2B89A

Structural basis for molecular recognition in an affibody:affibody complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
58
structure length
58
Chain Sequence
VDNKFNKERVIAIGEIMRLPNLNSLQVVAFINSLRDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for molecular recognition in an affibody:affibody complex.
pubmed doi rcsb
molecule keywords anti-ZTaq affibody
molecule tags Protein binding
source organism Staphylococcus aureus
total genus 17
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2005-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2b89A00
4ASWA 3FXEA 3PH0A 4GODA 4KJMA 2I8DA 4HJGH 3MZWB 1NVOA 2B89A 1H0TA 4BXLA 2OTKE 2WMMA 3MHVA 1X0TA 4NPFX 2JWDA 1OVUA 4ZMDA 2LR2A 2KUBA 1U7JA 2KIKA 2RKLA 1OVVA 5K5GB 2UWJE 2KI7B 2P58A 1JMBA 4WWIA 1Y47A 2KZJA 2LXCB 4K3AA 1EDKA 3ZDMA 2LXBA 3RGUA 1MFTA 1H0TB 5DJTB 2B87A 4CPGA 2M0BA 4GOFA 1DEEG 2SPZA 1FC2C 1OVRA 1SS1A 1JM0A 1U7MA 2M5AA 5DJUB 4HKZH 1BDDA 4HB1A 3FXDA 2Q1KA 4GOEA 1LP1A 4K35A 4MN4C 5EFWB 2B87B 1EDJA 2KS1B 1Q2NA 1EC5A 1ZW0A 5C39A 1LT1A 2R44A 4JBZA 1S3JA 4ASVA 1ZXGA 4IOIH 5CBOA 2HR3A 2K3RA 3QWOC 1EDIA 2B88A 2ZAEB 4ZNCA 2M5AB 5CBNA 2QVAA 1BDCA 1LP1B 3S1KA 4NPDA 2QRXA 1EDLA 4NPEA 4EYYQ 2KZIA
chains in the Genus database with same CATH superfamily
1TU3F 1H0TA 2WT7B 1CI6B 4DOJA 4JYCA 2W90A 1KFMA 2HFED 2D2CD 4EDFA 2N9BA 2YXRB 3ABVC 3BCCG 1OW6A 4WWIA 2MKVA 1CZQA 1HGZA 1RF1C 2O01H 5KLVK 1S5LH 5KLVG 2SPZA 1GL2A 1T6AA 1ZR4A 5KAFE 1HWTC 5CCGC 4U3FE 2P10A 3RBZA 3AE1C 3VOPA 2KSEA 3FGAD 1SVFA 1RF0A 1SQBJ 3A0HE 1Q90D 1GU5A 1VQNP 2IYPA 1MKMA 4H44C 1FZEA 3M9BA 1YYCA 5AW3B 1Q81Q 3L36A 2HR3A 3AE8C 3PJSK 2M5AB 3WUUA 1Z56A 1BSHA 1NTZG 3B71A 4BWNA 1JO5A 1KQSO 4N3YB 1JUNA 5GTHE 3I5CA 3JCUE 3L74G 1P84I 3CCVP 2G8YA 3L73E 1KB9D 1NTZJ 5AVYB 1X0TA 2JP3A 3CX5H 4R4LA 1OVUA 4WB4A 5AVVB 1FZAA 3Q5RA 3L74J 3BRTB 3HE5B 1LTBC 2M3EA 2J5UA 1H88A 2YIUC 1FZFA 4K3AA 1NTMK 1MFZA 2YIUB 3C1LA 4W80A 1SLQA 1AVYA 3CI9A 4WY4A 1BGYJ 1UIXA 2W8ZA 2WTYA 3TSIA 3CCQP 2AXTE 2ZVNB 5B5EE 4LC1A 3OW2O 2Y9ZA 3CD6P 4IFFA 2PGDA 3EWKA 1L4AD 3BCCE 4D6TG 1GD2E 2P1JA 1FBMA 4GIFA 1HJ0A 1KYOI 3PRJA 1DIPA 3KXDA 5KLVE 2E74C 5BU5A 1JTHA 5CBOA 3V2QA 1SFCA 2K3RA 3W67A 3S9OA 2E74B 4GKGA 1J1EC 1LTJA 3I55P 2IBZI 3FWNA 4HJGH 4H13B 1NTKK 1NTKG 3RL0D 3OAKA 3HUSC 2WVRA 2Q7CA 2AEJA 1JOCA 3TNUA 1UIIA 3HUSB 2BCCD 1YJNP 1ZR2A 1SQPD 4ZMDA 1E79H 5CMZA 4UB6H 1NO4A 5APVA 3CCSP 5K5GB 1VQLP 1NTZE 1S5LE 1AQ5A 3IF4A 1IC2A 4R4MA 1T8ZA 3RGUA 3O6QA 1K04A 2FYUK 2FYUG 3L74E 3AEBC 3R2PA 5AVUB 1JMMA 2CK3H 3HTKA 2GUVA 3EFGA 5AVTB 1RQUA 4H44D 2QJPC 1SQXK 2Y0CA 1SQXG 3G4SP 3AECC 2N1TA 2MJZA 3L37A 4K35A 5EFWB 3RK3E 2B87B 2NPSA 2QJPB 1OWAA 2A45H 3TNUB 1KILD 1EZVD 1NGMB 2WSFH 2I1KA 5AW2B 3Q5PA 3JC22 1EQ7A 1PP9D 3G9RA 4EIJA 2DW3A 2ZXXA 3VYIA 2K88A 2WSCH 1N7SA 1ZMEC 1T3UA 2E5YA 2QM7A 4D6TE 2FXOA 2M3BA 3W68A 1RE4A 3CX5E 1M56D 4PJ0H 4JF7A 3PHLA 2R5BA 2RN0A 1LTIC 3H1JD 2FFDA 1KC8Q 5KJ7D 3P7KA 1WMKA 3C8VA 1KQGB 1USDA 2A45G 4DJGA 3PTZA 3CXHD 3NXSA 3L70D 1SQVK 2RKLA 1SQVG 2XKMA 1L0ND 2C9LY 1DH3A 1GU4A 1PGQA 2OYOA 1MFTA 3N4XA 2YMYA 1NTKE 1W5CE 1VQ9P 3C9IA 4U7JA 3B4SA 2WSSH 1BDDA 2ZYGA 2D2CC 2WSCJ 1Q86Q 1LJ2A 3H1LG 2E42A 2D2CB 2FXPA 2KS1B 1JY2P 1QLED 4Y99C 2VRSA 3B5ND 2OYHA 2FYUE 1NHLA 1MUUA 4JQ0D 4Y99B 1T2KC 4N78D 4NPDA 1SQXE 2HPCB 3M9QA 4RKUJ 4ASWA 1L0LD 3FXEA 1NAFA 5KAIH 2O3JA 1W2EA 1OFCX 4UB6E 4GT1A 1NU1D 2OQQA 1IJDB 1URQC 1E5WA 2IFMA 4DZOA 1YI2P 1HBWA 2WZ7A 3M0DC 1VQ6P 4BRYA 2KIKA 1OVVA 3AEFC 1LTSC 1KQFB 3CWBD 2LXCB 2OTLP 2BCCJ 1SQPJ 3IAOA 1SQQD 1M1JC 4OGQD 1KD1Q 4XE5B 1D7MA 2NRGA 2YNYA 1L4AA 1U7MA 1IZNB 1AA0A 3CL3D 1JEKA 1S5LX 5AVZB 4PV1D 1OXZA 2KYVA 1GK4A 1SQVE 2W83C 3P32A 1CW5A 1GW3A 5H2FH 1JY3P 3CCEP 3N7NA 3CXHH 1EZVG 5APYA 2Q3EA 2L5GB 1ZRTD 3CC4P 1CI6A 1PP9G 2ZYAA 3U59A 1BDCA 1G2CB 1YTZI 3HD7D 4PJ0E 1A02J 1PPJD 5CJ4A 5TISH 3H1LE 1PP9J 3AE5C 3V5BA 1YQ3C 3KQGA 1FDOA 4RESB 4BXLA 1L4AB 1RE3C 2PFXA 4QMAA 1IO4A 3VMZA 4L74A 3CPWO 4NPFX 3L70G 1AJYA 4YXWH 3WU2H 2J58A 3H1JJ 5CCGA 2O1KA 3SFDC 1DD3A 5AW6B 2XNDH 4HH2A 3ZDMA 5AW4B 2KP8A 4CPGA 3L70J 1L0NJ 3AEGC 2OYIC 3RL0C 1AVOA 1FDIA 3D71A 1PFIA 2KNCB 3RL0B 3V6IA 2M5AA 3CX5I 2E76D 2YKOA 3A3YB 4XFJA 1LWUC 3H1KD 1SQBK 1SQBG 1M7LA 4I1LA 3GLMA 3L71D 1LWUB 1T2KD 1RF1B 2K37A 3A7OA 3KPEA 3SFEC 5C39A 1BCCD 1LT1A 2CPBA 4LGDE 5APTA 1N2DC 1FS0E 3E7KA 5B66H 1VQ8P 3NTNA 5KAIE 2YO3A 1P84D 2JDIH 2PRRA 2QRXA 2QIWA 3VP9A 4NPEA 3HE5A 2C0WA 1KZUB 1URQD 4PD4D 1EZVE 3CMAP 4H44B 4GDOA 2Z4EA 1KILC 1NU1G 3TF5A 1PP9E 1L0LJ 1KILB 1NTZK 1X22A 1CSBA 1HTLC 4LLHA 1Q7YQ 1NU1J 3H32B 4TLFA 3MGNA 3SWFA 1SQQG 2KLUA 1BE3D 2QEXP 2FBWC 2WSEH 1DX7A 1M1KQ 3CWBJ 1KV4A 2FY8A 5KJ7C 1PGJA 5H2FE 1SQQJ 3HE4B 1R5SA 2HODB 3L70E 1BGYG 1KYOD 2M8RA 2HLOA 4W7YA 3G71P 2FYZA 2WPQA 1SP4A 2C9NY 2ZXEB 1R8EA 4Y28J 2IBZD 1YQ4C 2CPSA 3HUSA 2B88A 5CBNA 3AE3C 1PPJG 2QM8A 1J1DC 3A0BH 3BASA 3S1KA 4KJMA 1J1DB 4A7PA 1SQBE 3H1ID 1FOSF 5AVSB 4H0LD 1K73Q 3WU2E 2WSEJ 3OA7A 3B5NC 1IFNA 2A45I 3P8CE 3S4RA 2LR2A 3B5NB 5BVZA 1IFDA 1N73C 2YXQB 1IFJA 1ZN5A 3JSVC 1ZV8A 5CJ0A 1J1EB 2P58A 4ZKUA 1N73B 1AV1A 1HVVA 2B87A 4L75A 3H1HJ 1NU1E 3F5HA 4PD4H 3D70A 1GW4A 1GMJA 5AW5B 3D6YA 3Q2YA 2QG4A 1USEA 2Q1KA 4YTPC 1ZP0C 3CLQA 2YKPA 3WMM0 5CCHD 1S4XA 1SQQE 2Q9IA 5B66E 3WUVA 5KTBA 4JBZA 4O9BA 4IL6H 3H1KJ 3GW6A 1KORA 3FWLA 3USSA 4OGQC 1KB9H 3QWOC 3L71J 3AE6C 3VN0A 1BCCJ 1X79B 4OGQB 2GM4A 1BGYE 2QSIA 3MTUE 4PV1C 3GG2A 5AVRB 1Q2NA 2KSJA 2I8DA 1JB0J 4PV1B 3MZWB 3PLNA 1WRGA 2WMMA 3MD0A 1RQVA 1M57D 3CCRP 3TGUD 3H25A 2JWDA 2FXMA 2HG5D 2KB7P 1FAVA 1VL2A 1Q82Q 3LIDA 1PPJE 3HD7C 1GL2D 2E43A 1BE3G 1FOSE 1S1CX 3HD7B 2KS1A 2M0BA 1VF5D 1DEBA 4EI2A 3CC7P 2K1AA 4DT0A 3L73D 4Z1MH 1H89A 1BE3J 3CCJP 1BSNA 3VMYA 5APXA 5M1BA 4L76A 3FXDA 1EZVI 1N86A 2NPSC 2HPCA 2E75C 1EC5A 1HF9A 1S3JA 1VQKP 3E1IA 1PIXA 3M91A 3GHGC 2LKMA 3M0DA 2R3CA 2E76C 4YXDC 3KZIH 3GHGB 3BCCD 2E76B 1FJKA 2RH0A 5AW7B 5AW9B 3TYYA 3B8EB 1VQOP 1K8AQ 5AW1B 2GA1A 1M1JA 1QEXA 3H1IJ 5KLVD 2H8PD 2Z5IA 3II6A 3U1AA 1Y9BA 3RBXA 3CC2P 2ITAA 1JMBA 3F89A 4XA4A 1EDKA 1JY3O 4WY4D 4PD4E 5DJTB 3D6ZA 1OZHA 2BCCG 1SQPK 1SQPG 2QJKC 1FC2C 3L72D 1URQB 2O1JA 2FYNC 2XDJA 1Y8AA 2QJKB 3EQ2A 3RK2D 2FYNB 1G2CA 5BU8B 3LW5H 2KK7A 1FDMA 4IL6E 1JCDA 2P2UA 3MUDA 