2O1KA 1IC2A 5AW7B 5AVWB 3LW5H 1NU1K 4ZKUA 3V2RA 1GW4A 2BASA 1DH3A 1RE3A 1GU5A 1DEBA 1KFNA 3IR9A 2LKMA 5AW8B 2XDJA 2GM4A 1M1JB 5APWA 3VP9A 5AW9B 1GL2C 2OYIC 2OARA 5CJ0A 4AUWA 5CCHA 5AVXB 1GL2D 2FYZA 1NOHA 4IFMA 1S9KD 1GK4A 1SVFA 1FU1A 2P7JA 2FKWB 1LT9B 1T3UA 4EIJA 3VP8A 3RK2B 4DOJA 4XE5B 3HD7A 3U1AA 3H32B 3HD7B 2CPSA 3CL3D 5CHXA 1S9KE 3EFGA 3HE5A 2Z4EA 2R5DA 3BRVB 2W6AA 2XU6A 5KJ7C 2P2UA 1RE4A 1X8YA 3HTKB 3IFMA 3HTKA 5KJ7D 4C7NB 1N86A 3R2PA 1IFIA 3V4WA 2R5BA 1SQBK 3HD7C 1MFZA 3P32A 1OXZA 2Z5HA 1JY3N 1L4AC 1G1IA 3B5NB 1AFOA 3A5TA 2N1TA 1VPCA 1FJPA 3O8ZA 2YO3A 2OYIB 3BRTB 3RK3B 3HD7D 3WMM0 3N7NA 3OA7A 3V2PA 2KLVA 1L0LK 3NXSA 1GU4A 3SWFA 1NHLA 4EOTA 1GL2A 3L36A 1IFNA 2A45I 3M06A 2CPBA 1RF1C 1GL2B 1CZQA 1E5WA 1PFIA 2FXMA 2IPPA 3M91A 2FFDB 2C9NY 3A7OA 1SP4A 3OAKA 2WT7B 1JY3P 1ZLLA 2WSCH 1T2KC 1LT9C 1JY2N 2XKMA 5AVZB 4LC1A 5AVYB 3MTUE 3L37A 1N2DC 1LTJB 4AYCA 4C7RA 1LTJA 2W6BA 1M1JA 4WY4B 4AQRD 3V4QA 1J1DB 2NPSC 1RF0C 2R3CA 1LTAC 1H89A 1LTJC 3KPEA 2PAJA 1FZAA 5AW1B 2O01H 5CMZA 1N7SD 3H6PA 3TSIA 1JUNA 1RF1A 1L4AD 1HBWA 2KSJA 2I1JA 3HUSA 3V2NA 5APUA 5APYA 2M8RA 1FBMA 3B8EB 1EQ7A 2JEEA 4JYBA 1NAFA 1IFJA 1XTCC 2KOGA 1GD2E 1OWAA 2FFDC 3HE4A 1LT9A 4I1LA 1WT6A 5AVUB 3HE4B 1NKNA 1KQLA 1NKZB 2H8PD 5BU5A 1LTTC 1ZR2A 3H32A 1FOSE 1LTGC 5AVQB 1CW5A 4N3YB 1H8AA 4O9BA 4LLHA 1AQ5A 1HVVA 1URQD 1JMMA 3RL0C 3GHGC 1J2JB 1A02F 3P8MC 1QL1A 3BASA 1NO4A 5APVA 5AW6B 4GT1A 4Y99B 1QL2A 1T8ZA 1JY2O 4WBAA 3U59A 1M1JC 5AW0B 5AW4B 4C7NA 1L0NK 2NPSB 3T97A 3V5BA 1J1DC 2NPSA 1RF0A 1MZ9A 2IFMA 5CCHD 3VN0A 4WY4C 3LIEA 1L4AB 2WTYA 1FZFA 2N1TB 1T2KD 1YYCA 3TK1A 1FZEA 2GUVA 2HODB 1JTHA 1N7SB 1ZN5A 2O1JA 1GW3A 1GDTA 3VTPC 2WT7A 1SQVK 3EQ2A 1G2CB 2A45G 5APQA 2WZ7A 3PP5A 1FDMA 3HUSC 1JCDA 4N78E 3RK2C 2WSFH 3TNUB 2XV5A 3TNUA 4WB4A 2YKPA 2QM7A 2NPSD 3CLQA 3LIDA 2FFDA 1HWTC 3KQGA 1H88A 3M9HA 1FZCC 2XNXA 1HGZA 3U1CA 3NMDA 2WWWA 3VYIA 1SFCD 2HPCA 1MV8A 4IFFA 4LGDE 2R32A 2KP8A 1URQB 1NTKK 1LTIC 1M7LA 1URQA 1J1EC 3GHGA 1IFMA 2A45H 1NTZK 4GKGA 1FZCB 1FZCA 3P8CD 3RL0B 2PP6A 1SFCB 2I1KA 4RESB 1LWUC 3M9QA 1G1JA 4HYTB 4WY4A 1HUCA 2IX7C 3HUSB 1MUUA 4N6JA 3P8CE 2GUSA 3M0DC 4ZKPA 3V2QA 2JJLA 2J58A 2C0XA 2WPSA 1X79B 3CI9A 2ZXEB 1SQQK 1JNMA 3VMXA 2YKQA 3B5ND 3HE5B 3G3ZA 1KZUB 1HH0A 3KDPB 4WY4D 1XTGB 4HH2A 3M0AA 4OH8B 1N7LA 4GIFA 3M9BA 5AW2B 5BVZA 1CI6A 2L5GB 2YMYA 1URQC 5AVSB 3RL0D 3MD0A 1CSBA 1J1EB 1KFMA 1YTZI 5APSA 1Z56A 2HODA 3C9IA 5CCGD 3KYQA 1SQPK 4W80A 3RK2D 3VMZA 1LWUA 2WPQA 5APTA 4XA4A 3SWYA 2H7HA 4M3LA 4I2LC 2YO2A 3A3YB 5APXA 4KHXA 2W27A 4B86A 1FZGA 3L4FA 1ZR4A 5AVTB 2J59M 2Q5UA 3M0DA 2N9BA 2P1JA 1IFDA 2H43A 2C9LY 3VMYA 1YTZT 2KYVA 1DX7A 1N73C 1GK6A 1JY3O 1G2CA 1NH4A 1KILC 3P7KA 3E1IA 3RK3D 5CJ4A 