1GK4A

Human vimentin coil 2b fragment (cys2)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
79
structure length
79
Chain Sequence
CEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conserved Segments 1A and 2B of the Intermediate Filament Dimer: Their Atomic Structures and Role in Filament Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Vimentin
molecule keywords VIMENTIN
total genus 38
structure length 79
sequence length 79
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2001-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gk4A00
1CI6A 1JUNA 5APUA 3HE4A 3L36A 1MV8A 3M9HA 5APSA 3VMXA 2H7HA 2ZFCA 3NMDA 4XE5B 1DH3A 4GKGA 1GK6A 5AVXB 2KP8A 2QM8A 3VN0A 4M3LA 1HWTC 2ZXEB 3VYIA 2E43A 1HBWA 2WPSA 1SLQA 2R5BA 2JJLA 3TYYA 5APTA 3L35A 2W27A 3MD0A 1IO4A 2E42A 1GD2E 3A2AA 4C7NA 1MUUA 4AYCA 4B86A 2P2UA 5APXA 3SWFA 2VRSA 1G2CB 3P32A 4JYBA 1A02F 5AVTB 1KQLA 2W6AA 5AW3B 5AW7B 4I2LC 5APYA 3VMYA 2IPPA 3HE5B 5AVSB 3HE4B 2YO2A 3UIAA 1HJBA 1CI6B 3LIDA 4C46A 5CMZA 3P7KA 3TNUB 4GT1A 3IR9A 3M0DA 3T97A 3M91A 2WPRA 3A5TA 5AW2B 5AW0B 2WT7B 2C9NY 4EOTA 3M0AA 1NAFA 5AW6B 2Z5HA 5AVRB 2N9BA 3B8EB 3V4WA 1T2KD 5APQA 3O8ZA 2Q3IA 5AVUB 1FOSF 3A7OA 4KHXA 5AW9B 5AVQB 5AW4B 1S9KE 3I5CA 1T2KC 2R3CA 1JNMA 1OWAA 3MGNA 5AW8B 3NXSA 1YYCA 2P7JA 2QM7A 2Q5UA 2XV5A 3VTPC 3V4QA 1GU5A 4HYTB 1J2JB 2WPQA 2BASA 1FAVA 2Q7CA 5AVVB 1GU4A 4RESB 3LIEA 5AVWB 3OAKA 1CZQA 2WTYA 4LC1A 3M06A 5AVZB 1GZLA 2R32A 2YO3A 5AW1B 2XZRA 4AQRD 2WWWA 4AUWA 1X8YA 3HE5A 5APWA 3NFQA 4I6MC 1MFZA 3VMZA 1OXZA 2R5DA 3M9BA 3NTNA 1NWQA 1H8AA 1GTWA 4C7NB 1HUCA 3HTKA 1FOSE 2P67A 2XU6A 2YNYA 1CSBA 4JYCA 1H88A 3L37A 1H89A 3A3YB 3KQGA 2C9LY 5AVYB 3P8MC 1SP4A 3TK1A 4DZOA 3V5BA 1GK4A 2WT7A 3KDPB 1S9KD 2Z5IA 3TNUA 5AW5B 1A02J 5APVA
chains in the Genus database with same CATH superfamily
3G3ZA 1M56D 1N8RQ 4BWNA 3O6QA 5KLVD 3V2PA 1KC8Q 2H7HA 1T3UA 3PP5A 3AEEC 1PFIA 3CX5E 3NMDA 1JY2O 1SQVJ 4XE5B 3TGUG 4D6TG 1Q82Q 1EDKA 2ZT9D 1S1CX 2AXTH 2QIWA 3B5ND 4M3LA 3VN0A 4PD4E 3FGAD 3TF5A 1S5LX 2ZXEB 3GF3A 3CWBJ 3VYIA 1ZV8A 5EFWB 5GTIH 1YITP 2FYNB 2WPSA 3L74G 1KILB 3CWBE 3OA7A 1L0LK 1OW8A 5L8RJ 4YXWH 1N7SD 1AFOA 1L0NK 2V7QJ 3L73G 2E42A 4W80A 2I1JA 3HTKB 1RF1B 2LXBA 1OX3A 1MUUA 1SFCD 2FXOA 4IOIH 1YIJP 2WSCH 3VMAA 2KLVA 1OVRA 1YI2P 3AEFC 1JOCA 1RQVA 2JWAA 2MKVA 3SSUA 1YJ9P 1E5WA 1R8EA 3BVHA 1A02F 2W6AA 5AW3B 5AW7B 2KSJA 2PGDA 4I2LC 2POHA 4N78E 1N7SA 3L75E 4DOJA 2IYPA 2JDIH 2QJKB 2FFDC 1PGOA 2FKWB 3B5NA 3CCSP 2JWDA 3L74J 3CCRP 4PD4D 4GT1A 3IR9A 2R3SA 2KS1A 1NTKG 3RL0C 1BE3D 1IJDB 2WPRA 1BGYD 3G4SP 5KLVE 2WT7B 4EOTA 1NAFA 1OMIA 1BDCA 1DD3A 3GHGA 4H44C 5AVRB 2J58A 2YXRB 3AE1C 1PP9G 1X22A 3FX0A 3KPEA 3U1CA 2A06G 1OW7A 5KLVK 3O8ZA 2Q3IA 4OGQD 1FZBA 3AECC 1KD1Q 1KILD 2YKQA 2YKOA 1JB0J 4KHXA 4WB4A 2QEXP 1SQXE 1SQBK 5CCGC 2N1TA 3MHVA 1NTKJ 1GL2D 1M8OB 5B5EH 2Y0EA 4IFFA 1S9KE 1NYHA 2E74D 1ZW0A 4YPCA 2AXCA 1AJYA 2ZVOB 2K37A 1EZVE 1BGYG 1FBMA 5AW8B 2OYHA 2XV5A 2FYNC 4PJ0E 3AE7C 1KB9E 1VQLP 1JO5A 1L4AB 2WPQA 3CMEP 5TISE 3AE9C 4XA4A 2N1TC 1VQNP 1KYOE 3C8VA 1OVVA 3WUTA 1RF1C 4RESB 4GDOA 3L73D 1CZQA 2JO1A 2QJPB 2ZYGA 3CXHH 3P8CE 4LC1A 1LWUC 2KIKA 3AE3C 3GF7A 3L75D 1TU3F 2G3AA 1LTGC 5AW1B 2XZRA 1Y9BA 4R4LA 4UB6H 2WWWA 3FWNA 2RH0A 3BRTB 4WY4C 1Q90D 1L0ND 3AE8C 5KLVJ 4AUWA 1LNQA 3E1RA 3H1IJ 1BCCE 1ZP0C 1VF5C 1RE4C 1FE6A 2V4HA 3CCLP 4WBAA 1EZVD 3JSVC 1KN7A 5GTHE 1EXIA 2OYHB 1IK7A 3N7NA 1USEA 3AE5C 3N4XA 1EZVG 4JF7A 5KAFE 1PV3A 1XTCC 3TGUJ 1GL2A 4EDFA 2OGUA 2KLUA 2Q9IA 2C0XA 2E76D 2R5DA 3KZIE 3RL0B 3NTNA 3H1LG 2QSIA 1L0NE 1UIIA 3HD7D 1KORA 4PJ0H 4BRYA 3G71P 2E76B 3RL0D 1Q86Q 1VQ9P 1K04A 1IC2A 2O3JA 3EWKA 2H43A 4H44B 1KQGB 1RH5B 1S4XA 1H88A 3M0DC 3IAOA 3L37A 5KLIB 2KOGA 3H1IG 5KLVG 3P8MC 2M8RA 3TK1A 2L91A 5B66E 4PV1C 1GK4A 2WT7A 1SQBD 2Q3EA 1S9KD 1G1JA 3CCUP 4TT3H 2FYUG 2MJZA 1LWUB 2KK7A 1PP9D 2CPBA 3CCQP 2JP3A 1KYOI 1T6AA 3BRVB 1L4AA 4ZKUA 3Q2YA 3CL3D 3BCCE 1N7LA 1LJ2A 3M9HA 1S3JA 3U59A 3A0HH 3VMXA 1GW3A 5BU5A 4OGQB 1KMIZ 1SS1A 1DD4A 1N7SC 1PGJA 2SPZA 2N1TB 5AVXB 2KP8A 2JEEA 1VQKP 2Y9YA 5H2FE 1VQMP 1HWTC 1IFDA 1HF9A 1NAYA 1EQ7A 1SFCA 2ZT9C 3B5NC 3HD7C 1SLQA 2R5BA 1ZRTE 3L4FA 3TYYA 1U7MA 2E76C 