3H32A

Crystal structure of d-dimer from human fibrin complexed with gly-his-arg-pro-tyr-amide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrinogen alpha chain
publication title Two families of synthetic peptides that enhance fibrin turbidity and delay fibrinolysis by different mechanisms.
pubmed doi rcsb
molecule tags Blood clotting
total genus 20
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08702 Fib_alpha Fibrinogen alpha/beta chain family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3h32A00
1RF0C 1RE4A 1LT9A 3E1IA 2XNXA 1RE3C 2HODA 2FFDC 1FZGA 1RF1C 1N73A 2Q9IA 1FZCA 1M1JB 1LWUA 1JY2N 1JY2P 3HUSC 3BVHA 2OYIB 3GHGB 1FZAA 1N86A 1FZFA 2OYHC 2A45H 1JY3N 1JY3P 1LTJB 1M1JA 2Z4EA 1RE4C 3H32B 1LT9C 2H43A 1T3UA 2OYIA 2HLOA 1JY2O 3GHGA 1RF1B 2FFDB 1FZCC 1N73C 3HUSB 1FZBA 1LTJA 1LWUC 1RF0A 3H32A 2A45I 1RE3A 2HPCB 1JY3O 2OYHB 1RF1A 1W2EA 2FFDA 3HUSA 1FZEA 2OYIC 1LT9B 1M1JC 2A45G 3GHGC 2HODB 2HPCA 2OYHA 1N73B 1FZCB 1LTJC 1LWUB
chains in the Genus database with same CATH superfamily
1FU1A 1LNQA 1L0LG 3VYIA 1YTZT 3WUUA 2M5AB 3L71G 2V7QH 3RK3E 1N73C 1SQXG 2K3RA 2O01H 4OVNF 4PD4E 4UB8E 4YXDC 1YIJP 1SQVD 3LIEA 2YO3A 4ASWA 1PPJE 1L0NG 1LT9C 3VMXA 2BCCG 2KS1B 3FXEA 4H44D 3V6IA 3U1AA 3QWOC 4I1LA 2W83C 4H44B 1BCCE 3EQ2A 1PFIA 4L76A 1IO4A 1MUUA 3AECC 1YQ3C 5AW7B 1NTMK 5CHXA 3R4YA 4Y28J 1OW6A 4U7JA 3HUSA 1FAVA 2FYNC 5AVYB 3UIAA 2W90A 3A0BH 2IFNA 2BCCJ 1P84I 2OYHC 2W6BA 2A06G 2Y9ZA 1IFJA 2GUVA 1ZR2A 3H1KJ 4D6TG 1ZW0A 1LWUB 2WSSH 1JOCA 5CCHD 3L74J 1T2KD 1NTZK 3O6QA 1YBKA 5KJ7C 1FJKA 2K1AA 2HPCA 3AEDC 4BWNA 1G2CA 4N6JA 3CXHI 1URQC 2KSJA 5AW5B 4ZKUA 3TNUB 5KAIH 1HH0A 3BCCD 1KORA 4R4MA 5TISE 1KMIZ 3PRJA 1DH3A 1NTKK 3AE9C 1PGQA 4LGDE 5APVA 1KILD 1H8AA 2JKVA 4NPEA 1KILB 3H1JD 2ZYDA 1IFDA 3M9HA 1GZLA 1FC2C 1A02F 3TGUG 1BE3D 3MTUE 1GU4A 1VPCA 2HG5D 3H1HD 3Q3DA 5E79H 2IYPA 1EZVI 2ZVOB 2FXOA 2PGDA 4TLFA 1KZUB 2FKWB 3SFEC 2V4HA 1IZNB 2FYUD 3G3ZA 3H1KE 3G71P 1ZMEC 1W2BO 1JM0A 3PHLA 3H1LG 2XV5A 3L70D 3L74E 1VDFA 2Y0EA 2J5UA 3L72J 4KHXA 2P58A 2QVAA 2ZT9B 1IC2A 2J59M 2WSCH 3HTKA 3T97A 1KQGB 3PTZA 4RO0A 1VQ5P 1GMJA 1N8RQ 1KYOI 3BVHA 1ZXGA 1FE6A 5H2FE 1J1EC 3W68A 2E76C 3CX5H 1VF5C 1ZRTE 3MUDC 4GOFA 3H6PA 3M06A 4OH8B 3F5HA 1GL2A 1P84D 2P67A 3AE7C 1HVVA 1M1JB 1NU1E 4IFFA 2ZYGA 2JDIH 1LP1B 4I7ZC 1RF1A 4GODA 2E74D 4QMAA 2P1JA 2E76B 4PD4H 4UB8H 5AW6B 3RBZA 3RK2D 2E75C 3RK2B 1SQVJ 3WUTA 2KUBA 4PJ0H 3CCQP 2CPBA 5AW4B 2QM8A 2KNCA 1RE4A 3WUVA 1NGMB 3L75J 3RL0D 4I7ZB 5KLVJ 1FDMA 3PP5A 4OGQD 2GA1A 3L72E 1SQPD 4BRYA 1L0LK 3A2AA 3CC2P 2YXRB 1H89A 2R3CA 1XTCC 3L71D 1KQFB 5AVXB 1SQXD 1VQ4P 3KYQA 3CCEP 1YJWP 5KTBA 1M8OB 1BDDA 4JPZB 3HUSB 1QLED 2YMYA 2QM7A 2A45G 4TT3H 2I1JA 2NPSA 3BCCG 1L0ND 1L4AA 1OXZA 1EQ7A 1RQUA 3P8CE 1JY3N 2RN0A 4C7RA 2P2UA 4Z1MH 1RE3A 2B9BA 5CCHA 1KQLA 3AE4C 4M3LA 2KLVA 1FBMA 1SQVE 2UWJE 2LXBA 1DEEG 3H1HG 2WQYC 2WTYA 3O6QB 4IFMA 4H13D 3IR9A 2HPCB 2K37A 1G2CB 1UIXA 1MKMA 4NPDA 3L75E 4H13B 3EWKA 5KLVE 3RBXA 3A3YB 5KKZC 2A06D 1TU3F 3E1RA 3AEBC 4HH2A 3MIWA 2OTLP 5KAIE 4D6TD 1M56D 1AJYA 2IYOA 4ZNCA 2KZIA 5BVZA 3H1JJ 3KPEA 1BGYD 2IBZE 3II6A 2B89A 1BE3J 1EDJA 3C8VA 3M91A 1VQ6P 1SFCD 3AE3C 2JWAA 2HLOA 1HTLC 1Y8AA 1CW5A 3TK1A 1SQBG 3SWYA 2FBWC 2FYUJ 2LR2A 2E42A 2ZXEB 2KIKA 2YXQB 2BEQD 5AW3B 3L70J 3AEGC 4OWFA 2FYZA 3KQGA 1NTZE 2JR8A 3P32A 3EFGA 3SWKA 4GT1A 5KLIC 3NTNA 2XNXA 4HKZH 1FZCA 1SS1A 1X9VA 2N1TC 1H0TA 3CMEP 1MFTA 1NJIQ 1T8ZA 1U7JA 2R5DA 2QJPB 3OJAB 3TF5A 2A45I 3HTKB 3T97B 2FFDA 4LC1A 4EDFA 3M0DA 1JTHA 1VQ8P 1AFOA 2Q6QA 3GG2A 1JNMA 1KV4A 4PV1D 3L4FA 1JO5A 1KB9D 5KLIB 4WY4A 2IZ1A 4AYCA 2IZ0A 1GL2D 1PZQA 1GL2B 1IK9A 1BE3E 1CI6A 3I56P 3L37A 3G6EP 3E7KA 3PH0A 1DIPA 2XU6A 2OGUA 5BU5A 2FY8A 3H1IG 4C7NA 3JSVC 4H44C 1RF1B 2E43A 1VQMP 3A7OA 2FYUE 5TJHA 3N7NA 3L73J 2N9BA 3V2PA 1HBWA 4RJTA 4O9BA 1Y47A 3GLMA 3PJSK 4LLHA 3B5ND 1SQVK 5APQA 3MGNA 3CCSP 1JY2P 2AEJA 3Q1MA 2Q7CA 2Z4EA 4PJ0E 1RF0A 1SQPJ 