2B89A

Structural basis for molecular recognition in an affibody:affibody complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
58
structure length
58
Chain Sequence
VDNKFNKERVIAIGEIMRLPNLNSLQVVAFINSLRDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-ZTaq affibody
publication title Structural basis for molecular recognition in an affibody:affibody complex.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 17
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2005-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2b89A00
1EDIA 1LP1B 5CBOA 3RGUA 4CPGA 2B87A 1S3JA 1U7JA 4JBZA 3MZWB 1SS1A 2QVAA 4GOEA 1MFTA 4MN4C 4WWIA 1BDDA 1JMBA 2UWJE 2Q1KA 2M0BA 1OVUA 2QRXA 4HJGH 4EYYQ 1OVRA 4HKZH 2KI7B 2OTKE 2KIKA 1Y47A 2RKLA 4K3AA 4BXLA 2KUBA 1LP1A 4GODA 2WMMA 1EDLA 2M5AB 5K5GB 2LXCB 1ZXGA 1EC5A 1H0TB 1OVVA 2HR3A 2B89A 3S1KA 2KS1B 2R44A 5CBNA 1EDJA 5DJUB 1NVOA 2LR2A 1FC2C 2LXBA 3QWOC 4NPDA 5C39A 4NPFX 4GOFA 3MHVA 4ZMDA 4IOIH 1ZW0A 2B88A 2KZJA 4HB1A 2M5AA 1Q2NA 4KJMA 1H0TA 2KZIA 1DEEG 3PH0A 2B87B 2P58A 1X0TA 4K35A 3FXDA 1EDKA 4ASVA 1U7MA 4ASWA 2I8DA 4NPEA 5EFWB 1BDCA 3ZDMA 2K3RA 4ZNCA 2JWDA 2SPZA 1LT1A 5DJTB 1JM0A 2ZAEB 3FXEA
chains in the Genus database with same CATH superfamily
3VMZA 4HYTB 3IF4A 3L73E 2YO3A 3L4FA 4CPGA 3CX5H 2WSEJ 2OYIC 2P1JA 4JPZB 2HYNA 2Q9IA 4I2LC 4WY4C 4U3FJ 1JY2N 3WU2H 1FZAA 1NU1D 5AW0B 1ZRTD 3Q2YA 2KOGA 1JEKA 1VF5B 2Z5IA 2GUSA 3FGAD 3N4XA 2R3SA 1OVVA 4Z1MH 1VQLP 5B66E 5KAFH 3CC4P 3TGUJ 2PAJA 1X9VA 2QSIA 2ZJSE 3CWBG 1Y8AA 3P7KA 3LW5H 2O01J 3Q5PA 3SFDC 3HUSA 3H1HJ 2BEQD 1YI2P 4IOIH 1M56D 1PL5A 3PTZA 3BCCE 1VQ9P 1OZHA 3H1KJ 3M0DC 2FFDB 1KORA 2FYNB 3HTKB 1J1DC 2WSFJ 1ZV8A 2PP6A 2SPZA 3P8CE 4H13D 1HTLC 1M1JC 1SQQJ 3H1KE 1L0LJ 4DT0A 5CBOA 3RK2C 2YMYA 5AVVB 1ZR2A 1WMKA 5KTBA 1LGHB 1GW4A 3RBXA 1PPJE 1N2DC 1MFTA 1HJ0A 5CCHD 4N6JA 3H1LD 3JC22 3L71E 2OTKE 3CCLP 1KC8Q 2QIWA 4H13B 3CPWO 5AVXB 2WMMA 2RN0A 1VQ4P 1K9MQ 4PD4I 1KQGB 3A0HE 1NTKJ 3AEFC 3T97A 3JSVC 3D70A 5AW3B 1EZVD 4GOFA 1L0ND 1NTKE 3L72E 1VQ6P 1ZW0A 4WY4D 1NTZD 4PD4E 3TNUB 1P84H 1KB9E 5APXA 5KLIB 1SQBG 3HE5A 3M0AA 5CCGC 1BDCA 1N7SA 2OYIB 1J1EC 4WY4B 3V4QA 3F89A 1BE3J 1QL2A 1XTGB 2G8YA 2BCCD 4N3YB 2Q5UA 2MJZA 1T2KC 1YTZT 2W90A 3II6A 1BGYD 4W7YA 1JTHB 3CXHI 1SQVD 1SFCD 2LKMA 1LTJB 1PZQA 5CHXA 1S1CX 4O9BA 3CCEP 1LP1A 2YKPA 3RL0g 2QM7A 4C46A 2M5AB 2LXCB 3Q5RA 4AUWA 1SQPK 3S1KA 3AECC 3G6EP 5APSA 4DZOA 3CXHE 1RHZB 4ZMDA 4PV1D 1SFCB 1HJBA 3C8VA 1KFMA 3L73D 1NU1J 2IYOA 2CK3H 1X79B 4KT0J 1SQXK 2N1TC 1J1DB 3CCVP 1M1JB 1FZFA 2ZXEB 4TLFA 2GM4A 3FWNA 2OARA 5AVRB 5AW8B 2W8ZA 1Q81Q 4PJ0H 4M3LA 2E74C 3GF7A 4PV1B 3H1IG 1BCCE 4JQ0D 1DH3A 2CPSA 3CCMP 1SS1A 3L74G 5APVA 5E79H 1FZCA 4HJGH 4EYYQ 4IL6H 2WT7B 3NFQA 3GF3A 4IL6X 3F5HA 5KLVK 5CCGD 2BEZF 4JF7A 3BCCD 1X8YA 2E5TA 2A06E 4D6TG 3IR9A 3WMM0 2FKWB 1NVOA 2XDJA 1T3JA 2IZ0A 2KSJA 2ZT9D 3G3ZA 3P8CD 1M57D 1KYOE 1T2KD 1OIPA 3H1LJ 5KAIH 3L70G 1LT9C 2WSSH 4H0LC 1Q2NA 5AW1B 1IFPA 2Q7CA 3L37A 4N78E 1LTBC 2KS1A 3UIAA 1PPJD 1PP9G 1EZVI 4EIJA 1EDKA 3KQGA 1FU1A 1JY2O 2P67A 3EFGA 1RF0A 2IFNA 3U1AA 4JYBA 