3H32A

Crystal structure of d-dimer from human fibrin complexed with gly-his-arg-pro-tyr-amide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
b'IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrinogen alpha chain
molecule tags Blood clotting
publication title Two families of synthetic peptides that enhance fibrin turbidity and delay fibrinolysis by different mechanisms.
pubmed doi rcsb
total genus 20
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08702 Fib_alpha Fibrinogen alpha/beta chain family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3h32A00
1JY3N 2HLOA 3HUSA 1LTJA 2Z4EA 2A45I 1N86A 1M1JA 1JY2N 2OYIC 2OYHB 1LT9B 2A45G 1T3UA 1JY2P 3GHGB 1M1JC 2Q9IA 1RF0A 1W2EA 1FZCC 1N73B 3H32B 1RF0C 1M1JB 2H43A 1LTJB 1RE3C 1RE4A 3HUSB 2HODA 1FZCB 1RE3A 2OYIB 1LWUA 2OYHA 1LT9C 2HODB 3GHGC 1FZCA 2HPCB 3E1IA 1RF1B 3H32A 2XNXA 1FZAA 2FFDA 1RE4C 2OYIA 1N73A 1FZEA 1JY3O 2FFDC 2A45H 3HUSC 1LWUC 1JY2O 1FZGA 1LT9A 3GHGA 1RF1A 2FFDB 2OYHC 1FZFA 2HPCA 1RF1C 3BVHA 1LWUB 1N73C 1LTJC 1JY3P 1FZBA
chains in the Genus database with same CATH superfamily
2YO3A 3LIDA 5KAIH 3CMAP 3L37A 1T6AA 1QX8A 2E74B 2IX7C 4Y99C 2L91A 4ZNCA 1MV8A 1NTMJ 2E75D 2W6BA 2Z5IA 3CX5I 1ZN5A 3GHGB 4RKUJ 4U3FJ 4ASVA 5K5GB 1AFOA 1NU1K 1OMIA 2KZJA 2R5DA 1DEEG 2XKMA 3M9QA 5KLVK 2WSCH 5APVA 2YXQB 3H32B 4BXLA 1NU1D 2Q1KA 4Z1MH 1NAFA 3P8CE 4N78D 3RK3B 3CCLP 2YXRB 1HVVA 1X9VA 3CCRP 1T2KC 3KHUA 5KAFE 4GKGA 4IL6E 4U3FD 3AE9C 1M56D 3B5NB 3B8EB 2ZVNB 3MD0A 1YQ3C 5B66H 1K73Q 1SLQA 2KI7B 1Y9BA 1IO4A 5CCGD 2ZVOB 4DOJA 2IYPA 2O3JA 5KKZC 5C39A 1Q81Q 2PFXA 3PHLA 2QJYB 4D6TD 3HE5B 2NPSC 1T3JA 2N9YB 3GLMA 3MZWB 4CPGA 1N8RQ 2OYIC 3KZIH 3TNUB 1ZMEC 1SQQG 3CCMP 3A0HE 2V7QH 2KLVA 4H0LB 5B66E 1SP4A 3MUDA 3NXSA 4U3FG 1VQ9P 4GOFA 3G3ZA 4HB1A 3VN0A 3I55P 3MP7B 3L35A 2OYOA 1JMBA 3NMDA 3RK3D 4I7ZC 1HBWA 1J1EC 2FYUE 3CC2P 3PH0A 2PP6A 1RQVA 3LW5H 4C7NB 4PV1D 1EXIA 1R5SA 2O1JA 3H1JD 3CCQP 1BCCJ 1GW4A 2QA4P 3S1KA 2KUBA 1FZEA 2FXPA 3VP8A 2QVAA 1H0TB 4IFDK 2FXMA 3HD7C 1FS0E 2P67A 3B5NC 3PRJA 2QRXA 4YXWH 1YJ9P 1PP9J 3RGUA 2DW3A 3A5TA 2AEMA 2Q3EA 3AEFC 1M7LA 1QL2A 4OVNF 4WY4C 5KKZB 3SWFA 1G1JA 2FY8A 3CWBD 3IR9A 1HF9A 1MFZA 1L4AB 1ZP0C 3A7OA 2I1KA 1VQ4P 2JKVA 3H1KJ 1VF5C 1TU3F 2R3SA 3IFMA 4YTPC 3V5BA 2Q7CA 1YI2P 4RO0A 3CL3D 4W7YA 1ZR2A 3L70D 1GL2C 3P8MC 3L73J 4D6TE 1R5LA 1RE3C 1SQXE 4ZMDA 2OYHC 3AE5C 2H7HA 1S2EA 2FXOA 1M57D 3L74J 5B5EH 3BCCD 1FOSF 1Q2NA 1QGKB 1EQ7A 1N7SB 2Q6QA 5CJ0A 2KSEA 1J1EB 2QM8A 2YKPA 3P8CD 5AVSB 1RF1B 1X22A 1BGYE 1ZV8A 2KK7A 3RL0B 1DEBA 2GA1A 2W8ZA 3AE6C 1NTMG 2E74D 2CK3H 1KILE 2OQQA 2OTJP 4XE5B 1FZFA 2WQYC 3C9IA 3F89A 3S9OA 3TNUA 3ITKA 2BCCD 1S9KD 1LWUB 2BCCG 1U7MA 5AVQB 1G2CA 3CXHH 4A7PA 3SFDC 1LNQA 1LTTC 1LTJA 2A45I 1OVRA 2E76C 2B87B 1LT9B 3USSA 3PLNA 4DCKA 1PV3A 5BU8B 4HJGH 2A06G 2N1TD 1LT1A 2IBZD 5GTIH 1ZLLA 4GT1A 2HFED 1BGYJ 1KB9D 1NTZK 2E75B 1SQXD 3R2PA 3T97B 3GW6A 1L4AC 3CCSP 5GTHE 1LJ2A 2C0WA 1Y47A 4EYYQ 1LWUA 3CXHI 1JOCA 3NFQA 1FJKA 2ZT9D 2L5GB 1SQXJ 2KSJA 2OGUA 3CXHD 3HD7D 1RE4C 3L73E 1HGVA 3OAKA 3QWOC 4Y99B 4D6TJ 2ZXEB 4QMAA 1AA0A 1LTBC 2IFNA 2YMKA 3U1AA 4C7RA 1SFCA 2FFDC 4ASWA 4DJGA 1LT9A 1SQVK 4PD4D 3H1KE 4W7ZA 1NWQA 3L74G 4D6TG 4WY4A 1URQB 1GU4A 3GMAA 1W2BO 1P84H 2RKLA 2POHA 4RJTA 1S3JA 1YITP 2QM7A 3I5CA 1NTMK 3RK3C 1M8OB 4AQRD 1JTHA 4H44D 1EDKA 1NU1J 3L71J 5APWA 1Q86Q 5KJ7D 3R4YA 1EZVE 2AXCA 1ZRTE 1NVOA 1OW7A 3HUSB 1BCCE 2H88C 1GL2A 1Y8AA 1OXZA 3L72E 5DJTB 1QVGO 1HGZA 1RE3A 5GTIE 2OYHA 2HG5D 2JR8A 2YIUC 1T8ZA 1YYCA 2YKOA 3E1IA 2FBWC 1P84D 3L75E 5AW5B 2KB7P 3CCEP 4H0LD 2OTKE 3O8ZA 3B71A 1BDCA 3HRNA 4HYTB 2YMYA 4K3AA 1L0LE 1VF5B 2Y0CA 3AECC 4AYCA 2IBZI 1T2KD 1A02F 1DH3A 1LGHB 3V2RA 3KQGA 1SQPJ 2FYNB 2J5UA 3AE2C 1GL2B 3N4XA 1E79H 4GODA 4Y28J 3HUSA 5CCGA 1JMMA 1PP9D 3G9RA 4I2LC 4JYBA 3U1CA 3HTKA 4L74A 1JY2P 2NZ2A 2Y0DA 1L0NG 1MFTA 2E74C 3IAOA 2XNDH 2V7QJ 5DJUB 3BATA 3KXDA 1LTIC 3M91A 1NTKJ 5APXA 1E5WA 3GF7A 2HODA 