1LT1A 1L0LJ 2M3EA 5KLVK 1LTTC 4U3FD 1LTGC 2ITAA 1Q81Q 3L71J 3TSIA 5AVZB 4BRYB 1SQXJ 2NZ2A 3TDKA 1LWUC 2LKMA 1H88A 1FZEA 2W6JH 1DX7A 1SQQD 1P84E 5CCHC 4N78D 5GTIE 1L0NJ 3IF4A 1T2KC 1NTMD 5APWA 2NPSD 1L4AD 1HJ0A 3CWBD 4AQRD 2Q5UA 2NPSB 5DJTB 1L4AB 1VQKP 4YTPC 2WITA 1S9KE 2M8RA 4A7PA 2YIUB 1QVGO 3SFDC 2JJLA 1BGYG 2KB7P 3A0HE 3L73E 2WSEJ 2W8ZA 2WPVB 2IDBA 1K8AQ 4DJGA 1EXIA 1JY3O 3CLQA 1LJ2A 2POHA 3CXHE 3VP9A 1JMMA 1IFPA 1U7MA 1IJDB 1KILC 3E1IA 3AE6C 3CCJP 2HODA 4JBZA 2HFED 1U57A 2Y0DA 1E79H 5APTA 1G1IA 4K35A 2CK3H 1SQPE 1YQ4C 4D6TJ 1L0LE 1NU1G 2NRGA 3MHVA 2AEFA 1JUNA 2Q1KA 1E5WA 1EDIA 1S5LE 1YJNP 1NKNA 3SWFA 2H43A 1VL2A 1EZVE 3U59A 1SFCA 1QVFO 1NTKD 1MFZA 2QRXA 3ABVC 1L0NE 3CCVP 3CC4P 2H89C 3M0AA 2BCCE 1FJPA 2P10A 2KI7B 4H0LD 1HGZA 1FZFA 2ZT9C 3IAOA 3CX5D 2M0BA 2OYOA 1DEBA 1S1CX 1FZCC 1JCDA 4ZKPA 2FYUK 2B87A 5AW8B 1AA0A 3BASA 1J2JB 3AE8C 1GW4A 3ITKA 4XE5B 2FFDC 3M0DC 1PP9G 2WSFJ 4KT0J 1X8YA 1QEXA 2A45H 3LW5J 1AVOA 3RK3D 3TGUJ 3F89A 1T6AA 1AVYA 4PD4D 5AVTB 1M1JC 3S4RA 1KYOE 1BSNA 1FZCB 2A06E 1OW8A 3S1KA 1H0TB 1SQBD 4GDOA 1K05A 2CPSA 5CCGA 1Q86Q 5APXA 1PPJD 4D6TE 2OARA 2FFDB 2E74C 1HGVA 2WVRA 3H1LJ 2HYNA 1BCCD 2R3SA 2D2CD 3FGAD 3RK2C 2D2CB 2KYVA 4WY4D 1FDOA 2FXMA 1NAYA 2L91A 4WY4B 1NH4A 3V2RA 3R2PA 4U3FG 1CI6B 3OA7A 1NWQA 1N7SA 1QX8A 3RL0C 2E74B 1AV1A 5CJ4A 3BRTB 4OGQC 4WBAA 4C7NB 1EXJA 2QJKB 3KZIE 2O3JA 4RESB 4YXWH 2ZYAA 1SQQG 3B5NA 2IFMA 1CSBA 4KJMA 1BSHA 1NTMG 4IL6X 1FDIA 2WPRA 3CWBG 3HUSC 4I2LC 3TGUE 3RL0B 5APUA 1SQPK 4OGQB 1Q7YQ 3H32A 1AQTA 3CCRP 2SPZA 1Y9BA 5CMZA 3H1ID 1R8EA 3NMDA 4GIFA 1P84H 1USEA 1N73A 1SQXK 5GTIH 3OAKA 2XDJA 1J1DB 3USSA 3VMZA 1T3UA 3H1LE 2KP8A 3FWLA 1S2EA 1KB9I 2YO2A 3CWBJ 1NTZG 1L0NK 1LT9A 1KN7A 4N3YB 5AVRB 1VQLP 1N7LA 4AUWA 3A0HH 4H13C 3CD6P 1D7MA 2AEMA 1RY3A 3CXHH 4JYBA 1ZP0C 2K88A 5APSA 1T3JA 1LTBC 3AEEC 1S4XA 1QL1A 1Q82Q 1OZHA 2WT7A 1NTKG 3K5BA 1Q2NA 3H1KD 4WVZA 1NOHA 3BCCJ 2HODB 2OYHA 1FS0E 1S5LH 3GW6A 1JCCA 1SFCC 3L74D 2KZJA 1GD2E 2YNYA 1R5LA 4ZMDA 1S3JA 2QA4P 2W6AA 1AQ5A 2H88C 1NKZB 2YKQA 1M57D 3HE4A 3BATA 1OVRA 1PV3A 1IFMA 2QJYC 3H1HJ 3Q2YA 2XZRA 2E5TA 5KJ7A 3FX0A 3P8MC 3C1LA 1ZRTD 3AE1C 1URQA 1SFCB 4ASVA 1HWTC 4UB6E 1PPJG 2G3AA 3V4WA 2I8DA 4Y99B 1PL5A 1Q90D 2ZAEB 3Q5SA 2ZVNB 1NU1D 2QJPC 1BCCG 5M1BA 1JMBA 2WSEH 1KD1Q 2QJYB 1OW7A 2B87B 2MJZA 1FZBA 2PAJA 1L2PA 2BEZF 1ZLLA 3VN0A 3HD7D 2QE7H 1KYOH 4W7YA 1YJ9P 4IL6E 1JY2N 5K5GB 1K04A 1LTSC 1GL2C 1NAFA 3GF3A 1EDLA 5AW9B 1SQBJ 3BCCE 2R5BA 4EOTA 3Q5RA 1S5LX 5CCGD 1YI2P 4EIJA 1FOSE 2O1KA 1OWAA 2BASA 1EC5A 1RF1C 3QH9A 1KILE 1K9MQ 1PGOA 3ZDMA 2K9JA 4PV1B 3H1JE 1LGHB 2O01N 1PP9D 4L73A 3VMAA 3H1HE 4W80A 2Q9IA 1NHLA 3GMAA 3RGUA 5C39A 5CJ0A 1N7SD 5B66H 1RE4C 3KZIH 1HF9A 1N7SB 2QSIA 4IOIH 2AXTH 3CX5I 4JQ0D 1KTMA 1X0TA 2WSFH 1USDA 3L70E 3P8CD 3LW5H 2Y9YA 1FZAA 4BXLA 3B5NB 3MUDA 4B86A 3GHGA 3I55P 3BRVB 2G8YA 2KNCB 5AVWB 3CPWO 3JCUH 3CCMP 2R44A 3S9OA 1DD4A 5AW1B 1EZVG 1ZOYC 1GDTA 1OVVA 3H1IJ 4PD4I 1SQBE 3B8EB 2NPSC 1KB9H 3H32B 1L4AC 2OYIA 2IX7C 3VTPC 3GF7A 3VOPA 4HJGH 3L75D 5KLVD 2YIUC 1N73B 2RH0A 3FWNA 5AVVB 3H1KG 1SQQK 3LIDA 1RE3C 1GW3A 2PFXA 1WMKA 3G4SP 3D6ZA 3L74G 2JEEA 2IBZD 1LT9B 2Q3EA 3KXDA 3NXSA 1IFIA 1SLQA 5AVUB 1JB0J 2N9YB 5BU8B 5APYA 1XTGB 2KOGA 1RH5B 1GTWA 1MV8A 2WT7B 2Y0CA 1KFNA 1FOSF 2FYNB 2P7JA 2WMMA 5AVQB 3HRNA 1NTZD 1SVFA 2OYHB 3RL0g 4EI2A 2W27A 1WRGA 3H1IE 5CBOA 3KDPB 3L71E 4HB1A 2B88A 4H0LC 1KC8Q 3JC22 1BGYJ 1SQXE 3V2QA 2O1JA 3C9IA 3HE4B 5B5EH 1LTJA 4UB6H 5AW2B 5KJ7D 4K3AA 4XFJA 1URQD 3PLNA 3CC7P 3RK3C 1URQB 1W5CE 1NU1J 4WB4A 3MD0A 4H0LB 3W67A 2H8PD 3A5TA 3L72G 2RKLA 1G1JA 1M90Q 2WPQA 1RHZB 1JEKA 3WU2E 4IL6H 2QIWA 3HD7A 1QGKB 1NVOA 5KAFH 2QEXP 4DCKA 2ZXXA 2D2CC 2V7QJ 3RK3B 3H25A 3HE5A 2C9NY 3CCUP 4WY4C 1ZR4A 2O01J 1HJBA 2FXPA 2H7HA 3M9QA 4WWIA 3EFFK 1SQBK 2YKOA 3V2NA 1LTIC 2ZT9D 1JY2O 4EYYQ 4I6MC 3AE2C 1JTHB 2J58A 2C0WA 2QJKC 5GTHE 3VMYA 1BGYE 1PP9J 2K9JB 4L74A 1UIIA 4MN4C 1VQPP 1PGJA 1WT6A 1SQVG 