1GK4A

Human vimentin coil 2b fragment (cys2)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
79
structure length
79
Chain Sequence
CEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Vimentin
molecule keywords VIMENTIN
publication title Conserved Segments 1A and 2B of the Intermediate Filament Dimer: Their Atomic Structures and Role in Filament Assembly.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 79
sequence length 79
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2001-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gk4A00
4I6MC 4RESB 3L36A 2R5BA 1S9KD 5AVZB 2WT7A 3MD0A 1S9KE 5AVQB 4HYTB 2WPSA 5APVA 3LIEA 1X8YA 3NXSA 3T97A 2IPPA 2YO3A 1FAVA 3I5CA 2ZFCA 4M3LA 5AVVB 1GK4A 2XV5A 2YO2A 3P32A 1DH3A 1CI6B 3V4WA 2WPQA 5AVUB 1HUCA 2YNYA 3L35A 2QM7A 1T2KC 5AVTB 1A02F 2WWWA 3HE5A 3NTNA 3A5TA 1SLQA 5AW7B 5AW2B 2R5DA 2XZRA 5AW5B 3M91A 4AQRD 3TNUB 1JNMA 2WT7B 3NMDA 2P7JA 5AW4B 5APUA 3M9HA 1MFZA 1OWAA 4JYCA 2Z5HA 2H7HA 2E43A 3HE4B 1HBWA 5AVSB 5AVXB 2VRSA 1GU5A 4LC1A 1YYCA 3IR9A 2WTYA 1H8AA 1GK6A 1JUNA 3VN0A 5APYA 2R32A 1CZQA 4C46A 5APSA 1GD2E 3A2AA 3HE5B 2P67A 4GT1A 1FOSF 3M0AA 1J2JB 1H89A 3VTPC 1SP4A 2ZXEB 4AYCA 3M0DA 3VMZA 2C9LY 4KHXA 5APTA 4AUWA 3KDPB 2R3CA 2KP8A 2Q5UA 3VMYA 2P2UA 2N9BA 1CSBA 4C7NA 3V4QA 4EOTA 5AVYB 3OAKA 2Q7CA 5AW0B 3M9BA 3HTKA 1HJBA 1HWTC 1MUUA 1KQLA 1GZLA 4XE5B 5CMZA 3VYIA 4DZOA 5AVWB 3TYYA 3P7KA 1NWQA 1FOSE 5AW6B 2BASA 1GU4A 3TK1A 2E42A 5APXA 5AW3B 2JJLA 2WPRA 3TNUA 3V5BA 5APWA 3A3YB 4B86A 1T2KD 1MV8A 4GKGA 3VMXA 1G2CB 2Q3IA 1IO4A 5APQA 3SWFA 3A7OA 3B8EB 3NFQA 2W27A 3LIDA 3L37A 2C9NY 1A02J 3HE4A 2W6AA 3M06A 3MGNA 4C7NB 1H88A 2XU6A 3O8ZA 4I2LC 5AW1B 3P8MC 4JYBA 1CI6A 1OXZA 1GTWA 1NAFA 2Z5IA 5AW8B 5AVRB 3UIAA 2QM8A 5AW9B 3KQGA
chains in the Genus database with same CATH superfamily
1RE4C 5KKZB 1RF1B 1OW6A 1PV3A 4W80A 3AEGC 1Q2NA 2J59M 1VQNP 4TLFA 1H0TB 1GK4A 2AEMA 1X9VA 2ZVOB 3CXHE 3EFGA 1NTZG 1BE3G 2N1TD 5CCGC 2I1JA 1AFOA 1DEBA 1QX8A 4GIFA 3H1JE 2RH0A 3CXHH 3MP7B 1KD1Q 3VP9A 4K3AA 1HBWA 4WY4B 2M8RA 3IR9A 1H8AA 5KTBA 2O3JA 4OGQB 3IN6A 3CCRP 2NPSB 1M1KQ 3CI9A 2IFNA 4Y99C 2QIWA 1UIXA 2G3AA 2IDBA 1M90Q 1DD4A 2LR2A 1SQVE 5KAIH 5CCHA 3O6QA 2J5UA 2Q7CA 2KI7B 1KQLA 3CL3D 3H32B 2E75D 4CPGA 1PIXA 1NTZK 2WQYC 2POHA 1L0NE 2O01J 3G71P 1EDJA 2JO1A 1YJWP 2KNCA 1EQ7A 1BDDA 3GW6A 3Q5PA 3KHUA 4GOFA 1URQA 1H88A 1SQVG 1YJNP 1SQXJ 4PV1D 3BATA 3R4YA 2YXRB 1N7SC 5TISH 3CPWO 2JP3A 1DIPA 3LIEA 4EYYQ 1M8OB 5AVVB 2GM4A 1KZUB 1VDFA 2WPQA 1VQ6P 5AVUB 4H0LD 2OGUA 4YXDC 3AECC 3CWBJ 1KTMA 1SQXD 1M1JB 1ZN5A 3TNUB 4I1LA 3AE4C 1J1EC 1EXJA 3L74G 3CMAP 4JYCA 2KSEA 1AV1A 1SQVK 3A2AA 1OMIA 4U3FG 4EI2A 3CWBD 2E76D 3KDPB 3G6EP 1Y9BA 1KILC 2PRRA 5DJTB 1JY2N 2WSCJ 1D7MA 1YBKA 3RK2B 2ZT9D 3PJSK 3GHGC 4ZKPA 5AW3B 1T2KD 4B86A 3CCUP 3CMEP 1OVUA 4I7ZB 2O1KA 2KXPB 2N1TA 3AEEC 3BRVB 1N7LA 4JYBA 3H1HD 2HFED 3GMAA 1LT9C 1IK7A 1SFCC 2HYNA 2OARA 3S9OA 2BEQD 3O6QB 1GW3A 1HGVA 4N6JA 5AVTB 1A02F 2WWWA 1SQQD 4UB8E 3PHLA 5BVZA 4OH8B 3PH0A 4LLHA 3B5ND 1SQXE 2XZRA 1HVVA 3M91A 1RY3A 1Q81Q 3Q3DA 2FFDA 4W7ZA 3FGAD 3EFFK 3HUSA 1URQB 3D70A 5KJ7A 2D2CB 1T6AA 1L4AD 1H89A 2FYUJ 3VMAA 3PLNA 1ZP0C 3M0DA 3CWBE 3L72J 2DW3A 2K9JB 5AVYB 1PPJD 1NGMB 1IFNA 2IYPA 5BU8B 3TK1A 2E42A 1RQUA 1GL2B 1T3JA 1U7JA 2AXTE 2J58A 3AE5C 1OVVA 2FYUD 2QJPB 3PRJA 4C7NB 3L72D 3CC4P 1CI6A 1VF5B 5AW8B 1PGQA 2V7QJ 4OVNF 1AJYA 3JCUH 3H1HE 5KKZC 5CJ0A 1RF1C 4OWFA 4C7RA 1X8YA 3WUTA 3A0BE 1EZVG 2MJZA 3CX5D 1VQ9P 1K9MQ 3HE5A 3CCEP 1BGYG 1SQQE 3A0BH 1JM0A 2QA4P 1JTHA 4WWIA 3BCCD 2N1TB 4WY4C 1JMMA 3VN0A 3LW5H 4U7JA 4HKZH 1KB9I 1NTKG 2KZIA 1SQQG 4JBZA 2N9BA 2ZJSE 3AE3C 1USDA 5GTIE 2KLUA 1GZLA 5CMZA 1Q82Q 2IYOA 1TU3F 2IFMA 2WPVB 1RHZB 3H1IG 1M57D 1HTLC 2WMMA 2B87A 3L37A 3OJAB 2FXMA 2FYUE 2FFDB 3O8ZA 2E75B 1H0TA 3L72E 4XA4A 1GTWA 1M7LA 1PPJG 4L75A 2FBWC 3KQGA 1Q86Q 3MHVA 5CHXA 2E74B 2P58A 1NTKK 5B66E 4RKUJ 1P84I 1SQQK 4EDFA 4DT0A 1WRGA 4WY4A 2XV5A 4PV1B 2NPSA 3V6IA 1SLQA 1G2CA 3VOPA 5B66H 1JNMA 2WT7B 3CX5H 3BCCE 2E43A 4H0LB 3H32A 2IZ0A 4PD4I 1RF0A 2ZYAA 5APSA 1FZFA 4ASWA 2C0WA 3L70J 4TT3H 5KLVJ 2Q5UA 3L73G 2JR8A 2Z4EA 3BCCG 3RK2C 3N4XA 4HB1A 1SQPG 2E76B 2OQQA 