3H32A

Crystal structure of d-dimer from human fibrin complexed with gly-his-arg-pro-tyr-amide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
publication title Two families of synthetic peptides that enhance fibrin turbidity and delay fibrinolysis by different mechanisms.
pubmed doi rcsb
total genus 20
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08702 Fib_alpha Fibrinogen alpha/beta chain family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3h32A00
1LTJA 1JY3O 3HUSC 1FZGA 1FZAA 2Z4EA 2FFDC 1FZCB 2HODB 1RE4A 1RF0A 3H32A 1LTJC 1N86A 2OYIA 2A45G 3GHGC 2HPCA 1FZEA 1RE4C 1RF0C 1RF1B 2OYIC 1JY3P 1W2EA 1JY2O 3GHGA 1LWUA 2H43A 2Q9IA 1N73A 1LT9B 3HUSB 2XNXA 1M1JA 2FFDB 1JY3N 1LWUC 1T3UA 3GHGB 1LTJB 1JY2P 3E1IA 1N73C 1M1JC 2HODA 2OYHA 1FZCA 3H32B 2OYIB 2OYHC 1JY2N 2A45I 2HLOA 1RF1A 2HPCB 1FZBA 3BVHA 1FZCC 2OYHB 1LT9A 1RE3A 1LWUB 1FZFA 1RF1C 2A45H 3HUSA 1N73B 1M1JB 2FFDA 1LT9C 1RE3C
chains in the Genus database with same CATH superfamily
1P84H 3P8CD 1R5SA 5KAFH 5AW5B 1FAVA 2W27A 3VMXA 1N7SA 1PGPA 2KZIA 3JC22 4WY4C 1N7LA 3LIDA 1NHLA 2FYUJ 3A3YB 2QVAA 4GDOA 1VQ9P 2YO2A 1OVUA 4JYBA 2K1AA 1LTAC 1L2PA 4GIFA 3RK3B 1JTHA 1L0LJ 3AEFC 1HWTC 1LWUC 4OGQC 1M1KQ 1RQUA 1ZR2A 1QLED 1JNMA 4BWNA 3AEBC 4WB4A 1SQXE 2ZVOB 3L75G 5AW1B 2P2UA 2IZ0A 2D2CB 1VQOP 3AE2C 2H88C 3A0HE 2ZXEB 1MKMA 1SQPG 1S1CX 5CJ0A 1U7JA 3RK3D 5M1BA 5CHXA 1T3JA 3HE4B 1LTGC 2K9JB 4GT1A 3HE5A 2A06D 4MN4C 2R3SA 3P7KA 2M5AA 2D2CD 2WSFJ 4O9BA 2E76B 2NRGA 3HD7C 1OW6A 2IBZD 5AVTB 1AVYA 1LTSC 5DJTB 3IAOA 3H32B 4YPCA 1M7LA 3AE6C 2B87A 2JJLA 3JSVC 1VQPP 4DJGA 1J2JB 1S4XA 1EZVG 2G3AA 1URQA 1J1DC 1VF5C 2O01N 4PJ0H 5KLIB 4TLFA 3I56P 3L75J 3WUUA 3ITKA 2B9BA 2E76D 5H2FH 1N8RQ 1PP9E 5CBOA 2KNCA 1KYOE 1RF1A 1DH3A 1SQPJ 5KLVD 1DX7A 2YIUC 5H2FE 4D6TG 2G8YA 3OW2O 1D7MA 3L71E 1SFCB 2E75B 4N3YB 3SSUA 2RH0A 1PFIA 1WMKA 2J58A 3M91A 5CCGD 3MUDA 2N9YB 2QG4A 2L91A 3JCUH 1ZOYC 3EQ2A 4Z1MH 3CX5D 4W7ZA 1SQXK 3EWKA 2QJPC 1NU1G 2OYOA 4PD4I 1SFCD 1EXIA 2E75D 2O1KA 1JY2P 3JCUE 3L70G 1FZCA 1S5LH 1KFMA 4RKUJ 3PJSK 1K9MQ 2YNYA 1NTMG 3R4YA 1NTKE 1QEXA 1PGOA 4H44C 1AQTA 1ZN5A 1RF0A 1S5LE 1SQVJ 4ZKUA 1VQ7P 3CXHI 3GF7A 4D6TJ 3BCCG 1M90Q 3H25A 2FYUD 1S9KD 2ZFCA 4I2LC 1FU1A 1KQGB 4IOIH 1JOCA 1JCCA 4WY4B 3TDKA 1OXZA 1IC2A 1EZVE 3WU2E 1NYHA 1L0LD 3B8EB 3AE1C 3E1IA 3T97B 2BEQD 4RO0A 2L5GB 4TT3H 1QX8A 2Q6QA 1LWUB 1NU1J 2N1TB 1HBWA 3L70J 5AVUB 2H7HA 4WY4D 2KLUA 1KTMA 1NTMJ 1YJWP 4D6TE 3RL0C 1YJ9P 2WQYC 2WT7B 3G6EP 2IFNA 2OTKE 1KYOD 5APXA 2IDBA 3L72G 3BCCJ 2N1TD 3EFGA 1NOHA 3B5NA 5K5GB 4IFDK 2JWDA 1IFNA 1SQQG 3CC4P 2IBZI 1T8ZA 1NU1E 1HH0A 1Y8AA 1KQLA 2PAJA 3HD7B 3LW5H 2IFMA 3L35A 3L75D 1NTKK 1GK6A 3PHLA 1J1DB 1IO4A 3H1IG 1VF5B 1NGMB 2QIWA 2HLOA 2KB7P 1VQNP 1SQPD 1K73Q 1H0TA 3G4SP 3HD7D 3GHGA 1FDIA 3H1HG 1RE4C 2Z5HA 2YIUB 2ZT9C 1N73A 2PP6A 3OAKA 4H0LB 1FDOA 1BGYG 3L72J 1USEA 1VF5D 4EYYQ 3VP9A 1SQQJ 3KDPB 1IFPA 1KQFB 1PL5A 1KV4A 1JMBA 1H88A 1Y47A 3CX5I 2AXTH 2O01H 1M57D 4ZNCA 1EZVD 3D6ZA 1MFZA 5KTBA 2W6AA 4H0LD 3CMEP 1SLQA 3C1LA 3AE9C 2AXTE 1K05A 2FKWB 2YXQB 3H1IJ 2C0XA 3AECC 1FZGA 2DW3A 5AW8B 2P10A 1JMMA 3L72E 1M1JA 3CCSP 4D6TD 2W6BA 3H1HJ 1ZMEC 3L74G 2A45I 2QEXP 1FDMA 4IFMA 2R5BA 5AW7B 2Y9YA 1BGYJ 5KJ7C 1J1EC 1NU1K 1KB9E 5AVXB 2FY8A 4I6MC 1JEKA 2D2CC 3PLNA 3TGUE 2ZYDA 1NU1D 1LNQA 1QGKB 2J59M 3L4FA 1NTMD 2CK3H 4N6JA 2P1JA 3O6QA 3H1HE 3KXDA 5CMZA 3V2RA 1EDKA 3CXHH 3RL0B 1FZFA 2E76C 1KILE 3BCCD 5GTHH 3L74J 1FJKA 1MZ9A 1FOSF 4EOTA 3P8MC 3USSA 5DJUB 2KUBA 3OJAB 4KJMA 2XNDH 2FBWC 1BSNA 1BDCA 2BCCE 3RL0D 1NKNA 1BSHA 1M56D 3II6A 2E5YA 4HJGH 3CC2P 1SQXG 1KILA 1IJDB 3K5BA 1VQ8P 1JM0A 3VTPC 3M0AA 3HUSA 3KHUA 1AQ5A 1SFCC 2HODB 1E79H 3BRVB 2R3CA 3RK2B 2WVRA 1FJPA 2Y0EA 1YQ4C 1BDDA 5CBNA 3L72D 2PRRA 4IL6H 3PH0A 2ZT9B 1G2CA 1Q7YQ 1W2BO 2KZJA 1SQQD 3RGUA 3P32A 2K9YA 4C7NA 4JQ0D 1YTZI 2MJZA 1UIIA 1RQVA 3RK2D 5BVZA 5AW3B 3U59A 1G1IA 2LXCB 1IK9A 2ZT9D 3TGUD 1QVFO 1OVVA 