3GHGB 3H1KE 4WY4B 1LGHB 2HR3A 5APTA 3TSIA 1LT1A 3BASA 3I55P 1GD2E 3L73E 2QVAA 4IL6E 4C7NA 4AYCA 1NGMB 3SFEC 3SWFA 1IFPA 3GMAA 3L72E 1LTTC 3P32A 4JYBA 2ZXXA 1L0LG 1RE3C 3MZWB 3PHLA 4N6JA 3CXHD 2YIUC 3GW6A 1QGKB 4IL6H 2YMYA 4H0LB 5APYA 3RBXA 1P84D 2Z4EA 1LP1B 2IPPA 3CC7P 2K9JA 1FJKA 1HVVA 3E1IA 1CW5A 3HUSB 1FDIA 2OYIA 1VQOP 3K5BA 3UIAA 1ZLLA 1ZOYC 3QWOC 1HJBA 1N73B 1QVFO 5H2FH 1FZEA 4A7PA 1NKNA 3II6A 1SQPD 2OARA 4EIJA 3TNUB 4OWFA 3RK2D 1JEKA 1LWUA 1MFTA 1BCCJ 1ZN5A 3M91A 4JQ0D 3A5TA 1ZR2A 1M1JC 1JY2P 3D71A 3FWLA 1RF1A 1NU1E 2QE7H 1FZGA 2C9NY 1AQTA 1WRGA 1XTGB 2D2CC 4YTPC 2I1KA 4L76A 2B88A 1Y47A 3V4WA 3OW2O 1KILA 1QL2A 1GL2C 1R5SA 1KFMA 3VOPA 3GHGC 5CCGD 1M57D 5DJUB 5TISH 2E5YA 3S4RA 4L75A 2A45G 3TGUD 1SQQJ 4KT0J 3L70D 4OGQC 1BCCG 5AW4B 1JM0A 3BCCG 3I5CA 3MIWA 5CJ4A 3I56P 1JNMA 2CPSA 1H0TA 1SQPK 3CD6P 4IL6X 4MN4C 1NH4A 1YYCA 5KAIE 2Q5UA 4NPFX 3V4QA 4UB8E 1GU5A 1P84H 3A0BH 4HYTB 4H13D 3SWYA 4CPGA 3HD7B 2JR8A 1NTKE 1NJIQ 1FAVA 2Q7CA 1AVYA 5AVWB 2KNCB 2K88A 1YTZT 1P84E 1GW4A 1L0LJ 3A0BE 3L74D 4IFMA 2KYVA 2AEMA 3BATA 4H0LD 3S9OA 1E79H 1M7LA 2HODA 2NPSC 1JY3P 3H1LJ 1BE3J 3KYQA 4PD4H 4U3FD 5E79E 5KJ7D 1ZXGA 1VQ7P 1VQ4P 4AQRD 3CX5H 2RKLA 4TLFA 1N73A 2OYIC 1NTZD 3RL0g 2NPSD 2WQYC 4W7ZA 3Q3DA 3C1LA 1SQXG 2W6BA 3HRNA 1IFMA 3HE5A 3M9QA 1A02J 2M5AB 2OYOA 2Q1KA 3WU2H 1YHQP 4I7ZB 5K5GB 1MFZA 1N2DC 1KZUB 4GOEA 3L71E 4HJGH 4D6TE 3Q1MA 2K9YA 2E5TA 2FFDA 1VDFA 4Y28J 3M9BA 3EFFK 1VQ5P 4N3YB 1NU1J 1NWQA 1H8AA 2B89A 2LR2A 3WMM0 4EYYQ 3D6YA 1M1JB 1OZHA 5CCHC 1YJWP 1NHLA 1FOSE 3SFDC 2XU6A 3MUDA 1PGQA 1Z56A 4JYCA 3A0HE 3G6EP 2GUVA 1H89A 1NTMK 2M3BA 1Q7YQ 2HYNA 2FXPA 3AE2C 5CBNA 5GTHH 2OTKE 4DZOA 4JPZB 4U7JA 1S72P 3VP9A 1URQB 2KS1B 1RQUA 1S5LE 2E75C 3Q5RA 1QL1A 1JY2N 2D2CD 2R44A 2YXQB 4GIFA 5AW5B 1RF0C 2IYOA 1EZVI 3CI9A 4R4MA 2W6JH 3PLNA 5APVA 5AW2B 2IZ0A 3L71D 5APUA 1RE3A 2HFED 1KFNA 3L36A 4YXDC 1RF0A 2BCCG 1BGYE 1SQPJ 3PH0A 4L74A 4N78D 4NPEA 3RK2C 2OQQA 2V7QH 2ZFCA 3JC22 3RK3E 1FZFA 4Y99C 1BCCD 3H32A 1GK6A 1KYOH 3IN6A 5E79H 2QM8A 1NO4A 2Q6QA 1NTZE 2A45I 2GA1A 2K3RA 2ZJSE 2FY8A 1HGZA 4GOFA 2FBWC 2NPSB 1FZCC 3D70A 4K35A 1KV4A 5C39A 2JJLA 2O1JA 2P10A 3H1KD 2Y0DA 1HH0A 2QJYB 2UWJE 3IFMA 3MD0A 3CC4P 1M1JA 2E75D 4IFDK 1SQQD 5GTIE 3C9IA 2IBZI 3H1HG 4B86A 2P2UA 1SQPE 5APXA 2VRSA 3H1HE 1G2CB 2XKMA 4BRYB 2GM4A 3RGUA 1FZCA 1LT9C 1JTHB 1KB9D 1GL2B 1LTJA 1NTME 1U7JA 1KQLA 1SQBJ 2P1JA 2XDJA 3EQ2A 1JCCA 2GUSA 3RK3D 2IFNA 1EXJA 1MZ9A 3G9RA 3HE5B 3VMYA 1RHZB 5AVSB 5CCHD 3P8CD 4O9BA 3WU2E 2RMZA 3HE4B 3O6QB 2YO2A 1ZMEC 4W7YA 5BU8B 3LIDA 2OYHC 1BSHA 2NZ2A 3L72D 3P7KA 1L0LD 1NU1K 4UB6E 2BEQD 2ZAEB 3F89A 5CHXA 4DCKA 2HODB 3M0DA 4U3FJ 5KJ7A 1G2CA 3U1AA 1OVUA 1FU1A 1SQBE 3CWBG 3F5HA 2PP6A 4K3AA 3T97A 3W67A 1NTMJ 4RO0A 2L5GB 5AW0B 5B66H 1S2EA 2BEZF 1VQPP 2KB7P 2WVRA 1SQVG 1GMJA 2AXTE 3B8EB 3BCCD 1T8ZA 1LTAC 4D6TJ 2M0BA 4PD4I 3E7KA 5APQA 3WUUA 4RJTA 1T2KD 1QVGO 1BDDA 1SQPG 1NTMG 2AEJA 2PAJA 4WVZA 1URQD 5AVUB 3AEDC 4H0LC 4PV1B 3RK3B 2LXCB 2WSSH 2NRGA 5AVQB 4Y99B 4OVNF 5KAIH 4ASVA 1WT6A 1W2BO 1NU1D 1HGVA 4BXLA 1Y8AA 2C0WA 1X79B 1UIXA 3MGNA 1FJPA 2P7JA 1JTHA 1LTBC 1LTJB 3B4SA 1QEXA 2W90A 1LT9A 3H1LE 1R5LA 3CXHE 1SQVK 3PTZA 3ITKA 4H13C 4HB1A 4WWIA 5KTBA 1NTZG 4EI2A 1SQQG 2BASA 5AVVB 1GU4A 4WY4A 3LIEA 3H1KG 1NU1G 1X0TA 3M06A 1VF5D 1VQ8P 2OTLP 1OIPA 3EFGA 2FXMA 1QLED 5CJ0A 1YJNP 1YQ3C 1W5CE 2FYUJ 2YO3A 3KXDA 3CCEP 1YBKA 4WY4D 2A06E 3LW5J 3AEGC 1U57A 2B87A 2N9YB 4Z1MH 4NPDA 1URQC 1X8YA 1NOHA 1LP1A 1SQQK 1SQVD 1NTZK 1K05A 5DJTB 2HLOA 3NFQA 2KI7B 4I6MC 3VMZA 2FFDB 1ZRTD 2K1AA 3Q5PA 3CWBD 3L70J 1OW6A 1OXZA 2LKMA 2PRRA 3GLMA 1IFIA 2BCCJ 3QH9A 2PFXA 1SVFA 3TGUE 2OTJP 2H89C 1URQA 2FYZA 4XFJA 1KB9H 1GTWA 4C7NB 3HTKA 2B87B 1QX8A 3CLQA 3V6IA 2P67A 2P58A 2YNYA 1CSBA 3H1IE 4JBZA 2C9LY 3A3YB 1L4AC 5AVYB 2ITAA 1SP4A 2O01H 2QRXA 3L70G 3V5BA 4ZKPA 2DW3A 1BE3E 3KDPB 3L70E 2KNCA 3WUVA 3V2RA 1AV1A 1Q2NA 2D2CB 3MTUE 4L73A 3T97B 2A45H 4H44D 5CCGA 4ZNCA 1K9MQ 4QMAA 3HD7A 1J1DB 2I8DA 3H1LD 2IDBA 1AA0A 2WSCJ 1CI6A 1FC2C 1S5LH 1DEEG 1JUNA 1LTJC 3CXHI 3HE4A 1NKZB 1L2PA 1MV8A 1NTZJ 1FZAA 1T3JA 3L72J 5CCHA 3CPWO 5APSA 4DT0A 3H1JG 3USSA 1ZR4A 1EDLA 5KAFH 1VF5B 1EDIA 2H8PD 1L4AD 