1GK4A

Human vimentin coil 2b fragment (cys2)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
79
structure length
79
Chain Sequence
b'CEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VIMENTIN
publication title Conserved Segments 1A and 2B of the Intermediate Filament Dimer: Their Atomic Structures and Role in Filament Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Vimentin
total genus 38
structure length 79
sequence length 79
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2001-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gk4A00
1OWAA 3L35A 3L36A 1T2KD 2Q7CA 2P67A 2P2UA 4C46A 3HE4B 1FOSE 2H7HA 3M0DA 3IR9A 5AVUB 2P7JA 3LIEA 4M3LA 2WPSA 2YO3A 3P8MC 3TYYA 1FAVA 4JYCA 4KHXA 4I2LC 1KQLA 5AW7B 2XU6A 3M9HA 1G2CB 3VMZA 1CI6A 5AVXB 3KDPB 1X8YA 1CZQA 2R32A 1GU5A 4B86A 2JJLA 3T97A 1SP4A 1HJBA 5AW3B 3M91A 5AVRB 3P32A 5AW5B 4AUWA 1GTWA 1SLQA 1IO4A 3I5CA 3M0AA 2QM8A 3M9BA 2WT7A 1GK4A 3NMDA 3NFQA 2IPPA 5APYA 2WTYA 1JNMA 1CSBA 1J2JB 5AW2B 3B8EB 2R5BA 2KP8A 5AW1B 3A5TA 5AVWB 2Q5UA 3HE5A 3UIAA 1JUNA 1NAFA 2XV5A 3MD0A 5APUA 1A02F 4HYTB 3NTNA 3V5BA 2ZFCA 3LIDA 1HWTC 5AVQB 4C7NA 4GT1A 2ZXEB 5APVA 3V4QA 5AW8B 1CI6B 1GU4A 3VN0A 4RESB 3VYIA 2WPQA 4XE5B 5AVSB 5AW6B 1OXZA 3OAKA 5APQA 2Z5IA 1MV8A 3TNUA 2C9NY 1MUUA 1GZLA 4JYBA 2WT7B 2E43A 1S9KE 5AW9B 2WWWA 2BASA 1GK6A 2Q3IA 3A2AA 1DH3A 5AVVB 2XZRA 4LC1A 2R5DA 2QM7A 5AVTB 3VTPC 2YNYA 4EOTA 3A3YB 5AVYB 5APWA 3M06A 1H8AA 3VMYA 1H89A 1A02J 3HE4A 2VRSA 4C7NB 3V4WA 5AVZB 1FOSF 3MGNA 2N9BA 5APTA 3TK1A 2C9LY 4I6MC 5AW4B 2W6AA 3L37A 1T2KC 3A7OA 3HTKA 3TNUB 3SWFA 5APSA 1HUCA 5APXA 3VMXA 2WPRA 4AYCA 1YYCA 1S9KD 1HBWA 4AQRD 1MFZA 2Z5HA 2E42A 3O8ZA 3KQGA 3P7KA 3HE5B 1GD2E 2R3CA 5CMZA 3NXSA 2YO2A 4DZOA 4GKGA 2W27A 1H88A 5AW0B 1NWQA
chains in the Genus database with same CATH superfamily
4PJ0H 1KYOI 3H1KD 2HFED 3RBZA 1JOCA 3S4RA 1EXJA 3VMAA 3BRVB 4JYCA 4KHXA 1N7SB 4IFMA 1MZ9A 1KILD 1L0NG 3CXHE 1SQXD 3U59A 1KILC 2D2CB 2PGDA 5AW5B 1GTWA 3A0BE 3I5CA 2M5AB 1YQ4C 2KS1A 2JWAA 1RE4C 3JCUH 4ZNCA 2MJZA 1JTHB 3A5TA 3MUDA 2NZ2A 4ZKUA 4U3FE 2O3JA 4HYTB 1NAYA 1N7LA 2BEZF 3L71J 1WRGA 2XKMA 4WY4B 1YQ3C 1MUUA 2SPZA 2GUVA 3AECC 1SQBE 2OARA 2E75B 3RK2D 3WUUA 3R2PA 1Q81Q 3WUVA 1PGQA 4KJMA 1IZNB 2XNXA 2FYNB 1VQ4P 3RL0B 2Q9IA 5KLVJ 2AXTH 1EXIA 4OGQD 3L70E 3CCSP 2UWJE 4UB6E 1LTJC 4RKUJ 1N86A 3H25A 5AW0B 3CX5E 1NWQA 3H1HJ 3HD7D 1HVVA 3HE4B 1DD4A 1PL5A 2JKVA 2A06D 1LT9A 3F5HA 1L0LK 2H43A 1IFDA 1AFOA 1VQ7P 1L0NE 1PV3A 1AQ5A 2K9JB 1FZAA 4QMAA 1EC5A 3PHLA 2K9YA 3BCCG 1BCCJ 2WMMA 3GMAA 2OYHA 2WVRA 4PV1D 3VN0A 2I1KA 1NTMJ 2Q3EA 5CBNA 1P84E 2HPCA 1N7SD 1S9KE 2JWDA 3SSUA 1N7SC 2D2CD 3JSVC 2D2CC 2FBWC 3K5BA 3H1JG 3CCLP 2B9BA 4GDOA 1YITP 2ZT9B 1M7LA 2WPRA 3L75J 4UB8H 1URQD 1GL2D 2NPSA 4GKGA 1KB9D 3H1ID 1YTZT 5B5EE 4IL6H 4WY4D 2V7QH 3L35A 2AEMA 4WY4C 2GM4A 1BE3D 3IR9A 1AJYA 1LTSC 2E75D 1OMIA 1KB9H 3CWBJ 1EDJA 2E75C 1KYOD 1LWUA 3L73G 3P32A 2FYUK 2KSEA 3LW5J 2FYNC 3RL0C 1KYOH 1CSBA 2YKQA 1L4AA 4OWFA 2KZIA 3KZIE 1LGHB 1EDKA 1ZRTD 5AW8B 1NHLA 3B4SA 4H13B 3OAKA 3Q2YA 5CJ4A 2YIUB 1E79H 3WU2E 1OVRA 1Q86Q 2WWWA 2Q3IA 1Q90D 3H1JD 1NTKG 1FZCB 2N9YB 2XDJA 1SQXK 1BCCE 5H2FH 3AE4C 4C7NB 3CD6P 1S1CX 1J1DB 4I7ZB 3RBXA 3AE2C 1NTME 3WMM0 3G9RA 2I8DA 1RQVA 2J5UA 1JMBA 2RH0A 2Z5HA 3KQGA 4NPFX 2E76B 1SQBK 2PP6A 5GTHH 1YJWP 4DOJA 1W2EA 1Q7YQ 2J58A 4R4LA 1X79B 2WSFH 2OQQA 1NO4A 3L73D 2E5YA 3M9HA 1G2CB 1Q82Q 1PGOA 3B71A 3L75E 1X8YA 3ITKA 1VF5B 2N1TD 4A7PA 4TT3H 1IO4A 1NU1J 3B5NA 1FU1A 1MFTA 1Z56A 2KLVA 2FFDC 2E74B 1KQFB 1SFCA 2ZT9C 1HTLC 1NAFA 3L72D 1RF0C 3NTNA 2ZVOB 4D6TD 2BCCE 2QIWA 1AA0A 1OX3A 2KSJA 2ZYAA 1FZFA 3AEEC 1L0NK 2HODA 4DJGA 1KTMA 1PGPA 2BASA 1SQQJ 4LC1A 3MTUE 1JO5A 1PP9G 2YXRB 1YHQP 2AEJA 3Q5PA 3P8CD 3N4XA 2AXCA 3A0HE 3OJAB 5KJ7D 1NTKE 3AE5C 3TK1A 1LTGC 1OW6A 2LXBA 3GG2A 1NTZG 5KJ7C 3ABVC 5GTIE 1HUCA 1DX7A 1QLED 4AQRD 4KT0J 1SQVE 5CMZA 2C0XA 2Q1KA 2H89C 4H13C 5BVZA 1Q2NA 2YIUC 4C46A 2NRGA 1IFPA 2G8YA 2KNCA 3AEFC 2A45G 3Q5SA 2FKWB 1FZCC 1SLQA 3H32A 1J1DC 2M8RA 2YKOA 4I7ZC 1S5LX 3D70A 1QVFO 2P10A 3V2PA 4N3YB 3TGUG 5KAFE 3S9OA 3H1KJ 4GT1A 2E76C 2ZXEB 4RJTA 1Y47A 1P84I 2HYNA 4XA4A 3L4FA 1YBKA 3Q1MA 2H88C 