5AVYB 1J1DC 1PPJD 3H1JJ 3Q5RA 4PJ0H 1DD3A 2BASA 3AEDC 3CX5H 1OX3A 1YTZT 2I8DA 5GTHH 4DZOA 1GL2D 4L73A 4N78E 5AW4B 1NH4A 1SFCB 2YIUB 3L75G 2KNCB 5AVZB 1JNMA 2A45H 1NKZB 1ZRTD 1SQBJ 4TLFA 3W67A 4U3FE 1KQLA 1IJDB 1IC2A 1NTME 1BE3G 4R4LA 2HPCA 5CCHC 3BVHA 3V2QA 2D2CD 2E5TA 2WSEH 1NOHA 2YNYA 1NGMB 1KD1Q 5APSA 4H13C 1PFIA 2WSFH 1XTCC 4ZKUA 2WSCJ 4UB8H 2NPSB 2Y0EA 1SQVE 1K9MQ 1VQLP 5CHXA 4GDOA 1ZR4A 1AVYA 3FWLA 1GZLA 1M1JC 3L75D 1IZNB 2VRSA 1QVFO 3IF4A 3L4FA 1DIPA 3M0DC 3MGNA 1NU1G 1FDOA 2WT7B 3Q5PA 1L0LD 2P58A 3V6IA 4EDFA 1HJBA 1GW3A 2ZAEB 3BRVB 4U7JA 3BCCE 2JO1A 2K9JA 1NTZE 3L36A 1L0LK 3VMYA 2FYUG 3AE7C 3FWNA 2N1TB 4GIFA 1LTGC 3WMM0 1M1KQ 4OWFA 4WB4A 3A0BE 1URQD 2V4HA 1JY2O 1FZGA 3GHGA 5AW0B 1LTSC 2IDBA 1N7SA 2MKVA 2N9BA 5BVZA 1S4XA 3L70E 3RK2D 3BCCG 1IFMA 1JEKA 4HKZH 1W5CE 1MZ9A 1URQA 2WT7A 2IYOA 1NJIQ 3H1HJ 3H1LE 5CCGC 3G6EP 4LC1A 1IK9A 1NHLA 2ZT9B 3BRTB 4H13B 3H1KG 3ZDMA 5KLVJ 1HH0A 1RF0A 2R32A 2W6JH 3NTNA 2XZRA 2O01N 1M1JB 3TGUD 1LTJB 3BASA 2G3AA 1PL5A 4H13D 3CC7P 2K3RA 3CLQA 3L72G 4BWNA 2KLUA 5CCHD 3TSIA 1SQXK 4IFFA 5H2FH 1AQTA 1PPJE 2AXTE 3MIWA 1FZAA 3LIEA 1SQVD 3EFFK 5APUA 2XV5A 1WRGA 4OGQD 4RESB 3WU2E 1VQNP 3CMEP 1CZQA 1OVVA 3E1RA 4JBZA 5TJHA 1FDIA 1VPCA 4OH8B 5APYA 3VYIA 4M3LA 2Z4EA 2B89A 3KZIE 4YPCA 1YTZI 2BCCE 1J1DB 1GMJA 2W90A 2H89C 3P32A 5CJ4A 2QEXP 1S9KE 4GOEA 2E43A 1VQ6P 3SSUA 2QE7H 4OGQC 2Q9IA 1SQQJ 3VTPC 1OW6A 1G1IA 1ZOYC 3L70G 5TISE 3CCUP 3AE4C 1CSBA 1N2DC 3M9HA 1KQSO 3P7KA 1AV1A 2ITAA 3L72D 4TT3H 2QIWA 2ZYAA 3FX0A 2IBZE 3EQ2A 4LGDE 3TDKA 2P1JA 5CBNA 5AVRB 3Q5SA 1HTLC 1PZQA 1SQQD 1N7SC 2KS1B 3O6QA 5AW2B 2R5BA 1H0TA 3C1LA 3VOPA 2KNCA 1PGOA 1HWTC 2AEJA 2B87A 2M0BA 1SQPG 3RL0D 2WTYA 3GF3A 1KB9H 1EZVD 2WSFJ 3RK2C 2OYIA 1CW5A 1FZBA 4ZKPA 4PD4E 1LP1B 1NTKD 2HR3A 2FYUD 2W6AA 3U59A 3VMZA 1SQVG 3FGAD 5TISH 2Z5HA 5KJ7C 1W2EA 4R4MA 4YXDC 3H1LD 1DX7A 1JUNA 2QJYC 3OW2O 4JPZB 5APQA 4EIJA 3KDPB 1YJWP 5AW3B 1FE6A 1RE4A 1SQPD 3K5BA 4PD4H 1K05A 1Z56A 5B5EE 3II6A 1S5LH 3CX5E 3TGUJ 1GTWA 2O01H 3Q1MA 3TGUE 2OYIB 2D2CB 1SQBG 4EI2A 1VQPP 2WZ7A 3AE3C 2JEEA 1BE3J 4DT0A 2FKWB 3CWBE 2QJPB 3E7KA 3H1HD 3H6PA 3HD7A 5AW1B 1K8AQ 1H88A 2C9LY 2FFDB 3TF5A 2Y9YA 3TYYA 3PP5A 1EC5A 1GK6A 1L0NJ 1SFCD 2ZT9C 4I1LA 1KQFB 3V4WA 2Y9ZA 3GG2A 3OA7A 3AE8C 5AVWB 1NKNA 5AVXB 1N73C 2OTLP 2FYUK 2FYZA 3JSVC 4EOTA 1KV4A 1KYOH 3H1ID 3H1JG 3G4SP 1FDMA 1FC2C 2IPPA 3FXEA 5CMZA 5CCHA 2WPSA 2N1TC 3HD7B 5KLIB 1OW8A 3H1LG 2KP8A 2AEFA 1FU1A 3AE1C 2E42A 1KILC 4XFJA 1FJPA 4PD4I 1SQPE 1A02J 2O01J 1CI6B 2ZFCA 3H1IJ 3RBXA 2JWAA 1HJ0A 4JYCA 4UB6E 1OIPA 3M0DA 3IN6A 1PP9G 2QG4A 4KJMA 1RQUA 3CCVP 1GK4A 5AVVB 2J59M 1BDDA 1DD4A 1KYOD 1JY3O 1L0ND 3V2NA 1VQ8P 3CI9A 3V4QA 1JTHB 3F5HA 1KB9I 3HTKB 3SFEC 1YQ4C 2OARA 1BE3D 1LP1A 2YKQA 2ZYDA 1MKMA 1FOSE 1KORA 1VQ7P 1KB9E 1CI6A 3SWYA 1SQBD 1RH5B 3CX5D 4O9BA 1K04A 1WMKA 3RBZA 1U7JA 1HUCA 2O1KA 5KTBA 2I1JA 2HYNA 3KPEA 1KQGB 3QH9A 1NTZD 4H0LC 1NU1E 1RY3A 2KIKA 5KLVE 2IZ0A 1PGQA 1N73B 2LXCB 1FZCC 3H1HE 3H1LJ 1VQ5P 2C9NY 2IBZG 1JM0A 1L4AA 1H8AA 1UIXA 1R8EA 4IFMA 4WY4D 2BEQD 2C0XA 4WVZA 5KLIC 1NTKG 3H1IE 1IFIA 4IOIH 2HPCB 4BRYA 1KN7A 2FFDA 3M0AA 2PRRA 1VQKP 3H1HG 3OJAB 4H44C 2M5AA 2M3BA 2G8YA 1NTZJ 4OGQB 1Q7YQ 1RF1A 1KTMA 1EXJA 2BEZF 1YBKA 2KYVA 1S1CX 2PGDA 2RN0A 2CPSA 3BCCJ 4KT0J 1QEXA 3A2AA 1IFNA 4PV1C 1FAVA 4KHXA 3WUVA 3SWKA 4C7NA 1Q82Q 3H25A 3EWKA 4WY4B 3L70J 1N86A 5H2FE 2LXBA 3JCUE 1L0NE 1KYOE 1XTGB 3VMXA 2K37A 2GUSA 2WPRA 5AW9B 3RK3E 2CPBA 3PJSK 3WU2H 1AVOA 2UWJE 1BSHA 1PGPA 3CWBJ 1USEA 2N1TA 1BE3E 4BRYB 1IFDA 1D7MA 1FZCB 1KILA 1PPJG 4PJ0E 3W68A 2E5YA 2RMZA 1FBMA 1L4AD 2W83C 2NPSD 3GHGC 3HE5A 1P84I 3CWBG 3RK2B 3T97A 1SQBE 3A0HH 2SPZA 2R44A 3RL0C 5BU5A 1VQOP 2XNXA 3L71D 3D71A 3L71G 1QL1A 4NPEA 2WPQA 2MJZA 1USDA 2P7JA 3HUSC 1IFJA 1L2PA 1J2JB 1OZHA 2E76D 1S5LX 2JDIH 2NPSA 2P10A 4L75A 1KC8Q 1NTKK 1GDTA 1SQVJ 3L74E 5CBOA 3H1JE 2Q3IA 3D6ZA 2WVRA 1JCDA 3PTZA 2LKMA 1KILB 1JY3N 3JCUH 4JQ0D 4NPFX 1NTKE 