3D6ZA 1DH3A 1EC5A 4GKGA 1Q81Q 1BGYJ 1NTMD 1BSNA 3VP8A 2WSEH 2KXPB 2E43A 1YQ4C 1SQXJ 2A06D 3H1JD 2IBZE 1HBWA 1FZCB 1IZNB 4D6TD 1JMMA 3L35A 2W27A 1VPCA 2HPCA 1KQFB 2HPCB 1IO4A 3A2AA 4LLHA 1PPJE 1SQVE 2E74B 2WSFH 2YMKA 2O01N 1PL5A 3IF4A 4RKUJ 1NTKD 2RN0A 3CCVP 1HTLC 1SFCC 2NPSA 3H1HD 4PV1D 3CCMP 2HG5D 2KZJA 5AVTB 3S1KA 2M3EA 3RK2B 1H0TB 1LTIC 4ZMDA 3CMAP 1IFJA 3HUSA 2OYIB 1DIPA 1IFNA 4KJMA 2K9JB 2WMMA 2BCCE 2Y0CA 3AE6C 4GODA 1FDMA 3RBZA 1KTMA 5BVZA 1M1KQ 3L71J 1JY3N 1CI6B 3GG2A 4C46A 5CMZA 2J5UA 4H13B 2IZ1A 3MUDC 3CX5D 1RY3A 2ZYDA 3Q5SA 2IBZG 5KKZB 3OJAB 3M0AA 5AW6B 2FYUK 4HKZH 1L0NJ 3AEBC 2Z5HA 2ZYAA 2QJPC 3H1ID 3JCUE 1KYOD 2N9BA 2ZT9B 2J59M 2FYUE 3B5NB 2O1KA 3W68A 3L72G 1AQ5A 1X9VA 1PGPA 1KB9I 1L0LE 3H1KJ 1DEBA 2KUBA 2O01J 4I7ZC 5B5EE 2QA4P 1FOSF 3AE4C 3A7OA 2QG4A 2WSEJ 1OFCX 5AW9B 1J1EC 2B9BA 1N7SB 3H32B 1USDA 4I1LA 2BCCD 4HH2A 1D7MA 2R3CA 5M1BA 5CBOA 1OWAA 5KJ7C 1T2KC 3PJSK 3L71G 4ASWA 2N1TD 3NXSA 2YIUB 3VTPC 2QM7A 1PIXA 1M90Q 2M5AA 1J2JB 2WSFJ 1FS0E 3MP7B 3FXEA 1HJ0A 1NVOA 3CC2P 3HUSC 3PRJA 1LTSC 4C7RA 2E74C 2CK3H 1SQQE 1SQXK 2ZVNB 3ABVC 3KHUA 1N73C 3OAKA 2WTYA 5AVZB 2XNDH 1GZLA 1SFCB 1PP9J 2E75B 2KZIA 2R32A 1W2EA 1KILC 1P84I 1VL2A 2IX7C 3B71A 1G1IA 2IFMA 5KLIC 1GDTA 1DX7A 3RK3C 2QJYC 5TJHA 5KKZC 1RE4A 1FDOA 2WPVB 3V2QA 1YTZI 4U3FG 2AEFA 3BCCJ 4U3FE 5APWA 1LT9B 1J1DC 3L75G 1K73Q 3KZIH 2YKPA 3JCUH 3R2PA 2W8ZA 1JCDA 3H1JE 1SQXD 3H1JJ 2IBZD 1K8AQ 2Y9ZA 4UB8H 1PZQA 2G8YA 1EDJA 1L0NG 2W83C 3LW5H 3FXDA 1HUCA 1WMKA 3H25A 2JKVA 1SQBG 2H88C 1PPJD 2QJKC 4DJGA 3L74E 3H6PA 3KQGA 3ZDMA 4LGDE 2WZ7A 2KSEA 3H1HJ 3TDKA 1VQ6P 3AEAC 1PPJG 1J1EB 1KILE 1BE3G 1N86A 2XNXA 3L73J 1PP9E 3L75J 2WITA 1MKMA 3CCJP 1JY3O 2Z5IA 3TNUA 1KQSO 4OH8B 3R4YA 1JMBA 2FYUD 3V2NA 3CX5I 3SWKA 1AVOA 1NTKK 1IK9A
chains in the Genus database with same CATH topology
3G3ZA 2H7HA 1T3UA 3PP5A 1PFIA 3NMDA 1JY2O 4XE5B 3B5ND 3VN0A 4M3LA 2ZXEB 3VYIA 1ZV8A 2WPSA 3OA7A 1KILB 1L0LK 1N7SD 1AFOA 1L0NK 2E42A 4W80A 2I1JA 3HTKB 1RF1B 1MUUA 1SFCD 2WSCH 2KLVA 1JOCA 3BVHA 1A02F 1E5WA 2W6AA 5AW3B 5AW7B 2KSJA 4I2LC 2POHA 4N78E 1N7SA 4DOJA 2FFDC 2FKWB 3B5NA 4GT1A 3IR9A 3RL0C 1IJDB 2WPRA 2WT7B 4EOTA 1NAFA 3GHGA 5AVRB 3KPEA 2J58A 3U1CA 5KLVK 3O8ZA 2Q3IA 1FZBA 1KILD 2YKQA 2YKOA 4KHXA 4WB4A 1SQBK 5CCGC 2N1TA 1S9KE 1GL2D 4IFFA 5AW8B 1FBMA 2OYHA 2XV5A 1JO5A 1L4AB 2WPQA 4XA4A 2N1TC 1RF1C 4RESB 1CZQA 3P8CE 4LC1A 1LWUC 1LTGC 5AW1B 2XZRA 2WWWA 3BRTB 4WY4C 4AUWA 1RE4C 4WBAA 2OYHB 3N7NA 3N4XA 4JF7A 1XTCC 1GL2A 2Q9IA 2C0XA 2R5DA 3RL0B 3NTNA 3HD7D 3RL0D 1IC2A 2H43A 1H88A 3M0DC 3L37A 2KOGA 3P8MC 2M8RA 3TK1A 2WT7A 1GK4A 1S9KD 1G1JA 2MJZA 1LWUB 2CPBA 3BRVB 1L4AA 4ZKUA 3CL3D 1N7LA 3M9HA 3U59A 3VMXA 1GW3A 5BU5A 1N7SC 2N1TB 5AVXB 2KP8A 2JEEA 1HWTC 1IFDA 1EQ7A 1SFCA 3B5NC 3HD7C 1SLQA 2R5BA 3L4FA 3TYYA 3GHGB 5APTA 4WY4B 1LGHB 3TSIA 1GDTA 3BASA 1GD2E 4C7NA 4AYCA 3SWFA 4N6JA 1LTTC 3P32A 4JYBA 1RE3C 2YMYA 5APYA 2Z4EA 2IPPA 1FJKA 1HVVA 3E1IA 3HUSB 2OYIA 3UIAA 1ZLLA 1N73B 1HJBA 1FZEA 1NKNA 3II6A 2OARA 4EIJA 3TNUB 3RK2D 1LWUA 1ZN5A 3M91A 3A5TA 1ZR2A 1M1JC 1JY2P 1RF1A 2C9NY 1FZGA 1WRGA 1XTGB 2I1KA 3V4WA 1KILA 1QL2A 1GL2C 1KFMA 3VOPA 3GHGC 5CCGD 2A45G 5AW4B 3I5CA 5CJ4A 3MIWA 1JNMA 2CPSA 1SQPK 1NH4A 1YYCA 2Q5UA 3V4QA 1GU5A 4HYTB 3SWYA 3HD7B 1FAVA 2Q7CA 5AVWB 1YTZT 1GW4A 4IFMA 2KYVA 3BATA 1M7LA 2HODA 2NPSC 3KYQA 1JY3P 3V2PA 1FJPA 5KJ7D 4AQRD 1N73A 2OYIC 2NPSD 4W7ZA 2W6BA 3HRNA 1IFMA 3HE5A 3M9QA 1MFZA 1N2DC 1KZUB 2FFDA 1VDFA 3M9BA 4N3YB 1NWQA 1H8AA 3WMM0 1M1JB 5CCHC 1NHLA 1FOSE 2XU6A 3MUDA 4JYCA 1Z56A 1H89A 2GUVA 1NTMK 2M3BA 2HYNA 4DZOA 3VP9A 1URQB 1QL1A 1JY2N 4GIFA 5AW5B 1RF0C 5APVA 3CI9A 5AW2B 1A02J 5APUA 1RE3A 2HFED 1KFNA 3L36A 1RF0A 4N78D 3RK2C 1FZFA 2ZFCA 4Y99C 3H32A 1GK6A 2QM8A 1NO4A 2A45I 1HGZA 2NPSB 1FZCC 2JJLA 2O1JA 3MD0A 3IFMA 1HH0A 4IFDK 1M1JA 3C9IA 4B86A 2P2UA 5APXA 2VRSA 1G2CB 2XKMA 2GM4A 1FZCA 1LT9C 1JTHB 1LTJA 1GL2B 2P1JA 1KQLA 2XDJA 3EQ2A 1JCCA 2GUSA 3RK3D 2IFNA 1MZ9A 3HE5B 3VMYA 5AVSB 5CCHD 3P8CD 4O9BA 3HE4B 2YO2A 4W7YA 5BU8B 3LIDA 2OYHC 3P7KA 1NU1K 5CHXA 2HODB 3M0DA 5KJ7A 1G2CA 3U1AA 3T97A 1FU1A 2PP6A 2L5GB 5AW0B 2KB7P 3B8EB 1T8ZA 1LTAC 1T2KD 5APQA 2PAJA 1URQD 5AVUB 3RK3B 