1M8OB 2QRXA 4BXLA 1QL1A 1NU1E 2IFNA 1FJPA 4U3FG 1PP9D 1NKZB 2E43A 2KS1B 4EDFA 4YXWH 1RF1A 1OIPA 1VF5D 3CCVP 1AV1A 1U7JA 2PAJA 3H1LD 2K3RA 3PJSK 3C9IA 1FOSF 1N8RQ 2E74D 1JCDA 3OW2O 2CPBA 2E74C 4TLFA 2BEQD 2FYUD 2YO2A 4JBZA 4YPCA 4HH2A 3PLNA 3L70G 4H0LB 1BSNA 2QJPB 1JY3O 1PPJE 1W5CE 2Y9YA 3EFFK 1CI6A 2ZAEB 3E1RA 3EQ2A 2KI7B 1JY3P 2FXMA 1R8EA 5APYA 1S5LE 1YTZI 2WSEH 3B8EB 1VQ6P 2XV5A 3F89A 5CCGC 2FXPA 3RK3E 3KXDA 1FZEA 2JEEA 1SQPG 3A0BH 1LT9B 2QA4P 3TGUE 2JDIH 1MV8A 3SFEC 3L74D 1SQBD 3MHVA 1NKNA 3A3YB 5KLIB 2C9LY 2Z4EA 3JCUE 1LTJA 2HPCB 1HBWA 3L71G 3L70D 3AEGC 2R3CA 2IDBA 2OTJP 1YI2P 2OTKE 3HD7A 2DW3A 3FXEA 1ZN5A 1RE3A 1QX8A 3V2RA 1NTKK 3TYYA 2CK3H 1TU3F 3S1KA 5TJHA 1GU5A 1M56D 3CX5H 3MUDC 1Y8AA 2V7QJ 4DCKA 3AE1C 2NPSB 1QEXA 1KMIZ 1L0ND 5CJ0A 5AW2B 1S4XA 4HJGH 3HE5A 1JEKA 4U7JA 3H1IJ 1FZBA 1BE3J 2J59M 4L76A 3V4QA 3H1HG 4H0LD 5B66E 1IJDB 4H0LC 1SQPE 3BATA 3IN6A 1DIPA 1P84D 2QJPC 2WPVB 2FXOA 2B89A 3VP8A 1H8AA 1WMKA 1P84H 2N9BA 1T2KC 3HTKA 4OVNF 2A06E 4K35A 3CC2P 1BCCG 4C7RA 4JPZB 4N78E 1NJIQ 1URQA 1GL2A 4BRYA 3G4SP 2KB7P 1LT9C 1NTMG 2YMKA 1VQLP 2M0BA 2QJKB 1NOHA 3L71E 1G1JA 4WBAA 3H1JJ 2FFDB 1BDDA 2QVAA 2Q6QA 2KYVA 2O01H 1N73A 1J1EB 1T6AA 2K88A 5KTBA 1SP4A 3HUSA 3AE8C 5AW3B 1EQ7A 1OW7A 1NTZK 4DT0A 5KLIC 2OYHC 1EZVE 3I55P 1J2JB 1HH0A 3L75G 5KLVE 3V2NA 4YTPC 1Y9BA 3AEAC 1LT1A 3VYIA 2PFXA 3L73J 1RQUA 1BGYJ 1T3JA 5AW6B 3RL0D 2W6JH 3H1HE 3B5NB 3II6A 3BCCD 3KZIH 1SFCB 2IYPA 1KB9E 2BCCG 2YMYA 1VQ5P 3CCRP 2L5GB 2NPSD 1GW3A 5APWA 3M06A 1H89A 1BE3E 2NPSC 1BCCD 3L72J 3WU2H 4AYCA 1NTMD 2W90A 4D6TJ 5KKZB 1MFZA 2E42A 2HODB 3CCMP 3EFGA 3GLMA 3NXSA 3PH0A 4O9BA 3GW6A 3SWYA 1AVOA 1OWAA 1D7MA 1ZRTE 1SQVG 4H44B 3TDKA 2A45I 1JY2N 1M1JA 5AVXB 3G6EP 4LLHA 2LXCB 2N1TA 3L75D 2M3BA 5H2FE 3W67A 4EYYQ 3M9BA 2WT7A 1L0LJ 2RKLA 2OGUA 3BRTB 3CXHI 2Q5UA 3UIAA 3CMEP 2HR3A 1KC8Q 3MP7B 1ZP0C 2IFMA 2KNCB 4OH8B 5L8RJ 1CW5A 5DJTB 4RESB 3N7NA 1KORA 2QJKC 3KYQA 1IFIA 1OXZA 1UIXA 2OYIA 2BCCD 2K37A 2ZT9D 3BVHA 1IFNA 2W83C 4GOFA 2R44A 3CCEP 1GK6A 1J1EC 3USSA 2XZRA 1LJ2A 5K5GB 3CWBE 2IBZE 1NU1G 3MGNA 3LW5H 2KLUA 1OZHA 2P58A 1BGYE 1NTKD 3CCUP 3Q5RA 1RH5B 4ASWA 1SQPK 1ZR4A 1RF1B 3CCQP 3A0HH 2QSIA 5CCHA 1SQVD 3B5ND 3RK3B 3CL3D 4CPGA 1FOSE 1DEEG 3M0DA 4M3LA 3B5NC 1KFNA 1SFCD 2KK7A 3H1LJ 1OVVA 1SQQG 1SFCC 3VMZA 4D6TE 5C39A 3CX5I 1FDIA 1PIXA 3U1CA 3FX0A 4H13D 2QE7H 4JQ0D 3M91A 1GW4A 1PPJG 2QM8A 1X0TA 3GHGA 3NMDA 2IPPA 5BU5A 2FYUJ 5AW1B 1E5WA 1PZQA 5KKZC 1NH4A 2IZ1A 3P8CE 3C1LA 3HRNA 1RY3A 1H0TA 5APVA 1LTIC 2GA1A 1CI6B 3D71A 3Q3DA 3CCJP 4GODA 1L2PA 1GZLA 4H44D 2WSEJ 4NPEA 5KAFH 1L0LE 4Y99B 1R5SA 4H44C 2LR2A 4WWIA 2QJYB 2E76D 5TISE 3D6ZA 4EI2A 3MIWA 5KLVK 2RMZA 2QEXP 3AEBC 1SQXJ 2QG4A 5APSA 4N6JA 5APXA 2RN0A 3JC22 4GIFA 3H1KG 1ZMEC 4W7ZA 1K04A 3AEDC 3RK2B 1NTZD 1X9VA 3L74J 1RHZB 2IX7C 3FWLA 4PD4E 2PRRA 1VQ9P 2H7HA 1SQBJ 1HJ0A 2LKMA 1KD1Q 4IFFA 2FYZA 4OGQB 5AW7B 1FS0E 1IK7A 1LNQA 2B87A 4W80A 1EZVI 1LTAC 1SQQE 5KAIH 4XFJA 1SVFA 1IFJA 5E79E 1QL2A 3L70J 3HD7B 2R5BA 3VP9A 1AQTA 2WITA 1HGVA 1KILA 1RF1C 1NTMK 3BASA 1KQSO 2A45H 3CXHD 1RE4A 1QVGO 1S5LH 1FDMA 3RK3C 3TGUD 3MZWB 5CCGD 1KV4A 1DD3A 1EDLA 3CXHH 1YJ9P 3TF5A 1L0NJ 5AVTB 1U7MA 1ZLLA 4U3FD 2ZYGA 3PRJA 4PV1B 1BSHA 4PJ0E 4K3AA 2JO1A 3M9QA 1M1KQ 3O6QA 3CPWO 2ZYDA 3GF3A 1KN7A 1HGZA 3H1KE 2A06G 1W2BO 3L36A 2OYHB 3IFMA 2WPSA 1KILE 4MN4C 4Y99C 1FAVA 1SQXE 3CLQA 5CHXA 1KQLA 2L91A 2QJYC 3HTKB 1FZGA 2R32A 3AE9C 3T97A 3E1IA 5AVRB 1URQB 1GL2B 4HKZH 4BRYB 4ZKPA 2KUBA 3L74E 4GOEA 3CX5D 1JNMA 1JB0J 3RGUA 2KP8A 5AVWB 1LP1A 2O01J 4UB6H 5APUA 3AE6C 3H6PA 2IZ0A 3V5BA 2ZFCA 3RK2C 1N73B 1EZVG 1OFCX 1XTGB 3HUSB 2WSCH 3TNUA 3OA7A 1SQVK 5KLVG 2FY8A 1SQPD 1ZW0A 2K1AA 2IBZI 3CC4P 2AXTE 3RL0g 2KZJA 4OGQC 5AVVB 3GF7A 5B66H 1LWUB 4LGDE 1A02J 3V4WA 4IL6X 3PTZA 1K9MQ 2WZ7A 3L37A 3HD7C 1N7SA 3H1IG 2JR8A 1VQPP 1RE3C 2P1JA 2M3EA 1BE3G 1S9KD 1AVYA 3IAOA 1GDTA 1T3UA 1L4AB 1VQOP 1GD2E 4IFDK 4N78D 4YXDC 2M5AA 2ZXXA 3BCCJ 1T2KD 1JTHA 2P67A 2P2UA 3SFDC 3L71D 3PP5A 4L75A 2WSSH 1VL2A 1VPCA 1NU1K 1ZV8A 2XNDH 4ZMDA 4WY4A 4AUWA 4PV1C 3FXDA 1S2EA 1EZVD 2IYOA 1QGKB 1YIJP 1HWTC 5KLVD 2W8ZA 1OW8A 2R3SA 1S72P 5B5EH 4HB1A 1M1JB 1WT6A 2N1TB 2MKVA 