3H32A

Crystal structure of d-dimer from human fibrin complexed with gly-his-arg-pro-tyr-amide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
b'IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrinogen alpha chain
publication title Two families of synthetic peptides that enhance fibrin turbidity and delay fibrinolysis by different mechanisms.
pubmed doi rcsb
molecule tags Blood clotting
total genus 20
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08702 Fib_alpha Fibrinogen alpha/beta chain family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3h32A00
1FZAA 1RF1B 1N73C 1M1JB 2OYIA 1RF0C 1JY3O 1M1JA 2OYIB 1RE4A 2OYHC 1JY3P 1RF1A 2Q9IA 1LT9C 1FZCB 1FZCC 2FFDC 2HODB 3BVHA 2HLOA 1LTJC 1W2EA 1RE3A 1JY2N 1LWUB 2HODA 1LWUA 3HUSA 2H43A 2HPCA 2HPCB 1FZEA 3GHGC 3HUSC 3E1IA 1N73B 1RF0A 2OYHB 1N73A 1T3UA 1LT9B 3H32B 1LT9A 1JY3N 2Z4EA 2OYHA 1RE4C 1FZCA 1FZGA 1RF1C 1M1JC 3H32A 2OYIC 2FFDB 1LTJB 2FFDA 1LTJA 1JY2O 2A45I 1RE3C 3GHGB 1JY2P 2A45G 2A45H 1N86A 3HUSB 3GHGA 1LWUC 1FZFA 1FZBA 2XNXA
chains in the Genus database with same CATH superfamily
1IC2A 4L74A 1EC5A 1KORA 1N7SB 3IFMA 2FYUK 1LWUA 1R5LA 1IFIA 2JWAA 1S2EA 1FAVA 2ZAEB 4DT0A 3G71P 1RQUA 2K1AA 3E1RA 5KAIE 3MGNA 1M1KQ 3USSA 1DD4A 4YXWH 2K9YA 3VMXA 3H1IG 4LC1A 1JEKA 3RL0D 3AE8C 1SFCB 2JP3A 2O3JA 1KN7A 2NRGA 2QVAA 4IL6H 3F5HA 1SQXJ 2KZJA 1GW4A 1GU4A 2FFDC 3HD7C 2IDBA 5E79E 4H0LB 2RMZA 1NKZB 1YQ4C 1M7LA 1QL1A 4R4MA 2K3RA 3RK3B 3BCCD 1NAFA 2YIUB 4EIJA 1D7MA 3QWOC 3I55P 1YJ9P 3H1IE 4H13C 2QJYB 1NU1D 4YTPC 1ZMEC 1WMKA 3V2QA 4BRYA 5AW1B 2N1TC 4DZOA 4KHXA 2ZT9D 1NHLA 2I8DA 2BCCG 2KNCA 1QLED 2QIWA 1PZQA 1G1JA 1NTKG 2KI7B 1S9KD 4XA4A 2HYNA 1JY3O 4BRYB 3CCQP 4HH2A 1ZP0C 1HVVA 4H13D 1NWQA 2OYHA 1J2JB 4I7ZB 2Z4EA 1FZCB 5CHXA 2H89C 2KNCB 1SQBJ 4RESB 1EQ7A 2E43A 3LIDA 1WRGA 1FS0E 2N1TD 1VQ9P 3TF5A 2E42A 1RF0A 2OYHB 3SWKA 5APSA 1YI2P 3RK2B 3V4WA 4IFMA 2Q9IA 3CPWO 3I56P 1K05A 1BDCA 1BGYG 3FXDA 3SWYA 2L91A 3H1KE 3H1LJ 5AVRB 4N6JA 2NPSD 1SQXK 4L73A 4WY4D 3M9QA 3MZWB 3A3YB 1LGHB 1Q82Q 1VQKP 2LKMA 3AEBC 3CMEP 1VQNP 1BE3E 4D6TG 2ZVOB 2WSEH 3B5NA 4JQ0D 5AVUB 2FYZA 3M0DC 3MTUE 1MV8A 1Q7YQ 2WPVB 1SQPG 3LW5H 1J1DB 1GL2A 1LT9C 4PD4I 5CJ0A 1KMIZ 5C39A 3AEEC 2IYOA 3B5NB 3M9HA 3AEGC 3H1IJ 4JPZB 1L0NG 2RH0A 3SSUA 3A0HE 3EFFK 2M3EA 2XNXA 1LNQA 5AVYB 4IFDK 1RE4A 2FYUD 5B66E 2WSEJ 2QG4A 1ZV8A 4GODA 2Y0CA 3L74D 1FZEA 3L73G 1NTZE 2YMYA 3IF4A 4CPGA 1KILC 2V7QH 4OGQB 1PPJD 3PRJA 1HBWA 3RK3E 5AW4B 1SQPE 2W27A 1SQBK 2B87B 2KK7A 3A5TA 2HODA 3JCUE 1GZLA 4PJ0H 1X9VA 5TJHA 2GA1A 4Z1MH 3L75D 1JMMA 5AW0B 3KZIE 1RE3C 3H1HG 1KV4A 1L4AA 4OVNF 2HODB 2Q1KA 1YQ3C 2E75C 1PGQA 4QMAA 3L73E 1S72P 1FC2C 3F89A 5CBNA 2FXMA 5APXA 5B5EE 1ZW0A 1YTZT 1SQQG 5KJ7C 2BCCJ 3L70E 2M0BA 1N2DC 1K73Q 2E76C 1NTKJ 3CX5I 4KT0J 2AXTE 1MUUA 2ZXXA 1JY2O 1A02J 4HB1A 1PP9G 1NTME 1N7LA 4NPDA 2QRXA 3P8CD 2E75D 1EZVE 2R44A 3JC22 5BVZA 3H32A 2SPZA 1VL2A 1S5LE 1LTJA 2R5DA 3KDPB 2ZVNB 3L72E 1GU5A 3GHGA 3VMAA 3RL0B 3CCUP 1VQLP 1OW8A 5KJ7D 3VMYA 1X79B 4RKUJ 1LTTC 2E76D 1SQQE 3H32B 3VYIA 1LTJB 5KLIB 3V2PA 3GHGB 2WQYC 4K35A 2B9BA 1FZAA 3D70A 1SQVG 3CWBE 3TGUG 2WSFJ 4UB8H 2D2CC 1T3UA 2OYIC 1GW3A 2IFNA 1IFDA 3VP9A 1Y47A 2WT7A 2V4HA 4H44D 3Q1MA 3PHLA 4OWFA 4D6TJ 3W67A 1L0LG 1YBKA 1H88A 4ZMDA 2GUSA 1SQXD 1SQPJ 3K5BA 2OGUA 2ZT9B 1XTGB 1SVFA 3S4RA 1P84D 1FDOA 2WT7B 1AJYA 3C1LA 1OVVA 1PFIA 3RBZA 5KLVE 1L0NJ 2AXTH 2JWDA 2D2CD 1HF9A 3VN0A 3PJSK 3FWLA 1NGMB 1KB9E 2A45I 2G8YA 1NTKK 1SP4A 3L73J 4C46A 2DW3A 2WZ7A 1M1JB 2IYPA 2HR3A 1G2CB 3HE5A 1KC8Q 3WU2E 2FBWC 1Z56A 2A06D 2MKVA 1MKMA 1LJ2A 1AVOA 3BASA 1ZXGA 2FXPA 2NPSA 4WY4A 2KOGA 1BCCG 2N9YB 5DJUB 2P1JA 1HWTC 1OIPA 1LTBC 2PAJA 3P32A 4MN4C 3HE4B 3RBXA 1LTAC 1Q90D 4ZKUA 3H1HJ 3H1JG 5H2FE 3AE2C 4UB6E 1CI6A 2NPSB 3HUSA 1FZBA 5CCHC 2WPSA 2PFXA 1SQBD 1HGZA 2P7JA 1RF1A 3AE9C 2O01J 3MUDA 1JM0A 1VF5B 2HPCB 1LTGC 3OAKA 3AE5C 5KKZB 3A0BH 1CI6B 2YO3A 3CC4P 2I1KA 1SQQJ 1KYOI 1P84H 