1BE3E 2XV5A 3RL0g 1SFCD 1KB9E 3SWYA 3AEEC 2WWWA 1M1JB 1HGVA 2A06D 1NWQA 2R44A 3ITKA 1GK6A 1RE3A 1EDIA 2QE7H 1GZLA 1M8OB 2QVAA 2V4HA 3JCUH 3VMXA 1LP1B 2JO1A 4WVZA 1VPCA 2KLVA 2ZT9C 4UB8H 1NVOA 1A02F 2B89A 3RK3D 4ZKPA 4L73A 3GF3A 1NTMD 3TGUG 2Q6QA 2Y0DA 3AEDC 2H43A 2KXPB 1VQ5P 1U57A 4C7NB 2O01N 2KNCA 4AQRD 1IK7A 2UWJE 5KLIC 2BEZF 3LW5J 3TGUJ 2IZ1A 1K05A 3H1JG 4RO0A 3IR9A 3GF7A 5KLIB 4I6MC 4D6TD 2JWAA 1LWUA 1RF1A 3AE2C 3BVHA 4H0LC 1NKNA 2N1TD 1L0NK 1L0NG 4H0LB 1R5LA 1LT9C 2NPSD 3H1HD 2E75D 3H6PA 1LT9B 1OX3A 1X8YA 3L73J 4MN4C 4OH8B 1FZCC 3V4QA 2N9YB 2BASA 1JY3N 1FZCB 1N7SD 1RH5B 1MV8A 1LTTC 2BCCE 2OYIB 1SQPE 2Q3IA 1OW8A 1NTKD 1H8AA 4ZNCA 2IPPA 1KILA 3KZIE 1LTGC 2B9BA 1KMIZ 3A5TA 1VDFA 3H32A 2G3AA 3CMEP 1S9KD 5CCHC 2ZFCA 2WPVB 2W6JH 2AXCA 1M90Q 1NAYA 2K9YA 2FYUD 3TK1A 3BCCJ 1T3JA 3L75D 1KFNA 1L0LK 1L0LG 2K9JB 5AW8B 3HE4A 2HODA 2AEFA 5KJ7A 1KILE 5KLVJ 2LXBA 1NU1K 1H0TB 1SQXD 1DD4A 3L72G 2IX7C 2ZYDA 3TGUE 2RMZA 3KHUA 1JM0A 3P8MC 3CWBG 1XTCC 1SQQK 2OARA 1YIJP 2Y9YA 5L8RJ 3L72J 1NKZB 1GL2C 3H1JE 3VP8A 3L35A 4OWFA 3SSUA 2A06G 2OGUA 1ZW0A 5KKZC 1GL2B 1VF5C 1RF0C 5KKZB 1MZ9A 3CXHE 1NYHA 3K5BA 1L0NE 1OMIA 2O01J 1VF5B 1HUCA 2WQYC 4UB8E 2ZT9D 3B5NA 4IL6X 4PD4I 1YJWP 1EDLA 1N7LA 5APWA 2KZIA 1N73A 1SQVD 2OTKE 5TISE 3MHVA 1NTMG 3E1RA 3G6EP 2J59M 1EXJA 1ZOYC 1EXIA 2WPRA 1JCCA 3L4FA 3CCUP 1KB9I 1NTMJ 2KI7B 3M0AA 2KZJA 3HRNA 5E79H 3G3ZA 2W6AA 2E5TA 1VQ4P 3SWKA 3H1LD 3M9HA 2H7HA 2YMKA 3UIAA 1QL1A 4N78E 1KQLA 3H1HG 2P67A 4EOTA 2IFNA 4D6TJ 2NZ2A 2KOGA 4KT0J 1L0LE 3NFQA 4WBAA 2IZ0A 2I1JA 4GOEA 1P84H 3PP5A 1JNMA 1EDJA 1KN7A 4JPZB 4H13C 4WY4C 1YTZT 3CCMP 3L72E 4WY4B 2JEEA 4IOIH 3KDPB 2JJLA 2JKVA 3H1KG 4M3LA 5AVQB 3RK2C 3CWBE 1WT6A 1FE6A 3L71G 3I56P 1BCCG 3RK2B 1NTKJ 3PH0A 1YBKA 2IYOA 3T97A 5AVXB 1S72P 3BATA 3HD7A 2V7QH 1SFCC 2A06E 5CCGD 3U1CA 1JTHB 1SFCB 3L75G 2XZRA 4U3FD 3Q3DA 1LTJC 1OW7A 1U7JA 4DCKA 1LTJB 1ZLLA 1ZRTE 1KYOH 2Y0EA 2FYUJ 1FU1A 3L75J 1L2PA 1K9MQ 2QJYC 3Q1MA 1NTME 1LNQA 3RK3C 1X9VA 2QJYB 1IFPA 1GDTA 1PGPA 3VMAA 1LGHB 3RK3B 1SQXJ 3AE9C 5DJUB 1VQPP 3T97B 1AFOA 3O6QB 1JY2O 3GHGA 1YITP 2FKWB 2QA4P 1PV3A 4C7RA 2V7QJ 2AEMA 1NH4A 3HTKB 3O8ZA 4OVNF 2N1TC 3H1HE 3M06A 1RHZB 2N1TB 1PGOA 1QVGO 1QL2A 2NPSB 4HYTB 5APUA 4GODA 1HH0A 2E75B 3IFMA 2XU6A 4I2LC 4JYBA 2XNXA 5GTIH 3A0BE 2IBZG 1RY3A 2WPSA 2ZJSE 2H88C 1PZQA 2PAJA 1N7SC 1LTAC 1SQVJ 1URQA 4IFMA 2W27A 4B86A 2YKQA 4YPCA 2IDBA 2WSFJ 5E79E 1N7SB 2KUBA 1QGKB 3H1KE 4KHXA 1GTWA 1RE4C 3H1IG 3EFFK 3Q5SA 1IFMA 2OTJP 3L71E 1BCCE 2FFDC 3OJAB 2R5DA 4I7ZC 3FX0A 3CXHI 4GOFA 1KTMA 1S9KE 2E74D 2FFDB 1SQBD 4I7ZB 2HYNA 1OVRA 1P84E 3L75E 3H1LJ 3P8CD 4HB1A 3V2RA 3A2AA 4H13D 2Q5UA 3QH9A 5KAFH 1FZGA 1LP1A 1IFIA 3A0HH 1FJPA 3VTPC 4W7ZA 1HJBA 1J2JB 3V4WA 3AEAC 1FZBA 2L91A 4C7NA 2BEQD 1XTGB 3LIEA 4N6JA 4C46A 1NTZD 1OIPA 2OYHC 1VQ7P 3MP7B 3CCLP 1VQMP 2R3SA 2OYHB 3V2NA 2PP6A 5TJHA 1JY2N 3L74D 4IFDK 2POHA 2W6BA 5AW0B 5GTHH 4U3FG 2WITA 1IK9A 2GUSA 1KYOE 2C0XA 3MIWA 5AVWB 2JR8A 3R4YA 3TDKA 1LT9A 4AYCA 1Y47A 2P7JA 4U3FJ 1NOHA 1AQTA 2ZT9B 1BGYD 1NJIQ 1DEEG 2IBZE 1QVFO 3BRVB 3GMAA 1FZCA 2OYIA 1SS1A 2WT7A 3KYQA 1YJ9P 5APSA 4BRYB 2Z5HA 4HKZH 1S2EA 5APQA 3H1IE 4RJTA 3V2PA 4AUWA 3MUDC 2H89C 2AXTH 5B5EH 3CX5D 3AE7C 3L73G 1L4AC 2ZVOB 1N8RQ 1YHQP 1W2BO 4ASVA 1ZXGA 5CHXA 5CCHA 2ZAEB 4TT3H 1QX8A 2YO2A 1G1IA 1G1JA 5GTIE 2K9JA 3AE4C 2R32A 3IN6A 1PL5A 3NMDA 4EYYQ 3WUTA
