1EDJA

Staphylococcal protein a e-domain (180), nmr, 20 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
56
structure length
56
Chain Sequence
AQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL PROTEIN A
publication title Solution structure of the E-domain of staphylococcal protein A.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immunoglobulin-binding protein
total genus 18
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1996-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1edjA00
4HJGH 1BDDA 4ZMDA 1OVUA 1LT1A 4NPEA 2B87A 2K3RA 2KZJA 2B88A 4GOFA 3S1KA 2KZIA 1Q2NA 1OVRA 1LP1B 4K3AA 2WMMA 5DJUB 3ZDMA 4NPFX 2B89A 2SPZA 4WWIA 4IOIH 2P58A 2KUBA 2I8DA 3FXDA 5C39A 2LXBA 3FXEA 1DEEG 5EFWB 1H0TB 2KIKA 2ZAEB 2R44A 4EYYQ 1OVVA 2QRXA 1JMBA 1LP1A 4MN4C 2M5AA 1JM0A 5DJTB 4ASVA 2HR3A 1ZW0A 2LR2A 5CBOA 1ZXGA 2UWJE 4ASWA 4GODA 2B87B 1FC2C 1EDKA 1SS1A 1EDLA 3PH0A 2KS1B 5CBNA 2QVAA 1BDCA 4K35A 4NPDA 4HKZH 1U7MA 3MHVA 1NVOA 3MZWB 1EC5A 4JBZA 1Y47A 2RKLA 3RGUA 1EDJA 4HB1A 2KI7B 4GOEA 4BXLA 2JWDA 4KJMA 1U7JA 5K5GB 3QWOC 1X0TA 2M0BA 2Q1KA 1H0TA 1S3JA 1MFTA 2M5AB 1EDIA 4CPGA 4ZNCA 2OTKE 2LXCB
chains in the Genus database with same CATH superfamily
2Z5HA 2W6AA 5KLVJ 2PGDA 4WY4D 5AVWB 2KZIA 1QL1A 2HPCA 2YNYA 1LTAC 3MIWA 1KQFB 2PFXA 2OYHB 3CXHH 2B89A 2SPZA 3W68A 2MKVA 1BE3G 1WT6A 4N78E 3AE7C 4LC1A 1P84D 4RESB 1E5WA 2QRXA 1URQA 1LWUC 3AEGC 4IFDK 2OYHC 1RE4C 3SFDC 4ASVA 1GL2D 1SQVK 2UWJE 3L70D 1SQQJ 3MUDA 2BCCJ 1SQXK 3VYIA 4C7NA 1NTKJ 2WTYA 1HGVA 3RL0B 3GMAA 3CCRP 1OW8A 3Q5PA 4JBZA 3L37A 4HB1A 2CPSA 3A3YB 2QSIA 1L4AB 2AXTE 3CD6P 1PGPA 1FDOA 2R5DA 3A2AA 3RL0C 2L5GB 4R4MA 3CX5E 1YTZT 1L4AC 3ABVC 1BCCG 4DT0A 1SQBD 1SP4A 4GOFA 2JWAA 2QJKB 1RHZB 4K3AA 3B5NB 1LTGC 4NPFX 3A5TA 3G71P 1KC8Q 4I7ZC 2P58A 3H1LJ 5CMZA 1L0NG 4N3YB 4XA4A 1DEEG 3H1JJ 2BEQD 1LNQA 1EZVG 1EXJA 3H1IG 2FYUE 