3H1IG 2B88A 5EFWB 4AUWA 1JY2N 4HH2A 2JJLA 2A45G 2KXPB 2H8PD 1YJNP 3HE4A 3D6YA 1X8YA 1NTZG 2B9BA 2IFMA 4PV1B 3KYQA 1NO4A 2XDJA 2QJKB 5AVUB 5AW7B 2QJPC 3VMAA 5KJ7A 3Q2YA 5KLVD 3CD6P 1PIXA 5M1BA 1SQXG 2WITA 1KFNA 1PP9E 2GUVA 4L76A 1BGYD 1JCCA 1KYOI 3LW5J 3S4RA 1EDLA 4B86A 2Q5UA 3TK1A 1RHZB 2KOGA 1LTAC 1KILD 5L8RJ 3UIAA 3V2PA 1VL2A 1MUUA 1SQQK 2M5AB 2A06D 5E79E 4WBAA 1BCCG 1VF5D 2WSSH 3B5NA 1SQQE 2WPVB 1L0NK 1LWUC 2QSIA 3HE4B 4XA4A 1N7LA 4N6JA 1UIIA 2BCCJ 4UB6H 1KMIZ 1OWAA 2E76B 2FYUJ 2WSEJ 5AW8B 4C46A 1JY3P 2OYHB 1S5LE 2PAJA 3B4SA 1SFCC 2JWDA 2M3EA 3B5ND 1YHQP 1M1JA 2KZIA 1H89A 3CC4P 1L0LJ 1T3UA 3Q3DA 3WUUA 3AEAC 2IZ1A 3L71E 2YO2A 1NTMD 3AEEC 1Q90D 5KLVG 2H43A 3L75J 3L74D 3TGUG 2P2UA 2GM4A 1L0LG 2QJKC 3N7NA 4NPDA 2NRGA 1IFPA 3CXHE 3L73D 3L73G 2K1AA 4H44B 4I6MC 1QLED 2HODB 2LR2A 3L72J 2W27A 2AXTH 1KZUB 1NYHA 3FXDA 3H1KD 1GD2E 4I7ZB 1URQC 4W80A 4LLHA 2M8RA 4JF7A 1EDIA 3MTUE 1U57A 1OFCX 1SQBK 4N3YB 5APTA 1EDJA 2XU6A 1NAYA 1JB0J 1LTJC 1JO5A 5AW6B 2HLOA 3JC22 2FYNC 2ZXXA 5KAFH 3MUDC 1ZXGA 4IL6H 2K88A 4K35A 4UB8E 1AQ5A 5AVTB 1VDFA 3ABVC 4MN4C 1ZW0A 2ZYGA 3WUTA 3M06A 1BCCD 3G71P 1KFMA 1EZVI 1M90Q 5E79H 3CPWO 2R3CA 1N7SD 1RF0C 3O6QB 3D70A 2KS1A 3C8VA 2K9YA 1S72P 1WT6A 1OVUA 3MHVA 2J58A 3CCJP 1VQMP 4IL6X 1P84E 1EZVG 1SVFA 1BGYG 2D2CC 2WMMA 3VP9A 3I56P 1LT9C 1FZCA 1SQPK 1PGJA 3AEBC 1AJYA 1GU5A 3H32A 3M9BA 5KAIE 4WWIA 1X0TA 1N73A 3A0BH 2WWWA 2JP3A 2E75C 3RL0g 3AEGC 2ZJSE 1SS1A 1IK7A 3EFGA 1BSNA 2RH0A 2K9JB 2A06E 1YIJP 1RF1C 1X79B 1G2CB 3A3YB
chains in the Genus database with same CATH topology
2YO3A 3LIDA 3L37A 2IX7C 4Y99C 1MV8A 2W6BA 2Z5IA 3GHGB 1JNMA 1ZN5A 1AFOA 1NU1K 2XKMA 2R5DA 3M9QA 5KLVK 2WSCH 5APVA 3H32B 1NAFA 3P8CE 4N78D 3RK3B 1HVVA 1X9VA 1T2KC 4GKGA 3B8EB 3B5NB 3MD0A 1SLQA 1IO4A 5CCGD 4DOJA 3HE5B 2NPSC 1T3JA 2OYIC 3TNUB 2KLVA 1SP4A 3MUDA 3NXSA 3G3ZA 3VN0A 3L35A 3NMDA 3RK3D 1J1EC 2PP6A 4C7NB 3LW5H 2O1JA 1GW4A 1FZEA 3VP8A 4IFDK 2FXMA 3HD7C 2P67A 3B5NC 3A5TA 4WY4C 3SWFA 1M7LA 1QL2A 1G1JA 3IR9A 1MFZA 1L4AB 3A7OA 2I1KA 3IFMA 3V5BA 2Q7CA 3CL3D 4W7YA 1ZR2A 1GL2C 3P8MC 1RE3C 2H7HA 1FOSF 1EQ7A 1N7SB 5CJ0A 2QM8A 1J1EB 3P8CD 2YKPA 5AVSB 1RF1B 3RL0B 1ZV8A 1DEBA 4XE5B 1FZFA 3C9IA 3TNUA 1S9KD 1LWUB 5AVQB 1G2CA 1LTTC 1LTJA 2A45I 1LT9B 5BU8B 2N1TD 1ZLLA 4GT1A 2HFED 3R2PA 1NTZK 1L4AC 2C0WA 1LWUA 1JOCA 3NFQA 1FJKA 2L5GB 3OAKA 2KSJA 3HD7D 1RE4C 4Y99B 1HGVA 2ZXEB 4C7RA 1LTBC 2IFNA 3U1AA 2FFDC 1SFCA 1LT9A 1SQVK 4W7ZA 1NWQA 4WY4A 1URQB 1GU4A 2POHA 2QM7A 3I5CA 1NTMK 3RK3C 4AQRD 1JTHA 5APWA 5KJ7D 3HUSB 1GL2A 1OXZA 1HGZA 1RE3A 2OYHA 2HG5D 1T8ZA 1YYCA 2YKOA 3E1IA 5AW5B 2KB7P 3O8ZA 3HRNA 4HYTB 2YMYA 1A02F 4AYCA 1T2KD 1DH3A 1LGHB 3V2RA 3KQGA 3N4XA 5CCGA 1GL2B 3HUSA 1JMMA 3U1CA 4I2LC 4JYBA 3HTKA 1JY2P 3BATA 1LTIC 3M91A 5APXA 1E5WA 2HODA 1J1DC 2BASA 1YTZT 4DZOA 1GL2D 4N78E 5AW4B 1NH4A 1SFCB 5AVZB 2A45H 1NKZB 1KQLA 1IJDB 1IC2A 2HPCA 5CCHC 3BVHA 3V2QA 2WSEH 1PFIA 2YNYA 1NOHA 2C9LY 5APSA 2WSFH 1XTCC 4ZKUA 2NPSB 5CHXA 1ZR4A 1GZLA 1M1JC 2VRSA 3L4FA 3M0DC 3MGNA 2WT7B 1HJBA 1GW3A 3BRVB 3L36A 3VMYA 1L0LK 4GIFA 2N1TB 3WMM0 1LTGC 4WB4A 1URQD 1JY2O 1FZGA 3GHGA 5AW0B 1LTSC 1N7SA 2N9BA 5BVZA 3RK2D 1IFMA 1MZ9A 1URQA 2WT7A 5CCGC 4LC1A 1IK9A 1NHLA 3BRTB 1HH0A 1RF0A 2R32A 3NTNA 2XZRA 1M1JB 1LTJB 3BASA 3CLQA 5CCHD 3TSIA 1SQXK 4IFFA 3MIWA 1FZAA 3LIEA 5APUA 2XV5A 1WRGA 4RESB 1CZQA 1VPCA 4OH8B 5APYA 3VYIA 4M3LA 2Z4EA 1YTZI 1S9KE 1J1DB 5CJ4A 2E43A 3P32A 2Q9IA 3VTPC 1G1IA 1CSBA 1N2DC 3M9HA 3P7KA 1HBWA 3EQ2A 4LGDE 2P1JA 5AVRB 1HTLC 1N7SC 2R5BA 3VOPA 1HWTC 3RL0D 2WTYA 1CW5A 3RK2C 2OYIA 1FZBA 4ZKPA 2W6AA 3U59A 3VMZA 2Z5HA 5KJ7C 1W2EA 1DX7A 1JUNA 5APQA 4EIJA 3KDPB 5AW3B 1RE4A 1Z56A 3II6A 2OYIB 1GTWA 2O01H 2WZ7A 2JEEA 2FKWB 3H6PA 3HD7A 1H88A 5AW1B 2FFDB 3TYYA 3PP5A 1GK6A 1SFCD 3V4WA 4I1LA 3OA7A 5AVWB 1NKNA 5AVXB 1N73C 2FYUK 2FYZA 4EOTA 2IPPA 5CMZA 5CCHA 2WPSA 2N1TC 3HD7B 2KP8A 1FU1A 2E42A 1KILC 1A02J 1CI6B 2ZFCA 4JYCA 3M0DA 1GK4A 5AVVB 2J59M 