3FGAD 2WSFJ 1SQQK 4JYBA 2WT7B 1R5LA 1BDCA 3H1HD 1MKMA 3A2AA 1PGJA 2Y0CA 4EOTA 1UIIA 4UB8E 3VMYA 2CPSA 3HE4A 2O01N 1URQC 1GL2C 4WVZA 2Y9ZA 2GUSA 5AVZB 4IL6E 5APTA 4RO0A 3W68A 5AW4B 2OYIB 3CWBG 2IBZG 1YYCA 5M1BA 3ZDMA 3H1IE 4PD4I 2BCCJ 1N73C 2KOGA 3SWKA 1BGYG 2OYOA 1VQMP 2ITAA 2K9JA 3HUSC 2Q7CA 1FDOA 2P7JA 3V6IA 2YO3A 1KYOE 1ZOYC 1LTBC 3E7KA 1K8AQ 2Y0DA 1X22A 1NTKJ 1LWUC 3L72G 3BCCE 1FC2C 2WTYA 2OTLP 1USEA 4D6TG 4NPDA 1NGMB 2V4HA 3G3ZA 3AE3C 1JUNA 1L4AD 3MD0A 1SQVJ 2Y0EA 2H8PD 1L4AC 3LIDA 4L73A 3CMAP 1GU4A 2ZVNB 1NVOA 2FFDA 1JM0A 4BWNA 2I1JA 3GHGB 1LTTC 3H1JE 1RF0A 3CI9A 1DEBA 2KIKA 1VQ8P 3V2QA 1JY3N 3R4YA 5AVYB 3VOPA 1NYHA 3CWBD 1H0TB 2IBZD 4W7YA 5GTHE 1VQNP 1L0LG 4L74A 4I6MC 2HLOA 1XTCC 3H32B 1BGYD 3KPEA 1IFMA 3P7KA 3D6YA 2C0WA 3QH9A 3AE7C 2W27A 1M1JC 5DJUB 1N2DC 5KJ7A 1A02F 2N1TC 3L73E 5EFWB 1S3JA 2ZJSE 1IK9A 3P8MC 1ZR2A 4Z1MH 4I2LC 2G3AA 1CZQA 1T8ZA 5BU8B 2E5TA 1PP9J 1M57D 1GK4A 4IOIH 4ASVA 3NFQA 5GTIH 2OYIC 1NTZJ 3L72E 1FZCA 2B88A 2WQYC 1KFMA 5AVQB 4C7NA 2AEFA 2B87B 4XE5B 3QWOC 3U1AA 2JP3A 1K73Q 5APQA 2Z5IA 2C9NY 4I1LA 3H1LG 1DH3A 1L0LD 2HG5D 1YJNP 2QM7A 4WB4A 1KILB 5CCHD 1USDA 3C8VA 2O1JA 5CCHC 3KHUA 2FYUG 3G71P 2W6AA 3SWFA 1G2CA 3M0DC 3VMXA 1NU1D 5TISH 1G1IA 1GMJA 1K05A 3TGUJ 3I56P 5CBOA 1JMMA 1PFIA 4EIJA 4PD4D 5AVUB 3LIEA 3GHGC 4U3FJ 2XU6A 3KDPB 1SS1A 4B86A 2JJLA 1FBMA 1HJBA 4PD4H 3O6QB 4R4MA 1SQQD 2W6BA 3M0AA 2O1KA 1SQXG 1FE6A 1KZUB 1VDFA 1JCCA 2YKPA 4Y28J 3EWKA 1LTJB 4JF7A 1PPJD 3L74G 1VF5C 2KXPB 5E79H 2WPQA 5AVSB 3T97B 1VQKP 1SQBG 1PP9E 3WUTA 1M90Q 1HF9A 2POHA 1JY2O 5CCGA 1U57A 5AW9B 1EDIA 1NTZE 1LP1B 1ZXGA 3H1LE 2R5DA 3CC7P 3VTPC 2YNYA 1OVUA 2VRSA 3RK3D 1JY2P 5KAIE 2WSCJ 2YXQB 3IF4A 3FWNA 1IC2A 1KB9I 3A7OA 3TNUB 2FYUE 1KQGB 3O8ZA 3HE5B 4DZOA 3TSIA 1H88A 1FJKA 1SQPJ
chains in the Genus database with same CATH topology
1OWAA 1T2KD 1JTHA 2P67A 2P2UA 4C46A 2HFED 3PP5A 1JOCA 3BRVB 4JYCA 4KHXA 1N7SB 2A45G 4IFMA 1MZ9A 2FKWB 1KILD 2A45I 1VPCA 1JY2N 1NU1K 1M1JA 5AVXB 1FZCC 1ZV8A 3U59A 4LLHA 2N1TA 1KILC 4WY4A 5AW5B 1GTWA 4AUWA 2M3BA 1SLQA 3I5CA 3H32A 3M9BA 1J1DC 2M8RA 2WT7A 2YKOA 1RE4C 2MJZA 3BRTB 1JTHB 3A5TA 3V2PA 2Q5UA 4N3YB 3UIAA 3MUDA 4ZKUA 4HYTB 2IFMA 1HWTC 4GT1A 1N7LA 2ZXEB 4OH8B 1WRGA 1CW5A 1M1JB 2HYNA 4RESB 4XA4A 3L4FA 3N7NA 1WT6A 2N1TB 3KYQA 1IFIA 1OXZA 2OYIA 2XKMA 4WY4B 1QL1A 1MUUA 1SQQK 2IFNA 4JYBA 1FJPA 3BVHA 1NKZB 2WT7B 2E43A 1IFNA 2GUVA 2OARA 1RF1A 1GK6A 3A2AA 1J1EC 3RK2D 2XZRA 3R2PA 4EOTA 2PAJA 3VMYA 2CPSA 3HE4A 1URQC 1GL2C 2GUSA 3C9IA 5AVZB 1FOSF 3MGNA 3LW5H 2XNXA 5APTA 1JCDA 5AW4B 3RL0B 2CPBA 2Q9IA 2OYIB 1YYCA 1SQPK 1ZR4A 1LTJC 1RF1B 1N86A 1N73C 2KOGA 2YO2A 5CCHA 5AW0B 4HH2A 1NWQA 3HUSC 3B5ND 3HD7D 2Q7CA 3RK3B 3CL3D 1HVVA 3HE4B 1FOSE 3M0DA 2P7JA 4M3LA 3B5NC 1KFNA 1SFCD 2YO3A 1JY3O 1SFCC 3VMZA 1LTBC 1CI6A 1LT9A 3U1CA 1L0LK 3M91A 2H43A 1IFDA 1AFOA 1LWUC 1GW4A 3EQ2A 2QM8A 3GHGA 1JY3P 1AQ5A 2FXMA 3NMDA 2WTYA 2IPPA 5APYA 5BU5A 1YTZI 1FZAA 2WSEH 3B8EB 3G3ZA 5AW1B 1E5WA 1JUNA 1L4AD 2XV5A 3MD0A 5CCGC 1NH4A 3P8CE 2H8PD 3HRNA 1RY3A 1L4AC 3LIDA 1FZEA 2JEEA 5APVA 1LTIC 2OYHA 1CI6B 1GU4A 1LT9B 3VN0A 2I1KA 2FFDA 1MV8A 2HPCA 1GZLA 2I1JA 1N7SD 3GHGB 1S9KE 1LTTC 4Y99B 1RF0A 3CI9A 1N7SC 1DEBA 3V2QA 1NKNA 1JY3N 3A3YB 5AVYB 3MIWA 3VOPA 5KLVK 4W7YA 2C9LY 4I6MC 2HLOA 1XTCC 2Z4EA 1LTJA 3H32B 5APSA 2HPCB 1M7LA 4N6JA 2WPRA 5APXA 4GIFA 1HBWA 3KPEA 4W7ZA 1IFMA 3P7KA 2R3CA 3RK2B 1URQD 1GL2D 2C0WA 2NPSA 4GKGA 1X9VA 2W27A 1M1JC 1N2DC 1YTZT 2IX7C 4WY4D 5KJ7A 1A02F 2N1TC 3HD7A 3L35A 1ZN5A 4WY4C 2H7HA 2GM4A 3IR9A 2LKMA 1RE3A 1LTSC 1IK9A 3V2RA 3P8MC 1ZR2A 1NTKK 3TYYA 4IFFA 2FYZA 4I2LC 5AW7B 1LWUA 1CZQA 4W80A 1GU5A 1T8ZA 1LTAC 5BU8B 1SVFA 3P32A 2FYUK 1IFJA 2NPSB 1GK4A 3NFQA 3RL0C 5CJ0A 1QL2A 1CSBA 5AW2B 3HD7B 2R5BA 2YKQA 2OYIC 3VP9A 1L4AA 3HE5A 1FZCA 2WITA 1KFMA 1HGVA 1KILA 1LGHB 1RF1C 1NTMK 3BASA 5AVQB 4C7NA 1FZBA 2A45H 2J59M 3V4QA 5AW8B 1NHLA 1RE4A 4XE5B 3U1AA 3OAKA 5CJ4A 1IJDB 2Z5IA 5APQA 3RK3C 2C9NY 1FDMA 4I1LA 3BATA 5CCGD 2WWWA 1DH3A 2Q3IA 2HG5D 1FZCB 3VP8A 2QM7A 4WB4A 2XDJA 1KILB 5AVTB 1ZLLA 1SQXK 5CCHD 1H8AA 4C7NB 2O1JA 1J1DB 2N9BA 5CCHC 2W6AA 3WMM0 1T2KC 3HTKA 3SWFA 1G2CA 3M0DC 3VMXA 1G1IA 4C7RA 3M9QA 