3B5NC 1LTTC 1ZXGA 1HH0A 3K5BA 3USSA 3KYQA 1FDIA 1PV3A 3CX5D 2R3SA 5GTHE 1URQD 3L75J 4NPDA 1IK9A 2K1AA 1BE3E 1CI6B 4KT0J 2JR8A 2QM8A 1IFPA 2V4HA 3C8VA 1PPJE 1VQOP 2O3JA 2M0BA 2IFNA 4IL6H 3M9BA 3KZIH 2IX7C 3HUSB 1FJPA 1HJBA 1VQKP 1ZN5A 1J1EB 3H1KG 1W5CE 1YJWP 1R5LA 1FOSF 2E74D 2FYUD 1NTMK 2KZJA 3A0BH 4JF7A 3BCCJ 3IR9A 3NFQA 3R4YA 2IYPA 2E5YA 3HUSC 3P8MC 5AW4B 5BU5A 2E42A 5DJUB 3ZDMA 2Y9ZA 1J1EC 3VP8A 4YPCA 2Q5UA 1BE3D 2A06G 3KXDA 1OWAA 4EYYQ 3VMAA 1PPJD 1CW5A 1BCCE 2QJYB 1T2KC 1SQPJ 2J59M 1JY3N 4O9BA 1M7LA 2CK3H 1JO5A 3FX0A 3MTUE 3AE2C 3VN0A 3RBXA 2A45I 2QJYC 2W90A 1EC5A 1NU1E 2RKLA 1IFIA 1EZVE 1IFNA 1M1JC 2Y0DA 3CMAP 3H1IE 5KAIE 1LTIC 1LTJB 1KQSO 3L74G 4H0LD 3CWBJ 3U59A 1JTHA 4CPGA 1AVOA 3VTPC 2AXTH 1XTCC 1BCCD 3SSUA 4BRYA 1R5SA 5L8RJ 1LTJC 3JCUE 2PRRA 1ZMEC 2FFDB 3TNUB 3LIDA 2E75B 1NTZJ 1GW3A 3V2RA 3HD7B 1SQVE 2G3AA 4OGQB 1L0LK 2I8DA 1NU1D 1KILA 2NPSB 1OXZA 1SQXE 3C9IA 4JQ0D 3Q1MA 5H2FE 3CCUP 1JCCA 1EZVD 3H1KE 2FXPA 2FFDC 1NTMG 3L71G 1JY2N 1JY3O 2HR3A 2E75C 3GF7A 4EOTA 2N1TA 4OGQC 1LT9B 1HJ0A 3L70J 4WY4B 3CI9A 2NPSC 2E76D 1J1DB 4BWNA 4ZKPA 1SFCC 2M3EA 2KSEA 5BU8B 3TNUA 2A06E 3HE4A 3HD7A 2KYVA 1LT9C 4YXDC 3RBZA 4WY4C 1SQVD 3O6QB 4RO0A 1VF5D 2L91A 1VQ7P 4L76A 1J1DC 1IO4A 3P8CE 1LJ2A 2M5AB 1K9MQ 3V2NA 1SQXD 2AXCA 1GL2B 2OTKE 5CCHD 2PAJA 3H1KD 2JKVA 4JPZB 1M8OB 2RN0A 3BVHA 1YJNP 4D6TG 1AVYA 1EXIA 1LTSC 1KB9E 3L72G 5AVQB 3GHGC 1SQBJ 3TK1A 2WSCJ 5CJ0A 3L73G 4H44C 4I6MC 1GL2C 1HF9A 2OYIB 2ZYAA 3L74E 2K88A 3CXHI 1IC2A 2Y0EA 3MGNA 5CCGC 5C39A 2YIUC 1PZQA 5KLVK 2ZYDA 3FXEA 1JY2O 2C9LY 1BGYG 1VDFA 1OVVA 2ZJSE 3O6QA 1PGQA 2HLOA 2WSEJ 3BRTB 3GW6A 2M5AA 2LR2A 4WB4A 1WMKA 2AEFA 1HBWA 3P8CD 4KHXA 3RK2D 1FZCB 1EDKA 1NYHA 1KILD 2YXRB 3WU2E 1H88A 5CBNA 1FS0E 3LW5H 1L0LG 1KB9D 1U7MA 1NVOA 1FJKA 3M9QA 2N1TD 1Y47A 1MKMA 1EQ7A 5APUA 2G8YA 2OYIA 1FZCC 2Z5IA 1FU1A 1NTME 4KJMA 3L71E 3L74D 3U1AA 