1RF1B 1BCCE 2W8ZA 2IBZI 1DH3A 3L71G 4I6MC 2KSJA 1LWUB 1R5SA 1IFJA 3CWBJ 1PV3A 4EDFA 1PP9J 3ZDMA 1HTLC 3H1LD 1NAYA 2PP6A 3H1JE 1KD1Q 1SQPK 5CCHD 5CMZA 3M0DA 1X22A 2E74C 2QJPC 1LT9A 4NPEA 1NH4A 2QM8A 5GTIH 1L0NK 3CCVP 4N78D 2B89A 4LGDE 2YMKA 1CW5A 2PGDA 1FOSE 2GUVA 3L71E 1KB9I 4PD4E 4DJGA 1SQVJ 1YJNP 3TGUJ 2KYVA 1OMIA 3H1ID 1NU1E 5AVXB 3CL3D 5AW3B 1URQC 5H2FH 4UB6H 1K9MQ 3G9RA 1SLQA 3HD7D 3SFEC 2E74D 2QJKC 1L0LJ 3M06A 3CXHI 3D6ZA 3H1KG 5CCGC 1YHQP 2C0WA 3N4XA 3IAOA 4ASWA 3TNUA 4YXDC 5KAIH 1YIJP 3H6PA 3KQGA 1JNMA 1K8AQ 1URQD 1SQQK 2XDJA 1QEXA 1BE3G 1UIXA 3UIAA 4PV1C 5AVQB 1N73A 2CK3H 3TNUB 1HH0A 1RH5B 1U57A 1N7SC 1T6AA 3EWKA 5E79H 3PH0A 5CCGD 1PL5A 2KSEA 1N73B 1IFMA 1BCCJ 2BCCD 1JO5A 1NTKD 4ASVA 4EYYQ 2O1KA 3CX5E 4A7PA 4EI2A 3H1JJ 3LIEA 1MFZA 3P7KA 1SFCC 4Y99B 3Q5PA 3V6IA 1NTZG 1BDDA 4PV1D 2M8RA 3U1AA 4U7JA 3E7KA 2PRRA 2QSIA 3M91A 3WMM0 1N7SD 3D6YA 1SQVK 4H0LC 4GOEA 4H44B 4I1LA 1H0TA 4AYCA 3RK3C 2YIUC 1EDKA 2ZXEB 2FYNB 3L71J 1NO4A 5AVZB 1BGYD 5GTHE 1KQFB 2UWJE 1BSNA 1L0LK 2M5AA 2OYIA 1GL2B 2QJYC 2LXCB 2KS1A 3O6QA 1SFCD 2GM4A 1H0TB 1YITP 3A7OA 5AW2B 1NJIQ 1OW6A 2A45G 2Z5HA 4R4LA 2M5AB 5APTA 2O01N 3L70G 4H0LD 2KS1B 3O6QB 2HLOA 4D6TD 1X0TA 4L76A 1SQPD 1OW7A 1SS1A 1NTMG 4U3FG 4RJTA 1FBMA 4I7ZC 1FZCC 2KP8A 1H8AA 1EZVG 4C7NA 3CI9A 1Q86Q 5KAFE 3CX5H 3FX0A 1L0ND 4ZKPA 1ZRTE 3L72G 1DIPA 2K9JA 1FJPA 4Y28J 1KILD 1L4AB 2OYHC 3FWNA 1S5LX 2Z5IA 3L73D 2IZ1A 3NFQA 4C7NB 3RK2C 3HRNA 3CCRP 2K9JB 2XV5A 3H1KJ 1IK7A 1JCDA 1GTWA 1NVOA 3CWBG 3RL0g 4U3FE 4LLHA 2H88C 2IBZG 3I5CA 1VQMP 5CCHA 2IFMA 1LP1A 2W90A 1FE6A 2WSFH 3A0HH 1GMJA 3H1HD 1BE3J 2N9BA 5B66H 1M56D 3CCLP 1VQ6P 3L37A 1LP1B 2R5BA 4HYTB 1J1DC 2YXRB 2HFED 3CLQA 1SQQD 2P2UA 1IJDB 5KLVG 3B5NC 1IZNB 3JCUH 1KYOE 4C7RA 1KQLA 2IBZE 2C0XA 5TISE 3KZIH 2JO1A 1IK9A 1GK4A 2FFDA 1OZHA 1PP9D 2FY8A 5AVSB 3FXEA 3HD7A 1KFMA 1N86A 1FZFA 1NTZJ 1JTHA 2W6AA 3AE1C 3OW2O 4OGQC 2O1JA 1RE4C 2FFDB 4GOFA 1JOCA 3HD7B 5B5EH 2KUBA 1U7JA 5K5GB 3Q5SA 1FDMA 4WBAA 2OQQA 1VPCA 3C8VA 3V5BA 1OVUA 3CMAP 5AW5B 1QX8A 1URQA 3M0AA 2YKPA 2N1TA 3Q2YA 4H13B 1SQVD 1MFTA 1X8YA 3TGUD 3MIWA 4BXLA 4W7YA 2H8PD 2ZFCA 1NKNA 4OGQD 1S5LH 3L70J 5CCGA 2N1TB 2O01H 1L0LD 3CCEP 2RKLA 1Q2NA 1JY3P 2KXPB 5APQA 3HE5B 1ZOYC 3CXHE 1NTMJ 5AVTB 4U3FJ 2HG5D 4WWIA 5AVWB 2R32A 3FGAD 2Y9ZA 5CBOA 2Y0EA 3H25A 3V4QA 4WY4B 3GW6A 4N3YB 2ZYAA 2W83C 1PGJA 3L72J 1N7SA 3GG2A 3IR9A 2AEFA 3PP5A 1KQSO 1SQBE 3WUUA 3KXDA 3N7NA 2ZJSE 3RL0C 1A02F 1YYCA 2P58A 2M3BA 4IFFA 4JF7A 3HUSB 3BCCG 1LTJC 1NTZK 5KLIC 1VQ4P 3GHGC 1AQ5A 3GF7A 3CCMP 4XE5B 1BCCD 1SFCA 1NU1G 2IX7C 3H1LE 2P10A 2QA4P 1EXJA 1PGPA 3ITKA 1UIIA 4GDOA 3H1JD 2CPBA 2Y0DA 4M3LA 1KB9H 1K04A 4WVZA 5AW9B 5CJ4A 1MZ9A 4XFJA 4GIFA 3GF3A 1ZLLA 4B86A 4TT3H 1KFNA 1PGOA 3V2NA 1N8RQ 1P84I 1RHZB 1S1CX 5APWA 4AUWA 3L4FA 3QH9A 3WU2H 2ZT9C 4N78E 3MHVA 3NXSA 1ZR2A 1WT6A 3BCCE 1LT9B 1Y9BA 4DOJA 3WUVA 5KLVJ 2FXOA 2B88A 5M1BA 3U59A 2R3SA 3W68A 1QVGO 3L71D 1KZUB 2WMMA 4PD4D 3CXHH 1XTCC 2P67A 2QM7A 1S3JA 2J58A 4KJMA 1KILA 4GKGA 1BSHA 1M1JC 2WVRA 3P8MC 2NZ2A 2KIKA 1NTMK 3TYYA 1AV1A 1OWAA 3JSVC 2KLVA 2AEJA 1EXIA 2Q7CA 3SFDC 1USEA 1KILB 2WITA 1RE3A 4GT1A 1S9KE 3G4SP 1OXZA 1FJKA 2AEMA 2R3CA 4WB4A 3L36A 3TDKA 1NOHA 1FZCA 2Q3IA 5EFWB 1DEBA 3CC7P 2BASA 4DCKA 1JMBA 1ZN5A 2KZIA 3AE4C 4K3AA 2NPSC 4WY4C 5L8RJ 4ZNCA 2XU6A 3U1CA 2E75B 5KJ7A 2BEQD 2RN0A 4NPFX 2JR8A 1VF5C 1VQOP 5KKZC 2YKQA 3EQ2A 1USDA 1JUNA 3A2AA 3BRTB 1KQGB 3HUSC 5AW8B 1DD3A 2KLUA 3PLNA 2WWWA 1RF1C 4PJ0E 1CSBA 3CD6P 1VQ8P 3L35A 3MUDC 2E76B 1JY2P 3G6EP 4O9BA 1LWUC 2BCCE 2H7HA 3H1KD 1DEEG 2OTKE 3II6A 1NTKE 2J59M 1IFPA 3GLMA 2OTLP 3S9OA 2FYUG 4PD4H 2K37A 3CX5D 5BU5A 3AE3C 1GDTA 2QEXP 3TSIA 3L74G 2JJLA 2LXBA 1W5CE 1VF5D 5KLVK 1BE3D 1YJWP 1PPJG 1J1EB 1RY3A 1JY3N 3VMZA 1E5WA 1CZQA 3BCCJ 3B8EB 3L75G 5AW7B 2OTJP 2J5UA 3CCJP 1H89A 1BGYE 2IPPA 1NU1J 4JYCA 1RQVA 2WSSH 1OX3A 2FYUE 1PIXA 1HGVA 5BU8B 3NTNA 2JKVA 3L74E 2D2CB 3O8ZA 2K88A 2OYIB 1R8EA 2YKOA 