1GK4A

Human vimentin coil 2b fragment (cys2)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
79
structure length
79
Chain Sequence
CEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conserved Segments 1A and 2B of the Intermediate Filament Dimer: Their Atomic Structures and Role in Filament Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Vimentin
molecule keywords VIMENTIN
total genus 38
structure length 79
sequence length 79
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2001-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gk4A00
5AVTB 5AW4B 2WWWA 4HYTB 2W27A 1SLQA 1CSBA 3M06A 2Q3IA 3KDPB 5APXA 5AVXB 1T2KD 3MGNA 2IPPA 2R5DA 3A7OA 1OXZA 3L35A 3VTPC 3P7KA 3VYIA 4RESB 5AW7B 3NFQA 1H89A 3MD0A 5CMZA 2C9LY 3TNUB 1NWQA 2E43A 4JYCA 3A3YB 5APSA 4GT1A 5AVUB 3VMZA 1YYCA 2WTYA 3NMDA 3IR9A 2YNYA 4M3LA 1T2KC 1CZQA 3VMXA 1CI6A 1JUNA 2Q7CA 3V4QA 1CI6B 4XE5B 3P8MC 1GK6A 1MV8A 1G2CB 1GU5A 4I2LC 1X8YA 4DZOA 3M0DA 4LC1A 2Z5IA 2XZRA 1FOSE 3A5TA 2N9BA 3L36A 1S9KD 1H88A 4AUWA 2QM7A 5AW1B 2WPQA 2XU6A 3V5BA 1DH3A 3OAKA 5APQA 1JNMA 1GTWA 5AW9B 3L37A 3I5CA 1NAFA 1HUCA 3A2AA 1IO4A 3HE5A 4AQRD 3HE5B 3LIEA 2R32A 3VN0A 3SWFA 3B8EB 5AVRB 3KQGA 3TNUA 2XV5A 3M9HA 5AW0B 4I6MC 2QM8A 2W6AA 3VMYA 2JJLA 1J2JB 3TK1A 4C7NA 4KHXA 5APYA 4C7NB 5AW3B 1HBWA 2KP8A 3NTNA 3HTKA 5AW2B 3P32A 1KQLA 2ZXEB 3LIDA 3HE4A 4GKGA 2WT7B 2E42A 5AVVB 1OWAA 4JYBA 3T97A 2YO2A 1MUUA 3M91A 2P2UA 3M0AA 3TYYA 5AVSB 5APTA 2P67A 5AVZB 5AVWB 2Z5HA 2Q5UA 5APWA 1H8AA 3NXSA 5AVQB 1A02J 5AVYB 2ZFCA 5AW6B 1S9KE 5AW5B 1GD2E 2YO3A 1GK4A 3HE4B 1SP4A 2VRSA 3UIAA 4C46A 4EOTA 1A02F 5APUA 2R3CA 3V4WA 1GZLA 2R5BA 2WT7A 2C9NY 2BASA 4B86A 1HJBA 2WPSA 4AYCA 1HWTC 1MFZA 1FOSF 2H7HA 3O8ZA 1FAVA 3M9BA 5AW8B 2WPRA 5APVA 2P7JA 1GU4A
chains in the Genus database with same CATH superfamily
4WY4B 1LWUC 1LTBC 4PV1B 3SWKA 2BCCJ 5KAIE 1LWUB 4PV1C 1VDFA 1X22A 1KYOI 2W27A 2DW3A 3CXHH 3H1JJ 1KN7A 4NPEA 1PP9E 1M8OB 1SLQA 1CSBA 3M06A 3B71A 1KB9I 1BGYG 4BWNA 2AEMA 1SFCB 2N1TB 3B5ND 2IPPA 2KLUA 2R5DA 5KAIH 3Q5SA 3CPWO 2E74C 1OW6A 3L72E 1U57A 2BEQD 4OVNF 2PP6A 2OYHC 1EDKA 3II6A 1L0LK 1W2BO 2KLVA 1R5SA 4JQ0D 2E43A 4WY4D 3U1AA 2WTYA 1JM0A 2W6JH 1BCCE 3L4FA 1VQOP 1YHQP 1IFDA 1QVGO 1FDIA 2XNDH 3RK3C 1NTKK 2Y0DA 3WMM0 3CC7P 2HPCB 2YMYA 3PTZA 1EQ7A 2SPZA 3M9QA 2ZVOB 4H13D 4XE5B 1EDJA 2JWAA 3V6IA 3CCMP 4RO0A 1GK6A 1G2CB 3H1JD 2FY8A 1KILC 1LT1A 3BCCE 3A0HE 3LW5H 3M0DA 1IFNA 2XZRA 4I2LC 4W7YA 1HTLC 3WUUA 1S5LX 3KXDA 5CCGD 2N9BA 3L36A 1L4AC 1HGZA 2B87B 2FXPA 1VQPP 4AUWA 5AW1B 3RL0B 2XU6A 2V7QJ 1FZEA 3H1IJ 3OAKA 2WSEH 3WUTA 4ZKUA 1DIPA 3PRJA 2IYOA 1PPJE 4H0LC 1JMMA 1HUCA 3I56P 2LR2A 3HE5A 4AQRD 1JMBA 3Q5PA 3V2PA 1IJDB 1LWUA 1IFIA 1N7SB 1J1EB 1S5LE 2JO1A 2WQYC 3CCEP 2M3BA 4RJTA 3RGUA 1PP9G 1KV4A 2NPSB 1BCCJ 3RK2B 2NRGA 2XV5A 3G3ZA 5CJ0A 3TNUA 1PPJG 2GA1A 5CCGA 5KLVG 5AW0B 1KILA 5CJ4A 1JO5A 2OTLP 1R5LA 3HUSA 2GUSA 5KJ7D 1KD1Q 1M7LA 1ZXGA 1J2JB 2QSIA 4IOIH 3TK1A 3S9OA 1JY2N 1EZVI 2XDJA 4KHXA 5DJTB 5AW3B 2E75D 1SFCA 2N1TA 2AXCA 2HYNA 1JTHB 2J59M 2KSEA 1DEEG 2V7QH 3L70G 3L75E 3NTNA 1HF9A 1L2PA 1EC5A 1P84H 1H0TB 2KI7B 3BCCG 1QX8A 1RE3A 3Q1MA 2KK7A 1KQLA 3CD6P 2KNCA 3LIDA 5CCHA 1FZAA 2CK3H 1JCCA 3HE4A 2BEZF 3MHVA 2O1JA 4GKGA 4JYBA 5E79E 4EIJA 3CWBD 5GTIE 2Z4EA 2KXPB 1Z56A 1N86A 3JCUE 1KILE 2KS1A 4W7ZA 3JCUH 3MIWA 2YIUB 1AA0A 1FU1A 1BCCG 2K88A 3TYYA 4DCKA 1KB9E 2P67A 1LTJA 1H8AA 1HH0A 2Q5UA 2LXCB 1URQD 2WZ7A 3AEAC 2ITAA 3IN6A 4EYYQ 1QVFO 1KFMA 3CXHI 3WU2H 3AE5C 1VQMP 2OYIA 1NU1J 2H89C 3K5BA 1G2CA 3H1HD 1YITP 3PLNA 1USDA 1KB9H 2K9JA 2FFDB 1S9KE 1GD2E 4PJ0H 4NPDA 1SFCD 2N1TD 3B5NB 1GW4A 1QL1A 1ZRTD 1BDDA 1Q2NA 2FYUJ 4C46A 3KZIE 2Q9IA 5APUA 1RE4C 2M0BA 2KYVA 1GZLA 1Y8AA 3BVHA 2FYUE 1JB0J 2WT7A 3MTUE 5DJUB 2QJKB 1GW3A 1N73B 2M5AB 4U3FD 3G9RA 3CWBJ 2KSJA 2G3AA 2IZ0A 1X0TA 2HLOA 2M8RA 1L4AD 1OX3A 3H1KJ 3PP5A 4MN4C 1FOSF 2HODA 3BRTB 4L74A 3CX5I 2C9NY 2KOGA 2IZ1A 1M1KQ 1N7LA 2IBZD 1JCDA 2WPRA 5AVZB 5AVTB 5AW4B 5KLVD 4HB1A 1NU1D 1DX7A 1ZP0C 3H1LE 1BE3D 1FC2C 1VQLP 1Q81Q 4OWFA 3G4SP 3H1JG 2BCCG 4K3AA 2Q3IA 1AJYA 3KDPB 2PGDA 5AVXB 5KKZB 2O3JA 1T2KD 1IFMA 2K9YA 1NYHA 3PHLA 3PJSK 1NU1E 2FFDC 1KTMA 3MGNA 