3H32A

Crystal structure of d-dimer from human fibrin complexed with gly-his-arg-pro-tyr-amide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Two families of synthetic peptides that enhance fibrin turbidity and delay fibrinolysis by different mechanisms.
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 20
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08702 Fib_alpha Fibrinogen alpha/beta chain family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3h32A00
1RE4A 1N73C 1LTJC 1JY3O 2FFDA 1RF1B 3HUSB 2A45I 2OYHA 2HPCB 1RF0C 1T3UA 3E1IA 3H32A 1LT9A 1LWUB 1FZBA 2XNXA 1FZCC 1RE3C 2HODB 2H43A 2HPCA 2FFDB 3H32B 1FZCB 1LWUC 3HUSA 1N73A 1M1JA 2A45G 2FFDC 1FZEA 2HLOA 3HUSC 1FZFA 3BVHA 1RF0A 1FZCA 1W2EA 3GHGA 2Z4EA 1FZGA 1M1JB 2OYHC 3GHGC 1FZAA 1RF1A 1LT9C 1JY2N 2OYIB 2Q9IA 1N86A 1JY3P 1RE3A 1RF1C 1LTJB 2OYIA 1N73B 2OYIC 1LT9B 1JY2O 1LWUA 3GHGB 2HODA 1JY2P 1M1JC 2A45H 1RE4C 2OYHB 1JY3N 1LTJA
chains in the Genus database with same CATH superfamily
1BGYG 3L74E 4WWIA 2O01H 2WSFJ 2ZVNB 1P84I 2QIWA 5CHXA 5KKZC 1SQQE 3A0HH 2M8RA 3CC4P 2OYOA 4GIFA 1NH4A 2NZ2A 4K35A 1LTIC 4HKZH 1N7SD 2JP3A 1GTWA 3P32A 2ZT9D 1Q82Q 2KYVA 4TLFA 1D7MA 1Q81Q 1BDDA 2HLOA 2H8PD 1KD1Q 2M3BA 3WU2H 3MHVA 3BVHA 4U7JA 1FC2C 2HFED 1X0TA 3TYYA 1YJWP 4UB8H 1E79H 4JBZA 5KLIB 3JCUH 2HYNA 2QJKB 3AE5C 4D6TG 3H25A 1NKZB 4GODA 1RY3A 1FOSF 3HE4B 3VN0A 1SQQJ 2OYIC 2KNCB 1JY2P 1N7SA 2YMKA 2AXCA 5AVUB 3CCQP 2OYHB 1VQ8P 1CI6A 3IN6A 5K5GB 2YKOA 2A45I 1JTHB 1OWAA 2GUSA 2WSEH 4DJGA 1T3JA 1HTLC 3GLMA 2RMZA 4N3YB 4WY4B 3T97B 3G4SP 3WUUA 2QJPC 2G3AA 3AE7C 3V2NA 5CCHD 3G6EP 3O6QB 2KI7B 1NU1D 3L70D 1Z56A 2NPSD 1VPCA 2SPZA 4DCKA 2C0XA 3GW6A 1H88A 1S3JA 4WY4C 1T8ZA 3S4RA 1SQPE 3BCCJ 1W5CE 2KIKA 1GL2D 4GOEA 1FOSE 3FGAD 3MZWB 4W7ZA 5AW7B 2MJZA 1ZV8A 1NTMJ 2K9YA 2O1JA 1URQA 2JWDA 2W6BA 2YO3A 3BCCD 1NU1K 5KJ7D 3KPEA 4U3FE 3GHGC 3RBZA 1VL2A 1LT9C 1YYCA 3SFEC 2Q6QA 2IBZI 3UIAA 1SQQG 3SWFA 1K73Q 1PGOA 2ZT9B 3H1KD 3L73G 5APSA 2XDJA 4KHXA 2AXTH 4AQRD 5CBOA 2ZXEB 4KT0J 5AVYB 2BEQD 1VQKP 1U7JA 3U1CA 2N1TD 1T6AA 3QWOC 3K5BA 1SQBE 4PD4I 1MFZA 1GK4A 2AEFA 4R4MA 3CMAP 3H32A 5KLVJ 1SQPJ 3BCCE 3VOPA 1PPJD 4IFMA 3M0AA 4RKUJ 2N1TA 3ABVC 4PV1C 1HBWA 3H1LJ 4MN4C 3AE9C 1EZVG 2BCCG 3KDPB 2ZJSE 4TT3H 2WWWA 4ZNCA 2YIUB 2E5YA 3H1LD 1L0LE 1VQ4P 4UB6H 2XKMA 4RESB 1HGZA 2KSJA 3CCJP 1T2KC 2ZFCA 1QL1A 2C9LY 2K3RA 1BCCG 1N2DC 3L4FA 5DJTB 5AVSB 2M0BA 5KLVD 3HE5B 2HR3A 5AW2B 3RK2C 3L70E 2KOGA 3B4SA 3CLQA 1RE3A 1SQXE 3M0DA 2A06G 1YHQP 1LTJB 2K37A 2NPSA 3L71G 1PFIA 3JSVC 3L75E 1S9KE 1U7MA 2FYUK 1FDMA 2W90A 3FWLA 3H1LE 4ZKUA 4ZMDA 3MUDA 4NPDA 1NTMG 2KLVA 1U57A 1VF5D 1VDFA 2WSCJ 3IF4A 2WT7A 3E1RA 3RL0C 1VQ6P 1IFPA 1XTCC 3E1IA 1JTHA 3LW5J 3C9IA 2R32A 4R4LA 3CCLP 4RO0A 1QX8A 1WT6A 1KFNA 1S72P 1SQBD 3H1JJ 3KYQA 1KILD 1AVYA 1N73A 4H13B 1VQOP 1A02J 1NTKG 1NTZE 3VMXA 5E79E 1M56D 4GOFA 3AEGC 2AEJA 2YKPA 1QL2A 3PP5A 3GF7A 3MP7B 2KNCA 4U3FD 1LP1A 1JY3P 2WMMA 2WTYA 1J1EC 2L5GB 1YITP 2QEXP 1JB0J 1UIXA 2K1AA 1LT9B 2W6AA 3GHGB 2Z5IA 1ZN5A 1VF5B 3T97A 4CPGA 1KYOD 1URQC 3F5HA 1CZQA 4K3AA 1GW4A 1T3UA 3GF3A 4O9BA 3AE4C 3VYIA 2J58A 1QGKB 1KILC 1AQ5A 3HD7D 1SFCB 1PPJE 3CCUP 3CXHH 2JEEA 3A2AA 3NXSA 1QVGO 1KQGB 3L74D 3IFMA 2ZYAA 3CCRP 1DD4A 1N7LA 2H88C 1LTTC 2I1KA 2O01J 2WSFH 4Y28J 1GD2E 1IFMA 3H1JD 1S2EA 1VF5C 1BSNA 1W2EA 2W8ZA 3H1KG 3NFQA 3V6IA 3HTKA 2FYUJ 1EDJA 1NVOA 2E5TA 4IFFA 3F89A 3CX5I 4N78D 2E75C 5AW0B 1YJNP 4PD4E 1HGVA 1VQNP 1DEBA 1KB9I 3L35A 4LLHA 1L4AB 1SLQA 3OAKA 4B86A 3M06A 5TISE 2FYNB 4WB4A 4L74A 3SWYA 1NTKJ 1L0NG 1DD3A 1M7LA 1QEXA 1HUCA 3L72G 3Q3DA 1LWUB 1OVUA 3A0HE 1JMBA 3M91A 5BU5A 1W2BO 1R5SA 1K05A 3RL0g 2Y0DA 1NJIQ 5TJHA 1NGMB 2H43A 2E75D 1ZMEC 1L4AA 3D6YA 2FFDB 2YO2A 3CL3D 1BSHA 4JYBA 3CC7P 1Q7YQ 5KKZB 3BASA 4PD4D 1SQPK 2WPSA 4BWNA 1L2PA 1FS0E 1M1JA 1SQBG 4OVNF 5CMZA 4IFDK 3P7KA 2AXTE 3HTKB 2ZAEB 4H0LB 2Q3EA 1TU3F 5APUA 1G1IA 3FWNA 5APXA 2QSIA 4U3FG 4EIJA 