1JY3O 3V2NA 3CI9A 3V4QA 1JTHB 3HTKB 2OARA 2YKQA 1FOSE 3SWYA 1CI6A 4O9BA 1HUCA 2O1KA 5KTBA 2I1JA 2HYNA 3KPEA 1RY3A 1FZCC 1N73B 2C9NY 1H8AA 1L4AA 4IFMA 4WY4D 2C0XA 1IFIA 2HPCB 2FFDA 3M0AA 3OJAB 2M3BA 1RF1A 2KYVA 5AVYB 2CPSA 4C7NA 3A2AA 1IFNA 1FAVA 4KHXA 4WY4B 1N86A 3VMXA 1XTGB 5AW9B 2GUSA 2WPRA 2CPBA 2N1TA 1IFDA 1FZCB 1KILA 1FBMA 1L4AD 3HE5A 2NPSD 3GHGC 3RK2B 3T97A 3RL0C 2XNXA 1QL1A 2WPQA 2MJZA 2P7JA 3HUSC 1IFJA 2OYHC 1J2JB 1GDTA 2NPSA 1NTKK 2Q3IA 1JCDA 2LKMA 1KILB 1JY3N 4AUWA 1JY2N 4HH2A 2JJLA 2A45G 2H8PD 3HE4A 1X8YA 2IFMA 3KYQA 1NO4A 2XDJA 5AVUB 5AW7B 5KJ7A 2WITA 1KFNA 2GUVA 1JCCA 4B86A 2Q5UA 3TK1A 2KOGA 1LTAC 1KILD 3UIAA 3V2PA 1MUUA 1SQQK 4WBAA 5BU5A 3B5NA 1FDMA 3HE4B 1L0NK 1LWUC 4XA4A 1N7LA 4N6JA 1OWAA 5AW8B 4C46A 2OYHB 1JY3P 2PAJA 1SFCC 1H89A 3B5ND 1M1JA 1T3UA 2YO2A 2H43A 2P2UA 2GM4A 5AW2B 3N7NA 4I6MC 2HODB 2W27A 1KZUB 1GD2E 1URQC 4W80A 4LLHA 2M8RA 4JF7A 3MTUE 5APTA 1SQBK 4N3YB 2XU6A 1LTJC 1JO5A 5AW6B 2HLOA 1AQ5A 5AVTB 1VDFA 3M06A 1KFMA 2R3CA 1N7SD 1RF0C 1WT6A 2J58A 3VP9A 1SVFA 1FJPA 1LT9C 1FZCA 1SQPK 1GU5A 3H32A 3M9BA 1N73A 2WWWA 3EFGA 1RF1C 1X79B 1G2CB 3A3YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY3 N;  2HLO A;  3HUS A;  1LTJ A;  2Z4E A;  2A45 I;  1N86 A;  1M1J A;  1JY2 N;  2OYI C;  2OYH B;  1LT9 B;  2A45 G;  1T3U A;  1JY2 P;  3GHG B;  1M1J C;  2Q9I A;  1RF0 A;  1W2E A;  1FZC C;  1N73 B;  3H32 B;  1RF0 C;  1M1J B;  2H43 A;  1LTJ B;  1RE3 C;  1RE4 A;  3HUS B;  2HOD A;  1FZC B;  1RE3 A;  2OYI B;  1LWU A;  2OYH A;  1LT9 C;  2HOD B;  3GHG C;  1FZC A;  2HPC B;  3E1I A;  1RF1 B;  3H32 A;  2XNX A;  1FZA A;  2FFD A;  1RE4 C;  2OYI A;  1N73 A;  1FZE A;  1JY3 O;  2FFD C;  2A45 H;  3HUS C;  1LWU C;  1JY2 O;  1FZG A;  1LT9 A;  3GHG A;  1RF1 A;  2FFD B;  2OYH C;  1FZF A;  2HPC A;  1RF1 C;  3BVH A;  1LWU B;  1N73 C;  1LTJ C;  1JY3 P;  1FZB A; 
#chains in the Genus database with same CATH topology
 2YO3 A;  3LID A;  5KAI H;  3CMA P;  3L37 A;  1T6A A;  1QX8 A;  2E74 B;  2IX7 C;  4Y99 C;  2L91 A;  4ZNC A;  1MV8 A;  1NTM J;  2E75 D;  2W6B A;  2Z5I A;  3CX5 I;  1ZN5 A;  3GHG B;  4RKU J;  4U3F J;  4ASV A;  5K5G B;  1AFO A;  1NU1 K;  1OMI A;  2KZJ A;  2R5D A;  1DEE G;  2XKM A;  3M9Q A;  5KLV K;  2WSC H;  5APV A;  2YXQ B;  3H32 B;  4BXL A;  1NU1 D;  2Q1K A;  4Z1M H;  1NAF A;  3P8C E;  4N78 D;  3RK3 B;  3CCL P;  2YXR B;  1HVV A;  1X9V A;  3CCR P;  1T2K C;  3KHU A;  5KAF E;  4GKG A;  4IL6 E;  4U3F D;  3AE9 C;  1M56 D;  3B5N B;  3B8E B;  2ZVN B;  3MD0 A;  1YQ3 C;  5B66 H;  1K73 Q;  1SLQ A;  2KI7 B;  1Y9B A;  1IO4 A;  5CCG D;  2ZVO B;  4DOJ A;  2IYP A;  2O3J A;  5KKZ C;  5C39 A;  1Q81 Q;  2PFX A;  3PHL A;  2QJY B;  4D6T D;  3HE5 B;  2NPS C;  1T3J A;  2N9Y B;  3GLM A;  3MZW B;  4CPG A;  1N8R Q;  2OYI C;  3KZI H;  3TNU B;  1ZME C;  1SQQ G;  3CCM P;  3A0H E;  2V7Q H;  2KLV A;  4H0L B;  5B66 E;  1SP4 A;  3MUD A;  3NXS A;  4U3F G;  1VQ9 P;  4GOF A;  3G3Z A;  4HB1 A;  3VN0 A;  3I55 P;  3MP7 B;  3L35 A;  2OYO A;  1JMB A;  3NMD A;  3RK3 D;  4I7Z C;  1HBW A;  1J1E C;  2FYU E;  3CC2 P;  3PH0 A;  2PP6 A;  1RQV A;  3LW5 H;  4C7N B;  4PV1 D;  1EXI A;  1R5S A;  2O1J A;  3H1J D;  3CCQ P;  1BCC J;  1GW4 A;  2QA4 P;  3S1K A;  2KUB A;  1FZE A;  2FXP A;  3VP8 A;  2QVA A;  1H0T B;  4IFD K;  2FXM A;  3HD7 C;  1FS0 E;  2P67 A;  3B5N C;  3PRJ A;  2QRX A;  4YXW H;  1YJ9 P;  1PP9 J;  3RGU A;  2DW3 A;  3A5T A;  2AEM A;  2Q3E A;  3AEF C;  1M7L A;  1QL2 A;  4OVN F;  4WY4 C;  5KKZ B;  3SWF A;  1G1J A;  2FY8 A;  3CWB D;  3IR9 A;  1HF9 A;  1MFZ A;  1L4A B;  1ZP0 C;  3A7O A;  2I1K A;  1VQ4 P;  2JKV A;  3H1K J;  1VF5 C;  1TU3 F;  2R3S A;  3IFM A;  4YTP C;  3V5B A;  2Q7C A;  1YI2 P;  4RO0 A;  3CL3 D;  4W7Y A;  1ZR2 A;  3L70 D;  1GL2 C;  3P8M C;  3L73 J;  4D6T E;  1R5L A;  1RE3 C;  1SQX E;  4ZMD A;  2OYH C;  3AE5 C;  2H7H A;  1S2E A;  2FXO A;  1M57 D;  3L74 J;  5B5E H;  3BCC D;  1FOS F;  1Q2N A;  1QGK B;  1EQ7 A;  1N7S B;  