2H89C 1HJ0A 3H1ID 4UB6H 1SQXJ 2Z4EA 3G3ZA 3N4XA 2CPBA 1PP9G 4UB6E 3U1CA 3Q5SA 2WSCJ 2C9LY 2Z5IA 1SQBK 1P84E 3H1HD 4NPEA 1GTWA 5KAFE 3AEAC 3M0DC 2AEMA 1BGYD 3VP8A 3V6IA 3L71G 2J5UA 1KQSO 1KC8Q 1GD2E 1ZW0A 2K9JA 3CWBE 2VRSA 1QVGO 2NZ2A 1J1EB 1LGHB 2N1TC 4EI2A 3KPEA 1LT9C 2BCCD 4AYCA 3F89A 3H32A 3NMDA 1LJ2A 1X9VA 2KIKA 3G71P 2LR2A 1JY3N 1VPCA 3AE8C 5KJ7D 1NTKG 1GW3A 1YYCA 2YKQA 4IFFA 1PP9J 5C39A 3H1LG 2A45H 5AVYB 4JYCA 3L36A 4ASWA 3L74D 1PIXA 3V4WA 4YTPC 1L0NE 5CCGA 4BRYB 2WZ7A 3GG2A 2WMMA 4C7RA 1IZNB 3B4SA 2NPSC 1GU4A 3L71J 1ZP0C 2AEFA 1Y9BA 1JB0J 2FFDA 1RE3C 3L73E 3M9BA 4H13C 5AW4B 4Y99B 2JWAA 4BXLA 2B88A 1LTTC 2WTYA 5KKZB 4PJ0E 2HG5D 1VQLP 1GL2A 1SP4A 1LTJA 1NTKJ 4H0LC 5APVA 2R32A 1ZLLA 2RN0A 2Q5UA 1ZXGA 3HE5B 3H1LJ 1VQ6P 4DOJA 4NPDA 1OMIA 3KQGA 1AA0A 4RJTA 3HTKB 3N7NA 3AEDC 2V7QH 2B87B 1Q2NA 4LGDE 4WY4A 3V2PA 2QJKC 2OARA 4XE5B 1OW8A 1SQXD 3H1JE 3T97A 2KSEA 3FWNA 3H1LE 2KNCB 1LWUA 3OA7A 2ZVNB 2OYHA 4WBAA 1L0NK 2WT7A 4DCKA 2N9BA 3IF4A 4Y28J 1IFIA 2ZYGA 3FWLA 3I55P 4R4LA 2HYNA 3MIWA 2HPCB 4EDFA 2IYPA 3BVHA 2OTJP 2BASA 1S72P 2I8DA 1YJNP 1KMIZ 1FZCB 4YXDC 1YHQP 1VQ4P 3RBZA 3HD7A 2QRXA 1LT9B 3O8ZA 2IX7C 4HKZH 3Q1MA 1PP9D 1OX3A 2BEZF 1E5WA 3QWOC 3Q3DA 3V4QA 5CCHC 3AE5C 1UIXA 4B86A 3VN0A 5AVWB 1HVVA 5AW2B 4K3AA 3L71D 3CL3D 5GTIH 2WPVB 1DD3A 2NPSB 3S1KA 2WPQA 3CCEP 2KSJA 1HTLC 1PGQA 4U7JA 2WSEJ 1X8YA 1KFNA 3UIAA 1DIPA 3PTZA 1IFDA 2IPPA 5AVZB 4H13B 2W8ZA 3TGUG 3D70A 2QJYB 2HFED 2NPSD 2O01J 3RK2C 1NTKD 2Q1KA 3KZIH 1HJBA 1HGZA 3CCRP 2OYIC 3FX0A 3H1LD 2OQQA 3R2PA 2QSIA 5KAIH 1NO4A 4H13D 3KZIE 3CCLP 3B5NB 1AFOA 3AE3C 3CI9A 1SQBG 3IN6A 1Q86Q 2FXPA 2YMKA 1NTZE 2YKPA 1JY3P 4LLHA 2JKVA 2YMYA 3V2NA 2BCCG 1X79B 1KORA 4DZOA 3CCQP 3B5ND 3FGAD 2QJKB 3CPWO 3TGUJ 2WITA 1N86A 3TNUB 4QMAA 1WT6A 1GU5A 4HH2A 5TISH 1PPJE 1H0TB 2IYOA 3GHGB 4AUWA 2FXMA 5AW6B 1Q82Q 1L4AC 4YXWH 1ZRTE 3CLQA 1GK4A 3M06A 1SQBJ 5BU5A 5EFWB 3G9RA 4PD4H 2P7JA 1Q90D 2WPSA 4PD4E 2BCCJ 2M3EA 1AV1A 1CI6B 1R8EA 3A2AA 3RL0g 1LTBC 1N7SC 2RMZA 4I1LA 3EFFK 2H8PD 1USDA 1YBKA 3AE4C 3NXSA 2Q7CA 3P8CE 3Q2YA 2R44A 1KYOI 2M8RA 1LP1B 1SQBE 3CXHE 3FXEA 2WSSH 3TSIA 3PRJA 1K04A 2HODA 3A5TA 3VYIA 5GTHE 1NTZK 4HB1A 2K3RA 1KN7A 2UWJE 2CPSA 4Y99C 3M9QA 2KXPB 3AE7C 3CWBG 1FZAA 1RE4A 2XU6A 1NAYA 5KKZC 5APYA 2KI7B 5CCHD 3NTNA 1HGVA 1MFTA 2C0WA 3U1AA 3GMAA 2KS1A 4N78E 1H89A 3RK3E 5CJ4A 1PZQA 1A02J 4ZKPA 2P58A 2OYIB 1OWAA 2A06E 4PV1B 3V2QA 2Y0DA 1L0NG 2E5TA 3Q5PA 2FFDC 4GODA 3F5HA 3NFQA 4OVNF 5E79H 2A45G 1URQC 4IL6E 1S3JA 2OTLP 2IBZE 1JY2O 4W80A 1KB9D 3GLMA 1EZVI 3CWBJ 1WRGA 2O1JA 3WMM0 5E79E 3TK1A 1EXJA 4NPFX 3ABVC 3L73G 1G1JA 5KJ7A 1RF1C 4PV1D 1VQ5P 1KILB 1LTJC 4L74A 2GUSA 1QL1A 3HUSB 1BCCG 2ZXXA 1OVRA 1NVOA 5KLVE 4C46A 4WVZA 2OGUA 4LC1A 3Q5RA 2FYZA 1ZR4A 3MUDC 1IK7A 1OFCX 1G2CB 1KILD 3HE4A 3QH9A 2GM4A 1X0TA 4UB8H 1SQBD 1BE3G 1L4AB 3CXHD 1L0NJ 1JUNA 1T3UA 3CX5H 1R5LA 4C7NB 4EIJA 4BRYA 1T6AA 2E74C 1FZCC 4UB8E 3SWKA 1M8OB 3AEGC 3CX5E 1RF0C 4DT0A 3L73J 2JDIH 3TF5A 5L8RJ 4ZMDA 1L4AD 3A0HH 2OYHC 2WSCH 3H1JG 1EC5A 5AVSB 1BCCJ 1YI2P 1MV8A 1N7SB 1LT1A 2JP3A 4WWIA 1NJIQ 4N78D 2O3JA 4OH8B 2QE7H 3GF3A 4GOFA 1AJYA 2ZAEB 2FYUE 1S9KE 4RESB 4U3FG 3WUTA 2FYNC 1BE3J 1SFCA 1JTHB 3VMAA 5AW9B 1N7SD 1FE6A 1L0LE 2Q9IA 5BU8B 3BASA 3SFDC 3HTKA 2QJYC 1BCCE 1OW7A 3MZWB 2V7QJ 1NH4A 3M9HA 1EDLA 1DD4A 1IFMA 5KLVK 1KYOH 4R4MA 3H1JJ 2Q3IA 1NKZB 1FC2C 2KP8A 2Q3EA 5APUA 2C9NY 2FXOA 2WSFH 3B5NC 3D6YA 1CZQA 1YQ3C 2M5AB 1BE3E 2POHA 3VMZA 1SQVG 1P84D 1EQ7A 3E1RA 3WUVA 1Z56A 4KT0J 2GUVA 1AVOA 1JY3O 4U3FJ 3H1KG 5APTA 1KB9I 2FFDB 3CWBD 3V5BA 1URQB 3B71A 3M0DA 2W83C 1FOSE 4I7ZC 3H6PA 5AVRB 3PP5A 3L75E 4XA4A 3GHGC 2HPCA 1RF1B 2XKMA 1GL2B 1DEEG 2N1TA 1LTJB 1N73C 1S5LX 3SWYA 1SQPE 1KD1Q 3AEEC 1URQD 1NWQA 1VDFA 1LT9A 2YO3A 3IR9A 4W7YA 4U3FE 4GKGA 2FYUK 1MUUA 1L0ND 1X22A 2B89A 1XTCC 1GL2D 1L0LK 2V4HA 2Y9ZA 3H1KJ 3WU2H 2LXBA 1PGJA 4HYTB 1NTZG 1S2EA 1XTGB 2E74B 2XDJA 5B5EH 3L73D 2NPSA 2I1KA 