4EOTA 1EXIA 2C9NY 2IDBA 1FDOA 2W83C 1QLED 3L74G 5AVRB 1YIJP 1CW5A 1SQVJ 1NTZK 2POHA 3CI9A 2IX7C 3M9HA 2P1JA 4PD4H 3CD6P 2KS1B 2B88A 5CBNA 5AVTB 3H1KJ 3H1IG 5CCGA 1IZNB 2BCCJ 1ZR2A 4N78E 2Z5HA 1IK9A 3H1HJ 4IL6E 3CC2P 1Y9BA 4H13C 3L36A 1VQPP 2C0WA 1H0TB 1KYOI 2KUBA 3D6ZA 1L0LK 1XTGB 4H44D 1DEEG 5APTA 3CWBG 2A45G 1BE3D 1R5LA 1AQTA 2P58A 4GT1A 5C39A 2YMYA 1FJKA 2FYNC 3H1JE 4I2LC 3MD0A 1YTZI 2W27A 1FZAA 1UIIA 2M5AA 1OZHA 1PIXA 1SQXK 5AW6B 3H1HD 4UB8E 1VQ5P 3I55P 3QH9A 1YI2P 2B89A 1RF1C 3H1HE 1Q2NA 1EDKA 3CXHI 4I7ZC 1SQVG 1GW3A 2LKMA 3H1KE 1N73B 1MZ9A 2A45H 4W7YA 3N7NA 4C7RA 3RGUA 4HH2A 3RK3D 2I1JA 1LTJC 3VP8A 3L75G 2WITA 1FDIA 1LTSC 2LXBA 4YTPC 1FJPA 1NWQA 2P10A 2Q1KA 4IL6X 3CXHD 1K8AQ 3H1ID 1T2KD 2FYUD 2KB7P 2N9YB 2QG4A 3L75D 3V5BA 2E74D 3AE2C 3H1JG 4NPFX 2QJPB 3W68A 3H32B 3PRJA 2KK7A 2R3CA 2KZIA 3AEDC 3RK3B 3RK2D 4YXWH 3A5TA 2FFDC 5AW8B 1BE3G 1USEA 1BDCA 1LJ2A 4L75A 4PV1B 2CPBA 2QE7H 2Y9ZA 1FZCA 4XFJA 2OYHC 1SFCD 3BRVB 1VQMP 1EC5A 3P8MC 1FAVA 2OYIB 2OTJP 1YQ3C 4YPCA 1NAYA 2WSSH 3EWKA 1J1EB 2Q5UA 1S5LE 4OWFA 1KFMA 2FYUE 2YXQB 1NKNA 1OX3A 5APWA 2QM7A 3LIDA 2HODA 3C8VA 1P84E 1NTKK 1LTAC 3MTUE 3PJSK 1JY3O 5BVZA 4DT0A 3HUSB 2JJLA 1ZP0C 1OMIA 1SVFA 1FZCC 1PL5A 1ZRTD 3CCSP 1NU1G 2E43A 2KP8A 2QRXA 2P7JA 4WY4D 1SP4A 2Y0CA 1EXJA 1KZUB 3Q1MA 3D70A 1DIPA 3AE6C 1H0TA 1S4XA 1NTME 1OW8A 3V4QA 1NTMK 4ASWA 1WMKA 2WQYC 2QA4P 3CWBD 3EQ2A 4UB6E 1VQLP 3H1IJ 4N6JA 4H0LD 3I5CA 5KLVK 1S5LX 3LW5H 4L76A 2ITAA 1RF1A 1SQQD 3B5NA 4NPEA 1S1CX 3H6PA 3CCMP 1OW6A 2QJYB 2ZYGA 4C7NB 3OA7A 1M1JC 4XA4A 4AYCA 3MUDC 1JY3N 3CCVP 2Z4EA 2BEZF 3L73J 1LP1B 3RK3E 2QJKC 1M1KQ 1BE3J 1YTZT 2RKLA 3AE8C 2LXCB 3S9OA 4ASVA 1LT9A 2ZYDA 2YIUC 4BXLA 4OGQD 3SFDC 1RE3C 3CX5D 4D6TE 3M9QA 3TGUD 1LTBC 3VMYA 5AVXB 3CX5E 5CCGC 3H1IE 1IFDA 3ITKA 3V2RA 5KAIH 3BCCG 5BU8B 2LR2A 5GTIH 3IR9A 2B9BA 2L91A 3EFGA 5AVZB 2Q7CA 3L70J 5B66H 1M90Q 1KQSO 1J2JB 4PJ0E 5APQA 1JCDA 1FZEA 2Y9YA 3EFFK 4JQ0D 1RF0A 1SQXJ 1FZGA 1AA0A 1H89A 2N1TC 1A02F 2OGUA 2QJYC 1HJ0A 1SQQK 2A06D 2O3JA 2ZT9C 2OYIA 1E5WA 2D2CB 2XU6A 3PLNA 3SSUA 3USSA 2E42A 1JUNA 1KB9E 1BGYE 1KYOH 5AW4B 1FZBA 1M57D 1NTMD 3RK2B 2FYZA 2WPRA 3L73D 3O8ZA 4IL6H 2FYUG 2IZ1A 4OGQB 1KMIZ 2P67A 1Q90D 2XNXA 3HD7B 1PP9G 3RBXA 2NRGA 1EZVI 1H8AA 1EDLA 3W67A 1PP9J 2WPQA 2O01N 1K04A 3BATA 4HB1A 5EFWB 2J5UA 1J1DC 2JWAA 4HYTB 1YJ9P 3NMDA 5B5EH 1JCCA 1M8OB 4I6MC 2E76C 3WU2E 1ZXGA 3HUSC 1NTKD 1JMMA 5B66E 2UWJE 3OJAB 3S1KA 1G1JA 1HJBA 1BGYJ 2IYOA 1JOCA 2YNYA 1OIPA 1RHZB 2QM8A 3AE1C 3JC22 1KN7A 2E74B 2E74C 2WT7B 4EI2A 1BCCD 2IBZE 3E7KA 5KAFH 2MKVA 5KLVG 1X8YA 3FX0A 3KZIH 1EQ7A 1RQVA 2H7HA 2N9BA 2JR8A 1AV1A 1KB9H 3L71E 1PGQA 1RF0C 3BRTB 3L71D 1KTMA 3AEEC 3C1LA 3HRNA 3RK3C 1SQXG 1JNMA 5AVVB 1PPJG 1GMJA 2GM4A 2HPCA 2IZ0A 1SQBJ 3FXDA 3NTNA 2E76D 5H2FH 2V4HA 1LTGC 3HD7C 3M9BA 1HVVA 3HUSA 3B5ND 1RQUA 3CWBE 3G3ZA 1L0LG 2R5BA 3TGUJ 3TGUG 5B5EE 2V7QH 1S5LH 3L71J 2IPPA 1DX7A 1SFCC 3A3YB 3GHGA 5AW5B 2AEMA 3KXDA 1OVRA 3M0DC 5AW3B 1JY2N 4H44C 3JCUE 3V2QA 1R8EA 1LT1A 3PHLA 1PGJA 3B5NC 4JYCA 2CK3H 3G71P 1NAFA 4WY4A 1L4AD 5GTHE 2RH0A 4XE5B 1HH0A 5AVQB 1NTKE 1NTZG 3V4WA 3VMZA 4I7ZB 1SQVD 1N73C 3VP9A 5L8RJ 4W80A 1RF1B 5KLIC 3L73E 3VTPC 3CWBJ 1NU1J 3D71A 4HJGH 1SQXD 4GKGA 1BCCJ 3AECC 4A7PA 1GL2C 2JKVA 5M1BA 1DH3A 1G2CA 2V7QJ 3Q5RA 4GDOA 3Q2YA 1IC2A 1S9KD 4AUWA 2FY8A 2VRSA 2Y0EA 4EDFA 4LGDE 1SQPG 5AW9B 3MGNA 3CMEP 3H1LG 1L0LD 2ZVOB 1SFCA 2B87B 1FZFA 1Q86Q 3CCEP 1KC8Q 2IBZG 1SS1A 1SQVK 2Q3IA 2WPVB 3H1HG 3WUVA 1G2CB 2A06E 5KLVE 3U1AA 2FKWB 3OW2O 1K9MQ 2KZJA 2H89C 2NPSC 3TNUA 2IFMA 1L0ND 2FXOA 3L72D 1NTZJ 4H44B 1VQ7P 3MIWA 2FXMA 1BCCE 1X9VA 2IBZD 2IFNA 1L0LJ 1RE4C 2XNDH 1IFIA 1NTZD 1P84H 3HD7A 4BRYB 1MV8A 4PV1D 1KILE 2KLUA 2NPSB 5KAIE 1GU5A 2HPCB 5GTIE 2FFDA 3L74J 3TK1A 4H0LC 1ZR4A 1EZVE 1OVVA 2BCCE 1ZOYC 1X79B 2PRRA 3A0BE 2OQQA 1EZVD 1GK6A 2BCCD 2HODB 4JF7A 5CJ0A 3TF5A 1IK7A 1PP9E 1VQ9P 1NHLA 3GG2A 2R3SA 1FZCB 3SWKA 1LWUC 1FU1A 1GZLA 