1NTZD 3HTKA 2B87A 1VDFA 2POHA 2QE7H 1PPJE 3LW5J 3BATA 1AQTA 4D6TE 3OA7A 3RK3D 3G3ZA 1GK6A 5APUA 2JEEA 5APVA 2JDIH 3KYQA 2IZ0A 3TK1A 2L5GB 3L75E 3HTKB 2OYOA 1S4XA 1W2EA 5DJTB 4UB8E 2YO2A 1T2KC 1NYHA 1L2PA 3S1KA 3R4YA 3V2RA 1L0NE 4HJGH 1OFCX 3B71A 1ZRTD 1VQPP 3AEAC 1KILE 2V7QJ 2ZYDA 2BEZF 3E1IA 3L70D 4OH8B 1N73C 1RF0C 1T3JA 4W7ZA 2ITAA 1YTZI 1VQ7P 1GD2E 4W80A 1AA0A 4AQRD 2Q5UA 2Q3EA 2MJZA 2LR2A 1M8OB 1T2KD 1NTMD 5GTHH 3P8CE 4U3FD 3BRVB 5KTBA 4YPCA 1JCCA 1QGKB 4Y99C 5AW6B 1AFOA 1EZVD 2YXQB 1U7MA 3KHUA 3H1HE 1LT1A 2CPSA 3SWFA 3RK2D 3L72D 1TU3F 2XNDH 1SQXG 2Q6QA 1NU1K 2I1JA 1J1EC 4H44C 2WTYA 4I2LC 3VP8A 3NMDA 2WSCH 4EOTA 3BVHA 2FYNC 3VOPA 1BGYJ 1HUCA 4BWNA 1GL2C 3WUTA 2Y9YA 3CWBD 4TLFA 2FYUJ 1KYOD 4IOIH 2W6BA 2IBZD 1M57D 3L74J 1AVYA 3AEFC 1PP9E 1LTSC 2C9NY 5KAFH 3KPEA 1FOSF 1DX7A 2XZRA 3AECC 3CC2P 4IL6X 2WPRA 1SQXE 2WSCJ 3A0BE 2A06G 2A45H 2E74B 1JTHB 2QJPB 1QVFO 2E5YA 3IN6A 3T97A 3D71A 1P84E 3B5ND 3MP7B 1FDIA 1JY2N 3RGUA 3L75J 2FKWB 2C9LY 3VTPC 1FZGA 3AE6C 1GL2D 2OARA 2ZYGA 1T8ZA 3ABVC 5KLVD 3EFGA 3T97B 1LTIC 1M1JA 5APYA 3CCSP 3M9BA 1FU1A 4JYBA 2W6JH 1G2CA 3R2PA 1VQ5P 4IL6E 1SQVE 1SQBG 2YNYA 2WPQA 1KB9D 3TGUE 5AVVB 1JB0J 3Q3DA 1HJBA 1W2BO 1ZR4A 3Q5RA 1E79H 4L75A 1URQB 1IFNA 1L4AC 1IO4A 1KTMA 3C9IA 2AXCA 4RO0A 1QL2A 3B4SA 2QJKB 5GTIE 2A06E 4JBZA 1L0LE 1HJ0A 4HKZH 2H43A 2XKMA 3HE4A 3PTZA 1EDJA 1EDIA 3AEDC 3H1LG 2KB7P 3CXHD 3GMAA 3AE7C 1KYOH 3OJAB 1EZVI 2VRSA 2HPCA 1M90Q 5TISH 1G1IA 1OVRA 1L4AD 1Q81Q 2G3AA 3MD0A 2E5TA 1EDLA 1Y8AA 4PV1B
chains in the Genus database with same CATH topology
1FZAA 1IC2A 5APTA 2BASA 1N7SB 3IFMA 1ZN5A 2FYUK 2HLOA 1LWUA 1IFIA 2NPSC 4WY4C 1FAVA 1T3UA 2XU6A 3U1CA 2OYIC 1GW3A 2IFNA 5KJ7A 1IFDA 3MGNA 3VP9A 2WT7A 3VMXA 1H88A 1FBMA 1FZCC 2KP8A 2GUSA 2YKQA 1H8AA 3EQ2A 1JUNA 3A2AA 4C7NA 3CI9A 3BRTB 3HUSC 5AW8B 4LC1A 2WWWA 4ZKPA 1RF1C 1XTGB 1CSBA 1SVFA 3RL0D 1SFCB 3L35A 1FJPA 1JY2P 2WT7B 4O9BA 1LWUC 2H7HA 1KILD 1L4AB 2OYHC 3II6A 2J59M 2Z5IA 1GW4A 1GU4A 3NFQA 2FFDC 4C7NB 3RK2C 1PFIA 5BU5A 3HD7C 3VN0A 1GDTA 3HRNA 3TSIA 1NKZB 2JJLA 2XV5A 1JCDA 1GTWA 2A45I 1M7LA 1NTKK 1SP4A 4C46A 1QL1A 2WZ7A 3RK3B 1M1JB 1NAFA 4EIJA 5KLVK 4LLHA 1G2CB 3HE5A 1J1EB 1RY3A 3I5CA 5CCHA 2IFMA 1JY3N 3VMZA 1Z56A 2WSFH 1E5WA 1CZQA 3B8EB 3BASA 2NPSA 2N9BA 5AW7B 4WY4A 2KOGA 3V2QA 2P1JA 1HWTC 1H89A 5AW1B 1LTBC 2PAJA 2N1TC 4DZOA 3L37A 4KHXA 2IPPA 3P32A 3HE4B 4JYCA 1NHLA 1LTAC 2R5BA 4ZKUA 4HYTB 1HGVA 5BU8B 1J1DC 3NTNA 1CI6A 2NPSB 2HFED 3O8ZA 3HUSA 3CLQA 1FZBA 1G1JA 5CCHC 1S9KD 4XA4A 2OYIB 2WPSA 2YKOA 2HYNA 1JY3O 2P2UA 1HGZA 1IJDB 2P7JA 1RF1A 3B5NC 3HTKA 4C7RA 4HH2A 3MUDA 1VDFA 2POHA 2HPCB 1KQLA 1LTGC 1HVVA 3OAKA 3BATA 1NWQA 2OYHA 1J2JB 2Z4EA 2C0XA 1FZCB 1CI6B 2YO3A 3OA7A 5CHXA 1IK9A 1GK4A 3RK3D 2I1KA 2FFDA 3G3ZA 1GK6A 5APUA 5AVSB 4RESB 2JEEA 3HD7A 5APVA 1KFMA 1N86A 3KYQA 1FZFA 1JTHA 1EQ7A 1RF1B 2E43A 2W6AA 3TK1A 3LIDA 2L5GB 3HTKB 1WRGA 1DH3A 4I6MC 1W2EA 2KSJA 2N1TD 1LWUB 1IFJA 2E42A 1RF0A 2OYHB 2O1JA 5APSA 1HTLC 2YO2A 1T2KC 1RE4C 2FFDB 2PP6A 3RK2B 3V4WA 1JOCA 3HD7B 1SQPK 4IFMA 3V2RA 2Q9IA 5CCHD 5CMZA 1FDMA 4WBAA 3SWYA 3M0DA 1VPCA 5AVRB 4N6JA 3E1IA 3V5BA 2NPSD 1SQXK 5AW5B 4WY4D 1LT9A 3M9QA 1NH4A 1URQA 2QM8A 3M0AA 2YKPA 1L0NK 2N1TA 4N78D 3A3YB 1X8YA 1LGHB 4OH8B 1N73C 3MIWA 1RF0C 1T3JA 2LKMA 4W7ZA 1YTZI 4LGDE 1GD2E 4W7YA 4W80A 1CW5A 1FOSE 4AQRD 2GUVA 2Q5UA 2H8PD 2MJZA 2ZFCA 1NKNA 1T2KD 2WSEH 3B5NA 5CCGA 2N1TB 3P8CE 5AVUB 2FYZA 3BRVB 5KTBA 2KYVA 3M0DC 2O01H 1MV8A 3MTUE 1JCCA 4Y99C 5AW6B 5AVXB 3LW5H 3CL3D 1AFOA 1J1DB 1GL2A 1JY3P 1LT9C 5APQA 5AW3B 1URQC 3HE5B 2CPSA 3SWFA 5CJ0A 3RK2D 5AVTB 1SLQA 3HD7D 2HG5D 5AVWB 2R32A 3B5NB 3M9HA 1NU1K 2I1JA 3V4QA 1J1EC 4WY4B 3M06A 2XNXA 4N3YB 5AVYB 4IFDK 1RE4A 2WTYA 4I2LC 3VP8A 3NMDA 2WSCH 1N7SA 5CCGC 2C0WA 4EOTA 1ZV8A 3BVHA 3IR9A 3PP5A 3VOPA 3N4XA 1FZEA 1HUCA 3N7NA 3TNUA 3RL0C 1A02F 1GL2C 1YYCA 2M3BA 2YMYA 4IFFA 4JF7A 1KILC 3HUSB 3H6PA 3KQGA 1HBWA 2W6BA 1JNMA 5AW4B 2C9NY 1LTSC 