1S1CX 4DZOA 2YXQB 1PP9G 4NPEA 2WZ7A 3CLQA 2R3CA 2FYUJ 2FBWC 3B4SA 1URQB 4EDFA 1Y9BA 3CCEP 1AQTA 1L0NK 2KXPB 1NHLA 2WSFJ 2IBZI 1NOHA 3IFMA 5B5EH 3E7KA 3Q5SA 4H13D 3JCUH 4C7NB 1H0TB 1BE3J 2FYZA 1PGOA 5AW1B 1URQC 3A0HE 3M0DA 1NTZD 5B66H 3L71D 4W7YA 4M3LA 4D6TE 3L72E 3V5BA 3MUDC 2WPVB 2XKMA 3HTKB 2E74B 2RMZA 1RH5B 3AE4C 1H8AA 2WQYC 1JNMA 2XZRA 1HVVA 5H2FH 2I1KA 1M56D 4EI2A 1NH4A 2O1KA 5KLVG 2A45G 2P10A 5AVXB 2OTLP 3PTZA 3V2PA 3EWKA 1BGYE 2FKWB 2E74C 3VMZA 2E5TA 3IF4A 2JWDA 4GT1A 2GUVA 1U7JA 1H0TA 1DD4A 3I56P 3U1CA 5KKZB 3AEEC 3T97B 2OGUA 1KORA 3HTKA 4D6TD 3MD0A 1RY3A 1P84I 1L0LE 1J2JB 3LW5J 1BCCJ 1ZR4A 1FBMA 1K05A 1NKNA 3EFGA 1FZFA 3OAKA 3IN6A 1N7SD 1VQ9P 4HH2A 4N78D 5KKZC 2BCCG 3CCMP 1K8AQ 2XNDH 4WVZA 1GZLA 1KYOH 4H0LB 1N73B 1NU1J 1PP9E 1JMBA 3CL3D 1VQ4P 3VP9A 4GODA 1RF0A 1R8EA 3T97A 1YTZI 5GTIH 1S5LE 2JP3A 3Q5RA 4H0LC 2QJKC 1MFZA 5AW3B 2HG5D 1GW4A 2XNXA 2YO3A 4BXLA 3WU2H 1GD2E 1HTLC 1G1IA 1N73A 1MFTA 1QX8A 1SQVJ 1IK7A 1G2CA 3PHLA 1N2DC 1PP9D 1SQXJ 2D2CD 1GU4A 3H1JG 2K3RA 3H1KJ 1ZRTE 3WUTA 2OYOA 1DEBA 5KLVE 2DW3A 1JEKA 3D6YA 1S5LX 3PJSK 4GDOA 1P84H 5TJHA 5KLIB 3AE6C 4R4LA 3L75G 4DCKA 3S4RA 1K73Q 4L73A 1VF5B 4JYBA 1AA0A 3V2QA 2YKPA 5E79E 2WWWA 1FZGA 2WT7A 1L2PA 4L74A 2H88C 1IZNB 1KQGB 1NAFA 1SS1A 1H89A 1AQ5A 5AVRB 3CPWO 3AEDC 2BCCE 2BEZF 1VF5C 1JTHB 3A0HH 2N9BA 1ZRTD 1AV1A 3MHVA 2K9JA 1NAYA 3RGUA 1N8RQ 2M3BA 1UIXA 3BCCG 4BRYB 2AEJA 5M1BA 3QWOC 3L74J 4DOJA 5AVVB 3H6PA 1FZBA 3GF3A 1L0NE 5CCHA 3VOPA 2E43A 2WSCH 3RK2B 3D71A 3HE5A 2HODB 2QIWA 5AVYB 2XV5A 5CJ4A 2QEXP 1KILB 2QE7H 2ZXXA 4Y99B 3NTNA 3CCJP 3Q2YA 1SQPG 3D70A 2FYNB 1BSHA 2QA4P 2N1TB 2WSEH 2IBZG 3RK2C 1OFCX 1KILC 4Y99C 4U3FG 5APXA 2OQQA 1Z56A 2ZVOB 2FYNC 1SQBK 5DJTB 2K9YA 1PIXA 3HE4B 2N1TC 1DD3A 4ASWA 3OA7A 3CX5H 4QMAA 3L71J 1VQLP 1ZV8A 3CWBG 1VQNP 1RE3A 5AW8B 2HODA 1L0ND 3RL0g 1PL5A 1W2EA 3O8ZA 5KTBA 3H1ID 4GIFA 1GMJA 