1JO5A 2WSEH 3GHGB 1VDFA 4JF7A 5CCGC 2E42A 1IJDB 2N1TD 1A02J 5AW5B 2XZRA 1N73B 5BU8B 1SFCA 1FAVA 1N73A 2QM8A 2VRSA 2C0WA 2M3BA 2MJZA 4W7YA 2OYHC 1X9VA 3NFQA 4IFDK 5CCGA 1ZV8A 1JOCA 3N4XA 3L35A 2POHA 4W7ZA 1LGHB 1SFCC 3I5CA 1KILD 1SQXK 3MGNA 1FOSF 2HLOA 1JCCA 1RF1B 3TYYA 5KLVK 1HGVA 4N78D 2E43A 1FZBA 4DZOA 3OJAB 3B5NA 1T3JA 1NTMK 2Q3IA 2HG5D 1LTBC 5AVRB 3MIWA 1GZLA 2OYIA 2HYNA 4JYCA 5CCHC 5AVVB 1KILB 5KTBA 3BATA 3A2AA 1SLQA 1KILA 4Y99C 2YKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RE4 A;  1FZC C;  2A45 H;  1JY2 N;  2OYH C;  1N73 B;  1FZC B;  2FFD C;  1N86 A;  1RF0 A;  1N73 A;  2A45 I;  1FZG A;  1FZC A;  1LT9 A;  1LTJ C;  1RF1 C;  1FZA A;  2HLO A;  2H43 A;  2OYI C;  1RF1 B;  1LWU C;  1FZF A;  2Q9I A;  2FFD A;  1LT9 B;  1JY3 N;  1LTJ B;  1LWU B;  1T3U A;  1FZB A;  1W2E A;  2HOD A;  3H32 A;  3BVH A;  1N73 C;  1JY3 O;  1LTJ A;  1FZE A;  2HOD B;  2XNX A;  1RF1 A;  1JY2 P;  1LWU A;  2FFD B;  2OYI B;  3H32 B;  3HUS B;  2OYH A;  3GHG C;  1RE3 A;  1M1J A;  2OYI A;  2HPC A;  3HUS A;  1RE4 C;  2OYH B;  2Z4E A;  3E1I A;  2A45 G;  1M1J B;  1JY3 P;  3GHG B;  2HPC B;  1JY2 O;  1RF0 C;  3GHG A;  1RE3 C;  1M1J C;  1LT9 C;  3HUS C; 
#chains in the Genus database with same CATH topology
 2FYU K;  3AEE C;  1NTZ D;  4IOI H;  1EZV E;  2I8D A;  2YNY A;  4C46 A;  2YXR B;  1KV4 A;  2Q7C A;  2KZI A;  3AED C;  2V4H A;  3W68 A;  1KN7 A;  2E74 C;  1PP9 G;  1K05 A;  1VF5 B;  3R4Y A;  1USD A;  3B5N C;  4K35 A;  1K8A Q;  5KAI E;  1L0N E;  2P67 A;  2GA1 A;  2Q9I A;  5K5G B;  1W2E A;  3L73 J;  4ASV A;  3BVH A;  1WMK A;  3SWK A;  1Y47 A;  4CPG A;  1HJB A;  1VQ9 P;  4I6M C;  3RK3 C;  1SS1 A;  1JY2 P;  2E74 D;  4NPF X;  1SQQ E;  3UIA A;  3CWB G;  1NTK J;  1N7S C;  5AW3 B;  2WIT A;  2OYH A;  3RBZ A;  1LTS C;  5KJ7 A;  1NWQ A;  1IO4 A;  1RE4 C;  1GTW A;  2OYH B;  1OVV A;  3KXD A;  3B4S A;  4L73 A;  1VQ5 P;  2IBZ I;  1QVG O;  5B66 H;  2KK7 A;  1CI6 B;  1FJK A;  3NTN A;  1NU1 G;  2HPC B;  3MUD A;  1RE3 C;  4OGQ B;  3VOP A;  2IZ0 A;  3II6 A;  1NU1 D;  3CCQ P;  2QVA A;  1EDL A;  1RY3 A;  1L4A A;  2RH0 A;  3H1K E;  1HTL C;  2KB7 P;  1WRG A;  3H1J D;  2HFE D;  2Z5I A;  2K9J A;  5TIS E;  2N1T C;  1EZV I;  2WPR A;  2WVR A;  3HRN A;  2ZFC A;  1JTH B;  1N7S A;  1IK9 A;  1LWU B;  1L0L D;  1QX8 A;  1R5S A;  2IFN A;  2O1K A;  1IC2 A;  1S5L E;  2SPZ A;  3AE7 C;  3L75 E;  3QH9 A;  4OWF A;  4UB6 H;  3W67 A;  5AW7 B;  5AVW B;  1VQN P;  1BGY G;  3LW5 H;  1NU1 K;  2B9B A;  4ZKU A;  3V2R A;  1GW4 A;  2BAS A;  1VL2 A;  1DH3 A;  2ZVN B;  1RE3 A;  1GU5 A;  1DEB A;  3VMA A;  1KFN A;  3IR9 A;  2LKM A;  3GLM A;  2XDJ A;  3JCU H;  4HJG H;  1M1J B;  3H1H J;  3IF4 A;  2FXP A;  4IL6 E;  5APW A;  5AW9 