1URQD 2W27A 1SQQK 1SQBK 2XDJA 1LTJC 3A5TA 2HODA 1NTZK 3KPEA 3GHGC 1GZLA 3UIAA 1FOSF 1DX7A 2XZRA 5AVQB 1N73A 1X9VA 3TNUB 1AQ5A 1HH0A 1JMMA 4XE5B 2WPRA 1SFCA 5AW0B 1N7SC 1RE3C 2IX7C 2A45H 1JTHB 1L4AA 3T97A 3B5ND 2HODB 5CCGD 1JY2N 2CPBA 1N73B 1IFMA 4M3LA 5CJ4A 5AW9B 2FKWB 2C9LY 3VTPC 1JO5A 1FZGA 1MZ9A 1GL2D 4GIFA 2OARA 1ZLLA 4B86A 2O1KA 1KFNA 1T8ZA 3V2NA 3EFGA 2FXMA 1LTIC 1M1JA 5APYA 5APWA 5APXA 3L4FA 4AUWA 3M9BA 1FU1A 4JYBA 1YTZT 1G2CA 3LIEA 3R2PA 1MFZA 3P7KA 4N78E 3NXSA 2YNYA 2WPQA 5KJ7C 1SFCC 5AVVB 4Y99B 1ZR2A 1WT6A 1N2DC 1HJBA 2M8RA 3U1AA 1ZR4A 1LT9B 4DOJA 1URQB 1IFNA 1L4AC 1IO4A 1MUUA 3C9IA 3M91A 1JY2O 1QL2A 3WMM0 1N7SD 1A02J 3U59A 1N7LA 1KZUB 1SQVK 1XTCC 2P67A 2QM7A 3P8CD 2J58A 4I1LA 2H43A 1KILA 2XKMA 3HE4A 4GKGA 5BVZA 4AYCA 3RK3C 1M1JC 3H32A 2ZXEB 3P8MC 1LTJA 2R5DA 3KDPB 1NTMK 1NO4A 2KB7P 5AVZB 1GU5A 3TYYA 3GHGA 1L0LK 3RL0B 2OYIA 1GL2B 1OWAA 3OJAB 2KLVA 2VRSA 2Q7CA 1KILB 2WITA 1RE3A 5KJ7D 3VMYA 1SFCD 1X79B 4GT1A 2HPCA 1S9KE 1OXZA 1LTTC 1FJKA 2GM4A 1G1IA 2R3CA 3H32B 3A7OA 3L36A 4WB4A 3VYIA 1NOHA 1FZCA 1L4AD 2Q3IA 5AW2B 1LTJB 3MD0A 3V2PA 3GHGB 1DEBA 2A45G 2Z5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZA A;  1RF1 B;  1N73 C;  1M1J B;  2OYI A;  1RF0 C;  1JY3 O;  1M1J A;  2OYI B;  1RE4 A;  2OYH C;  1JY3 P;  1RF1 A;  2Q9I A;  1LT9 C;  1FZC B;  1FZC C;  2FFD C;  2HOD B;  3BVH A;  2HLO A;  1LTJ C;  1W2E A;  1RE3 A;  1JY2 N;  1LWU B;  2HOD A;  1LWU A;  3HUS A;  2H43 A;  2HPC A;  2HPC B;  1FZE A;  3GHG C;  3HUS C;  3E1I A;  1N73 B;  1RF0 A;  2OYH B;  1N73 A;  1T3U A;  1LT9 B;  3H32 B;  1LT9 A;  1JY3 N;  2Z4E A;  2OYH A;  1RE4 C;  1FZC A;  1FZG A;  1RF1 C;  1M1J C;  3H32 A;  2OYI C;  2FFD B;  1LTJ B;  2FFD A;  1LTJ A;  1JY2 O;  2A45 I;  1RE3 C;  3GHG B;  1JY2 P;  2A45 G;  2A45 H;  1N86 A;  3HUS B;  3GHG A;  1LWU C;  1FZF A;  1FZB A;  2XNX A; 
#chains in the Genus database with same CATH topology
 1IC2 A;  4L74 A;  1EC5 A;  1KOR A;  1N7S B;  3IFM A;  2FYU K;  1LWU A;  1R5L A;  1IFI A;  2JWA A;  1S2E A;  1FAV A;  2ZAE B;  4DT0 A;  3G71 P;  1RQU A;  2K1A A;  3E1R A;  5KAI E;  3MGN A;  1M1K Q;  3USS A;  1DD4 A;  4YXW H;  2K9Y A;  3VMX A;  3H1I G;  4LC1 A;  1JEK A;  3RL0 D;  3AE8 C;  1SFC B;  2JP3 A;  2O3J A;  1KN7 A;  2NRG A;  2QVA A;  4IL6 H;  3F5H A;  1SQX J;  2KZJ A;  1GW4 A;  1GU4 A;  2FFD C;  3HD7 C;  2IDB A;  5E79 E;  4H0L B;  2RMZ A;  1NKZ B;  1YQ4 C;  1M7L A;  1QL1 A;  4R4M A;  2K3R A;  3RK3 B;  3BCC D;  1NAF A;  2YIU B;  4EIJ A;  1D7M A;  3QWO C;  3I55 P;  1YJ9 P;  3H1I E;  4H13 C;  2QJY B;  1NU1 D;  4YTP C;  1ZME C;  1WMK A;  3V2Q A;  4BRY A;  5AW1 B;  2N1T C;  4DZO A;  4KHX A;  2ZT9 D;  1NHL A;  2I8D A;  2BCC G;  2KNC A;  1QLE D;  2QIW A;  1PZQ A;  1G1J A;  1NTK G;  2KI7 B;  1S9K D;  4XA4 A;  2HYN A;  1JY3 O;  4BRY B;  3CCQ P;  4HH2 A;  1ZP0 C;  1HVV A;  4H13 D;  1NWQ A;  2OYH A;  1J2J B;  4I7Z B;  2Z4E A;  1FZC B;  5CHX A;  2H89 C;  2KNC B;  1SQB J;  4RES B;  1EQ7 A;  2E43 A;  3LID A;  1WRG A;  1FS0 E;  2N1T D;  1VQ9 P;  3TF5 A;  2E42 A;  1RF0 A;  2OYH B;  3SWK A;  5APS A;  1YI2 P;  3RK2 B;  3V4W A;  4IFM A;  2Q9I A;  3CPW O;  3I56 P;  1K05 A;  1BDC A;  1BGY G;  3FXD A;  3SWY A;  2L91 A;  3H1K E;  3H1L J;  5AVR B;  4N6J A;  2NPS D;  1SQX K;  4L73 A;  4WY4 D;  3M9Q A;  3MZW B;  3A3Y B;  1LGH B;  1Q82 Q;  1VQK P;  2LKM A;  3AEB C;  3CME P;  1VQN P;  1BE3 E;  4D6T G;  2ZVO B;  2WSE H;  3B5N A;  4JQ0 D;  5AVU B;  2FYZ A;  3M0D C;  3MTU E;  1MV8 A;  1Q7Y Q;  2WPV B;  1SQP G;  3LW5 H;  1J1D B;  1GL2 A;  1LT9 C;  4PD4 I;  5CJ0 A;  1KMI Z;  5C39 A;  3AEE C;  2IYO A;  3B5N B;  3M9H A;  3AEG C;  3H1I J;  4JPZ B;  1L0N G;  2RH0 A;  3SSU A;  3A0H E;  3EFF K;  2M3E A;  2XNX A;  1LNQ A;  5AVY B;  4IFD K;  1RE4 A;  2FYU D;  5B66 E;  2WSE J;  2QG4 A;  1ZV8 A;  4GOD A;  2Y0C A;  3L74 D;  1FZE A;  3L73 G;  1NTZ E;  2YMY A;  3IF4 A;  4CPG A;  1KIL C;  2V7Q H;  4OGQ B;  1PPJ D;  3PRJ A;  