1N86A 3L71D 3M9QA 2FYUK 3W67A 4Y99B 4L73A 1AVOA 2ZT9B 3G9RA 1VQOP 3TYYA 2YXRB 3RGUA 2B87A 3CX5I 1L0NJ 4RESB 1JY2P 4U3FG 1GK4A 1YJWP 2QVAA 5KJ7C 3H32A 1SQPE 1JY3O 1NTZJ 2KXPB 1A02J 4WWIA 2N1TD 5AW7B 3B5ND 2K1AA 2AEJA 2CPBA 1VQNP 3L72D 3LIDA 4XA4A 2FXPA 2J58A 3CX5E 3TGUG 1FS0E 4PD4D 1NTMG 3TSIA 1SQXE 1H0TB 5AW9B 1KB9D 2E74D 3MD0A 3Q1MA 1YBKA 3G4SP 3H1HG 3WU2E 2BCCJ 1N7LA 1IK7A 2N1TB 2JEEA 1LWUB 5AW4B 3MHVA 3B5NB 4UB6E 1YQ3C 1BGYJ 2WWWA 2M3BA 2FYZA 2DW3A 2BCCE 1SQVJ 4H13C 1M1KQ 1U57A 2E5YA 2P2UA 2K9JA 2ZVOB 5AVSB 5KAFE 1K05A 2E74B 1NAYA 1SQQG 2XNDH 4NPEA 5EFWB 3JCUH 1WT6A 1L0LG 1KTMA 3FX0A 1FE6A 1KILE 3L36A 3IFMA 2JR8A 1G2CB 2HODB 1KMIZ 4W80A 5KLVE 2IBZG 2KNCB 1JOCA 5APUA 3N7NA 3MGNA 2Y9YA 4JBZA 3L73J 3MZWB 1MZ9A 4H0LD 5GTIH 1E5WA 3CXHD 1M90Q 2RKLA 2W6JH 1YTZI 3D6YA 2PRRA 2WPQA 4C7NA 2OYOA 2XZRA 4EDFA 1Q90D 2OYHB 5K5GB 2QJYB 3KXDA 2M8RA 1N73A 3GLMA 3TK1A 3H6PA 5CMZA 2NPSA 5APWA 1LTAC 1ZOYC 1PGQA 3IN6A 1LT9B 2E42A 4H0LB 1CI6A 4GT1A 1KFNA 4UB6H 4BWNA 5KJ7D 3KDPB 2FYUE 3D71A 2B88A 3P32A 4YXWH 3AE8C 1LTJC 1BCCD 2KYVA 1PGOA 1YITP 4WBAA 1ZP0C 1JY3N 3GHGC 1OW8A 4AQRD 3E7KA 1QVFO 3BCCJ 2O01N 2H43A 1NYHA 3ZDMA 2JWDA 2JDIH 3O8ZA 2HPCB 1BE3G 2IPPA 2IFMA 3FXEA 3SWYA 4RJTA 5AVWB 3B71A 1OFCX 3FWLA 1SFCC 3GMAA 1P84E 3GG2A 1NTME 3PLNA 2A06D 1GU4A 1KILC 3CMAP 2Q3EA 1GDTA 3L75E 2P10A 1OVRA 4LC1A 2KIKA 3NMDA 1KYOD 3VTPC 4BRYB 3L71J 3O6QB 1EDLA 2WITA 1GW3A 3KZIH 5L8RJ 1RE4C 1GL2C 1CZQA 4PV1C 4N78D 1RH5B 3PJSK 3P8MC 3V2PA 2KB7P 2K9YA 1YHQP 1SLQA 2W27A 4NPDA 5TJHA 3HD7A 1M8OB 1NU1G 1MKMA 4RKUJ 1MV8A 2WSEH 1CW5A 1L4AA 1QX8A 2KZJA 3PRJA 2Y0EA 1KB9I 3L72J 2V7QJ 4ZKPA 2P58A 1X0TA 1W2BO 2MKVA 2A45I 1SQPD 3S9OA 2ITAA 2J59M 3H1JE 1QEXA 2ZYDA 1JNMA 4GKGA 3AEGC 3RL0C 3MP7B 3U1CA 2HODA 1KQLA 3CX5D 2PFXA 1SQXD 2ZFCA 1VQ7P 1SQBK 3HE4B 3ABVC 1AQTA 1OX3A 4GOEA 2O01H 1BDDA 1HVVA 1NO4A 1IJDB 2YMKA 4PJ0E 4H44C 5TISH 2QEXP 2QA4P 1GD2E 4LGDE 1X22A 1NAFA 4Y99C 1CSBA 2IDBA 3WUVA 1ZLLA 3H25A 2ZT9C 1ZXGA 2B89A 2WSFH 3HUSC 2AEFA 1RQVA 2P7JA 3CWBE 5E79E 5DJUB 1ZR4A 1JMMA 1S9KE 3H1LG 1FOSF 2WVRA 1IFJA 1RE3C 1KILD 4IL6E 1K8AQ 3GHGB 4DJGA 1ZN5A 5KLVD 2R3CA 4ZKUA 2KZIA 4GIFA 1IFNA 3IAOA 3S4RA 1AFOA 3CCQP 3WUUA 2QJPC 1NKNA 2Y9ZA 1KD1Q 1QLED 3LIEA 1GL2D 1EZVG 2YIUC 3L35A 5DJTB 2KLUA 1L0NG 5KAIE 1KILB 1K73Q 1FDOA 1LWUC 3B5NC 1DIPA 2OQQA 2N9YB 1NTZG 2WTYA 3E1RA 2FFDA 1W2EA 1BCCJ 3HTKA 2FXOA 3E1IA 5BU5A 2Q1KA 1AA0A 4OGQC 3MTUE 2KI7B 1GL2B 1AJYA 2FYUD 3M9BA 2WPVB 1J2JB 2JKVA 1RF1B 3W68A 1FBMA 4L74A 3RL0D 1URQB 1BGYG 1KZUB 1KYOI 5APTA 2VRSA 1SQVG 2WPRA 1LTIC 2J5UA 2K88A 2W83C 4H44D 2KLVA 2Y0CA 1P84D 1N7SC 2OYHC 1NTMD 1SQBE 2QJYC 3VMXA 3RL0B 4ASVA 3VP8A 4ASWA 5CCHA 1G1JA 1YYCA 2I8DA 3L75D 3HRNA 5APYA 1RY3A 3A5TA 2AXCA 3M06A 4I7ZC 3L73G 3TNUA 2BASA 2HLOA 1S3JA 1EXJA 4H44B 3EQ2A 1DX7A 1S4XA 1AVYA 1OWAA 2GA1A 3JCUE 4IFDK 2OYIA 1SQPJ 1L0LD 1E79H 2Z4EA 2E75C 2WZ7A 3HUSB 4WY4A 5KKZC 1S5LH 4GDOA 3KYQA 3AE7C 1L2PA 2V4HA 5GTIE 1JO5A 5CBNA 4JYCA 2E76C 1VQMP 1SQXJ 3H1JD 1JTHA 5AW2B 1VDFA 1USDA 1H89A 1LTJA 2JJLA 1OW6A 3CMEP 1PFIA 1JCDA 2QJPB 3A7OA 1JY3P 3OW2O 4XFJA 