2PRRA 1VQOP 1M1KQ 1RQVA 3D70A 3G9RA 1HUCA 3GHGC 2N1TA 1NO4A 1MZ9A 2RMZA 1RF0C 4R4LA 2KLUA 3L75G 3I5CA 5KLVG 3L36A 4GKGA 5B66E 1KFMA 5DJUB 2KXPB 2M5AA 2E76D 3TYYA 1OX3A 1VF5D 2AXTE 1J1EB 2JP3A 2OYIC 1J1DC 2ZJSE 1S9KD 1VF5B 2Z5HA 1S72P 1BDCA 3M9BA 3GHGB 2IBZG 4U3FJ 3L73D 2OTJP 3L35A 3CXHD 4DZOA 2OTKE 1QL2A 2KS1A 3JCUE 1VQNP 2HR3A 1FZGA 3V5BA 5EFWB 2OYIB 1SQQJ 4RKUJ 2QG4A 2E75D 3B71A 4GOEA 1KB9E 5L8RJ 1L0LD 2GM4A 2E75B 1EDKA 3MP7B 1NTMJ 1OFCX 1CZQA 1PP9E 2LXCB 2GUSA 3P7KA 3WMM0 2L5GB 2E5YA 3IFMA 1EZVD 3CL3D 3SSUA 3V4QA 2OQQA 1GK4A 3IN6A 3U1CA 3A0BE 2BCCD 3AE5C 2C9LY 2JWDA 1LWUA 3VP8A 1M7LA 1PIXA 1NTZJ 3B4SA 1K73Q 3O8ZA 3H1JG 1LTJC 2R32A 4XA4A 2MKVA 4U3FE 2VRSA 1BE3G 1N86A 4C46A 3FXDA 2YMKA 3TNUA 5AVSB 1PGPA 4Y99C 3CMAP 1KQSO 1Z56A 1X22A 2K9YA 1R5SA 2WWWA 1KYOD 5TISH 2IPPA 3CI9A 2FYUG 2WSCJ 1SQQE 1NTKJ 2I1KA 3D71A 1IFNA 2DW3A 4N78E 3KHUA 1LTJB 1OIPA 4YPCA 1NTME 3L70G 1KILA 2PP6A 5B5EE 3HD7C 2C0XA 3CWBE 3N4XA 2JO1A 2IBZI 3D6YA 3WU2H 1OVUA 1IK7A 1NU1K 1X79B 5KKZB 1JY3P 1GU5A 4HYTB 5CCGC 1SP4A 1A02J 1NYHA 1W2EA 1YYCA 5E79E 5AW0B 3HD7B 5CBNA 4DT0A 3CCLP 4PV1C 4CPGA 2KSEA 5KAFE 4JYCA 1GK6A 4JF7A 2WZ7A 1ZV8A 3HE5B 4NPFX 3OW2O 1YHQP 3AEAC 4IFDK 1YITP 2Z5IA 1VQ7P 5GTHH 1BCCJ 2KK7A 3TGUD 1N7SC 3AEFC 3L72D 5H2FH 1ZN5A 3NFQA 2ZFCA 2XKMA 3MZWB 4W7ZA 2AXCA 3L73G 1NTKE 3B5NC 1VQ9P 3Q5PA 2XNDH 1DD3A 3H1LD 1M1JA 1LTAC 2M3BA 2N1TD 3CX5E 1OMIA 2YKPA 4DOJA 2N1TB 1LP1A 4L75A 2WPSA 1N2DC 2Q3IA 1YTZI 1SQPG
chains in the Genus database with same CATH topology
1FU1A 5CJ4A 3BRTB 4WBAA 4C7NB 4HH2A 3MIWA 3VYIA 1YTZT 3V2QA 4RESB 3B5NA 2O1JA 3C9IA 3HE4B 1N73C 1LTJA 5BVZA 2O01H 2IFMA 1CSBA 5AW2B 3KPEA 5KJ7D 3II6A 3LIEA 2YO3A 2WPRA 1URQD 3HUSC 4I2LC 3M91A 3RK3C 3RL0B 1SFCD 1URQB 5APUA 1LT9C 3VMXA 4WB4A 2HLOA 1HTLC 3MD0A 1SQPK 1CW5A 3TK1A 3H32A 3U1AA 2H8PD 3SWYA 3A5TA 4I1LA 3EQ2A 1PFIA 5CMZA 1IO4A 3NMDA 1G1JA 2WPQA 4GIFA 2E42A 2ZXEB 1N73A 1SQXK 3OAKA 2XDJA 1J1DB 1MUUA 3HD7A 5AW3B 5AW7B 3VMZA 1NTMK 1T3UA 5CHXA 2FYZA 2KP8A 3KQGA 3RK3B 3P32A 3EFGA 2YO2A 3HE5A 1FAVA 3HUSA 5AVYB 2C9NY 3UIAA 4WY4C 4GT1A 1ZR4A 1HJBA 2H7HA 1L0NK 3M9QA 1LT9A 4N3YB 3NTNA 2XNXA 5AVRB 2IFNA 1FZCA 1SQBK 1N7LA 2YKOA 4AUWA 1X9VA 2OYHC 2N1TC 3V2NA 1T8ZA 2W6BA 1LTIC 1JY2O 1RY3A 2R5DA 4I6MC 3OJAB 1IFJA 2A45I 2GUVA 3HTKB 1JTHB 2J58A 4LC1A 4JYBA 1ZR2A 2FFDA 3M0DA 2C0WA 1JTHA 5APSA 3VMYA 1T3JA 1LWUB 1LTBC 1AFOA 1JOCA 1QL1A 1JNMA 5CCHD 2WT7A 3L4FA 1JO5A 4WY4A 4AYCA 1WT6A 1T2KD 1NTZK 1GL2D 5KJ7C 1IK9A 1GL2B 1NOHA 1CI6A 1HUCA 3L37A 3GHGC 2HODB 1FJKA 2HPCA 2OYHA 1G2CA 2N1TA 1NO4A 4N6JA 1MZ9A 1URQC 2KSJA 1RF0C 5AW5B 1JCCA 1SFCC 2XU6A 4ZKUA 5BU5A 3I5CA 3TNUB 3L36A 1GD2E 4GKGA 4C7NA 1KFMA 2YNYA 1HH0A 1RF1B 2E43A 3A7OA 2W6AA 3N7NA 3TYYA 1AQ5A 1J1EB 1NKZB 2YKQA 3HE4A 2OYIC 2N9BA 3V2PA 1HBWA 3BATA 1J1DC 1DH3A 1S9KD 1NTKK 4O9BA 4LLHA 2Z5HA 1IFMA 3B5ND 1SQVK 5APQA 4LGDE 5APVA 1KILD 3MGNA 1JY2P 1H8AA 3M9BA 3GHGB 2Q7CA 2XZRA 5KJ7A 3P8MC 1KILB 2Z4EA 1URQA 1IFDA 1SFCB 3L35A 1RF0A 3M9HA 4DZOA 1HWTC 1GZLA 1A02F 1QL2A 3MTUE 1GU4A 1VPCA 3V4WA 2HG5D 5KLVK 4Y99B 1LTTC 1LTGC 1FZGA 3V5BA 3TSIA 2OYIB 1KZUB 5AVZB 2FKWB 2WSEH 2MJZA 2GM4A 1FZBA 1LWUC 3G3ZA 2PAJA 2LKMA 1H88A 1ZLLA 3VN0A 1CZQA 1FZEA 3HD7D 1DX7A 4W7YA 2GUSA 2XV5A 5CCHC 4N78D 1JY2N 3P7KA 3WMM0 2L5GB 1T2KC 1LTSC 1GL2C 1NAFA 1VDFA 5APWA 5AW9B 2NPSD 3IFMA 2R5BA 4EOTA 4KHXA 1L4AD 3CL3D 4AQRD 3V4QA 2Q5UA 2NPSB 1IC2A 1L4AB 1GK4A 5CCGD 2J59M 2WSCH 4EIJA 3HTKA 2WITA 2O1KA 1FOSE 1OWAA 2BASA 3T97A 3U1CA 1S9KE 2C9LY 1RF1C 2M8RA 1LWUA 3BVHA 3VP8A 1J1EC 2JJLA 2KB7P 1LGHB 1M7LA 1JY3O 3CLQA 2POHA 3VP9A 1JMMA 3H6PA 3M06A 3O8ZA 4OH8B 1GL2A 1LTJC 1IJDB 2R32A 1KILC 3E1IA 4XA4A 2HODA 2P67A 4W80A 2VRSA 1NHLA 2Q9IA 1HVVA 1M1JB 2HFED 5CJ0A 4IFFA 1N7SD 1N86A 4C46A 5APTA 1RE4C 1G1IA 3TNUA 5AVSB 1N7SB 4Y99C 1Z56A 1RF1A 2WWWA 1JUNA 2P1JA 2IPPA 1E5WA 3CI9A 5AW6B 3RK2D 2WSFH 2I1KA 3P8CD 1IFNA 3LW5H 4N78E 3RK2B 1FZAA 3B5NB 3MUDA 1LTJB 