1HBW A;  3RK3 E;  5AW4 B;  1SQP E;  2W27 A;  1SQB K;  2B87 B;  2KK7 A;  3A5T A;  2HOD A;  3JCU E;  1GZL A;  4PJ0 H;  1X9V A;  5TJH A;  2GA1 A;  4Z1M H;  3L75 D;  1JMM A;  5AW0 B;  3KZI E;  1RE3 C;  3H1H G;  1KV4 A;  1L4A A;  4OVN F;  2HOD B;  2Q1K A;  1YQ3 C;  2E75 C;  1PGQ A;  4QMA A;  3L73 E;  1S72 P;  1FC2 C;  3F89 A;  5CBN A;  2FXM A;  5APX A;  5B5E E;  1ZW0 A;  1YTZ T;  1SQQ G;  5KJ7 C;  2BCC J;  3L70 E;  2M0B A;  1N2D C;  1K73 Q;  2E76 C;  1NTK J;  3CX5 I;  4KT0 J;  2AXT E;  1MUU A;  2ZXX A;  1JY2 O;  1A02 J;  4HB1 A;  1PP9 G;  1NTM E;  1N7L A;  4NPD A;  2QRX A;  3P8C D;  2E75 D;  1EZV E;  2R44 A;  3JC2 2;  5BVZ A;  3H32 A;  2SPZ A;  1VL2 A;  1S5L E;  1LTJ A;  2R5D A;  3KDP B;  2ZVN B;  3L72 E;  1GU5 A;  3GHG A;  3VMA A;  3RL0 B;  3CCU P;  1VQL P;  1OW8 A;  5KJ7 D;  3VMY A;  1X79 B;  4RKU J;  1LTT C;  2E76 D;  1SQQ E;  3H32 B;  3VYI A;  1LTJ B;  5KLI B;  3V2P A;  3GHG B;  2WQY C;  4K35 A;  2B9B A;  1FZA A;  3D70 A;  1SQV G;  3CWB E;  3TGU G;  2WSF J;  4UB8 H;  2D2C C;  1T3U A;  2OYI C;  1GW3 A;  2IFN A;  1IFD A;  3VP9 A;  1Y47 A;  2WT7 A;  2V4H A;  4H44 D;  3Q1M A;  3PHL A;  4OWF A;  4D6T J;  3W67 A;  1L0L G;  1YBK A;  1H88 A;  4ZMD A;  2GUS A;  1SQX D;  1SQP J;  3K5B A;  2OGU A;  2ZT9 B;  1XTG B;  1SVF A;  3S4R A;  1P84 D;  1FDO A;  2WT7 B;  1AJY A;  3C1L A;  1OVV A;  1PFI A;  3RBZ A;  5KLV E;  1L0N J;  2AXT H;  2JWD A;  2D2C D;  1HF9 A;  3VN0 A;  3PJS K;  3FWL A;  1NGM B;  1KB9 E;  2A45 I;  2G8Y A;  1NTK K;  1SP4 A;  3L73 J;  4C46 A;  2DW3 A;  2WZ7 A;  1M1J B;  2IYP A;  2HR3 A;  1G2C B;  3HE5 A;  1KC8 Q;  3WU2 E;  2FBW C;  1Z56 A;  2A06 D;  2MKV A;  1MKM A;  1LJ2 A;  1AVO A;  3BAS A;  1ZXG A;  2FXP A;  2NPS A;  4WY4 A;  2KOG A;  1BCC G;  2N9Y B;  5DJU B;  2P1J A;  1HWT C;  1OIP A;  1LTB C;  2PAJ A;  3P32 A;  4MN4 C;  3HE4 B;  3RBX A;  1LTA C;  1Q90 D;  4ZKU A;  3H1H J;  3H1J G;  5H2F E;  3AE2 C;  4UB6 E;  1CI6 A;  2NPS B;  3HUS A;  1FZB A;  5CCH C;  2WPS A;  2PFX A;  1SQB D;  1HGZ A;  2P7J A;  1RF1 A;  3AE9 C;  2O01 J;  3MUD A;  1JM0 A;  1VF5 B;  2HPC B;  1LTG C;  3OAK A;  3AE5 C;  5KKZ B;  3A0B H;  1CI6 B;  2YO3 A;  3CC4 P;  2I1K A;  1SQQ J;  1KYO I;  1P84 H;  1RF1 B;  1BCC E;  2W8Z A;  2IBZ I;  1DH3 A;  3L71 G;  4I6M C;  2KSJ A;  1LWU B;  1R5S A;  1IFJ A;  3CWB J;  1PV3 A;  4EDF A;  1PP9 J;  3ZDM A;  1HTL C;  3H1L D;  1NAY A;  2PP6 A;  3H1J E;  1KD1 Q;  1SQP K;  5CCH D;  5CMZ A;  3M0D A;  1X22 A;  2E74 C;  2QJP C;  1LT9 A;  4NPE A;  1NH4 A;  2QM8 A;  5GTI H;  1L0N K;  3CCV P;  4N78 D;  2B89 A;  4LGD E;  2YMK A;  1CW5 A;  2PGD A;  1FOS E;  2GUV A;  3L71 E;  1KB9 I;  4PD4 E;  4DJG A;  1SQV J;  1YJN P;  3TGU J;  2KYV A;  1OMI A;  3H1I D;  1NU1 E;  5AVX B;  3CL3 D;  5AW3 B;  1URQ C;  5H2F H;  4UB6 H;  1K9M Q;  3G9R A;  1SLQ A;  3HD7 D;  3SFE C;  2E74 D;  2QJK C;  1L0L J;  3M06 A;  3CXH I;  3D6Z A;  3H1K G;  5CCG C;  1YHQ P;  2C0W A;  3N4X A;  3IAO A;  4ASW A;  3TNU A;  4YXD C;  5KAI H;  1YIJ P;  3H6P A;  3KQG A;  1JNM A;  1K8A Q;  1URQ D;  1SQQ K;  2XDJ A;  1QEX A;  1BE3 G;  1UIX A;  3UIA A;  4PV1 C;  5AVQ B;  1N73 A;  2CK3 H;  3TNU B;  1HH0 A;  1RH5 B;  1U57 A;  1N7S C;  1T6A A;  3EWK A;  5E79 H;  3PH0 A;  5CCG D;  1PL5 A;  2KSE A;  1N73 B;  1IFM A;  1BCC J;  2BCC D;  1JO5 A;  1NTK D;  4ASV A;  4EYY Q;  2O1K A;  3CX5 E;  4A7P A;  4EI2 A;  3H1J J;  3LIE A;  1MFZ A;  3P7K A;  1SFC C;  4Y99 B;  3Q5P A;  3V6I A;  1NTZ G;  1BDD A;  4PV1 D;  2M8R A;  3U1A A;  4U7J A;  3E7K A;  2PRR A;  2QSI A;  3M91 A;  3WMM 0;  1N7S D;  3D6Y A;  1SQV K;  4H0L C;  4GOE A;  4H44 B;  4I1L A;  1H0T A;  4AYC A;  3RK3 C;  2YIU C;  1EDK A;  2ZXE B;  2FYN B;  3L71 J;  1NO4 A;  5AVZ B;  1BGY D;  5GTH E;  1KQF B;  2UWJ E;  1BSN A;  1L0L K;  2M5A A;  2OYI A;  1GL2 B;  2QJY C;  2LXC B;  2KS1 A;  3O6Q A;  1SFC D;  2GM4 A;  1H0T B;  1YIT P;  3A7O A;  5AW2 B;  1NJI Q;  1OW6 A;  2A45 G;  2Z5H A;  4R4L A;  2M5A