2HFED 1NTMK 2M5AA 4OGQD 3VOPA 5AVTB 3D6ZA 1EXIA 3PH0A 2O3JA 1FZEA 2YIUB 1GK6A 3BCCG 4EOTA 3R4YA 2QE7H 3CL3D 1S72P 2QJKC 1SFCA 3AEBC 3EWKA 2ZAEB 2C9LY 3M0DA 3H1IE 1VQ8P 2XNXA 3H1KG 4C7RA 3LW5J 2OGUA 3RK3E 3USSA 1FZCC 4W7ZA 4OGQB 2XV5A 1M1JA 5AW6B 3L74E 1SP4A 1SQQK 2NZ2A 2AXTH 5KLVJ 2KK7A 1PPJG 5CJ4A 3CWBD 1L0LK 5B5EH 1FDIA 2H88C 1JMBA 2ZYAA 1S9KD 4I1LA 2ZXXA 3A0BH 1N7SD 3L71G 1IK9A 1RE4A 2WQYC 1HUCA 4IFFA 1PIXA 4D6TE 3M91A 2E43A 1GU5A 1DD4A 3NTNA 1H88A 3CCUP 1FJKA 3HE5B 1HGVA 1FC2C 2KSEA 2QM8A 1Y9BA 3I55P 4R4LA 2WT7A 3BRTB 3K5BA 1N7SB 1HWTC 3TF5A 4UB8H 3L70E 2AEMA 1NTKG 3L72G 3KZIE 1NWQA 2IYPA 1RF0C 2FYUJ 1FZBA 3I56P 3SWFA 2E75D 1PP9E 1QVGO 3Q5SA 4I7ZB 1LTSC 4LLHA 1FAVA 3U59A 2A45G 2N9BA 4HH2A 2E76D 1IFIA 3CC2P 5CCGA 1NGMB 3NXSA 1JUNA 1LP1B 1P84I 1KN7A 1YJ9P 2H8PD 4U3FE 1PV3A 5H2FH 5AVYB 1LTGC 1WRGA 1IZNB 2E75B 1YQ4C 2M3EA 1JB0J 3A3YB 1R8EA 3MUDC 2R5BA 1NTMJ 5KKZB 4EI2A 3RK3C 3V4WA 5AVUB 3L75J 3RBZA 2E76B 1DD3A 3TGUE 2WSCH 2IZ1A 1VQ5P 2HR3A 4KHXA 4OH8B 5KLIC 1SQBD 3V5BA 2C0XA 1RE3A 2G3AA 1GZLA 3H1HE 2LR2A 1IC2A 3CCSP 2RMZA 3KHUA 1TU3F 3R2PA 5TISE 3KPEA 3AE9C 2KP8A 4B86A 4HB1A 2IBZI 1OXZA 1H0TA 1UIIA 3B4SA 1SVFA 1OMIA 4YPCA 2QJKB 3AEEC 1HGZA 3C9IA 5GTHE 1RF1C 1SQQE 1U7MA 1IO4A 1L0LE 2N1TA 2Q3IA 1NU1K 1FZCB 1LWUA 3B5NA 1N8RQ 1URQC 1UIXA 2O1KA 3MIWA 3H1JJ 1EDIA 2B9BA 1KQFB 2IBZE 1BCCG 1U7JA 1JCCA 5B66H 3V6IA 2Y0DA 1AV1A 2M0BA 4I6MC 4HKZH 1G2CA 1R5SA 1N73C 4L75A 2NPSC 1VQKP 2KNCA 1MUUA 2W6BA 1IFMA 2ZYGA 4Y28J 3PHLA 1IFDA 2A06G 2KS1B 2R44A 1QGKB 5AVQB 2LXBA 2FXMA 1Q7YQ 1NJIQ 4R4MA 4NPFX 4OVNF 2FY8A 3CWBJ 4L76A 1NHLA 3GW6A 3H1ID 2OYHA 2H89C 3RK3D 1G1IA 5AVZB 3AE2C 2B87B 5GTHH 3VMYA 4QMAA 3L74D 1RQUA 1FOSE 3FXDA 1LT9A 1ZMEC 2H7HA 3H32B 2O1JA 4RO0A 1BE3E 2JWAA 1JM0A 1W5CE 1R5LA 1KQSO 1K04A 5BVZA 1GTWA 1EQ7A 5BU8B 3RK3B 3AE6C 4D6TD 1DEBA 3A0HH 1SQPG 1Q86Q 3CLQA 2Q6QA 1KV4A 3M9HA 3RK2D 1L0NK 3EFFK 2HPCA 1Y47A 5KJ7A 3CCJP 3L70D 2KUBA 2JO1A 2C9NY 2V7QH 3SFEC 4YXDC 1NTZK 1URQD 4PD4H 1PP9D 1SQXG 3HD7C 1T6AA 1KB9H 2K9JB 2NRGA 4YTPC 1L4AC 3G71P 3QWOC 2A45H 3OA7A 1NU1E 1ZRTE 3RK2B 4BRYA 1HBWA 3O6QA 1D7MA 4WVZA 3TDKA 4KJMA 1S5LE 3SWKA 1BSNA 2BCCG 4U3FD 2NPSD 2D2CC 4U7JA 3CCRP 2WPSA 4TT3H 4OWFA 4DCKA 2XKMA 1LJ2A 2R5DA 1SQVK 2K3RA 1Q82Q 3CI9A 1SQBJ 1HF9A 1FJPA 3B8EB 3VYIA 4C7NB 1BSHA 3TGUD 5KLVG 1N73B 2I1JA 3BASA 3SSUA 3QH9A 2NPSB 5AW5B 1YJNP 3H1HD 1VPCA 3I5CA 2UWJE 1NKZB 2YNYA 3AEDC 1GMJA 2RH0A 1CI6B 1MFZA 3AE5C 3CXHH 2Z5HA 3VN0A 2L5GB 4K3AA 4BXLA 1VQPP 3H1KD 1S2EA 2ZVNB 3HE4A 4IFMA 2AXTE 1SQQD 5B5EE 1EDJA 1VF5C 3H1LE 3A0BE 3VP9A 1USEA 1J1EB 1T3UA 5C39A 1PGPA 1Z56A 1FZGA 1PGJA 2FYUG 2HG5D 5CJ0A 2IBZD 2XU6A 3C1LA 1S5LX 2YXQB 3V2QA 3AE4C 1DEEG 3AE1C 1NH4A 3V2NA 2QG4A 4WB4A 2K37A 3CD6P 2IX7C 2L91A 5APQA 1EZVE 3BATA 2PGDA 2YO2A 3OAKA 2JP3A 3HD7D 1LT1A 1L0NE 4UB8E 2YKQA 3GHGA 1L4AD 2FFDC 1NTKD 2FYNC 1NTZE 4XE5B 3PP5A 3VMAA 5M1BA 3MUDA 3H1IJ 1A02F 3WUTA 2OTLP 3OJAB 4A7PA 1YIJP 2I1KA 4MN4C 1OVUA 2QRXA 3L74J 1AQ5A 3L75G 3A2AA 1HH0A 2D2CD 1KILA 2R32A 1KYOH 1XTCC 3HD7B 1NOHA 1OW7A 4GODA 1L4AB 5H2FE 1EC5A 2C0WA 3T97B 1QL1A 1LNQA 1BGYE 2WSCJ 4D6TJ 1GL2A 1BE3D 1SQVE 1FDMA 3BRVB 1H8AA 2D2CB 3AEAC 2GUVA 1RF1A 3AE3C 5CCHC 4DOJA 1LTTC 3Q3DA 2YKOA 3L70J 2OTJP 4K35A 1URQA 3BVHA 3CC7P 1VL2A 2POHA 1T8ZA 1PP9J 3H1JG 4ZNCA 2FBWC 3V2RA 1M7LA 1NTKK 2W6AA 3ITKA 4AYCA 1VF5D