4N78E 2Z5HA 3KQGA 1URQA 1GL2A 2KB7P 1SQBK 2PP6A 1LT9C 1HGZA 4DOJA 1JMMA 1W2EA 1NOHA 2J58A 3L36A 1G1JA 2OYHB 1PFIA 4WBAA 4EIJA 1X79B 3IFMA 2WSFH 5AVUB 3LIEA 2FFDB 2WPSA 1NO4A 3GHGC 4Y99C 2KYVA 1FAVA 3CLQA 5CHXA 2O01H 1KQLA 1N73A 3HTKB 1J1EB 2XU6A 1G2CB 3M9HA 1FZGA 3KDPB 1X8YA 2R32A 4B86A 2JJLA 1FBMA 3T97A 5KTBA 1SP4A 3HUSA 1HJBA 2N1TD 3E1IA 5AVRB 5AW3B 1EQ7A 1URQB 1GL2B 1NTZK 1IO4A 4ZKPA 3B5NA 2W6BA 3M0AA 2OYHC 2O1KA 1FU1A 1KZUB 1VDFA 1Z56A 2KLVA 1JNMA 2FFDC 1J2JB 1JCCA 1SFCA 1HH0A 2YKPA 2KP8A 5AVWB 1HTLC 1NAFA 5APUA 3H6PA 3V2NA 1LTJB 4JF7A 1RF0C 3NTNA 3V5BA 2ZFCA 3RK2C 1N73B 3VYIA 1XTGB 2WPQA 5AVSB 1T3JA 3HUSB 5AW6B 3RL0D 2KSJA 2WSCH 3TNUA 3OA7A 1SQVK 2POHA 5BVZA 1JY2O 3B5NB 5CCGA 1FZFA 3II6A 1L0NK 5AW9B 2HODA 2BASA 1SFCB 5AVVB 2YMYA 4LC1A 3MTUE 2R5DA 1JO5A 2L5GB 2NPSD 2YNYA 3P8CD 1GW3A 3VTPC 5APWA 3M06A 3N4XA 1H89A 1LWUB 3OJAB 2VRSA 4LGDE 1JY2P 5KJ7D 3RK3D 3V4WA 1A02J 2NPSC 3TK1A 1LTGC 1IC2A 2WZ7A 3L37A 5KJ7C 3HD7C 1N7SA 3A7OA 3TNUB 1HUCA 4AYCA 1DX7A 1RE3C 2P1JA 1S9KD 4AQRD 1GDTA 1MFZA 2E42A 2HODB 3O8ZA 1T3UA 1L4AB 3HE5B 1GD2E 3EFGA 5CMZA 4IFDK 2C0XA 3NXSA 4DZOA 4O9BA 4N78D 3TSIA 1H88A 1FJKA 3SWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OWA A;  3L35 A;  3L36 A;  1T2K D;  2Q7C A;  2P67 A;  2P2U A;  4C46 A;  3HE4 B;  1FOS E;  2H7H A;  3M0D A;  3IR9 A;  5AVU B;  2P7J A;  3LIE A;  4M3L A;  2WPS A;  2YO3 A;  3P8M C;  3TYY A;  1FAV A;  4JYC A;  4KHX A;  4I2L C;  1KQL A;  5AW7 B;  2XU6 A;  3M9H A;  1G2C B;  3VMZ A;  1CI6 A;  5AVX B;  3KDP B;  1X8Y A;  1CZQ A;  2R32 A;  1GU5 A;  4B86 A;  2JJL A;  3T97 A;  1SP4 A;  1HJB A;  5AW3 B;  3M91 A;  5AVR B;  3P32 A;  5AW5 B;  4AUW A;  1GTW A;  1SLQ A;  1IO4 A;  3I5C A;  3M0A A;  2QM8 A;  3M9B A;  2WT7 A;  1GK4 A;  3NMD A;  3NFQ A;  2IPP A;  5APY A;  2WTY A;  1JNM A;  1CSB A;  1J2J B;  5AW2 B;  3B8E B;  2R5B A;  2KP8 A;  5AW1 B;  3A5T A;  5AVW B;  2Q5U A;  3HE5 A;  3UIA A;  1JUN A;  1NAF A;  2XV5 A;  3MD0 A;  5APU A;  1A02 F;  4HYT B;  3NTN A;  3V5B A;  2ZFC A;  3LID A;  1HWT C;  5AVQ B;  4C7N A;  4GT1 A;  2ZXE B;  5APV A;  3V4Q A;  5AW8 B;  1CI6 B;  1GU4 A;  3VN0 A;  4RES B;  3VYI A;  2WPQ A;  4XE5 B;  5AVS B;  5AW6 B;  1OXZ A;  3OAK A;  5APQ A;  2Z5I A;  1MV8 A;  3TNU A;  2C9N Y;  1MUU A;  1GZL A;  4JYB A;  2WT7 B;  2E43 A;  1S9K E;  5AW9 B;  2WWW A;  2BAS A;  1GK6 A;  2Q3I A;  3A2A A;  1DH3 A;  5AVV B;  2XZR A;  4LC1 A;  2R5D A;  2QM7 A;  5AVT B;  3VTP C;  2YNY A;  4EOT A;  3A3Y B;  5AVY B;  5APW A;  3M06 A;  1H8A A;  3VMY A;  1H89 A;  1A02 J;  3HE4 A;  2VRS A;  4C7N B;  3V4W A;  5AVZ B;  1FOS F;  3MGN A;  2N9B A;  5APT A;  3TK1 A;  2C9L Y;  4I6M C;  5AW4 B;  2W6A A;  3L37 A;  1T2K C;  3A7O A;  3HTK A;  3TNU B;  3SWF A;  5APS A;  1HUC A;  5APX A;  3VMX A;  2WPR A;  4AYC A;  1YYC A;  1S9K D;  1HBW A;  4AQR D;  1MFZ A;  2Z5H A;  2E42 A;  3O8Z A;  3KQG A;  3P7K A;  3HE5 B;  1GD2 E;  2R3C A;  5CMZ A;  3NXS A;  2YO2 A;  4DZO A;  4GKG A;  2W27 A;  1H88 A;  5AW0 B;  1NWQ A; 
#chains in the Genus database with same CATH topology
 4PJ0 H;  1KYO I;  3H1K D;  2HFE D;  3RBZ A;  1JOC A;  3S4R A;  1EXJ A;  3VMA A;  3BRV B;  4JYC A;  4KHX A;  1N7S B;  4IFM A;  1MZ9 A;  1KIL D;  1L0N G;  3CXH E;  1SQX D;  3U59 A;  1KIL C;  2D2C B;  2PGD A;  5AW5 B;  1GTW A;  3A0B E;  3I5C A;  2M5A B;  1YQ4 C;  2KS1 A;  2JWA A;  1RE4 C;  3JCU H;  4ZNC A;  2MJZ A;  1JTH B;  3A5T A;  3MUD A;  2NZ2 A;  4ZKU A;  4U3F E;  2O3J A;  4HYT B;  1NAY A;  1N7L A;  2BEZ F;  3L71 J;  1WRG A;  2XKM A;  4WY4 B;  1YQ3 C;  1MUU A;  2SPZ A;  2GUV A;  3AEC C;  1SQB E;  2OAR A;  2E75 B;  3RK2 D;  3WUU A;  3R2P A;  1Q81 Q;  3WUV A;  1PGQ A;  4KJM A;  1IZN B;  2XNX A;  2FYN B;  1VQ4 P;  3RL0 B;  2Q9I A;  5KLV J;  2AXT H;  1EXI A;  4OGQ D;  3L70 E;  3CCS P;  2UWJ E;  4UB6 E;  1LTJ C;  4RKU J;  1N86 A;  3H25 A;  5AW0 B;  3CX5 E;  1NWQ A;  3H1H J;  3HD7 D;  1HVV A;  3HE4 B;  1DD4 A;  1PL5 A;  2JKV A;  2A06 D;  1LT9 A;  3F5H A;  1L0L K;  2H43 A;  1IFD A;  1AFO A;  1VQ7 P;  1L0N E;  1PV3 A;  1AQ5 A;  2K9J B;  1FZA A;  4QMA A;  1EC5 A;  3PHL A;  2K9Y A;  3BCC G;  1BCC J;  2WMM A;  3GMA A;  2OYH A;  2WVR A;  4PV1 