B;  5APT A;  2O01 N;  3L70 G;  4H0L D;  2KS1 B;  3O6Q B;  2HLO A;  4D6T D;  1X0T A;  4L76 A;  1SQP D;  1OW7 A;  1SS1 A;  1NTM G;  4U3F G;  4RJT A;  1FBM A;  4I7Z C;  1FZC C;  2KP8 A;  1H8A A;  1EZV G;  4C7N A;  3CI9 A;  1Q86 Q;  5KAF E;  3CX5 H;  3FX0 A;  1L0N D;  4ZKP A;  1ZRT E;  3L72 G;  1DIP A;  2K9J A;  1FJP A;  4Y28 J;  1KIL D;  1L4A B;  2OYH C;  3FWN A;  1S5L X;  2Z5I A;  3L73 D;  2IZ1 A;  3NFQ A;  4C7N B;  3RK2 C;  3HRN A;  3CCR P;  2K9J B;  2XV5 A;  3H1K J;  1IK7 A;  1JCD A;  1GTW A;  1NVO A;  3CWB G;  3RL0 g;  4U3F E;  4LLH A;  2H88 C;  2IBZ G;  3I5C A;  1VQM P;  5CCH A;  2IFM A;  1LP1 A;  2W90 A;  1FE6 A;  2WSF H;  3A0H H;  1GMJ A;  3H1H D;  1BE3 J;  2N9B A;  5B66 H;  1M56 D;  3CCL P;  1VQ6 P;  3L37 A;  1LP1 B;  2R5B A;  4HYT B;  1J1D C;  2YXR B;  2HFE D;  3CLQ A;  1SQQ D;  2P2U A;  1IJD B;  5KLV G;  3B5N C;  1IZN B;  3JCU H;  1KYO E;  4C7R A;  1KQL A;  2IBZ E;  2C0X A;  5TIS E;  3KZI H;  2JO1 A;  1IK9 A;  1GK4 A;  2FFD A;  1OZH A;  1PP9 D;  2FY8 A;  5AVS B;  3FXE A;  3HD7 A;  1KFM A;  1N86 A;  1FZF A;  1NTZ J;  1JTH A;  2W6A A;  3AE1 C;  3OW2 O;  4OGQ C;  2O1J A;  1RE4 C;  2FFD B;  4GOF A;  1JOC A;  3HD7 B;  5B5E H;  2KUB A;  1U7J A;  5K5G B;  3Q5S A;  1FDM A;  4WBA A;  2OQQ A;  1VPC A;  3C8V A;  3V5B A;  1OVU A;  3CMA P;  5AW5 B;  1QX8 A;  1URQ A;  3M0A A;  2YKP A;  2N1T A;  3Q2Y A;  4H13 B;  1SQV D;  1MFT A;  1X8Y A;  3TGU D;  3MIW A;  4BXL A;  4W7Y A;  2H8P D;  2ZFC A;  1NKN A;  4OGQ D;  1S5L H;  3L70 J;  5CCG A;  2N1T B;  2O01 H;  1L0L D;  3CCE P;  2RKL A;  1Q2N A;  1JY3 P;  2KXP B;  5APQ A;  3HE5 B;  1ZOY C;  3CXH E;  1NTM J;  5AVT B;  4U3F J;  2HG5 D;  4WWI A;  5AVW B;  2R32 A;  3FGA D;  2Y9Z A;  5CBO A;  2Y0E A;  3H25 A;  3V4Q A;  4WY4 B;  3GW6 A;  4N3Y B;  2ZYA A;  2W83 C;  1PGJ A;  3L72 J;  1N7S A;  3GG2 A;  3IR9 A;  2AEF A;  3PP5 A;  1KQS O;  1SQB E;  3WUU A;  3KXD A;  3N7N A;  2ZJS E;  3RL0 C;  1A02 F;  1YYC A;  2P58 A;  2M3B A;  4IFF A;  4JF7 A;  3HUS B;  3BCC G;  1LTJ C;  1NTZ K;  5KLI C;  1VQ4 P;  3GHG C;  1AQ5 A;  3GF7 A;  3CCM P;  4XE5 B;  1BCC D;  1SFC A;  1NU1 G;  2IX7 C;  3H1L E;  2P10 A;  2QA4 P;  1EXJ A;  1PGP A;  3ITK A;  1UII A;  4GDO A;  3H1J D;  2CPB A;  2Y0D A;  4M3L A;  1KB9 H;  1K04 A;  4WVZ A;  5AW9 B;  5CJ4 A;  1MZ9 A;  4XFJ A;  4GIF A;  3GF3 A;  1ZLL A;  4B86 A;  4TT3 H;  1KFN A;  1PGO A;  3V2N A;  1N8R Q;  1P84 I;  1RHZ B;  1S1C X;  5APW A;  4AUW A;  3L4F A;  3QH9 A;  3WU2 H;  2ZT9 C;  4N78 E;  3MHV A;  3NXS A;  1ZR2 A;  1WT6 A;  3BCC E;  1LT9 B;  1Y9B A;  4DOJ A;  3WUV A;  5KLV J;  2FXO A;  2B88 A;  5M1B A;  3U59 A;  2R3S A;  3W68 A;  1QVG O;  3L71 D;  1KZU B;  2WMM A;  4PD4 D;  3CXH H;  1XTC C;  2P67 A;  2QM7 A;  1S3J A;  2J58 A;  4KJM A;  1KIL A;  4GKG A;  1BSH A;  1M1J C;  2WVR A;  3P8M C;  2NZ2 A;  2KIK A;  1NTM K;  3TYY A;  1AV1 A;  1OWA A;  3JSV C;  2KLV A;  2AEJ A;  1EXI A;  2Q7C A;  3SFD C;  1USE A;  1KIL B;  2WIT A;  1RE3 A;  4GT1 A;  1S9K E;  3G4S P;  1OXZ A;  1FJK A;  2AEM A;  2R3C A;  4WB4 A;  3L36 A;  3TDK A;  1NOH A;  1FZC A;  2Q3I A;  5EFW B;  1DEB A;  3CC7 P;  2BAS A;  4DCK A;  1JMB A;  1ZN5 A;  2KZI A;  3AE4 C;  4K3A A;  2NPS C;  4WY4 C;  5L8R J;  4ZNC A;  2XU6 A;  3U1C A;  2E75 B;  5KJ7 A;  2BEQ D;  2RN0 A;  4NPF X;  2JR8 A;  1VF5 C;  1VQO P;  5KKZ C;  2YKQ A;  3EQ2 A;  1USD A;  1JUN A;  3A2A A;  3BRT B;  1KQG B;  3HUS C;  5AW8 B;  1DD3 A;  2KLU A;  3PLN A;  2WWW A;  1RF1 C;  4PJ0 E;  1CSB A;  3CD6 P;  1VQ8 P;  3L35 A;  3MUD C;  2E76 B;  1JY2 P;  3G6E P;  4O9B A;  1LWU C;  2BCC E;  2H7H A;  3H1K D;  1DEE G;  2OTK E;  3II6 A;  1NTK E;  2J59 M;  1IFP A;  3GLM A;  2OTL P;  3S9O A;  2FYU G;  4PD4 H;  2K37 A;  3CX5 D;  5BU5 A;  3AE3 C;  1GDT A;  2QEX P;  3TSI A;  3L74 G;  2JJL A;  2LXB A;  1W5C E;  1VF5 D;  5KLV K;  1BE3 D;  1YJW P;  1PPJ G;  1J1E B;  1RY3 A;  1JY3 N;  3VMZ A;  1E5W A;  1CZQ A;  3BCC J;  3B8E B;  3L75 G;  