B;  3VP9 A;  3Q3D A;  4TT3 H;  1MFT A;  1GL2 C;  1SQV J;  2OYI C;  3PRJ A;  2OAR A;  5CJ0 A;  4AUW A;  5B5E H;  4RJT A;  5AVX B;  1GL2 D;  1PL5 A;  2FYZ A;  1L0N D;  5CCH A;  1NOH A;  1PPJ E;  4IFM A;  3PJS K;  1S9K D;  2AEF A;  1GK4 A;  2KLU A;  1VQ7 P;  1SVF A;  4IL6 H;  3GF7 A;  1FU1 A;  1EDK A;  3RBX A;  1ZRT D;  4YPC A;  3H1H G;  2ZT9 B;  2P7J A;  2FKW B;  2ZYG A;  3TGU J;  1LT9 B;  1T3U A;  4EIJ A;  1NTM E;  2E5Y A;  2O01 N;  3VP8 A;  3RK2 B;  5GTI H;  1D7M A;  4DOJ A;  1BGY J;  2PRR A;  4WWI A;  3C1L A;  4XE5 B;  3A0H H;  3HD7 A;  3U1A A;  4QMA A;  3GF3 A;  3H32 B;  3HD7 B;  5GTH H;  2CPS A;  3CL3 D;  4GOF A;  5CHX A;  3EFG A;  3WUT A;  3HE5 A;  1S9K E;  4D6T D;  2Z4E A;  5TIS H;  1YI2 P;  3G71 P;  1KYO E;  2R5D A;  5M1B A;  3TF5 A;  3BRV B;  3H1K G;  2W6A A;  3G4S P;  2W6J H;  2Y0E A;  1QLE D;  2XU6 A;  1Q7Y Q;  5KJ7 C;  1PGJ A;  2P2U A;  1M8O B;  1RE4 A;  1X8Y A;  3HTK B;  4U7J A;  4Y28 J;  1SQB E;  2LXB A;  3IFM A;  3HTK A;  5KJ7 D;  4C7N B;  1N86 A;  3MUD C;  1KMI Z;  3O6Q B;  3R2P A;  1EXJ A;  1IFI A;  3O6Q A;  4TLF A;  3V4W A;  2R5B A;  3BCC D;  1SQB K;  2OGU A;  3AE1 C;  3HD7 C;  2N9Y B;  1MFZ A;  1SQX G;  1OXZ A;  2Z5H A;  3P32 A;  1JY3 N;  1L4A C;  4YXD C;  1G1I A;  3A0B H;  3BCC G;  1VQO P;  3B5N B;  1OX3 A;  2Q1K A;  3CXH D;  1S5L H;  5KKZ C;  3A5T A;  1AFO A;  2N1T A;  1VPC A;  2KS1 A;  3O8Z A;  1FJP A;  2YO3 A;  4K3A A;  2OYI B;  3RGU A;  3BRT B;  3RK3 B;  3H25 A;  2JWD A;  1PZQ A;  3HD7 D;  3WMM 0;  3N7N A;  3H1I E;  3OA7 A;  3V6I A;  1OZH A;  1NTK D;  3RL0 g;  1OMI A;  4ZMD A;  3V2P A;  2E75 C;  2KLV A;  1L0L K;  3NXS A;  5E79 H;  1GU4 A;  1DIP A;  3AE4 C;  3SWF A;  1NHL A;  2P10 A;  4EOT A;  1KB9 D;  1GL2 A;  1S3J A;  1IFN A;  2A45 I;  2B87 B;  2M0B A;  2CPB A;  3L36 A;  3M06 A;  1RF1 C;  1GL2 B;  1K04 A;  4MN4 C;  3EWK A;  1K73 Q;  3JC2 2;  2YKO A;  5L8R J;  1CZQ A;  1E5W A;  1PFI A;  1ZP0 C;  1BGY D;  1FDI A;  2Y9Y A;  4EDF A;  4L76 A;  5KLV E;  1OFC X;  2FXM A;  1L0L G;  2IPP A;  3M91 A;  3FXD A;  1W2B O;  2FFD B;  3L70 J;  2C9N Y;  3FWN A;  3A7O A;  1SP4 A;  5EFW B;  3SFD C;  2P58 A;  3OAK A;  3TGU D;  2WT7 B;  1JY3 P;  2B89 A;  2WSF J;  3CCS P;  2B88 A;  2QRX A;  1ZLL A;  1P84 I;  3BCC J;  2WSC H;  1T2K C;  2D2C D;  3CCV P;  1LT9 C;  1OW7 A;  5KAI H;  1EDI A;  1KB9 I;  5E79 E;  1JY2 N;  3CWB E;  5H2F H;  2XKM A;  5AVZ B;  2D2C C;  2O3J A;  2BCC G;  3H1H D;  2K9J B;  4LC1 A;  1VQP P;  5AVY B;  3PLN A;  3MTU E;  3H1L E;  4HKZ H;  3L37 A;  2YIU C;  3AEB C;  3FGA D;  2FBW C;  3PHL A;  3CWB D;  2LXC B;  1N2D C;  1LTJ B;  2V7Q H;  4OGQ D;  4AYC A;  4C7R A;  3H1I G;  1LTJ A;  3IN6 A;  4BRY A;  1EZV G;  2G3A A;  2W6B A;  