chains in the Genus database with same CATH topology
1EDIA 1LP1B 5CBOA 3RGUA 4CPGA 2B87A 1S3JA 1U7JA 4JBZA 3MZWB 1SS1A 2QVAA 4GOEA 1MFTA 4MN4C 4WWIA 1BDDA 1JMBA 2UWJE 2Q1KA 2M0BA 1OVUA 2QRXA 4HJGH 4EYYQ 1OVRA 4HKZH 2KI7B 2OTKE 2KIKA 1Y47A 2RKLA 4K3AA 4BXLA 2KUBA 1LP1A 4GODA 2WMMA 1EDLA 2M5AB 5K5GB 2LXCB 1ZXGA 1EC5A 1H0TB 1OVVA 2HR3A 2B89A 3S1KA 2KS1B 2R44A 5CBNA 1EDJA 5DJUB 1NVOA 2LR2A 1FC2C 2LXBA 3QWOC 4NPDA 5C39A 4NPFX 4GOFA 3MHVA 4ZMDA 4IOIH 1ZW0A 2B88A 2KZJA 4HB1A 2M5AA 1Q2NA 4KJMA 1H0TA 2KZIA 1DEEG 3PH0A 2B87B 2P58A 1X0TA 4K35A 3FXDA 1EDKA 4ASVA 1U7MA 4ASWA 2I8DA 4NPEA 5EFWB 1BDCA 3ZDMA 2K3RA 4ZNCA 2JWDA 2SPZA 1LT1A 5DJTB 1JM0A 2ZAEB 3FXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EDI A;  1LP1 B;  5CBO A;  3RGU A;  4CPG A;  2B87 A;  1S3J A;  1U7J A;  4JBZ A;  3MZW B;  1SS1 A;  2QVA A;  4GOE A;  1MFT A;  4MN4 C;  4WWI A;  1BDD A;  1JMB A;  2UWJ E;  2Q1K A;  2M0B A;  1OVU A;  2QRX A;  4HJG H;  4EYY Q;  1OVR A;  4HKZ H;  2KI7 B;  2OTK E;  2KIK A;  1Y47 A;  2RKL A;  4K3A A;  4BXL A;  2KUB A;  1LP1 A;  4GOD A;  2WMM A;  1EDL A;  2M5A B;  5K5G B;  2LXC B;  1ZXG A;  1EC5 A;  1H0T B;  1OVV A;  2HR3 A;  2B89 A;  3S1K A;  2KS1 B;  2R44 A;  5CBN A;  1EDJ A;  5DJU B;  1NVO A;  2LR2 A;  1FC2 C;  2LXB A;  3QWO C;  4NPD A;  5C39 A;  4NPF X;  4GOF A;  3MHV A;  4ZMD A;  4IOI H;  1ZW0 A;  2B88 A;  2KZJ A;  4HB1 A;  2M5A A;  1Q2N A;  4KJM A;  1H0T A;  2KZI A;  1DEE G;  3PH0 A;  2B87 B;  2P58 A;  1X0T A;  4K35 A;  3FXD A;  1EDK A;  4ASV A;  1U7M A;  4ASW A;  2I8D A;  4NPE A;  5EFW B;  1BDC A;  3ZDM A;  2K3R A;  4ZNC A;  2JWD A;  2SPZ A;  1LT1 A;  5DJT B;  1JM0 A;  2ZAE B;  3FXE A; 
#chains in the Genus database with same CATH topology
 3VMZ A;  4HYT B;  3IF4 A;  3L73 E;  2YO3 A;  3L4F A;  4CPG A;  3CX5 H;  2WSE J;  2OYI C;  2P1J A;  4JPZ B;  2HYN A;  2Q9I A;  4I2L C;  4WY4 C;  4U3F J;  1JY2 N;  3WU2 H;  1FZA A;  1NU1 D;  5AW0 B;  1ZRT D;  3Q2Y A;  2KOG A;  1JEK A;  1VF5 B;  2Z5I A;  2GUS A;  3FGA D;  3N4X A;  2R3S A;  1OVV A;  4Z1M H;  1VQL P;  5B66 E;  5KAF H;  3CC4 P;  3TGU J;  2PAJ A;  1X9V A;  2QSI A;  2ZJS E;  3CWB G;  1Y8A A;  3P7K A;  3LW5 H;  2O01 J;  3Q5P A;  3SFD C;  3HUS A;  3H1H J;  2BEQ D;  1YI2 P;  4IOI H;  1M56 D;  1PL5 A;  3PTZ A;  3BCC E;  1VQ9 P;  1OZH A;  3H1K J;  3M0D C;  2FFD B;  1KOR A;  2FYN B;  3HTK B;  1J1D C;  2WSF J;  1ZV8 A;  2PP6 A;  2SPZ A;  3P8C E;  4H13 D;  1HTL C;  1M1J C;  1SQQ J;  3H1K E;  1L0L J;  4DT0 A;  5CBO A;  3RK2 C;  2YMY A;  5AVV B;  1ZR2 A;  1WMK A;  5KTB A;  1LGH B;  1GW4 A;  3RBX A;  1PPJ E;  1N2D C;  1MFT A;  1HJ0 A;  5CCH D;  4N6J A;  3H1L D;  3JC2 2;  3L71 E;  2OTK E;  3CCL P;  1KC8 Q;  2QIW A;  4H13 B;  3CPW O;  5AVX B;  2WMM A;  2RN0 A;  1VQ4 P;  1K9M Q;  4PD4 I;  1KQG B;  3A0H E;  1NTK J;  3AEF C;  3T97 A;  