2R44A 5APWA 4A7PA 2W6JH 2SPZA 4GKGA 5CCGD 3SWFA 2NRGA 3Q5RA 2KOGA 1JTHB 2KK7A 3L70D 5KLVD 2ZT9B 1OXZA 1N2DC 2XDJA 4NPFX 1Y47A 2ITAA 1BSNA 1JB0J 3G9RA 2K9YA 2KS1A 1M1JA 3TGUJ 1QLED 2IBZD 4WB4A 1PZQA 1S5LH 4Z1MH 3FXEA 1Y8AA 1GDTA 5KAFH 1N86A 3CLQA 1SQPK 2BCCJ 2W6BA 2JWAA 3TGUD 1YTZI 4XFJA 1SQBD 2B87B 3TSIA 1URQC 3JSVC 2L5GB 1JUNA 3L75G 3B5NB 1GD2E 1KORA 1NU1G 3FXDA 2WSEJ 1AVYA 2CK3H 4PJ0E 4H44C 1EDKA 3V2NA 1LJ2A 1N7SD 3WU2E 3VMYA 2QG4A 1ZXGA 2ZYGA 1KV4A 3E1RA 4PJ0H 1L4AB 1ZMEC 5AW6B 3G4SP 2WSSH 1U57A 3L71J 1G2CB 1VPCA 5K5GB 2QJPC 2Y0EA 3MGNA 2QVAA 3H1JG 2C0XA 4I2LC 1VF5C 3L70E 5KLVE 1QEXA 5M1BA 2LKMA 3U1AA 2W90A 3BASA 1S72P 3IAOA 1NYHA 1EXIA 1NU1K 2IBZE 3BVHA 1LTTC 2N9YB 4HYTB 3AE2C 3L71D 1IK9A 1FAVA 4O9BA 2RKLA 1IFIA 3HD7A 3AEAC 2OYHB 1KILD 1AQTA 3CCSP 1HUCA 1R5SA 4K35A 1S5LX 4DJGA 1Z56A 1EC5A 1L0LJ 2H88C 2P7JA 5AW4B 2K9JA 3TGUE 1L0NG 2P10A 2N1TC 2QJYB 1SQBE 3F89A 3C8VA 2VRSA 1YYCA 1KFMA 3MTUE 5APYA 3RK3C 1HF9A 1GL2A 3RBZA 1VL2A 3RBXA 2KS1B 1NKNA 1SP4A 5CBNA 3FWNA 1CSBA 3USSA 4C7NA 5L8RJ 4EOTA 1SFCD 1SQBG 2PAJA 1PFIA 1ZR4A 1JY3N 1EDLA 3V5BA 3H1KJ 1JO5A 2FFDC 1L0NK 3HUSC 2YKQA 3QH9A 3K5BA 5KJ7C 3UIAA 1LTGC 3Q2YA 2QRXA 1VQLP 3ITKA 2KZJA 3Q1MA 1R8EA 3M0DC 2E74C 1BGYJ 1LTJA 3RL0D 3H1KD 3L71E 1K05A 4M3LA 1KILE 2A45H 3KPEA 3L35A 3IFMA 1SQBK 3NTNA 4HJGH 1PGPA 2A45G 4IFMA 1W2EA 2B89A 1NTKJ 1FZAA 4H0LC 4IFFA 2A06D 1NTMJ 3QWOC 2FYNC 1EZVI 4C46A 4L74A 4D6TJ 1OW7A 1J2JB 1T8ZA 1FZCA 2HG5D 3VMZA 2O01H 2KP8A 3H1IJ 4RJTA 1L0LE 3G3ZA 1OFCX 1VQ4P 3V2RA 2OTJP 3HD7B 2B9BA 4UB8H 3TYYA 1FZBA 2CPSA 4ZKUA 5APXA 2YIUB 5CJ4A 1X22A 1IJDB 1LP1B 1Q90D 1YQ4C 1SS1A 4D6TD 1YI2P 1FJKA 1SQXG 3M06A 2PGDA 2FXOA 5AW1B 3P8MC 1MKMA 3H1LJ 2O01N 1FS0E 5AVWB 3L36A 1HGZA 2WT7A 5AVQB 4H13D 1PP9J 3H1KE 3CWBG 1LTAC 2YXQB 2QJKC 2MKVA 3D6YA 3MIWA 2AXTH 3H1LD 3EQ2A 3A0HE 3SSUA 3V2PA 3CC2P 1PGOA 1SQXK 4BXLA 2A06E 2WSCH 2Q1KA 3A0HH 3JC22 1BCCJ 4KHXA 1KB9D 1SQPJ 1AQ5A 3H1HG 1GW4A 1ZOYC 1LTJB 2OYOA 3CCQP 3E1IA 3HRNA 4OGQC 1L4AC 2NPSC 3GLMA 2A06G 4N78D 5E79E 5CBOA 3A7OA 1BCCD 3CX5I 3CCVP 1RE3A 4D6TE 1FDMA 2K1AA 1FBMA 3AEFC 2XU6A 4JF7A 5E79H 2RMZA 2Z5IA 4L76A 3U1CA 4MN4C 5AW9B 1RF0C 1L2PA 2I1KA 1WMKA 2HR3A 1KYOD 2R5BA 1S9KD 1LWUA 5KLIB 1FZCB 1MFTA 1J1EB 1VQ5P 5GTIH 1RH5B 3B4SA 2V4HA 2WSFH 3B5NA 2KIKA 1QVFO 1IFDA 4Y28J 4DOJA 1NTZJ 3H1LE 1BE3J 2R5DA 1PGJA 1NU1J 3M9HA 2QJYC 1QGKB 1XTCC 2PP6A 1G1IA 4YXWH 4EIJA 1MZ9A 1PP9E 4LC1A 2IZ1A 1GK6A 2FYUG 1L4AA 3AEBC 3L72G 2KB7P 3GHGB 1Q7YQ 3GF7A 1M1JC 4PD4D 4NPEA 1KB9E 1NTZD 1BE3D 2Y9ZA 3V4QA 3OAKA 5GTHE 1LTSC 4DCKA 5CCHD 3SWYA 3H1JJ 2V7QH 4N78E 2E5YA 2JJLA 1ZR2A 1HJ0A 3C9IA 1OVRA 1LT9B 5APQA 1OZHA 1VQKP 3B8EB 1BCCE 2C9NY 1A02J 3E7KA 3WUUA 2LXBA 2OYHA 1YQ3C 3S1KA 3D6ZA 1NAYA 2FYUK 1BSHA 4IOIH 1SQVJ 2RN0A 1DEEG 2H8PD 1U7MA 1KYOE 5AVZB 1S9KE 2IX7C 2WPSA 5APVA 3CXHI 4I7ZC 1OX3A 4H44D 1VQ8P 2ZXXA 4L73A 2ZFCA 2YO2A 1R5LA 1L0NJ 3TF5A 2QM7A 1KYOH 1FC2C 3ZDMA 3A5TA 3PTZA 2OYIA 3RL0B 2QSIA 2P1JA 2FY8A 1NHLA 3F5HA 1NVOA 3AEDC 1FDOA 1YHQP 3L74J 4YPCA 1VF5D 2YMYA 1SVFA 4GT1A 1NH4A 4PD4E 2HPCA 2C9LY 1LWUB 2Q9IA 1NJIQ 1NTZE 1BDCA 1BE3E 4U3FJ 3D71A 2NZ2A 1JOCA 3MUDC 1HWTC 3HD7C 4XE5B 4DZOA 1GMJA 2D2CC 4ZNCA 1GU4A 2YIUC 3L74D 2O1JA 1ZW0A 3S4RA 4WVZA 3LIDA 1J1DB 2BCCD 3H25A 4U3FD 1ZLLA 4BWNA 1RQVA 3I55P 1WT6A 1M56D 1HH0A 1GL2C 3W68A 1LNQA 3WU2H 3KZIE 3RK3D 3CCJP 2JDIH 1N73A 3MD0A 2ZVNB 1ZV8A 2YO3A 1K73Q 1G1JA 5KAIE 1DH3A 3KZIH 3MZWB 2YNYA 2WVRA 5AW7B 2W83C 4H13B 3U59A 2QE7H 2WITA 5APUA 2I8DA 2H7HA 3T97B 5BU5A 3MUDA 4QMAA 2Y0DA 1S3JA 4W7YA 3L70G 5KLVG 1RE4A 5KJ7D 4IFDK 3M0AA 1LP1A 3VTPC 3CD6P 1X0TA 5TISE 4AUWA 2R3CA 2IBZG 1LTJC 4IL6E 2E74D 2ZYDA 5AW0B 1LGHB 1NOHA 2A45I 1NWQA 2B88A 5CCGA 2CPBA 2BASA 2G8YA 3GG2A 3L74E 3CCMP 1VQMP 1YJ9P 3VMXA 4IL6H 2OYIB 2HLOA 2JWDA 1L0LD 3V2QA 4GODA 2BCCE 3TGUG 2KYVA 1N8RQ 4U3FE 5AVRB 2QM8A 1AVOA 1FZGA 2H43A 2H89C 5KLIC 5KLVK 3R2PA 3RK3E 1W5CE 1FZCC 1OW8A 2HPCB 4HH2A 1UIIA 1XTGB 2E75C 2FKWB 2WZ7A 1IC2A 3OA7A 3EWKA 3IF4A 2BCCG 1IFPA 3W67A 1ZRTD 2WSEH 1K04A 3WMM0 2AXCA 2Z5HA 1USEA 1NO4A 2M3BA 3H1HJ 1GU5A 4PV1C 2Q6QA 1N7SA 1EZVD 2ZXEB 1FZEA 1N73B 3HTKA 1SQQJ 1BGYD 3LW5J 3L71G 1EDIA 1FOSE 2W8ZA 1VQOP 