1U7MA 2KK7A 1T2KC 1M1JC 1OIPA 3KYQA 5TJHA 3LW5J 5B5EE 1GZLA 1BCCD 4OGQB 1RE3A 4L75A 1GMJA 1HF9A 1PV3A 2OYHB 1SQVE 3MGNA 1PPJG 1HUCA 2KOGA 2E74D 1W2EA 3H1KE 2JO1A 1QL2A 1BE3D 3GW6A 3S9OA 1LTIC 4OGQD 3SWFA 1CW5A 2FYNB 1RH5B 5GTIE 1NTZJ 2QM7A 1SVFA 3CMAP 3CCMP 4KHXA 2W6JH 1YTZT 2SPZA 2M0BA 4CPGA 5B66H 2PFXA 3L70E 1A02F 1NTME 1SQPK 2WWWA 4OWFA 4ASVA 2AEJA 3H1JD 1U57A 5B66E 2W90A 4PV1C 5AVVB 1RY3A 3TNUA 2JR8A 2K88A 1IFJA 1RHZB 3BCCE 1P84I 2ITAA 1CSBA 3LIEA 5KAIE 4U3FD 3L37A 4JPZB 2WSEH 2E43A 2MKVA 1VQKP 4JBZA 2M3BA 2AXCA 1KILC 4K35A 2YXRB 5AVQB 3HUSC 3I5CA 4L73A 1OZHA 4I7ZB 1JO5A 1SQVK 3CCJP 3CD6P 2QJPB 3SFEC 1CI6A 5TISE 1N73B 3HRNA 2RKLA 2KLVA 1SQVD 1FS0E 2WPRA 4H44B 1GDTA 3CCVP 2A06G 3FXDA 1LP1A 2HR3A 1KB9H 1SQQE 2R5DA 3H1KD 2P67A 5CCHA 5AW0B 3RK3C 2QM8A 2IBZG 2JEEA 1YIJP 2E42A 4M3LA 1NTMK 4H44D 1NAFA 3MD0A 1DEBA 3S4RA 3H1IE 1YITP 2ZYAA 1KZUB 1SS1A 1M1JB 3IFMA 3L70D 2KYVA 1FZEA 3C8VA 3VMYA 5KLVG 4AQRD 3RBXA 3TYYA 1JY2N 1FZBA 1BGYE 3BRTB 3CC7P 1T2KD 2OYIA 1VQMP 1NTZD 1Q81Q 3W67A 5KLIC 3MP7B 1FBMA 2LKMA 1JCDA 3O6QB 2I1JA 4JF7A 2PGDA 2Y0CA 5APSA 2IZ1A 2H43A 5CCGC 3CCUP 3C9IA 1VL2A 1PPJD 3MHVA 1N2DC 4GOEA 1EDIA 3VOPA 3L74E 5KLVJ 1ZV8A 2E75C 2YKOA 1SQQK 2QA4P 2K37A 1ZRTD 2XNXA 5APWA 2FYUG 1H8AA 1EDJA 4IL6X 3BATA 4XFJA 3MTUE 1L4AA 1L0LG 3D71A 1GL2C 2ZJSE 1K8AQ 4L76A 4PD4D 3W68A 3A7OA 3A0BH 2XZRA 3ZDMA 2KS1B 1TU3F 5APQA 2XV5A 2GA1A 1W5CE 3E7KA 1GW4A 3A0BE 4A7PA
chains in the Genus database with same CATH topology
1JY3O 3P8CD 2KSJA 1HTLC 3L4FA 1X8YA 5AW5B 1KFNA 3UIAA 1FAVA 5APTA 4N6JA 2W27A 1IFDA 2P1JA 3VMXA 2IPPA 1N7SA 2FFDB 5AVZB 5CMZA 3V2RA 3V5BA 1URQB 4WY4C 1N7LA 3M0DA 3RL0B 1FOSE 3LIDA 3H6PA 1NHLA 1FZFA 5AVRB 3A3YB 2HFED 2NPSD 3PP5A 3RK2C 2YO2A 4JYBA 1LTAC 4XA4A 3GHGC 2HPCA 4GIFA 1HJBA 1HGZA 2XKMA 1RF1B 1FJKA 2OYIC 3RK3B 1GL2B 1JTHA 1MZ9A 3R2PA 1FOSF 1HWTC 4EOTA 1LWUC 2N1TA 1LTJB 1N73C 1ZR2A 1JNMA 3P8MC 3SWYA 1NO4A 3OJAB 1URQD 4WB4A 3B5NB 1AFOA 1NWQA 1VDFA 1LT9A 5AW1B 2P2UA 3CI9A 3RL0D 2YO3A 3IR9A 1NKNA 4W7YA 4GKGA 2FYUK 3II6A 2YKPA 1JY3P 1MUUA 2ZXEB 4LLHA 5CJ0A 1XTCC 3RK3D 1GL2D 1KILA 2YMYA 1T3JA 1L0LK 5CHXA 1IJDB 3V2NA 3HE4B 1X79B 1LTGC 3VTPC 4DZOA 3M0AA 4GT1A 3HE5A 3HUSA 4HYTB 1AQ5A 3B5ND 1SFCC 3P7KA 1XTGB 2WITA 2HODB 1N86A 3TNUB 4O9BA 2XDJA 3BRVB 1WT6A 2NPSA 2R3CA 1GU5A 2I1KA 4HH2A 3RK2B 1FJPA 3HD7C 3GHGB 1T2KC 5AVTB 1M1JC 4AUWA 1LTSC 2FXMA 3KYQA 3H32B 1M7LA 1G2CA 5AW6B 1GZLA 2JJLA 1RE3A 1J2JB 3P32A 1L4AC 1URQA 1J1DC 2OYHB 4C7NA 3MGNA 3CLQA 1HUCA 1YTZI 2MJZA 1GK4A 2KOGA 1W2EA 3M06A 5BU5A 3RK2D 5BVZA 5AW3B 3U59A 1QL2A 1G1IA 1RF1A 1DH3A 1IK9A 2P7JA 1DX7A 1LTIC 2WPSA 3SWFA 2Z4EA 3G3ZA 3N4XA 2CPBA 1CW5A 1CI6B 1SFCB 4N3YB 3A2AA 3U1CA 2C9LY 2QM7A 1SVFA 2Z5IA 1LTBC 1N7SC 1SQBK 4KHXA 4I1LA 1PFIA 1YTZT 1GTWA 2H8PD 2J58A 3NXSA 2Q7CA 3M0DC 3P8CE 3M91A 5CCGD 3MUDA 1A02F 3VP8A 2M8RA 1SQPK 2WWWA 3EQ2A 4W7ZA 1SQXK 1GD2E 3TSIA 2VRSA 1J1EB 5AVVB 1SFCD 1RY3A 1JY2P 1LGHB 2O1KA 2HODA 3A5TA 3TNUA 3VYIA 1FZCA 2N1TC 1NTZK 1IFJA 1KFMA 2YNYA 2CPSA 3KPEA 3M9QA 4Y99C 1LT9C 1FZAA 1CSBA 1ZN5A 4AYCA 1RE4A 1RF0A 2XU6A 3H32A 3LIEA 3NMDA 1X9VA 3L37A 4ZKUA 2WSEH 2E43A 5APYA 1JY3N 5CCHD 1VPCA 5KJ7D 3NTNA 1GW3A 2M3BA 1YYCA 2YKQA 1KILC 4IFFA 1HGVA 2C0WA 1S9KD 2A45H 2ZFCA 4I2LC 5AVYB 4JYCA 3L36A 1FU1A 1JOCA 3U1AA 1JCCA 4WY4B 3HUSC 5AVQB 3I5CA 1OXZA 1IC2A 3V4WA 5CCGA 4N78E 1H89A 2WZ7A 1JO5A 4C7RA 3B8EB 2NPSC 1GU4A 1SQVK 3E1IA 5CJ4A 1A02J 2L5GB 4ZKPA 2OYIB 1OWAA 1CI6A 3V2QA 1LWUB 1N73B 2FFDA 2N1TB 3HRNA 1RE3C 1HBWA 3M9BA 2FFDC 3NFQA 5AVUB 5AW4B 2H7HA 2KLVA 2A45G 4WY4D 1URQC 4Y99B 1JY2O 2WPRA 4W80A 3RL0C 1GDTA 1LTTC 2WTYA 1WRGA 2WT7B 2O1JA 3WMM0 3TK1A 2R5DA 2HG5D 2P67A 2IFNA 1G1JA 5CCHA 5KJ7A 1RF1C 1GL2A 5APXA 5AW0B 3RK3C 2QM8A 1SP4A 1LTJA 1KILB 2JEEA 2N1TD 3EFGA 1LTJC 1NOHA 5APVA 2E42A 2R32A 1ZLLA 2GUSA 3B5NA 4M3LA 4IFDK 1QL1A 2Q5UA 3HE5B 3HUSB 1IFNA 1NTMK 1NAFA 3MD0A 4DOJA 1T8ZA 1DEBA 1HH0A 4C46A 1KZUB 1KQLA 