1YBK A;  1NYH A;  2PGD A;  2CK3 H;  3TGU E;  1M1J A;  4WY4 B;  4AQR D;  3D6Z A;  3AEG C;  2E74 B;  2KUB A;  1P84 D;  3V4Q A;  1N8R Q;  1K9M Q;  1J1D B;  1P84 H;  1BCC J;  1NTZ G;  2NPS C;  1NU1 J;  1RF0 C;  2NRG A;  2R3C A;  3H1J J;  3E1R A;  2KXP B;  1SQB G;  1LTA C;  4PV1 B;  1KQF B;  4BWN A;  1SQP D;  3I55 P;  4RO0 A;  2BCC J;  3GW6 A;  1H89 A;  1LTJ C;  3KPE A;  2PAJ A;  1FZA A;  1SQV D;  4PD4 I;  3S4R A;  1BDC A;  5AW1 B;  2KSE A;  2KIK A;  2FYN C;  1NTM J;  3S1K A;  2O01 H;  1IZN B;  5CMZ A;  2E76 D;  4PJ0 E;  3CCR P;  1N7S D;  3H6P A;  1OVR A;  1W5C E;  2W90 A;  3TSI A;  1RF1 A;  1JUN A;  2RMZ A;  3B71 A;  4H13 D;  1AVO A;  2WSE J;  5DJT B;  1SQV E;  1L4A D;  2QJP B;  1HBW A;  2FXO A;  2KSJ A;  2I1J A;  3AEA C;  1Y8A A;  3HUS A;  5APY A;  3KHU A;  5APU A;  3S9O A;  1AA0 A;  2M8R A;  2NZ2 A;  1FBM A;  1EXI A;  3AEF C;  3B8E B;  2ZVO B;  1EQ7 A;  1H0T B;  1NTM G;  2JEE A;  4JYB A;  1NAF A;  2FYU E;  2BCC D;  1IFJ A;  1XTC C;  2KOG A;  2Q3E A;  1SQQ J;  2Y9Z A;  1GD2 E;  1OWA A;  2A06 E;  2FFD C;  3HE4 A;  1SQP G;  2DW3 A;  2FYN B;  1LT9 A;  4I1L A;  1WT6 A;  5AVU B;  3HE4 B;  4EYY Q;  1Q81 Q;  1NKN A;  5KLI B;  1KQL A;  2KNC A;  1NKZ B;  5H2F E;  1YQ4 C;  2H8P D;  2XND H;  1LTT C;  5BU5 A;  1Q86 Q;  1ZR2 A;  3L72 D;  1EDJ A;  3CXH E;  3CX5 E;  3H32 A;  1X22 A;  1LTG C;  3L74 J;  5AVQ B;  1FOS E;  2QJP C;  4PD4 E;  1CW5 A;  1FS0 E;  1DD3 A;  4N3Y B;  3GMA A;  5DJU B;  1H8A A;  4O9B A;  3ITK A;  4LLH A;  1HVV A;  1URQ D;  1JMM A;  3RL0 C;  1AQ5 A;  5CBN A;  3GHG C;  1T6A A;  2KZJ A;  1J2J B;  4WVZ A;  3P8M C;  1QL1 A;  3BAS A;  1A02 F;  1AV1 A;  1NO4 A;  1OW8 A;  5APV A;  5AW6 B;  4GT1 A;  4ASW A;  1SQB D;  3ABV C;  4Y99 B;  1QL2 A;  1L2P A;  1JY2 O;  1T8Z A;  2E75 B;  2JKV A;  2R44 A;  4WBA A;  1M1J C;  5AW0 B;  5AW4 B;  4I7Z B;  1BDD A;  3U59 A;  4C7N A;  3T97 B;  1KQS O;  1L0N K;  4L74 A;  2WMM A;  2NPS B;  3T97 A;  2B87 A;  3V5B A;  1J1D C;  1SQP J;  1RF0 A;  1MZ9 A;  2IFM A;  2JP3 A;  2NPS A;  3E7K A;  5KAF E;  3VN0 A;  4HB1 A;  5CCH D;  1VQ8 P;  4U3F E;  4WY4 C;  3LIE A;  5AW8 B;  1L4A B;  2WTY A;  1FZF A;  2N1T B;  1YJN P;  1SQX J;  1IFP A;  4JQ0 D;  4H44 B;  4YTP C;  1YYC A;  1EZV D;  3TK1 A;  1T2K D;  3H1I J;  1FZE A;  2GUV A;  2YMK A;  2HOD B;  3KZI E;  1JTH A;  1N7S B;  1KB9 H;  1ZN5 A;  2E76 B;  2HR3 A;  2O1J A;  1GW3 A;  1GDT A;  1U7M A;  2UWJ E;  3VTP C;  3L70 E;  5C39 A;  2WT7 A;  2FYU G;  2PFX A;  1SQV K;  3G6E P;  3EQ2 A;  1G2C B;  3CXH I;  2QEX P;  1KB9 E;  1PP9 J;  2A45 G;  4A7P A;  5APQ A;  1NVO A;  2M5A B;  1R8E A;  4OGQ C;  2RN0 A;  3CME P;  3TGU G;  2WZ7 A;  3PP5 A;  1FDM A;  3CX5 H;  3HUS C;  3QWO C;  1L0L E;  