D;  3VN0 A;  2I1K A;  1NTM J;  2Q3E A;  5CBN A;  1P84 E;  2HPC A;  1N7S D;  1S9K E;  2JWD A;  3SSU A;  1N7S C;  2D2C D;  3JSV C;  2D2C C;  2FBW C;  3K5B A;  3H1J G;  3CCL P;  2B9B A;  4GDO A;  1YIT P;  2ZT9 B;  1M7L A;  2WPR A;  3L75 J;  4UB8 H;  1URQ D;  1GL2 D;  2NPS A;  4GKG A;  1KB9 D;  3H1I D;  1YTZ T;  5B5E E;  4IL6 H;  4WY4 D;  2V7Q H;  3L35 A;  2AEM A;  4WY4 C;  2GM4 A;  1BE3 D;  3IR9 A;  1AJY A;  1LTS C;  2E75 D;  1OMI A;  1KB9 H;  3CWB J;  1EDJ A;  2E75 C;  1KYO D;  1LWU A;  3L73 G;  3P32 A;  2FYU K;  2KSE A;  3LW5 J;  2FYN C;  3RL0 C;  1KYO H;  1CSB A;  2YKQ A;  1L4A A;  4OWF A;  2KZI A;  3KZI E;  1LGH B;  1EDK A;  1ZRT D;  5AW8 B;  1NHL A;  3B4S A;  4H13 B;  3OAK A;  3Q2Y A;  5CJ4 A;  2YIU B;  1E79 H;  3WU2 E;  1OVR A;  1Q86 Q;  2WWW A;  2Q3I A;  1Q90 D;  3H1J D;  1NTK G;  1FZC B;  2N9Y B;  2XDJ A;  1SQX K;  1BCC E;  5H2F H;  3AE4 C;  4C7N B;  3CD6 P;  1S1C X;  1J1D B;  4I7Z B;  3RBX A;  3AE2 C;  1NTM E;  3WMM 0;  3G9R A;  2I8D A;  1RQV A;  2J5U A;  1JMB A;  2RH0 A;  2Z5H A;  3KQG A;  4NPF X;  2E76 B;  1SQB K;  2PP6 A;  5GTH H;  1YJW P;  4DOJ A;  1W2E A;  1Q7Y Q;  2J58 A;  4R4L A;  1X79 B;  2WSF H;  2OQQ A;  1NO4 A;  3L73 D;  2E5Y A;  3M9H A;  1G2C B;  1Q82 Q;  1PGO A;  3B71 A;  3L75 E;  1X8Y A;  3ITK A;  1VF5 B;  2N1T D;  4A7P A;  4TT3 H;  1IO4 A;  1NU1 J;  3B5N A;  1FU1 A;  1MFT A;  1Z56 A;  2KLV A;  2FFD C;  2E74 B;  1KQF B;  1SFC A;  2ZT9 C;  1HTL C;  1NAF A;  3L72 D;  1RF0 C;  3NTN A;  2ZVO B;  4D6T D;  2BCC E;  2QIW A;  1AA0 A;  1OX3 A;  2KSJ A;  2ZYA A;  1FZF A;  3AEE C;  1L0N K;  2HOD A;  4DJG A;  1KTM A;  1PGP A;  2BAS A;  1SQQ J;  4LC1 A;  3MTU E;  1JO5 A;  1PP9 G;  2YXR B;  1YHQ P;  2AEJ A;  3Q5P A;  3P8C D;  3N4X A;  2AXC A;  3A0H E;  3OJA B;  5KJ7 D;  1NTK E;  3AE5 C;  3TK1 A;  1LTG C;  1OW6 A;  2LXB A;  3GG2 A;  1NTZ G;  5KJ7 C;  3ABV C;  5GTI E;  1HUC A;  1DX7 A;  1QLE D;  4AQR D;  4KT0 J;  1SQV E;  5CMZ A;  2C0X A;  2Q1K A;  2H89 C;  4H13 C;  5BVZ A;  1Q2N A;  2YIU C;  4C46 A;  2NRG A;  1IFP A;  2G8Y A;  2KNC A;  3AEF C;  2A45 G;  3Q5S A;  2FKW B;  1FZC C;  1SLQ A;  3H32 A;  1J1D C;  2M8R A;  2YKO A;  4I7Z C;  1S5L X;  3D70 A;  1QVF O;  2P10 A;  3V2P A;  4N3Y B;  3TGU G;  5KAF E;  3S9O A;  3H1K J;  4GT1 A;  2E76 C;  2ZXE B;  4RJT A;  1Y47 A;  1P84 I;  2HYN A;  4XA4 A;  3L4F A;  1YBK A;  3Q1M A;  2H88 C;  1M8O B;  2QRX A;  4BXL A;  1QL1 A;  1NU1 E;  2IFN A;  1FJP A;  4U3F G;  1PP9 D;  1NKZ B;  2E43 A;  2KS1 B;  4EDF A;  4YXW H;  1RF1 A;  1OIP A;  1VF5 D;  3CCV P;  1AV1 A;  1U7J A;  2PAJ A;  3H1L D;  2K3R A;  3PJS K;  3C9I A;  1FOS F;  1N8R Q;  2E74 D;  1JCD A;  3OW2 O;  2CPB A;  2E74 C;  4TLF A;  2BEQ D;  2FYU D;  2YO2 A;  4JBZ A;  4YPC A;  4HH2 A;  3PLN A;  3L70 G;  4H0L B;  1BSN A;  2QJP B;  1JY3 O;  1PPJ E;  1W5C E;  2Y9Y A;  3EFF K;  1CI6 A;  2ZAE B;  3E1R A;  3EQ2 A;  2KI7 B;  1JY3 P;  2FXM A;  1R8E A;  5APY A;  1S5L E;  1YTZ I;  2WSE H;  3B8E B;  1VQ6 P;  2XV5 A;  3F89 A;  5CCG C;  2FXP A;  3RK3 E;  3KXD A;  1FZE A;  2JEE A;  1SQP G;  3A0B H;  1LT9 B;  2QA4 P;  3TGU E;  2JDI H;  1MV8 A;  3SFE C;  3L74 D;  1SQB D;  3MHV A;  1NKN A;  3A3Y B;  5KLI B;  2C9L Y;  2Z4E A;  3JCU E;  1LTJ A;  2HPC B;  1HBW A;  3L71 G;  3L70 D;  3AEG C;  2R3C A;  2IDB A;  2OTJ P;  1YI2 P;  2OTK E;  3HD7 A;  2DW3 A;  3FXE A;  1ZN5 A;  1RE3 A;  1QX8 A;  3V2R A;  1NTK K;  3TYY A;  2CK3 H;  1TU3 F;  3S1K A;  5TJH A;  1GU5 A;  1M56 D;  3CX5 H;  3MUD C;  1Y8A A;  2V7Q J;  4DCK A;  3AE1 C;  2NPS B;  1QEX A;  1KMI Z;  1L0N D;  5CJ0 A;  5AW2 B;  1S4X A;  4HJG H;  3HE5 A;  1JEK A;  4U7J A;  3H1I J;  1FZB A;  1BE3 J;  2J59 M;  4L76 A;  3V4Q A;  3H1H G;  4H0L D;  5B66 E;  1IJD B;  4H0L C;  1SQP E;  3BAT A;  3IN6 A;  1DIP A;  1P84 D;  2QJP C;  2WPV B;  2FXO A;  2B89 A;  3VP8 A;  1H8A A;  1WMK A;  1P84 H;  2N9B A;  1T2K C;  3HTK A;  4OVN F;  2A06 E;  4K35 A;  3CC2 P;  1BCC G;  4C7R A;  4JPZ B;  4N78 E;  1NJI Q;  1URQ A;  1GL2 A;  4BRY A;  3G4S P;  2KB7 P;  1LT9 C;  1NTM G;  2YMK A;  1VQL P;  2M0B A;  2QJK B;  1NOH A;  3L71 E;  1G1J A;  4WBA A;  3H1J J;  2FFD B;  1BDD A;  2QVA A;  2Q6Q A;  2KYV A;  