2Q6Q A;  5CJ0 A;  2KSE A;  1J1E B;  2QM8 A;  2YKP A;  3P8C D;  5AVS B;  1RF1 B;  1X22 A;  1BGY E;  1ZV8 A;  2KK7 A;  3RL0 B;  1DEB A;  2GA1 A;  2W8Z A;  3AE6 C;  1NTM G;  2E74 D;  2CK3 H;  1KIL E;  2OQQ A;  2OTJ P;  4XE5 B;  1FZF A;  2WQY C;  3C9I A;  3F89 A;  3S9O A;  3TNU A;  3ITK A;  2BCC D;  1S9K D;  1LWU B;  2BCC G;  1U7M A;  5AVQ B;  1G2C A;  3CXH H;  4A7P A;  3SFD C;  1LNQ A;  1LTT C;  1LTJ A;  2A45 I;  1OVR A;  2E76 C;  2B87 B;  1LT9 B;  3USS A;  3PLN A;  4DCK A;  1PV3 A;  5BU8 B;  4HJG H;  2A06 G;  2N1T D;  1LT1 A;  2IBZ D;  5GTI H;  1ZLL A;  4GT1 A;  2HFE D;  1BGY J;  1KB9 D;  1NTZ K;  2E75 B;  1SQX D;  3R2P A;  3T97 B;  3GW6 A;  1L4A C;  3CCS P;  5GTH E;  1LJ2 A;  2C0W A;  1Y47 A;  4EYY Q;  1LWU A;  3CXH I;  1JOC A;  3NFQ A;  1FJK A;  2ZT9 D;  2L5G B;  1SQX J;  2KSJ A;  2OGU A;  3CXH D;  3HD7 D;  1RE4 C;  3L73 E;  1HGV A;  3OAK A;  3QWO C;  4Y99 B;  4D6T J;  2ZXE B;  4QMA A;  1AA0 A;  1LTB C;  2IFN A;  2YMK A;  3U1A A;  4C7R A;  1SFC A;  2FFD C;  4ASW A;  4DJG A;  1LT9 A;  1SQV K;  4PD4 D;  3H1K E;  4W7Z A;  1NWQ A;  3L74 G;  4D6T G;  4WY4 A;  1URQ B;  1GU4 A;  3GMA A;  1W2B O;  1P84 H;  2RKL A;  2POH A;  4RJT A;  1S3J A;  1YIT P;  2QM7 A;  3I5C A;  1NTM K;  3RK3 C;  1M8O B;  4AQR D;  1JTH A;  4H44 D;  1EDK A;  1NU1 J;  3L71 J;  5APW A;  1Q86 Q;  5KJ7 D;  3R4Y A;  1EZV E;  2AXC A;  1ZRT E;  1NVO A;  1OW7 A;  3HUS B;  1BCC E;  2H88 C;  1GL2 A;  1Y8A A;  1OXZ A;  3L72 E;  5DJT B;  1QVG O;  1HGZ A;  1RE3 A;  5GTI E;  2OYH A;  2HG5 D;  2JR8 A;  2YIU C;  1T8Z A;  1YYC A;  2YKO A;  3E1I A;  2FBW C;  1P84 D;  3L75 E;  5AW5 B;  2KB7 P;  3CCE P;  4H0L D;  2OTK E;  3O8Z A;  3B71 A;  1BDC A;  3HRN A;  4HYT B;  2YMY A;  4K3A A;  1L0L E;  1VF5 B;  2Y0C A;  3AEC C;  4AYC A;  2IBZ I;  1T2K D;  1A02 F;  1DH3 A;  1LGH B;  3V2R A;  3KQG A;  1SQP J;  2FYN B;  2J5U A;  3AE2 C;  1GL2 B;  3N4X A;  1E79 H;  4GOD A;  4Y28 J;  3HUS A;  5CCG A;  1JMM A;  1PP9 D;  3G9R A;  4I2L C;  4JYB A;  3U1C A;  3HTK A;  4L74 A;  1JY2 P;  2NZ2 A;  2Y0D A;  1L0N G;  1MFT A;  2E74 C;  3IAO A;  2XND H;  2V7Q J;  5DJU B;  3BAT A;  3KXD A;  1LTI C;  3M91 A;  1NTK J;  5APX A;  1E5W A;  3GF7 A;  2HOD A;  5AVY B;  1J1D C;  1PPJ D;  3H1J J;  3Q5R A;  4PJ0 H;  1DD3 A;  2BAS A;  3AED C;  3CX5 H;  1OX3 A;  1YTZ T;  2I8D A;  5GTH H;  4DZO A;  1GL2 D;  4L73 A;  4N78 E;  5AW4 B;  1NH4 A;  1SFC B;  2YIU B;  3L75 G;  2KNC B;  5AVZ B;  1JNM A;  2A45 H;  1NKZ B;  1ZRT D;  1SQB J;  4TLF A;  3W67 A;  4U3F E;  1KQL A;  1IJD B;  1IC2 A;  1NTM E;  1BE3 G;  4R4L A;  2HPC A;  5CCH C;  3BVH A;  3V2Q A;  2D2C D;  2E5T A;  2WSE H;  1NOH A;  2YNY A;  1NGM B;  1KD1 Q;  5APS A;  4H13 C;  1PFI A;  2WSF H;  1XTC C;  4ZKU A;  2WSC J;  4UB8 H;  2NPS B;  2Y0E A;  1SQV E;  1K9M Q;  1VQL P;  5CHX A;  4GDO A;  1ZR4 A;  1AVY A;  3FWL A;  1GZL A;  1M1J C;  3L75 D;  1IZN B;  2VRS A;  1QVF O;  3IF4 A;  3L4F A;  1DIP A;  3M0D C;  3MGN A;  1NU1 G;  1FDO A;  2WT7 B;  3Q5P A;  1L0L D;  2P58 A;  3V6I A;  4EDF A;  1HJB A;  1GW3 A;  2ZAE B;  3BRV B;  4U7J A;  3BCC E;  2JO1 A;  2K9J A;  1NTZ E;  3L36 A;  1L0L K;  3VMY A;  2FYU G;  3AE7 C;  3FWN A;  2N1T B;  4GIF A;  1LTG C;  3WMM 0;  1M1K Q;  4OWF A;  4WB4 A;  3A0B E;  1URQ D;  2V4H A;  1JY2 O;  1FZG A;  3GHG A;  5AW0 B;  1LTS C;  2IDB A;  1N7S A;  2MKV A;  2N9B A;  5BVZ A;  1S4X A;  3L70 E;  3RK2 D;  3BCC G;  1IFM A;  1JEK A;  4HKZ H;  1W5C E;  1MZ9 A;  1URQ A;  2WT7 A;  2IYO A;  1NJI Q;  3H1H J;  3H1L E;  5CCG C;  3G6E P;  4LC1 A;  1IK9 A;  1NHL A;  2ZT9 B;  3BRT B;  4H13 B;  3H1K G;  3ZDM A;  5KLV J;  1HH0 A;  1RF0 A;  2R32 A;  2W6J H;  3NTN A;  2XZR A;  2O01 N;  1M1J B;  3TGU D;  1LTJ B;  3BAS A;  2G3A A;  1PL5 A;  4H13 D;  3CC7 P;  2K3R A;  3CLQ A;  3L72 G;  4BWN A;  2KLU A;  5CCH D;  3TSI A;  1SQX K;  4IFF A;  5H2F H;  1AQT A;  1PPJ E;  2AXT E;  3MIW A;  1FZA A;  3LIE A;  1SQV D;  3EFF K;  5APU A;  2XV5 