4B86A 1NKNA 3SWFA 2H43A 3GHGA 3BRVB 1KILA 2PP6A 3HD7C 2C0XA 2CPBA 3U59A 5AVWB 5AW4B 1SFCA 2QM8A 1MFZA 3N4XA 1RE4A 5AW1B 3RL0D 3M0AA 1GDTA 1FDMA 1FJPA 3PP5A 1NU1K 1X79B 1HGZA 3B8EB 1FZFA 2NPSC 1JY3P 3H32B 1L4AC 2OYIA 1DEBA 2IX7C 1GU5A 1FZCC 1JCDA 3VTPC 4ZKPA 3VOPA 1L0LK 2FYUK 3A2AA 4HYTB 5CCGC 1SP4A 1A02J 1H89A 1W2EA 2R3CA 5AW8B 1YYCA 1XTCC 3BASA 1J2JB 5AW0B 1N73B 1GW4A 4XE5B 5AVVB 5AVXB 3HD7B 1SQQK 3LIDA 1RE3C 2FFDC 3M0DC 1X8YA 1GW3A 2A45H 3KYQA 3RK3D 5KTBA 4JYCA 1GK6A 4JF7A 2WZ7A 1ZV8A 3HE5B 3HUSB 2YMYA 2JEEA 2QM7A 5AVTB 1LT9B 1M1JC 2A45G 4IFDK 2I1JA 2NPSA 2Z5IA 1FZCB 1L4AA 1OXZA 1N7SC 1EQ7A 2CPSA 5CCGA 5APXA 3NXSA 1IFIA 3P8CE 1SLQA 5AVUB 1ZN5A 5BU8B 1JY3N 5APYA 4C7RA 2P2UA 2OARA 2FFDB 1XTGB 3NFQA 1HGVA 2KOGA 2ZFCA 2XKMA 1RE3A 2HYNA 5CCHA 1GTWA 1KQLA 4M3LA 2KLVA 4W7ZA 3RK2C 1MV8A 3B5NC 2KYVA 4WY4D 2WT7B 2FXMA 1KFNA 1FBMA 1FOSF 4WY4B 2P7JA 1NH4A 5AVQB 3V2RA 1M1JA 3HRNA 1LTAC 2M3BA 2WTYA 2N1TD 3R2PA 1CI6B 3OA7A 2YKPA 4IFMA 3IR9A 1SVFA 2HPCB 1NWQA 4DOJA 1G2CB 2N1TB 2OYHB 1N7SA 2W27A 3RL0C 1WRGA 1N2DC 2Q3IA 1YTZI 2WPSA 3KDPB 3A3YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RF0 C;  1RE4 A;  1LT9 A;  3E1I A;  2XNX A;  1RE3 C;  2HOD A;  2FFD C;  1FZG A;  1RF1 C;  1N73 A;  2Q9I A;  1FZC A;  1M1J B;  1LWU A;  1JY2 N;  1JY2 P;  3HUS C;  3BVH A;  2OYI B;  3GHG B;  1FZA A;  1N86 A;  1FZF A;  2OYH C;  2A45 H;  1JY3 N;  1JY3 P;  1LTJ B;  1M1J A;  2Z4E A;  1RE4 C;  3H32 B;  1LT9 C;  2H43 A;  1T3U A;  2OYI A;  2HLO A;  1JY2 O;  3GHG A;  1RF1 B;  2FFD B;  1FZC C;  1N73 C;  3HUS B;  1FZB A;  1LTJ A;  1LWU C;  1RF0 A;  3H32 A;  2A45 I;  1RE3 A;  2HPC B;  1JY3 O;  2OYH B;  1RF1 A;  1W2E A;  2FFD A;  3HUS A;  1FZE A;  2OYI C;  1LT9 B;  1M1J C;  2A45 G;  3GHG C;  2HOD B;  2HPC A;  2OYH A;  1N73 B;  1FZC B;  1LTJ C;  1LWU B; 
#chains in the Genus database with same CATH topology
 1FU1 A;  1LNQ A;  1L0L G;  3VYI A;  1YTZ T;  3WUU A;  2M5A B;  3L71 G;  2V7Q H;  3RK3 E;  1N73 C;  1SQX G;  2K3R A;  2O01 H;  4OVN F;  4PD4 E;  4UB8 E;  4YXD C;  1YIJ P;  1SQV D;  3LIE A;  2YO3 A;  4ASW A;  1PPJ E;  1L0N G;  1LT9 C;  3VMX A;  2BCC G;  2KS1 B;  3FXE A;  4H44 D;  3V6I A;  3U1A A;  3QWO C;  4I1L A;  2W83 C;  4H44 B;  1BCC E;  3EQ2 A;  1PFI A;  4L76 A;  1IO4 A;  1MUU A;  3AEC C;  1YQ3 C;  5AW7 B;  1NTM K;  5CHX A;  3R4Y A;  4Y28 J;  1OW6 A;  4U7J A;  3HUS A;  1FAV A;  2FYN C;  5AVY B;  3UIA A;  2W90 A;  3A0B H;  2IFN A;  2BCC J;  1P84 I;  2OYH C;  2W6B A;  2A06 G;  2Y9Z A;  1IFJ A;  2GUV A;  1ZR2 A;  3H1K J;  4D6T G;  1ZW0 A;  1LWU B;  2WSS H;  1JOC A;  5CCH D;  3L74 J;  1T2K D;  1NTZ K;  3O6Q A;  1YBK A;  5KJ7 C;  1FJK A;  2K1A A;  2HPC A;  3AED C;  4BWN A;  1G2C A;  4N6J A;  3CXH I;  1URQ C;  2KSJ A;  5AW5 B;  4ZKU A;  3TNU B;  5KAI H;  1HH0 A;  3BCC D;  1KOR A;  4R4M A;  5TIS E;  1KMI Z;  3PRJ A;  1DH3 A;  1NTK K;  3AE9 C;  1PGQ A;  4LGD E;  5APV A;  1KIL D;  1H8A A;  2JKV A;  4NPE A;  1KIL B;  3H1J D;  2ZYD A;  1IFD A;  3M9H A;  1GZL A;  1FC2 C;  1A02 F;  3TGU G;  1BE3 D;  3MTU E;  1GU4 A;  1VPC A;  2HG5 D;  3H1H D;  3Q3D A;  5E79 H;  2IYP A;  1EZV I;  2ZVO B;  2FXO A;  2PGD A;  4TLF A;  1KZU B;  2FKW B;  3SFE C;  2V4H A;  1IZN B;  2FYU D;  3G3Z A;  3H1K E;  3G71 P;  1ZME C;  1W2B O;  1JM0 A;  3PHL A;  3H1L G;  2XV5 A;  3L70 D;  3L74 E;  1VDF A;  2Y0E A;  2J5U A;  3L72 J;  4KHX A;  2P58 A;  2QVA A;  2ZT9 B;  1IC2 A;  2J59 M;  2WSC H;  3HTK A;  3T97 A;  1KQG B;  3PTZ A;  4RO0 A;  1VQ5 P;  1GMJ A;  1N8R Q;  1KYO I;  3BVH A;  1ZXG A;  1FE6 A;  5H2F E;  1J1E C;  3W68 A;  2E76 C;  3CX5 H;  1VF5 C;  1ZRT E;  3MUD C;  4GOF A;  3H6P A;  3M06 A;  4OH8 B;  3F5H A;  1GL2 A;  1P84 D;  2P67 A;  3AE7 C;  1HVV A;  1M1J B;  1NU1 E;  4IFF A;  2ZYG A;  2JDI H;  1LP1 B;  4I7Z C;  1RF1 A;  4GOD A;  2E74 D;  4QMA A;  2P1J A;  2E76 B;  4PD4 H;  4UB8 H;  5AW6 B;  3RBZ A;  3RK2 D;  2E75 C;  3RK2 B;  1SQV J;  3WUT A;  