4GDOA 1KQGB 3A3YB 1E79H 2GUVA 2Q3IA 4NPDA 1JY3P 3NFQA 4IL6X 2L91A 1QVGO 4WBAA 5H2FE 1JMBA 3CCLP 2K88A 2JKVA 1IFJA 1JY2P 1NTKD 3CC7P 3AE8C 2E76C 1NTMD 1KFNA 4I6MC 1FDIA 3H6PA 1K8AQ 5H2FH 3ABVC 2KNCB 5EFWB 1KILA 1YITP 2WSFJ 3TDKA 1VQPP 2M0BA 2PFXA 2AEFA 3P8CD 2ZT9C 3P32A 1FJPA 3H1ID 3V4WA 1L0LG 4BRYA 4WY4D 3GHGA 1T2KC 4OGQD 2NPSD 5AW2B 1ZRTE 4H44B 3RL0C 1RE3C 2M3EA 2YKPA 5AVSB 1S1CX 1OIPA 3RGUA 3SWKA 1LTBC 2WTYA 2R32A 1CZQA 1W2BO 3GF3A 4Y99B 3C1LA 3AE7C 1LT9A 3JCUE 1EZVE 1LWUC 4RO0A 1SFCA 2P2UA 2OTKE 1X79B 1MUUA 1PP9D 3VYIA 1BGYE 2M5AA 3L73J 5DJUB 3H1KG 3P7KA 3B5NC 3B71A 2LXCB 1L0LK 3PP5A 3BCCJ 2XKMA 2W27A 3HE4A 1J1DC 3BRTB 1VQ7P 1NKZB 1NTKE 4UB6E 3L73D 4KJMA 1NTME 1N7SB 3FWLA 4R4MA 4JQ0D 1SQPD 2GUSA 3P8CE 4UB6H 3HTKB 3H1IE 2YKOA 1IFMA 3RK3B 4H13C 2Q3EA 5AW5B 4AQRD 1NTMG 3NMDA 5TJHA 1OWAA 4GOEA 3WUVA 1PPJE 3FX0A 4D6TG 2OYHC 1P84D 2HODA 1FU1A 1RF1A 2P67A 1FOSF 3RK2D 2UWJE 3L75J 5APTA 4ASVA 1KILB 3I56P 4N3YB 3M9BA 5B5EE 1HJBA 1S2EA 1QL1A 3HUSB 3AE9C 2QEXP 1KYOI 2FYZA 4BRYB 2WPRA 2BEZF 2ZAEB 2OYIC 1IO4A 1LT1A 3VP8A 4R4LA 5B5EH 3H1LG 2W6AA 4KT0J 3L75D 1NTMK 2XNDH 1NU1D 1QL2A 3CX5E 1LTIC 1NAFA 1PP9G 3M9QA 4RESB 3L73E 2FXPA 1KB9H 5C39A 3OW2O 1KN7A 1IZNB 3NXSA 2Y9YA 3KYQA 1SFCB 2KUBA 5GTHH 3T97A 2IPPA 2JEEA 1KQFB 1JEKA 3I5CA 2Y0CA 3CXHD 1KQSO 1SQPE 1S4XA 1CI6B 4ZMDA 1JCCA 2XNXA 1URQD 2FYNB 2M5AB 2KSJA 3HD7D 2D2CD 3L4FA 1E5WA 1FE6A 2GA1A 3H1JD 3SFDC 1MFZA 2E5TA 4JPZB 3HE4B 3AE6C 5AVXB 1BCCG 1AA0A 1KC8Q 1JY3O 1P84E 3HE5B 3N7NA 4LGDE 4AYCA 1KMIZ 1GL2D 1N73C 2K3RA 3II6A 1SQVD 1JY2O 1P84H 3KXDA 1CW5A 2K37A 1YIJP 1PL5A 1DD3A 4YTPC 1YTZT 3RL0g 3Q5SA 1S5LE 1L0ND 2KLVA 1SQBJ 3TNUA 2R3SA 5KAFE 1MV8A 3SFEC 1DX7A 3AE1C 5CCHC 2OTLP 3L75E 1NU1E 2AEJA 2QJKB 1T3UA 2YMKA 1JCDA 2IBZI 2HODB 4PD4H
chains in the Genus database with same CATH topology
1FZGA 1RE4C 1HGZA 3L36A 2H43A 1RF1B 5KLVK 3R2PA 2WT7A 1FZCC 5AVQB 5CHXA 2HPCB 4W80A 1NTKK 4HH2A 2J59M 1SQQK 1XTGB 1WRGA 4WY4A 2FKWB 2WZ7A 1LTAC 1IC2A 1GK4A 2XV5A 1X9VA 3EFGA 3OA7A 2NPSA 2N1TD 3MIWA 5CCGC 1SLQA 2I1JA 1G2CA 2WSEH 3VOPA 3EQ2A 1AFOA 1DEBA 3WMM0 1JNMA 4GIFA 2WT7B 3V2PA 3VP9A 2Z5HA 2E43A 1HBWA 1NO4A 4WY4B 1SQXK 2M3BA 2M8RA 3H32A 1GU5A 3IR9A 1H8AA 2WSCH 5KTBA 2NPSB 1RF0A 3CI9A 2IFNA 5APSA 4Y99C 1N7SA 1FZFA 2C0WA 2ZXEB 1FZEA 4KHXA 1AQ5A 1N73B 2Q5UA 1GW4A 5CCHA 2Q7CA 1LTJB 3HTKA 1KQLA 3CL3D 3H32B 3E1IA 3HRNA 2Z4EA 3RK2C 1L4AC 3N4XA 2NPSC 1FOSE 4N78D 1NTZK 2POHA 5APWA 3A3YB 4GKGA 5CCGD 2GUVA 2Q3IA 1JY3P 3SWFA 3A7OA 1EQ7A 3NFQA 1RE3A 1FDMA 2KOGA 1FBMA 1URQA 4WBAA 1H88A 2XU6A 1JTHB 4JF7A 1OXZA 1IFJA 1N2DC 2Z5IA 2XDJA 3U1CA 1JY2P 5AW9B 1RF0C 3BATA 2I1KA 1KFNA 4I6MC 1M1JA 1N7SC 3H6PA 2R5BA 1S9KD 1LWUA 1FZCB 1J1EB 3LIEA 1KILA 4WB4A 5AVVB 2GM4A 2WSFH 3P8CD 1KZUB 1VDFA 3P32A 1FJPA 3V4WA 2WPQA 3B5NA 5AVUB 4WY4D 3GHGA 1T2KC 1GDTA 1IFDA 1N86A 4DOJA 2NPSD 5AW2B 1M1JB 1ZN5A 3CLQA 2R5DA 3RL0C 1SQPK 3TNUB 2W6BA 4I1LA 1J1EC 1YTZI 3M9HA 1RE3C 4JYCA 1XTCC 2PP6A 2YKPA 3TSIA 1URQC 1G1IA 5AVSB 4EIJA 1MZ9A 1LTBC 4LC1A 2WTYA 1GK6A 2L5GB 1L4AA 1JUNA 1SQVK 2R32A 1CZQA 3B5NB 1GD2E 2KB7P 4Y99B 3GHGB 3A2AA 1M1JC 1LT9A 1LWUC 3V2NA 1N7SD 1SFCA 3KDPB 3VMYA 2P2UA 1KILC 3V4QA 3OAKA 1JY2N 1X79B 1MUUA 1LTSC 3VYIA 5CCHD 3RK2B 1L4AB 3P7KA 3B5NC 3SWYA 5AW6B 4ZKPA 3GHGC 4N78E 1L0LK 5AW3B 2JJLA 3PP5A 1ZR2A 4B86A 3C9IA 1T2KD 1G2CB 1VPCA 1LT9B 2XKMA 5APQA 3B8EB 2O1KA 2W27A 2N1TA 1A02J 2C9NY 3HE4A 1J1DC 3BRVB 3MGNA 1N7LA 2C0XA 4I2LC 2OYHA 4JYBA 3BRTB 2LKMA 3U1AA 1NKZB 3BASA 2FYUK 2HFED 1N7SB 2H8PD 1NU1K 5AVZB 3BVHA 1LTTC 2IX7C 1LT9C 1S9KE 4HYTB 2WPSA 5APVA 1SFCC 2HYNA 2OARA 1IK9A 1FAVA 2ZFCA 4O9BA 1IFIA 1GW3A 3HD7A 2GUSA 1HGVA 2OYHB 2YO2A 1KILD 3P8CE 3HTKB 2YKOA 4N6JA 1HUCA 1IFMA 2QM7A 3RK3B 5AVTB 1A02F 2WWWA 3A5TA 5BVZA 4OH8B 1Z56A 4LLHA 2OYIA 3B5ND 2XZRA 5AW5B 1HVVA 3M91A 1RY3A 3RL0B 4AQRD 3NMDA 2P1JA 2P7JA 5AW4B 2FFDA 1NHLA 1OWAA 2N1TC 4W7ZA 3HUSA 1URQB 2VRSA 2OYHC 1YYCA 5KJ7A 1KFMA 2HODA 3MTUE 5APYA 3RK3C 2YMYA 1GL2A 1FU1A 1RF1A 1SVFA 4GT1A 2P67A 1FOSF 3RK2D 1L4AD 1H89A 1NH4A 1NKNA 1SP4A 2HPCA 3M0DA 2C9LY 1LWUB 5APTA 2Q9IA 1CSBA 4C7NA 4EOTA 1KILB 5AVYB 1IFNA 4N3YB 1JOCA 3M9BA 1SFCD 1HJBA 1HWTC 1QL1A 3HD7C 