2O01 H;  1N73 A;  1J1E B;  1T6A A;  2K88 A;  5KTB A;  1SP4 A;  3HUS A;  3AE8 C;  5AW3 B;  1EQ7 A;  1OW7 A;  1NTZ K;  4DT0 A;  5KLI C;  2OYH C;  1EZV E;  3I55 P;  1J2J B;  1HH0 A;  3L75 G;  5KLV E;  3V2N A;  4YTP C;  1Y9B A;  3AEA C;  1LT1 A;  3VYI A;  2PFX A;  3L73 J;  1RQU A;  1BGY J;  1T3J A;  5AW6 B;  3RL0 D;  2W6J H;  3H1H E;  3B5N B;  3II6 A;  3BCC D;  3KZI H;  1SFC B;  2IYP A;  1KB9 E;  2BCC G;  2YMY A;  1VQ5 P;  3CCR P;  2L5G B;  2NPS D;  1GW3 A;  5APW A;  3M06 A;  1H89 A;  1BE3 E;  2NPS C;  1BCC D;  3L72 J;  3WU2 H;  4AYC A;  1NTM D;  2W90 A;  4D6T J;  5KKZ B;  1MFZ A;  2E42 A;  2HOD B;  3CCM P;  3EFG A;  3GLM A;  3NXS A;  3PH0 A;  4O9B A;  3GW6 A;  3SWY A;  1AVO A;  1OWA A;  1D7M A;  1ZRT E;  1SQV G;  4H44 B;  3TDK A;  2A45 I;  1JY2 N;  1M1J A;  5AVX B;  3G6E P;  4LLH A;  2LXC B;  2N1T A;  3L75 D;  2M3B A;  5H2F E;  3W67 A;  4EYY Q;  3M9B A;  2WT7 A;  1L0L J;  2RKL A;  2OGU A;  3BRT B;  3CXH I;  2Q5U A;  3UIA A;  3CME P;  2HR3 A;  1KC8 Q;  3MP7 B;  1ZP0 C;  2IFM A;  2KNC B;  4OH8 B;  5L8R J;  1CW5 A;  5DJT B;  4RES B;  3N7N A;  1KOR A;  2QJK C;  3KYQ A;  1IFI A;  1OXZ A;  1UIX A;  2OYI A;  2BCC D;  2K37 A;  2ZT9 D;  3BVH A;  1IFN A;  2W83 C;  4GOF A;  2R44 A;  3CCE P;  1GK6 A;  1J1E C;  3USS A;  2XZR A;  1LJ2 A;  5K5G B;  3CWB E;  2IBZ E;  1NU1 G;  3MGN A;  3LW5 H;  2KLU A;  1OZH A;  2P58 A;  1BGY E;  1NTK D;  3CCU P;  3Q5R A;  1RH5 B;  4ASW A;  1SQP K;  1ZR4 A;  1RF1 B;  3CCQ P;  3A0H H;  2QSI A;  5CCH A;  1SQV D;  3B5N D;  3RK3 B;  3CL3 D;  4CPG A;  1FOS E;  1DEE G;  3M0D A;  4M3L A;  3B5N C;  1KFN A;  1SFC D;  2KK7 A;  3H1L J;  1OVV A;  1SQQ G;  1SFC C;  3VMZ A;  4D6T E;  5C39 A;  3CX5 I;  1FDI A;  1PIX A;  3U1C A;  3FX0 A;  4H13 D;  2QE7 H;  4JQ0 D;  3M91 A;  1GW4 A;  1PPJ G;  2QM8 A;  1X0T A;  3GHG A;  3NMD A;  2IPP A;  5BU5 A;  2FYU J;  5AW1 B;  1E5W A;  1PZQ A;  5KKZ C;  1NH4 A;  2IZ1 A;  3P8C E;  3C1L A;  3HRN A;  1RY3 A;  1H0T A;  5APV A;  1LTI C;  2GA1 A;  1CI6 B;  3D71 A;  3Q3D A;  3CCJ P;  4GOD A;  1L2P A;  1GZL A;  4H44 D;  2WSE J;  4NPE A;  5KAF H;  1L0L E;  4Y99 B;  1R5S A;  4H44 C;  2LR2 A;  4WWI A;  2QJY B;  2E76 D;  5TIS E;  3D6Z A;  4EI2 A;  3MIW A;  5KLV K;  2RMZ A;  2QEX P;  3AEB C;  1SQX J;  2QG4 A;  5APS A;  4N6J A;  5APX A;  2RN0 A;  3JC2 2;  4GIF A;  3H1K G;  1ZME C;  4W7Z A;  1K04 A;  3AED C;  3RK2 B;  1NTZ D;  1X9V A;  3L74 J;  1RHZ B;  2IX7 C;  3FWL A;  4PD4 E;  2PRR A;  1VQ9 P;  2H7H A;  1SQB J;  1HJ0 A;  2LKM A;  1KD1 Q;  4IFF A;  2FYZ A;  4OGQ B;  5AW7 B;  1FS0 E;  1IK7 A;  1LNQ A;  2B87 A;  4W80 A;  1EZV I;  1LTA C;  1SQQ E;  5KAI H;  4XFJ A;  1SVF A;  1IFJ A;  5E79 E;  1QL2 A;  3L70 J;  3HD7 B;  2R5B A;  3VP9 A;  1AQT A;  2WIT A;  1HGV A;  1KIL A;  1RF1 C;  1NTM K;  3BAS A;  1KQS O;  2A45 H;  3CXH D;  1RE4 A;  1QVG O;  1S5L H;  1FDM A;  3RK3 C;  3TGU D;  3MZW B;  5CCG D;  1KV4 A;  1DD3 A;  1EDL A;  3CXH H;  1YJ9 P;  3TF5 A;  1L0N J;  5AVT B;  1U7M A;  1ZLL A;  4U3F D;  2ZYG A;  3PRJ A;  4PV1 B;  1BSH A;  4PJ0 E;  4K3A A;  2JO1 A;  3M9Q A;  1M1K Q;  3O6Q A;  3CPW O;  2ZYD A;  3GF3 A;  1KN7 A;  1HGZ A;  3H1K E;  2A06 G;  1W2B O;  3L36 A;  2OYH B;  3IFM A;  2WPS A;  1KIL E;  4MN4 C;  4Y99 C;  1FAV A;  1SQX E;  3CLQ A;  5CHX A;  1KQL A;  2L91 A;  2QJY C;  3HTK B;  1FZG A;  2R32 A;  3AE9 C;  3T97 A;  3E1I A;  5AVR B;  1URQ B;  1GL2 B;  4HKZ H;  4BRY B;  4ZKP A;  2KUB A;  3L74 E;  4GOE A;  3CX5 D;  1JNM A;  1JB0 J;  3RGU A;  2KP8 A;  5AVW B;  1LP1 A;  2O01 J;  4UB6 H;  5APU A;  3AE6 C;  3H6P A;  2IZ0 A;  3V5B A;  2ZFC A;  3RK2 C;  1N73 B;  1EZV G;  1OFC X;  1XTG B;  3HUS B;  2WSC H;  3TNU A;  3OA7 A;  1SQV K;  5KLV G;  2FY8 A;  1SQP D;  1ZW0 A;  2K1A A;  2IBZ I;  3CC4 P;  2AXT E;  3RL0 g;  2KZJ A;  4OGQ C;  5AVV B;  3GF7 A;  5B66 H;  1LWU B;  4LGD E;  1A02 J;  3V4W A;  4IL6 X;  3PTZ A;  1K9M Q;  2WZ7 A;  3L37 A;  3HD7 C;  1N7S A;  3H1I G;  2JR8 A;  1VQP P;  1RE3 C;  2P1J A;  2M3E A;  1BE3 G;  1S9K D;  1AVY A;  3IAO A;  1GDT A;  1T3U A;  1L4A B;  1VQO P;  1GD2 E;  4IFD K;  4N78 D;  4YXD C;  2M5A A;  2ZXX A;  3BCC J;  1T2K D;  1JTH A;  2P67 A;  2P2U A;  3SFD