1GU4A 1N7SC 2WSCH 3IAOA 2FXPA 4OH8B 1OFCX 1AFOA 3LIEA 1USDA 4EYYQ 1CI6B 5KJ7C 1ZLLA 4M3LA 4Z1MH 1KILA 4LC1A 1AJYA 1FE6A 3R4YA 3II6A 4DOJA 4WBAA 1Y47A 4L73A 3V2PA 2K9JA 3VMAA 1L4AC 2G8YA 1L0NJ 3L72J 3O6QA 4C46A 3U59A 2WSEJ 1JM0A 2DW3A 2E75B 5APYA 3TDKA 3B5NB 5CCGD 3CPWO 2R5DA 2P2UA 1QVFO 2OARA 1N7SB 2ZXXA 5CJ4A 2OYHA 4ZKPA 1PV3A 2E76B 4C7NA 1KV4A 2XV5A 3KQGA 3A7OA 3GMAA 3P8CD 1ZW0A 2GA1A 1OXZA 2J59M 1J1DB 2RN0A 3CX5H 3P8CE 3PH0A 2KS1A 1PZQA 2M3EA 3A0BH 1KQLA 2O1KA 5DJUB 1L0NE 2HG5D 3L72E 2BASA 2PFXA 5CCHA 2M5AB 5CCHC 1IJDB 3TGUE 4OGQC 3TSIA 2R44A 1P84D 3B71A 3FXEA 1MKMA 1SQPD 4IOIH 1JO5A 1HF9A 5KAFE 1NOHA 1EDIA 2K88A 2B87A 4U3FJ 1KILB 3RL0D 4WVZA 3R2PA 2CPSA 1IFNA 1LGHB 2Q9IA 2PAJA 3N4XA 2K9JB 1URQB 3I56P 1MFTA 1NO4A 1HWTC 1KB9D 1OW7A 4QMAA 1JY2O 2N1TB 2QVAA 5TISH 3Q5PA 1GDTA 1KYOE 3L37A 3AEBC 1BGYD 1RE4A 2PGDA 1KQFB 3WMM0 2WVRA 5APVA 5H2FE 1SQVE 1YBKA 3G9RA 5AW1B 4RJTA 3Q5SA 1IO4A 3AE3C 1YQ4C 1IFJA 1NYHA 1LNQA 2OTKE 5AVWB 3L70G 1NU1E 3AEAC 5KTBA 3CXHE 3HE5A 2PP6A 1N8RQ 2IYPA 1WRGA 1GL2B 2KXPB 3WUTA 1PP9D 3KHUA 2JO1A 1AVOA 4YXDC 3B8EB 3AEFC 1SQBK 4PJ0H 4JPZB 2OTLP 3PTZA 1FBMA 5KJ7A 1URQD 3TNUB 2W6JH 1ZRTE 2D2CD 1M1JB 5GTHH 3ZDMA 1JEKA 1GL2A 4I1LA 2WZ7A 4DZOA 2YXRB 3RL0B 4D6TD 1Y8AA 1N86A 3L75J 2KSEA 1KORA 2GUVA 2XZRA 2YKQA 4H13D 5E79H 4BRYA 1PGPA 2JDIH 1LWUA 4D6TJ 2I8DA 1CSBA 4Y99C 1L0NK 1RH5B 1MUUA 1X22A 2FBWC 1BE3E 3HE4A 3KZIE 1LTJA 4KJMA 4Y99B 2D2CC
chains in the Genus database with same CATH topology
2O01H 5CHXA 2M8RA 4GIFA 1NH4A 1LTIC 1N7SD 1GTWA 3P32A 2KYVA 2HLOA 2H8PD 2M3BA 3BVHA 2HFED 3TYYA 2HYNA 1NKZB 1RY3A 1FOSF 3HE4B 3VN0A 2OYIC 5AVUB 1JY2P 1N7SA 2OYHB 1CI6A 2YKOA 2A45I 1JTHB 1OWAA 2GUSA 2WSEH 1GU4A 1T3JA 1HTLC 4N3YB 4WY4B 2HPCB 3V2NA 5CCHD 1Z56A 2NPSD 1VPCA 2C0XA 1H88A 4WY4C 1T8ZA 1GL2D 1FOSE 4W7ZA 5AW7B 2MJZA 1ZV8A 2O1JA 2W6BA 2YO3A 1URQA 5KJ7D 1NU1K 3KPEA 3GHGC 1LT9C 1YYCA 3SWFA 3UIAA 5APSA 2XDJA 4KHXA 4AQRD 2ZXEB 5AVYB 3U1CA 2N1TD 1MFZA 1GK4A 3H32A 3VOPA 4IFMA 3M0AA 2N1TA 1HBWA 3KDPB 2WWWA 2XKMA 4RESB 1HGZA 2KSJA 1T2KC 2C9LY 2ZFCA 1QL1A 1N2DC 3L4FA 5AVSB 3HE5B 5AW2B 3RK2C 3M0DA 2KOGA 3CLQA 1RE3A 1LTJB 2NPSA 1PFIA 1S9KE 2FYUK 1FDMA 4ZKUA 3MUDA 2KLVA 1VDFA 2WT7A 3RL0C 1XTCC 3E1IA 1JTHA 3C9IA 2R32A 1WT6A 1KFNA 3KYQA 1N73A 1KILD 1A02J 2YKPA 1QL2A 3PP5A 1JY3P 1J1EC 2L5GB 1LT9B 2W6AA 3GHGB 2Z5IA 1ZN5A 3T97A 1URQC 1CZQA 4O9BA 1GW4A 1T3UA 3VYIA 2J58A 1KILC 1AQ5A 3HD7D 1SFCB 2JEEA 3A2AA 3NXSA 3IFMA 1N7LA 2WSFH 1LTTC 2I1KA 1GD2E 1IFMA 1W2EA 3NFQA 3HTKA 4IFFA 4N78D 5AW0B 1HGVA 3L35A 1DEBA 4LLHA 1L4AB 1SLQA 3OAKA 4B86A 3M06A 4WB4A 3SWYA 1M7LA 1HUCA 1LWUB 3M91A 5BU5A 2H43A 1L4AA 2FFDB 2YO2A 3CL3D 4JYBA 3BASA 2WPSA 1SQPK 4IFDK 5CMZA 1M1JA 3P7KA 3HTKB 5APUA 4EOTA 1G1IA 5APXA 4EIJA 2C9NY 5AVRB 1CW5A 1NTZK 2POHA 3CI9A 2IX7C 3M9HA 2P1JA 5AVTB 5CCGA 1ZR2A 4N78E 2Z5HA 1IK9A 3L36A 2C0WA 1L0LK 1XTGB 5APTA 2A45G 4GT1A 2YMYA 1FJKA 4I2LC 3MD0A 1YTZI 2W27A 1FZAA 5AW6B 1SQXK 1RF1C 1N73B 1GW3A 2LKMA 1MZ9A 2A45H 4W7YA 3N7NA 4C7RA 4HH2A 3RK3D 2I1JA 1LTJC 3VP8A 2WITA 1LTSC 1FJPA 1NWQA 1T2KD 2KB7P 3V5BA 3H32B 3RK3B 2R3CA 3A5TA 3RK2D 2FFDC 5AW8B 2CPBA 1FZCA 2OYHC 1SFCD 3BRVB 2OYIB 3P8MC 1FAVA 1J1EB 2Q5UA 1KFMA 1NKNA 5APWA 2QM7A 3LIDA 2HODA 1NTKK 1LTAC 3MTUE 1JY3O 5BVZA 3HUSB 2JJLA 1SVFA 1FZCC 2E43A 2KP8A 2P7JA 4WY4D 1SP4A 1KZUB 3V4QA 1NTMK 3EQ2A 4N6JA 5KLVK 3I5CA 3LW5H 1RF1A 3B5NA 3H6PA 4C7NB 3OA7A 1M1JC 4XA4A 4AYCA 1JY3N 2Z4EA 1YTZT 1LT9A 1RE3C 3M9QA 1LTBC 3VMYA 5AVXB 5CCGC 3V2RA 1IFDA 5BU8B 3IR9A 5AVZB 3EFGA 2Q7CA 1J2JB 5APQA 1JCDA 1FZEA 1RF0A 1FZGA 1H89A 2N1TC 1A02F 1SQQK 2OYIA 1E5WA 2XU6A 2E42A 1JUNA 5AW4B 1FZBA 2FYZA 2WPRA 3O8ZA 2P67A 2XNXA 3HD7B 1H8AA 2WPQA 3BATA 1J1DC 4HYTB 3NMDA 1JCCA 4I6MC 3HUSC 1JMMA 1HJBA 3OJAB 1G1JA 1JOCA 2YNYA 2QM8A 2WT7B 1X8YA 1EQ7A 2H7HA 2N9BA 1RF0C 3BRTB 3HRNA 3RK3C 1JNMA 5AVVB 2GM4A 2HPCA 3NTNA 1LTGC 3HD7C 3M9BA 1HVVA 3HUSA 3B5ND 3G3ZA 2R5BA 2IPPA 