3HUSB 4XE5B 4DZOA 2PAJA 1PFIA 2FYZA 5BU8B 1ZR4A 1GU4A 3TK1A 2E42A 1GL2B 1T3JA 1JY3N 2WPRA 3V5BA 2J58A 2OYIC 2O1JA 1IO4A 3VP8A 1JO5A 3LIDA 2FFDC 2W6AA 1J1DB 4C7NB 1NTMK 1QL2A 1L0NK 1LTIC 1CI6A 3HUSC 1ZLLA 1NAFA 2YKQA 5AW8B 5KJ7C 3UIAA 1WT6A 1HH0A 1LTGC 3M9QA 1GL2C 4RESB 5CJ0A 1RF1C 3RK3D 1N73A 3MD0A 4C7RA 3M0DC 1X8YA 3NXSA 1LTJA 3KYQA 1SFCB 3RL0D 1ZV8A 3T97A 2IPPA 2YO3A 2JEEA 3I5CA 4M3LA 1G1JA 2MJZA 1DH3A 1CI6B 2A45H 1JCCA 2XNXA 1URQD 2YNYA 3KPEA 3L35A 2KSJA 3HD7D 3IFMA 1SQBK 3HE5A 3NTNA 5AW7B 3L4FA 1E5WA 3U59A 2WITA 2A45G 5APUA 4IFMA 1MFZA 1W2EA 1JTHA 2H7HA 2N1TB 1FZAA 3HE4B 4WY4C 5BU5A 4IFFA 5AVXB 3MUDA 1JMMA 1JY3O 3VN0A 3LW5H 4C46A 4W7YA 1RE4A 3HE5B 3N7NA 4LGDE 5KJ7D 3M0AA 1J2JB 4IFDK 1T8ZA 3VTPC 1FZCA 4AYCA 2HG5D 3VMZA 1GL2D 2O01H 1N73C 4AUWA 3II6A 2R3CA 2KP8A 1JY2O 2N9BA 1LTJC 1CW5A 5AW0B 3G3ZA 1LGHB 1GZLA 1NOHA 5CMZA 3HD7B 3V2RA 2A45I 5AVWB 3TYYA 1FZBA 1NWQA 1YTZT 5CCGA 2CPSA 2CPBA 2BASA 4ZKUA 5APXA 2IFMA 5CJ4A 2KLVA 3TNUA 1IJDB 1MV8A 3VMXA 2OYIB 1HTLC 2HLOA 1FJKA 1DX7A 3L37A 3OJAB 2FXMA 5CCHC 3M06A 2FFDB 3O8ZA 3V2QA 5AW1B 3P8MC 4XA4A 2KYVA 1GTWA 1T3UA 1M7LA 5AVRB 2QM8A 1JCDA 2HODB 3KQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6M C;  4RES B;  3L36 A;  2R5B A;  1S9K D;  5AVZ B;  2WT7 A;  3MD0 A;  1S9K E;  5AVQ B;  4HYT B;  2WPS A;  5APV A;  3LIE A;  1X8Y A;  3NXS A;  3T97 A;  2IPP A;  2YO3 A;  1FAV A;  3I5C A;  2ZFC A;  4M3L A;  5AVV B;  1GK4 A;  2XV5 A;  2YO2 A;  3P32 A;  1DH3 A;  1CI6 B;  3V4W A;  2WPQ A;  5AVU B;  1HUC A;  2YNY A;  3L35 A;  2QM7 A;  1T2K C;  5AVT B;  1A02 F;  2WWW A;  3HE5 A;  3NTN A;  3A5T A;  1SLQ A;  5AW7 B;  5AW2 B;  2R5D A;  2XZR A;  5AW5 B;  3M91 A;  4AQR D;  3TNU B;  1JNM A;  2WT7 B;  3NMD A;  2P7J A;  5AW4 B;  5APU A;  3M9H A;  1MFZ A;  1OWA A;  4JYC A;  2Z5H A;  2H7H A;  2E43 A;  3HE4 B;  1HBW A;  5AVS B;  5AVX B;  2VRS A;  1GU5 A;  4LC1 A;  1YYC A;  3IR9 A;  2WTY A;  1H8A A;  1GK6 A;  1JUN A;  3VN0 A;  5APY A;  2R32 A;  1CZQ A;  4C46 A;  5APS A;  1GD2 E;  3A2A A;  3HE5 B;  2P67 A;  4GT1 A;  1FOS F;  3M0A A;  1J2J B;  1H89 A;  3VTP C;  1SP4 A;  2ZXE B;  4AYC A;  3M0D A;  3VMZ A;  2C9L Y;  4KHX A;  5APT A;  4AUW A;  3KDP B;  2R3C A;  2KP8 A;  2Q5U A;  3VMY A;  2P2U A;  2N9B A;  1CSB A;  4C7N A;  3V4Q A;  4EOT A;  5AVY B;  3OAK A;  2Q7C A;  5AW0 B;  3M9B A;  3HTK A;  1HJB A;  1HWT C;  1MUU A;  1KQL A;  1GZL A;  4XE5 B;  5CMZ A;  3VYI A;  4DZO A;  5AVW B;  3TYY A;  3P7K A;  1NWQ A;  1FOS E;  5AW6 B;  2BAS A;  1GU4 A;  3TK1 A;  2E42 A;  5APX A;  5AW3 B;  2JJL A;  2WPR A;  3TNU A;  3V5B A;  5APW A;  3A3Y B;  4B86 A;  1T2K D;  1MV8 A;  4GKG A;  3VMX A;  1G2C B;  2Q3I A;  1IO4 A;  5APQ A;  3SWF A;  3A7O A;  3B8E B;  3NFQ A;  2W27 A;  3LID A;  3L37 A;  2C9N Y;  1A02 J;  3HE4 A;  2W6A A;  3M06 A;  3MGN A;  4C7N B;  1H88 A;  2XU6 A;  3O8Z A;  4I2L C;  5AW1 B;  3P8M C;  4JYB A;  1CI6 A;  1OXZ A;  1GTW A;  1NAF A;  2Z5I A;  5AW8 B;  5AVR B;  3UIA A;  2QM8 A;  5AW9 B;  3KQG A; 
#chains in the Genus database with same CATH topology
 1RE4 C;  5KKZ B;  1RF1 B;  1OW6 A;  1PV3 A;  4W80 A;  3AEG C;  1Q2N A;  2J59 M;  1VQN P;  4TLF A;  1H0T B;  1GK4 A;  2AEM A;  1X9V A;  2ZVO B;  3CXH E;  3EFG A;  1NTZ G;  1BE3 G;  2N1T D;  5CCG C;  2I1J A;  1AFO A;  1DEB A;  1QX8 A;  4GIF A;  3H1J E;  2RH0 A;  3CXH H;  3MP7 B;  1KD1 Q;  3VP9 A;  4K3A A;  1HBW A;  4WY4 B;  2M8R A;  3IR9 A;  1H8A A;  5KTB A;  2O3J A;  4OGQ B;  3IN6 A;  3CCR P;  2NPS B;  1M1K Q;  3CI9 A;  2IFN A;  4Y99 C;  2QIW A;  1UIX A;  2G3A A;  2IDB A;  1M90 Q;  1DD4 A;  2LR2 A;  1SQV E;  5KAI H;  5CCH A;  3O6Q A;  2J5U A;  2Q7C A;  2KI7 B;  1KQL A;  3CL3 D;  3H32 B;  2E75 D;  4CPG A;  1PIX A;  1NTZ K;  2WQY C;  2POH A;  1L0N E;  2O01 J;  3G71 P;  1EDJ A;  2JO1 A;  1YJW P;  2KNC A;  1EQ7 A;  1BDD A;  3GW6 A;  3Q5P A;  3KHU A;  4GOF A;  1URQ A;  1H88 A;  1SQV G;  1YJN P;  1SQX J;  4PV1 D;  3BAT A;  3R4Y A;  2YXR B;  1N7S C;  5TIS H;  3CPW O;  2JP3 A;  1DIP A;  3LIE A;  4EYY Q;  1M8O B;  5AVV B;  2GM4 A;  1KZU B;  1VDF A;  2WPQ A;  1VQ6 P;  5AVU B;  4H0L D;  2OGU A;  4YXD C;  3AEC C;  3CWB J;  1KTM A;  1SQX D;  1M1J