3A7OA 3L35A 3VTPC 5CBNA 1URQC 1VQ6P 2Q1KA 1FDOA 3M0DC 2ZAEB 2E75B 3MD0A 2KS1B 3KHUA 2C9LY 1RHZB 1NWQA 1YIJP 2CPSA 3H6PA 5APSA 2FYNC 1YYCA 1EZVE 3AEBC 1ZR4A 1MFTA 2WSCH 4JF7A 1VQ7P 1Q90D 1SQQD 3L73G 2AXTH 2R44A 1FJPA 4GODA 1J1DC 3EFFK 1L4AB 2Q6QA 1SQQE 3FWLA 3GF3A 1FE6A 4Y28J 1S72P 1NKNA 1T8ZA 3RL0D 3SFEC 1IK9A 3TGUG 1X8YA 1YQ4C 1GL2A 2Z5IA 1QL2A 4IL6X 2B9BA 4U3FE 5KLVK 2W90A 3A5TA 1S9KD 2JEEA 3ABVC 1ZW0A 2FKWB 2QJPC 3H1ID 3D71A 3CCQP 2OTKE 1KYOD 2B87A 1DH3A 2PRRA 2A06G 1GDTA 1PP9D 2B89A 3WUVA 2POHA 1S1CX 1PIXA 1M1JA 2OQQA 3QH9A 2WSCJ 4A7PA 4UB8H 3BCCD 3I5CA 1NTME 1FZBA 3B5NC 2C0WA 1ZRTE 3A2AA 5KAFE 3D70A 1PGPA 2IDBA 2IX7C 3HE5B 4WB4A 3RK3D 3SFDC 5K5GB 1BE3E 4IFMA 2P10A 1RF1B 3B8EB 4OGQB 5E79H 3TGUJ 5GTHE 3RK3B 1SQQK 1N2DC 1PZQA 2H88C 3FWNA 4L75A 5H2FH 3U59A 4JBZA 3CC2P 1IFJA 2FYNB 2ZVNB 3BASA 4N78E 1MKMA 3U1CA 1KB9D 1KILB 2W6AA 1JY3O 2D2CD 4WBAA 1N73C 3CWBE 3L71E 2E76C 1LNQA 3EWKA 3D6YA 1BSHA 2KP8A 2YXRB 3GHGA 1ZMEC 1OZHA 2KUBA 3HTKA 1L0NG 1N7SA 1NO4A 1OIPA 4NPFX 3P32A 1NU1K 1YQ3C 2J5UA 1P84I 4DJGA 1FZCA 1OMIA 1SQPG 1EXIA 3L71D 3A0HH 2YO2A 3CX5H 2QEXP 3H1LJ 3RBZA 1FS0E 1RE4A 1S2EA 5KLIC 3AE7C 3RL0g 5CCHD 1KC8Q 1LT9B 3H1HE 2QIWA 1KQSO 3AE1C 1NTMD 2WVRA 1NAYA 2E5TA 5BU8B 1NJIQ 2ZT9D 4IFFA 5KJ7C 3OA7A 3NXSA 2GM4A 1SS1A 2A06D 5AVYB 2ZJSE 3O6QB 5AW6B 1ZV8A 2OTJP 1NTZK 1DEBA 2B88A 1N8RQ 2KNCB 3HE4B 5BVZA 2FYZA 2LXBA 1IK7A 1NTMK 3AE8C 1K05A 4ZMDA 1SQBE 3CMEP 2NZ2A 4L73A 2IFMA 1RQUA 1SQVD 1PGQA 1SQXD 1YTZI 4LLHA 2R5BA 4R4LA 1NTKE 2E76B 4UB6E 2IBZE 2W83C 4C7NB 4OGQD 1IC2A 3H1IE 4DT0A 1VQNP 2QVAA 3H32B 3L71J 5CBOA 1VPCA 1JTHA 2M5AA 3P8CD 2E76D 2ZT9C 1KZUB 1MFZA 2A45G 2BCCD 3C8VA 1PGOA 2D2CC 2H7HA 1TU3F 3M9BA 3CCUP 1NOHA 2HODB 4BXLA 3N4XA 1VQKP 5B5EH 1U7MA 5APVA 4CPGA 5M1BA 4D6TG 5KKZC 3L73D 3A0BE 3AE2C 2WWWA 2IBZG 3BRVB 1EZVD 3TSIA 1SVFA 1USEA 3AE9C 4DOJA 2JKVA 3GG2A 3H25A 3HD7D 3CCRP 2XKMA 3RBXA 2JWDA 4PV1D 2QA4P 4IFDK 5APXA 1GL2D 3HTKB 1RY3A 1M56D 1ZR2A 3L72D 2FBWC 3L74D 1MZ9A 1M57D 4LGDE 4WVZA 1OXZA 2K9JB 2O01H 2Y9ZA 3L75J 3L74G 2QJKC 2ZYAA 2W8ZA 4RESB 3MUDC 5AW7B 4K35A 1H89A 1EDLA 5CMZA 1LTTC 2MKVA 1G1IA 1A02F 4EI2A 3W68A 2FXMA 1LT9A 4H13B 2K3RA 4GT1A 5AVUB 1PP9J 3F5HA 1YBKA 4H13C 1IZNB 2YNYA 3FXDA 3HD7A 4GOEA 1SQPJ 1T2KC 3T97B 1CZQA 2J58A 1Q7YQ 1CI6A 4UB6H 2Q7CA 2RN0A 2R3SA 2D2CB 3S4RA 1SQPE 1JUNA 3Q3DA 1S5LH 3B4SA 1BDCA 3P8MC 1BSNA 1MV8A 1RE3C 2C0XA 1GU5A 4DZOA 4H0LD 2IBZI 3HUSB 1S3JA 4LC1A 3L74E 1T3UA 4W80A 1FOSE 3R2PA 1NH4A 2KZJA 5TJHA 2NPSC 3CWBG 2AEFA 1VQ4P 3KYQA 3H1KG 3L72J 1KQFB 1SQPK 3OJAB 4GIFA 5APQA 4BRYA 4H44D 4HJGH 4OH8B 1AVOA 1PL5A 5GTHH 3IFMA 4ZNCA 1L0NK 1NAFA 2L91A 1ZOYC 1K9MQ 4I1LA 4RKUJ 3LIEA 3SWYA 3VOPA 3TGUD 4PD4E 2O01J 1WRGA 2WMMA 5AVRB 3H1KE 3A0BH 4U7JA 2WSFJ 4R4MA 2BCCE 4UB8E 5B66H 3G6EP 1GMJA 3AE6C 3E7KA 2KIKA 3KQGA 3CCLP 4Z1MH 4D6TD 1YJNP 3GW6A 2P58A 2ZT9B 1NTKJ 2Y9YA 3L70D 1H88A 1L0NJ 1PGJA 1NTMJ 1L0LE 3GMAA 2NPSA 4KT0J 1VF5D 3EFGA 5APYA 2OYOA 1L4AA 1OW7A 2QG4A 1XTCC 4D6TJ 2HR3A 2O01N 4U3FG 1FJKA 5GTIH 1L0LJ 3HD7C 4Y99C 3I55P 4GDOA 5AW2B 1JOCA 1LT9C 1HWTC 1SQVG 3CCSP 2WT7B 3RK2C 1KFNA 1N7SD 2E42A 1OWAA 2RKLA 1BGYD 3T97A 3IAOA 3MUDA 2WPVB 1JY3N 1RF0C 3FXEA 4HH2A 2E75C 1MUUA 1JEKA 2WSFH 4XFJA 1RF1C 2P2UA 2YKPA 3M0AA 5KTBA 3CLQA 1NKZB 1E79H 3E1IA 1FZFA 2FFDA 2Z5HA 1PPJD 5APWA 3CL3D 5TISH 1S4XA 3P8CE 5AVQB 5B66E 1SQXG 1AVYA 2ZYGA 1SQBK 1D7MA 4ASVA 1NTKD 1URQA 3L70J 4JPZB 1LTJB 4QMAA 5AW5B 4ASWA 1NTZJ 1SQVE 3Q5RA 3C1LA 1GK4A 3IF4A 3V2NA 1ZN5A 2I1KA 3CI9A 3R4YA 1L0NE 2YIUC 3MZWB 1NTZE 1SQVJ 3H1LD 4WY4A 3VP8A 4YXDC 2N9YB 1L0LD 2R3CA 1SFCC 2N1TC 3MP7B 1WT6A 4H0LB 1L0LG 1K04A 2PFXA 5CHXA 1OVVA 1WMKA 2A45I 2KZIA 3AEFC 4N3YB 4B86A 3GF7A 2PAJA 3HUSC 4PD4H 4D6TE 4AYCA 1Q86Q 3GHGB 1LTAC 1NVOA 2XNXA 1E5WA 4PD4I 3TF5A 3CMAP 3AE3C 3O8ZA 1YTZT 1P84D 2HG5D 3L71G 3AEGC 1NTZG 3AEDC 2H8PD 2P7JA 1HJ0A 1RQVA 1LTIC 2JDIH 4OGQC 3VP9A 1LTGC 1W2EA 1HVVA 5CCGC 3CC4P 4TT3H 3H1IG 3PH0A 3CX5D 4HYTB 4ZKPA 1SQXJ 1QGKB 1JY3P 2JR8A 2FYUG 1PV3A 2WSSH 3B5NA 3L73J 3LW5J 4PD4D 1OFCX 2FXOA 2OARA 1SQBG 2E5YA 2W6BA 3RK2D 1KMIZ 1SQXE 2MJZA 2QJYB 1NGMB 5KLVJ 4GOFA 2QJYC 4WY4C 4YPCA 1EXJA 1AQ5A 1LTJC 3BATA 2Y0CA 4EDFA 