3KQGA 4LC1A 2PAJA 3HD7B 2FYZA 3LW5H 1M1JB 1ZR4A 3IFMA 3HTKB 3N7NA 2IFMA 2KYVA 3L35A 1FZEA 1G2CB 1KILD 3HE4A 2GM4A 1NTKK 1GK6A 4LGDE 1L4AB 3VMYA 1J1DB 1IO4A 4AQRD 1JUNA 4WY4A 1T3UA 3TYYA 3V2PA 4C7NB 4EIJA 1JY2N 2HLOA 2KB7P 1FZBA 1FZCC 3BRTB 2OARA 4XE5B 3HD7D 3GHGA 3T97A 1T2KD 2OYIA 1RE4C 1RF0C 2Z5HA 1LWUA 1N73A 3OA7A 2PP6A 3OAKA 1L4AD 2OYHA 4WBAA 2OYHC 1L0NK 2WSCH 5AVSB 3VP9A 3KDPB 1FBMA 1MV8A 2LKMA 1N7SB 1JCDA 2WT7A 2I1JA 4JF7A 1H88A 5APSA 2N9BA 2O01H 2H43A 5CCGC 1IFIA 4N78D 1MFZA 4OH8B 5KTBA 3C9IA 2W6AA 2HYNA 3MIWA 1SLQA 1S9KE 1N2DC 2HPCB 3BVHA 4RESB 1SFCA 2FKWB 3VOPA 2BASA 1JTHB 1ZV8A 2YKOA 2C0XA 1FZGA 5AW9B 1FZCB 1N7SD 1SQQK 5AW8B 3HD7A 1JMMA 2Q9IA 1LT9B 3O8ZA 2XNXA 1M1JA 5BU8B 5APWA 2IX7C 3BASA 1H8AA 3HTKA 3BATA 2W6BA 2A45I 1FDMA 3MTUE 1E5WA 1L4AA 4IFMA 2R5BA 5AW7B 1NH4A 3M9HA 3V4QA 5CCHC 5KJ7C 1GL2C 1J1EC 1IFMA 4B86A 3VN0A 5KLVK 1NU1K 5AVWB 5AVXB 1HVVA 2Q3IA 1NKZB 2KP8A 5APUA 2C9NY 3A7OA 2WSFH 5AW2B 3B5NC 1CZQA 2XZRA 4I6MC 2POHA 3VMZA 5APQA 3CL3D 2XV5A 1GW4A 1EQ7A 2NPSB 2J59M 1Z56A 2WPQA 2GUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTJ A;  1JY3 O;  3HUS C;  1FZG A;  1FZA A;  2Z4E A;  2FFD C;  1FZC B;  2HOD B;  1RE4 A;  1RF0 A;  3H32 A;  1LTJ C;  1N86 A;  2OYI A;  2A45 G;  3GHG C;  2HPC A;  1FZE A;  1RE4 C;  1RF0 C;  1RF1 B;  2OYI C;  1JY3 P;  1W2E A;  1JY2 O;  3GHG A;  1LWU A;  2H43 A;  2Q9I A;  1N73 A;  1LT9 B;  3HUS B;  2XNX A;  1M1J A;  2FFD B;  1JY3 N;  1LWU C;  1T3U A;  3GHG B;  1LTJ B;  1JY2 P;  3E1I A;  1N73 C;  1M1J C;  2HOD A;  2OYH A;  1FZC A;  3H32 B;  2OYI B;  2OYH C;  1JY2 N;  2A45 I;  2HLO A;  1RF1 A;  2HPC B;  1FZB A;  3BVH A;  1FZC C;  2OYH B;  1LT9 A;  1RE3 A;  1LWU B;  1FZF A;  1RF1 C;  2A45 H;  3HUS A;  1N73 B;  1M1J B;  2FFD A;  1LT9 C;  1RE3 C; 
#chains in the Genus database with same CATH topology
 1P84 H;  3P8C D;  1R5S A;  5KAF H;  5AW5 B;  1FAV A;  2W27 A;  3VMX A;  1N7S A;  1PGP A;  2KZI A;  3JC2 2;  4WY4 C;  1N7L A;  3LID A;  1NHL A;  2FYU J;  3A3Y B;  2QVA A;  4GDO A;  1VQ9 P;  2YO2 A;  1OVU A;  4JYB A;  2K1A A;  1LTA C;  1L2P A;  4GIF A;  3RK3 B;  1JTH A;  1L0L J;  3AEF C;  1HWT C;  1LWU C;  4OGQ C;  1M1K Q;  1RQU A;  1ZR2 A;  1QLE D;  1JNM A;  4BWN A;  3AEB C;  4WB4 A;  1SQX E;  2ZVO B;  3L75 G;  5AW1 B;  2P2U A;  2IZ0 A;  2D2C B;  1VQO P;  3AE2 C;  2H88 C;  3A0H E;  2ZXE B;  1MKM A;  1SQP G;  1S1C X;  5CJ0 A;  1U7J A;  3RK3 D;  5M1B A;  5CHX A;  1T3J A;  3HE4 B;  1LTG C;  2K9J B;  4GT1 A;  3HE5 A;  2A06 D;  4MN4 C;  2R3S A;  3P7K A;  2M5A A;  2D2C D;  2WSF J;  4O9B A;  2E76 B;  2NRG A;  3HD7 C;  1OW6 A;  2IBZ D;  5AVT B;  1AVY A;  1LTS C;  5DJT B;  3IAO A;  3H32 B;  4YPC A;  1M7L A;  3AE6 C;  2B87 A;  2JJL A;  3JSV C;  1VQP P;  4DJG A;  1J2J B;  1S4X A;  1EZV G;  2G3A A;  1URQ A;  1J1D C;  1VF5 C;  2O01 N;  4PJ0 H;  5KLI B;  4TLF A;  3I56 P;  3L75 J;  3WUU A;  3ITK A;  2B9B A;  2E76 D;  5H2F H;  1N8R Q;  1PP9 E;  5CBO A;  2KNC A;  1KYO E;  1RF1 A;  1DH3 A;  1SQP J;  5KLV D;  1DX7 A;  2YIU C;  5H2F E;  4D6T G;  2G8Y A;  3OW2 O;  1D7M A;  3L71 E;  1SFC B;  2E75 B;  4N3Y B;  3SSU A;  2RH0 A;  1PFI A;  1WMK A;  2J58 A;  3M91 A;  5CCG D;  3MUD A;  2N9Y B;  2QG4 A;  2L91 A;  3JCU H;  1ZOY C;  3EQ2 A;  4Z1M H;  3CX5 D;  4W7Z A;  1SQX K;  3EWK A;  2QJP C;  1NU1 G;  2OYO A;  4PD4 I;  1SFC D;  1EXI A;  2E75 D;  2O1K A;  1JY2 P;  3JCU E;  3L70 G;  1FZC A;  1S5L H;  1KFM A;  4RKU J;  3PJS K;  1K9M Q;  2YNY A;  1NTM G;  3R4Y A;  1NTK E;  1QEX A;  1PGO A;  4H44 C;  1AQT A;  1ZN5 A;  1RF0 A;  1S5L E;  1SQV J;  4ZKU A;  1VQ7 P;  3CXH I;  3GF7 A;  4D6T J;  3BCC G;  1M90 Q;  3H25 A;  2FYU D;  1S9K D;  2ZFC A;  4I2L C;  1FU1 A;  1KQG B;  4IOI H;  1JOC A;  1JCC A;  4WY4 B;  3TDK A;  1OXZ A;  1IC2 A;  1EZV E;  3WU2 E;  1NYH A;  1L0L D;  3B8E B;  3AE1 C;  3E1I A;  3T97 B;  2BEQ D;  4RO0 A;  2L5G B;  4TT3 H;  1QX8 A;  2Q6Q A;  1LWU B;  1NU1 J;  