B;  1ZN5 A;  3TNU B;  4I1L A;  3AE4 C;  1J1E C;  1EXJ A;  3L74 G;  3CMA P;  4JYC A;  2KSE A;  1AV1 A;  1SQV K;  3A2A A;  1OMI A;  4U3F G;  4EI2 A;  3CWB D;  2E76 D;  3KDP B;  3G6E P;  1Y9B A;  1KIL C;  2PRR A;  5DJT B;  1JY2 N;  2WSC J;  1D7M A;  1YBK A;  3RK2 B;  2ZT9 D;  3PJS K;  3GHG C;  4ZKP A;  5AW3 B;  1T2K D;  4B86 A;  3CCU P;  3CME P;  1OVU A;  4I7Z B;  2O1K A;  2KXP B;  2N1T A;  3AEE C;  3BRV B;  1N7L A;  4JYB A;  3H1H D;  2HFE D;  3GMA A;  1LT9 C;  1IK7 A;  1SFC C;  2HYN A;  2OAR A;  3S9O A;  2BEQ D;  3O6Q B;  1GW3 A;  1HGV A;  4N6J A;  5AVT B;  1A02 F;  2WWW A;  1SQQ D;  4UB8 E;  3PHL A;  5BVZ A;  4OH8 B;  3PH0 A;  4LLH A;  3B5N D;  1SQX E;  2XZR A;  1HVV A;  3M91 A;  1RY3 A;  1Q81 Q;  3Q3D A;  2FFD A;  4W7Z A;  3FGA D;  3EFF K;  3HUS A;  1URQ B;  3D70 A;  5KJ7 A;  2D2C B;  1T6A A;  1L4A D;  1H89 A;  2FYU J;  3VMA A;  3PLN A;  1ZP0 C;  3M0D A;  3CWB E;  3L72 J;  2DW3 A;  2K9J B;  5AVY B;  1PPJ D;  1NGM B;  1IFN A;  2IYP A;  5BU8 B;  3TK1 A;  2E42 A;  1RQU A;  1GL2 B;  1T3J A;  1U7J A;  2AXT E;  2J58 A;  3AE5 C;  1OVV A;  2FYU D;  2QJP B;  3PRJ A;  4C7N B;  3L72 D;  3CC4 P;  1CI6 A;  1VF5 B;  5AW8 B;  1PGQ A;  2V7Q J;  4OVN F;  1AJY A;  3JCU H;  3H1H E;  5KKZ C;  5CJ0 A;  1RF1 C;  4OWF A;  4C7R A;  1X8Y A;  3WUT A;  3A0B E;  1EZV G;  2MJZ A;  3CX5 D;  1VQ9 P;  1K9M Q;  3HE5 A;  3CCE P;  1BGY G;  1SQQ E;  3A0B H;  1JM0 A;  2QA4 P;  1JTH A;  4WWI A;  3BCC D;  2N1T B;  4WY4 C;  1JMM A;  3VN0 A;  3LW5 H;  4U7J A;  4HKZ H;  1KB9 I;  1NTK G;  2KZI A;  1SQQ G;  4JBZ A;  2N9B A;  2ZJS E;  3AE3 C;  1USD A;  5GTI E;  2KLU A;  1GZL A;  5CMZ A;  1Q82 Q;  2IYO A;  1TU3 F;  2IFM A;  2WPV B;  1RHZ B;  3H1I G;  1M57 D;  1HTL C;  2WMM A;  2B87 A;  3L37 A;  3OJA B;  2FXM A;  2FYU E;  2FFD B;  3O8Z A;  2E75 B;  1H0T A;  3L72 E;  4XA4 A;  1GTW A;  1M7L A;  1PPJ G;  4L75 A;  2FBW C;  3KQG A;  1Q86 Q;  3MHV A;  5CHX A;  2E74 B;  2P58 A;  1NTK K;  5B66 E;  4RKU J;  1P84 I;  1SQQ K;  4EDF A;  4DT0 A;  1WRG A;  4WY4 A;  2XV5 A;  4PV1 B;  2NPS A;  3V6I A;  1SLQ A;  1G2C A;  3VOP A;  5B66 H;  1JNM A;  2WT7 B;  3CX5 H;  3BCC E;  2E43 A;  4H0L B;  3H32 A;  2IZ0 A;  4PD4 I;  1RF0 A;  2ZYA A;  5APS A;  1FZF A;  4ASW A;  2C0W A;  3L70 J;  4TT3 H;  5KLV J;  2Q5U A;  3L73 G;  2JR8 A;  2Z4E A;  3BCC G;  3RK2 C;  3N4X A;  4HB1 A;  1SQP G;  2E76 B;  2OQQ A;  2R44 A;  5APW A;  4A7P A;  2W6J H;  2SPZ A;  4GKG A;  5CCG D;  3SWF A;  2NRG A;  3Q5R A;  2KOG A;  1JTH B;  2KK7 A;  3L70 D;  5KLV D;  2ZT9 B;  1OXZ A;  1N2D C;  2XDJ A;  4NPF X;  1Y47 A;  2ITA A;  1BSN A;  1JB0 J;  3G9R A;  2K9Y A;  2KS1 A;  1M1J A;  3TGU J;  1QLE D;  2IBZ D;  4WB4 A;  1PZQ A;  1S5L H;  4Z1M H;  3FXE A;  1Y8A A;  1GDT A;  5KAF H;  1N86 A;  3CLQ A;  1SQP K;  2BCC J;  2W6B A;  2JWA A;  3TGU D;  1YTZ I;  4XFJ A;  1SQB D;  2B87 B;  3TSI A;  1URQ C;  3JSV C;  2L5G B;  1JUN A;  3L75 G;  3B5N B;  1GD2 E;  1KOR A;  1NU1 G;  3FXD A;  2WSE J;  1AVY A;  2CK3 H;  4PJ0 E;  4H44 C;  1EDK A;  3V2N A;  1LJ2 A;  1N7S D;  3WU2 E;  3VMY A;  2QG4 A;  1ZXG A;  2ZYG A;  1KV4 A;  3E1R A;  4PJ0 H;  1L4A B;  1ZME C;  5AW6 B;  3G4S P;  2WSS H;  1U57 A;  3L71 J;  1G2C B;  1VPC A;  5K5G B;  2QJP C;  2Y0E A;  3MGN A;  2QVA A;  3H1J G;  2C0X A;  4I2L C;  1VF5 C;  3L70 E;  5KLV E;  1QEX A;  5M1B A;  2LKM A;  3U1A A;  2W90 A;  3BAS A;  1S72 P;  3IAO A;  1NYH A;  1EXI A;  1NU1 K;  2IBZ E;  3BVH A;  1LTT C;  2N9Y B;  4HYT B;  3AE2 C;  3L71 D;  1IK9 A;  1FAV A;  4O9B A;  2RKL A;  1IFI A;  3HD7 A;  3AEA C;  2OYH B;  1KIL D;  1AQT A;  3CCS P;  1HUC A;  1R5S A;  4K35 A;  1S5L X;  4DJG A;  1Z56 A;  1EC5 A;  1L0L J;  2H88 C;  2P7J A;  5AW4 B;  2K9J A;  3TGU E;  1L0N G;  2P10 A;  2N1T C;  2QJY B;  1SQB E;  3F89 A;  3C8V A;  2VRS A;  1YYC A;  1KFM A;  3MTU E;  5APY A;  3RK3 C;  1HF9 A;  1GL2 A;  3RBZ A;  1VL2 A;  3RBX A;  2KS1 B;  1NKN A;  1SP4 A;  5CBN A;  3FWN A;  1CSB A;  3USS A;  4C7N A;  5L8R J;  4EOT A;  1SFC D;  1SQB G;  2PAJ A;  1PFI A;  1ZR4 A;  1JY3 N;  1EDL A;  3V5B A;  3H1K J;  1JO5 A;  2FFD C;  1L0N K;  3HUS C;  2YKQ A;  3QH9 A;  3K5B A;  5KJ7 C;  3UIA A;  1LTG C;  3Q2Y A;  