C;  3L71 D;  3PP5 A;  4L75 A;  2WSS H;  1VL2 A;  1VPC A;  1NU1 K;  1ZV8 A;  2XND H;  4ZMD A;  4WY4 A;  4AUW A;  4PV1 C;  3FXD A;  1S2E A;  1EZV D;  2IYO A;  1QGK B;  1YIJ P;  1HWT C;  5KLV D;  2W8Z A;  1OW8 A;  2R3S A;  1S72 P;  5B5E H;  4HB1 A;  1M1J B;  1WT6 A;  2N1T B;  2MKV A;  3FGA D;  2WSF J;  1SQQ K;  4JYB A;  2WT7 B;  1R5L A;  1BDC A;  3H1H D;  1MKM A;  3A2A A;  1PGJ A;  2Y0C A;  4EOT A;  1UII A;  4UB8 E;  3VMY A;  2CPS A;  3HE4 A;  2O01 N;  1URQ C;  1GL2 C;  4WVZ A;  2Y9Z A;  2GUS A;  5AVZ B;  4IL6 E;  5APT A;  4RO0 A;  3W68 A;  5AW4 B;  2OYI B;  3CWB G;  2IBZ G;  1YYC A;  5M1B A;  3ZDM A;  3H1I E;  4PD4 I;  2BCC J;  1N73 C;  2KOG A;  3SWK A;  1BGY G;  2OYO A;  1VQM P;  2ITA A;  2K9J A;  3HUS C;  2Q7C A;  1FDO A;  2P7J A;  3V6I A;  2YO3 A;  1KYO E;  1ZOY C;  1LTB C;  3E7K A;  1K8A Q;  2Y0D A;  1X22 A;  1NTK J;  1LWU C;  3L72 G;  3BCC E;  1FC2 C;  2WTY A;  2OTL P;  1USE A;  4D6T G;  4NPD A;  1NGM B;  2V4H A;  3G3Z A;  3AE3 C;  1JUN A;  1L4A D;  3MD0 A;  1SQV J;  2Y0E A;  2H8P D;  1L4A C;  3LID A;  4L73 A;  3CMA P;  1GU4 A;  2ZVN B;  1NVO A;  2FFD A;  1JM0 A;  4BWN A;  2I1J A;  3GHG B;  1LTT C;  3H1J E;  1RF0 A;  3CI9 A;  1DEB A;  2KIK A;  1VQ8 P;  3V2Q A;  1JY3 N;  3R4Y A;  5AVY B;  3VOP A;  1NYH A;  3CWB D;  1H0T B;  2IBZ D;  4W7Y A;  5GTH E;  1VQN P;  1L0L G;  4L74 A;  4I6M C;  2HLO A;  1XTC C;  3H32 B;  1BGY D;  3KPE A;  1IFM A;  3P7K A;  3D6Y A;  2C0W A;  3QH9 A;  3AE7 C;  2W27 A;  1M1J C;  5DJU B;  1N2D C;  5KJ7 A;  1A02 F;  2N1T C;  3L73 E;  5EFW B;  1S3J A;  2ZJS E;  1IK9 A;  3P8M C;  1ZR2 A;  4Z1M H;  4I2L C;  2G3A A;  1CZQ A;  1T8Z A;  5BU8 B;  2E5T A;  1PP9 J;  1M57 D;  1GK4 A;  4IOI H;  4ASV A;  3NFQ A;  5GTI H;  2OYI C;  1NTZ J;  3L72 E;  1FZC A;  2B88 A;  2WQY C;  1KFM A;  5AVQ B;  4C7N A;  2AEF A;  2B87 B;  4XE5 B;  3QWO C;  3U1A A;  2JP3 A;  1K73 Q;  5APQ A;  2Z5I A;  2C9N Y;  4I1L A;  3H1L G;  1DH3 A;  1L0L D;  2HG5 D;  1YJN P;  2QM7 A;  4WB4 A;  1KIL B;  5CCH D;  1USD A;  3C8V A;  2O1J A;  5CCH C;  3KHU A;  2FYU G;  3G71 P;  2W6A A;  3SWF A;  1G2C A;  3M0D C;  3VMX A;  1NU1 D;  5TIS H;  1G1I A;  1GMJ A;  1K05 A;  3TGU J;  3I56 P;  5CBO A;  1JMM A;  1PFI A;  4EIJ A;  4PD4 D;  5AVU B;  3LIE A;  3GHG C;  4U3F J;  2XU6 A;  3KDP B;  1SS1 A;  4B86 A;  2JJL A;  1FBM A;  1HJB A;  4PD4 H;  3O6Q B;  4R4M A;  1SQQ D;  2W6B A;  3M0A A;  2O1K A;  1SQX G;  1FE6 A;  1KZU B;  1VDF A;  1JCC A;  2YKP A;  4Y28 J;  3EWK A;  1LTJ B;  4JF7 A;  1PPJ D;  3L74 G;  1VF5 C;  2KXP B;  5E79 H;  2WPQ A;  5AVS B;  3T97 B;  1VQK P;  1SQB G;  1PP9 E;  3WUT A;  1M90 Q;  1HF9 A;  2POH A;  1JY2 O;  5CCG A;  1U57 A;  5AW9 B;  1EDI A;  1NTZ E;  1LP1 B;  1ZXG A;  3H1L E;  2R5D A;  3CC7 P;  3VTP C;  2YNY A;  1OVU A;  2VRS A;  3RK3 D;  1JY2 P;  5KAI E;  2WSC J;  2YXQ B;  3IF4 A;  3FWN A;  1IC2 A;  1KB9 I;  3A7O A;  3TNU B;  2FYU E;  1KQG B;  3O8Z A;  3HE5 B;  4DZO A;  3TSI A;  1H88 A;  1FJK A;  1SQP J; 
#chains in the Genus database with same CATH homology
 1OWA A;  1T2K D;  1JTH A;  2P67 A;  2P2U A;  4C46 A;  2HFE D;  3PP5 A;  1JOC A;  3BRV B;  4JYC A;  4KHX A;  1N7S B;  2A45 G;  4IFM A;  1MZ9 A;  2FKW B;  1KIL D;  2A45 I;  1VPC A;  1JY2 N;  1NU1 K;  1M1J A;  5AVX B;  1FZC C;  1ZV8 A;  3U59 A;  4LLH A;  2N1T A;  1KIL C;  4WY4 A;  5AW5 B;  1GTW A;  4AUW A;  2M3B A;  1SLQ A;  3I5C A;  3H32 A;  3M9B A;  1J1D C;  2M8R A;  2WT7 A;  2YKO A;  1RE4 C;  2MJZ A;  3BRT B;  1JTH B;  3A5T A;  3V2P A;  2Q5U A;  4N3Y B;  3UIA A;  3MUD A;  4ZKU A;  4HYT B;  2IFM A;  1HWT C;  4GT1 A;  1N7L A;  2ZXE B;  4OH8 B;  1WRG A;  1CW5 A;  1M1J B;  2HYN A;  4RES B;  4XA4 A;  3L4F A;  3N7N A;  1WT6 A;  2N1T B;  3KYQ A;  1IFI A;  1OXZ A;  2OYI A;  2XKM A;  4WY4 B;  1QL1 A;  1MUU A;  1SQQ K;  2IFN A;  4JYB A;  1FJP A;  3BVH A;  1NKZ B;  2WT7 B;  2E43 A;  1IFN A;  2GUV A;  2OAR A;  1RF1 A;  1GK6 A;  3A2A A;  1J1E C;  3RK2 D;  2XZR A;  3R2P A;  4EOT A;  2PAJ A;  3VMY A;  2CPS A;  3HE4 A;  1URQ C;  1GL2 C;  2GUS A;  3C9I A;  5AVZ B;  1FOS F;  3MGN A;  3LW5 H;  2XNX A;  5APT A;  1JCD A;  5AW4 B;  3RL0 B;  2CPB A;  2Q9I A;  2OYI B;  1YYC A;  