2N1T B;  1HBW A;  3L70 J;  5AVU B;  2H7H A;  4WY4 D;  2KLU A;  1KTM A;  1NTM J;  1YJW P;  4D6T E;  3RL0 C;  1YJ9 P;  2WQY C;  2WT7 B;  3G6E P;  2IFN A;  2OTK E;  1KYO D;  5APX A;  2IDB A;  3L72 G;  3BCC J;  2N1T D;  3EFG A;  1NOH A;  3B5N A;  5K5G B;  4IFD K;  2JWD A;  1IFN A;  1SQQ G;  3CC4 P;  2IBZ I;  1T8Z A;  1NU1 E;  1HH0 A;  1Y8A A;  1KQL A;  2PAJ A;  3HD7 B;  3LW5 H;  2IFM A;  3L35 A;  3L75 D;  1NTK K;  1GK6 A;  3PHL A;  1J1D B;  1IO4 A;  3H1I G;  1VF5 B;  1NGM B;  2QIW A;  2HLO A;  2KB7 P;  1VQN P;  1SQP D;  1K73 Q;  1H0T A;  3G4S P;  3HD7 D;  3GHG A;  1FDI A;  3H1H G;  1RE4 C;  2Z5H A;  2YIU B;  2ZT9 C;  1N73 A;  2PP6 A;  3OAK A;  4H0L B;  1FDO A;  1BGY G;  3L72 J;  1USE A;  1VF5 D;  4EYY Q;  3VP9 A;  1SQQ J;  3KDP B;  1IFP A;  1KQF B;  1PL5 A;  1KV4 A;  1JMB A;  1H88 A;  1Y47 A;  3CX5 I;  2AXT H;  2O01 H;  1M57 D;  4ZNC A;  1EZV D;  3D6Z A;  1MFZ A;  5KTB A;  2W6A A;  4H0L D;  3CME P;  1SLQ A;  3C1L A;  3AE9 C;  2AXT E;  1K05 A;  2FKW B;  2YXQ B;  3H1I J;  2C0X A;  3AEC C;  1FZG A;  2DW3 A;  5AW8 B;  2P10 A;  1JMM A;  3L72 E;  1M1J A;  3CCS P;  4D6T D;  2W6B A;  3H1H J;  1ZME C;  3L74 G;  2A45 I;  2QEX P;  1FDM A;  4IFM A;  2R5B A;  5AW7 B;  2Y9Y A;  1BGY J;  5KJ7 C;  1J1E C;  1NU1 K;  1KB9 E;  5AVX B;  2FY8 A;  4I6M C;  1JEK A;  2D2C C;  3PLN A;  3TGU E;  2ZYD A;  1NU1 D;  1LNQ A;  1QGK B;  2J59 M;  3L4F A;  1NTM D;  2CK3 H;  4N6J A;  2P1J A;  3O6Q A;  3H1H E;  3KXD A;  5CMZ A;  3V2R A;  1EDK A;  3CXH H;  3RL0 B;  1FZF A;  2E76 C;  1KIL E;  3BCC D;  5GTH H;  3L74 J;  1FJK A;  1MZ9 A;  1FOS F;  4EOT A;  3P8M C;  3USS A;  5DJU B;  2KUB A;  3OJA B;  4KJM A;  2XND H;  2FBW C;  1BSN A;  1BDC A;  2BCC E;  3RL0 D;  1NKN A;  1BSH A;  1M56 D;  3II6 A;  2E5Y A;  4HJG H;  3CC2 P;  1SQX G;  1KIL A;  1IJD B;  3K5B A;  1VQ8 P;  1JM0 A;  3VTP C;  3M0A A;  3HUS A;  3KHU A;  1AQ5 A;  1SFC C;  2HOD B;  1E79 H;  3BRV B;  2R3C A;  3RK2 B;  2WVR A;  1FJP A;  2Y0E A;  1YQ4 C;  1BDD A;  5CBN A;  3L72 D;  2PRR A;  4IL6 H;  3PH0 A;  2ZT9 B;  1G2C A;  1Q7Y Q;  1W2B O;  2KZJ A;  1SQQ D;  3RGU A;  3P32 A;  2K9Y A;  4C7N A;  4JQ0 D;  1YTZ I;  2MJZ A;  1UII A;  1RQV A;  3RK2 D;  5BVZ A;  5AW3 B;  3U59 A;  1G1I A;  2LXC B;  1IK9 A;  2ZT9 D;  3TGU D;  1QVF O;  1OVV A;  2H89 C;  1HJ0 A;  3H1I D;  4UB6 H;  1SQX J;  2Z4E A;  3G3Z A;  3N4X A;  2CPB A;  1PP9 G;  4UB6 E;  3U1C A;  3Q5S A;  2WSC J;  2C9L Y;  2Z5I A;  1SQB K;  1P84 E;  3H1H D;  4NPE A;  1GTW A;  5KAF E;  3AEA C;  3M0D C;  2AEM A;  1BGY D;  3VP8 A;  3V6I A;  3L71 G;  2J5U A;  1KQS O;  1KC8 Q;  1GD2 E;  1ZW0 A;  2K9J A;  3CWB E;  2VRS A;  1QVG O;  2NZ2 A;  1J1E B;  1LGH B;  2N1T C;  4EI2 A;  3KPE A;  1LT9 C;  2BCC D;  4AYC A;  3F89 A;  3H32 A;  3NMD A;  1LJ2 A;  1X9V A;  2KIK A;  3G71 P;  2LR2 A;  1JY3 N;  1VPC A;  3AE8 C;  5KJ7 D;  1NTK G;  1GW3 A;  1YYC A;  2YKQ A;  4IFF A;  1PP9 J;  5C39 A;  3H1L G;  2A45 H;  5AVY B;  4JYC A;  3L36 A;  4ASW A;  3L74 D;  1PIX A;  3V4W A;  4YTP C;  1L0N E;  5CCG A;  4BRY B;  2WZ7 A;  3GG2 A;  2WMM A;  4C7R A;  1IZN B;  3B4S A;  2NPS C;  1GU4 A;  3L71 J;  1ZP0 C;  2AEF A;  1Y9B A;  1JB0 J;  2FFD A;  1RE3 C;  3L73 E;  3M9B A;  4H13 C;  5AW4 B;  4Y99 B;  2JWA A;  4BXL A;  2B88 A;  1LTT C;  2WTY A;  5KKZ B;  4PJ0 E;  2HG5 D;  1VQL P;  1GL2 A;  1SP4 A;  1LTJ A;  1NTK J;  4H0L C;  5APV A;  2R32 A;  1ZLL A;  2RN0 A;  2Q5U A;  1ZXG A;  3HE5 B;  3H1L J;  1VQ6 P;  4DOJ A;  4NPD A;  1OMI A;  3KQG A;  1AA0 A;  4RJT A;  3HTK B;  3N7N A;  3AED C;  2V7Q H;  2B87 B;  1Q2N A;  4LGD E;  4WY4 A;  3V2P A;  2QJK C;  2OAR A;  4XE5 B;  1OW8 A;  1SQX D;  3H1J E;  3T97 A;  2KSE A;  3FWN A;  3H1L E;  2KNC B;  1LWU A;  3OA7 A;  2ZVN B;  2OYH A;  4WBA A;  1L0N K;  2WT7 A;  4DCK A;  2N9B A;  3IF4 A;  4Y28 J;  1IFI A;  2ZYG A;  3FWL A;  3I55 P;  4R4L A;  2HYN A;  3MIW A;  2HPC B;  4EDF A;  2IYP A;  3BVH A;  2OTJ P;  2BAS A;  