3CXHE 3UIAA 3B71A 3HD7C 1KTMA 4IFFA 4H13B 1RF1B 1JY3P 1SLQA 2H8PD 3R2PA 1S5LH 1MUUA 3L4FA 5K5GB 1YI2P 3IAOA 1X8YA 1HUCA 4HJGH 2Y0CA 5APTA 3VMXA 4L75A 4ZMDA 2XU6A 1QGKB 4H13C 2WSFH 4YTPC 3G3ZA 4AUWA 1IJDB 3TGUG 5GTHH 4D6TJ 2PP6A 3L72J 2O01N 1OX3A 1ZR2A 1GK4A 2W6BA 2YMYA 4PD4E 2B9BA 1OW7A 2KUBA 2Q3IA 3E1IA 3CXHD 1RF1A 1VQ5P 5EFWB 2KLVA 1QVFO 2FYUK 2KK7A 3FGAD 1DH3A 1LP1A 4MN4C 2WPRA 3HRNA 1X9VA 3PLNA 1RQVA 2ZYGA 4N6JA 1NKZB 1FC2C 2WVRA 3M0AA 3H1HG 1HGZA 3AE3C 2ITAA 4OWFA 2W8ZA 1MZ9A 2A06D 2P7JA 3WUVA 3RK3E 1KN7A 1JOCA 4YXWH 5E79H 1N7SB 1JY2P 1UIIA 1OZHA 1AJYA 4U3FE 1KD1Q 2OYIC 3M06A 2IZ1A 1SQBG 4HYTB 4TT3H 3D6ZA 4PD4D 1K04A 1IFMA 2J58A 3CWBE 3P7KA 1USDA 1LGHB 5APSA 3PRJA 5AW9B 2QJPB 1PP9J 4JYCA 2H7HA 1SQQK 1JUNA 2IZ0A 3A7OA 2KSJA 3S1KA 1YQ3C 3G6EP 1KZUB 1KFMA 1OVRA 1NTKK 2WMMA 1N7LA 1N7SA 3RK3D 1CSBA 1QLED 3CMEP 2ZT9D 5KAIH 3FXDA 3MP7B 2MJZA 4IL6E 3NXSA 3KZIE 3M0DC 3FWNA 2Q7CA 1FAVA 2CPBA 2E75D 1KYOI 4PV1D 3C1LA 4I2LC 2Q3EA 2J5UA 2YMKA 4OGQD 3TGUE 1DX7A 1Q90D 3V4QA 2D2CB 1RQUA 3S9OA 2IDBA 3V4WA 1SFCD 4K35A 2YKOA 4HKZH 1NTMD 1NU1K 1KV4A 3MZWB 1FDMA 2R5BA 2FYUG 2D2CC 1ZOYC 3AE5C 5KJ7A 4GOEA 1YBKA 4UB6E 5APWA 3L73E 1TU3F 1U57A 2ZXEB 1LWUB 2YKQA 3H1HE 3CC4P 3LIEA 1JB0J 4IL6X 2W83C 1Q82Q 3SWKA 2WPQA 2B88A 3TGUD 3CCSP 3KQGA 1YJ9P 1QL2A 1PPJG 4H44D 1VQPP 3AEAC 1SQBE 4IOIH 5CCGD 3Q3DA 4UB8E 2P1JA 4EIJA 3SWYA 3JC22 2P67A 3L72D 2Z4EA 3EFFK 1S4XA 3SFEC 1LWUA 1D7MA 3L73D 1SQQG 3SWFA 2OYHA 1RE4A 5CBOA 3WMM0 1RF0C 4PD4H 1OIPA 1DIPA 3H1HD 3KDPB 1NTKG 3P32A 3N7NA 1KB9H 5APYA 3L35A 2QVAA 1BGYD 1L0NJ 2POHA 1G2CB 2JDIH 5TISE 1NWQA 3VMYA 3H1IJ 1YQ4C 1WRGA 4I7ZB 1SVFA 4XE5B 1GU5A 2O01J 2QM7A 1FOSE 3BATA 1T6AA 4OH8B 1N73C 3W67A 1L0LD 3ITKA 4RJTA 3CC7P 1L4AA 1SQPK 5KJ7D 1X79B 1NU1G 3TF5A 4C7RA 1FZAA 3B8EB 2WPSA 2KP8A 2WT7B 3AEBC 3H1LG 2KNCB 4WWIA 1VPCA 2VRSA 2KB7P 1JMMA 2AEMA 1A02F 2E76B 