3JSV C;  3D70 A;  5AW3 B;  1EZV D;  4GOF A;  1L0N D;  1NTK E;  3L72 E;  1VQ6 P;  1ZW0 A;  4WY4 D;  1NTZ D;  4PD4 E;  3TNU B;  1P84 H;  1KB9 E;  5APX A;  5KLI B;  1SQB G;  3HE5 A;  3M0A A;  5CCG C;  1BDC A;  1N7S A;  2OYI B;  1J1E C;  4WY4 B;  3V4Q A;  3F89 A;  1BE3 J;  1QL2 A;  1XTG B;  2G8Y A;  2BCC D;  4N3Y B;  2Q5U A;  2MJZ A;  1T2K C;  1YTZ T;  2W90 A;  3II6 A;  1BGY D;  4W7Y A;  1JTH B;  3CXH I;  1SQV D;  1SFC D;  2LKM A;  1LTJ B;  1PZQ A;  5CHX A;  1S1C X;  4O9B A;  3CCE P;  1LP1 A;  2YKP A;  3RL0 g;  2QM7 A;  4C46 A;  2M5A B;  2LXC B;  3Q5R A;  4AUW A;  1SQP K;  3S1K A;  3AEC C;  3G6E P;  5APS A;  4DZO A;  3CXH E;  1RHZ B;  4ZMD A;  4PV1 D;  1SFC B;  1HJB A;  3C8V A;  1KFM A;  3L73 D;  1NU1 J;  2IYO A;  2CK3 H;  1X79 B;  4KT0 J;  1SQX K;  2N1T C;  1J1D B;  3CCV P;  1M1J B;  1FZF A;  2ZXE B;  4TLF A;  2GM4 A;  3FWN A;  2OAR A;  5AVR B;  5AW8 B;  2W8Z A;  1Q81 Q;  4PJ0 H;  4M3L A;  2E74 C;  3GF7 A;  4PV1 B;  3H1I G;  1BCC E;  4JQ0 D;  1DH3 A;  2CPS A;  3CCM P;  1SS1 A;  3L74 G;  5APV A;  5E79 H;  1FZC A;  4HJG H;  4EYY Q;  4IL6 H;  2WT7 B;  3NFQ A;  3GF3 A;  4IL6 X;  3F5H A;  5KLV K;  5CCG D;  2BEZ F;  4JF7 A;  3BCC D;  1X8Y A;  2E5T A;  2A06 E;  4D6T G;  3IR9 A;  3WMM 0;  2FKW B;  1NVO A;  2XDJ A;  1T3J A;  2IZ0 A;  2KSJ A;  2ZT9 D;  3G3Z A;  3P8C D;  1M57 D;  1KYO E;  1T2K D;  1OIP A;  3H1L J;  5KAI H;  3L70 G;  1LT9 C;  2WSS H;  4H0L C;  1Q2N A;  5AW1 B;  1IFP A;  2Q7C A;  3L37 A;  4N78 E;  1LTB C;  2KS1 A;  3UIA A;  1PPJ D;  1PP9 G;  1EZV I;  4EIJ A;  1EDK A;  3KQG A;  1FU1 A;  1JY2 O;  2P67 A;  3EFG A;  1RF0 A;  2IFN A;  3U1A A;  4JYB A;  1N86 A;  3L71 D;  3M9Q A;  2FYU K;  3W67 A;  4Y99 B;  4L73 A;  1AVO A;  2ZT9 B;  3G9R A;  1VQO P;  3TYY A;  2YXR B;  3RGU A;  2B87 A;  3CX5 I;  1L0N J;  4RES B;  1JY2 P;  4U3F G;  1GK4 A;  1YJW P;  2QVA A;  5KJ7 C;  3H32 A;  1SQP E;  1JY3 O;  1NTZ J;  2KXP B;  1A02 J;  4WWI A;  2N1T D;  5AW7 B;  3B5N D;  2K1A A;  2AEJ A;  2CPB A;  1VQN P;  3L72 D;  3LID A;  4XA4 A;  2FXP A;  2J58 A;  3CX5 E;  3TGU G;  1FS0 E;  4PD4 D;  1NTM G;  3TSI A;  1SQX E;  1H0T B;  5AW9 B;  1KB9 D;  2E74 D;  3MD0 A;  3Q1M A;  1YBK A;  3G4S P;  3H1H G;  3WU2 E;  2BCC J;  1N7L A;  1IK7 A;  2N1T B;  2JEE A;  1LWU B;  5AW4 B;  3MHV A;  3B5N B;  4UB6 E;  1YQ3 C;  1BGY J;  2WWW A;  2M3B A;  2FYZ A;  2DW3 A;  2BCC E;  1SQV J;  4H13 C;  1M1K Q;  1U57 A;  2E5Y A;  2P2U A;  2K9J A;  2ZVO B;  5AVS B;  5KAF E;  1K05 A;  2E74 B;  1NAY A;  1SQQ G;  2XND H;  4NPE A;  5EFW B;  3JCU H;  1WT6 A;  1L0L G;  1KTM A;  3FX0 A;  1FE6 A;  1KIL E;  3L36 A;  3IFM A;  2JR8 A;  1G2C B;  2HOD B;  1KMI Z;  4W80 A;  5KLV E;  2IBZ G;  2KNC B;  1JOC A;  5APU A;  3N7N A;  3MGN A;  2Y9Y A;  4JBZ A;  3L73 J;  3MZW B;  1MZ9 A;  4H0L D;  5GTI H;  1E5W A;  3CXH D;  1M90 Q;  2RKL A;  2W6J H;  1YTZ I;  3D6Y A;  2PRR A;  2WPQ A;  4C7N A;  2OYO A;  2XZR A;  4EDF A;  1Q90 D;  2OYH B;  5K5G B;  2QJY B;  3KXD A;  2M8R A;  1N73 A;  3GLM A;  3TK1 A;  3H6P A;  5CMZ A;  2NPS A;  5APW A;  1LTA C;  1ZOY C;  1PGQ A;  3IN6 A;  