4R4M A;  4ZNC A;  1JCD A;  4H44 D;  3L71 E;  2WSF H;  4N78 E;  3RK2 C;  3TNU B;  2ZXX A;  1YHQ P;  2XV5 A;  1Q82 Q;  1BE3 D;  2H88 C;  3TNU A;  2FYU J;  4H44 C;  3H1J E;  3CC7 P;  4WB4 A;  1BE3 E;  1KIL E;  3AE9 C;  2YKP A;  3H1L J;  2QM7 A;  2NPS D;  3CLQ A;  4Z1M H;  1YJW P;  1VQK P;  2ZT9 C;  1SQV G;  3LID A;  2FFD A;  2BCC E;  3KQG A;  3M9H A;  1H88 A;  1FZC C;  1HWT C;  2XNX A;  1FE6 A;  1HGZ A;  1PIX A;  3U1C A;  3Q1M A;  2OTL P;  3NMD A;  3CCE P;  1RH5 B;  2WWW A;  4I7Z C;  1SFC D;  2JDI H;  3VYI A;  2HPC A;  1MV8 A;  2AEJ A;  4IFF A;  5GTH E;  2OQQ A;  4LGD E;  2R32 A;  2KP8 A;  3AEC C;  3A0H E;  1URQ B;  1NTK K;  1RHZ B;  1SQQ D;  1LTI C;  1NU1 E;  3L71 D;  3L73 G;  1M7L A;  4JPZ B;  1URQ A;  1BCC E;  1J1E C;  3GHG A;  5GTI E;  3FX0 A;  1VQM P;  1YIJ P;  2W8Z A;  4EI2 A;  1YJ9 P;  1IFM A;  4IL6 X;  1VQ6 P;  2A45 H;  2D2C B;  2QSI A;  1NTZ K;  5KLV G;  2K88 A;  4GKG A;  1FZC B;  1M90 Q;  4GOE A;  4H0L C;  3WU2 H;  3G9R A;  4DT0 A;  1FZC A;  3P8C D;  1FC2 C;  3RL0 B;  1E79 H;  2PP6 A;  2W83 C;  1SFC B;  2I1K A;  2ZYA A;  3GG2 A;  4RES B;  1BSN A;  1LWU C;  2K1A A;  5B5E E;  4BRY B;  3M9Q A;  1SQP E;  3ZDM A;  1G1J A;  4HYT B;  4KT0 J;  1PGQ A;  2QJY B;  2KI7 B;  5KLI C;  4U3F J;  2OTK E;  4WY4 A;  5KKZ B;  3Q5P A;  3IAO A;  1HUC A;  3D70 A;  4GOD A;  1IK7 A;  1LJ2 A;  2IX7 C;  3HUS B;  1MUU A;  3JCU E;  4N6J A;  3D6Y A;  3P8C E;  1PPJ D;  1PGP A;  1S4X A;  3H1L G;  3EFF K;  2GUS A;  4H13 B;  3M0D C;  1OW6 A;  1UIX A;  2ZYD A;  4ZKP A;  4GDO A;  1JMB A;  3CX5 D;  4YXW H;  1BE3 G;  2IYO A;  4XFJ A;  2FY8 A;  5KLV J;  1X0T A;  3CD6 P;  3V2Q A;  1R5L A;  2E76 C;  3L75 D;  2IBZ G;  2JJL A;  4BXL A;  2J58 A;  1BSH A;  1YQ3 C;  2KNC B;  2C0X A;  2Y0C A;  3H1H E;  2A06 D;  2RKL A;  2WPS A;  1X79 B;  4L75 A;  3CI9 A;  2ZXE B;  3H1K J;  1SQQ K;  4PV1 D;  2A06 G;  1JNM A;  1OVU A;  3VMX A;  1QEX A;  2YKQ A;  4U3F G;  2ZAE B;  4D6T J;  3KZI H;  2BEZ F;  3B5N D;  3HE5 B;  3Q2Y A;  3CWB J;  3CCU P;  4PV1 C;  1Y9B A;  2OTJ P;  3G3Z A;  3L70 G;  1KZU B;  3CC4 P;  1U57 A;  1HH0 A;  1S5L X;  3KDP B;  3H1K D;  1XTG B;  4HH2 A;  4WY4 D;  3M0A A;  1JM0 A;  1NAY A;  3CCJ P;  3Q5R A;  2ITA A;  4OH8 B;  3WUV A;  1N7L A;  4GIF A;  1ZOY C;  5KLV D;  1JB0 J;  3Q5S A;  3M9B A;  5AW2 B;  1JEK A;  4D6T G;  2E75 D;  1RQV A;  1BGY E;  1DEE G;  1CI6 A;  5BVZ A;  2L5G B;  1VQ4 P;  4NPE A;  2AXT H;  2YMY A;  1URQ C;  5AVS B;  2M3E A;  2WSC J;  3MD0 A;  3RL0 D;  1VQL P;  1CSB A;  1J1E B;  1KFM A;  1YTZ I;  1ZXG A;  3I56 P;  2IBZ D;  1SQX E;  5APS A;  4DCK A;  4DJG A;  2IZ1 A;  3MZW B;  1UII A;  1Z56 A;  2HOD A;  3C9I A;  5CCG D;  3H1J G;  4JBZ A;  3KYQ A;  1SQP K;  1AVY