2KUB A;  4PJ0 H;  3CCQ P;  2CPB A;  5AW4 B;  2QM8 A;  2KNC A;  1RE4 A;  3WUV A;  1NGM B;  3L75 J;  3RL0 D;  4I7Z B;  5KLV J;  1FDM A;  3PP5 A;  4OGQ D;  2GA1 A;  3L72 E;  1SQP D;  4BRY A;  1L0L K;  3A2A A;  3CC2 P;  2YXR B;  1H89 A;  2R3C A;  1XTC C;  3L71 D;  1KQF B;  5AVX B;  1SQX D;  1VQ4 P;  3KYQ A;  3CCE P;  1YJW P;  5KTB A;  1M8O B;  1BDD A;  4JPZ B;  3HUS B;  1QLE D;  2YMY A;  2QM7 A;  2A45 G;  4TT3 H;  2I1J A;  2NPS A;  3BCC G;  1L0N D;  1L4A A;  1OXZ A;  1EQ7 A;  1RQU A;  3P8C E;  1JY3 N;  2RN0 A;  4C7R A;  2P2U A;  4Z1M H;  1RE3 A;  2B9B A;  5CCH A;  1KQL A;  3AE4 C;  4M3L A;  2KLV A;  1FBM A;  1SQV E;  2UWJ E;  2LXB A;  1DEE G;  3H1H G;  2WQY C;  2WTY A;  3O6Q B;  4IFM A;  4H13 D;  3IR9 A;  2HPC B;  2K37 A;  1G2C B;  1UIX A;  1MKM A;  4NPD A;  3L75 E;  4H13 B;  3EWK A;  5KLV E;  3RBX A;  3A3Y B;  5KKZ C;  2A06 D;  1TU3 F;  3E1R A;  3AEB C;  4HH2 A;  3MIW A;  2OTL P;  5KAI E;  4D6T D;  1M56 D;  1AJY A;  2IYO A;  4ZNC A;  2KZI A;  5BVZ A;  3H1J J;  3KPE A;  1BGY D;  2IBZ E;  3II6 A;  2B89 A;  1BE3 J;  1EDJ A;  3C8V A;  3M91 A;  1VQ6 P;  1SFC D;  3AE3 C;  2JWA A;  2HLO A;  1HTL C;  1Y8A A;  1CW5 A;  3TK1 A;  1SQB G;  3SWY A;  2FBW C;  2FYU J;  2LR2 A;  2E42 A;  2ZXE B;  2KIK A;  2YXQ B;  2BEQ D;  5AW3 B;  3L70 J;  3AEG C;  4OWF A;  2FYZ A;  3KQG A;  1NTZ E;  2JR8 A;  3P32 A;  3EFG A;  3SWK A;  4GT1 A;  5KLI C;  3NTN A;  2XNX A;  4HKZ H;  1FZC A;  1SS1 A;  1X9V A;  2N1T C;  1H0T A;  3CME P;  1MFT A;  1NJI Q;  1T8Z A;  1U7J A;  2R5D A;  2QJP B;  3OJA B;  3TF5 A;  2A45 I;  3HTK B;  3T97 B;  2FFD A;  4LC1 A;  4EDF A;  3M0D A;  1JTH A;  1VQ8 P;  1AFO A;  2Q6Q A;  3GG2 A;  1JNM A;  1KV4 A;  4PV1 D;  3L4F A;  1JO5 A;  1KB9 D;  5KLI B;  4WY4 A;  2IZ1 A;  4AYC A;  2IZ0 A;  1GL2 D;  1PZQ A;  1GL2 B;  1IK9 A;  1BE3 E;  1CI6 A;  3I56 P;  3L37 A;  3G6E P;  3E7K A;  3PH0 A;  1DIP A;  2XU6 A;  2OGU A;  5BU5 A;  2FY8 A;  3H1I G;  4C7N A;  3JSV C;  4H44 C;  1RF1 B;  2E43 A;  1VQM P;  3A7O A;  2FYU E;  5TJH A;  3N7N A;  3L73 J;  2N9B A;  3V2P A;  1HBW A;  4RJT A;  4O9B A;  1Y47 A;  3GLM A;  3PJS K;  4LLH A;  3B5N D;  1SQV K;  5APQ A;  3MGN A;  3CCS P;  1JY2 P;  2AEJ A;  3Q1M A;  2Q7C A;  2Z4E A;  4PJ0 E;  1RF0 A;  1SQP J;  1LT1 A;  1L0L J;  2M3E A;  5KLV K;  1LTT C;  4U3F D;  1LTG C;  2ITA A;  1Q81 Q;  3L71 J;  3TSI A;  5AVZ B;  4BRY B;  1SQX J;  2NZ2 A;  3TDK A;  1LWU C;  2LKM A;  1H88 A;  1FZE A;  2W6J H;  1DX7 A;  1SQQ D;  1P84 E;  5CCH C;  4N78 D;  5GTI E;  1L0N J;  3IF4 A;  1T2K C;  1NTM D;  5APW A;  2NPS D;  1L4A D;  1HJ0 A;  3CWB D;  4AQR D;  2Q5U A;  2NPS B;  5DJT B;  1L4A B;  1VQK P;  4YTP C;  2WIT A;  1S9K E;  2M8R A;  4A7P A;  2YIU B;  1QVG O;  3SFD C;  2JJL A;  1BGY G;  2KB7 P;  3A0H E;  3L73 E;  2WSE J;  2W8Z A;  2WPV B;  2IDB A;  1K8A Q;  4DJG A;  1EXI A;  1JY3 O;  3CLQ A;  1LJ2 A;  2POH A;  3CXH E;  3VP9 A;  1JMM A;  1IFP A;  1U7M A;  1IJD B;  1KIL C;  3E1I A;  3AE6 C;  3CCJ P;  2HOD A;  4JBZ A;  2HFE D;  1U57 A;  2Y0D A;  1E79 H;  5APT A;  1G1I A;  4K35 A;  2CK3 H;  1SQP E;  1YQ4 C;  4D6T J;  1L0L E;  1NU1 G;  2NRG A;  3MHV A;  2AEF A;  1JUN A;  2Q1K A;  1E5W A;  1EDI A;  1S5L E;  1YJN P;  1NKN A;  3SWF A;  2H43 A;  1VL2 A;  1EZV E;  3U59 A;  1SFC A;  1QVF O;  1NTK D;  1MFZ A;  2QRX A;  3ABV C;  1L0N E;  3CCV P;  3CC4 P;  2H89 C;  3M0A A;  2BCC E;  1FJP A;  2P10 A;  2KI7 B;  4H0L D;  1HGZ A;  1FZF A;  2ZT9 C;  3IAO A;  3CX5 D;  2M0B A;  2OYO A;  1DEB A;  1S1C X;  1FZC C;  1JCD A;  4ZKP A;  2FYU K;  2B87 A;  5AW8 B;  1AA0 A;  3BAS A;  1J2J B;  3AE8 C;  1GW4 A;  3ITK A;  4XE5 B;  2FFD C;  3M0D C;  1PP9 G;  2WSF J;  4KT0 J;  1X8Y A;  1QEX A;  2A45 H;  3LW5 J;  1AVO A;  3RK3 D;  3TGU J;  3F89 A;  1T6A A;  1AVY A;  4PD4 D;  5AVT B;  1M1J C;  3S4R A;  1KYO E;  1BSN A;  1FZC B;  2A06 E;  1OW8 A;  3S1K A;  1H0T B;  1SQB D;  4GDO A;  1K05 A;  2CPS A;  5CCG A;  1Q86 Q;  5APX