5AVQB 4Y99B 1WT6A 1HGVA 3MGNA 2C0WA 1X79B 2P7JA 1JTHA 1LTBC 1LTJB 1FZCB 1LT9A 1SQVK 5KTBA 2BASA 5AVVB 1GU4A 4WY4A 3LIEA 3M06A 3EFGA 2FXMA 5CJ0A 2YO3A 4WY4D 1URQC 1X8YA 1NOHA 1SQQK 1NTZK 2HLOA 3NFQA 4I6MC 2FFDB 3VMZA 1OXZA 2LKMA 1IFIA 1SVFA 1URQA 2FYZA 1GTWA 4C7NB 3HTKA 3CLQA 2P67A 2YNYA 1CSBA 2C9LY 3A3YB 1L4AC 5AVYB 1SP4A 2O01H 3V5BA 4ZKPA 3KDPB 3V2RA 3MTUE 2A45H 5CCGA 3HD7A 1J1DB 1CI6A 1JUNA 1LTJC 3HE4A 1NKZB 1MV8A 5CCHA 1FZAA 1T3JA 5APSA 2H8PD 1L4AD 1DH3A 4GKGA 3VP8A 2WSEH 2E43A 1HBWA 1JMMA 3L35A 2W27A 1VPCA 2HPCA 2HPCB 1IO4A 3A2AA 4LLHA 2WSFH 1HTLC 1SFCC 2NPSA 2HG5D 5AVTB 3RK2B 1LTIC 1IFJA 3HUSA 2OYIB 1IFNA 1FDMA 5BVZA 1JY3N 1CI6B 4C46A 5CMZA 1RY3A 3OJAB 3M0AA 5AW6B 2FYUK 2Z5HA 2N9BA 3B5NB 2J59M 2O1KA 1AQ5A 1X9VA 1DEBA 1FOSF 3A7OA 5AW9B 1J1EC 1N7SB 3H32B 4I1LA 1T2KC 4HH2A 2R3CA 1OWAA 5KJ7C 2N1TD 3NXSA 3VTPC 2QM7A 1J2JB 3HUSC 1LTSC 4C7RA 1N73C 1SQXK 3OAKA 2WTYA 5AVZB 1GZLA 1SFCB 2R32A 1KILC 1W2EA 2IX7C 1DX7A 1G1IA 2IFMA 3RK3C 1RE4A 3V2QA 1YTZI 5APWA 1LT9B 1J1DC 2YKPA 3R2PA 1JCDA 3LW5H 1HUCA 3H6PA 3KQGA 4LGDE 2WZ7A 1J1EB 1N86A 2XNXA 1CW5A 2WITA 1JY3O 2Z5IA 3TNUA 4OH8B 3V2NA 1ZR4A 1NTKK 1IK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CI6 A;  1JUN A;  5APU A;  3HE4 A;  3L36 A;  1MV8 A;  3M9H A;  5APS A;  3VMX A;  2H7H A;  2ZFC A;  3NMD A;  4XE5 B;  1DH3 A;  4GKG A;  1GK6 A;  5AVX B;  2KP8 A;  2QM8 A;  3VN0 A;  4M3L A;  1HWT C;  2ZXE B;  3VYI A;  2E43 A;  1HBW A;  2WPS A;  1SLQ A;  2R5B A;  2JJL A;  3TYY A;  5APT A;  3L35 A;  2W27 A;  3MD0 A;  1IO4 A;  2E42 A;  1GD2 E;  3A2A A;  4C7N A;  1MUU A;  4AYC A;  4B86 A;  2P2U A;  5APX A;  3SWF A;  2VRS A;  1G2C B;  3P32 A;  4JYB A;  1A02 F;  5AVT B;  1KQL A;  2W6A A;  5AW3 B;  5AW7 B;  4I2L C;  5APY A;  3VMY A;  2IPP A;  3HE5 B;  5AVS B;  3HE4 B;  2YO2 A;  3UIA A;  1HJB A;  1CI6 B;  3LID A;  4C46 A;  5CMZ A;  3P7K A;  3TNU B;  4GT1 A;  3IR9 A;  3M0D A;  3T97 A;  3M91 A;  2WPR A;  3A5T A;  5AW2 B;  5AW0 B;  2WT7 B;  2C9N Y;  4EOT A;  3M0A A;  1NAF A;  5AW6 B;  2Z5H A;  5AVR B;  2N9B A;  3B8E B;  3V4W A;  1T2K D;  5APQ A;  3O8Z A;  2Q3I A;  5AVU B;  1FOS F;  3A7O A;  4KHX A;  5AW9 B;  5AVQ B;  5AW4 B;  1S9K E;  3I5C A;  1T2K C;  2R3C A;  1JNM A;  1OWA A;  3MGN A;  5AW8 B;  3NXS A;  1YYC A;  2P7J A;  2QM7 A;  2Q5U A;  2XV5 A;  3VTP C;  3V4Q A;  1GU5 A;  4HYT B;  1J2J B;  2WPQ A;  2BAS A;  1FAV A;  2Q7C A;  5AVV B;  1GU4 A;  4RES B;  3LIE A;  5AVW B;  3OAK A;  1CZQ A;  2WTY A;  4LC1 A;  3M06 A;  5AVZ B;  1GZL A;  2R32 A;  2YO3 A;  5AW1 B;  2XZR A;  4AQR D;  2WWW A;  4AUW A;  1X8Y A;  3HE5 A;  5APW A;  3NFQ A;  4I6M C;  1MFZ A;  3VMZ A;  1OXZ A;  2R5D A;  3M9B A;  3NTN A;  1NWQ A;  1H8A A;  1GTW A;  4C7N B;  1HUC A;  3HTK A;  1FOS E;  2P67 A;  2XU6 A;  2YNY A;  1CSB A;  4JYC A;  1H88 A;  3L37 A;  1H89 A;  3A3Y B;  3KQG A;  2C9L Y;  5AVY B;  3P8M C;  1SP4 A;  3TK1 A;  4DZO A;  3V5B A;  1GK4 A;  2WT7 A;  3KDP B;  1S9K D;  2Z5I A;  3TNU A;  5AW5 B;  1A02 J;  5APV A; 
#chains in the Genus database with same CATH topology
 3G3Z A;  1M56 D;  1N8R Q;  4BWN A;  3O6Q A;  5KLV D;  3V2P A;  1KC8 Q;  2H7H A;  1T3U A;  3PP5 A;  3AEE C;  1PFI A;  3CX5 E;  3NMD A;  1JY2 O;  1SQV J;  4XE5 B;  3TGU G;  4D6T G;  1Q82 Q;  1EDK A;  2ZT9 D;  1S1C X;  2AXT H;  2QIW A;  3B5N D;  4M3L A;  3VN0 A;  4PD4 E;  3FGA D;  3TF5 A;  1S5L X;  2ZXE B;  3GF3 A;  3CWB J;  3VYI A;  1ZV8 A;  5EFW B;  5GTI H;  1YIT P;  2FYN B;  2WPS A;  3L74 G;  1KIL B;  3CWB E;  3OA7 A;  1L0L K;  1OW8 A;  5L8R J;  4YXW H;  1N7S D;  1AFO A;  1L0N K;  2V7Q J;  3L73 G;  2E42 A;  4W80 A;  2I1J A;  3HTK B;  1RF1 B;  2LXB A;  1OX3 A;  1MUU A;  1SFC D;  2FXO A;  4IOI H;  1YIJ P;  2WSC H;  3VMA A;  2KLV A;  1OVR A;  1YI2 P;  3AEF C;  1JOC A;  1RQV A;  2JWA A;  2MKV A;  3SSU A;  1YJ9 P;  1E5W A;  1R8E A;  3BVH A;  1A02 F;  2W6A A;  5AW3 B;  5AW7 B;  2KSJ A;  2PGD A;  4I2L C;  2POH A;  4N78 E;  1N7S A;  3L75 E;  4DOJ A;  2IYP A;  2JDI H;  2QJK B;  2FFD C;  1PGO A;  2FKW B;  3B5N A;  3CCS P;  2JWD A;  3L74 J;  3CCR P;  4PD4 D;  4GT1 A;  3IR9 A;  2R3S A;  2KS1 A;  1NTK G;  3RL0 C;  1BE3 D;  1IJD B;  2WPR A;  1BGY