A;  1WRG A;  4OGQ D;  4RES B;  3WU2 E;  1VQN P;  3CME P;  1CZQ A;  1OVV A;  3E1R A;  4JBZ A;  5TJH A;  1FDI A;  1VPC A;  4OH8 B;  5APY A;  3VYI A;  4M3L A;  2Z4E A;  2B89 A;  3KZI E;  4YPC A;  1YTZ I;  2BCC E;  1J1D B;  1GMJ A;  2W90 A;  2H89 C;  3P32 A;  5CJ4 A;  2QEX P;  1S9K E;  4GOE A;  2E43 A;  1VQ6 P;  3SSU A;  2QE7 H;  4OGQ C;  2Q9I A;  1SQQ J;  3VTP C;  1OW6 A;  1G1I A;  1ZOY C;  3L70 G;  5TIS E;  3CCU P;  3AE4 C;  1CSB A;  1N2D C;  3M9H A;  1KQS O;  3P7K A;  1AV1 A;  2ITA A;  3L72 D;  4TT3 H;  2QIW A;  2ZYA A;  3FX0 A;  2IBZ E;  3EQ2 A;  4LGD E;  3TDK A;  2P1J A;  5CBN A;  5AVR B;  3Q5S A;  1HTL C;  1PZQ A;  1SQQ D;  1N7S C;  2KS1 B;  3O6Q A;  5AW2 B;  2R5B A;  1H0T A;  3C1L A;  3VOP A;  2KNC A;  1PGO A;  1HWT C;  2AEJ A;  2B87 A;  2M0B A;  1SQP G;  3RL0 D;  2WTY A;  3GF3 A;  1KB9 H;  1EZV D;  2WSF J;  3RK2 C;  2OYI A;  1CW5 A;  1FZB A;  4ZKP A;  4PD4 E;  1LP1 B;  1NTK D;  2HR3 A;  2FYU D;  2W6A A;  3U59 A;  3VMZ A;  1SQV G;  3FGA D;  5TIS H;  2Z5H A;  5KJ7 C;  1W2E A;  4R4M A;  4YXD C;  3H1L D;  1DX7 A;  1JUN A;  2QJY C;  3OW2 O;  4JPZ B;  5APQ A;  4EIJ A;  3KDP B;  1YJW P;  5AW3 B;  1FE6 A;  1RE4 A;  1SQP D;  3K5B A;  4PD4 H;  1K05 A;  1Z56 A;  5B5E E;  3II6 A;  1S5L H;  3CX5 E;  3TGU J;  1GTW A;  2O01 H;  3Q1M A;  3TGU E;  2OYI B;  2D2C B;  1SQB G;  4EI2 A;  1VQP P;  2WZ7 A;  3AE3 C;  2JEE A;  1BE3 J;  4DT0 A;  2FKW B;  3CWB E;  2QJP B;  3E7K A;  3H1H D;  3H6P A;  3HD7 A;  5AW1 B;  1K8A Q;  1H88 A;  2C9L Y;  2FFD B;  3TF5 A;  2Y9Y A;  3TYY A;  3PP5 A;  1EC5 A;  1GK6 A;  1L0N J;  1SFC D;  2ZT9 C;  4I1L A;  1KQF B;  3V4W A;  2Y9Z A;  3GG2 A;  3OA7 A;  3AE8 C;  5AVW B;  1NKN A;  5AVX B;  1N73 C;  2OTL P;  2FYU K;  2FYZ A;  3JSV C;  4EOT A;  1KV4 A;  1KYO H;  3H1I D;  3H1J G;  3G4S P;  1FDM A;  1FC2 C;  2IPP A;  3FXE A;  5CMZ A;  5CCH A;  2WPS A;  2N1T C;  3HD7 B;  5KLI B;  1OW8 A;  3H1L G;  2KP8 A;  2AEF A;  1FU1 A;  3AE1 C;  2E42 A;  1KIL C;  4XFJ A;  1FJP A;  4PD4 I;  1SQP E;  1A02 J;  2O01 J;  1CI6 B;  2ZFC A;  3H1I J;  3RBX A;  2JWA A;  1HJ0 A;  4JYC A;  4UB6 E;  1OIP A;  3M0D A;  3IN6 A;  1PP9 G;  2QG4 A;  4KJM A;  1RQU A;  3CCV P;  1GK4 A;  5AVV B;  2J59 M;  1BDD A;  1DD4 A;  1KYO D;  1JY3 O;  1L0N D;  3V2N A;  1VQ8 P;  3CI9 A;  3V4Q A;  1JTH B;  3F5H A;  1KB9 I;  3HTK B;  3SFE C;  1YQ4 C;  2OAR A;  1BE3 D;  1LP1 A;  2YKQ A;  2ZYD A;  1MKM A;  1FOS E;  1KOR A;  1VQ7 P;  1KB9 E;  1CI6 A;  3SWY A;  1SQB D;  1RH5 B;  3CX5 D;  4O9B A;  1K04 A;  1WMK A;  3RBZ A;  1U7J A;  1HUC A;  2O1K A;  5KTB A;  2I1J A;  2HYN A;  3KPE A;  1KQG B;  3QH9 A;  1NTZ D;  4H0L C;  1NU1 E;  1RY3 A;  2KIK A;  5KLV E;  2IZ0 A;  1PGQ A;  1N73 B;  2LXC B;  1FZC C;  3H1H E;  3H1L J;  1VQ5 P;  2C9N Y;  2IBZ G;  1JM0 A;  1L4A A;  1H8A A;  1UIX A;  1R8E A;  4IFM A;  4WY4 D;  2BEQ D;  2C0X A;  4WVZ A;  5KLI C;  1NTK G;  3H1I E;  1IFI A;  4IOI H;  2HPC B;  4BRY A;  1KN7 A;  2FFD A;  3M0A A;  2PRR A;  1VQK P;  3H1H G;  3OJA B;  4H44 C;  2M5A A;  2M3B A;  2G8Y A;  1NTZ J;  4OGQ B;  1Q7Y Q;  1RF1 A;  1KTM A;  1EXJ A;  2BEZ F;  1YBK A;  2KYV A;  1S1C X;  2PGD A;  2RN0 A;  2CPS A;  3BCC J;  4KT0 J;  1QEX A;  3A2A A;  1IFN A;  4PV1 C;  1FAV A;  4KHX A;  3WUV A;  3SWK A;  4C7N A;  1Q82 Q;  3H25 A;  3EWK A;  4WY4 B;  3L70 J;  1N86 A;  5H2F E;  2LXB A;  3JCU E;  1L0N E;  1KYO E;  1XTG B;  3VMX A;  2K37 A;  2GUS A;  2WPR A;  5AW9 B;  3RK3 E;  2CPB A;  3PJS K;  3WU2 H;  1AVO A;  2UWJ E;  1BSH A;  1PGP A;  3CWB J;  1USE A;  2N1T A;  1BE3 E;  4BRY B;  1IFD A;  1D7M A;  1FZC B;  1KIL A;  1PPJ G;  4PJ0 E;  3W68 A;  2E5Y A;  2RMZ A;  1FBM A;  1L4A D;  2W83 C;  2NPS D;  3GHG C;  3HE5 A;  1P84 I;  3CWB G;  3RK2 B;  3T97 A;  1SQB E;  3A0H H;  2SPZ A;  2R44 A;  3RL0 C;  5BU5 A;  1VQO P;  2XNX A;  3L71 D;  3D71 A;  3L71 G;  1QL1 A;  4NPE A;  2WPQ A;  2MJZ A;  1USD A;  2P7J A;  3HUS C;  1IFJ A;  1L2P A;  1J2J B;  1OZH A;  