4L76A 3EQ2A 3F89A 3G71P 3JC22 3P7KA 3VYIA 3OW2O 2OYIC 3NFQA 1DD3A 1H0TA 4U3FJ 1X79B 4H44B 3TNUB 2A06E 2GUVA 1X9VA 1AQTA 1HGVA 2K1AA 2QJPB 3A3YB 3KPEA 4JYCA 2LKMA 3VMZA 1N7SC 1R8EA 3CX5E 3CXHE 3IR9A 3NMDA 1RF1A 4M3LA 3GHGC 3HD7B 1GL2C 1NHLA 2OYHB 2AXTE 2KB7P 3RK3E 3VMXA 3W67A 3TGUE 1UIXA 3V4QA 1CI6B 1FZCC 3ZDMA 2H43A 1URQB 4IL6E 1SQQG 3L75D 3KZIH 1BE3J 2I8DA 2WSEJ 2YXQB 4I7ZB 1KYOH 1UIIA 5C39A 1KYOE 1JY2P 1LTSC 2QM7A 2HFED 2ZXXA 2WPQA 3QWOC 3V5BA 1YI2P 1AFOA 1VL2A 1KQGB 4IL6H 5TISE 1RH5B 1JNMA 1GTWA 2QE7H 3H1JE 5AW9B 3L37A 5H2FE 3GLMA 1VQ9P 1L0ND 1IO4A 3L72G 5KLVE 3CCVP 3V2QA 2I1JA 1YJWP 2ZYDA 1Y47A 4N78D 2IFNA 2YMKA 3FGAD 2R32A 3RL0C 3VN0A 1M1JC 1JY2O 2UWJE 3SWFA 1M1JB 1LJ2A 4C7RA 1BGYE 1M90Q 1BE3G 1T6AA 4H44C 1SQQJ 5BU5A 1BGYJ 1OVUA 1VF5B 3H1LG 1K8AQ 1NTMG 1Q82Q 1QEXA 1VF5C 3M9HA 1P84E 1U7JA 2E74B 2IYPA 3HRNA 3O6QA 4I6MC 4BRYB 1GL2B 1QLED 2QM8A 3VMYA 2Y0EA 2JJLA 1SQXK 1NTKG 4C7NA 1SQBD 2E74D 2P1JA 1VQ5P 1FZCB 4YTPC 1HBWA 2O1KA 4KJMA 4HKZH 2A45H 1T3JA 3VMAA 3S1KA 1YJ9P 2QRXA 1SQBJ 2ZXEB 4N6JA 1NTZD 3BCCJ 4WWIA 1BCCD 5AVVB 1Y9BA 2OYHA 2V4HA 3JSVC 1KORA 1IFPA 1FZGA 2M3EA 3L73E 2AEJA 3M91A 2NPSD 2OGUA 5B5EE 2YKQA 1LP1B 5APTA 1EZVG 2RH0A 5AVSB 1J1DB 1NU1G 3AE4C 3AECC 5AVWB 3E1RA 3SSUA 1AV1A 3CCJP 3H1HG 1K73Q 1KILD 1EDIA 2FYUK 3AEEC 2OYIB 1A02J 2JP3A 2CPBA 2ZFCA 3H1KD 1DD4A 3V2RA 1CW5A 5KJ7A 2YO3A 5CCHC 4PJ0E 2FYUD 4TLFA 1J1EC 2HPCA 1SP4A 5KLIB 1VQ8P 2VRSA 1W5CE 2G8YA 3UIAA 1XTGB 4EOTA 4Y99B 3L74J 2K37A 3WU2E 5EFWB 3V4WA 1RF0A 5L8RJ 1FDMA 2Q3EA 4XA4A 1FBMA 2BASA 3USSA 4YXWH 1LGHB 3N7NA 4O9BA 4I7ZC 3CXHD 1HJBA 3ITKA 2WPSA 1OW8A 3Q2YA 1SQVK 3C9IA 3H1HJ 3L75G 2YKOA 3L70E 1FAVA 5KAFH 1G1JA 5AW8B 1OVRA 2L5GB 1LP1A 1SQPD 2RMZA 3FX0A 3D6ZA 1N73A 1ZLLA 1PFIA 3H32A 3TDKA 2WITA 1GU4A
chains in the Genus database with same CATH topology
4WY4B 1LWUC 1LTBC 1LWUB 1VDFA 2W27A 1SLQA 1CSBA 3M06A 1SFCB 2N1TB 3B5ND 2IPPA 2R5DA 2PP6A 2OYHC 3II6A 1L0LK 2KLVA 2E43A 4WY4D 3U1AA 2WTYA 3L4FA 1IFDA 3WMM0 3RK3C 1NTKK 2HPCB 2YMYA 1EQ7A 3M9QA 4XE5B 1GK6A 1G2CB 4I2LC 1KILC 3M0DA 3LW5H 1IFNA 2XZRA 4W7YA 5CCGD 1HTLC 2N9BA 3L36A 1L4AC 1HGZA 4AUWA 5AW1B 3RL0B 2XU6A 1FZEA 3OAKA 2WSEH 4ZKUA 1JMMA 1HUCA 3HE5A 4AQRD 3V2PA 1IJDB 1LWUA 1IFIA 1N7SB 1J1EB 2M3BA 2NPSB 3RK2B 2XV5A 3G3ZA 5CJ0A 3TNUA 5AW0B 1KILA 5CJ4A 3HUSA 2GUSA 5KJ7D 1M7LA 1J2JB 3TK1A 1JY2N 2XDJA 4KHXA 4C7NB 5AW3B 1SFCA 2N1TA 2HYNA 1JTHB 2J59M 3NTNA 1RE3A 1KQLA 3LIDA 5CCHA 1FZAA 3HE4A 1JCCA 4GKGA 2Z4EA 4EIJA 2O1JA 4JYBA 4W7ZA 1Z56A 1N86A 3MIWA 1FU1A 3TYYA 2P67A 1LTJA 1H8AA 1HH0A 2Q5UA 1URQD 2WZ7A 1KFMA 2OYIA 1G2CA 2FFDB 1S9KE 1GD2E 1SFCD 2N1TD 3B5NB 1GW4A 1QL1A 4C46A 2Q9IA 5APUA 1RE4C 2KYVA 1GZLA 3BVHA 2WT7A 3MTUE 1GW3A 2KSJA 1HWTC 2M8RA 2HLOA 1L4AD 1FOSF 3PP5A 2HODA 3BRTB 2KOGA 1N7LA 2WPRA 1JCDA 5AVZB 5AVTB 5AW4B 1DX7A 2Q3IA 3KDPB 5AVXB 1T2KD 1IFMA 2FFDC 3MGNA 3A7OA 3L35A 3VTPC 1URQC 3M0DC 3MD0A 2C9LY 1NWQA 2CPSA 3H6PA 5APSA 1YYCA 1ZR4A 4JF7A 2WSCH 1FJPA 1J1DC 1L4AB 1NKNA 1T8ZA 3RL0D 1IK9A 1X8YA 1GL2A 2Z5IA 1QL2A 5KLVK 3A5TA 1S9KD 1H88A 2JEEA 2FKWB 1DH3A 1GDTA 2POHA 1M1JA 3I5CA 1FZBA 3B5NC 2C0WA 3A2AA 3HE5B 2IX7C 4WB4A 3RK3D 4IFMA 1RF1B 3B8EB 3RK3B 1SQQK 1N2DC 3U59A 1IFJA 3BASA 4N78E 3U1CA 1KILB 2W6AA 1JY3O 4WBAA 1N73C 2KP8A 3GHGA 3HTKA 1N7SA 1NO4A 3P32A 1NU1K 1FZCA 2YO2A 1RE4A 5CCHD 1LT9B 4IFFA 5KJ7C 3OA7A 3NXSA 2GM4A 5AVYB 5AW6B 1ZV8A 1NTZK 1DEBA 3HE4B 5BVZA 2FYZA 1NTMK 2IFMA 1YTZI 4LLHA 2R5BA 2C9NY 1IC2A 3H32B 1VPCA 1JTHA 3P8CD 1KZUB 1MFZA 2A45G 2H7HA 3M9BA 1NOHA 2HODB 3N4XA 5APVA 2WWWA 3BRVB 3TSIA 1SVFA 4DOJA 3HD7D 2XKMA 4IFDK 5APXA 1GL2D 3HTKB 1RY3A 1ZR2A 1MZ9A 4LGDE 1OXZA 2O01H 4RESB 5AW7B 1H89A 5CMZA 1LTTC 1G1IA 2FXMA 1LT9A 4GT1A 5AVUB 3HD7A 2YNYA 1T2KC 1CZQA 2J58A 1CI6A 1JUNA 2Q7CA 3P8MC 1MV8A 1RE3C 1GU5A 2C0XA 4DZOA 3HUSB 4LC1A 1FOSE 1T3UA 4W80A 3R2PA 1NH4A 2NPSC 3KYQA 1SQPK 3OJAB 4GIFA 5APQA 4OH8B 3IFMA 1L0NK 1NAFA 4I1LA 3LIEA 3SWYA 3VOPA 1WRGA 5AVRB 1JO5A 3KQGA 2NPSA 3EFGA 5APYA 1L4AA 1XTCC 1FJKA 3HD7C 4Y99C 5AW2B 1JOCA 1LT9C 2WT7B 3RK2C 1KFNA 1N7SD 2E42A 1OWAA 3T97A 3MUDA 4HH2A 1JY3N 1RF0C 1MUUA 2WSFH 1RF1C 2P2UA 2YKPA 3M0AA 5KTBA 3CLQA 1NKZB 3E1IA 1FZFA 2FFDA 