2QRX A;  1VQL P;  3ITK A;  2KZJ A;  3Q1M A;  1R8E A;  3M0D C;  2E74 C;  1BGY J;  1LTJ A;  3RL0 D;  3H1K D;  3L71 E;  1K05 A;  4M3L A;  1KIL E;  2A45 H;  3KPE A;  3L35 A;  3IFM A;  1SQB K;  3NTN A;  4HJG H;  1PGP A;  2A45 G;  4IFM A;  1W2E A;  2B89 A;  1NTK J;  1FZA A;  4H0L C;  4IFF A;  2A06 D;  1NTM J;  3QWO C;  2FYN C;  1EZV I;  4C46 A;  4L74 A;  4D6T J;  1OW7 A;  1J2J B;  1T8Z A;  1FZC A;  2HG5 D;  3VMZ A;  2O01 H;  2KP8 A;  3H1I J;  4RJT A;  1L0L E;  3G3Z A;  1OFC X;  1VQ4 P;  3V2R A;  2OTJ P;  3HD7 B;  2B9B A;  4UB8 H;  3TYY A;  1FZB A;  2CPS A;  4ZKU A;  5APX A;  2YIU B;  5CJ4 A;  1X22 A;  1IJD B;  1LP1 B;  1Q90 D;  1YQ4 C;  1SS1 A;  4D6T D;  1YI2 P;  1FJK A;  1SQX G;  3M06 A;  2PGD A;  2FXO A;  5AW1 B;  3P8M C;  1MKM A;  3H1L J;  2O01 N;  1FS0 E;  5AVW B;  3L36 A;  1HGZ A;  2WT7 A;  5AVQ B;  4H13 D;  1PP9 J;  3H1K E;  3CWB G;  1LTA C;  2YXQ B;  2QJK C;  2MKV A;  3D6Y A;  3MIW A;  2AXT H;  3H1L D;  3EQ2 A;  3A0H E;  3SSU A;  3V2P A;  3CC2 P;  1PGO A;  1SQX K;  4BXL A;  2A06 E;  2WSC H;  2Q1K A;  3A0H H;  3JC2 2;  1BCC J;  4KHX A;  1KB9 D;  1SQP J;  1AQ5 A;  3H1H G;  1GW4 A;  1ZOY C;  1LTJ B;  2OYO A;  3CCQ P;  3E1I A;  3HRN A;  4OGQ C;  1L4A C;  2NPS C;  3GLM A;  2A06 G;  4N78 D;  5E79 E;  5CBO A;  3A7O A;  1BCC D;  3CX5 I;  3CCV P;  1RE3 A;  4D6T E;  1FDM A;  2K1A A;  1FBM A;  3AEF C;  2XU6 A;  4JF7 A;  5E79 H;  2RMZ A;  2Z5I A;  4L76 A;  3U1C A;  4MN4 C;  5AW9 B;  1RF0 C;  1L2P A;  2I1K A;  1WMK A;  2HR3 A;  1KYO D;  2R5B A;  1S9K D;  1LWU A;  5KLI B;  1FZC B;  1MFT A;  1J1E B;  1VQ5 P;  5GTI H;  1RH5 B;  3B4S A;  2V4H A;  2WSF H;  3B5N A;  2KIK A;  1QVF O;  1IFD A;  4Y28 J;  4DOJ A;  1NTZ J;  3H1L E;  1BE3 J;  2R5D A;  1PGJ A;  1NU1 J;  3M9H A;  2QJY C;  1QGK B;  1XTC C;  2PP6 A;  1G1I A;  4YXW H;  4EIJ A;  1MZ9 A;  1PP9 E;  4LC1 A;  2IZ1 A;  1GK6 A;  2FYU G;  1L4A A;  3AEB C;  3L72 G;  2KB7 P;  3GHG B;  1Q7Y Q;  3GF7 A;  1M1J C;  4PD4 D;  4NPE A;  1KB9 E;  1NTZ D;  1BE3 D;  2Y9Z A;  3V4Q A;  3OAK A;  5GTH E;  1LTS C;  4DCK A;  5CCH D;  3SWY A;  3H1J J;  2V7Q H;  4N78 E;  2E5Y A;  2JJL A;  1ZR2 A;  1HJ0 A;  3C9I A;  1OVR A;  1LT9 B;  5APQ A;  1OZH A;  1VQK P;  3B8E B;  1BCC E;  2C9N Y;  1A02 J;  3E7K A;  3WUU A;  2LXB A;  2OYH A;  1YQ3 C;  3S1K A;  3D6Z A;  1NAY A;  2FYU K;  1BSH A;  4IOI H;  1SQV J;  2RN0 A;  1DEE G;  2H8P D;  1U7M A;  1KYO E;  5AVZ B;  1S9K E;  2IX7 C;  2WPS A;  5APV A;  3CXH I;  4I7Z C;  1OX3 A;  4H44 D;  1VQ8 P;  2ZXX A;  4L73 A;  2ZFC A;  2YO2 A;  1R5L A;  1L0N J;  3TF5 A;  2QM7 A;  1KYO H;  1FC2 C;  3ZDM A;  3A5T A;  3PTZ A;  2OYI A;  3RL0 B;  2QSI A;  2P1J A;  2FY8 A;  1NHL A;  3F5H A;  1NVO A;  3AED C;  1FDO A;  1YHQ P;  3L74 J;  4YPC A;  1VF5 D;  2YMY A;  1SVF A;  4GT1 A;  1NH4 A;  4PD4 E;  2HPC A;  2C9L Y;  1LWU B;  2Q9I A;  1NJI Q;  1NTZ E;  1BDC A;  1BE3 E;  4U3F J;  3D71 A;  2NZ2 A;  1JOC A;  3MUD C;  1HWT C;  3HD7 C;  4XE5 B;  4DZO A;  1GMJ A;  2D2C C;  4ZNC A;  1GU4 A;  2YIU C;  3L74 D;  2O1J A;  1ZW0 A;  3S4R A;  4WVZ A;  3LID A;  1J1D B;  2BCC D;  3H25 A;  4U3F D;  1ZLL A;  4BWN A;  1RQV A;  3I55 P;  1WT6 A;  1M56 D;  1HH0 A;  1GL2 C;  3W68 A;  1LNQ A;  3WU2 H;  3KZI E;  3RK3 D;  3CCJ P;  2JDI H;  1N73 A;  3MD0 A;  2ZVN B;  1ZV8 A;  2YO3 A;  1K73 Q;  1G1J A;  5KAI E;  1DH3 A;  3KZI H;  3MZW B;  2YNY A;  2WVR A;  5AW7 B;  2W83 C;  4H13 B;  3U59 A;  2QE7 H;  2WIT A;  5APU A;  2I8D A;  2H7H A;  3T97 B;  5BU5 A;  3MUD A;  4QMA A;  2Y0D A;  1S3J A;  4W7Y A;  3L70 G;  5KLV G;  1RE4 A;  5KJ7 D;  4IFD K;  3M0A A;  1LP1 A;  3VTP C;  3CD6 P;  1X0T A;  5TIS E;  4AUW A;  2R3C A;  2IBZ G;  1LTJ C;  4IL6 E;  2E74 D;  2ZYD A;  5AW0 B;  1LGH B;  1NOH A;  2A45 I;  1NWQ A;  2B88 A;  5CCG A;  2CPB A;  2BAS A;  2G8Y A;  3GG2 A;  3L74 E;  3CCM P;  1VQM P;  1YJ9 P;  3VMX A;  4IL6 H;  2OYI B;  2HLO A;  2JWD A;  1L0L D;  3V2Q A;  4GOD A;  2BCC E;  3TGU G;  2KYV A;  1N8R Q;  4U3F E;  5AVR B;  2QM8 A;  1AVO A;  1FZG A;  2H43 A;  2H89 C;  5KLI C;  5KLV K;  3R2P A;  3RK3 E;  1W5C E;  1FZC C;  1OW8 A;  2HPC B;  4HH2 A;  1UII A;  1XTG B;  2E75 C;  2FKW B;  2WZ7 A;  1IC2 A;  3OA7 