A;  1PPJ D;  4D6T E;  2OAR A;  2FFD B;  2E74 C;  1HGV A;  2WVR A;  3H1L J;  2HYN A;  1BCC D;  2R3S A;  2D2C D;  3FGA D;  3RK2 C;  2D2C B;  2KYV A;  4WY4 D;  1FDO A;  2FXM A;  1NAY A;  2L91 A;  4WY4 B;  1NH4 A;  3V2R A;  3R2P A;  4U3F G;  1CI6 B;  3OA7 A;  1NWQ A;  1N7S A;  1QX8 A;  3RL0 C;  2E74 B;  1AV1 A;  5CJ4 A;  3BRT B;  4OGQ C;  4WBA A;  4C7N B;  1EXJ A;  2QJK B;  3KZI E;  2O3J A;  4RES B;  4YXW H;  2ZYA A;  1SQQ G;  3B5N A;  2IFM A;  1CSB A;  4KJM A;  1BSH A;  1NTM G;  4IL6 X;  1FDI A;  2WPR A;  3CWB G;  3HUS C;  4I2L C;  3TGU E;  3RL0 B;  5APU A;  1SQP K;  4OGQ B;  1Q7Y Q;  3H32 A;  1AQT A;  3CCR P;  2SPZ A;  1Y9B A;  5CMZ A;  3H1I D;  1R8E A;  3NMD A;  4GIF A;  1P84 H;  1USE A;  1N73 A;  1SQX K;  5GTI H;  3OAK A;  2XDJ A;  1J1D B;  3USS A;  3VMZ A;  1T3U A;  3H1L E;  2KP8 A;  3FWL A;  1S2E A;  1KB9 I;  2YO2 A;  3CWB J;  1NTZ G;  1L0N K;  1LT9 A;  1KN7 A;  4N3Y B;  5AVR B;  1VQL P;  1N7L A;  4AUW A;  3A0H H;  4H13 C;  3CD6 P;  1D7M A;  2AEM A;  1RY3 A;  3CXH H;  4JYB A;  1ZP0 C;  2K88 A;  5APS A;  1T3J A;  1LTB C;  3AEE C;  1S4X A;  1QL1 A;  1Q82 Q;  1OZH A;  2WT7 A;  1NTK G;  3K5B A;  1Q2N A;  3H1K D;  4WVZ A;  1NOH A;  3BCC J;  2HOD B;  2OYH A;  1FS0 E;  1S5L H;  3GW6 A;  1JCC A;  1SFC C;  3L74 D;  2KZJ A;  1GD2 E;  2YNY A;  1R5L A;  4ZMD A;  1S3J A;  2QA4 P;  2W6A A;  1AQ5 A;  2H88 C;  1NKZ B;  2YKQ A;  1M57 D;  3HE4 A;  3BAT A;  1OVR A;  1PV3 A;  1IFM A;  2QJY C;  3H1H J;  3Q2Y A;  2XZR A;  2E5T A;  5KJ7 A;  3FX0 A;  3P8M C;  3C1L A;  1ZRT D;  3AE1 C;  1URQ A;  1SFC B;  4ASV A;  1HWT C;  4UB6 E;  1PPJ G;  2G3A A;  3V4W A;  2I8D A;  4Y99 B;  1PL5 A;  1Q90 D;  2ZAE B;  3Q5S A;  2ZVN B;  1NU1 D;  2QJP C;  1BCC G;  5M1B A;  1JMB A;  2WSE H;  1KD1 Q;  2QJY B;  1OW7 A;  2B87 B;  2MJZ A;  1FZB A;  2PAJ A;  1L2P A;  2BEZ F;  1ZLL A;  3VN0 A;  3HD7 D;  2QE7 H;  1KYO H;  4W7Y A;  1YJ9 P;  4IL6 E;  1JY2 N;  5K5G B;  1K04 A;  1LTS C;  1GL2 C;  1NAF A;  3GF3 A;  1EDL A;  5AW9 B;  1SQB J;  3BCC E;  2R5B A;  4EOT A;  3Q5R A;  1S5L X;  5CCG D;  1YI2 P;  4EIJ A;  1FOS E;  2O1K A;  1OWA A;  2BAS A;  1EC5 A;  1RF1 C;  3QH9 A;  1KIL E;  1K9M Q;  1PGO A;  3ZDM A;  2K9J A;  4PV1 B;  3H1J E;  1LGH B;  2O01 N;  1PP9 D;  4L73 A;  3VMA A;  3H1H E;  4W80 A;  2Q9I A;  1NHL A;  3GMA A;  3RGU A;  5C39 A;  5CJ0 A;  1N7S D;  5B66 H;  1RE4 C;  3KZI H;  1HF9 A;  1N7S B;  2QSI A;  4IOI H;  2AXT H;  3CX5 I;  4JQ0 D;  1KTM A;  1X0T A;  2WSF H;  1USD A;  3L70 E;  3P8C D;  3LW5 H;  2Y9Y A;  1FZA A;  4BXL A;  3B5N B;  3MUD A;  4B86 A;  3GHG A;  3I55 P;  3BRV B;  2G8Y A;  2KNC B;  5AVW B;  3CPW O;  3JCU H;  3CCM P;  2R44 A;  3S9O A;  1DD4 A;  5AW1 B;  1EZV G;  1ZOY C;  1GDT A;  1OVV A;  3H1I J;  4PD4 I;  1SQB E;  3B8E B;  2NPS C;  1KB9 H;  3H32 B;  1L4A C;  2OYI A;  2IX7 C;  3VTP C;  3GF7 A;  3VOP A;  4HJG H;  3L75 D;  5KLV D;  2YIU C;  1N73 B;  2RH0 A;  3FWN A;  5AVV B;  3H1K G;  1SQQ K;  3LID A;  1RE3 C;  1GW3 A;  2PFX A;  1WMK A;  3G4S P;  3D6Z A;  3L74 G;  2JEE A;  2IBZ D;  1LT9 B;  2Q3E A;  3KXD A;  3NXS A;  1IFI A;  1SLQ A;  5AVU B;  1JB0 J;  2N9Y B;  5BU8 B;  5APY A;  1XTG B;  2KOG A;  1RH5 B;  1GTW A;  1MV8 A;  2WT7 B;  2Y0C A;  1KFN A;  1FOS F;  2FYN B;  2P7J A;  2WMM A;  5AVQ B;  3HRN A;  1NTZ D;  1SVF A;  2OYH B;  3RL0 g;  4EI2 A;  2W27 A;  1WRG A;  3H1I E;  5CBO A;  3KDP B;  3L71 E;  4HB1 A;  2B88 A;  4H0L C;  1KC8 Q;  3JC2 2;  1BGY J;  1SQX E;  3V2Q A;  2O1J A;  3C9I A;  3HE4 B;  5B5E H;  1LTJ A;  4UB6 H;  5AW2 B;  5KJ7 D;  4K3A A;  4XFJ A;  1URQ D;  3PLN A;  3CC7 P;  3RK3 C;  1URQ B;  1W5C E;  1NU1 J;  4WB4 A;  3MD0 A;  4H0L B;  3W67 A;  2H8P D;  3A5T A;  3L72 G;  2RKL A;  1G1J A;  1M90 Q;  2WPQ A;  1RHZ B;  1JEK A;  3WU2 E;  4IL6 H;  2QIW A;  3HD7 A;  1QGK B;  1NVO A;  5KAF H;  2QEX P;  4DCK A;  2ZXX A;  2D2C C;  2V7Q J;  3RK3 B;  3H25 A;  3HE5 A;  2C9N Y;  3CCU P;  4WY4 C;  1ZR4 A;  2O01 J;  1HJB A;  2FXP A;  2H7H A;  3M9Q A;  4WWI A;  3EFF K;  1SQB K;  2YKO A;  3V2N A;  1LTI C;  2ZT9 D;  1JY2 O;  4EYY Q;  4I6M C;  3AE2 C;  1JTH B;  2J58 A;  2C0W A;  2QJK C;  5GTH E;  3VMY A;  1BGY E;  1PP9 J;  2K9J B;  4L74 A;  1UII A;  4MN4 C;  1VQP P;  1PGJ A;  1WT6 A;  1SQV G;  2PRR A;  1VQO P;  1M1K Q;  1RQV A;  3D70 A;  3G9R A;  1HUC A;  3GHG C;  2N1T A;  1NO4 A;  1MZ9 A;  2RMZ A;  1RF0 C;  4R4L A;  2KLU A;  3L75 G;  3I5C A;  5KLV G;  3L36 A;  4GKG A;  5B66 E;  1KFM A;  5DJU B;  2KXP B;  2M5A A;  2E76 D;  3TYY A;  1OX3 A;  1VF5 D;  2AXT E;  1J1E B;  2JP3 A;  2OYI C;  1J1D C;  2ZJS E;  1S9K D;  1VF5 B;  2Z5H A;  1S72 P;  1BDC A;  3M9B A;  3GHG B;  2IBZ G;  4U3F J;  3L73 D;  2OTJ P;  3L35 A;  3CXH D;  4DZO A;  2OTK E;  1QL2 A;  2KS1 A;  3JCU E;  1VQN P;  2HR3 A;  1FZG A;  3V5B A;  5EFW B;  2OYI B;  1SQQ J;  4RKU J;  2QG4 A;  2E75 D;  3B71 A;  4GOE A;  1KB9 E;  5L8R J;  1L0L D;  2GM4 A;  2E75 B;  1EDK A;  3MP7 B;  1NTM J;  1OFC X;  1CZQ A;  1PP9 E;  2LXC B;  2GUS A;  3P7K A;  3WMM 0;  2L5G B;  2E5Y A;  3IFM A;  1EZV D;  3CL3 D;  3SSU A;  3V4Q A;  2OQQ A;  1GK4 A;  3IN6 A;  3U1C A;  3A0B E;  2BCC D;  3AE5 C;  2C9L Y;  2JWD A;  1LWU A;  3VP8 A;  1M7L A;  1PIX A;  1NTZ J;  3B4S A;  1K73 Q;  3O8Z A;  3H1J G;  1LTJ C;  2R32 A;  4XA4 A;  2MKV A;  4U3F E;  2VRS A;  1BE3 G;  1N86 A;  4C46 A;  3FXD A;  2YMK A;  3TNU A;  5AVS B;  1PGP A;  4Y99 C;  3CMA P;  1KQS O;  1Z56 A;  1X22 A;  2K9Y A;  1R5S A;  2WWW A;  1KYO D;  5TIS H;  2IPP A;  3CI9 A;  2FYU G;  2WSC J;  1SQQ E;  1NTK J;  2I1K A;  3D71 A;  1IFN A;  2DW3 A;  4N78 E;  3KHU A;  1LTJ B;  1OIP A;  4YPC A;  1NTM E;  3L70 G;  1KIL A;  2PP6 A;  5B5E E;  3HD7 C;  2C0X A;  3CWB E;  3N4X A;  2JO1 A;  2IBZ I;  3D6Y A;  3WU2 H;  1OVU A;  1IK7 A;  1NU1 K;  1X79 B;  5KKZ B;  1JY3 P;  1GU5 A;  4HYT B;  5CCG C;  1SP4 A;  1A02 J;  1NYH A;  1W2E A;  1YYC A;  5E79 E;  5AW0 B;  3HD7 B;  5CBN A;  4DT0 A;  3CCL P;  4PV1 C;  4CPG A;  2KSE A;  5KAF E;  4JYC A;  1GK6 A;  4JF7 A;  2WZ7 A;  1ZV8 A;  3HE5 B;  4NPF X;  3OW2 O;  1YHQ P;  3AEA C;  4IFD K;  1YIT P;  2Z5I A;  1VQ7 P;  5GTH H;  1BCC J;  2KK7 A;  3TGU D;  1N7S C;  3AEF C;  3L72 D;  5H2F H;  1ZN5 A;  3NFQ A;  2ZFC A;  2XKM A;  3MZW B;  4W7Z A;  2AXC A;  3L73 G;  1NTK E;  3B5N C;  1VQ9 P;  3Q5P A;  2XND H;  1DD3 A;  3H1L D;  1M1J A;  1LTA C;  2M3B A;  2N1T D;  3CX5 E;  1OMI A;  2YKP A;  4DOJ A;  2N1T B;  1LP1 A;  4L75 A;  2WPS A;  1N2D C;  2Q3I A;  1YTZ I;  1SQP G; 
#chains in the Genus database with same CATH homology
 1FU1 A;  5CJ4 A;  3BRT B;  4WBA A;  4C7N B;  4HH2 A;  3MIW A;  3VYI A;  1YTZ T;  3V2Q A;  4RES B;  3B5N A;  2O1J A;  3C9I A;  3HE4 B;  1N73 C;  1LTJ A;  5BVZ A;  2O01 H;  2IFM A;  1CSB A;  5AW2 B;  3KPE A;  5KJ7 D;  3II6 A;  3LIE A;  2YO3 A;  2WPR A;  1URQ D;  3HUS C;  4I2L C;  3M91 A;  3RK3 C;  3RL0 B;  1SFC D;  1URQ B;  5APU A;  1LT9 C;  3VMX A;  4WB4 A;  2HLO A;  1HTL C;  3MD0 A;  1SQP K;  1CW5 A;  3TK1 A;  3H32 A;  3U1A A;  2H8P D;  3SWY A;  3A5T A;  4I1L A;  3EQ2 A;  1PFI A;  5CMZ A;  1IO4 A;  3NMD A;  1G1J A;  2WPQ A;  4GIF A;  2E42 A;  2ZXE B;  1N73 A;  1SQX K;  3OAK A;  2XDJ A;  1J1D B;  1MUU A;  3HD7 A;  5AW3 B;  5AW7 B;  3VMZ A;  1NTM K;  1T3U A;  5CHX A;  2FYZ A;  2KP8 A;  3KQG A;  3RK3 B;  3P32 A;  3EFG A;  2YO2 A;  3HE5 A;  1FAV A;  3HUS A;  5AVY B;  2C9N Y;  3UIA A;  4WY4 C;  4GT1 A;  1ZR4 A;  1HJB A;  2H7H A;  1L0N K;  3M9Q A;  1LT9 A;  4N3Y B;  3NTN A;  2XNX A;  5AVR B;  2IFN A;  1FZC A;  1SQB K;  1N7L A;  2YKO A;  4AUW A;  1X9V A;  2OYH C;  2N1T C;  3V2N A;  1T8Z A;  2W6B A;  1LTI C;  1JY2 O;  1RY3 A;  2R5D A;  4I6M C;  3OJA B;  1IFJ A;  2A45 I;  2GUV A;  3HTK B;  1JTH B;  2J58 A;  4LC1 A;  4JYB A;  1ZR2 A;  2FFD A;  3M0D A;  2C0W A;  1JTH A;  5APS A;  3VMY A;  1T3J A;  1LWU B;  1LTB C;  1AFO A;  1JOC A;  1QL1 A;  1JNM A;  5CCH D;  2WT7 A;  3L4F A;  1JO5 A;  