2Z5HA 5APWA 3CL3D 3P8CE 5AVQB 1SQBK 1URQA 1LTJB 5AW5B 1GK4A 3V2NA 1ZN5A 2I1KA 3CI9A 4WY4A 3VP8A 2R3CA 1SFCC 2N1TC 1WT6A 5BU8B 5CHXA 2A45I 4B86A 4N3YB 2PAJA 3HUSC 4AYCA 3GHGB 1LTAC 2XNXA 1E5WA 3O8ZA 1YTZT 2HG5D 2H8PD 2P7JA 3VP9A 1LTIC 1LTGC 1W2EA 1HVVA 5CCGC 4HYTB 4ZKPA 1JY3P 3B5NA 3RK2D 2OARA 2W6BA 2MJZA 4WY4C 1LTJC 3BATA 3EQ2A 3P7KA 3VYIA 2OYIC 3NFQA 1X79B 3TNUB 2GUVA 1X9VA 1HGVA 4JYCA 3A3YB 3KPEA 2LKMA 3VMZA 1N7SC 3NMDA 3IR9A 1RF1A 4M3LA 3GHGC 3HD7B 1GL2C 1NHLA 2OYHB 2KB7P 3VMXA 3V4QA 1CI6B 1FZCC 2H43A 1URQB 1JY2P 1LTSC 2QM7A 2HFED 1AFOA 2WPQA 3V5BA 1JNMA 1GTWA 5AW9B 3L37A 1IO4A 3V2QA 2I1JA 4N78D 3RL0C 2IFNA 2R32A 3VN0A 1M1JC 1JY2O 3SWFA 1M1JB 4C7RA 5BU5A 3M9HA 1AQ5A 4I6MC 3HRNA 5CCGA 1GL2B 2QM8A 3VMYA 2JJLA 1SQXK 4C7NA 2P1JA 1FZCB 1HBWA 2O1KA 2A45H 1T3JA 2ZXEB 4N6JA 5AVVB 2OYHA 1FZGA 3M91A 2NPSD 2YKQA 5APTA 5AVSB 1N73B 1J1DB 5AVWB 1KILD 2FYUK 2OYIB 1A02J 2CPBA 2ZFCA 3V2RA 1CW5A 5KJ7A 2YO3A 5CCHC 1J1EC 2HPCA 1SP4A 2VRSA 3UIAA 4EOTA 1A02F 1XTGB 4Y99B 3V4WA 1RF0A 1FDMA 4XA4A 1FBMA 2BASA 1LGHB 3N7NA 4O9BA 1HJBA 2WPSA 1SQVK 3C9IA 2YKOA 1FAVA 1G1JA 5AW8B 2L5GB 1N73A 1ZLLA 1PFIA 3H32A 2WITA 1GU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVT B;  5AW4 B;  2WWW A;  4HYT B;  2W27 A;  1SLQ A;  1CSB A;  3M06 A;  2Q3I A;  3KDP B;  5APX A;  5AVX B;  1T2K D;  3MGN A;  2IPP A;  2R5D A;  3A7O A;  1OXZ A;  3L35 A;  3VTP C;  3P7K A;  3VYI A;  4RES B;  5AW7 B;  3NFQ A;  1H89 A;  3MD0 A;  5CMZ A;  2C9L Y;  3TNU B;  1NWQ A;  2E43 A;  4JYC A;  3A3Y B;  5APS A;  4GT1 A;  5AVU B;  3VMZ A;  1YYC A;  2WTY A;  3NMD A;  3IR9 A;  2YNY A;  4M3L A;  1T2K C;  1CZQ A;  3VMX A;  1CI6 A;  1JUN A;  2Q7C A;  3V4Q A;  1CI6 B;  4XE5 B;  3P8M C;  1GK6 A;  1MV8 A;  1G2C B;  1GU5 A;  4I2L C;  1X8Y A;  4DZO A;  3M0D A;  4LC1 A;  2Z5I A;  2XZR A;  1FOS E;  3A5T A;  2N9B A;  3L36 A;  1S9K D;  1H88 A;  4AUW A;  2QM7 A;  5AW1 B;  2WPQ A;  2XU6 A;  3V5B A;  1DH3 A;  3OAK A;  5APQ A;  1JNM A;  1GTW A;  5AW9 B;  3L37 A;  3I5C A;  1NAF A;  1HUC A;  3A2A A;  1IO4 A;  3HE5 A;  4AQR D;  3HE5 B;  3LIE A;  2R32 A;  3VN0 A;  3SWF A;  3B8E B;  5AVR B;  3KQG A;  3TNU A;  2XV5 A;  3M9H A;  5AW0 B;  4I6M C;  2QM8 A;  2W6A A;  3VMY A;  2JJL A;  1J2J B;  3TK1 A;  4C7N A;  4KHX A;  5APY A;  4C7N B;  5AW3 B;  1HBW A;  2KP8 A;  3NTN A;  3HTK A;  5AW2 B;  3P32 A;  1KQL A;  2ZXE B;  3LID A;  3HE4 A;  4GKG A;  2WT7 B;  2E42 A;  5AVV B;  1OWA A;  4JYB A;  3T97 A;  2YO2 A;  1MUU A;  3M91 A;  2P2U A;  3M0A A;  3TYY A;  5AVS B;  5APT A;  2P67 A;  5AVZ B;  5AVW B;  2Z5H A;  2Q5U A;  5APW A;  1H8A A;  3NXS A;  5AVQ B;  1A02 J;  5AVY B;  2ZFC A;  5AW6 B;  1S9K E;  5AW5 B;  1GD2 E;  2YO3 A;  1GK4 A;  3HE4 B;  1SP4 A;  2VRS A;  3UIA A;  4C46 A;  4EOT A;  1A02 F;  5APU A;  2R3C A;  3V4W A;  1GZL A;  2R5B A;  2WT7 A;  2C9N Y;  2BAS A;  4B86 A;  1HJB A;  2WPS A;  4AYC A;  1HWT C;  1MFZ A;  1FOS F;  2H7H A;  3O8Z A;  1FAV A;  3M9B A;  5AW8 B;  2WPR A;  5APV A;  2P7J A;  1GU4 A; 
#chains in the Genus database with same CATH topology
 4WY4 B;  1LWU C;  1LTB C;  4PV1 B;  3SWK A;  2BCC J;  5KAI E;  1LWU B;  4PV1 C;  1VDF A;  1X22 A;  1KYO I;  2W27 A;  2DW3 A;  3CXH H;  3H1J J;  1KN7 A;  4NPE A;  1PP9 E;  1M8O B;  1SLQ A;  1CSB A;  3M06 A;  3B71 A;  1KB9 I;  1BGY G;  4BWN A;  2AEM A;  1SFC B;  2N1T B;  3B5N D;  2IPP A;  2KLU A;  2R5D A;  5KAI H;  3Q5S A;  3CPW O;  2E74 C;  1OW6 A;  3L72 E;  1U57 A;  2BEQ D;  4OVN F;  2PP6 A;  2OYH C;  1EDK A;  3II6 A;  1L0L K;  1W2B O;  2KLV A;  1R5S A;  4JQ0 D;  2E43 A;  4WY4 D;  3U1A A;  2WTY A;  1JM0 A;  2W6J H;  1BCC E;  3L4F A;  1VQO P;  1YHQ P;  1IFD A;  1QVG O;  1FDI A;  2XND H;  3RK3 C;  1NTK K;  2Y0D A;  3WMM 0;  3CC7 P;  2HPC B;  2YMY A;  3PTZ A;  1EQ7 A;  2SPZ A;  3M9Q A;  2ZVO B;  4H13 D;  4XE5 B;  1EDJ A;  2JWA A;  3V6I A;  3CCM P;  4RO0 A;  1GK6 A;  1G2C B;  3H1J D;  2FY8 A;  1KIL C;  1LT1 A;  3BCC E;  3A0H E;  3LW5 H;  3M0D A;  1IFN A;  2XZR A;  4I2L C;  4W7Y A;  1HTL C;  3WUU A;  1S5L X;  3KXD A;  5CCG D;  2N9B A;  3L36 A;  1L4A C;  1HGZ A;  2B87 B;  2FXP A;  1VQP P;  4AUW A;  5AW1 B;  3RL0 B;  2XU6 A;  2V7Q J;  1FZE