1LT9 B;  2E42 A;  4H0L B;  1CI6 A;  4GT1 A;  1KFN A;  4UB6 H;  4BWN A;  5KJ7 D;  3KDP B;  2FYU E;  3D71 A;  2B88 A;  3P32 A;  4YXW H;  3AE8 C;  1LTJ C;  1BCC D;  2KYV A;  1PGO A;  1YIT P;  4WBA A;  1ZP0 C;  1JY3 N;  3GHG C;  1OW8 A;  4AQR D;  3E7K A;  1QVF O;  3BCC J;  2O01 N;  2H43 A;  1NYH A;  3ZDM A;  2JWD A;  2JDI H;  3O8Z A;  2HPC B;  1BE3 G;  2IPP A;  2IFM A;  3FXE A;  3SWY A;  4RJT A;  5AVW B;  3B71 A;  1OFC X;  3FWL A;  1SFC C;  3GMA A;  1P84 E;  3GG2 A;  1NTM E;  3PLN A;  2A06 D;  1GU4 A;  1KIL C;  3CMA P;  2Q3E A;  1GDT A;  3L75 E;  2P10 A;  1OVR A;  4LC1 A;  2KIK A;  3NMD A;  1KYO D;  3VTP C;  4BRY B;  3L71 J;  3O6Q B;  1EDL A;  2WIT A;  1GW3 A;  3KZI H;  5L8R J;  1RE4 C;  1GL2 C;  1CZQ A;  4PV1 C;  4N78 D;  1RH5 B;  3PJS K;  3P8M C;  3V2P A;  2KB7 P;  2K9Y A;  1YHQ P;  1SLQ A;  2W27 A;  4NPD A;  5TJH A;  3HD7 A;  1M8O B;  1NU1 G;  1MKM A;  4RKU J;  1MV8 A;  2WSE H;  1CW5 A;  1L4A A;  1QX8 A;  2KZJ A;  3PRJ A;  2Y0E A;  1KB9 I;  3L72 J;  2V7Q J;  4ZKP A;  2P58 A;  1X0T A;  1W2B O;  2MKV A;  2A45 I;  1SQP D;  3S9O A;  2ITA A;  2J59 M;  3H1J E;  1QEX A;  2ZYD A;  1JNM A;  4GKG A;  3AEG C;  3RL0 C;  3MP7 B;  3U1C A;  2HOD A;  1KQL A;  3CX5 D;  2PFX A;  1SQX D;  2ZFC A;  1VQ7 P;  1SQB K;  3HE4 B;  3ABV C;  1AQT A;  1OX3 A;  4GOE A;  2O01 H;  1BDD A;  1HVV A;  1NO4 A;  1IJD B;  2YMK A;  4PJ0 E;  4H44 C;  5TIS H;  2QEX P;  2QA4 P;  1GD2 E;  4LGD E;  1X22 A;  1NAF A;  4Y99 C;  1CSB A;  2IDB A;  3WUV A;  1ZLL A;  3H25 A;  2ZT9 C;  1ZXG A;  2B89 A;  2WSF H;  3HUS C;  2AEF A;  1RQV A;  2P7J A;  3CWB E;  5E79 E;  5DJU B;  1ZR4 A;  1JMM A;  1S9K E;  3H1L G;  1FOS F;  2WVR A;  1IFJ A;  1RE3 C;  1KIL D;  4IL6 E;  1K8A Q;  3GHG B;  4DJG A;  1ZN5 A;  5KLV D;  2R3C A;  4ZKU A;  2KZI A;  4GIF A;  1IFN A;  3IAO A;  3S4R A;  1AFO A;  3CCQ P;  3WUU A;  2QJP C;  1NKN A;  2Y9Z A;  1KD1 Q;  1QLE D;  3LIE A;  1GL2 D;  1EZV G;  2YIU C;  3L35 A;  5DJT B;  2KLU A;  1L0N G;  5KAI E;  1KIL B;  1K73 Q;  1FDO A;  1LWU C;  3B5N C;  1DIP A;  2OQQ A;  2N9Y B;  1NTZ G;  2WTY A;  3E1R A;  2FFD A;  1W2E A;  1BCC J;  3HTK A;  2FXO A;  3E1I A;  5BU5 A;  2Q1K A;  1AA0 A;  4OGQ C;  3MTU E;  2KI7 B;  1GL2 B;  1AJY A;  2FYU D;  3M9B A;  2WPV B;  1J2J B;  2JKV A;  1RF1 B;  3W68 A;  1FBM A;  4L74 A;  3RL0 D;  1URQ B;  1BGY G;  1KZU B;  1KYO I;  5APT A;  2VRS A;  1SQV G;  2WPR A;  1LTI C;  2J5U A;  2K88 A;  2W83 C;  4H44 D;  2KLV A;  2Y0C A;  1P84 D;  1N7S C;  2OYH C;  1NTM D;  1SQB E;  2QJY C;  3VMX A;  3RL0 B;  4ASV A;  3VP8 A;  4ASW A;  5CCH A;  1G1J A;  1YYC A;  2I8D A;  3L75 D;  3HRN A;  5APY A;  1RY3 A;  3A5T A;  2AXC A;  3M06 A;  4I7Z C;  3L73 G;  3TNU A;  2BAS A;  2HLO A;  1S3J A;  1EXJ A;  4H44 B;  3EQ2 A;  1DX7 A;  1S4X A;  1AVY A;  1OWA A;  2GA1 A;  3JCU E;  4IFD K;  2OYI A;  1SQP J;  1L0L D;  1E79 H;  2Z4E A;  2E75 C;  2WZ7 A;  3HUS B;  4WY4 A;  5KKZ C;  1S5L H;  4GDO A;  3KYQ A;  3AE7 C;  1L2P A;  2V4H A;  5GTI E;  1JO5 A;  5CBN A;  4JYC A;  2E76 C;  1VQM P;  1SQX J;  3H1J D;  1JTH A;  5AW2 B;  1VDF A;  1USD A;  1H89 