chains in the Genus database with same CATH topology
4ASWA 3FXEA 3PH0A 4GODA 4KJMA 2I8DA 4HJGH 3MZWB 1NVOA 2B89A 1H0TA 4BXLA 2OTKE 2WMMA 3MHVA 1X0TA 4NPFX 2JWDA 1OVUA 4ZMDA 2LR2A 2KUBA 1U7JA 2KIKA 2RKLA 1OVVA 5K5GB 2UWJE 2KI7B 2P58A 1JMBA 4WWIA 1Y47A 2KZJA 2LXCB 4K3AA 1EDKA 3ZDMA 2LXBA 3RGUA 1MFTA 1H0TB 5DJTB 2B87A 4CPGA 2M0BA 4GOFA 1DEEG 2SPZA 1FC2C 1OVRA 1SS1A 1JM0A 1U7MA 2M5AA 5DJUB 4HKZH 1BDDA 4HB1A 3FXDA 2Q1KA 4GOEA 1LP1A 4K35A 4MN4C 5EFWB 2B87B 1EDJA 2KS1B 1Q2NA 1EC5A 1ZW0A 5C39A 1LT1A 2R44A 4JBZA 1S3JA 4ASVA 1ZXGA 4IOIH 5CBOA 2HR3A 2K3RA 3QWOC 1EDIA 2B88A 2ZAEB 4ZNCA 2M5AB 5CBNA 2QVAA 1BDCA 1LP1B 3S1KA 4NPDA 2QRXA 1EDLA 4NPEA 4EYYQ 2KZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ASW A;  3FXE A;  3PH0 A;  4GOD A;  4KJM A;  2I8D A;  4HJG H;  3MZW B;  1NVO A;  2B89 A;  1H0T A;  4BXL A;  2OTK E;  2WMM A;  3MHV A;  1X0T A;  4NPF X;  2JWD A;  1OVU A;  4ZMD A;  2LR2 A;  2KUB A;  1U7J A;  2KIK A;  2RKL A;  1OVV A;  5K5G B;  2UWJ E;  2KI7 B;  2P58 A;  1JMB A;  4WWI A;  1Y47 A;  2KZJ A;  2LXC B;  4K3A A;  1EDK A;  3ZDM A;  2LXB A;  3RGU A;  1MFT A;  1H0T B;  5DJT B;  2B87 A;  4CPG A;  2M0B A;  4GOF A;  1DEE G;  2SPZ A;  1FC2 C;  1OVR A;  1SS1 A;  1JM0 A;  1U7M A;  2M5A A;  5DJU B;  4HKZ H;  1BDD A;  4HB1 A;  3FXD A;  2Q1K A;  4GOE A;  1LP1 A;  4K35 A;  4MN4 C;  5EFW B;  2B87 B;  1EDJ A;  2KS1 B;  1Q2N A;  1EC5 A;  1ZW0 A;  5C39 A;  1LT1 A;  2R44 A;  4JBZ A;  1S3J A;  4ASV A;  1ZXG A;  4IOI H;  5CBO A;  2HR3 A;  2K3R A;  3QWO C;  1EDI A;  2B88 A;  2ZAE B;  4ZNC A;  2M5A B;  5CBN A;  2QVA A;  1BDC A;  1LP1 B;  3S1K A;  4NPD A;  2QRX A;  1EDL A;  4NPE A;  4EYY Q;  2KZI A; 
#chains in the Genus database with same CATH topology
 1TU3 F;  1H0T A;  2WT7 B;  1CI6 B;  4DOJ A;  4JYC A;  2W90 A;  1KFM A;  2HFE D;  2D2C D;  4EDF A;  2N9B A;  2YXR B;  3ABV C;  3BCC G;  1OW6 A;  4WWI A;  2MKV A;  1CZQ A;  1HGZ A;  1RF1 C;  2O01 H;  5KLV K;  1S5L H;  5KLV G;  2SPZ A;  1GL2 A;  1T6A A;  1ZR4 A;  5KAF E;  1HWT C;  5CCG C;  4U3F E;  2P10 A;  3RBZ A;  3AE1 C;  3VOP A;  2KSE A;  3FGA D;  1SVF A;  1RF0 A;  1SQB J;  3A0H E;  1Q90 D;  1GU5 A;  1VQN P;  2IYP A;  1MKM A;  4H44 C;  1FZE A;  3M9B A;  1YYC A;  5AW3 B;  1Q81 Q;  3L36 A;  2HR3 A;  3AE8 C;  3PJS K;  2M5A B;  3WUU A;  1Z56 A;  1BSH A;  1NTZ G;  3B71 A;  4BWN A;  1JO5 A;  1KQS O;  4N3Y B;  1JUN A;  5GTH E;  3I5C A;  3JCU E;  3L74 G;  1P84 I;  3CCV P;  2G8Y A;  3L73 E;  1KB9 D;  1NTZ J;  5AVY B;  1X0T A;  2JP3 A;  3CX5 H;  4R4L A;  1OVU A;  4WB4 A;  5AVV B;  1FZA A;  3Q5R A;  3L74 J;  3BRT B;  3HE5 B;  1LTB C;  2M3E A;  2J5U A;  1H88 A;  2YIU C;  1FZF A;  4K3A A;  1NTM K;  1MFZ A;  2YIU B;  3C1L A;  4W80 A;  1SLQ A;  1AVY A;  3CI9 A;  4WY4 A;  1BGY J;  1UIX A;  2W8Z A;  2WTY A;  3TSI A;  3CCQ P;  