A;  3H1I J;  3OAK A;  2WSE H;  3WUT A;  4ZKU A;  1DIP A;  3PRJ A;  2IYO A;  1PPJ E;  4H0L C;  1JMM A;  1HUC A;  3I56 P;  2LR2 A;  3HE5 A;  4AQR D;  1JMB A;  3Q5P A;  3V2P A;  1IJD B;  1LWU A;  1IFI A;  1N7S B;  1J1E B;  1S5L E;  2JO1 A;  2WQY C;  3CCE P;  2M3B A;  4RJT A;  3RGU A;  1PP9 G;  1KV4 A;  2NPS B;  1BCC J;  3RK2 B;  2NRG A;  2XV5 A;  3G3Z A;  5CJ0 A;  3TNU A;  1PPJ G;  2GA1 A;  5CCG A;  5KLV G;  5AW0 B;  1KIL A;  5CJ4 A;  1JO5 A;  2OTL P;  1R5L A;  3HUS A;  2GUS A;  5KJ7 D;  1KD1 Q;  1M7L A;  1ZXG A;  1J2J B;  2QSI A;  4IOI H;  3TK1 A;  3S9O A;  1JY2 N;  1EZV I;  2XDJ A;  4KHX A;  5DJT B;  5AW3 B;  2E75 D;  1SFC A;  2N1T A;  2AXC A;  2HYN A;  1JTH B;  2J59 M;  2KSE A;  1DEE G;  2V7Q H;  3L70 G;  3L75 E;  3NTN A;  1HF9 A;  1L2P A;  1EC5 A;  1P84 H;  1H0T B;  2KI7 B;  3BCC G;  1QX8 A;  1RE3 A;  3Q1M A;  2KK7 A;  1KQL A;  3CD6 P;  2KNC A;  3LID A;  5CCH A;  1FZA A;  2CK3 H;  1JCC A;  3HE4 A;  2BEZ F;  3MHV A;  2O1J A;  4GKG A;  4JYB A;  5E79 E;  4EIJ A;  3CWB D;  5GTI E;  2Z4E A;  2KXP B;  1Z56 A;  1N86 A;  3JCU E;  1KIL E;  2KS1 A;  4W7Z A;  3JCU H;  3MIW A;  2YIU B;  1AA0 A;  1FU1 A;  1BCC G;  2K88 A;  3TYY A;  4DCK A;  1KB9 E;  2P67 A;  1LTJ A;  1H8A A;  1HH0 A;  2Q5U A;  2LXC B;  1URQ D;  2WZ7 A;  3AEA C;  2ITA A;  3IN6 A;  4EYY Q;  1QVF O;  1KFM A;  3CXH I;  3WU2 H;  3AE5 C;  1VQM P;  2OYI A;  1NU1 J;  2H89 C;  3K5B A;  1G2C A;  3H1H D;  1YIT P;  3PLN A;  1USD A;  1KB9 H;  2K9J A;  2FFD B;  1S9K E;  1GD2 E;  4PJ0 H;  4NPD A;  1SFC D;  2N1T D;  3B5N B;  1GW4 A;  1QL1 A;  1ZRT D;  1BDD A;  1Q2N A;  2FYU J;  4C46 A;  3KZI E;  2Q9I A;  5APU A;  1RE4 C;  2M0B A;  2KYV A;  1GZL A;  1Y8A A;  3BVH A;  2FYU E;  1JB0 J;  2WT7 A;  3MTU E;  5DJU B;  2QJK B;  1GW3 A;  1N73 B;  2M5A B;  4U3F D;  3G9R A;  3CWB J;  2KSJ A;  2G3A A;  2IZ0 A;  1X0T A;  2HLO A;  2M8R A;  1L4A D;  1OX3 A;  3H1K J;  3PP5 A;  4MN4 C;  1FOS F;  2HOD A;  3BRT B;  4L74 A;  3CX5 I;  2C9N Y;  2KOG A;  2IZ1 A;  1M1K Q;  1N7L A;  2IBZ D;  1JCD A;  2WPR A;  5AVZ B;  5AVT B;  5AW4 B;  5KLV D;  4HB1 A;  1NU1 D;  1DX7 A;  1ZP0 C;  3H1L E;  1BE3 D;  1FC2 C;  1VQL P;  1Q81 Q;  4OWF A;  3G4S P;  3H1J G;  2BCC G;  4K3A A;  2Q3I A;  1AJY A;  3KDP B;  2PGD A;  5AVX B;  5KKZ B;  2O3J A;  1T2K D;  1IFM A;  2K9Y A;  1NYH A;  3PHL A;  3PJS K;  1NU1 E;  2FFD C;  1KTM A;  3MGN A;  3A7O A;  3L35 A;  3VTP C;  5CBN A;  1URQ C;  1VQ6 P;  2Q1K A;  1FDO A;  3M0D C;  2ZAE B;  2E75 B;  3MD0 A;  2KS1 B;  3KHU A;  2C9L Y;  1RHZ B;  1NWQ A;  1YIJ P;  2CPS A;  3H6P A;  5APS A;  2FYN C;  1YYC A;  1EZV E;  3AEB C;  1ZR4 A;  1MFT A;  2WSC H;  4JF7 A;  1VQ7 P;  1Q90 D;  1SQQ D;  3L73 G;  2AXT H;  2R44 A;  1FJP A;  4GOD A;  1J1D C;  3EFF K;  1L4A B;  2Q6Q A;  1SQQ E;  3FWL A;  3GF3 A;  1FE6 A;  4Y28 J;  1S72 P;  1NKN A;  1T8Z A;  3RL0 D;  3SFE C;  1IK9 A;  3TGU G;  1X8Y A;  1YQ4 C;  1GL2 A;  2Z5I A;  1QL2 A;  4IL6 X;  2B9B A;  4U3F E;  5KLV K;  2W90 A;  3A5T A;  1S9K D;  2JEE A;  3ABV C;  1ZW0 A;  2FKW B;  2QJP C;  3H1I D;  3D71 A;  3CCQ P;  2OTK E;  1KYO D;  2B87 A;  1DH3 A;  2PRR A;  2A06 G;  1GDT A;  1PP9 D;  2B89 A;  3WUV A;  2POH A;  1S1C X;  1PIX A;  1M1J A;  2OQQ A;  3QH9 A;  2WSC J;  4A7P A;  4UB8 H;  3BCC D;  3I5C A;  1NTM E;  1FZB A;  3B5N C;  2C0W A;  1ZRT E;  3A2A A;  5KAF E;  3D70 A;  1PGP A;  2IDB A;  2IX7 C;  3HE5 B;  4WB4 A;  3RK3 D;  3SFD C;  5K5G B;  1BE3 E;  4IFM A;  2P10 A;  1RF1 B;  3B8E B;  4OGQ B;  5E79 H;  3TGU J;  5GTH E;  3RK3 B;  1SQQ K;  1N2D C;  1PZQ A;  2H88 C;  3FWN A;  4L75 A;  5H2F H;  3U59 A;  4JBZ A;  3CC2 P;  1IFJ A;  2FYN B;  2ZVN B;  3BAS A;  4N78 E;  1MKM A;  3U1C A;  1KB9 D;  1KIL B;  2W6A A;  1JY3 O;  2D2C D;  4WBA A;  1N73 C;  3CWB E;  3L71 E;  2E76 C;  1LNQ A;  3EWK A;  3D6Y A;  1BSH A;  2KP8 A;  2YXR B;  3GHG A;  1ZME C;  1OZH A;  2KUB A;  3HTK A;  1L0N G;  1N7S A;  1NO4 A;  1OIP A;  4NPF X;  3P32 A;  1NU1 K;  1YQ3 C;  2J5U A;  1P84 I;  4DJG A;  1FZC A;  1OMI A;  1SQP G;  1EXI A;  3L71 D;  3A0H H;  2YO2 A;  3CX5 H;  2QEX P;  3H1L J;  3RBZ A;  1FS0 E;  1RE4 A;  1S2E A;  5KLI C;  3AE7 C;  3RL0 g;  5CCH D;  1KC8 Q;  