D;  3G4S P;  5KLV E;  2WT7 B;  4EOT A;  1NAF A;  1OMI A;  1BDC A;  1DD3 A;  3GHG A;  4H44 C;  5AVR B;  2J58 A;  2YXR B;  3AE1 C;  1PP9 G;  1X22 A;  3FX0 A;  3KPE A;  3U1C A;  2A06 G;  1OW7 A;  5KLV K;  3O8Z A;  2Q3I A;  4OGQ D;  1FZB A;  3AEC C;  1KD1 Q;  1KIL D;  2YKQ A;  2YKO A;  1JB0 J;  4KHX A;  4WB4 A;  2QEX P;  1SQX E;  1SQB K;  5CCG C;  2N1T A;  3MHV A;  1NTK J;  1GL2 D;  1M8O B;  5B5E H;  2Y0E A;  4IFF A;  1S9K E;  1NYH A;  2E74 D;  1ZW0 A;  4YPC A;  2AXC A;  1AJY A;  2ZVO B;  2K37 A;  1EZV E;  1BGY G;  1FBM A;  5AW8 B;  2OYH A;  2XV5 A;  2FYN C;  4PJ0 E;  3AE7 C;  1KB9 E;  1VQL P;  1JO5 A;  1L4A B;  2WPQ A;  3CME P;  5TIS E;  3AE9 C;  4XA4 A;  2N1T C;  1VQN P;  1KYO E;  3C8V A;  1OVV A;  3WUT A;  1RF1 C;  4RES B;  4GDO A;  3L73 D;  1CZQ A;  2JO1 A;  2QJP B;  2ZYG A;  3CXH H;  3P8C E;  4LC1 A;  1LWU C;  2KIK A;  3AE3 C;  3GF7 A;  3L75 D;  1TU3 F;  2G3A A;  1LTG C;  5AW1 B;  2XZR A;  1Y9B A;  4R4L A;  4UB6 H;  2WWW A;  3FWN A;  2RH0 A;  3BRT B;  4WY4 C;  1Q90 D;  1L0N D;  3AE8 C;  5KLV J;  4AUW A;  1LNQ A;  3E1R A;  3H1I J;  1BCC E;  1ZP0 C;  1VF5 C;  1RE4 C;  1FE6 A;  2V4H A;  3CCL P;  4WBA A;  1EZV D;  3JSV C;  1KN7 A;  5GTH E;  1EXI A;  2OYH B;  1IK7 A;  3N7N A;  1USE A;  3AE5 C;  3N4X A;  1EZV G;  4JF7 A;  5KAF E;  1PV3 A;  1XTC C;  3TGU J;  1GL2 A;  4EDF A;  2OGU A;  2KLU A;  2Q9I A;  2C0X A;  2E76 D;  2R5D A;  3KZI E;  3RL0 B;  3NTN A;  3H1L G;  2QSI A;  1L0N E;  1UII A;  3HD7 D;  1KOR A;  4PJ0 H;  4BRY A;  3G71 P;  2E76 B;  3RL0 D;  1Q86 Q;  1VQ9 P;  1K04 A;  1IC2 A;  2O3J A;  3EWK A;  2H43 A;  4H44 B;  1KQG B;  1RH5 B;  1S4X A;  1H88 A;  3M0D C;  3IAO A;  3L37 A;  5KLI B;  2KOG A;  3H1I G;  5KLV G;  3P8M C;  2M8R A;  3TK1 A;  2L91 A;  5B66 E;  4PV1 C;  1GK4 A;  2WT7 A;  1SQB D;  2Q3E A;  1S9K D;  1G1J A;  3CCU P;  4TT3 H;  2FYU G;  2MJZ A;  1LWU B;  2KK7 A;  1PP9 D;  2CPB A;  3CCQ P;  2JP3 A;  1KYO I;  1T6A A;  3BRV B;  1L4A A;  4ZKU A;  3Q2Y A;  3CL3 D;  3BCC E;  1N7L A;  1LJ2 A;  3M9H A;  1S3J A;  3U59 A;  3A0H H;  3VMX A;  1GW3 A;  5BU5 A;  4OGQ B;  1KMI Z;  1SS1 A;  1DD4 A;  1N7S C;  1PGJ A;  2SPZ A;  2N1T B;  5AVX B;  2KP8 A;  2JEE A;  1VQK P;  2Y9Y A;  5H2F E;  1VQM P;  1HWT C;  1IFD A;  1HF9 A;  1NAY A;  1EQ7 A;  1SFC A;  2ZT9 C;  3B5N C;  3HD7 C;  1SLQ A;  2R5B A;  1ZRT E;  3L4F A;  3TYY A;  1U7M A;  2E76 C;  3GHG B;  3H1K E;  4WY4 B;  1LGH B;  2HR3 A;  5APT A;  3TSI A;  1LT1 A;  3BAS A;  3I55 P;  1GD2 E;  3L73 E;  2QVA A;  4IL6 E;  4C7N A;  4AYC A;  1NGM B;  3SFE C;  3SWF A;  1IFP A;  3GMA A;  3L72 E;  1LTT C;  3P32 A;  4JYB A;  2ZXX A;  1L0L G;  1RE3 C;  3MZW B;  3PHL A;  4N6J A;  3CXH D;  2YIU C;  3GW6 A;  1QGK B;  4IL6 H;  2YMY A;  4H0L B;  5APY A;  3RBX A;  1P84 D;  2Z4E A;  1LP1 B;  2IPP A;  3CC7 P;  2K9J A;  1FJK A;  1HVV A;  3E1I A;  1CW5 A;  3HUS B;  1FDI A;  2OYI A;  1VQO P;  3K5B A;  3UIA A;  1ZLL A;  1ZOY C;  3QWO C;  1HJB A;  1N73 B;  1QVF O;  5H2F H;  1FZE A;  4A7P A;  1NKN A;  3II6 A;  1SQP D;  2OAR A;  4EIJ A;  3TNU B;  4OWF A;  3RK2 D;  1JEK A;  1LWU A;  1MFT A;  1BCC J;  1ZN5 A;  3M91 A;  4JQ0 D;  3A5T A;  1ZR2 A;  1M1J C;  1JY2 P;  3D71 A;  3FWL A;  1RF1 A;  1NU1 E;  2QE7 H;  1FZG A;  2C9N Y;  1AQT A;  1WRG A;  1XTG B;  2D2C C;  4YTP C;  2I1K A;  4L76 A;  2B88 A;  1Y47 A;  3V4W A;  3OW2 O;  1KIL A;  1QL2 A;  1GL2 C;  1R5S A;  1KFM A;  3VOP A;  3GHG C;  5CCG D;  1M57 D;  5DJU B;  5TIS H;  2E5Y A;  3S4R A;  4L75 A;  2A45 G;  3TGU D;  1SQQ J;  4KT0 J;  3L70 D;  4OGQ C;  1BCC G;  5AW4 B;  1JM0 A;  3BCC G;  3I5C A;  3MIW A;  5CJ4 A;  3I56 P;  1JNM A;  2CPS A;  1H0T A;  1SQP K;  3CD6 P;  4IL6 X;  4MN4 C;  1NH4 A;  1YYC A;  5KAI E;  2Q5U A;  4NPF X;  3V4Q A;  4UB8 E;  1GU5 A;  1P84 H;  3A0B H;  4HYT B;  4H13 D;  3SWY A;  4CPG A;  3HD7 B;  2JR8 A;  1NTK E;  1NJI Q;  1FAV A;  2Q7C A;  1AVY A;  5AVW B;  2KNC B;  2K88 A;  1YTZ T;  1P84 E;  1GW4 A;  1L0L J;  3A0B E;  3L74 D;  4IFM A;  2KYV A;  2AEM A;  3BAT A;  4H0L D;  3S9O A;  1E79 H;  1M7L A;  2HOD A;  2NPS C;  1JY3 P;  3H1L J;  1BE3 J;  3KYQ A;  4PD4 H;  4U3F D;  5E79 E;  5KJ7 D;  1ZXG A;  1VQ7 P;  1VQ4 P;  