2ZAEB 3M91A 5AW5B 3H25A 3F5HA 2Y9YA 2K9JB 3B5NA 2C0WA 1VQ6P 1ZLLA 5APVA 5AW6B 2I1JA 1T3JA 3TYYA 3PH0A 1SQVG 3CX5I 2KS1B 4XFJA 2FY8A 2E76C 1SQXG 2QG4A 1M1KQ 2KNCA 1NTZK 2OTJP 5KLIC 3HE5B 2WSSH 4WBAA 2HFED 5AW0B 2YO2A 1PGJA 4IFMA 1SQQE 1S3JA 3KPEA 2R32A 2JEEA 1EDIA 4ZNCA 1NTKE 3TDKA 1CI6A 2LXCB 3AE1C 5KLVD 5CCHC 2C9NY 3WUUA 2GUSA 4A7PA 4UB6H 4Z1MH 5AVSB 1GTWA 1NGMB 1VQ8P 2KS1A 1NO4A 3HUSA 3BRVB 3RL0D 1Q7YQ 1QVGO 3L36A 2H89C 2RH0A 1S72P 1KMIZ 2O1JA 4PJ0E 1L4AD 1M1JB 5AW7B 5KAFE 1W2BO 1YYCA 2R44A 3F89A 4U3FJ 1PFIA 3EQ2A 1SQQD 2WITA 2BCCD 2H43A 1N86A 2GA1A 2B87B 3PP5A 1AFOA 4DJGA 1NTKD 1RE3C 1EDLA 4UB8H 3H1LE 3OJAB 1S9KE 1M57D 1MV8A 5AW2B 3FWLA 3B5ND 3H1JE 3RK3B 2Q6QA 1EDJA 1NTMJ 5B5EE 2JO1A 3GG2A 2BASA 3AEFC 1M1JA 2IYOA 2ZT9B 2P2UA 1YIJP 4W7ZA 1X0TA 1KQLA 3AE9C 2HYNA 3I5CA 1G1JA 5TISH 1YITP 5B66E 1Q81Q 2N9YB 4PV1B 2C0XA 3RK3C 3L75E 1BDDA 1LT1A 1CZQA 2B87A 2ZT9C 1OMIA 1ZP0C 1LTJA 3N4XA 2FXOA 1SFCB 1Q2NA 1NJIQ 1NTZG 1LP1B 2NZ2A 3TGUJ 4PV1C 3H1LD 2IFMA 1S9KD 1X22A 3H1JD 1RF1C 4LLHA 1IFJA 2XDJA 1EZVI 1VQMP 2V7QH 2FFDA 4GKGA 3BCCE 5APQA 4LGDE 1T8ZA 4AYCA 3L70G 3L73J 1FE6A 4ZKUA 2Q9IA 5AVTB 1USEA 3KHUA 1JCDA 2NRGA 3H1HJ 3L75D 2NPSA 2A45H 3GHGB 2JJLA 3E1RA 1SFCA 4H44B 2K37A 3CCQP 1GK6A 1BGYJ 1KILE 1T2KD 3NMDA 2KI7B 1LT9A 3BASA 3AE8C 3H32B 1SQPE 2YIUB 1Y8AA 2OARA 4WY4A 5CHXA 1KYOE 2Q1KA 3OW2O 2IBZE 2LKMA 1OVUA 4AQRD 1L0LJ 2FXMA 2KOGA 3BCCD 5GTIE 1OW6A 2GM4A 1A02J 2IPPA 3GHGA 3G9RA 5BVZA 1N7SC 3JSVC 1GL2A 4C46A 1T3UA 1M90Q 2W27A 1IFDA 1QEXA 3TSIA 2M8RA 4I1LA 4Y28J 5AVUB 1Q86Q 5CCGA 1HWTC 3H32A 2LXBA 2KIKA 3CCVP 1YHQP 1BSNA 1SQPD 1E79H 1JM0A 3M9HA 1KYOD 1ZW0A 1KFNA 2ZVNB 4PJ0H 2IBZD 4W80A 5KAFH 4OVNF 1NTZE 2QJPC 4U7JA 3I55P 4PD4I 1VL2A 4U3FD 4B86A 2HPCB 2O01H 3II6A 1BDCA 3V6IA 2ZFCA 1FZEA 1XTGB 1KB9I 1S2EA 2W6JH 3HD7D 3AECC 4TLFA 1P84E 5AVZB 1FZCA 5KJ7C 2V7QJ 3CWBD 3A0BE 2NPSD 3CC2P 3QH9A 3G4SP 3L70E 4RKUJ 3GLMA 3CCLP 1LTBC 1GDTA 2KLUA