1LT9 B;  3H1H E;  2QIW A;  1KQS O;  3AE1 C;  1NTM D;  2WVR A;  1NAY A;  2E5T A;  5BU8 B;  1NJI Q;  2ZT9 D;  4IFF A;  5KJ7 C;  3OA7 A;  3NXS A;  2GM4 A;  1SS1 A;  2A06 D;  5AVY B;  2ZJS E;  3O6Q B;  5AW6 B;  1ZV8 A;  2OTJ P;  1NTZ K;  1DEB A;  2B88 A;  1N8R Q;  2KNC B;  3HE4 B;  5BVZ A;  2FYZ A;  2LXB A;  1IK7 A;  1NTM K;  3AE8 C;  1K05 A;  4ZMD A;  1SQB E;  3CME P;  2NZ2 A;  4L73 A;  2IFM A;  1RQU A;  1SQV D;  1PGQ A;  1SQX D;  1YTZ I;  4LLH A;  2R5B A;  4R4L A;  1NTK E;  2E76 B;  4UB6 E;  2IBZ E;  2W83 C;  4C7N B;  4OGQ D;  1IC2 A;  3H1I E;  4DT0 A;  1VQN P;  2QVA A;  3H32 B;  3L71 J;  5CBO A;  1VPC A;  1JTH A;  2M5A A;  3P8C D;  2E76 D;  2ZT9 C;  1KZU B;  1MFZ A;  2A45 G;  2BCC D;  3C8V A;  1PGO A;  2D2C C;  2H7H A;  1TU3 F;  3M9B A;  3CCU P;  1NOH A;  2HOD B;  4BXL A;  3N4X A;  1VQK P;  5B5E H;  1U7M A;  5APV A;  4CPG A;  5M1B A;  4D6T G;  5KKZ C;  3L73 D;  3A0B E;  3AE2 C;  2WWW A;  2IBZ G;  3BRV B;  1EZV D;  3TSI A;  1SVF A;  1USE A;  3AE9 C;  4DOJ A;  2JKV A;  3GG2 A;  3H25 A;  3HD7 D;  3CCR P;  2XKM A;  3RBX A;  2JWD A;  4PV1 D;  2QA4 P;  4IFD K;  5APX A;  1GL2 D;  3HTK B;  1RY3 A;  1M56 D;  1ZR2 A;  3L72 D;  2FBW C;  3L74 D;  1MZ9 A;  1M57 D;  4LGD E;  4WVZ A;  1OXZ A;  2K9J B;  2O01 H;  2Y9Z A;  3L75 J;  3L74 G;  2QJK C;  2ZYA A;  2W8Z A;  4RES B;  3MUD C;  5AW7 B;  4K35 A;  1H89 A;  1EDL A;  5CMZ A;  1LTT C;  2MKV A;  1G1I A;  1A02 F;  4EI2 A;  3W68 A;  2FXM A;  1LT9 A;  4H13 B;  2K3R A;  4GT1 A;  5AVU B;  1PP9 J;  3F5H A;  1YBK A;  4H13 C;  1IZN B;  2YNY A;  3FXD A;  3HD7 A;  4GOE A;  1SQP J;  1T2K C;  3T97 B;  1CZQ A;  2J58 A;  1Q7Y Q;  1CI6 A;  4UB6 H;  2Q7C A;  2RN0 A;  2R3S A;  2D2C B;  3S4R A;  1SQP E;  1JUN A;  3Q3D A;  1S5L H;  3B4S A;  1BDC A;  3P8M C;  1BSN A;  1MV8 A;  1RE3 C;  2C0X A;  1GU5 A;  4DZO A;  4H0L D;  2IBZ I;  3HUS B;  1S3J A;  4LC1 A;  3L74 E;  1T3U A;  4W80 A;  1FOS E;  3R2P A;  1NH4 A;  2KZJ A;  5TJH A;  2NPS C;  3CWB G;  2AEF A;  1VQ4 P;  3KYQ A;  3H1K G;  3L72 J;  1KQF B;  1SQP K;  3OJA B;  4GIF A;  5APQ A;  4BRY A;  4H44 D;  4HJG H;  4OH8 B;  1AVO A;  1PL5 A;  5GTH H;  3IFM A;  4ZNC A;  1L0N K;  1NAF A;  2L91 A;  1ZOY C;  1K9M Q;  4I1L A;  4RKU J;  3LIE A;  3SWY A;  3VOP A;  3TGU D;  4PD4 E;  2O01 J;  1WRG A;  2WMM A;  5AVR B;  3H1K E;  3A0B H;  4U7J A;  2WSF J;  4R4M A;  2BCC E;  4UB8 E;  5B66 H;  3G6E P;  1GMJ A;  3AE6 C;  3E7K A;  2KIK A;  3KQG A;  3CCL P;  4Z1M H;  4D6T D;  1YJN P;  3GW6 A;  2P58 A;  2ZT9 B;  1NTK J;  2Y9Y A;  3L70 D;  1H88 A;  1L0N J;  1PGJ A;  1NTM J;  1L0L E;  3GMA A;  2NPS A;  4KT0 J;  1VF5 D;  3EFG A;  5APY A;  2OYO A;  1L4A A;  1OW7 A;  2QG4 A;  1XTC C;  4D6T J;  2HR3 A;  2O01 N;  4U3F G;  1FJK A;  5GTI H;  1L0L J;  3HD7 C;  4Y99 C;  3I55 P;  4GDO A;  5AW2 B;  1JOC A;  1LT9 C;  1HWT C;  1SQV G;  3CCS P;  2WT7 B;  3RK2 C;  1KFN A;  1N7S D;  2E42 A;  1OWA A;  2RKL A;  1BGY D;  3T97 A;  3IAO A;  3MUD A;  2WPV B;  1JY3 N;  1RF0 C;  3FXE A;  4HH2 A;  2E75 C;  1MUU A;  1JEK A;  2WSF H;  4XFJ A;  1RF1 C;  2P2U A;  2YKP A;  3M0A A;  5KTB A;  3CLQ A;  1NKZ B;  1E79 H;  3E1I A;  1FZF A;  2FFD A;  2Z5H A;  1PPJ D;  5APW A;  3CL3 D;  5TIS H;  1S4X A;  3P8C E;  5AVQ B;  5B66 E;  1SQX G;  1AVY A;  2ZYG A;  1SQB K;  1D7M A;  4ASV A;  1NTK D;  1URQ A;  3L70 J;  4JPZ B;  1LTJ B;  4QMA A;  5AW5 B;  4ASW A;  1NTZ J;  1SQV E;  3Q5R A;  3C1L A;  1GK4 A;  3IF4 A;  3V2N A;  1ZN5 A;  2I1K A;  3CI9 A;  3R4Y A;  1L0N E;  2YIU C;  3MZW B;  1NTZ E;  1SQV J;  3H1L D;  4WY4 A;  3VP8 A;  4YXD C;  2N9Y B;  1L0L D;  2R3C A;  1SFC C;  2N1T C;  3MP7 B;  1WT6 A;  4H0L B;  1L0L G;  1K04 A;  2PFX A;  5CHX A;  1OVV A;  1WMK A;  2A45 I;  2KZI A;  3AEF C;  4N3Y B;  4B86 A;  3GF7 A;  2PAJ A;  3HUS C;  4PD4 H;  4D6T E;  4AYC A;  1Q86 Q;  3GHG B;  1LTA C;  1NVO A;  2XNX A;  1E5W A;  4PD4 I;  3TF5 A;  3CMA P;  3AE3 C;  3O8Z A;  1YTZ T;  1P84 D;  2HG5 D;  3L71 G;  3AEG C;  1NTZ G;  3AED C;  2H8P D;  2P7J A;  1HJ0 A;  1RQV A;  1LTI C;  2JDI H;  4OGQ C;  3VP9 A;  1LTG C;  1W2E A;  1HVV A;  5CCG C;  3CC4 P;  4TT3 H;  3H1I G;  3PH0 A;  3CX5 D;  4HYT B;  4ZKP A;  1SQX J;  1QGK