1S72 P;  2I8D A;  1YJN P;  1KMI Z;  1FZC B;  4YXD C;  1YHQ P;  1VQ4 P;  3RBZ A;  3HD7 A;  2QRX A;  1LT9 B;  3O8Z A;  2IX7 C;  4HKZ H;  3Q1M A;  1PP9 D;  1OX3 A;  2BEZ F;  1E5W A;  3QWO C;  3Q3D A;  3V4Q A;  5CCH C;  3AE5 C;  1UIX A;  4B86 A;  3VN0 A;  5AVW B;  1HVV A;  5AW2 B;  4K3A A;  3L71 D;  3CL3 D;  5GTI H;  2WPV B;  1DD3 A;  2NPS B;  3S1K A;  2WPQ A;  3CCE P;  2KSJ A;  1HTL C;  1PGQ A;  4U7J A;  2WSE J;  1X8Y A;  1KFN A;  3UIA A;  1DIP A;  3PTZ A;  1IFD A;  2IPP A;  5AVZ B;  4H13 B;  2W8Z A;  3TGU G;  3D70 A;  2QJY B;  2HFE D;  2NPS D;  2O01 J;  3RK2 C;  1NTK D;  2Q1K A;  3KZI H;  1HJB A;  1HGZ A;  3CCR P;  2OYI C;  3FX0 A;  3H1L D;  2OQQ A;  3R2P A;  2QSI A;  5KAI H;  1NO4 A;  4H13 D;  3KZI E;  3CCL P;  3B5N B;  1AFO A;  3AE3 C;  3CI9 A;  1SQB G;  3IN6 A;  1Q86 Q;  2FXP A;  2YMK A;  1NTZ E;  2YKP A;  1JY3 P;  4LLH A;  2JKV A;  2YMY A;  3V2N A;  2BCC G;  1X79 B;  1KOR A;  4DZO A;  3CCQ P;  3B5N D;  3FGA D;  2QJK B;  3CPW O;  3TGU J;  2WIT A;  1N86 A;  3TNU B;  4QMA A;  1WT6 A;  1GU5 A;  4HH2 A;  5TIS H;  1PPJ E;  1H0T B;  2IYO A;  3GHG B;  4AUW A;  2FXM A;  5AW6 B;  1Q82 Q;  1L4A C;  4YXW H;  1ZRT E;  3CLQ A;  1GK4 A;  3M06 A;  1SQB J;  5BU5 A;  5EFW B;  3G9R A;  4PD4 H;  2P7J A;  1Q90 D;  2WPS A;  4PD4 E;  2BCC J;  2M3E A;  1AV1 A;  1CI6 B;  1R8E A;  3A2A A;  3RL0 g;  1LTB C;  1N7S C;  2RMZ A;  4I1L A;  3EFF K;  2H8P D;  1USD A;  1YBK A;  3AE4 C;  3NXS A;  2Q7C A;  3P8C E;  3Q2Y A;  2R44 A;  1KYO I;  2M8R A;  1LP1 B;  1SQB E;  3CXH E;  3FXE A;  2WSS H;  3TSI A;  3PRJ A;  1K04 A;  2HOD A;  3A5T A;  3VYI A;  5GTH E;  1NTZ K;  4HB1 A;  2K3R A;  1KN7 A;  2UWJ E;  2CPS A;  4Y99 C;  3M9Q A;  2KXP B;  3AE7 C;  3CWB G;  1FZA A;  1RE4 A;  2XU6 A;  1NAY A;  5KKZ C;  5APY A;  2KI7 B;  5CCH D;  3NTN A;  1HGV A;  1MFT A;  2C0W A;  3U1A A;  3GMA A;  2KS1 A;  4N78 E;  1H89 A;  3RK3 E;  5CJ4 A;  1PZQ A;  1A02 J;  4ZKP A;  2P58 A;  2OYI B;  1OWA A;  2A06 E;  4PV1 B;  3V2Q A;  2Y0D A;  1L0N G;  2E5T A;  3Q5P A;  2FFD C;  4GOD A;  3F5H A;  3NFQ A;  4OVN F;  5E79 H;  2A45 G;  1URQ C;  4IL6 E;  1S3J A;  2OTL P;  2IBZ E;  1JY2 O;  4W80 A;  1KB9 D;  3GLM A;  1EZV I;  3CWB J;  1WRG A;  2O1J A;  3WMM 0;  5E79 E;  3TK1 A;  1EXJ A;  4NPF X;  3ABV C;  3L73 G;  1G1J A;  5KJ7 A;  1RF1 C;  4PV1 D;  1VQ5 P;  1KIL B;  1LTJ C;  4L74 A;  2GUS A;  1QL1 A;  3HUS B;  1BCC G;  2ZXX A;  1OVR A;  1NVO A;  5KLV E;  4C46 A;  4WVZ A;  2OGU A;  4LC1 A;  3Q5R A;  2FYZ A;  1ZR4 A;  3MUD C;  1IK7 A;  1OFC X;  1G2C B;  1KIL D;  3HE4 A;  3QH9 A;  2GM4 A;  1X0T A;  4UB8 H;  1SQB D;  1BE3 G;  1L4A B;  3CXH D;  1L0N J;  1JUN A;  1T3U A;  3CX5 H;  1R5L A;  4C7N B;  4EIJ A;  4BRY A;  1T6A A;  2E74 C;  1FZC C;  4UB8 E;  3SWK A;  1M8O B;  3AEG C;  3CX5 E;  1RF0 C;  4DT0 A;  3L73 J;  2JDI H;  3TF5 A;  5L8R J;  4ZMD A;  1L4A D;  3A0H H;  2OYH C;  2WSC H;  3H1J G;  1EC5 A;  5AVS B;  1BCC J;  1YI2 P;  1MV8 A;  1N7S B;  1LT1 A;  2JP3 A;  4WWI A;  1NJI Q;  4N78 D;  2O3J A;  4OH8 B;  2QE7 H;  3GF3 A;  4GOF A;  1AJY A;  2ZAE B;  2FYU E;  1S9K E;  4RES B;  4U3F G;  3WUT A;  2FYN C;  1BE3 J;  1SFC A;  1JTH B;  3VMA A;  5AW9 B;  1N7S D;  1FE6 A;  1L0L E;  2Q9I A;  5BU8 B;  3BAS A;  3SFD C;  3HTK A;  2QJY C;  1BCC E;  1OW7 A;  3MZW B;  2V7Q J;  1NH4 A;  3M9H A;  1EDL A;  1DD4 A;  1IFM A;  5KLV K;  1KYO H;  4R4M A;  3H1J J;  2Q3I A;  1NKZ B;  1FC2 C;  2KP8 A;  2Q3E A;  5APU A;  2C9N Y;  2FXO A;  2WSF H;  3B5N C;  3D6Y A;  1CZQ A;  1YQ3 C;  2M5A B;  1BE3 E;  2POH A;  3VMZ A;  1SQV G;  1P84 D;  1EQ7 A;  3E1R A;  3WUV A;  1Z56 A;  4KT0 J;  2GUV A;  1AVO A;  1JY3 O;  4U3F J;  3H1K G;  5APT A;  1KB9 I;  2FFD B;  3CWB D;  3V5B A;  1URQ B;  3B71 A;  3M0D A;  2W83 C;  1FOS E;  4I7Z C;  3H6P A;  5AVR B;  3PP5 A;  3L75 E;  4XA4 A;  3GHG C;  2HPC A;  1RF1 B;  2XKM A;  1GL2 B;  1DEE G;  2N1T A;  1LTJ B;  1N73 C;  1S5L X;  3SWY A;  1SQP