4AQR D;  3CX5 H;  2RKL A;  4TLF A;  1N73 A;  2OYI C;  1NTZ D;  3RL0 g;  2NPS D;  2WQY C;  4W7Z A;  3Q3D A;  3C1L A;  1SQX G;  2W6B A;  3HRN A;  1IFM A;  3HE5 A;  3M9Q A;  1A02 J;  2M5A B;  2OYO A;  2Q1K A;  3WU2 H;  1YHQ P;  4I7Z B;  5K5G B;  1MFZ A;  1N2D C;  1KZU B;  4GOE A;  3L71 E;  4HJG H;  4D6T E;  3Q1M A;  2K9Y A;  2E5T A;  2FFD A;  1VDF A;  4Y28 J;  3M9B A;  3EFF K;  1VQ5 P;  4N3Y B;  1NU1 J;  1NWQ A;  1H8A A;  2B89 A;  2LR2 A;  3WMM 0;  4EYY Q;  3D6Y A;  1M1J B;  1OZH A;  5CCH C;  1YJW P;  1NHL A;  1FOS E;  3SFD C;  2XU6 A;  3MUD A;  1PGQ A;  1Z56 A;  4JYC A;  3A0H E;  3G6E P;  2GUV A;  1H89 A;  1NTM K;  2M3B A;  1Q7Y Q;  2HYN A;  2FXP A;  3AE2 C;  5CBN A;  5GTH H;  2OTK E;  4DZO A;  4JPZ B;  4U7J A;  1S72 P;  3VP9 A;  1URQ B;  2KS1 B;  1RQU A;  1S5L E;  2E75 C;  3Q5R A;  1QL1 A;  1JY2 N;  2D2C D;  2R44 A;  2YXQ B;  4GIF A;  5AW5 B;  1RF0 C;  2IYO A;  1EZV I;  3CI9 A;  4R4M A;  2W6J H;  3PLN A;  5APV A;  5AW2 B;  2IZ0 A;  3L71 D;  5APU A;  1RE3 A;  2HFE D;  1KFN A;  3L36 A;  4YXD C;  1RF0 A;  2BCC G;  1BGY E;  1SQP J;  3PH0 A;  4L74 A;  4N78 D;  4NPE A;  3RK2 C;  2OQQ A;  2V7Q H;  2ZFC A;  3JC2 2;  3RK3 E;  1FZF A;  4Y99 C;  1BCC D;  3H32 A;  1GK6 A;  1KYO H;  3IN6 A;  5E79 H;  2QM8 A;  1NO4 A;  2Q6Q A;  1NTZ E;  2A45 I;  2GA1 A;  2K3R A;  2ZJS E;  2FY8 A;  1HGZ A;  4GOF A;  2FBW C;  2NPS B;  1FZC C;  3D70 A;  4K35 A;  1KV4 A;  5C39 A;  2JJL A;  2O1J A;  2P10 A;  3H1K D;  2Y0D A;  1HH0 A;  2QJY B;  2UWJ E;  3IFM A;  3MD0 A;  3CC4 P;  1M1J A;  2E75 D;  4IFD K;  1SQQ D;  5GTI E;  3C9I A;  2IBZ I;  3H1H G;  4B86 A;  2P2U A;  1SQP E;  5APX A;  2VRS A;  3H1H E;  1G2C B;  2XKM A;  4BRY B;  2GM4 A;  3RGU A;  1FZC A;  1LT9 C;  1JTH B;  1KB9 D;  1GL2 B;  1LTJ A;  1NTM E;  1U7J A;  1KQL A;  1SQB J;  2P1J A;  2XDJ A;  3EQ2 A;  1JCC A;  2GUS A;  3RK3 D;  2IFN A;  1EXJ A;  1MZ9 A;  3G9R A;  3HE5 B;  3VMY A;  1RHZ B;  5AVS B;  5CCH D;  3P8C D;  4O9B A;  3WU2 E;  2RMZ A;  3HE4 B;  3O6Q B;  2YO2 A;  1ZME C;  4W7Y A;  5BU8 B;  3LID A;  2OYH C;  1BSH A;  2NZ2 A;  3L72 D;  3P7K A;  1L0L D;  1NU1 K;  4UB6 E;  2BEQ D;  2ZAE B;  3F89 A;  5CHX A;  4DCK A;  2HOD B;  3M0D A;  4U3F J;  5KJ7 A;  1G2C A;  3U1A A;  1OVU A;  1FU1 A;  1SQB E;  3CWB G;  3F5H A;  2PP6 A;  4K3A A;  3T97 A;  3W67 A;  1NTM J;  4RO0 A;  2L5G B;  5AW0 B;  5B66 H;  1S2E A;  2BEZ F;  1VQP P;  2KB7 P;  2WVR A;  1SQV G;  1GMJ A;  2AXT E;  3B8E B;  3BCC D;  1T8Z A;  1LTA C;  4D6T J;  2M0B A;  4PD4 I;  3E7K A;  5APQ A;  3WUU A;  4RJT A;  1T2K D;  1QVG O;  1BDD A;  1SQP G;  1NTM G;  2AEJ A;  2PAJ A;  4WVZ A;  1URQ D;  5AVU B;  3AED C;  4H0L C;  4PV1 B;  3RK3 B;  2LXC B;  2WSS H;  2NRG A;  5AVQ B;  4Y99 B;  4OVN F;  5KAI H;  4ASV A;  1WT6 A;  1W2B O;  1NU1 D;  1HGV A;  4BXL A;  1Y8A A;  2C0W A;  1X79 B;  1UIX A;  3MGN A;  1FJP A;  2P7J A;  1JTH A;  1LTB C;  1LTJ B;  3B4S A;  1QEX A;  2W90 A;  1LT9 A;  3H1L E;  1R5L A;  3CXH E;  1SQV K;  3PTZ A;  3ITK A;  4H13 C;  4HB1 A;  4WWI A;  5KTB A;  1NTZ G;  4EI2 A;  1SQQ G;  2BAS A;  5AVV B;  1GU4 A;  4WY4 A;  3LIE A;  3H1K G;  1NU1 G;  1X0T A;  3M06 A;  1VF5 D;  1VQ8 P;  2OTL P;  1OIP A;  3EFG A;  2FXM A;  1QLE D;  5CJ0 A;  1YJN P;  1YQ3 C;  1W5C E;  2FYU J;  2YO3 A;  3KXD A;  3CCE P;  1YBK A;  4WY4 D;  2A06 E;  3LW5 J;  3AEG C;  1U57 A;  2B87 A;  2N9Y B;  4Z1M H;  4NPD A;  1URQ C;  1X8Y A;  1NOH A;  1LP1 A;  1SQQ K;  1SQV D;  1NTZ K;  1K05 A;  5DJT B;  2HLO A;  3NFQ A;  2KI7 B;  4I6M C;  3VMZ A;  2FFD B;  1ZRT D;  2K1A A;  3Q5P A;  3CWB D;  3L70 J;  1OW6 A;  1OXZ A;  2LKM A;  2PRR A;  3GLM A;  1IFI A;  2BCC J;  3QH9 A;  2PFX A;  1SVF A;  3TGU E;  2OTJ P;  2H89 C;  1URQ A;  2FYZ A;  4XFJ A;  1KB9 H;  1GTW A;  4C7N B;  3HTK A;  2B87 B;  1QX8 A;  3CLQ A;  3V6I A;  2P67 A;  2P58 A;  2YNY A;  1CSB A;  3H1I E;  4JBZ A;  2C9L Y;  3A3Y B;  1L4A C;  5AVY B;  2ITA A;  1SP4 A;  2O01 H;  2QRX A;  3L70 G;  3V5B A;  4ZKP A;  2DW3 A;  1BE3 E;  3KDP B;  3L70 E;  2KNC A;  3WUV A;  3V2R A;  1AV1 A;  1Q2N A;  2D2C B;  3MTU E;  4L73 A;  3T97 B;  2A45 H;  4H44 D;  5CCG A;  4ZNC A;  1K9M Q;  4QMA A;  3HD7 A;  1J1D B;  2I8D