A;  4W80 A;  1KOR A;  3RK2 D;  1SQB J;  3CPW O;  1NGM B;  3VMZ A;  1LWU A;  2K9Y A;  2WPQ A;  2J5U A;  5APT A;  1PPJ G;  3A0B E;  2V7Q J;  2Y0D A;  4U3F D;  3CX5 I;  3CCM P;  1NTK E;  2ZT9 D;  4XA4 A;  3SWY A;  1NJI Q;  1KC8 Q;  5KAF H;  2QA4 P;  2H7H A;  3L73 D;  1Q90 D;  4I2L C;  2YO2 A;  3A3Y B;  3L75 J;  4M3L A;  5APX A;  3USS A;  1HF9 A;  4KHX A;  2AXT E;  2W27 A;  2WPV B;  4OVN F;  1NTZ E;  4B86 A;  3D71 A;  1FZG A;  4KJM A;  3L4F A;  1ZR4 A;  2WSS H;  5AVT B;  1VF5 C;  2J59 M;  2Q5U A;  3AE5 C;  3L71 J;  3M0D A;  1YIT P;  2N9B A;  1AJY A;  2P1J A;  3L74 E;  3SSU A;  1IFD A;  2H43 A;  2C9L Y;  2L91 A;  3VMY A;  1USE A;  2QG4 A;  3LW5 J;  1L0N G;  2KYV A;  2MKV A;  3AE3 C;  4PD4 D;  1DX7 A;  2GM4 A;  1N73 C;  1GK6 A;  1JY3 O;  3FWL A;  3CXH H;  2AEM A;  1DD4 A;  3L72 E;  3PTZ A;  2H89 C;  1G2C A;  1AQT A;  1KYO H;  1NH4 A;  1KYO D;  1SQQ G;  1FDO A;  2M5A A;  1EC5 A;  3H1L D;  1KIL C;  1LNQ A;  1M57 D;  3JSV C;  2JWA A;  4D6T E;  3P7K A;  1KTM A;  1Q2N A;  3E1I A;  3RK3 D;  3F89 A;  1OIP A;  5CJ4 A;  4PD4 H;  1JO5 A;  3WUU A;  2WSE H;  3GHG B;  1VDF A;  4JF7 A;  5CCG C;  1KD1 Q;  2FYU D;  2LR2 A;  2QJK C;  4UB8 E;  3SFE C;  5CBO A;  2E42 A;  1BE3 J;  1IJD B;  2N1T D;  4RKU J;  1NTM D;  1A02 J;  1H0T A;  5AW5 B;  2XZR A;  1N73 B;  5BU8 B;  2IBZ E;  3TDK A;  1PV3 A;  1ZRT E;  1SFC A;  1FAV A;  2R3S A;  3L73 E;  2QM8 A;  1N73 A;  2YIU B;  3AE6 C;  2VRS A;  3F5H A;  3L75 G;  3CC2 P;  1TU3 F;  2C0W A;  2M3B A;  1HJ0 A;  2OYO A;  1PP9 D;  1BCC G;  1NTZ J;  2MJZ A;  2ZJS E;  4W7Y A;  3V2N A;  3CMA P;  2OYH C;  2JR8 A;  2K3R A;  4UB8 H;  1X9V A;  2BEQ D;  3NFQ A;  1S72 P;  1PP9 E;  1BCC D;  1KYO I;  3K5B A;  4UB6 E;  1S2E A;  4NPD A;  1SQX D;  4IFD K;  3L71 G;  3FXE A;  2QIW A;  2IDB A;  3AE8 C;  5CCG A;  1ZV8 A;  3C8V A;  5TJH A;  1LP1 A;  1ZW0 A;  1JOC A;  3H1I D;  2KS1 B;  3N4X A;  1MKM A;  1VF5 D;  2K37 A;  4R4L A;  1LP1 B;  3AE2 C;  3L35 A;  2POH A;  3WU2 E;  1L0N J;  1U7J A;  4W7Z A;  2WQY C;  3PH0 A;  1LGH B;  4PJ0 H;  1SFC C;  3L74 G;  1S1C X;  3I5C A;  4H13 C;  2Q6Q A;  2AXC A;  1KQG B;  4H0L B;  2G8Y A;  2IYP A;  1P84 E;  3RK3 E;  1KIL D;  1SQX K;  1M56 D;  2JO1 A;  2O01 J;  2QJY C;  3BCC E;  3L72 G;  3MGN A;  1FOS F;  3CCL P;  1QGK B;  1JCC A;  2HLO A;  1RF1 B;  2E5T A;  3TYY A;  5KLV K;  1M1K Q;  1HGV A;  4N78 D;  2E43 A;  1FZB A;  1ZME C;  4DZO A;  2YXQ B;  1GMJ A;  3OJA B;  3B5N A;  1L0L J;  1QVF O;  5B66 E;  1T3J A;  1NTM K;  2Q3I A;  2QJK B;  2HG5 D;  1NTK G;  1LTB C;  5AVR B;  3MIW A;  1GZL A;  1PGO A;  3L74 D;  2OYI A;  3L72 J;  3OW2 O;  3L70 D;  2QE7 H;  3MHV A;  2HYN A;  4JYC A;  1RQU A;  5CCH C;  5AVV B;  1KIL B;  3MP7 B;  5KTB A;  3BAT A;  3A2A A;  1SLQ A;  1KIL A;  4Y99 C;  4H0L D;  1YTZ T;  1LT1 A; 