A;  3EWK A;  3IF4 A;  2BCC G;  1IFP A;  3W67 A;  1ZRT D;  2WSE H;  1K04 A;  3WMM 0;  2AXC A;  2Z5H A;  1USE A;  1NO4 A;  2M3B A;  3H1H J;  1GU5 A;  4PV1 C;  2Q6Q A;  1N7S A;  1EZV D;  2ZXE B;  1FZE A;  1N73 B;  3HTK A;  1SQQ J;  1BGY D;  3LW5 J;  3L71 G;  1EDI A;  1FOS E;  2W8Z A;  1VQO P;  4GDO A;  1KQG B;  3A3Y B;  1E79 H;  2GUV A;  2Q3I A;  4NPD A;  1JY3 P;  3NFQ A;  4IL6 X;  2L91 A;  1QVG O;  4WBA A;  5H2F E;  1JMB A;  3CCL P;  2K88 A;  2JKV A;  1IFJ A;  1JY2 P;  1NTK D;  3CC7 P;  3AE8 C;  2E76 C;  1NTM D;  1KFN A;  4I6M C;  1FDI A;  3H6P A;  1K8A Q;  5H2F H;  3ABV C;  2KNC B;  5EFW B;  1KIL A;  1YIT P;  2WSF J;  3TDK A;  1VQP P;  2M0B A;  2PFX A;  2AEF A;  3P8C D;  2ZT9 C;  3P32 A;  1FJP A;  3H1I D;  3V4W A;  1L0L G;  4BRY A;  4WY4 D;  3GHG A;  1T2K C;  4OGQ D;  2NPS D;  5AW2 B;  1ZRT E;  4H44 B;  3RL0 C;  1RE3 C;  2M3E A;  2YKP A;  5AVS B;  1S1C X;  1OIP A;  3RGU A;  3SWK A;  1LTB C;  2WTY A;  2R32 A;  1CZQ A;  1W2B O;  3GF3 A;  4Y99 B;  3C1L A;  3AE7 C;  1LT9 A;  3JCU E;  1EZV E;  1LWU C;  4RO0 A;  1SFC A;  2P2U A;  2OTK E;  1X79 B;  1MUU A;  1PP9 D;  3VYI A;  1BGY E;  2M5A A;  3L73 J;  5DJU B;  3H1K G;  3P7K A;  3B5N C;  3B71 A;  2LXC B;  1L0L K;  3PP5 A;  3BCC J;  2XKM A;  2W27 A;  3HE4 A;  1J1D C;  3BRT B;  1VQ7 P;  1NKZ B;  1NTK E;  4UB6 E;  3L73 D;  4KJM A;  1NTM E;  1N7S B;  3FWL A;  4R4M A;  4JQ0 D;  1SQP D;  2GUS A;  3P8C E;  4UB6 H;  3HTK B;  3H1I E;  2YKO A;  1IFM A;  3RK3 B;  4H13 C;  2Q3E A;  5AW5 B;  4AQR D;  1NTM G;  3NMD A;  5TJH A;  1OWA A;  4GOE A;  3WUV A;  1PPJ E;  3FX0 A;  4D6T G;  2OYH C;  1P84 D;  2HOD A;  1FU1 A;  1RF1 A;  2P67 A;  1FOS F;  3RK2 D;  2UWJ E;  3L75 J;  5APT A;  4ASV A;  1KIL B;  3I56 P;  4N3Y B;  3M9B A;  5B5E E;  1HJB A;  1S2E A;  1QL1 A;  3HUS B;  3AE9 C;  2QEX P;  1KYO I;  2FYZ A;  4BRY B;  2WPR A;  2BEZ F;  2ZAE B;  2OYI C;  1IO4 A;  1LT1 A;  3VP8 A;  4R4L A;  5B5E H;  3H1L G;  2W6A A;  4KT0 J;  3L75 D;  1NTM K;  2XND H;  1NU1 D;  1QL2 A;  3CX5 E;  1LTI C;  1NAF A;  1PP9 G;  3M9Q A;  4RES B;  3L73 E;  2FXP A;  1KB9 H;  5C39 A;  3OW2 O;  1KN7 A;  1IZN B;  3NXS A;  2Y9Y A;  3KYQ A;  1SFC B;  2KUB A;  5GTH H;  3T97 A;  2IPP A;  2JEE A;  1KQF B;  1JEK A;  3I5C A;  2Y0C A;  3CXH D;  1KQS O;  1SQP E;  1S4X A;  1CI6 B;  4ZMD A;  1JCC A;  2XNX A;  1URQ D;  2FYN B;  2M5A B;  2KSJ A;  3HD7 D;  2D2C D;  3L4F A;  1E5W A;  1FE6 A;  2GA1 A;  3H1J D;  3SFD C;  1MFZ A;  2E5T A;  4JPZ B;  3HE4 B;  3AE6 C;  5AVX B;  1BCC G;  1AA0 A;  1KC8 Q;  1JY3 O;  1P84 E;  3HE5 B;  3N7N A;  4LGD E;  4AYC A;  1KMI Z;  1GL2 D;  1N73 C;  2K3R A;  3II6 A;  1SQV D;  1JY2 O;  1P84 H;  3KXD A;  1CW5 A;  2K37 A;  1YIJ P;  1PL5 A;  1DD3 A;  4YTP C;  1YTZ T;  3RL0 g;  3Q5S A;  1S5L E;  1L0N D;  2KLV A;  1SQB J;  3TNU A;  2R3S A;  5KAF E;  1MV8 A;  3SFE C;  1DX7 A;  3AE1 C;  5CCH C;  2OTL P;  3L75 E;  1NU1 E;  2AEJ A;  2QJK B;  1T3U A;  2YMK A;  1JCD A;  2IBZ I;  2HOD B;  4PD4 H; 
#chains in the Genus database with same CATH homology
 1FZG A;  1RE4 C;  1HGZ A;  3L36 A;  2H43 A;  1RF1 B;  5KLV K;  3R2P A;  2WT7 A;  1FZC C;  5AVQ B;  5CHX A;  2HPC B;  4W80 A;  1NTK K;  4HH2 A;  2J59 M;  1SQQ K;  1XTG B;  1WRG A;  4WY4 A;  2FKW B;  2WZ7 A;  1LTA C;  1IC2 A;  1GK4 A;  2XV5 A;  1X9V A;  3EFG A;  3OA7 A;  2NPS A;  2N1T D;  3MIW A;  5CCG C;  1SLQ A;  2I1J A;  1G2C A;  2WSE H;  3VOP A;  3EQ2 A;  1AFO A;  1DEB A;  3WMM 0;  1JNM A;  4GIF A;  2WT7 B;  3V2P A;  3VP9 A;  2Z5H A;  2E43 A;  1HBW A;  1NO4 A;  4WY4 B;  1SQX K;  2M3B A;  2M8R A;  3H32 A;  1GU5 A;  3IR9 A;  1H8A A;  2WSC H;  5KTB A;  2NPS B;  1RF0 A;  3CI9 A;  2IFN A;  5APS A;  4Y99 C;  1N7S A;  1FZF A;  2C0W A;  2ZXE B;  1FZE A;  4KHX A;  1AQ5 A;  1N73 B;  2Q5U A;  1GW4 A;  5CCH A;  2Q7C A;  1LTJ B;  3HTK A;  1KQL A;  3CL3 D;  3H32 B;  3E1I A;  3HRN A;  2Z4E A;  3RK2 C;  1L4A C;  3N4X A;  2NPS C;  1FOS E;  4N78 D;  1NTZ K;  2POH A;  5APW A;  3A3Y B;  4GKG A;  5CCG D;  2GUV A;  2Q3I A;  1JY3 P;  3SWF A;  3A7O A;  1EQ7 A;  3NFQ A;  1RE3 A;  1FDM A;  2KOG A;  1FBM A;  1URQ A;  4WBA A;  1H88 A;  2XU6 A;  1JTH B;  4JF7 A;  1OXZ A;  1IFJ A;  