5AW7 B;  2OTJ P;  2J5U A;  3CCJ P;  1H89 A;  1BGY E;  2IPP A;  1NU1 J;  4JYC A;  1RQV A;  2WSS H;  1OX3 A;  2FYU E;  1PIX A;  1HGV A;  5BU8 B;  3NTN A;  2JKV A;  3L74 E;  2D2C B;  3O8Z A;  2K88 A;  2OYI B;  1R8E A;  2YKO A;  1NTZ D;  3HTK A;  2B87 A;  1VDF A;  2POH A;  2QE7 H;  1PPJ E;  3LW5 J;  3BAT A;  1AQT A;  4D6T E;  3OA7 A;  3RK3 D;  3G3Z A;  1GK6 A;  5APU A;  2JEE A;  5APV A;  2JDI H;  3KYQ A;  2IZ0 A;  3TK1 A;  2L5G B;  3L75 E;  3HTK B;  2OYO A;  1S4X A;  1W2E A;  5DJT B;  4UB8 E;  2YO2 A;  1T2K C;  1NYH A;  1L2P A;  3S1K A;  3R4Y A;  3V2R A;  1L0N E;  4HJG H;  1OFC X;  3B71 A;  1ZRT D;  1VQP P;  3AEA C;  1KIL E;  2V7Q J;  2ZYD A;  2BEZ F;  3E1I A;  3L70 D;  4OH8 B;  1N73 C;  1RF0 C;  1T3J A;  4W7Z A;  2ITA A;  1YTZ I;  1VQ7 P;  1GD2 E;  4W80 A;  1AA0 A;  4AQR D;  2Q5U A;  2Q3E A;  2MJZ A;  2LR2 A;  1M8O B;  1T2K D;  1NTM D;  5GTH H;  3P8C E;  4U3F D;  3BRV B;  5KTB A;  4YPC A;  1JCC A;  1QGK B;  4Y99 C;  5AW6 B;  1AFO A;  1EZV D;  2YXQ B;  1U7M A;  3KHU A;  3H1H E;  1LT1 A;  2CPS A;  3SWF A;  3RK2 D;  3L72 D;  1TU3 F;  2XND H;  1SQX G;  2Q6Q A;  1NU1 K;  2I1J A;  1J1E C;  4H44 C;  2WTY A;  4I2L C;  3VP8 A;  3NMD A;  2WSC H;  4EOT A;  3BVH A;  2FYN C;  3VOP A;  1BGY J;  1HUC A;  4BWN A;  1GL2 C;  3WUT A;  2Y9Y A;  3CWB D;  4TLF A;  2FYU J;  1KYO D;  4IOI H;  2W6B A;  2IBZ D;  1M57 D;  3L74 J;  1AVY A;  3AEF C;  1PP9 E;  1LTS C;  2C9N Y;  5KAF H;  3KPE A;  1FOS F;  1DX7 A;  2XZR A;  3AEC C;  3CC2 P;  4IL6 X;  2WPR A;  1SQX E;  2WSC J;  3A0B E;  2A06 G;  2A45 H;  2E74 B;  1JTH B;  2QJP B;  1QVF O;  2E5Y A;  3IN6 A;  3T97 A;  3D71 A;  1P84 E;  3B5N D;  3MP7 B;  1FDI A;  1JY2 N;  3RGU A;  3L75 J;  2FKW B;  2C9L Y;  3VTP C;  1FZG A;  3AE6 C;  1GL2 D;  2OAR A;  2ZYG A;  1T8Z A;  3ABV C;  5KLV D;  3EFG A;  3T97 B;  1LTI C;  1M1J A;  5APY A;  3CCS P;  3M9B A;  1FU1 A;  4JYB A;  2W6J H;  1G2C A;  3R2P A;  1VQ5 P;  4IL6 E;  1SQV E;  1SQB G;  2YNY A;  2WPQ A;  1KB9 D;  3TGU E;  5AVV B;  1JB0 J;  3Q3D A;  1HJB A;  1W2B O;  1ZR4 A;  3Q5R A;  1E79 H;  4L75 A;  1URQ B;  1IFN A;  1L4A C;  1IO4 A;  1KTM A;  3C9I A;  2AXC A;  4RO0 A;  1QL2 A;  3B4S A;  2QJK B;  5GTI E;  2A06 E;  4JBZ A;  1L0L E;  1HJ0 A;  4HKZ H;  2H43 A;  2XKM A;  3HE4 A;  3PTZ A;  1EDJ A;  1EDI A;  3AED C;  3H1L G;  2KB7 P;  3CXH D;  3GMA A;  3AE7 C;  1KYO H;  3OJA B;  1EZV I;  2VRS A;  2HPC A;  1M90 Q;  5TIS H;  1G1I A;  1OVR A;  1L4A D;  1Q81 Q;  2G3A A;  3MD0 A;  2E5T A;  1EDL A;  1Y8A A;  4PV1 B; 
#chains in the Genus database with same CATH homology
 1FZA A;  1IC2 A;  5APT A;  2BAS A;  1N7S B;  3IFM A;  1ZN5 A;  2FYU K;  2HLO A;  1LWU A;  1IFI A;  2NPS C;  4WY4 C;  1FAV A;  1T3U A;  2XU6 A;  3U1C A;  2OYI C;  1GW3 A;  2IFN A;  5KJ7 A;  1IFD A;  3MGN A;  3VP9 A;  2WT7 A;  3VMX A;  1H88 A;  1FBM A;  1FZC C;  2KP8 A;  2GUS A;  2YKQ A;  1H8A A;  3EQ2 A;  1JUN A;  3A2A A;  4C7N A;  3CI9 A;  3BRT B;  3HUS C;  5AW8 B;  4LC1 A;  2WWW A;  4ZKP A;  1RF1 C;  1XTG B;  1CSB A;  1SVF A;  3RL0 D;  1SFC B;  3L35 A;  1FJP A;  1JY2 P;  2WT7 B;  4O9B A;  1LWU C;  2H7H A;  1KIL D;  1L4A B;  2OYH C;  3II6 A;  2J59 M;  2Z5I A;  1GW4 A;  1GU4 A;  3NFQ A;  2FFD C;  4C7N B;  3RK2 C;  1PFI A;  5BU5 A;  3HD7 C;  3VN0 A;  1GDT A;  3HRN A;  3TSI A;  1NKZ B;  2JJL A;  2XV5 A;  1JCD A;  1GTW A;  2A45 I;  1M7L A;  1NTK K;  1SP4 A;  4C46 A;  1QL1 A;  2WZ7 A;  3RK3 B;  1M1J B;  1NAF A;  4EIJ A;  5KLV K;  4LLH A;  1G2C B;  3HE5 A;  1J1E B;  1RY3 A;  3I5C A;  5CCH A;  2IFM A;  1JY3 N;  3VMZ A;  1Z56 A;  2WSF H;  1E5W A;  1CZQ A;  3B8E B;  3BAS A;  2NPS A;  2N9B A;  5AW7 B;  4WY4 A;  2KOG A;  3V2Q A;  2P1J A;  1HWT C;  1H89 A;  5AW1 B;  1LTB C;  2PAJ A;  2N1T C;  4DZO A;  3L37 A;  4KHX A;  2IPP A;  3P32 A;  3HE4 B;  4JYC A;  1NHL A;  1LTA C;  2R5B A;  4ZKU A;  4HYT B;  1HGV A;  5BU8 B;  1J1D C;  3NTN A;  1CI6 A;  2NPS B;  2HFE D;  3O8Z A;  3HUS A;  