2AXT E;  2ZVN B;  5B5E E;  4LC1 A;  3OW2 O;  2Y9Z A;  3CD6 P;  4IFF A;  2PGD A;  3EWK A;  1L4A D;  3BCC E;  4D6T G;  1GD2 E;  2P1J A;  1FBM A;  4GIF A;  1HJ0 A;  1KYO I;  3PRJ A;  1DIP A;  3KXD A;  5KLV E;  2E74 C;  5BU5 A;  1JTH A;  5CBO A;  3V2Q A;  1SFC A;  2K3R A;  3W67 A;  3S9O A;  2E74 B;  4GKG A;  1J1E C;  1LTJ A;  3I55 P;  2IBZ I;  3FWN A;  4HJG H;  4H13 B;  1NTK K;  1NTK G;  3RL0 D;  3OAK A;  3HUS C;  2WVR A;  2Q7C A;  2AEJ A;  1JOC A;  3TNU A;  1UII A;  3HUS B;  2BCC D;  1YJN P;  1ZR2 A;  1SQP D;  4ZMD A;  1E79 H;  5CMZ A;  4UB6 H;  1NO4 A;  5APV A;  3CCS P;  5K5G B;  1VQL P;  1NTZ E;  1S5L E;  1AQ5 A;  3IF4 A;  1IC2 A;  4R4M A;  1T8Z A;  3RGU A;  3O6Q A;  1K04 A;  2FYU K;  2FYU G;  3L74 E;  3AEB C;  3R2P A;  5AVU B;  1JMM A;  2CK3 H;  3HTK A;  2GUV A;  3EFG A;  5AVT B;  1RQU A;  4H44 D;  2QJP C;  1SQX K;  2Y0C A;  1SQX G;  3G4S P;  3AEC C;  2N1T A;  2MJZ A;  3L37 A;  4K35 A;  5EFW B;  3RK3 E;  2B87 B;  2NPS A;  2QJP B;  1OWA A;  2A45 H;  3TNU B;  1KIL D;  1EZV D;  1NGM B;  2WSF H;  2I1K A;  5AW2 B;  3Q5P A;  3JC2 2;  1EQ7 A;  1PP9 D;  3G9R A;  4EIJ A;  2DW3 A;  2ZXX A;  3VYI A;  2K88 A;  2WSC H;  1N7S A;  1ZME C;  1T3U A;  2E5Y A;  2QM7 A;  4D6T E;  2FXO A;  2M3B A;  3W68 A;  1RE4 A;  3CX5 E;  1M56 D;  4PJ0 H;  4JF7 A;  3PHL A;  2R5B A;  2RN0 A;  1LTI C;  3H1J D;  2FFD A;  1KC8 Q;  5KJ7 D;  3P7K A;  1WMK A;  3C8V A;  1KQG B;  1USD A;  2A45 G;  4DJG A;  3PTZ A;  3CXH D;  3NXS A;  3L70 D;  1SQV K;  2RKL A;  1SQV G;  2XKM A;  1L0N D;  2C9L Y;  1DH3 A;  1GU4 A;  1PGQ A;  2OYO A;  1MFT A;  3N4X A;  2YMY A;  1NTK E;  1W5C E;  1VQ9 P;  3C9I A;  4U7J A;  3B4S A;  2WSS H;  1BDD A;  2ZYG A;  2D2C C;  2WSC J;  1Q86 Q;  1LJ2 A;  3H1L G;  2E42 A;  2D2C B;  2FXP A;  2KS1 B;  1JY2 P;  1QLE D;  4Y99 C;  2VRS A;  3B5N D;  2OYH A;  2FYU E;  1NHL A;  1MUU A;  4JQ0 D;  4Y99 B;  1T2K C;  4N78 D;  4NPD A;  1SQX E;  2HPC B;  3M9Q A;  4RKU J;  4ASW A;  1L0L D;  3FXE A;  1NAF A;  5KAI H;  2O3J A;  1W2E A;  1OFC X;  4UB6 E;  4GT1 A;  1NU1 D;  2OQQ A;  1IJD B;  1URQ C;  1E5W A;  2IFM A;  4DZO A;  1YI2 P;  1HBW A;  2WZ7 A;  3M0D C;  1VQ6 P;  4BRY A;  2KIK A;  1OVV A;  3AEF C;  1LTS C;  1KQF B;  3CWB D;  2LXC B;  2OTL P;  2BCC J;  1SQP J;  3IAO A;  1SQQ D;  1M1J C;  4OGQ D;  1KD1 Q;  4XE5 B;  1D7M A;  2NRG A;  2YNY A;  1L4A A;  1U7M A;  1IZN B;  1AA0 A;  3CL3 D;  1JEK A;  1S5L X;  5AVZ B;  4PV1 D;  1OXZ A;  2KYV A;  1GK4 A;  1SQV E;  2W83 C;  3P32 A;  1CW5 A;  1GW3 A;  5H2F H;  1JY3 P;  3CCE P;  3N7N A;  3CXH H;  1EZV G;  5APY A;  2Q3E A;  2L5G B;  1ZRT D;  3CC4 P;  1CI6 A;  1PP9 G;  2ZYA A;  3U59 A;  1BDC A;  1G2C B;  1YTZ I;  3HD7 D;  4PJ0 E;  1A02 J;  1PPJ D;  5CJ4 A;  5TIS H;  3H1L E;  1PP9 J;  3AE5 C;  3V5B A;  1YQ3 C;  3KQG A;  1FDO A;  4RES B;  4BXL A;  1L4A B;  1RE3 C;  2PFX A;  4QMA A;  1IO4 A;  3VMZ A;  4L74 A;  3CPW O;  4NPF X;  3L70 G;  1AJY A;  4YXW H;  3WU2 H;  2J58 A;  3H1J J;  5CCG A;  2O1K A;  3SFD C;  1DD3 A;  5AW6 B;  2XND H;  4HH2 A;  3ZDM A;  5AW4 B;  2KP8 A;  4CPG A;  3L70 J;  1L0N J;  3AEG C;  