1N2D C;  2Z5I A;  2XDJ A;  3U1C A;  1JY2 P;  5AW9 B;  1RF0 C;  3BAT A;  2I1K A;  1KFN A;  4I6M C;  1M1J A;  1N7S C;  3H6P A;  2R5B A;  1S9K D;  1LWU A;  1FZC B;  1J1E B;  3LIE A;  1KIL A;  4WB4 A;  5AVV B;  2GM4 A;  2WSF H;  3P8C D;  1KZU B;  1VDF A;  3P32 A;  1FJP A;  3V4W A;  2WPQ A;  3B5N A;  5AVU B;  4WY4 D;  3GHG A;  1T2K C;  1GDT A;  1IFD A;  1N86 A;  4DOJ A;  2NPS D;  5AW2 B;  1M1J B;  1ZN5 A;  3CLQ A;  2R5D A;  3RL0 C;  1SQP K;  3TNU B;  2W6B A;  4I1L A;  1J1E C;  1YTZ I;  3M9H A;  1RE3 C;  4JYC A;  1XTC C;  2PP6 A;  2YKP A;  3TSI A;  1URQ C;  1G1I A;  5AVS B;  4EIJ A;  1MZ9 A;  1LTB C;  4LC1 A;  2WTY A;  1GK6 A;  2L5G B;  1L4A A;  1JUN A;  1SQV K;  2R32 A;  1CZQ A;  3B5N B;  1GD2 E;  2KB7 P;  4Y99 B;  3GHG B;  3A2A A;  1M1J C;  1LT9 A;  1LWU C;  3V2N A;  1N7S D;  1SFC A;  3KDP B;  3VMY A;  2P2U A;  1KIL C;  3V4Q A;  3OAK A;  1JY2 N;  1X79 B;  1MUU A;  1LTS C;  3VYI A;  5CCH D;  3RK2 B;  1L4A B;  3P7K A;  3B5N C;  3SWY A;  5AW6 B;  4ZKP A;  3GHG C;  4N78 E;  1L0L K;  5AW3 B;  2JJL A;  3PP5 A;  1ZR2 A;  4B86 A;  3C9I A;  1T2K D;  1G2C B;  1VPC A;  1LT9 B;  2XKM A;  5APQ A;  3B8E B;  2O1K A;  2W27 A;  2N1T A;  1A02 J;  2C9N Y;  3HE4 A;  1J1D C;  3BRV B;  3MGN A;  1N7L A;  2C0X A;  4I2L C;  2OYH A;  4JYB A;  3BRT B;  2LKM A;  3U1A A;  1NKZ B;  3BAS A;  2FYU K;  2HFE D;  1N7S B;  2H8P D;  1NU1 K;  5AVZ B;  3BVH A;  1LTT C;  2IX7 C;  1LT9 C;  1S9K E;  4HYT B;  2WPS A;  5APV A;  1SFC C;  2HYN A;  2OAR A;  1IK9 A;  1FAV A;  2ZFC A;  4O9B A;  1IFI A;  1GW3 A;  3HD7 A;  2GUS A;  1HGV A;  2OYH B;  2YO2 A;  1KIL D;  3P8C E;  3HTK B;  2YKO A;  4N6J A;  1HUC A;  1IFM A;  2QM7 A;  3RK3 B;  5AVT B;  1A02 F;  2WWW A;  3A5T A;  5BVZ A;  4OH8 B;  1Z56 A;  4LLH A;  2OYI A;  3B5N D;  2XZR A;  5AW5 B;  1HVV A;  3M91 A;  1RY3 A;  3RL0 B;  4AQR D;  3NMD A;  2P1J A;  2P7J A;  5AW4 B;  2FFD A;  1NHL A;  1OWA A;  2N1T C;  4W7Z A;  3HUS A;  1URQ B;  2VRS A;  2OYH C;  1YYC A;  5KJ7 A;  1KFM A;  2HOD A;  3MTU E;  5APY A;  3RK3 C;  2YMY A;  1GL2 A;  1FU1 A;  1RF1 A;  1SVF A;  4GT1 A;  2P67 A;  1FOS F;  3RK2 D;  1L4A D;  1H89 A;  1NH4 A;  1NKN A;  1SP4 A;  2HPC A;  3M0D A;  2C9L Y;  1LWU B;  5APT A;  2Q9I A;  1CSB A;  4C7N A;  4EOT A;  1KIL B;  5AVY B;  1IFN A;  4N3Y B;  1JOC A;  3M9B A;  1SFC D;  1HJB A;  1HWT C;  1QL1 A;  3HD7 C;  3HUS B;  4XE5 B;  4DZO A;  2PAJ A;  1PFI A;  2FYZ A;  5BU8 B;  1ZR4 A;  1GU4 A;  3TK1 A;  2E42 A;  1GL2 B;  1T3J A;  1JY3 N;  2WPR A;  3V5B A;  2J58 A;  2OYI C;  2O1J A;  1IO4 A;  3VP8 A;  1JO5 A;  3LID A;  2FFD C;  2W6A A;  1J1D B;  4C7N B;  1NTM K;  1QL2 A;  1L0N K;  1LTI C;  1CI6 A;  3HUS C;  1ZLL A;  1NAF A;  2YKQ A;  5AW8 B;  5KJ7 C;  3UIA A;  1WT6 A;  1HH0 A;  1LTG C;  3M9Q A;  1GL2 C;  4RES B;  5CJ0 A;  1RF1 C;  3RK3 D;  1N73 A;  3MD0 A;  4C7R A;  3M0D C;  1X8Y A;  3NXS A;  1LTJ A;  3KYQ A;  1SFC B;  3RL0 D;  1ZV8 A;  3T97 A;  2IPP A;  2YO3 A;  2JEE A;  3I5C A;  4M3L A;  1G1J A;  2MJZ A;  1DH3 A;  1CI6 B;  2A45 H;  1JCC A;  2XNX A;  1URQ D;  2YNY A;  3KPE A;  3L35 A;  2KSJ A;  3HD7 D;  3IFM A;  1SQB K;  3HE5 A;  3NTN A;  5AW7 B;  3L4F A;  1E5W A;  3U59 A;  2WIT A;  2A45 G;  5APU A;  4IFM A;  1MFZ A;  1W2E A;  1JTH A;  2H7H A;  2N1T B;  1FZA A;  3HE4 B;  4WY4 C;  5BU5 A;  4IFF A;  5AVX B;  3MUD A;  1JMM A;  1JY3 O;  3VN0 A;  3LW5 H;  4C46 A;  4W7Y A;  1RE4 A;  3HE5 B;  3N7N A;  4LGD E;  5KJ7 D;  3M0A A;  1J2J B;  4IFD K;  1T8Z A;  3VTP C;  1FZC A;  4AYC A;  2HG5 D;  3VMZ A;  1GL2 D;  2O01 H;  1N73 C;  4AUW A;  3II6 A;  2R3C A;  2KP8 A;  1JY2 O;  2N9B A;  1LTJ C;  1CW5 A;  5AW0 B;  3G3Z A;  1LGH B;  1GZL A;  1NOH A;  5CMZ A;  3HD7 B;  3V2R A;  2A45 I;  5AVW B;  3TYY A;  1FZB A;  1NWQ A;  1YTZ T;  5CCG A;  2CPS A;  2CPB A;  2BAS A;  4ZKU A;  5APX A;  2IFM A;  5CJ4 A;  2KLV A;  3TNU A;  1IJD B;  1MV8 A;  3VMX A;  2OYI B;  1HTL C;  2HLO A;  1FJK A;  1DX7 A;  3L37 A;  3OJA B;  2FXM A;  5CCH C;  3M06 A;  2FFD B;  3O8Z A;  3V2Q A;  5AW1 B;  3P8M C;  4XA4 A;  2KYV A;  1GTW A;  1T3U A;  1M7L A;  5AVR B;  2QM8 A;  1JCD A;  2HOD B;  3KQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...