3CLQ A;  1FZB A;  1G1J A;  5CCH C;  1S9K D;  4XA4 A;  2OYI B;  2WPS A;  2YKO A;  2HYN A;  1JY3 O;  2P2U A;  1HGZ A;  1IJD B;  2P7J A;  1RF1 A;  3B5N C;  3HTK A;  4C7R A;  4HH2 A;  3MUD A;  1VDF A;  2POH A;  2HPC B;  1KQL A;  1LTG C;  1HVV A;  3OAK A;  3BAT A;  1NWQ A;  2OYH A;  1J2J B;  2Z4E A;  2C0X A;  1FZC B;  1CI6 B;  2YO3 A;  3OA7 A;  5CHX A;  1IK9 A;  1GK4 A;  3RK3 D;  2I1K A;  2FFD A;  3G3Z A;  1GK6 A;  5APU A;  5AVS B;  4RES B;  2JEE A;  3HD7 A;  5APV A;  1KFM A;  1N86 A;  3KYQ A;  1FZF A;  1JTH A;  1EQ7 A;  1RF1 B;  2E43 A;  2W6A A;  3TK1 A;  3LID A;  2L5G B;  3HTK B;  1WRG A;  1DH3 A;  4I6M C;  1W2E A;  2KSJ A;  2N1T D;  1LWU B;  1IFJ A;  2E42 A;  1RF0 A;  2OYH B;  2O1J A;  5APS A;  1HTL C;  2YO2 A;  1T2K C;  1RE4 C;  2FFD B;  2PP6 A;  3RK2 B;  3V4W A;  1JOC A;  3HD7 B;  1SQP K;  4IFM A;  3V2R A;  2Q9I A;  5CCH D;  5CMZ A;  1FDM A;  4WBA A;  3SWY A;  3M0D A;  1VPC A;  5AVR B;  4N6J A;  3E1I A;  3V5B A;  2NPS D;  1SQX K;  5AW5 B;  4WY4 D;  1LT9 A;  3M9Q A;  1NH4 A;  1URQ A;  2QM8 A;  3M0A A;  2YKP A;  1L0N K;  2N1T A;  4N78 D;  3A3Y B;  1X8Y A;  1LGH B;  4OH8 B;  1N73 C;  3MIW A;  1RF0 C;  1T3J A;  2LKM A;  4W7Z A;  1YTZ I;  4LGD E;  1GD2 E;  4W7Y A;  4W80 A;  1CW5 A;  1FOS E;  4AQR D;  2GUV A;  2Q5U A;  2H8P D;  2MJZ A;  2ZFC A;  1NKN A;  1T2K D;  2WSE H;  3B5N A;  5CCG A;  2N1T B;  3P8C E;  5AVU B;  2FYZ A;  3BRV B;  5KTB A;  2KYV A;  3M0D C;  2O01 H;  1MV8 A;  3MTU E;  1JCC A;  4Y99 C;  5AW6 B;  5AVX B;  3LW5 H;  3CL3 D;  1AFO A;  1J1D B;  1GL2 A;  1JY3 P;  1LT9 C;  5APQ A;  5AW3 B;  1URQ C;  3HE5 B;  2CPS A;  3SWF A;  5CJ0 A;  3RK2 D;  5AVT B;  1SLQ A;  3HD7 D;  2HG5 D;  5AVW B;  2R32 A;  3B5N B;  3M9H A;  1NU1 K;  2I1J A;  3V4Q A;  1J1E C;  4WY4 B;  3M06 A;  2XNX A;  4N3Y B;  5AVY B;  4IFD K;  1RE4 A;  2WTY A;  4I2L C;  3VP8 A;  3NMD A;  2WSC H;  1N7S A;  5CCG C;  2C0W A;  4EOT A;  1ZV8 A;  3BVH A;  3IR9 A;  3PP5 A;  3VOP A;  3N4X A;  1FZE A;  1HUC A;  3N7N A;  3TNU A;  3RL0 C;  1A02 F;  1GL2 C;  1YYC A;  2M3B A;  2YMY A;  4IFF A;  4JF7 A;  1KIL C;  3HUS B;  3H6P A;  3KQG A;  1HBW A;  2W6B A;  1JNM A;  5AW4 B;  2C9N Y;  1LTS C;  1URQ D;  2W27 A;  1SQQ K;  1SQB K;  2XDJ A;  1LTJ C;  3A5T A;  2HOD A;  1NTZ K;  3KPE A;  3GHG C;  1GZL A;  3UIA A;  1FOS F;  1DX7 A;  2XZR A;  5AVQ B;  1N73 A;  1X9V A;  3TNU B;  1AQ5 A;  1HH0 A;  1JMM A;  4XE5 B;  2WPR A;  1SFC A;  5AW0 B;  1N7S C;  1RE3 C;  2IX7 C;  2A45 H;  1JTH B;  1L4A A;  3T97 A;  3B5N D;  2HOD B;  5CCG D;  1JY2 N;  2CPB A;  1N73 B;  1IFM A;  4M3L A;  5CJ4 A;  5AW9 B;  2FKW B;  2C9L Y;  3VTP C;  1JO5 A;  1FZG A;  1MZ9 A;  1GL2 D;  4GIF A;  2OAR A;  1ZLL A;  4B86 A;  2O1K A;  1KFN A;  1T8Z A;  3V2N A;  3EFG A;  2FXM A;  1LTI C;  1M1J A;  5APY A;  5APW A;  5APX A;  3L4F A;  4AUW A;  3M9B A;  1FU1 A;  4JYB A;  1YTZ T;  1G2C A;  3LIE A;  3R2P A;  1MFZ A;  3P7K A;  4N78 E;  3NXS A;  2YNY A;  2WPQ A;  5KJ7 C;  1SFC C;  5AVV B;  4Y99 B;  1ZR2 A;  1WT6 A;  1N2D C;  1HJB A;  2M8R A;  3U1A A;  1ZR4 A;  1LT9 B;  4DOJ A;  1URQ B;  1IFN A;  1L4A C;  1IO4 A;  1MUU A;  3C9I A;  3M91 A;  1JY2 O;  1QL2 A;  3WMM 0;  1N7S D;  1A02 J;  3U59 A;  1N7L A;  1KZU B;  1SQV K;  1XTC C;  2P67 A;  2QM7 A;  3P8C D;  2J58 A;  4I1L A;  2H43 A;  1KIL A;  2XKM A;  3HE4 A;  4GKG A;  5BVZ A;  4AYC A;  3RK3 C;  1M1J C;  3H32 A;  2ZXE B;  3P8M C;  1LTJ A;  2R5D A;  3KDP B;  1NTM K;  1NO4 A;  2KB7 P;  5AVZ B;  1GU5 A;  3TYY A;  3GHG A;  1L0L K;  3RL0 B;  2OYI A;  1GL2 B;  1OWA A;  3OJA B;  2KLV A;  2VRS A;  2Q7C A;  1KIL B;  2WIT A;  1RE3 A;  5KJ7 D;  3VMY A;  1SFC D;  1X79 B;  4GT1 A;  2HPC A;  1S9K E;  1OXZ A;  1LTT C;  1FJK A;  2GM4 A;  1G1I A;  2R3C A;  3H32 B;  3A7O A;  3L36 A;  4WB4 A;  3VYI A;  1NOH A;  1FZC A;  1L4A D;  2Q3I A;  5AW2 B;  1LTJ B;  3MD0 A;  3V2P A;  3GHG B;  1DEB A;  2A45 G;  2Z5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...