B;  1JY3 P;  2JR8 A;  2FYU G;  1PV3 A;  2WSS H;  3B5N A;  3L73 J;  3LW5 J;  4PD4 D;  1OFC X;  2FXO A;  2OAR A;  1SQB G;  2E5Y A;  2W6B A;  3RK2 D;  1KMI Z;  1SQX E;  2MJZ A;  2QJY B;  1NGM B;  5KLV J;  4GOF A;  2QJY C;  4WY4 C;  4YPC A;  1EXJ A;  1AQ5 A;  1LTJ C;  3BAT A;  2Y0C A;  4EDF A;  4L76 A;  3EQ2 A;  3F89 A;  3G71 P;  3JC2 2;  3P7K A;  3VYI A;  3OW2 O;  2OYI C;  3NFQ A;  1DD3 A;  1H0T A;  4U3F J;  1X79 B;  4H44 B;  3TNU B;  2A06 E;  2GUV A;  1X9V A;  1AQT A;  1HGV A;  2K1A A;  2QJP B;  3A3Y B;  3KPE A;  4JYC A;  2LKM A;  3VMZ A;  1N7S C;  1R8E A;  3CX5 E;  3CXH E;  3IR9 A;  3NMD A;  1RF1 A;  4M3L A;  3GHG C;  3HD7 B;  1GL2 C;  1NHL A;  2OYH B;  2AXT E;  2KB7 P;  3RK3 E;  3VMX A;  3W67 A;  3TGU E;  1UIX A;  3V4Q A;  1CI6 B;  1FZC C;  3ZDM A;  2H43 A;  1URQ B;  4IL6 E;  1SQQ G;  3L75 D;  3KZI H;  1BE3 J;  2I8D A;  2WSE J;  2YXQ B;  4I7Z B;  1KYO H;  1UII A;  5C39 A;  1KYO E;  1JY2 P;  1LTS C;  2QM7 A;  2HFE D;  2ZXX A;  2WPQ A;  3QWO C;  3V5B A;  1YI2 P;  1AFO A;  1VL2 A;  1KQG B;  4IL6 H;  5TIS E;  1RH5 B;  1JNM A;  1GTW A;  2QE7 H;  3H1J E;  5AW9 B;  3L37 A;  5H2F E;  3GLM A;  1VQ9 P;  1L0N D;  1IO4 A;  3L72 G;  5KLV E;  3CCV P;  3V2Q A;  2I1J A;  1YJW P;  2ZYD A;  1Y47 A;  4N78 D;  2IFN A;  2YMK A;  3FGA D;  2R32 A;  3RL0 C;  3VN0 A;  1M1J C;  1JY2 O;  2UWJ E;  3SWF A;  1M1J B;  1LJ2 A;  4C7R A;  1BGY E;  1M90 Q;  1BE3 G;  1T6A A;  4H44 C;  1SQQ J;  5BU5 A;  1BGY J;  1OVU A;  1VF5 B;  3H1L G;  1K8A Q;  1NTM G;  1Q82 Q;  1QEX A;  1VF5 C;  3M9H A;  1P84 E;  1U7J A;  2E74 B;  2IYP A;  3HRN A;  3O6Q A;  4I6M C;  4BRY B;  1GL2 B;  1QLE D;  2QM8 A;  3VMY A;  2Y0E A;  2JJL A;  1SQX K;  1NTK G;  4C7N A;  1SQB D;  2E74 D;  2P1J A;  1VQ5 P;  1FZC B;  4YTP C;  1HBW A;  2O1K A;  4KJM A;  4HKZ H;  2A45 H;  1T3J A;  3VMA A;  3S1K A;  1YJ9 P;  2QRX A;  1SQB J;  2ZXE B;  4N6J A;  1NTZ D;  3BCC J;  4WWI A;  1BCC D;  5AVV B;  1Y9B A;  2OYH A;  2V4H A;  3JSV C;  1KOR A;  1IFP A;  1FZG A;  2M3E A;  3L73 E;  2AEJ A;  3M91 A;  2NPS D;  2OGU A;  5B5E E;  2YKQ A;  1LP1 B;  5APT A;  1EZV G;  2RH0 A;  5AVS B;  1J1D B;  1NU1 G;  3AE4 C;  3AEC C;  5AVW B;  3E1R A;  3SSU A;  1AV1 A;  3CCJ P;  3H1H G;  1K73 Q;  1KIL D;  1EDI A;  2FYU K;  3AEE C;  2OYI B;  1A02 J;  2JP3 A;  2CPB A;  2ZFC A;  3H1K D;  1DD4 A;  3V2R A;  1CW5 A;  5KJ7 A;  2YO3 A;  5CCH C;  4PJ0 E;  2FYU D;  4TLF A;  1J1E C;  2HPC A;  1SP4 A;  5KLI B;  1VQ8 P;  2VRS A;  1W5C E;  2G8Y A;  3UIA A;  1XTG B;  4EOT A;  4Y99 B;  3L74 J;  2K37 A;  3WU2 E;  5EFW B;  3V4W A;  1RF0 A;  5L8R J;  1FDM A;  2Q3E A;  4XA4 A;  1FBM A;  2BAS A;  3USS A;  4YXW H;  1LGH B;  3N7N A;  4O9B A;  4I7Z C;  3CXH D;  1HJB A;  3ITK A;  2WPS A;  1OW8 A;  3Q2Y A;  1SQV K;  3C9I A;  3H1H J;  3L75 G;  2YKO A;  3L70 E;  1FAV A;  5KAF H;  1G1J A;  5AW8 B;  1OVR A;  2L5G B;  1LP1 A;  1SQP D;  2RMZ A;  3FX0 A;  3D6Z A;  1N73 A;  1ZLL A;  1PFI A;  3H32 A;  3TDK A;  2WIT A;  1GU4 A; 
#chains in the Genus database with same CATH homology
 4WY4 B;  1LWU C;  1LTB C;  1LWU B;  1VDF A;  2W27 A;  1SLQ A;  1CSB A;  3M06 A;  1SFC B;  2N1T B;  3B5N D;  2IPP A;  2R5D A;  2PP6 A;  2OYH C;  3II6 A;  1L0L K;  2KLV A;  2E43 A;  4WY4 D;  3U1A A;  2WTY A;  3L4F A;  1IFD A;  3WMM 0;  3RK3 C;  1NTK K;  2HPC B;  2YMY A;  1EQ7 A;  3M9Q A;  4XE5 B;  1GK6 A;  1G2C B;  4I2L C;  1KIL C;  3M0D A;  3LW5 H;  1IFN A;  2XZR A;  4W7Y A;  5CCG D;  1HTL C;  2N9B A;  3L36 A;  1L4A C;  1HGZ A;  4AUW A;  5AW1 B;  3RL0 B;  2XU6 A;  1FZE A;  3OAK A;  2WSE H;  4ZKU A;  1JMM A;  1HUC A;  3HE5 A;  4AQR D;  3V2P A;  1IJD B;  1LWU A;  1IFI A;  1N7S B;  1J1E B;  2M3B A;  2NPS B;  3RK2 B;  2XV5 A;  3G3Z A;  5CJ0 A;  3TNU A;  5AW0 B;  1KIL A;  5CJ4 A;  3HUS A;  2GUS A;  5KJ7 D;  1M7L A;  1J2J B;  3TK1 A;  1JY2 N;  2XDJ A;  4KHX A;  4C7N B;  5AW3 B;  1SFC A;  2N1T A;  2HYN A;  1JTH B;  2J59 M;  3NTN A;  1RE3 A;  1KQL A;  3LID A;  5CCH A;  1FZA A;  3HE4 A;  1JCC A;  4GKG A;  2Z4E A;  4EIJ A;  2O1J A;  4JYB A;  4W7Z A;  1Z56 A;  1N86 A;  3MIW A;  1FU1 A;  3TYY A;  2P67 A;  1LTJ A;  1H8A A;  1HH0 A;  2Q5U A;  1URQ D;  2WZ7 A;  1KFM A;  