2OYI C;  3RL0 C;  1AVO A;  1FDI A;  3D71 A;  1PFI A;  2KNC B;  3RL0 B;  3V6I A;  2M5A A;  3CX5 I;  2E76 D;  2YKO A;  3A3Y B;  4XFJ A;  1LWU C;  3H1K D;  1SQB K;  1SQB G;  1M7L A;  4I1L A;  3GLM A;  3L71 D;  1LWU B;  1T2K D;  1RF1 B;  2K37 A;  3A7O A;  3KPE A;  3SFE C;  5C39 A;  1BCC D;  1LT1 A;  2CPB A;  4LGD E;  5APT A;  1N2D C;  1FS0 E;  3E7K A;  5B66 H;  1VQ8 P;  3NTN A;  5KAI E;  2YO3 A;  1P84 D;  2JDI H;  2PRR A;  2QRX A;  2QIW A;  3VP9 A;  4NPE A;  3HE5 A;  2C0W A;  1KZU B;  1URQ D;  4PD4 D;  1EZV E;  3CMA P;  4H44 B;  4GDO A;  2Z4E A;  1KIL C;  1NU1 G;  3TF5 A;  1PP9 E;  1L0L J;  1KIL B;  1NTZ K;  1X22 A;  1CSB A;  1HTL C;  4LLH A;  1Q7Y Q;  1NU1 J;  3H32 B;  4TLF A;  3MGN A;  3SWF A;  1SQQ G;  2KLU A;  1BE3 D;  2QEX P;  2FBW C;  2WSE H;  1DX7 A;  1M1K Q;  3CWB J;  1KV4 A;  2FY8 A;  5KJ7 C;  1PGJ A;  5H2F E;  1SQQ J;  3HE4 B;  1R5S A;  2HOD B;  3L70 E;  1BGY G;  1KYO D;  2M8R A;  2HLO A;  4W7Y A;  3G71 P;  2FYZ A;  2WPQ A;  1SP4 A;  2C9N Y;  2ZXE B;  1R8E A;  4Y28 J;  2IBZ D;  1YQ4 C;  2CPS A;  3HUS A;  2B88 A;  5CBN A;  3AE3 C;  1PPJ G;  2QM8 A;  1J1D C;  3A0B H;  3BAS A;  3S1K A;  4KJM A;  1J1D B;  4A7P A;  1SQB E;  3H1I D;  1FOS F;  5AVS B;  4H0L D;  1K73 Q;  3WU2 E;  2WSE J;  3OA7 A;  3B5N C;  1IFN A;  2A45 I;  3P8C E;  3S4R A;  2LR2 A;  3B5N B;  5BVZ A;  1IFD A;  1N73 C;  2YXQ B;  1IFJ A;  1ZN5 A;  3JSV C;  1ZV8 A;  5CJ0 A;  1J1E B;  2P58 A;  4ZKU A;  1N73 B;  1AV1 A;  1HVV A;  2B87 A;  4L75 A;  3H1H J;  1NU1 E;  3F5H A;  4PD4 H;  3D70 A;  1GW4 A;  1GMJ A;  5AW5 B;  3D6Y A;  3Q2Y A;  2QG4 A;  1USE A;  2Q1K A;  4YTP C;  1ZP0 C;  3CLQ A;  2YKP A;  3WMM 0;  5CCH D;  1S4X A;  1SQQ E;  2Q9I A;  5B66 E;  3WUV A;  5KTB A;  4JBZ A;  4O9B A;  4IL6 H;  3H1K J;  3GW6 A;  1KOR A;  3FWL A;  3USS A;  4OGQ C;  1KB9 H;  3QWO C;  3L71 J;  3AE6 C;  3VN0 A;  1BCC J;  1X79 B;  4OGQ B;  2GM4 A;  1BGY E;  2QSI A;  3MTU E;  4PV1 C;  3GG2 A;  5AVR B;  1Q2N A;  2KSJ A;  2I8D A;  1JB0 J;  4PV1 B;  3MZW B;  3PLN A;  1WRG A;  2WMM A;  3MD0 A;  1RQV A;  1M57 D;  3CCR P;  3TGU D;  3H25 A;  2JWD A;  2FXM A;  2HG5 D;  2KB7 P;  1FAV A;  1VL2 A;  1Q82 Q;  3LID A;  1PPJ E;  3HD7 C;  1GL2 D;  2E43 A;  1BE3 G;  1FOS E;  1S1C X;  3HD7 B;  2KS1 A;  2M0B A;  1VF5 D;  1DEB A;  4EI2 A;  3CC7 P;  2K1A A;  4DT0 A;  3L73 D;  4Z1M H;  1H89 A;  1BE3 J;  3CCJ P;  1BSN A;  3VMY A;  5APX A;  5M1B A;  4L76 A;  3FXD A;  1EZV I;  1N86 A;  2NPS C;  2HPC A;  2E75 C;  1EC5 A;  1HF9 A;  1S3J A;  1VQK P;  3E1I A;  1PIX A;  3M91 A;  3GHG C;  2LKM A;  3M0D A;  2R3C A;  2E76 C;  4YXD C;  3KZI H;  3GHG B;  3BCC D;  2E76 B;  1FJK A;  2RH0 A;  5AW7 B;  5AW9 B;  3TYY A;  3B8E B;  1VQO P;  1K8A Q;  5AW1 B;  2GA1 A;  1M1J A;  1QEX A;  3H1I J;  5KLV D;  2H8P D;  2Z5I A;  3II6 A;  3U1A A;  1Y9B A;  3RBX A;  3CC2 P;  2ITA A;  1JMB A;  3F89 A;  4XA4 A;  1EDK A;  1JY3 O;  4WY4 D;  4PD4 E;  5DJT B;  3D6Z A;  1OZH A;  2BCC G;  1SQP K;  1SQP G;  2QJK C;  1FC2 C;  3L72 D;  1URQ B;  2O1J A;  2FYN C;  2XDJ A;  1Y8A A;  2QJK B;  3EQ2 A;  3RK2 D;  2FYN B;  1G2C