A;  3H1L D;  2IDB A;  1AA0 A;  2WSC J;  1CI6 A;  1FC2 C;  1S5L H;  1DEE G;  1JUN A;  1LTJ C;  3CXH I;  3HE4 A;  1NKZ B;  1L2P A;  1MV8 A;  1NTZ J;  1FZA A;  1T3J A;  3L72 J;  5CCH A;  3CPW O;  5APS A;  4DT0 A;  3H1J G;  3USS A;  1ZR4 A;  1EDL A;  5KAF H;  1VF5 B;  1EDI A;  2H8P D;  1L4A D;  3D6Z A;  1DH3 A;  1EC5 A;  4GKG A;  1Q81 Q;  1BGY J;  1NTM D;  1BSN A;  3VP8 A;  2WSE H;  2KXP B;  2E43 A;  1YQ4 C;  1SQX J;  2A06 D;  3H1J D;  2IBZ E;  1HBW A;  1FZC B;  1IZN B;  4D6T D;  1JMM A;  3L35 A;  2W27 A;  1VPC A;  2HPC A;  1KQF B;  2HPC B;  1IO4 A;  3A2A A;  4LLH A;  1PPJ E;  1SQV E;  2E74 B;  2WSF H;  2YMK A;  2O01 N;  1PL5 A;  3IF4 A;  4RKU J;  1NTK D;  2RN0 A;  3CCV P;  1HTL C;  1SFC C;  2NPS A;  3H1H D;  4PV1 D;  3CCM P;  2HG5 D;  2KZJ A;  5AVT B;  3S1K A;  2M3E A;  3RK2 B;  1H0T B;  1LTI C;  4ZMD A;  3CMA P;  1IFJ A;  3HUS A;  2OYI B;  1DIP A;  1IFN A;  4KJM A;  2K9J B;  2WMM A;  2BCC E;  2Y0C A;  3AE6 C;  4GOD A;  1FDM A;  3RBZ A;  1KTM A;  5BVZ A;  1M1K Q;  3L71 J;  1JY3 N;  1CI6 B;  3GG2 A;  4C46 A;  5CMZ A;  2J5U A;  4H13 B;  2IZ1 A;  3MUD C;  3CX5 D;  1RY3 A;  2ZYD A;  3Q5S A;  2IBZ G;  5KKZ B;  3OJA B;  3M0A A;  5AW6 B;  2FYU K;  4HKZ H;  1L0N J;  3AEB C;  2Z5H A;  2ZYA A;  2QJP C;  3H1I D;  3JCU E;  1KYO D;  2N9B A;  2ZT9 B;  2J59 M;  2FYU E;  3B5N B;  2O1K A;  3W68 A;  3L72 G;  1AQ5 A;  1X9V A;  1PGP A;  1KB9 I;  1L0L E;  3H1K J;  1DEB A;  2KUB A;  2O01 J;  4I7Z C;  5B5E E;  2QA4 P;  1FOS F;  3AE4 C;  3A7O A;  2QG4 A;  2WSE J;  1OFC X;  5AW9 B;  1J1E C;  2B9B A;  1N7S B;  3H32 B;  1USD A;  4I1L A;  2BCC D;  4HH2 A;  1D7M A;  2R3C A;  5M1B A;  5CBO A;  1OWA A;  5KJ7 C;  1T2K C;  3PJS K;  3L71 G;  4ASW A;  2N1T D;  3NXS A;  2YIU B;  3VTP C;  2QM7 A;  1PIX A;  1M90 Q;  2M5A A;  1J2J B;  2WSF J;  1FS0 E;  3MP7 B;  3FXE A;  1HJ0 A;  1NVO A;  3CC2 P;  3HUS C;  3PRJ A;  1LTS C;  4C7R A;  2E74 C;  2CK3 H;  1SQQ E;  1SQX K;  2ZVN B;  3ABV C;  3KHU A;  1N73 C;  3OAK A;  2WTY A;  5AVZ B;  2XND H;  1GZL A;  1SFC B;  1PP9 J;  2E75 B;  2KZI A;  2R32 A;  1W2E A;  1KIL C;  1P84 I;  1VL2 A;  2IX7 C;  3B71 A;  1G1I A;  2IFM A;  5KLI C;  1GDT A;  1DX7 A;  3RK3 C;  2QJY C;  5TJH A;  5KKZ C;  1RE4 A;  1FDO A;  2WPV B;  3V2Q A;  1YTZ I;  4U3F G;  2AEF A;  3BCC J;  4U3F E;  5APW A;  1LT9 B;  1J1D C;  3L75 G;  1K73 Q;  3KZI H;  2YKP A;  3JCU H;  3R2P A;  2W8Z A;  1JCD A;  3H1J E;  1SQX D;  3H1J J;  2IBZ D;  1K8A Q;  2Y9Z A;  4UB8 H;  1PZQ A;  2G8Y A;  1EDJ A;  1L0N G;  2W83 C;  3LW5 H;  3FXD A;  1HUC A;  1WMK A;  3H25 A;  2JKV A;  1SQB G;  2H88 C;  1PPJ D;  2QJK C;  4DJG A;  3L74 E;  3H6P A;  3KQG A;  3ZDM A;  4LGD E;  2WZ7 A;  2KSE A;  3H1H J;  3TDK A;  1VQ6 P;  3AEA C;  1PPJ G;  1J1E B;  1KIL E;  1BE3 G;  1N86 A;  2XNX A;  3L73 J;  1PP9 E;  3L75 J;  2WIT A;  1MKM A;  3CCJ P;  1JY3 O;  2Z5I A;  3TNU A;  1KQS O;  4OH8 B;  3R4Y A;  1JMB A;  2FYU D;  3V2N A;  3CX5 I;  3SWK A;  1AVO A;  1NTK K;  1IK9 A; 
#chains in the Genus database with same CATH homology
 3G3Z A;  2H7H A;  1T3U A;  3PP5 A;  1PFI A;  3NMD A;  1JY2 O;  4XE5 B;  3B5N D;  3VN0 A;  4M3L A;  2ZXE B;  3VYI A;  1ZV8 A;  2WPS A;  3OA7 A;  1KIL B;  1L0L K;  1N7S D;  1AFO A;  1L0N K;  2E42 A;  4W80 A;  2I1J A;  3HTK B;  1RF1 B;  1MUU A;  1SFC D;  2WSC H;  2KLV A;  1JOC A;  3BVH A;  1A02 F;  1E5W A;  2W6A A;  5AW3 B;  5AW7 B;  2KSJ A;  4I2L C;  2POH A;  4N78 E;  1N7S A;  4DOJ A;  2FFD C;  2FKW B;  3B5N A;  4GT1 A;  3IR9 A;  3RL0 C;  1IJD B;  2WPR A;  2WT7 B;  4EOT A;  1NAF A;  3GHG A;  5AVR B;  3KPE A;  2J58 A;  3U1C A;  5KLV K;  3O8Z A;  2Q3I A;  1FZB A;  1KIL D;  2YKQ A;  2YKO A;  4KHX A;  4WB4 A;  1SQB K;  5CCG C;  2N1T A;  1S9K E;  1GL2 D;  4IFF A;  5AW8 B;  1FBM A;  2OYH A;  2XV5 A;  1JO5 A;  1L4A B;  2WPQ A;  4XA4 A;  2N1T C;  1RF1 C;  4RES B;  1CZQ A;  3P8C E;  4LC1 A;  1LWU C;  1LTG C;  5AW1 B;  2XZR A;  2WWW A;  3BRT B;  4WY4 C;  4AUW A;  1RE4 C;  4WBA A;  2OYH B;  3N7N A;  3N4X A;  4JF7 A;  1XTC C;  1GL2 A;  2Q9I A;  2C0X A;  2R5D A;  3RL0 B;  3NTN A;  3HD7 D;  3RL0 D;  1IC2 A;  2H43 A;  1H88 A;  3M0D C;  3L37 A;  2KOG A;  3P8M C;  2M8R A;  