1DX7A 1SFCC 3A3YB 3GHGA 5AW5B 3M0DC 5AW3B 1JY2N 3V2QA 3B5NC 4JYCA 1NAFA 4WY4A 1L4AD 4XE5B 1HH0A 5AVQB 3V4WA 3VMZA 1N73C 3VP9A 4W80A 1RF1B 3VTPC 4GKGA 1GL2C 1DH3A 1G2CA 1S9KD 4AUWA 1IC2A 2VRSA 4LGDE 5AW9B 3MGNA 1SFCA 1FZFA 1SQVK 2Q3IA 1G2CB 3U1AA 2FKWB 3TNUA 2NPSC 2IFMA 3MIWA 2FXMA 1X9VA 2IFNA 1RE4C 1IFIA 3HD7A 1MV8A 2NPSB 1GU5A 2FFDA 3TK1A 1ZR4A 3RK2B 3VMXA 1X79B 1GK6A 4JF7A 2HODB 5CJ0A 1NHLA 1FZCB 1LWUC 1FU1A 1GZLA 1N7SC 2WSCH 4OH8B 1AFOA 3LIEA 5KJ7C 1CI6B 4M3LA 1KILA 4LC1A 3II6A 4DOJA 4WBAA 3V2PA 1L4AC 4C46A 3U59A 5APYA 5CCGD 3B5NB 2R5DA 2P2UA 2OARA 1N7SB 5CJ4A 2OYHA 4ZKPA 4C7NA 2XV5A 3KQGA 3A7OA 3P8CD 1OXZA 2J59M 1J1DB 3P8CE 2WTYA 1KQLA 2O1KA 2HG5D 2BASA 5CCHC 1IJDB 3TSIA 1JO5A 1NOHA 1KILB 3RL0D 3R2PA 2CPSA 1IFNA 1LGHB 2Q9IA 2PAJA 3N4XA 1URQB 1NO4A 1HWTC 1JY2O 2N1TB 1GDTA 3L37A 1RE4A 3WMM0 5APVA 1IO4A 5AW1B 1IFJA 5AVWB 5KTBA 3HE5A 2PP6A 1WRGA 1GL2B 3B8EB 1SQBK 5KJ7A 1FBMA 1URQD 3TNUB 1M1JB 4I1LA 1GL2A 2WZ7A 4DZOA 3RL0B 1N86A 2GUVA 2XZRA 2YKQA 1LWUA 1CSBA 4Y99C 1L0NK 1MUUA 1ZLLA 3HE4A 4Y99B 1LTJA 5CCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RE4 A;  1N73 C;  1LTJ C;  1JY3 O;  2FFD A;  1RF1 B;  3HUS B;  2A45 I;  2OYH A;  2HPC B;  1RF0 C;  1T3U A;  3E1I A;  3H32 A;  1LT9 A;  1LWU B;  1FZB A;  2XNX A;  1FZC C;  1RE3 C;  2HOD B;  2H43 A;  2HPC A;  2FFD B;  3H32 B;  1FZC B;  1LWU C;  3HUS A;  1N73 A;  1M1J A;  2A45 G;  2FFD C;  1FZE A;  2HLO A;  3HUS C;  1FZF A;  3BVH A;  1RF0 A;  1FZC A;  1W2E A;  3GHG A;  2Z4E A;  1FZG A;  1M1J B;  2OYH C;  3GHG C;  1FZA A;  1RF1 A;  1LT9 C;  1JY2 N;  2OYI B;  2Q9I A;  1N86 A;  1JY3 P;  1RE3 A;  1RF1 C;  1LTJ B;  2OYI A;  1N73 B;  2OYI C;  1LT9 B;  1JY2 O;  1LWU A;  3GHG B;  2HOD A;  1JY2 P;  1M1J C;  2A45 H;  1RE4 C;  2OYH B;  1JY3 N;  1LTJ A; 
#chains in the Genus database with same CATH topology
 1BGY G;  3L74 E;  4WWI A;  2O01 H;  2WSF J;  2ZVN B;  1P84 I;  2QIW A;  5CHX A;  5KKZ C;  1SQQ E;  3A0H H;  2M8R A;  3CC4 P;  2OYO A;  4GIF A;  1NH4 A;  2NZ2 A;  4K35 A;  1LTI C;  4HKZ H;  1N7S D;  2JP3 A;  1GTW A;  3P32 A;  2ZT9 D;  1Q82 Q;  2KYV A;  4TLF A;  1D7M A;  1Q81 Q;  1BDD A;  2HLO A;  2H8P D;  1KD1 Q;  2M3B A;  3WU2 H;  3MHV A;  3BVH A;  4U7J A;  1FC2 C;  2HFE D;  1X0T A;  3TYY A;  1YJW P;  4UB8 H;  1E79 H;  4JBZ A;  5KLI B;  3JCU H;  2HYN A;  2QJK B;  3AE5 C;  4D6T G;  3H25 A;  1NKZ B;  4GOD A;  1RY3 A;  1FOS F;  3HE4 B;  3VN0 A;  1SQQ J;  2OYI C;  2KNC B;  1JY2 P;  1N7S A;  2YMK A;  2AXC A;  5AVU B;  3CCQ P;  2OYH B;  1VQ8 P;  1CI6 A;  3IN6 A;  5K5G B;  2YKO A;  2A45 I;  1JTH B;  1OWA A;  2GUS A;  2WSE H;  4DJG A;  1T3J A;  1HTL C;  3GLM A;  2RMZ A;  4N3Y B;  4WY4 B;  3T97 B;  3G4S P;  3WUU A;  2QJP C;  2G3A A;  3AE7 C;  3V2N A;  5CCH D;  3G6E P;  3O6Q B;  2KI7 B;  1NU1 D;  3L70 D;  1Z56 A;  2NPS D;  1VPC A;  2SPZ A;  4DCK A;  2C0X A;  3GW6 A;  1H88 A;  1S3J A;  4WY4 C;  1T8Z A;  3S4R A;  1SQP E;  3BCC J;  1W5C E;  2KIK A;  1GL2 D;  4GOE A;  1FOS E;  3FGA D;  3MZW B;  4W7Z A;  5AW7 B;  2MJZ A;  1ZV8 A;  1NTM J;  2K9Y A;  2O1J A;  1URQ A;  2JWD A;  2W6B A;  2YO3 A;  3BCC D;  1NU1 K;  5KJ7 D;  3KPE A;  4U3F E;  3GHG C;  3RBZ A;  1VL2 A;  1LT9 C;  1YYC A;  3SFE C;  2Q6Q A;  2IBZ I;  3UIA A;  1SQQ G;  3SWF A;  1K73 Q;  1PGO A;  2ZT9 B;  3H1K D;  3L73 G;  5APS A;  2XDJ A;  4KHX A;  2AXT H;  4AQR D;  5CBO A;  2ZXE B;  4KT0 J;  5AVY B;  2BEQ D;  1VQK P;  1U7J A;  3U1C A;  2N1T D;  1T6A A;  3QWO C;  3K5B A;  1SQB E;  4PD4 I;  1MFZ A;  1GK4 A;  2AEF A;  4R4M A;  3CMA P;  3H32 A;  5KLV J;  1SQP J;  3BCC E;  3VOP A;  1PPJ D;  4IFM A;  3M0A A;  4RKU J;  2N1T A;  3ABV C;  4PV1 C;  1HBW A;  3H1L J;  4MN4 C;  3AE9 C;  1EZV G;  2BCC G;  3KDP B;  2ZJS E;  4TT3 H;  2WWW A;  4ZNC A;  2YIU B;  2E5Y A;  3H1L D;  1L0L E;  1VQ4 P;  4UB6 H;  2XKM A;  4RES B;  1HGZ A;  2KSJ A;  3CCJ P;  1T2K C;  2ZFC A;  1QL1 A;  2C9L Y;  2K3R A;  1BCC G;  1N2D