2E76 D;  1S5L X;  2JDI H;  2NPS A;  2P10 A;  4L75 A;  1KC8 Q;  1NTK K;  1GDT A;  1SQV J;  3L74 E;  5CBO A;  3H1J E;  2Q3I A;  3D6Z A;  2WVR A;  1JCD A;  3PTZ A;  2LKM A;  1KIL B;  1JY3 N;  3JCU H;  4JQ0 D;  4NPF X;  1NTK E;  3H1I G;  2B88 A;  5EFW B;  4AUW A;  1JY2 N;  4HH2 A;  2JJL A;  2A45 G;  2KXP B;  2H8P D;  1YJN P;  3HE4 A;  3D6Y A;  1X8Y A;  1NTZ G;  2B9B A;  2IFM A;  4PV1 B;  3KYQ A;  1NO4 A;  2XDJ A;  2QJK B;  5AVU B;  5AW7 B;  2QJP C;  3VMA A;  5KJ7 A;  3Q2Y A;  5KLV D;  3CD6 P;  1PIX A;  5M1B A;  1SQX G;  2WIT A;  1KFN A;  1PP9 E;  2GUV A;  4L76 A;  1BGY D;  1JCC A;  1KYO I;  3LW5 J;  3S4R A;  1EDL A;  4B86 A;  2Q5U A;  3TK1 A;  1RHZ B;  2KOG A;  1LTA C;  1KIL D;  5L8R J;  3UIA A;  3V2P A;  1VL2 A;  1MUU A;  1SQQ K;  2M5A B;  2A06 D;  5E79 E;  4WBA A;  1BCC G;  1VF5 D;  2WSS H;  3B5N A;  1SQQ E;  2WPV B;  1L0N K;  1LWU C;  2QSI A;  3HE4 B;  4XA4 A;  1N7L A;  4N6J A;  1UII A;  2BCC J;  4UB6 H;  1KMI Z;  1OWA A;  2E76 B;  2FYU J;  2WSE J;  5AW8 B;  4C46 A;  1JY3 P;  2OYH B;  1S5L E;  2PAJ A;  3B4S A;  1SFC C;  2JWD A;  2M3E A;  3B5N D;  1YHQ P;  1M1J A;  2KZI A;  1H89 A;  3CC4 P;  1L0L J;  1T3U A;  3Q3D A;  3WUU A;  3AEA C;  2IZ1 A;  3L71 E;  2YO2 A;  1NTM D;  3AEE C;  1Q90 D;  5KLV G;  2H43 A;  3L75 J;  3L74 D;  3TGU G;  2P2U A;  2GM4 A;  1L0L G;  2QJK C;  3N7N A;  4NPD A;  2NRG A;  1IFP A;  3CXH E;  3L73 D;  3L73 G;  2K1A A;  4H44 B;  4I6M C;  1QLE D;  2HOD B;  2LR2 A;  3L72 J;  2W27 A;  2AXT H;  1KZU B;  1NYH A;  3FXD A;  3H1K D;  1GD2 E;  4I7Z B;  1URQ C;  4W80 A;  4LLH A;  2M8R A;  4JF7 A;  1EDI A;  3MTU E;  1U57 A;  1OFC X;  1SQB K;  4N3Y B;  5APT A;  1EDJ A;  2XU6 A;  1NAY A;  1JB0 J;  1LTJ C;  1JO5 A;  5AW6 B;  2HLO A;  3JC2 2;  2FYN C;  2ZXX A;  5KAF H;  3MUD C;  1ZXG A;  4IL6 H;  2K88 A;  4K35 A;  4UB8 E;  1AQ5 A;  5AVT B;  1VDF A;  3ABV C;  4MN4 C;  1ZW0 A;  2ZYG A;  3WUT A;  3M06 A;  1BCC D;  3G71 P;  1KFM A;  1EZV I;  1M90 Q;  5E79 H;  3CPW O;  2R3C A;  1N7S D;  1RF0 C;  3O6Q B;  3D70 A;  2KS1 A;  3C8V A;  2K9Y A;  1S72 P;  1WT6 A;  1OVU A;  3MHV A;  2J58 A;  3CCJ P;  1VQM P;  4IL6 X;  1P84 E;  1EZV G;  1SVF A;  1BGY G;  2D2C C;  2WMM A;  3VP9 A;  3I56 P;  1LT9 C;  1FZC A;  1SQP K;  1PGJ A;  3AEB C;  1AJY A;  1GU5 A;  3H32 A;  3M9B A;  5KAI E;  4WWI A;  1X0T A;  1N73 A;  3A0B H;  2WWW A;  2JP3 A;  2E75 C;  3RL0 g;  3AEG C;  2ZJS E;  1SS1 A;  1IK7 A;  3EFG A;  1BSN A;  2RH0 A;  2K9J B;  2A06 E;  1YIJ P;  1RF1 C;  1X79 B;  1G2C B;  3A3Y B; 
#chains in the Genus database with same CATH homology
 2YO3 A;  3LID A;  3L37 A;  2IX7 C;  4Y99 C;  1MV8 A;  2W6B A;  2Z5I A;  3GHG B;  1JNM A;  1ZN5 A;  1AFO A;  1NU1 K;  2XKM A;  2R5D A;  3M9Q A;  5KLV K;  2WSC H;  5APV A;  3H32 B;  1NAF A;  3P8C E;  4N78 D;  3RK3 B;  1HVV A;  1X9V A;  1T2K C;  4GKG A;  3B8E B;  3B5N B;  3MD0 A;  1SLQ A;  1IO4 A;  5CCG D;  4DOJ A;  3HE5 B;  2NPS C;  1T3J A;  2OYI C;  3TNU B;  2KLV A;  1SP4 A;  3MUD A;  3NXS A;  3G3Z A;  3VN0 A;  3L35 A;  3NMD A;  3RK3 D;  1J1E C;  2PP6 A;  4C7N B;  3LW5 H;  2O1J A;  1GW4 A;  1FZE A;  3VP8 A;  4IFD K;  2FXM A;  3HD7 C;  2P67 A;  3B5N C;  3A5T A;  4WY4 C;  3SWF A;  1M7L A;  1QL2 A;  1G1J A;  3IR9 A;  1MFZ A;  1L4A B;  3A7O A;  2I1K A;  3IFM A;  3V5B A;  2Q7C A;  3CL3 D;  4W7Y A;  1ZR2 A;  1GL2 C;  3P8M C;  1RE3 C;  2H7H A;  1FOS F;  1EQ7 A;  1N7S B;  5CJ0 A;  2QM8 A;  1J1E B;  3P8C D;  2YKP A;  5AVS B;  1RF1 B;  3RL0 B;  1ZV8 A;  1DEB A;  4XE5 B;  1FZF A;  3C9I A;  3TNU A;  1S9K D;  1LWU B;  5AVQ B;  1G2C A;  1LTT C;  1LTJ A;  2A45 I;  1LT9 B;  5BU8 B;  2N1T D;  1ZLL A;  4GT1 A;  2HFE D;  3R2P A;  1NTZ K;  1L4A C;  2C0W A;  1LWU A;  1JOC A;  3NFQ A;  1FJK A;  2L5G B;  3OAK A;  2KSJ A;  3HD7 D;  1RE4 C;  4Y99 B;  1HGV A;  2ZXE B;  4C7R A;  1LTB C;  2IFN A;  3U1A A;  2FFD C;  1SFC A;  1LT9 A;  1SQV K;  4W7Z A;  1NWQ A;  4WY4 A;  1URQ B;  1GU4 A;  2POH A;  