A;  5BU8 B;  3LW5 H;  2KK7 A;  1FDM A;  4IL6 E;  1JCD A;  2P2U A;  3MUD A;  1BE3 E;  2XV5 A;  3RL0 g;  1SFC D;  1KB9 E;  3SWY A;  3AEE C;  2WWW A;  1M1J B;  1HGV A;  2A06 D;  1NWQ A;  2R44 A;  3ITK A;  1GK6 A;  1RE3 A;  1EDI A;  2QE7 H;  1GZL A;  1M8O B;  2QVA A;  2V4H A;  3JCU H;  3VMX A;  1LP1 B;  2JO1 A;  4WVZ A;  1VPC A;  2KLV A;  2ZT9 C;  4UB8 H;  1NVO A;  1A02 F;  2B89 A;  3RK3 D;  4ZKP A;  4L73 A;  3GF3 A;  1NTM D;  3TGU G;  2Q6Q A;  2Y0D A;  3AED C;  2H43 A;  2KXP B;  1VQ5 P;  1U57 A;  4C7N B;  2O01 N;  2KNC A;  4AQR D;  1IK7 A;  2UWJ E;  5KLI C;  2BEZ F;  3LW5 J;  3TGU J;  2IZ1 A;  1K05 A;  3H1J G;  4RO0 A;  3IR9 A;  3GF7 A;  5KLI B;  4I6M C;  4D6T D;  2JWA A;  1LWU A;  1RF1 A;  3AE2 C;  3BVH A;  4H0L C;  1NKN A;  2N1T D;  1L0N K;  1L0N G;  4H0L B;  1R5L A;  1LT9 C;  2NPS D;  3H1H D;  2E75 D;  3H6P A;  1LT9 B;  1OX3 A;  1X8Y A;  3L73 J;  4MN4 C;  4OH8 B;  1FZC C;  3V4Q A;  2N9Y B;  2BAS A;  1JY3 N;  1FZC B;  1N7S D;  1RH5 B;  1MV8 A;  1LTT C;  2BCC E;  2OYI B;  1SQP E;  2Q3I A;  1OW8 A;  1NTK D;  1H8A A;  4ZNC A;  2IPP A;  1KIL A;  3KZI E;  1LTG C;  2B9B A;  1KMI Z;  3A5T A;  1VDF A;  3H32 A;  2G3A A;  3CME P;  1S9K D;  5CCH C;  2ZFC A;  2WPV B;  2W6J H;  2AXC A;  1M90 Q;  1NAY A;  2K9Y A;  2FYU D;  3TK1 A;  3BCC J;  1T3J A;  3L75 D;  1KFN A;  1L0L K;  1L0L G;  2K9J B;  5AW8 B;  3HE4 A;  2HOD A;  2AEF A;  5KJ7 A;  1KIL E;  5KLV J;  2LXB A;  1NU1 K;  1H0T B;  1SQX D;  1DD4 A;  3L72 G;  2IX7 C;  2ZYD A;  3TGU E;  2RMZ A;  3KHU A;  1JM0 A;  3P8M C;  3CWB G;  1XTC C;  1SQQ K;  2OAR A;  1YIJ P;  2Y9Y A;  5L8R J;  3L72 J;  1NKZ B;  1GL2 C;  3H1J E;  3VP8 A;  3L35 A;  4OWF A;  3SSU A;  2A06 G;  2OGU A;  1ZW0 A;  5KKZ C;  1GL2 B;  1VF5 C;  1RF0 C;  5KKZ B;  1MZ9 A;  3CXH E;  1NYH A;  3K5B A;  1L0N E;  1OMI A;  2O01 J;  1VF5 B;  1HUC A;  2WQY C;  4UB8 E;  2ZT9 D;  3B5N A;  4IL6 X;  4PD4 I;  1YJW P;  1EDL A;  1N7L A;  5APW A;  2KZI A;  1N73 A;  1SQV D;  2OTK E;  5TIS E;  3MHV A;  1NTM G;  3E1R A;  3G6E P;  2J59 M;  1EXJ A;  1ZOY C;  1EXI A;  2WPR A;  1JCC A;  3L4F A;  3CCU P;  1KB9 I;  1NTM J;  2KI7 B;  3M0A A;  2KZJ A;  3HRN A;  5E79 H;  3G3Z A;  2W6A A;  2E5T A;  1VQ4 P;  3SWK A;  3H1L D;  3M9H A;  2H7H A;  2YMK A;  3UIA A;  1QL1 A;  4N78 E;  1KQL A;  3H1H G;  2P67 A;  4EOT A;  2IFN A;  4D6T J;  2NZ2 A;  2KOG A;  4KT0 J;  1L0L E;  3NFQ A;  4WBA A;  2IZ0 A;  2I1J A;  4GOE A;  1P84 H;  3PP5 A;  1JNM A;  1EDJ A;  1KN7 A;  4JPZ B;  4H13 C;  4WY4 C;  1YTZ T;  3CCM P;  3L72 E;  4WY4 B;  2JEE A;  4IOI H;  3KDP B;  2JJL A;  2JKV A;  3H1K G;  4M3L A;  5AVQ B;  3RK2 C;  3CWB E;  1WT6 A;  1FE6 A;  3L71 G;  3I56 P;  1BCC G;  3RK2 B;  1NTK J;  3PH0 A;  1YBK A;  2IYO A;  3T97 A;  5AVX B;  1S72 P;  3BAT A;  3HD7 A;  2V7Q H;  1SFC C;  2A06 E;  5CCG D;  3U1C A;  1JTH B;  1SFC B;  3L75 G;  2XZR A;  4U3F D;  3Q3D A;  1LTJ C;  1OW7 A;  1U7J A;  4DCK A;  1LTJ B;  1ZLL A;  1ZRT E;  1KYO H;  2Y0E A;  2FYU J;  1FU1 A;  3L75 J;  1L2P A;  1K9M Q;  2QJY C;  3Q1M A;  1NTM E;  1LNQ A;  3RK3 C;  1X9V A;  2QJY B;  1IFP A;  