A;  1LTJ A;  2JJL A;  1OW6 A;  3CME P;  1PFI A;  1JCD A;  2QJP B;  3A7O A;  1JY3 P;  3OW2 O;  4XFJ A;  2HFE D;  1NTM K;  2M5A A;  4OGQ D;  3VOP A;  5AVT B;  3D6Z A;  1EXI A;  3PH0 A;  2O3J A;  1FZE A;  2YIU B;  1GK6 A;  3BCC G;  4EOT A;  3R4Y A;  2QE7 H;  3CL3 D;  1S72 P;  2QJK C;  1SFC A;  3AEB C;  3EWK A;  2ZAE B;  2C9L Y;  3M0D A;  3H1I E;  1VQ8 P;  2XNX A;  3H1K G;  4C7R A;  3LW5 J;  2OGU A;  3RK3 E;  3USS A;  1FZC C;  4W7Z A;  4OGQ B;  2XV5 A;  1M1J A;  5AW6 B;  3L74 E;  1SP4 A;  1SQQ K;  2NZ2 A;  2AXT H;  5KLV J;  2KK7 A;  1PPJ G;  5CJ4 A;  3CWB D;  1L0L K;  5B5E H;  1FDI A;  2H88 C;  1JMB A;  2ZYA A;  1S9K D;  4I1L A;  2ZXX A;  3A0B H;  1N7S D;  3L71 G;  1IK9 A;  1RE4 A;  2WQY C;  1HUC A;  4IFF A;  1PIX A;  4D6T E;  3M91 A;  2E43 A;  1GU5 A;  1DD4 A;  3NTN A;  1H88 A;  3CCU P;  1FJK A;  3HE5 B;  1HGV A;  1FC2 C;  2KSE A;  2QM8 A;  1Y9B A;  3I55 P;  4R4L A;  2WT7 A;  3BRT B;  3K5B A;  1N7S B;  1HWT C;  3TF5 A;  4UB8 H;  3L70 E;  2AEM A;  1NTK G;  3L72 G;  3KZI E;  1NWQ A;  2IYP A;  1RF0 C;  2FYU J;  1FZB A;  3I56 P;  3SWF A;  2E75 D;  1PP9 E;  1QVG O;  3Q5S A;  4I7Z B;  1LTS C;  4LLH A;  1FAV A;  3U59 A;  2A45 G;  2N9B A;  4HH2 A;  2E76 D;  1IFI A;  3CC2 P;  5CCG A;  1NGM B;  3NXS A;  1JUN A;  1LP1 B;  1P84 I;  1KN7 A;  1YJ9 P;  2H8P D;  4U3F E;  1PV3 A;  5H2F H;  5AVY B;  1LTG C;  1WRG A;  1IZN B;  2E75 B;  1YQ4 C;  2M3E A;  1JB0 J;  3A3Y B;  1R8E A;  3MUD C;  2R5B A;  1NTM J;  5KKZ B;  4EI2 A;  3RK3 C;  3V4W A;  5AVU B;  3L75 J;  3RBZ A;  2E76 B;  1DD3 A;  3TGU E;  2WSC H;  2IZ1 A;  1VQ5 P;  2HR3 A;  4KHX A;  4OH8 B;  5KLI C;  1SQB D;  3V5B A;  2C0X A;  1RE3 A;  2G3A A;  1GZL A;  3H1H E;  2LR2 A;  1IC2 A;  3CCS P;  2RMZ A;  3KHU A;  1TU3 F;  3R2P A;  5TIS E;  3KPE A;  3AE9 C;  2KP8 A;  4B86 A;  4HB1 A;  2IBZ I;  1OXZ A;  1H0T A;  1UII A;  3B4S A;  1SVF A;  1OMI A;  4YPC A;  2QJK B;  3AEE C;  1HGZ A;  3C9I A;  5GTH E;  1RF1 C;  1SQQ E;  1U7M A;  1IO4 A;  1L0L E;  2N1T A;  2Q3I A;  1NU1 K;  1FZC B;  1LWU A;  3B5N A;  1N8R Q;  1URQ C;  1UIX A;  2O1K A;  3MIW A;  3H1J J;  1EDI A;  2B9B A;  1KQF B;  2IBZ E;  1BCC G;  1U7J A;  1JCC A;  5B66 H;  3V6I A;  2Y0D A;  1AV1 A;  2M0B A;  4I6M C;  4HKZ H;  1G2C A;  1R5S A;  1N73 C;  4L75 A;  2NPS C;  1VQK P;  2KNC A;  1MUU A;  2W6B A;  1IFM A;  2ZYG A;  4Y28 J;  3PHL A;  1IFD A;  2A06 G;  2KS1 B;  2R44 A;  1QGK B;  5AVQ B;  2LXB A;  2FXM A;  1Q7Y Q;  1NJI Q;  4R4M A;  4NPF X;  4OVN F;  2FY8 A;  3CWB J;  4L76 A;  1NHL A;  3GW6 A;  3H1I D;  2OYH A;  2H89 C;  3RK3 D;  1G1I A;  5AVZ B;  3AE2 C;  2B87 B;  5GTH H;  3VMY A;  4QMA A;  3L74 D;  1RQU A;  1FOS E;  3FXD A;  1LT9 A;  1ZME C;  2H7H A;  3H32 B;  2O1J A;  4RO0 A;  1BE3 E;  2JWA A;  1JM0 A;  1W5C E;  1R5L A;  1KQS O;  1K04 A;  5BVZ A;  1GTW A;  1EQ7 A;  5BU8 B;  3RK3 B;  3AE6 C;  4D6T D;  1DEB A;  3A0H H;  1SQP G;  1Q86 Q;  3CLQ A;  2Q6Q A;  1KV4 A;  3M9H A;  3RK2 D;  1L0N K;  3EFF K;  2HPC A;  1Y47 A;  5KJ7 A;  3CCJ P;  3L70 D;  2KUB A;  2JO1 A;  2C9N Y;  2V7Q H;  3SFE C;  4YXD C;  1NTZ K;  1URQ D;  4PD4 H;  1PP9 D;  1SQX G;  3HD7 C;  1T6A A;  1KB9 H;  2K9J B;  2NRG A;  4YTP C;  1L4A C;  3G71 P;  3QWO C;  2A45 H;  3OA7 A;  1NU1 E;  1ZRT E;  3RK2 B;  4BRY A;  1HBW A;  3O6Q A;  1D7M A;  4WVZ A;  3TDK A;  4KJM A;  1S5L E;  3SWK A;  1BSN A;  2BCC G;  4U3F D;  2NPS D;  2D2C C;  4U7J A;  3CCR P;  2WPS A;  4TT3 H;  4OWF A;  4DCK A;  2XKM A;  1LJ2 A;  2R5D A;  1SQV K;  2K3R A;  1Q82 Q;  3CI9 A;  1SQB J;  1HF9 A;  1FJP A;  3B8E B;  3VYI A;  4C7N B;  1BSH A;  3TGU D;  5KLV G;  1N73 B;  2I1J A;  3BAS A;  3SSU A;  3QH9 A;  2NPS B;  5AW5 B;  1YJN P;  3H1H D;  1VPC A;  3I5C A;  2UWJ E;  1NKZ B;  2YNY A;  3AED C;  1GMJ A;  2RH0 A;  1CI6 B;  1MFZ A;  3AE5 C;  3CXH H;  2Z5H A;  3VN0 A;  2L5G B;  4K3A A;  4BXL A;  1VQP P;  3H1K D;  1S2E A;  2ZVN B;  3HE4 A;  4IFM A;  2AXT E;  1SQQ D;  5B5E E;  1EDJ A;  1VF5 C;  3H1L E;  3A0B E;  3VP9 A;  1USE A;  1J1E B;  1T3U A;  5C39 A;  1PGP A;  1Z56 A;  1FZG A;  1PGJ A;  2FYU G;  2HG5 D;  5CJ0 A;  2IBZ D;  2XU6 A;  3C1L A;  1S5L X;  2YXQ B;  3V2Q A;  3AE4 C;  1DEE G;  3AE1 C;  1NH4 A;  3V2N A;  2QG4 A;  4WB4 A;  2K37 A;  3CD6 P;  2IX7 C;  2L91 A;  5APQ A;  1EZV E;  3BAT A;  2PGD A;  2YO2 A;  3OAK A;  2JP3 A;  3HD7 D;  1LT1 A;  1L0N E;  4UB8 E;  2YKQ A;  3GHG A;  1L4A D;  2FFD C;  1NTK D;  2FYN C;  1NTZ E;  4XE5 B;  3PP5 A;  3VMA A;  5M1B A;  3MUD A;  3H1I J;  1A02 F;  3WUT A;  2OTL P;  3OJA B;  4A7P A;  1YIJ P;  2I1K A;  4MN4 C;  1OVU A;  2QRX A;  3L74 J;  1AQ5 A;  3L75 G;  3A2A A;  1HH0 A;  2D2C D;  1KIL A;  2R32 A;  1KYO H;  1XTC C;  3HD7 B;  1NOH A;  1OW7 A;  4GOD A;  1L4A B;  5H2F E;  1EC5 A;  2C0W A;  3T97 B;  1QL1 A;  1LNQ A;  1BGY E;  2WSC J;  4D6T J;  1GL2 A;  1BE3 D;  1SQV E;  1FDM A;  3BRV B;  1H8A A;  2D2C B;  3AEA C;  2GUV A;  1RF1 A;  3AE3 C;  5CCH C;  4DOJ A;  1LTT C;  3Q3D A;  2YKO A;  3L70 J;  2OTJ P;  4K35 A;  1URQ A;  3BVH A;  3CC7 P;  1VL2 A;  2POH A;  1T8Z A;  1PP9 J;  3H1J G;  4ZNC A;  2FBW C;  3V2R A;  1M7L A;  1NTK K;  2W6A A;  3ITK A;  4AYC A;  1VF5 D; 
#chains in the Genus database with same CATH homology
 1EDI A;  1LP1 B;  5CBO A;  3RGU A;  4CPG A;  2B87 A;  1S3J A;  1U7J A;  4JBZ A;  3MZW B;  1SS1 A;  2QVA A;  4GOE A;  1MFT A;  4MN4 C;  4WWI A;  1BDD A;  1JMB A;  2UWJ E;  2Q1K A;  2M0B A;  1OVU A;  2QRX A;  4HJG H;  4EYY Q;  1OVR A;  4HKZ H;  2KI7 B;  2OTK E;  2KIK A;  1Y47 A;  2RKL A;  4K3A A;  4BXL A;  2KUB A;  1LP1 A;  4GOD A;  2WMM A;  1EDL A;  2M5A B;  5K5G B;  2LXC B;  1ZXG A;  1EC5 A;  1H0T B;  1OVV A;  2HR3 A;  2B89 A;  3S1K A;  2KS1 B;  2R44 A;  5CBN A;  1EDJ A;  5DJU B;  1NVO A;  2LR2 A;  1FC2 C;  2LXB A;  3QWO C;  4NPD A;  5C39 A;  4NPF X;  4GOF A;  3MHV A;  4ZMD A;  4IOI H;  1ZW0 A;  2B88 A;  2KZJ A;  4HB1 A;  2M5A A;  1Q2N A;  4KJM A;  1H0T A;  2KZI A;  1DEE G;  3PH0 A;  2B87 B;  2P58 A;  1X0T A;  4K35 A;  3FXD A;  1EDK A;  4ASV A;  1U7M A;  4ASW A;  2I8D A;  4NPE A;  5EFW B;  1BDC A;  3ZDM A;  2K3R A;  4ZNC A;  2JWD A;  2SPZ A;  1LT1 A;  5DJT B;  1JM0 A;  2ZAE B;  3FXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...