#chains in the Genus database with same CATH homology
 2FYU K;  2YNY A;  4C46 A;  2Q7C A;  3B5N C;  2P67 A;  2Q9I A;  1W2E A;  3BVH A;  1HJB A;  4I6M C;  3RK3 C;  1JY2 P;  3UIA A;  1N7S C;  5AW3 B;  2WIT A;  2OYH A;  1LTS C;  5KJ7 A;  1NWQ A;  1IO4 A;  1RE4 C;  1GTW A;  2OYH B;  2HPC B;  1CI6 B;  1FJK A;  3NTN A;  3MUD A;  1RE3 C;  3VOP A;  3II6 A;  1RY3 A;  1L4A A;  1HTL C;  2KB7 P;  1WRG A;  2HFE D;  2Z5I A;  2N1T C;  2WPR A;  3HRN A;  2ZFC A;  1JTH B;  1N7S A;  1IK9 A;  1LWU B;  2IFN A;  2O1K A;  1IC2 A;  5AW7 B;  5AVW B;  3LW5 H;  1NU1 K;  4ZKU A;  3V2R A;  1GW4 A;  2BAS A;  1DH3 A;  1RE3 A;  1GU5 A;  1DEB A;  1KFN A;  3IR9 A;  2LKM A;  5AW8 B;  2XDJ A;  2GM4 A;  1M1J B;  5APW A;  3VP9 A;  5AW9 B;  1GL2 C;  2OYI C;  2OAR A;  5CJ0 A;  4AUW A;  5CCH A;  5AVX B;  1GL2 D;  2FYZ A;  1NOH A;  4IFM A;  1S9K D;  1GK4 A;  1SVF A;  1FU1 A;  2P7J A;  2FKW B;  1LT9 B;  1T3U A;  4EIJ A;  3VP8 A;  3RK2 B;  4DOJ A;  4XE5 B;  3HD7 A;  3U1A A;  3H32 B;  3HD7 B;  2CPS A;  3CL3 D;  5CHX A;  1S9K E;  3EFG A;  3HE5 A;  2Z4E A;  2R5D A;  3BRV B;  2W6A A;  2XU6 A;  5KJ7 C;  2P2U A;  1RE4 A;  1X8Y A;  3HTK B;  3IFM A;  3HTK A;  5KJ7 D;  4C7N B;  1N86 A;  3R2P A;  1IFI A;  3V4W A;  2R5B A;  1SQB K;  3HD7 C;  1MFZ A;  3P32 A;  1OXZ A;  2Z5H A;  1JY3 N;  1L4A C;  1G1I A;  3B5N B;  1AFO A;  3A5T A;  2N1T A;  1VPC A;  1FJP A;  3O8Z A;  2YO3 A;  2OYI B;  3BRT B;  3RK3 B;  3HD7 D;  3WMM 0;  3N7N A;  3OA7 A;  3V2P A;  2KLV A;  1L0L K;  3NXS A;  1GU4 A;  3SWF A;  1NHL A;  4EOT A;  1GL2 A;  3L36 A;  1IFN A;  2A45 I;  3M06 A;  2CPB A;  1RF1 C;  1GL2 B;  1CZQ A;  1E5W A;  1PFI A;  2FXM A;  2IPP A;  3M91 A;  2FFD B;  2C9N Y;  3A7O A;  1SP4 A;  3OAK A;  2WT7 B;  1JY3 P;  1ZLL A;  2WSC H;  1T2K C;  1LT9 C;  1JY2 N;  2XKM A;  5AVZ B;  4LC1 A;  5AVY B;  3MTU E;  3L37 A;  1N2D C;  1LTJ B;  4AYC A;  4C7R A;  1LTJ A;  2W6B A;  1M1J A;  4WY4 B;  4AQR D;  3V4Q A;  1J1D B;  2NPS C;  1RF0 C;  2R3C A;  1LTA C;  1H89 A;  1LTJ C;  3KPE A;  2PAJ A;  1FZA A;  5AW1 B;  2O01 H;  5CMZ A;  1N7S D;  3H6P A;  3TSI A;  1JUN A;  1RF1 A;  1L4A D;  1HBW A;  2KSJ A;  2I1J A;  3HUS A;  3V2N A;  5APU A;  5APY A;  2M8R A;  1FBM A;  3B8E B;  1EQ7 A;  2JEE A;  4JYB A;  1NAF A;  1IFJ A;  1XTC C;  2KOG A;  1GD2 E;  1OWA A;  2FFD C;  3HE4 A;  1LT9 A;  4I1L A;  1WT6 A;  5AVU B;  3HE4 B;  1NKN A;  1KQL A;  1NKZ B;  2H8P D;  5BU5 A;  1LTT C;  1ZR2 A;  3H32 A;  1FOS E;  1LTG C;  5AVQ B;  1CW5 A;  4N3Y B;  1H8A A;  4O9B A;  4LLH A;  1AQ5 A;  1HVV A;  1URQ D;  1JMM A;  3RL0 C;  3GHG C;  1J2J B;  1A02 F;  3P8M C;  1QL1 A;  3BAS A;  