E;  1KD1 Q;  3AEE C;  1URQ D;  1NWQ A;  1VDF A;  1LT9 A;  2YO3 A;  3IR9 A;  4W7Y A;  4U3F E;  4GKG A;  2FYU K;  1MUU A;  1L0N D;  1X22 A;  2B89 A;  1XTC C;  1GL2 D;  1L0L K;  2V4H A;  2Y9Z A;  3H1K J;  3WU2 H;  2LXB A;  1PGJ A;  4HYT B;  1NTZ G;  1S2E A;  1XTG B;  2E74 B;  2XDJ A;  5B5E H;  3L73 D;  2NPS A;  2I1K A;  1U7M A;  2KK7 A;  1T2K C;  1M1J C;  1OIP A;  3KYQ A;  5TJH A;  3LW5 J;  5B5E E;  1GZL A;  1BCC D;  4OGQ B;  1RE3 A;  4L75 A;  1GMJ A;  1HF9 A;  1PV3 A;  2OYH B;  1SQV E;  3MGN A;  1PPJ G;  1HUC A;  2KOG A;  2E74 D;  1W2E A;  3H1K E;  2JO1 A;  1QL2 A;  1BE3 D;  3GW6 A;  3S9O A;  1LTI C;  4OGQ D;  3SWF A;  1CW5 A;  2FYN B;  1RH5 B;  5GTI E;  1NTZ J;  2QM7 A;  1SVF A;  3CMA P;  3CCM P;  4KHX A;  2W6J H;  1YTZ T;  2SPZ A;  2M0B A;  4CPG A;  5B66 H;  2PFX A;  3L70 E;  1A02 F;  1NTM E;  1SQP K;  2WWW A;  4OWF A;  4ASV A;  2AEJ A;  3H1J D;  1U57 A;  5B66 E;  2W90 A;  4PV1 C;  5AVV B;  1RY3 A;  3TNU A;  2JR8 A;  2K88 A;  1IFJ A;  1RHZ B;  3BCC E;  1P84 I;  2ITA A;  1CSB A;  3LIE A;  5KAI E;  4U3F D;  3L37 A;  4JPZ B;  2WSE H;  2E43 A;  2MKV A;  1VQK P;  4JBZ A;  2M3B A;  2AXC A;  1KIL C;  4K35 A;  2YXR B;  5AVQ B;  3HUS C;  3I5C A;  4L73 A;  1OZH A;  4I7Z B;  1JO5 A;  1SQV K;  3CCJ P;  3CD6 P;  2QJP B;  3SFE C;  1CI6 A;  5TIS E;  1N73 B;  3HRN A;  2RKL A;  2KLV A;  1SQV D;  1FS0 E;  2WPR A;  4H44 B;  1GDT A;  3CCV P;  2A06 G;  3FXD A;  1LP1 A;  2HR3 A;  1KB9 H;  1SQQ E;  2R5D A;  3H1K D;  2P67 A;  5CCH A;  5AW0 B;  3RK3 C;  2QM8 A;  2IBZ G;  2JEE A;  1YIJ P;  2E42 A;  4M3L A;  1NTM K;  4H44 D;  1NAF A;  3MD0 A;  1DEB A;  3S4R A;  3H1I E;  1YIT P;  2ZYA A;  1KZU B;  1SS1 A;  1M1J B;  3IFM A;  3L70 D;  2KYV A;  1FZE A;  3C8V A;  3VMY A;  5KLV G;  4AQR D;  3RBX A;  3TYY A;  1JY2 N;  1FZB A;  1BGY E;  3BRT B;  3CC7 P;  1T2K D;  2OYI A;  1VQM P;  1NTZ D;  1Q81 Q;  3W67 A;  5KLI C;  3MP7 B;  1FBM A;  2LKM A;  1JCD A;  3O6Q B;  2I1J A;  4JF7 A;  2PGD A;  2Y0C A;  5APS A;  2IZ1 A;  2H43 A;  5CCG C;  3CCU P;  3C9I A;  1VL2 A;  1PPJ D;  3MHV A;  1N2D C;  4GOE A;  1EDI A;  3VOP A;  3L74 E;  5KLV J;  1ZV8 A;  2E75 C;  2YKO A;  1SQQ K;  2QA4 P;  2K37 A;  1ZRT D;  2XNX A;  5APW A;  2FYU G;  1H8A A;  1EDJ A;  4IL6 X;  3BAT A;  4XFJ A;  3MTU E;  1L4A A;  1L0L G;  3D71 A;  1GL2 C;  2ZJS E;  1K8A Q;  4L76 A;  4PD4 D;  3W68 A;  3A7O A;  3A0B H;  2XZR A;  3ZDM A;  2KS1 B;  1TU3 F;  5APQ A;  2XV5 A;  2GA1 A;  1W5C E;  3E7K A;  1GW4 A;  3A0B E;  4A7P A; 
#chains in the Genus database with same CATH homology
 1JY3 O;  3P8C D;  2KSJ A;  1HTL C;  3L4F A;  1X8Y A;  5AW5 B;  1KFN A;  3UIA A;  1FAV A;  5APT A;  4N6J A;  2W27 A;  1IFD A;  2P1J A;  3VMX A;  2IPP A;  1N7S A;  2FFD B;  5AVZ B;  5CMZ A;  3V2R A;  3V5B A;  1URQ B;  4WY4 C;  1N7L A;  3M0D A;  3RL0 B;  1FOS E;  3LID A;  3H6P A;  1NHL A;  1FZF A;  5AVR B;  3A3Y B;  2HFE D;  2NPS D;  3PP5 A;  3RK2 C;  2YO2 A;  4JYB A;  1LTA C;  4XA4 A;  3GHG C;  2HPC A;  4GIF A;  1HJB A;  1HGZ A;  2XKM A;  1RF1 B;  1FJK A;  2OYI C;  3RK3 B;  1GL2 B;  1JTH A;  1MZ9 A;  3R2P A;  1FOS F;  1HWT C;  4EOT A;  1LWU C;  2N1T A;  1LTJ B;  1N73 C;  1ZR2 A;  1JNM A;  3P8M C;  3SWY A;  1NO4 A;  3OJA B;  1URQ D;  4WB4 A;  3B5N B;  1AFO A;  1NWQ A;  1VDF A;  1LT9 A;  5AW1 B;  2P2U A;  3CI9 A;  3RL0 D;  2YO3 A;  3IR9 A;  1NKN A;  4W7Y A;  4GKG A;  2FYU K;  3II6 A;  2YKP A;  1JY3 P;  1MUU A;  2ZXE B;  4LLH A;  5CJ0 A;  1XTC C;  3RK3 D;  1GL2 D;  1KIL A;  2YMY A;  1T3J A;  1L0L K;  5CHX A;  1IJD B;  3V2N A;  3HE4 B;  1X79 B;  1LTG C;  3VTP C;  4DZO A;  3M0A A;  4GT1 A;  3HE5 A;  3HUS A;  4HYT B;  1AQ5 A;  3B5N D;  1SFC C;  3P7K A;  1XTG B;  2WIT A;  2HOD B;  1N86 A;  3TNU B;  4O9B A;  2XDJ A;  3BRV B;  1WT6 A;  2NPS A;  2R3C A;  1GU5 A;  2I1K A;  4HH2 A;  3RK2 B;  1FJP A;  3HD7 C;  3GHG B;  1T2K C;  5AVT B;  1M1J C;  4AUW A;  1LTS C;  2FXM A;  3KYQ A;  3H32 B;  1M7L