C;  3L4F A;  5DJT B;  5AVS B;  2M0B A;  5KLV D;  3HE5 B;  2HR3 A;  5AW2 B;  3RK2 C;  3L70 E;  2KOG A;  3B4S A;  3CLQ A;  1RE3 A;  1SQX E;  3M0D A;  2A06 G;  1YHQ P;  1LTJ B;  2K37 A;  2NPS A;  3L71 G;  1PFI A;  3JSV C;  3L75 E;  1S9K E;  1U7M A;  2FYU K;  1FDM A;  2W90 A;  3FWL A;  3H1L E;  4ZKU A;  4ZMD A;  3MUD A;  4NPD A;  1NTM G;  2KLV A;  1U57 A;  1VF5 D;  1VDF A;  2WSC J;  3IF4 A;  2WT7 A;  3E1R A;  3RL0 C;  1VQ6 P;  1IFP A;  1XTC C;  3E1I A;  1JTH A;  3LW5 J;  3C9I A;  2R32 A;  4R4L A;  3CCL P;  4RO0 A;  1QX8 A;  1WT6 A;  1KFN A;  1S72 P;  1SQB D;  3H1J J;  3KYQ A;  1KIL D;  1AVY A;  1N73 A;  4H13 B;  1VQO P;  1A02 J;  1NTK G;  1NTZ E;  3VMX A;  5E79 E;  1M56 D;  4GOF A;  3AEG C;  2AEJ A;  2YKP A;  1QL2 A;  3PP5 A;  3GF7 A;  3MP7 B;  2KNC A;  4U3F D;  1LP1 A;  1JY3 P;  2WMM A;  2WTY A;  1J1E C;  2L5G B;  1YIT P;  2QEX P;  1JB0 J;  1UIX A;  2K1A A;  1LT9 B;  2W6A A;  3GHG B;  2Z5I A;  1ZN5 A;  1VF5 B;  3T97 A;  4CPG A;  1KYO D;  1URQ C;  3F5H A;  1CZQ A;  4K3A A;  1GW4 A;  1T3U A;  3GF3 A;  4O9B A;  3AE4 C;  3VYI A;  2J58 A;  1QGK B;  1KIL C;  1AQ5 A;  3HD7 D;  1SFC B;  1PPJ E;  3CCU P;  3CXH H;  2JEE A;  3A2A A;  3NXS A;  1QVG O;  1KQG B;  3L74 D;  3IFM A;  2ZYA A;  3CCR P;  1DD4 A;  1N7L A;  2H88 C;  1LTT C;  2I1K A;  2O01 J;  2WSF H;  4Y28 J;  1GD2 E;  1IFM A;  3H1J D;  1S2E A;  1VF5 C;  1BSN A;  1W2E A;  2W8Z A;  3H1K G;  3NFQ A;  3V6I A;  3HTK A;  2FYU J;  1EDJ A;  1NVO A;  2E5T A;  4IFF A;  3F89 A;  3CX5 I;  4N78 D;  2E75 C;  5AW0 B;  1YJN P;  4PD4 E;  1HGV A;  1VQN P;  1DEB A;  1KB9 I;  3L35 A;  4LLH A;  1L4A B;  1SLQ A;  3OAK A;  4B86 A;  3M06 A;  5TIS E;  2FYN B;  4WB4 A;  4L74 A;  3SWY A;  1NTK J;  1L0N G;  1DD3 A;  1M7L A;  1QEX A;  1HUC A;  3L72 G;  3Q3D A;  1LWU B;  1OVU A;  3A0H E;  1JMB A;  3M91 A;  5BU5 A;  1W2B O;  1R5S A;  1K05 A;  3RL0 g;  2Y0D A;  1NJI Q;  5TJH A;  1NGM B;  2H43 A;  2E75 D;  1ZME C;  1L4A A;  3D6Y A;  2FFD B;  2YO2 A;  3CL3 D;  1BSH A;  4JYB A;  3CC7 P;  1Q7Y Q;  5KKZ B;  3BAS A;  4PD4 D;  1SQP K;  2WPS A;  4BWN A;  1L2P A;  1FS0 E;  1M1J A;  1SQB G;  4OVN F;  5CMZ A;  4IFD K;  3P7K A;  2AXT E;  3HTK B;  2ZAE B;  4H0L B;  2Q3E A;  1TU3 F;  5APU A;  1G1I A;  3FWN A;  5APX A;  2QSI A;  4U3F G;  4EIJ A;  4EOT A;  1EXI A;  2C9N Y;  2IDB A;  1FDO A;  2W83 C;  1QLE D;  3L74 G;  5AVR B;  1YIJ P;  1CW5 A;  1SQV J;  1NTZ K;  2POH A;  3CI9 A;  2IX7 C;  3M9H A;  2P1J A;  4PD4 H;  3CD6 P;  2KS1 B;  2B88 A;  5CBN A;  5AVT B;  3H1K J;  3H1I G;  5CCG A;  1IZN B;  2BCC J;  1ZR2 A;  4N78 E;  2Z5H A;  1IK9 A;  3H1H J;  4IL6 E;  3CC2 P;  1Y9B A;  4H13 C;  3L36 A;  1VQP P;  2C0W A;  1H0T B;  1KYO I;  2KUB A;  3D6Z A;  1L0L K;  1XTG B;  4H44 D;  1DEE G;  5APT A;  3CWB G;  2A45 G;  1BE3 D;  1R5L A;  1AQT A;  2P58 A;  4GT1 A;  5C39 A;  2YMY A;  1FJK A;  2FYN C;  3H1J E;  4I2L C;  3MD0 A;  1YTZ I;  2W27 A;  1FZA A;  1UII A;  2M5A A;  1OZH A;  1PIX A;  1SQX K;  5AW6 B;  3H1H D;  4UB8 E;  1VQ5 P;  3I55 P;  3QH9 A;  1YI2 P;  2B89 A;  1RF1 C;  3H1H E;  1Q2N A;  1EDK A;  3CXH I;  4I7Z C;  1SQV G;  1GW3 A;  2LKM A;  3H1K E;  1N73 B;  1MZ9 A;  2A45 H;  4W7Y A;  3N7N A;  4C7R A;  3RGU A;  4HH2 A;  3RK3 D;  2I1J A;  1LTJ C;  3VP8 A;  3L75 G;  2WIT A;  1FDI A;  1LTS C;  2LXB A;  4YTP C;  1FJP A;  1NWQ A;  2P10 A;  2Q1K A;  4IL6 X;  3CXH D;  1K8A Q;  3H1I D;  1T2K D;  2FYU D;  2KB7 P;  2N9Y B;  2QG4 A;  3L75 D;  3V5B A;  2E74 D;  3AE2 C;  3H1J G;  4NPF X;  2QJP B;  3W68 A;  3H32 B;  3PRJ A;  2KK7 A;  2R3C A;  2KZI A;  3AED C;  3RK3 B;  3RK2 D;  4YXW H;  3A5T A;  2FFD C;  5AW8 B;  1BE3 G;  1USE A;  1BDC A;  1LJ2 A;  4L75 A;  4PV1 B;  2CPB A;  2QE7 H;  2Y9Z A;  1FZC A;  4XFJ A;  2OYH C;  1SFC D;  3BRV B;  1VQM P;  1EC5 A;  3P8M C;  1FAV A;  2OYI B;  2OTJ P;  1YQ3 C;  4YPC A;  1NAY A;  2WSS H;  3EWK A;  1J1E B;  2Q5U A;  1S5L E;  4OWF A;  1KFM A;  2FYU E;  2YXQ B;  1NKN A;  1OX3 A;  5APW A;  2QM7 A;  3LID A;  2HOD A;  3C8V A;  1P84 E;  1NTK K;  1LTA C;  3MTU E;  3PJS K;  1JY3 O;  5BVZ A;  4DT0 A;  3HUS B;  2JJL A;  1ZP0 C;  1OMI A;  1SVF A;  1FZC C;  1PL5 A;  1ZRT D;  3CCS P;  1NU1 G;  2E43 A;  2KP8 A;  2QRX A;  2P7J A;  4WY4 D;  1SP4 A;  2Y0C A;  1EXJ A;  1KZU B;  3Q1M A;  3D70 A;  1DIP A;  3AE6 C;  1H0T A;  1S4X A;  1NTM E;  1OW8 A;  3V4Q A;  1NTM K;  4ASW A;  1WMK A;  2WQY C;  2QA4 P;  3CWB D;  3EQ2 A;  4UB6 E;  1VQL P;  3H1I J;  4N6J A;  4H0L D;  3I5C A;  5KLV K;  1S5L X;  3LW5 H;  4L76 A;  2ITA A;  1RF1 A;  1SQQ D;  3B5N A;  4NPE A;  1S1C X;  3H6P A;  3CCM P;  1OW6 A;  2QJY B;  2ZYG A;  4C7N B;  3OA7 A;  1M1J C;  4XA4 A;  4AYC A;  3MUD C;  1JY3 N;  3CCV P;  2Z4E A;  2BEZ F;  3L73 J;  1LP1 B;  3RK3 E;  2QJK C;  1M1K Q;  1BE3 J;  1YTZ T;  2RKL A;  3AE8 C;  2LXC B;  3S9O A;  4ASV A;  1LT9 A;  2ZYD A;  2YIU C;  4BXL A;  4OGQ D;  3SFD C;  1RE3 C;  3CX5 D;  4D6T E;  3M9Q A;  3TGU D;  1LTB C;  3VMY A;  5AVX B;  3CX5 E;  5CCG C;  3H1I E;  1IFD A;  3ITK A;  3V2R A;  5KAI H;  3BCC G;  5BU8 B;  2LR2 A;  5GTI H;  3IR9 A;  2B9B A;  2L91 A;  3EFG A;  5AVZ B;  2Q7C A;  3L70 J;  5B66 H;  1M90 Q;  1KQS O;  1J2J B;  4PJ0 E;  5APQ A;  1JCD A;  1FZE A;  2Y9Y A;  3EFF K;  4JQ0 D;  1RF0 A;  1SQX J;  1FZG A;  1AA0 A;  1H89 A;  2N1T C;  1A02 F;  2OGU A;  2QJY C;  1HJ0 A;  1SQQ K;  2A06 D;  2O3J A;  2ZT9 C;  2OYI A;  1E5W A;  2D2C B;  2XU6 A;  3PLN A;  3SSU A;  3USS A;  2E42 A;  1JUN A;  1KB9 E;  1BGY E;  1KYO H;  5AW4 B;  1FZB A;  1M57 D;  1NTM D;  3RK2 B;  2FYZ A;  2WPR A;  3L73 D;  3O8Z A;  4IL6 H;  2FYU G;  2IZ1 A;  4OGQ B;  1KMI Z;  2P67 A;  1Q90 D;  2XNX A;  3HD7 B;  1PP9 G;  3RBX A;  2NRG A;  1EZV I;  1H8A A;  1EDL A;  3W67 A;  1PP9 J;  2WPQ A;  2O01 N;  1K04 A;  3BAT A;  4HB1 A;  5EFW B;  2J5U A;  1J1D C;  2JWA A;  4HYT B;  1YJ9 P;  3NMD A;  5B5E H;  1JCC A;  1M8O B;  4I6M C;  2E76 C;  3WU2 E;  1ZXG A;  3HUS C;  1NTK D;  1JMM A;  5B66 E;  2UWJ E;  3OJA B;  3S1K A;  1G1J A;  1HJB A;  1BGY J;  2IYO A;  1JOC A;  2YNY A;  1OIP A;  1RHZ B;  2QM8 A;  3AE1 C;  3JC2 2;  1KN7 A;  2E74 B;  2E74 C;  2WT7 B;  4EI2 A;  1BCC D;  2IBZ E;  3E7K A;  5KAF H;  2MKV A;  5KLV G;  1X8Y A;  3FX0 A;  3KZI H;  1EQ7 A;  1RQV A;  2H7H A;  2N9B A;  2JR8 A;  1AV1 A;  1KB9 H;  3L71 E;  1PGQ A;  1RF0 C;  3BRT B;  3L71 D;  1KTM A;  3AEE C;  3C1L A;  3HRN A;  3RK3 C;  1SQX G;  1JNM A;  5AVV B;  1PPJ G;  1GMJ A;  2GM4 A;  2HPC A;  2IZ0 A;  1SQB J;  3FXD A;  3NTN A;  2E76 D;  5H2F H;  2V4H A;  1LTG C;  3HD7 C;  3M9B A;  1HVV A;  3HUS A;  3B5N D;  1RQU A;  3CWB E;  3G3Z A;  1L0L G;  2R5B A;  3TGU J;  3TGU G;  5B5E E;  2V7Q H;  1S5L H;  3L71 J;  2IPP A;  1DX7 A;  1SFC C;  3A3Y B;  3GHG A;  5AW5 B;  2AEM A;  3KXD A;  1OVR A;  3M0D C;  5AW3 B;  1JY2 N;  4H44 C;  3JCU E;  3V2Q A;  1R8E A;  1LT1 A;  3PHL A;  1PGJ A;  3B5N C;  4JYC A;  2CK3 H;  3G71 P;  1NAF A;  4WY4 A;  1L4A D;  5GTH E;  2RH0 A;  4XE5 B;  1HH0 A;  5AVQ B;  1NTK E;  1NTZ G;  3V4W A;  3VMZ A;  4I7Z B;  1SQV D;  1N73 C;  3VP9 A;  5L8R J;  4W80 A;  1RF1 B;  5KLI C;  3L73 E;  3VTP C;  3CWB J;  1NU1 J;  3D71 A;  4HJG H;  1SQX D;  4GKG A;  1BCC J;  3AEC C;  4A7P A;  1GL2 C;  2JKV A;  5M1B A;  1DH3 A;  1G2C A;  2V7Q J;  3Q5R A;  4GDO A;  3Q2Y A;  1IC2 A;  1S9K D;  4AUW A;  2FY8 A;  2VRS A;  2Y0E A;  4EDF A;  4LGD E;  1SQP G;  5AW9 B;  3MGN A;  3CME P;  3H1L G;  1L0L D;  2ZVO B;  1SFC A;  2B87 B;  1FZF A;  1Q86 Q;  3CCE P;  1KC8 Q;  2IBZ G;  1SS1 A;  1SQV K;  2Q3I A;  2WPV B;  3H1H G;  3WUV A;  1G2C B;  2A06 E;  5KLV E;  3U1A A;  2FKW B;  3OW2 O;  1K9M Q;  2KZJ A;  2H89 C;  2NPS C;  3TNU A;  2IFM A;  1L0N D;  2FXO A;  3L72 D;  1NTZ J;  4H44 B;  1VQ7 P;  3MIW A;  2FXM A;  1BCC E;  1X9V A;  2IBZ D;  2IFN A;  1L0L J;  1RE4 C;  2XND H;  1IFI A;  1NTZ D;  1P84 H;  3HD7 A;  4BRY B;  1MV8 A;  4PV1 D;  1KIL E;  2KLU A;  2NPS