1NO4 A;  5APV A;  5AW6 B;  4GT1 A;  4Y99 B;  1QL2 A;  1T8Z A;  1JY2 O;  4WBA A;  3U59 A;  1M1J C;  5AW0 B;  5AW4 B;  4C7N A;  1L0N K;  2NPS B;  3T97 A;  3V5B A;  1J1D C;  2NPS A;  1RF0 A;  1MZ9 A;  2IFM A;  5CCH D;  3VN0 A;  4WY4 C;  3LIE A;  1L4A B;  2WTY A;  1FZF A;  2N1T B;  1T2K D;  1YYC A;  3TK1 A;  1FZE A;  2GUV A;  2HOD B;  1JTH A;  1N7S B;  1ZN5 A;  2O1J A;  1GW3 A;  1GDT A;  3VTP C;  2WT7 A;  1SQV K;  3EQ2 A;  1G2C B;  2A45 G;  5APQ A;  2WZ7 A;  3PP5 A;  1FDM A;  3HUS C;  1JCD A;  4N78 E;  3RK2 C;  2WSF H;  3TNU B;  2XV5 A;  3TNU A;  4WB4 A;  2YKP A;  2QM7 A;  2NPS D;  3CLQ A;  3LID A;  2FFD A;  1HWT C;  3KQG A;  1H88 A;  3M9H A;  1FZC C;  2XNX A;  1HGZ A;  3U1C A;  3NMD A;  2WWW A;  3VYI A;  1SFC D;  2HPC A;  1MV8 A;  4IFF A;  4LGD E;  2R32 A;  2KP8 A;  1URQ B;  1NTK K;  1LTI C;  1M7L A;  1URQ A;  1J1E C;  3GHG A;  1IFM A;  2A45 H;  1NTZ K;  4GKG A;  1FZC B;  1FZC A;  3P8C D;  3RL0 B;  2PP6 A;  1SFC B;  2I1K A;  4RES B;  1LWU C;  3M9Q A;  1G1J A;  4HYT B;  4WY4 A;  1HUC A;  2IX7 C;  3HUS B;  1MUU A;  4N6J A;  3P8C E;  2GUS A;  3M0D C;  4ZKP A;  3V2Q A;  2JJL A;  2J58 A;  2C0X A;  2WPS A;  1X79 B;  3CI9 A;  2ZXE B;  1SQQ K;  1JNM A;  3VMX A;  2YKQ A;  3B5N D;  3HE5 B;  3G3Z A;  1KZU B;  1HH0 A;  3KDP B;  4WY4 D;  1XTG B;  4HH2 A;  3M0A A;  4OH8 B;  1N7L A;  4GIF A;  3M9B A;  5AW2 B;  5BVZ A;  1CI6 A;  2L5G B;  2YMY A;  1URQ C;  5AVS B;  3RL0 D;  3MD0 A;  1CSB A;  1J1E B;  1KFM A;  1YTZ I;  5APS A;  1Z56 A;  2HOD A;  3C9I A;  5CCG D;  3KYQ A;  1SQP K;  4W80 A;  3RK2 D;  3VMZ A;  1LWU A;  2WPQ A;  5APT A;  4XA4 A;  3SWY A;  2H7H A;  4M3L A;  4I2L C;  2YO2 A;  3A3Y B;  5APX A;  4KHX A;  2W27 A;  4B86 A;  1FZG A;  3L4F A;  1ZR4 A;  5AVT B;  2J59 M;  2Q5U A;  3M0D A;  2N9B A;  2P1J A;  1IFD A;  2H43 A;  2C9L Y;  3VMY A;  1YTZ T;  2KYV A;  1DX7 A;  1N73 C;  1GK6 A;  1JY3 O;  1G2C A;  1NH4 A;  1KIL C;  3P7K A;  3E1I A;  3RK3 D;  5CJ4 A;  1JO5 A;  2WSE H;  3GHG B;  1VDF A;  4JF7 A;  5CCG C;  2E42 A;  1IJD B;  2N1T D;  1A02 J;  5AW5 B;  2XZR A;  1N73 B;  5BU8 B;  1SFC A;  1FAV A;  1N73 A;  2QM8 A;  2VRS A;  2C0W A;  2M3B A;  2MJZ A;  4W7Y A;  2OYH C;  1X9V A;  3NFQ A;  4IFD K;  5CCG A;  1ZV8 A;  1JOC A;  3N4X A;  3L35 A;  2POH A;  4W7Z A;  1LGH B;  1SFC C;  3I5C A;  1KIL D;  1SQX K;  3MGN A;  1FOS F;  2HLO A;  1JCC A;  1RF1 B;  3TYY A;  5KLV K;  1HGV A;  4N78 D;  2E43 A;  1FZB A;  4DZO A;  3OJA B;  3B5N A;  1T3J A;  1NTM K;  2Q3I A;  2HG5 D;  1LTB C;  5AVR B;  3MIW A;  1GZL A;  2OYI A;  2HYN A;  4JYC A;  5CCH C;  5AVV B;  1KIL B;  5KTB A;  3BAT A;  3A2A A;  1SLQ A;  1KIL A;  4Y99 C;  2YKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...