2QM7 A;  3I5C A;  1NTM K;  3RK3 C;  4AQR D;  1JTH A;  5APW A;  5KJ7 D;  3HUS B;  1GL2 A;  1OXZ A;  1HGZ A;  1RE3 A;  2OYH A;  2HG5 D;  1T8Z A;  1YYC A;  2YKO A;  3E1I A;  5AW5 B;  2KB7 P;  3O8Z A;  3HRN A;  4HYT B;  2YMY A;  1A02 F;  4AYC A;  1T2K D;  1DH3 A;  1LGH B;  3V2R A;  3KQG A;  3N4X A;  5CCG A;  1GL2 B;  3HUS A;  1JMM A;  3U1C A;  4I2L C;  4JYB A;  3HTK A;  1JY2 P;  3BAT A;  1LTI C;  3M91 A;  5APX A;  1E5W A;  2HOD A;  1J1D C;  2BAS A;  1YTZ T;  4DZO A;  1GL2 D;  4N78 E;  5AW4 B;  1NH4 A;  1SFC B;  5AVZ B;  2A45 H;  1NKZ B;  1KQL A;  1IJD B;  1IC2 A;  2HPC A;  5CCH C;  3BVH A;  3V2Q A;  2WSE H;  1PFI A;  2YNY A;  1NOH A;  2C9L Y;  5APS A;  2WSF H;  1XTC C;  4ZKU A;  2NPS B;  5CHX A;  1ZR4 A;  1GZL A;  1M1J C;  2VRS A;  3L4F A;  3M0D C;  3MGN A;  2WT7 B;  1HJB A;  1GW3 A;  3BRV B;  3L36 A;  3VMY A;  1L0L K;  4GIF A;  2N1T B;  3WMM 0;  1LTG C;  4WB4 A;  1URQ D;  1JY2 O;  1FZG A;  3GHG A;  5AW0 B;  1LTS C;  1N7S A;  2N9B A;  5BVZ A;  3RK2 D;  1IFM A;  1MZ9 A;  1URQ A;  2WT7 A;  5CCG C;  4LC1 A;  1IK9 A;  1NHL A;  3BRT B;  1HH0 A;  1RF0 A;  2R32 A;  3NTN A;  2XZR A;  1M1J B;  1LTJ B;  3BAS A;  3CLQ A;  5CCH D;  3TSI A;  1SQX K;  4IFF A;  3MIW A;  1FZA A;  3LIE A;  5APU A;  2XV5 A;  1WRG A;  4RES B;  1CZQ A;  1VPC A;  4OH8 B;  5APY A;  3VYI A;  4M3L A;  2Z4E A;  1YTZ I;  1S9K E;  1J1D B;  5CJ4 A;  2E43 A;  3P32 A;  2Q9I A;  3VTP C;  1G1I A;  1CSB A;  1N2D C;  3M9H A;  3P7K A;  1HBW A;  3EQ2 A;  4LGD E;  2P1J A;  5AVR B;  1HTL C;  1N7S C;  2R5B A;  3VOP A;  1HWT C;  3RL0 D;  2WTY A;  1CW5 A;  3RK2 C;  2OYI A;  1FZB A;  4ZKP A;  2W6A A;  3U59 A;  3VMZ A;  2Z5H A;  5KJ7 C;  1W2E A;  1DX7 A;  1JUN A;  5APQ A;  4EIJ A;  3KDP B;  5AW3 B;  1RE4 A;  1Z56 A;  3II6 A;  2OYI B;  1GTW A;  2O01 H;  2WZ7 A;  2JEE A;  2FKW B;  3H6P A;  3HD7 A;  1H88 A;  5AW1 B;  2FFD B;  3TYY A;  3PP5 A;  1GK6 A;  1SFC D;  3V4W A;  4I1L A;  3OA7 A;  5AVW B;  1NKN A;  5AVX B;  1N73 C;  2FYU K;  2FYZ A;  4EOT A;  2IPP A;  5CMZ A;  5CCH A;  2WPS A;  2N1T C;  3HD7 B;  2KP8 A;  1FU1 A;  2E42 A;  1KIL C;  1A02 J;  1CI6 B;  2ZFC A;  4JYC A;  3M0D A;  1GK4 A;  5AVV B;  2J59 M;  1JY3 O;  3V2N A;  3CI9 A;  3V4Q A;  1JTH B;  3HTK B;  2OAR A;  2YKQ A;  1FOS E;  3SWY A;  1CI6 A;  4O9B A;  1HUC A;  2O1K A;  5KTB A;  2I1J A;  2HYN A;  3KPE A;  1RY3 A;  1FZC C;  1N73 B;  2C9N Y;  1H8A A;  1L4A A;  4IFM A;  4WY4 D;  2C0X A;  1IFI A;  2HPC B;  2FFD A;  3M0A A;  3OJA B;  2M3B A;  1RF1 A;  2KYV A;  5AVY B;  2CPS A;  4C7N A;  3A2A A;  1IFN A;  1FAV A;  4KHX A;  4WY4 B;  1N86 A;  3VMX A;  1XTG B;  5AW9 B;  2GUS A;  2WPR A;  2CPB A;  2N1T A;  1IFD A;  1FZC B;  1KIL A;  1FBM A;  1L4A D;  3HE5 A;  2NPS D;  3GHG C;  3RK2 B;  3T97 A;  3RL0 C;  2XNX A;  1QL1 A;  2WPQ A;  2MJZ A;  2P7J A;  3HUS C;  1IFJ A;  2OYH C;  1J2J B;  1GDT A;  2NPS A;  1NTK K;  2Q3I A;  1JCD A;  2LKM A;  1KIL B;  1JY3 N;  4AUW A;  1JY2 N;  4HH2 A;  2JJL A;  2A45 G;  2H8P D;  3HE4 A;  1X8Y A;  2IFM A;  3KYQ A;  1NO4 A;  2XDJ A;  5AVU B;  5AW7 B;  5KJ7 A;  2WIT A;  1KFN A;  2GUV A;  1JCC A;  4B86 A;  2Q5U A;  3TK1 A;  2KOG A;  1LTA C;  1KIL D;  3UIA A;  3V2P A;  1MUU A;  1SQQ K;  4WBA A;  5BU5 A;  3B5N A;  1FDM A;  3HE4 B;  1L0N K;  1LWU C;  4XA4 A;  1N7L A;  4N6J A;  1OWA A;  5AW8 B;  4C46 A;  2OYH B;  1JY3 P;  2PAJ A;  1SFC C;  1H89 A;  3B5N D;  1M1J A;  1T3U A;  2YO2 A;  2H43 A;  2P2U A;  2GM4 A;  5AW2 B;  3N7N A;  4I6M C;  2HOD B;  2W27 A;  1KZU B;  1GD2 E;  1URQ C;  4W80 A;  4LLH A;  2M8R A;  4JF7 A;  3MTU E;  5APT A;  1SQB K;  4N3Y B;  2XU6 A;  1LTJ C;  1JO5 A;  5AW6 B;  2HLO A;  1AQ5 A;  5AVT B;  1VDF A;  3M06 A;  1KFM A;  2R3C A;  1N7S D;  1RF0 C;  1WT6 A;  2J58 A;  3VP9 A;  1SVF A;  1FJP A;  1LT9 C;  1FZC A;  1SQP K;  1GU5 A;  3H32 A;  3M9B A;  1N73 A;  2WWW A;  3EFG A;  1RF1 C;  1X79 B;  1G2C B;  3A3Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...