3TK1 A;  2WT7 A;  1GK4 A;  1S9K D;  1G1J A;  2MJZ A;  1LWU B;  2CPB A;  3BRV B;  1L4A A;  4ZKU A;  3CL3 D;  1N7L A;  3M9H A;  3U59 A;  3VMX A;  1GW3 A;  5BU5 A;  1N7S C;  2N1T B;  5AVX B;  2KP8 A;  2JEE A;  1HWT C;  1IFD A;  1EQ7 A;  1SFC A;  3B5N C;  3HD7 C;  1SLQ A;  2R5B A;  3L4F A;  3TYY A;  3GHG B;  5APT A;  4WY4 B;  1LGH B;  3TSI A;  1GDT A;  3BAS A;  1GD2 E;  4C7N A;  4AYC A;  3SWF A;  4N6J A;  1LTT C;  3P32 A;  4JYB A;  1RE3 C;  2YMY A;  5APY A;  2Z4E A;  2IPP A;  1FJK A;  1HVV A;  3E1I A;  3HUS B;  2OYI A;  3UIA A;  1ZLL A;  1N73 B;  1HJB A;  1FZE A;  1NKN A;  3II6 A;  2OAR A;  4EIJ A;  3TNU B;  3RK2 D;  1LWU A;  1ZN5 A;  3M91 A;  3A5T A;  1ZR2 A;  1M1J C;  1JY2 P;  1RF1 A;  2C9N Y;  1FZG A;  1WRG A;  1XTG B;  2I1K A;  3V4W A;  1KIL A;  1QL2 A;  1GL2 C;  1KFM A;  3VOP A;  3GHG C;  5CCG D;  2A45 G;  5AW4 B;  3I5C A;  5CJ4 A;  3MIW A;  1JNM A;  2CPS A;  1SQP K;  1NH4 A;  1YYC A;  2Q5U A;  3V4Q A;  1GU5 A;  4HYT B;  3SWY A;  3HD7 B;  1FAV A;  2Q7C A;  5AVW B;  1YTZ T;  1GW4 A;  4IFM A;  2KYV A;  3BAT A;  1M7L A;  2HOD A;  2NPS C;  3KYQ A;  1JY3 P;  3V2P A;  1FJP A;  5KJ7 D;  4AQR D;  1N73 A;  2OYI C;  2NPS D;  4W7Z A;  2W6B A;  3HRN A;  1IFM A;  3HE5 A;  3M9Q A;  1MFZ A;  1N2D C;  1KZU B;  2FFD A;  1VDF A;  3M9B A;  4N3Y B;  1NWQ A;  1H8A A;  3WMM 0;  1M1J B;  5CCH C;  1NHL A;  1FOS E;  2XU6 A;  3MUD A;  4JYC A;  1Z56 A;  1H89 A;  2GUV A;  1NTM K;  2M3B A;  2HYN A;  4DZO A;  3VP9 A;  1URQ B;  1QL1 A;  1JY2 N;  4GIF A;  5AW5 B;  1RF0 C;  5APV A;  3CI9 A;  5AW2 B;  1A02 J;  5APU A;  1RE3 A;  2HFE D;  1KFN A;  3L36 A;  1RF0 A;  4N78 D;  3RK2 C;  1FZF A;  2ZFC A;  4Y99 C;  3H32 A;  1GK6 A;  2QM8 A;  1NO4 A;  2A45 I;  1HGZ A;  2NPS B;  1FZC C;  2JJL A;  2O1J A;  3MD0 A;  3IFM A;  1HH0 A;  4IFD K;  1M1J A;  3C9I A;  4B86 A;  2P2U A;  5APX A;  2VRS A;  1G2C B;  2XKM A;  2GM4 A;  1FZC A;  1LT9 C;  1JTH B;  1LTJ A;  1GL2 B;  2P1J A;  1KQL A;  2XDJ A;  3EQ2 A;  1JCC A;  2GUS A;  3RK3 D;  2IFN A;  1MZ9 A;  3HE5 B;  3VMY A;  5AVS B;  5CCH D;  3P8C D;  4O9B A;  3HE4 B;  2YO2 A;  4W7Y A;  5BU8 B;  3LID A;  2OYH C;  3P7K A;  1NU1 K;  5CHX A;  2HOD B;  3M0D A;  5KJ7 A;  1G2C A;  3U1A A;  3T97 A;  1FU1 A;  2PP6 A;  2L5G B;  5AW0 B;  2KB7 P;  3B8E B;  1T8Z A;  1LTA C;  1T2K D;  5APQ A;  2PAJ A;  1URQ D;  5AVU B;  3RK3 B;  5AVQ B;  4Y99 B;  1WT6 A;  1HGV A;  3MGN A;  2C0W A;  1X79 B;  2P7J A;  1JTH A;  1LTB C;  1LTJ B;  1FZC B;  1LT9 A;  1SQV K;  5KTB A;  2BAS A;  5AVV B;  1GU4 A;  4WY4 A;  3LIE A;  3M06 A;  3EFG A;  2FXM A;  5CJ0 A;  2YO3 A;  4WY4 D;  1URQ C;  1X8Y A;  1NOH A;  1SQQ K;  1NTZ K;  2HLO A;  3NFQ A;  4I6M C;  2FFD B;  3VMZ A;  1OXZ A;  2LKM A;  1IFI A;  1SVF A;  1URQ A;  2FYZ A;  1GTW A;  4C7N B;  3HTK A;  3CLQ A;  2P67 A;  2YNY A;  1CSB A;  2C9L Y;  3A3Y B;  1L4A C;  5AVY B;  1SP4 A;  2O01 H;  3V5B A;  4ZKP A;  3KDP B;  3V2R A;  3MTU E;  2A45 H;  5CCG A;  3HD7 A;  1J1D B;  1CI6 A;  1JUN A;  1LTJ C;  3HE4 A;  1NKZ B;  1MV8 A;  5CCH A;  1FZA A;  1T3J A;  5APS A;  2H8P D;  1L4A D;  1DH3 A;  4GKG A;  3VP8 A;  2WSE H;  2E43 A;  1HBW A;  1JMM A;  3L35 A;  2W27 A;  1VPC A;  2HPC A;  2HPC B;  1IO4 A;  3A2A A;  4LLH A;  2WSF H;  1HTL C;  1SFC C;  2NPS A;  2HG5 D;  5AVT B;  3RK2 B;  1LTI C;  1IFJ A;  3HUS A;  2OYI B;  1IFN A;  1FDM A;  5BVZ A;  1JY3 N;  1CI6 B;  4C46 A;  5CMZ A;  1RY3 A;  3OJA B;  3M0A A;  5AW6 B;  2FYU K;  2Z5H A;  2N9B A;  3B5N B;  2J59 M;  2O1K A;  1AQ5 A;  1X9V A;  1DEB A;  1FOS F;  3A7O A;  5AW9 B;  1J1E C;  1N7S B;  3H32 B;  4I1L A;  1T2K C;  4HH2 A;  2R3C A;  1OWA A;  5KJ7 C;  2N1T D;  3NXS A;  3VTP C;  2QM7 A;  1J2J B;  3HUS C;  1LTS C;  4C7R A;  1N73 C;  1SQX K;  3OAK A;  2WTY A;  5AVZ B;  1GZL A;  1SFC B;  2R32 A;  1KIL C;  1W2E A;  2IX7 C;  1DX7 A;  1G1I A;  2IFM A;  3RK3 C;  1RE4 A;  3V2Q A;  1YTZ I;  5APW A;  1LT9 B;  1J1D C;  2YKP A;  3R2P A;  1JCD A;  3LW5 H;  1HUC A;  3H6P A;  3KQG A;  4LGD E;  2WZ7 A;  1J1E B;  1N86 A;  2XNX A;  1CW5 A;  2WIT A;  1JY3 O;  2Z5I A;  3TNU A;  4OH8 B;  3V2N A;  1ZR4 A;  1NTK K;  1IK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...