1SQP K;  1ZR4 A;  1LTJ C;  1RF1 B;  1N86 A;  1N73 C;  2KOG A;  2YO2 A;  5CCH A;  5AW0 B;  4HH2 A;  1NWQ A;  3HUS C;  3B5N D;  3HD7 D;  2Q7C A;  3RK3 B;  3CL3 D;  1HVV A;  3HE4 B;  1FOS E;  3M0D A;  2P7J A;  4M3L A;  3B5N C;  1KFN A;  1SFC D;  2YO3 A;  1JY3 O;  1SFC C;  3VMZ A;  1LTB C;  1CI6 A;  1LT9 A;  3U1C A;  1L0L K;  3M91 A;  2H43 A;  1IFD A;  1AFO A;  1LWU C;  1GW4 A;  3EQ2 A;  2QM8 A;  3GHG A;  1JY3 P;  1AQ5 A;  2FXM A;  3NMD A;  2WTY A;  2IPP A;  5APY A;  5BU5 A;  1YTZ I;  1FZA A;  2WSE H;  3B8E B;  3G3Z A;  5AW1 B;  1E5W A;  1JUN A;  1L4A D;  2XV5 A;  3MD0 A;  5CCG C;  1NH4 A;  3P8C E;  2H8P D;  3HRN A;  1RY3 A;  1L4A C;  3LID A;  1FZE A;  2JEE A;  5APV A;  1LTI C;  2OYH A;  1CI6 B;  1GU4 A;  1LT9 B;  3VN0 A;  2I1K A;  2FFD A;  1MV8 A;  2HPC A;  1GZL A;  2I1J A;  1N7S D;  3GHG B;  1S9K E;  1LTT C;  4Y99 B;  1RF0 A;  3CI9 A;  1N7S C;  1DEB A;  3V2Q A;  1NKN A;  1JY3 N;  3A3Y B;  5AVY B;  3MIW A;  3VOP A;  5KLV K;  4W7Y A;  2C9L Y;  4I6M C;  2HLO A;  1XTC C;  2Z4E A;  1LTJ A;  3H32 B;  5APS A;  2HPC B;  1M7L A;  4N6J A;  2WPR A;  5APX A;  4GIF A;  1HBW A;  3KPE A;  4W7Z A;  1IFM A;  3P7K A;  2R3C A;  3RK2 B;  1URQ D;  1GL2 D;  2C0W A;  2NPS A;  4GKG A;  1X9V A;  2W27 A;  1M1J C;  1N2D C;  1YTZ T;  2IX7 C;  4WY4 D;  5KJ7 A;  1A02 F;  2N1T C;  3HD7 A;  3L35 A;  1ZN5 A;  4WY4 C;  2H7H A;  2GM4 A;  3IR9 A;  2LKM A;  1RE3 A;  1LTS C;  1IK9 A;  3V2R A;  3P8M C;  1ZR2 A;  1NTK K;  3TYY A;  4IFF A;  2FYZ A;  4I2L C;  5AW7 B;  1LWU A;  1CZQ A;  4W80 A;  1GU5 A;  1T8Z A;  1LTA C;  5BU8 B;  1SVF A;  3P32 A;  2FYU K;  1IFJ A;  2NPS B;  1GK4 A;  3NFQ A;  3RL0 C;  5CJ0 A;  1QL2 A;  1CSB A;  5AW2 B;  3HD7 B;  2R5B A;  2YKQ A;  2OYI C;  3VP9 A;  1L4A A;  3HE5 A;  1FZC A;  2WIT A;  1KFM A;  1HGV A;  1KIL A;  1LGH B;  1RF1 C;  1NTM K;  3BAS A;  5AVQ B;  4C7N A;  1FZB A;  2A45 H;  2J59 M;  3V4Q A;  5AW8 B;  1NHL A;  1RE4 A;  4XE5 B;  3U1A A;  3OAK A;  5CJ4 A;  1IJD B;  2Z5I A;  5APQ A;  3RK3 C;  2C9N Y;  1FDM A;  4I1L A;  3BAT A;  5CCG D;  2WWW A;  1DH3 A;  2Q3I A;  2HG5 D;  1FZC B;  3VP8 A;  2QM7 A;  4WB4 A;  2XDJ A;  1KIL B;  5AVT B;  1ZLL A;  1SQX K;  5CCH D;  1H8A A;  4C7N B;  2O1J A;  1J1D B;  2N9B A;  5CCH C;  2W6A A;  3WMM 0;  1T2K C;  3HTK A;  3SWF A;  1G2C A;  3M0D C;  3VMX A;  1G1I A;  4C7R A;  3M9Q A;  4N78 E;  2Z5H A;  3KQG A;  1URQ A;  1GL2 A;  2KB7 P;  1SQB K;  2PP6 A;  1LT9 C;  1HGZ A;  4DOJ A;  1JMM A;  1W2E A;  1NOH A;  2J58 A;  3L36 A;  1G1J A;  2OYH B;  1PFI A;  4WBA A;  4EIJ A;  1X79 B;  3IFM A;  2WSF H;  5AVU B;  3LIE A;  2FFD B;  2WPS A;  1NO4 A;  3GHG C;  4Y99 C;  2KYV A;  1FAV A;  3CLQ A;  5CHX A;  2O01 H;  1KQL A;  1N73 A;  3HTK B;  1J1E B;  2XU6 A;  1G2C B;  3M9H A;  1FZG A;  3KDP B;  1X8Y A;  2R32 A;  4B86 A;  2JJL A;  1FBM A;  3T97 A;  5KTB A;  1SP4 A;  3HUS A;  1HJB A;  2N1T D;  3E1I A;  5AVR B;  5AW3 B;  1EQ7 A;  1URQ B;  1GL2 B;  1NTZ K;  1IO4 A;  4ZKP A;  3B5N A;  2W6B A;  3M0A A;  2OYH C;  2O1K A;  1FU1 A;  1KZU B;  1VDF A;  1Z56 A;  2KLV A;  1JNM A;  2FFD C;  1J2J B;  1JCC A;  1SFC A;  1HH0 A;  2YKP A;  2KP8 A;  5AVW B;  1HTL C;  1NAF A;  5APU A;  3H6P A;  3V2N A;  1LTJ B;  4JF7 A;  1RF0 C;  3NTN A;  3V5B A;  2ZFC A;  3RK2 C;  1N73 B;  3VYI A;  1XTG B;  2WPQ A;  5AVS B;  1T3J A;  3HUS B;  5AW6 B;  3RL0 D;  2KSJ A;  2WSC H;  3TNU A;  3OA7 A;  1SQV K;  2POH A;  5BVZ A;  1JY2 O;  3B5N B;  5CCG A;  1FZF A;  3II6 A;  1L0N K;  5AW9 B;  2HOD A;  2BAS A;  1SFC B;  5AVV B;  2YMY A;  4LC1 A;  3MTU E;  2R5D A;  1JO5 A;  2L5G B;  2NPS D;  2YNY A;  3P8C D;  1GW3 A;  3VTP C;  5APW A;  3M06 A;  3N4X A;  1H89 A;  1LWU B;  3OJA B;  2VRS A;  4LGD E;  1JY2 P;  5KJ7 D;  3RK3 D;  3V4W A;  1A02 J;  2NPS C;  3TK1 A;  1LTG C;  1IC2 A;  2WZ7 A;  3L37 A;  5KJ7 C;  3HD7 C;  1N7S A;  3A7O A;  3TNU B;  1HUC A;  4AYC A;  1DX7 A;  1RE3 C;  2P1J A;  1S9K D;  4AQR D;  1GDT A;  1MFZ A;  2E42 A;  2HOD B;  3O8Z A;  1T3U A;  1L4A B;  3HE5 B;  1GD2 E;  3EFG A;  5CMZ A;  4IFD K;  2C0X A;  3NXS A;  4DZO A;  4O9B A;  4N78 D;  3TSI A;  1H88 A;  1FJK A;  3SWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...