4WY4 A;  4AYC A;  1WT6 A;  1T2K D;  1NTZ K;  1GL2 D;  5KJ7 C;  1IK9 A;  1GL2 B;  1NOH A;  1CI6 A;  1HUC A;  3L37 A;  3GHG C;  2HOD B;  1FJK A;  2HPC A;  2OYH A;  1G2C A;  2N1T A;  1NO4 A;  4N6J A;  1MZ9 A;  1URQ C;  2KSJ A;  1RF0 C;  5AW5 B;  1JCC A;  1SFC C;  2XU6 A;  4ZKU A;  5BU5 A;  3I5C A;  3TNU B;  3L36 A;  1GD2 E;  4GKG A;  4C7N A;  1KFM A;  2YNY A;  1HH0 A;  1RF1 B;  2E43 A;  3A7O A;  2W6A A;  3N7N A;  3TYY A;  1AQ5 A;  1J1E B;  1NKZ B;  2YKQ A;  3HE4 A;  2OYI C;  2N9B A;  3V2P A;  1HBW A;  3BAT A;  1J1D C;  1DH3 A;  1S9K D;  1NTK K;  4O9B A;  4LLH A;  2Z5H A;  1IFM A;  3B5N D;  1SQV K;  5APQ A;  4LGD E;  5APV A;  1KIL D;  3MGN A;  1JY2 P;  1H8A A;  3M9B A;  3GHG B;  2Q7C A;  2XZR A;  5KJ7 A;  3P8M C;  1KIL B;  2Z4E A;  1URQ A;  1IFD A;  1SFC B;  3L35 A;  1RF0 A;  3M9H A;  4DZO A;  1HWT C;  1GZL A;  1A02 F;  1QL2 A;  3MTU E;  1GU4 A;  1VPC A;  3V4W A;  2HG5 D;  5KLV K;  4Y99 B;  1LTT C;  1LTG C;  1FZG A;  3V5B A;  3TSI A;  2OYI B;  1KZU B;  5AVZ B;  2FKW B;  2WSE H;  2MJZ A;  2GM4 A;  1FZB A;  1LWU C;  3G3Z A;  2PAJ A;  2LKM A;  1H88 A;  1ZLL A;  3VN0 A;  1CZQ A;  1FZE A;  3HD7 D;  1DX7 A;  4W7Y A;  2GUS A;  2XV5 A;  5CCH C;  4N78 D;  1JY2 N;  3P7K A;  3WMM 0;  2L5G B;  1T2K C;  1LTS C;  1GL2 C;  1NAF A;  1VDF A;  5APW A;  5AW9 B;  2NPS D;  3IFM A;  2R5B A;  4EOT A;  4KHX A;  1L4A D;  3CL3 D;  4AQR D;  3V4Q A;  2Q5U A;  2NPS B;  1IC2 A;  1L4A B;  1GK4 A;  5CCG D;  2J59 M;  2WSC H;  4EIJ A;  3HTK A;  2WIT A;  2O1K A;  1FOS E;  1OWA A;  2BAS A;  3T97 A;  3U1C A;  1S9K E;  2C9L Y;  1RF1 C;  2M8R A;  1LWU A;  3BVH A;  3VP8 A;  1J1E C;  2JJL A;  2KB7 P;  1LGH B;  1M7L A;  1JY3 O;  3CLQ A;  2POH A;  3VP9 A;  1JMM A;  3H6P A;  3M06 A;  3O8Z A;  4OH8 B;  1GL2 A;  1LTJ C;  1IJD B;  2R32 A;  1KIL C;  3E1I A;  4XA4 A;  2HOD A;  2P67 A;  4W80 A;  2VRS A;  1NHL A;  2Q9I A;  1HVV A;  1M1J B;  2HFE D;  5CJ0 A;  4IFF A;  1N7S D;  1N86 A;  4C46 A;  5APT A;  1RE4 C;  1G1I A;  3TNU A;  5AVS B;  1N7S B;  4Y99 C;  1Z56 A;  1RF1 A;  2WWW A;  1JUN A;  2P1J A;  2IPP A;  1E5W A;  3CI9 A;  5AW6 B;  3RK2 D;  2WSF H;  2I1K A;  3P8C D;  1IFN A;  3LW5 H;  4N78 E;  3RK2 B;  1FZA A;  3B5N B;  3MUD A;  1LTJ B;  4B86 A;  1NKN A;  3SWF A;  2H43 A;  3GHG A;  3BRV B;  1KIL A;  2PP6 A;  3HD7 C;  2C0X A;  2CPB A;  3U59 A;  5AVW B;  5AW4 B;  1SFC A;  2QM8 A;  1MFZ A;  3N4X A;  1RE4 A;  5AW1 B;  3RL0 D;  3M0A A;  1GDT A;  1FDM A;  1FJP A;  3PP5 A;  1NU1 K;  1X79 B;  1HGZ A;  3B8E B;  1FZF A;  2NPS C;  1JY3 P;  3H32 B;  1L4A C;  2OYI A;  1DEB A;  2IX7 C;  1GU5 A;  1FZC C;  1JCD A;  3VTP C;  4ZKP A;  3VOP A;  1L0L K;  2FYU K;  3A2A A;  4HYT B;  5CCG C;  1SP4 A;  1A02 J;  1H89 A;  1W2E A;  2R3C A;  5AW8 B;  1YYC A;  1XTC C;  3BAS A;  1J2J B;  5AW0 B;  1N73 B;  1GW4 A;  4XE5 B;  5AVV B;  5AVX B;  3HD7 B;  1SQQ K;  3LID A;  1RE3 C;  2FFD C;  3M0D C;  1X8Y A;  1GW3 A;  2A45 H;  3KYQ A;  3RK3 D;  5KTB A;  4JYC A;  1GK6 A;  4JF7 A;  2WZ7 A;  1ZV8 A;  3HE5 B;  3HUS B;  2YMY A;  2JEE A;  2QM7 A;  5AVT B;  1LT9 B;  1M1J C;  2A45 G;  4IFD K;  2I1J A;  2NPS A;  2Z5I A;  1FZC B;  1L4A A;  1OXZ A;  1N7S C;  1EQ7 A;  2CPS A;  5CCG A;  5APX A;  3NXS A;  1IFI A;  3P8C E;  1SLQ A;  5AVU B;  1ZN5 A;  5BU8 B;  1JY3 N;  5APY A;  4C7R A;  2P2U A;  2OAR A;  2FFD B;  1XTG B;  3NFQ A;  1HGV A;  2KOG A;  2ZFC A;  2XKM A;  1RE3 A;  2HYN A;  5CCH A;  1GTW A;  1KQL A;  4M3L A;  2KLV A;  4W7Z A;  3RK2 C;  1MV8 A;  3B5N C;  2KYV A;  4WY4 D;  2WT7 B;  2FXM A;  1KFN A;  1FBM A;  1FOS F;  4WY4 B;  2P7J A;  1NH4 A;  5AVQ B;  3V2R A;  1M1J A;  3HRN A;  1LTA C;  2M3B A;  2WTY A;  2N1T D;  3R2P A;  1CI6 B;  3OA7 A;  2YKP A;  4IFM A;  3IR9 A;  1SVF A;  2HPC B;  1NWQ A;  4DOJ A;  1G2C B;  2N1T B;  2OYH B;  1N7S A;  2W27 A;  3RL0 C;  1WRG A;  1N2D C;  2Q3I A;  1YTZ I;  2WPS A;  3KDP B;  3A3Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...