B;  5KAI E;  1GU5 A;  2HPC B;  5GTI E;  2FFD A;  3L74 J;  3TK1 A;  4H0L C;  1ZR4 A;  1EZV E;  1OVV A;  2BCC E;  1ZOY C;  1X79 B;  2PRR A;  3A0B E;  2OQQ A;  1EZV D;  1GK6 A;  2BCC D;  2HOD B;  4JF7 A;  5CJ0 A;  3TF5 A;  1IK7 A;  1PP9 E;  1VQ9 P;  1NHL A;  3GG2 A;  2R3S A;  1FZC B;  3SWK A;  1LWU C;  1FU1 A;  1GZL A;  1GU4 A;  1N7S C;  2WSC H;  3IAO A;  2FXP A;  4OH8 B;  1OFC X;  1AFO A;  3LIE A;  1USD A;  4EYY Q;  1CI6 B;  5KJ7 C;  1ZLL A;  4M3L A;  4Z1M H;  1KIL A;  4LC1 A;  1AJY A;  1FE6 A;  3R4Y A;  3II6 A;  4DOJ A;  4WBA A;  1Y47 A;  4L73 A;  3V2P A;  2K9J A;  3VMA A;  1L4A C;  2G8Y A;  1L0N J;  3L72 J;  3O6Q A;  4C46 A;  3U59 A;  2WSE J;  1JM0 A;  2DW3 A;  2E75 B;  5APY A;  3TDK A;  3B5N B;  5CCG D;  3CPW O;  2R5D A;  2P2U A;  1QVF O;  2OAR A;  1N7S B;  2ZXX A;  5CJ4 A;  2OYH A;  4ZKP A;  1PV3 A;  2E76 B;  4C7N A;  1KV4 A;  2XV5 A;  3KQG A;  3A7O A;  3GMA A;  3P8C D;  1ZW0 A;  2GA1 A;  1OXZ A;  2J59 M;  1J1D B;  2RN0 A;  3CX5 H;  3P8C E;  3PH0 A;  2KS1 A;  1PZQ A;  2M3E A;  3A0B H;  1KQL A;  2O1K A;  5DJU B;  1L0N E;  2HG5 D;  3L72 E;  2BAS A;  2PFX A;  5CCH A;  2M5A B;  5CCH C;  1IJD B;  3TGU E;  4OGQ C;  3TSI A;  2R44 A;  1P84 D;  3B71 A;  3FXE A;  1MKM A;  1SQP D;  4IOI H;  1JO5 A;  1HF9 A;  5KAF E;  1NOH A;  1EDI A;  2K88 A;  2B87 A;  4U3F J;  1KIL B;  3RL0 D;  4WVZ A;  3R2P A;  2CPS A;  1IFN A;  1LGH B;  2Q9I A;  2PAJ A;  3N4X A;  2K9J B;  1URQ B;  3I56 P;  1MFT A;  1NO4 A;  1HWT C;  1KB9 D;  1OW7 A;  4QMA A;  1JY2 O;  2N1T B;  2QVA A;  5TIS H;  3Q5P A;  1GDT A;  1KYO E;  3L37 A;  3AEB C;  1BGY D;  1RE4 A;  2PGD A;  1KQF B;  3WMM 0;  2WVR A;  5APV A;  5H2F E;  1SQV E;  1YBK A;  3G9R A;  5AW1 B;  4RJT A;  3Q5S A;  1IO4 A;  3AE3 C;  1YQ4 C;  1IFJ A;  1NYH A;  1LNQ A;  2OTK E;  5AVW B;  3L70 G;  1NU1 E;  3AEA C;  5KTB A;  3CXH E;  3HE5 A;  2PP6 A;  1N8R Q;  2IYP A;  1WRG A;  1GL2 B;  2KXP B;  3WUT A;  1PP9 D;  3KHU A;  2JO1 A;  1AVO A;  4YXD C;  3B8E B;  3AEF C;  1SQB K;  4PJ0 H;  4JPZ B;  2OTL P;  3PTZ A;  1FBM A;  5KJ7 A;  1URQ D;  3TNU B;  2W6J H;  1ZRT E;  2D2C D;  1M1J B;  5GTH H;  3ZDM A;  1JEK A;  1GL2 A;  4I1L A;  2WZ7 A;  4DZO A;  2YXR B;  3RL0 B;  4D6T D;  1Y8A A;  1N86 A;  3L75 J;  2KSE A;  1KOR A;  2GUV A;  2XZR A;  2YKQ A;  4H13 D;  5E79 H;  4BRY A;  1PGP A;  2JDI H;  1LWU A;  4D6T J;  2I8D A;  1CSB A;  4Y99 C;  1L0N K;  1RH5 B;  1MUU A;  1X22 A;  2FBW C;  1BE3 E;  3HE4 A;  3KZI E;  1LTJ A;  4KJM A;  4Y99 B;  2D2C C; 
#chains in the Genus database with same CATH homology
 2O01 H;  5CHX A;  2M8R A;  4GIF A;  1NH4 A;  1LTI C;  1N7S D;  1GTW A;  3P32 A;  2KYV A;  2HLO A;  2H8P D;  2M3B A;  3BVH A;  2HFE D;  3TYY A;  2HYN A;  1NKZ B;  1RY3 A;  1FOS F;  3HE4 B;  3VN0 A;  2OYI C;  5AVU B;  1JY2 P;  1N7S A;  2OYH B;  1CI6 A;  2YKO A;  2A45 I;  1JTH B;  1OWA A;  2GUS A;  2WSE H;  1GU4 A;  1T3J A;  1HTL C;  4N3Y B;  4WY4 B;  2HPC B;  3V2N A;  5CCH D;  1Z56 A;  2NPS D;  1VPC A;  2C0X A;  1H88 A;  4WY4 C;  1T8Z A;  1GL2 D;  1FOS E;  4W7Z A;  5AW7 B;  2MJZ A;  1ZV8 A;  2O1J A;  2W6B A;  2YO3 A;  1URQ A;  5KJ7 D;  1NU1 K;  3KPE A;  3GHG C;  1LT9 C;  1YYC A;  3SWF A;  3UIA A;  5APS A;  2XDJ A;  4KHX A;  4AQR D;  2ZXE B;  5AVY B;  3U1C A;  2N1T D;  1MFZ A;  1GK4 A;  3H32 A;  3VOP A;  4IFM A;  3M0A A;  2N1T A;  1HBW A;  3KDP B;  2WWW A;  2XKM A;  4RES B;  1HGZ A;  2KSJ A;  1T2K C;  2C9L Y;  2ZFC A;  1QL1 A;  1N2D C;  3L4F A;  5AVS B;  3HE5 B;  5AW2 B;  3RK2 C;  3M0D A;  2KOG A;  3CLQ A;  1RE3 A;  1LTJ B;  2NPS A;  1PFI A;  1S9K E;  2FYU K;  1FDM A;  4ZKU A;  3MUD A;  2KLV A;  1VDF A;  2WT7 A;  3RL0 C;  1XTC C;  3E1I A;  1JTH A;  3C9I A;  2R32 A;  1WT6 A;  1KFN A;  3KYQ A;  1N73 A;  1KIL D;  1A02 J;  2YKP A;  1QL2 A;  3PP5 A;  1JY3 P;  1J1E C;  2L5G B;  1LT9 B;  2W6A A;  3GHG B;  2Z5I A;  1ZN5 A;  3T97 A;  1URQ C;  1CZQ A;  4O9B A;  1GW4 A;  1T3U A;  3VYI A;  2J58 