1GDT A;  1PGP A;  3VMA A;  1LGH B;  3RK3 B;  1SQX J;  3AE9 C;  5DJU B;  1VQP P;  3T97 B;  1AFO A;  3O6Q B;  1JY2 O;  3GHG A;  1YIT P;  2FKW B;  2QA4 P;  1PV3 A;  4C7R A;  2V7Q J;  2AEM A;  1NH4 A;  3HTK B;  3O8Z A;  4OVN F;  2N1T C;  3H1H E;  3M06 A;  1RHZ B;  2N1T B;  1PGO A;  1QVG O;  1QL2 A;  2NPS B;  4HYT B;  5APU A;  4GOD A;  1HH0 A;  2E75 B;  3IFM A;  2XU6 A;  4I2L C;  4JYB A;  2XNX A;  5GTI H;  3A0B E;  2IBZ G;  1RY3 A;  2WPS A;  2ZJS E;  2H88 C;  1PZQ A;  2PAJ A;  1N7S C;  1LTA C;  1SQV J;  1URQ A;  4IFM A;  2W27 A;  4B86 A;  2YKQ A;  4YPC A;  2IDB A;  2WSF J;  5E79 E;  1N7S B;  2KUB A;  1QGK B;  3H1K E;  4KHX A;  1GTW A;  1RE4 C;  3H1I G;  3EFF K;  3Q5S A;  1IFM A;  2OTJ P;  3L71 E;  1BCC E;  2FFD C;  3OJA B;  2R5D A;  4I7Z C;  3FX0 A;  3CXH I;  4GOF A;  1KTM A;  1S9K E;  2E74 D;  2FFD B;  1SQB D;  4I7Z B;  2HYN A;  1OVR A;  1P84 E;  3L75 E;  3H1L J;  3P8C D;  4HB1 A;  3V2R A;  3A2A A;  4H13 D;  2Q5U A;  3QH9 A;  5KAF H;  1FZG A;  1LP1 A;  1IFI A;  3A0H H;  1FJP A;  3VTP C;  4W7Z A;  1HJB A;  1J2J B;  3V4W A;  3AEA C;  1FZB A;  2L91 A;  4C7N A;  2BEQ D;  1XTG B;  3LIE A;  4N6J A;  4C46 A;  1NTZ D;  1OIP A;  2OYH C;  1VQ7 P;  3MP7 B;  3CCL P;  1VQM P;  2R3S A;  2OYH B;  3V2N A;  2PP6 A;  5TJH A;  1JY2 N;  3L74 D;  4IFD K;  2POH A;  2W6B A;  5AW0 B;  5GTH H;  4U3F G;  2WIT A;  1IK9 A;  2GUS A;  1KYO E;  2C0X A;  3MIW A;  5AVW B;  2JR8 A;  3R4Y A;  3TDK A;  1LT9 A;  4AYC A;  1Y47 A;  2P7J A;  4U3F J;  1NOH A;  1AQT A;  2ZT9 B;  1BGY D;  1NJI Q;  1DEE G;  2IBZ E;  1QVF O;  3BRV B;  3GMA A;  1FZC A;  2OYI A;  1SS1 A;  2WT7 A;  3KYQ A;  1YJ9 P;  5APS A;  4BRY B;  2Z5H A;  4HKZ H;  1S2E A;  5APQ A;  3H1I E;  4RJT A;  3V2P A;  4AUW A;  3MUD C;  2H89 C;  2AXT H;  5B5E H;  3CX5 D;  3AE7 C;  3L73 G;  1L4A C;  2ZVO B;  1N8R Q;  1YHQ P;  1W2B O;  4ASV A;  1ZXG A;  5CHX A;  5CCH A;  2ZAE B;  4TT3 H;  1QX8 A;  2YO2 A;  1G1I A;  1G1J A;  5GTI E;  2K9J A;  3AE4 C;  2R32 A;  3IN6 A;  1PL5 A;  3NMD A;  4EYY Q;  3WUT A; 
#chains in the Genus database with same CATH homology
 4ASW A;  3FXE A;  3PH0 A;  4GOD A;  4KJM A;  2I8D A;  4HJG H;  3MZW B;  1NVO A;  2B89 A;  1H0T A;  4BXL A;  2OTK E;  2WMM A;  3MHV A;  1X0T A;  4NPF X;  2JWD A;  1OVU A;  4ZMD A;  2LR2 A;  2KUB A;  1U7J A;  2KIK A;  2RKL A;  1OVV A;  5K5G B;  2UWJ E;  2KI7 B;  2P58 A;  1JMB A;  4WWI A;  1Y47 A;  2KZJ A;  2LXC B;  4K3A A;  1EDK A;  3ZDM A;  2LXB A;  3RGU A;  1MFT A;  1H0T B;  5DJT B;  2B87 A;  4CPG A;  2M0B A;  4GOF A;  1DEE G;  2SPZ A;  1FC2 C;  1OVR A;  1SS1 A;  1JM0 A;  1U7M A;  2M5A A;  5DJU B;  4HKZ H;  1BDD A;  4HB1 A;  3FXD A;  2Q1K A;  4GOE A;  1LP1 A;  4K35 A;  4MN4 C;  5EFW B;  2B87 B;  1EDJ A;  2KS1 B;  1Q2N A;  1EC5 A;  1ZW0 A;  5C39 A;  1LT1 A;  2R44 A;  4JBZ A;  1S3J A;  4ASV A;  1ZXG A;  4IOI H;  5CBO A;  2HR3 A;  2K3R A;  3QWO C;  1EDI A;  2B88 A;  2ZAE B;  4ZNC A;  2M5A B;  5CBN A;  2QVA A;  1BDC A;  1LP1 B;  3S1K A;  4NPD A;  2QRX A;  1EDL A;  4NPE A;  4EYY Q;  2KZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...