2OYI A;  1G2C A;  2FFD B;  1S9K E;  1GD2 E;  1SFC D;  2N1T D;  3B5N B;  1GW4 A;  1QL1 A;  4C46 A;  2Q9I A;  5APU A;  1RE4 C;  2KYV A;  1GZL A;  3BVH A;  2WT7 A;  3MTU E;  1GW3 A;  2KSJ A;  1HWT C;  2M8R A;  2HLO A;  1L4A D;  1FOS F;  3PP5 A;  2HOD A;  3BRT B;  2KOG A;  1N7L A;  2WPR A;  1JCD A;  5AVZ B;  5AVT B;  5AW4 B;  1DX7 A;  2Q3I A;  3KDP B;  5AVX B;  1T2K D;  1IFM A;  2FFD C;  3MGN A;  3A7O A;  3L35 A;  3VTP C;  1URQ C;  3M0D C;  3MD0 A;  2C9L Y;  1NWQ A;  2CPS A;  3H6P A;  5APS A;  1YYC A;  1ZR4 A;  4JF7 A;  2WSC H;  1FJP A;  1J1D C;  1L4A B;  1NKN A;  1T8Z A;  3RL0 D;  1IK9 A;  1X8Y A;  1GL2 A;  2Z5I A;  1QL2 A;  5KLV K;  3A5T A;  1S9K D;  1H88 A;  2JEE A;  2FKW B;  1DH3 A;  1GDT A;  2POH A;  1M1J A;  3I5C A;  1FZB A;  3B5N C;  2C0W A;  3A2A A;  3HE5 B;  2IX7 C;  4WB4 A;  3RK3 D;  4IFM A;  1RF1 B;  3B8E B;  3RK3 B;  1SQQ K;  1N2D C;  3U59 A;  1IFJ A;  3BAS A;  4N78 E;  3U1C A;  1KIL B;  2W6A A;  1JY3 O;  4WBA A;  1N73 C;  2KP8 A;  3GHG A;  3HTK A;  1N7S A;  1NO4 A;  3P32 A;  1NU1 K;  1FZC A;  2YO2 A;  1RE4 A;  5CCH D;  1LT9 B;  4IFF A;  5KJ7 C;  3OA7 A;  3NXS A;  2GM4 A;  5AVY B;  5AW6 B;  1ZV8 A;  1NTZ K;  1DEB A;  3HE4 B;  5BVZ A;  2FYZ A;  1NTM K;  2IFM A;  1YTZ I;  4LLH A;  2R5B A;  2C9N Y;  1IC2 A;  3H32 B;  1VPC A;  1JTH A;  3P8C D;  1KZU B;  1MFZ A;  2A45 G;  2H7H A;  3M9B A;  1NOH A;  2HOD B;  3N4X A;  5APV A;  2WWW A;  3BRV B;  3TSI A;  1SVF A;  4DOJ A;  3HD7 D;  2XKM A;  4IFD K;  5APX A;  1GL2 D;  3HTK B;  1RY3 A;  1ZR2 A;  1MZ9 A;  4LGD E;  1OXZ A;  2O01 H;  4RES B;  5AW7 B;  1H89 A;  5CMZ A;  1LTT C;  1G1I A;  2FXM A;  1LT9 A;  4GT1 A;  5AVU B;  3HD7 A;  2YNY A;  1T2K C;  1CZQ A;  2J58 A;  1CI6 A;  1JUN A;  2Q7C A;  3P8M C;  1MV8 A;  1RE3 C;  1GU5 A;  2C0X A;  4DZO A;  3HUS B;  4LC1 A;  1FOS E;  1T3U A;  4W80 A;  3R2P A;  1NH4 A;  2NPS C;  3KYQ A;  1SQP K;  3OJA B;  4GIF A;  5APQ A;  4OH8 B;  3IFM A;  1L0N K;  1NAF A;  4I1L A;  3LIE A;  3SWY A;  3VOP A;  1WRG A;  5AVR B;  1JO5 A;  3KQG A;  2NPS A;  3EFG A;  5APY A;  1L4A A;  1XTC C;  1FJK A;  3HD7 C;  4Y99 C;  5AW2 B;  1JOC A;  1LT9 C;  2WT7 B;  3RK2 C;  1KFN A;  1N7S D;  2E42 A;  1OWA A;  3T97 A;  3MUD A;  4HH2 A;  1JY3 N;  1RF0 C;  1MUU A;  2WSF H;  1RF1 C;  2P2U A;  2YKP A;  3M0A A;  5KTB A;  3CLQ A;  1NKZ B;  3E1I A;  1FZF A;  2FFD A;  2Z5H A;  5APW A;  3CL3 D;  3P8C E;  5AVQ B;  1SQB K;  1URQ A;  1LTJ B;  5AW5 B;  1GK4 A;  3V2N A;  1ZN5 A;  2I1K A;  3CI9 A;  4WY4 A;  3VP8 A;  2R3C A;  1SFC C;  2N1T C;  1WT6 A;  5BU8 B;  5CHX A;  2A45 I;  4B86 A;  4N3Y B;  2PAJ A;  3HUS C;  4AYC A;  3GHG B;  1LTA C;  2XNX A;  1E5W A;  3O8Z A;  1YTZ T;  2HG5 D;  2H8P D;  2P7J A;  3VP9 A;  1LTI C;  1LTG C;  1W2E A;  1HVV A;  5CCG C;  4HYT B;  4ZKP A;  1JY3 P;  3B5N A;  3RK2 D;  2OAR A;  2W6B A;  2MJZ A;  4WY4 C;  1LTJ C;  3BAT A;  3EQ2 A;  3P7K A;  3VYI A;  2OYI C;  3NFQ A;  1X79 B;  3TNU B;  2GUV A;  1X9V A;  1HGV A;  4JYC A;  3A3Y B;  3KPE A;  2LKM A;  3VMZ A;  1N7S C;  3NMD A;  3IR9 A;  1RF1 A;  4M3L A;  3GHG C;  3HD7 B;  1GL2 C;  1NHL A;  2OYH B;  2KB7 P;  3VMX A;  3V4Q A;  1CI6 B;  1FZC C;  2H43 A;  1URQ B;  1JY2 P;  1LTS C;  2QM7 A;  2HFE D;  1AFO A;  2WPQ A;  3V5B A;  1JNM A;  1GTW A;  5AW9 B;  3L37 A;  1IO4 A;  3V2Q A;  2I1J A;  4N78 D;  3RL0 C;  2IFN A;  2R32 A;  3VN0 A;  1M1J C;  1JY2 O;  3SWF A;  1M1J B;  4C7R A;  5BU5 A;  3M9H A;  1AQ5 A;  4I6M C;  3HRN A;  5CCG A;  1GL2 B;  2QM8 A;  3VMY A;  2JJL A;  1SQX K;  4C7N A;  2P1J A;  1FZC B;  1HBW A;  2O1K A;  2A45 H;  1T3J A;  2ZXE B;  4N6J A;  5AVV B;  2OYH A;  1FZG A;  3M91 A;  2NPS D;  2YKQ A;  5APT A;  5AVS B;  1N73 B;  1J1D B;  5AVW B;  1KIL D;  2FYU K;  2OYI B;  1A02 J;  2CPB A;  2ZFC A;  3V2R A;  1CW5 A;  5KJ7 A;  2YO3 A;  5CCH C;  1J1E C;  2HPC A;  1SP4 A;  2VRS A;  3UIA A;  4EOT A;  1A02 F;  1XTG B;  4Y99 B;  3V4W A;  1RF0 A;  1FDM A;  4XA4 A;  1FBM A;  2BAS A;  1LGH B;  3N7N A;  4O9B A;  1HJB A;  2WPS A;  1SQV K;  3C9I A;  2YKO A;  1FAV A;  1G1J A;  5AW8 B;  2L5G B;  1N73 A;  1ZLL A;  1PFI A;  3H32 A;  2WIT A;  1GU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...