A;  1KIL C;  1AQ5 A;  3HD7 D;  1SFC B;  2JEE A;  3A2A A;  3NXS A;  3IFM A;  1N7L A;  2WSF H;  1LTT C;  2I1K A;  1GD2 E;  1IFM A;  1W2E A;  3NFQ A;  3HTK A;  4IFF A;  4N78 D;  5AW0 B;  1HGV A;  3L35 A;  1DEB A;  4LLH A;  1L4A B;  1SLQ A;  3OAK A;  4B86 A;  3M06 A;  4WB4 A;  3SWY A;  1M7L A;  1HUC A;  1LWU B;  3M91 A;  5BU5 A;  2H43 A;  1L4A A;  2FFD B;  2YO2 A;  3CL3 D;  4JYB A;  3BAS A;  2WPS A;  1SQP K;  4IFD K;  5CMZ A;  1M1J A;  3P7K A;  3HTK B;  5APU A;  4EOT A;  1G1I A;  5APX A;  4EIJ A;  2C9N Y;  5AVR B;  1CW5 A;  1NTZ K;  2POH A;  3CI9 A;  2IX7 C;  3M9H A;  2P1J A;  5AVT B;  5CCG A;  1ZR2 A;  4N78 E;  2Z5H A;  1IK9 A;  3L36 A;  2C0W A;  1L0L K;  1XTG B;  5APT A;  2A45 G;  4GT1 A;  2YMY A;  1FJK A;  4I2L C;  3MD0 A;  1YTZ I;  2W27 A;  1FZA A;  5AW6 B;  1SQX K;  1RF1 C;  1N73 B;  1GW3 A;  2LKM A;  1MZ9 A;  2A45 H;  4W7Y A;  3N7N A;  4C7R A;  4HH2 A;  3RK3 D;  2I1J A;  1LTJ C;  3VP8 A;  2WIT A;  1LTS C;  1FJP A;  1NWQ A;  1T2K D;  2KB7 P;  3V5B A;  3H32 B;  3RK3 B;  2R3C A;  3A5T A;  3RK2 D;  2FFD C;  5AW8 B;  2CPB A;  1FZC A;  2OYH C;  1SFC D;  3BRV B;  2OYI B;  3P8M C;  1FAV A;  1J1E B;  2Q5U A;  1KFM A;  1NKN A;  5APW A;  2QM7 A;  3LID A;  2HOD A;  1NTK K;  1LTA C;  3MTU E;  1JY3 O;  5BVZ A;  3HUS B;  2JJL A;  1SVF A;  1FZC C;  2E43 A;  2KP8 A;  2P7J A;  4WY4 D;  1SP4 A;  1KZU B;  3V4Q A;  1NTM K;  3EQ2 A;  4N6J A;  5KLV K;  3I5C A;  3LW5 H;  1RF1 A;  3B5N A;  3H6P A;  4C7N B;  3OA7 A;  1M1J C;  4XA4 A;  4AYC A;  1JY3 N;  2Z4E A;  1YTZ T;  1LT9 A;  1RE3 C;  3M9Q A;  1LTB C;  3VMY A;  5AVX B;  5CCG C;  3V2R A;  1IFD A;  5BU8 B;  3IR9 A;  5AVZ B;  3EFG A;  2Q7C A;  1J2J B;  5APQ A;  1JCD A;  1FZE A;  1RF0 A;  1FZG A;  1H89 A;  2N1T C;  1A02 F;  1SQQ K;  2OYI A;  1E5W A;  2XU6 A;  2E42 A;  1JUN A;  5AW4 B;  1FZB A;  2FYZ A;  2WPR A;  3O8Z A;  2P67 A;  2XNX A;  3HD7 B;  1H8A A;  2WPQ A;  3BAT A;  1J1D C;  4HYT B;  3NMD A;  1JCC A;  4I6M C;  3HUS C;  1JMM A;  1HJB A;  3OJA B;  1G1J A;  1JOC A;  2YNY A;  2QM8 A;  2WT7 B;  1X8Y A;  1EQ7 A;  2H7H A;  2N9B A;  1RF0 C;  3BRT B;  3HRN A;  3RK3 C;  1JNM A;  5AVV B;  2GM4 A;  2HPC A;  3NTN A;  1LTG C;  3HD7 C;  3M9B A;  1HVV A;  3HUS A;  3B5N D;  3G3Z A;  2R5B A;  2IPP A;  1DX7 A;  1SFC C;  3A3Y B;  3GHG A;  5AW5 B;  3M0D C;  5AW3 B;  1JY2 N;  3V2Q A;  3B5N C;  4JYC A;  1NAF A;  4WY4 A;  1L4A D;  4XE5 B;  1HH0 A;  5AVQ B;  3V4W A;  3VMZ A;  1N73 C;  3VP9 A;  4W80 A;  1RF1 B;  3VTP C;  4GKG A;  1GL2 C;  1DH3 A;  1G2C A;  1S9K D;  4AUW A;  1IC2 A;  2VRS A;  4LGD E;  5AW9 B;  3MGN A;  1SFC A;  1FZF A;  1SQV K;  2Q3I A;  1G2C B;  3U1A A;  2FKW B;  3TNU A;  2NPS C;  2IFM A;  3MIW A;  2FXM A;  1X9V A;  2IFN A;  1RE4 C;  1IFI A;  3HD7 A;  1MV8 A;  2NPS B;  1GU5 A;  2FFD A;  3TK1 A;  1ZR4 A;  3RK2 B;  3VMX A;  1X79 B;  1GK6 A;  4JF7 A;  2HOD B;  5CJ0 A;  1NHL A;  1FZC B;  1LWU C;  1FU1 A;  1GZL A;  1N7S C;  2WSC H;  4OH8 B;  1AFO A;  3LIE A;  5KJ7 C;  1CI6 B;  4M3L A;  1KIL A;  4LC1 A;  3II6 A;  4DOJ A;  4WBA A;  3V2P A;  1L4A C;  4C46 A;  3U59 A;  5APY A;  5CCG D;  3B5N B;  2R5D A;  2P2U A;  2OAR A;  1N7S B;  5CJ4 A;  2OYH A;  4ZKP A;  4C7N A;  2XV5 A;  3KQG A;  3A7O A;  3P8C D;  1OXZ A;  2J59 M;  1J1D B;  3P8C E;  2WTY A;  1KQL A;  2O1K A;  2HG5 D;  2BAS A;  5CCH C;  1IJD B;  3TSI A;  1JO5 A;  1NOH A;  1KIL B;  3RL0 D;  3R2P A;  2CPS A;  1IFN A;  1LGH B;  2Q9I A;  2PAJ A;  3N4X A;  1URQ B;  1NO4 A;  1HWT C;  1JY2 O;  2N1T B;  1GDT A;  3L37 A;  1RE4 A;  3WMM 0;  5APV A;  1IO4 A;  5AW1 B;  1IFJ A;  5AVW B;  5KTB A;  3HE5 A;  2PP6 A;  1WRG A;  1GL2 B;  3B8E B;  1SQB K;  5KJ7 A;  1FBM A;  1URQ D;  3TNU B;  1M1J B;  4I1L A;  1GL2 A;  2WZ7 A;  4DZO A;  3RL0 B;  1N86 A;  2GUV A;  2XZR A;  2YKQ A;  1LWU A;  1CSB A;  4Y99 C;  1L0N K;  1MUU A;  1ZLL A;  3HE4 A;  4Y99 B;  1LTJ A;  5CCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...