A;  1G2C A;  5AW6 B;  1GZL A;  2JJL A;  1RE3 A;  1J2J B;  3P32 A;  1L4A C;  1URQ A;  1J1D C;  2OYH B;  4C7N A;  3MGN A;  3CLQ A;  1HUC A;  1YTZ I;  2MJZ A;  1GK4 A;  2KOG A;  1W2E A;  3M06 A;  5BU5 A;  3RK2 D;  5BVZ A;  5AW3 B;  3U59 A;  1QL2 A;  1G1I A;  1RF1 A;  1DH3 A;  1IK9 A;  2P7J A;  1DX7 A;  1LTI C;  2WPS A;  3SWF A;  2Z4E A;  3G3Z A;  3N4X A;  2CPB A;  1CW5 A;  1CI6 B;  1SFC B;  4N3Y B;  3A2A A;  3U1C A;  2C9L Y;  2QM7 A;  1SVF A;  2Z5I A;  1LTB C;  1N7S C;  1SQB K;  4KHX A;  4I1L A;  1PFI A;  1YTZ T;  1GTW A;  2H8P D;  2J58 A;  3NXS A;  2Q7C A;  3M0D C;  3P8C E;  3M91 A;  5CCG D;  3MUD A;  1A02 F;  3VP8 A;  2M8R A;  1SQP K;  2WWW A;  3EQ2 A;  4W7Z A;  1SQX K;  1GD2 E;  3TSI A;  2VRS A;  1J1E B;  5AVV B;  1SFC D;  1RY3 A;  1JY2 P;  1LGH B;  2O1K A;  2HOD A;  3A5T A;  3TNU A;  3VYI A;  1FZC A;  2N1T C;  1NTZ K;  1IFJ A;  1KFM A;  2YNY A;  2CPS A;  3KPE A;  3M9Q A;  4Y99 C;  1LT9 C;  1FZA A;  1CSB A;  1ZN5 A;  4AYC A;  1RE4 A;  1RF0 A;  2XU6 A;  3H32 A;  3LIE A;  3NMD A;  1X9V A;  3L37 A;  4ZKU A;  2WSE H;  2E43 A;  5APY A;  1JY3 N;  5CCH D;  1VPC A;  5KJ7 D;  3NTN A;  1GW3 A;  2M3B A;  1YYC A;  2YKQ A;  1KIL C;  4IFF A;  1HGV A;  2C0W A;  1S9K D;  2A45 H;  2ZFC A;  4I2L C;  5AVY B;  4JYC A;  3L36 A;  1FU1 A;  1JOC A;  3U1A A;  1JCC A;  4WY4 B;  3HUS C;  5AVQ B;  3I5C A;  1OXZ A;  1IC2 A;  3V4W A;  5CCG A;  4N78 E;  1H89 A;  2WZ7 A;  1JO5 A;  4C7R A;  3B8E B;  2NPS C;  1GU4 A;  1SQV K;  3E1I A;  5CJ4 A;  1A02 J;  2L5G B;  4ZKP A;  2OYI B;  1OWA A;  1CI6 A;  3V2Q A;  1LWU B;  1N73 B;  2FFD A;  2N1T B;  3HRN A;  1RE3 C;  1HBW A;  3M9B A;  2FFD C;  3NFQ A;  5AVU B;  5AW4 B;  2H7H A;  2KLV A;  2A45 G;  4WY4 D;  1URQ C;  4Y99 B;  1JY2 O;  2WPR A;  4W80 A;  3RL0 C;  1GDT A;  1LTT C;  2WTY A;  1WRG A;  2WT7 B;  2O1J A;  3WMM 0;  3TK1 A;  2R5D A;  2HG5 D;  2P67 A;  2IFN A;  1G1J A;  5CCH A;  5KJ7 A;  1RF1 C;  1GL2 A;  5APX A;  5AW0 B;  3RK3 C;  2QM8 A;  1SP4 A;  1LTJ A;  1KIL B;  2JEE A;  2N1T D;  3EFG A;  1LTJ C;  1NOH A;  5APV A;  2E42 A;  2R32 A;  1ZLL A;  2GUS A;  3B5N A;  4M3L A;  4IFD K;  1QL1 A;  2Q5U A;  3HE5 B;  3HUS B;  1IFN A;  1NTM K;  1NAF A;  3MD0 A;  4DOJ A;  1T8Z A;  1DEB A;  1HH0 A;  4C46 A;  1KZU B;  1KQL A;  3KQG A;  4LC1 A;  2PAJ A;  3HD7 B;  2FYZ A;  3LW5 H;  1M1J B;  1ZR4 A;  3IFM A;  3HTK B;  3N7N A;  2IFM A;  2KYV A;  3L35 A;  1FZE A;  1G2C B;  1KIL D;  3HE4 A;  2GM4 A;  1NTK K;  1GK6 A;  4LGD E;  1L4A B;  3VMY A;  1J1D B;  1IO4 A;  4AQR D;  1JUN A;  4WY4 A;  1T3U A;  3TYY A;  3V2P A;  4C7N B;  4EIJ A;  1JY2 N;  2HLO A;  2KB7 P;  1FZB A;  1FZC C;  3BRT B;  2OAR A;  4XE5 B;  3HD7 D;  3GHG A;  3T97 A;  1T2K D;  2OYI A;  1RE4 C;  1RF0 C;  2Z5H A;  1LWU A;  1N73 A;  3OA7 A;  2PP6 A;  3OAK A;  1L4A D;  2OYH A;  4WBA A;  2OYH C;  1L0N K;  2WSC H;  5AVS B;  3VP9 A;  3KDP B;  1FBM A;  1MV8 A;  2LKM A;  1N7S B;  1JCD A;  2WT7 A;  2I1J A;  4JF7 A;  1H88 A;  5APS A;  2N9B A;  2O01 H;  2H43 A;  5CCG C;  1IFI A;  4N78 D;  1MFZ A;  4OH8 B;  5KTB A;  3C9I A;  2W6A A;  2HYN A;  3MIW A;  1SLQ A;  1S9K E;  1N2D C;  2HPC B;  3BVH A;  4RES B;  1SFC A;  2FKW B;  3VOP A;  2BAS A;  1JTH B;  1ZV8 A;  2YKO A;  2C0X A;  1FZG A;  5AW9 B;  1FZC B;  1N7S D;  1SQQ K;  5AW8 B;  3HD7 A;  1JMM A;  2Q9I A;  1LT9 B;  3O8Z A;  2XNX A;  1M1J A;  5BU8 B;  5APW A;  2IX7 C;  3BAS A;  1H8A A;  3HTK A;  3BAT A;  2W6B A;  2A45 I;  1FDM A;  3MTU E;  1E5W A;  1L4A A;  4IFM A;  2R5B A;  5AW7 B;  1NH4 A;  3M9H A;  3V4Q A;  5CCH C;  5KJ7 C;  1GL2 C;  1J1E C;  1IFM A;  4B86 A;  3VN0 A;  5KLV K;  1NU1 K;  5AVW B;  5AVX B;  1HVV A;  2Q3I A;  1NKZ B;  2KP8 A;  5APU A;  2C9N Y;  3A7O A;  2WSF H;  5AW2 B;  3B5N C;  1CZQ A;  2XZR A;  4I6M C;  2POH A;  3VMZ A;  5APQ A;  3CL3 D;  2XV5 A;  1GW4 A;  1EQ7 A;  2NPS B;  2J59 M;  1Z56 A;  2WPQ A;  2GUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...