chains in the Genus database with same CATH topology
4HJGH 1BDDA 4ZMDA 1OVUA 1LT1A 4NPEA 2B87A 2K3RA 2KZJA 2B88A 4GOFA 3S1KA 2KZIA 1Q2NA 1OVRA 1LP1B 4K3AA 2WMMA 5DJUB 3ZDMA 4NPFX 2B89A 2SPZA 4WWIA 4IOIH 2P58A 2KUBA 2I8DA 3FXDA 5C39A 2LXBA 3FXEA 1DEEG 5EFWB 1H0TB 2KIKA 2ZAEB 2R44A 4EYYQ 1OVVA 2QRXA 1JMBA 1LP1A 4MN4C 2M5AA 1JM0A 5DJTB 4ASVA 2HR3A 1ZW0A 2LR2A 5CBOA 1ZXGA 2UWJE 4ASWA 4GODA 2B87B 1FC2C 1EDKA 1SS1A 1EDLA 3PH0A 2KS1B 5CBNA 2QVAA 1BDCA 4K35A 4NPDA 4HKZH 1U7MA 3MHVA 1NVOA 3MZWB 1EC5A 4JBZA 1Y47A 2RKLA 3RGUA 1EDJA 4HB1A 2KI7B 4GOEA 4BXLA 2JWDA 4KJMA 1U7JA 5K5GB 3QWOC 1X0TA 2M0BA 2Q1KA 1H0TA 1S3JA 1MFTA 2M5AB 1EDIA 4CPGA 4ZNCA 2OTKE 2LXCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJG H;  1BDD A;  4ZMD A;  1OVU A;  1LT1 A;  4NPE A;  2B87 A;  2K3R A;  2KZJ A;  2B88 A;  4GOF A;  3S1K A;  2KZI A;  1Q2N A;  1OVR A;  1LP1 B;  4K3A A;  2WMM A;  5DJU B;  3ZDM A;  4NPF X;  2B89 A;  2SPZ A;  4WWI A;  4IOI H;  2P58 A;  2KUB A;  2I8D A;  3FXD A;  5C39 A;  2LXB A;  3FXE A;  1DEE G;  5EFW B;  1H0T B;  2KIK A;  2ZAE B;  2R44 A;  4EYY Q;  1OVV A;  2QRX A;  1JMB A;  1LP1 A;  4MN4 C;  2M5A A;  1JM0 A;  5DJT B;  4ASV A;  2HR3 A;  1ZW0 A;  2LR2 A;  5CBO A;  1ZXG A;  2UWJ E;  4ASW A;  4GOD A;  2B87 B;  1FC2 C;  1EDK A;  1SS1 A;  1EDL A;  3PH0 A;  2KS1 B;  5CBN A;  2QVA A;  1BDC A;  4K35 A;  4NPD A;  4HKZ H;  1U7M A;  3MHV A;  1NVO A;  3MZW B;  1EC5 A;  4JBZ A;  1Y47 A;  2RKL A;  3RGU A;  1EDJ A;  4HB1 A;  2KI7 B;  4GOE A;  4BXL A;  2JWD A;  4KJM A;  1U7J A;  5K5G B;  3QWO C;  1X0T A;  2M0B A;  2Q1K A;  1H0T A;  1S3J A;  1MFT A;  2M5A B;  1EDI A;  4CPG A;  4ZNC A;  2OTK E;  2LXC B; 
#chains in the Genus database with same CATH topology
 2Z5H A;  2W6A A;  5KLV J;  2PGD A;  4WY4 D;  5AVW B;  2KZI A;  1QL1 A;  2HPC A;  2YNY A;  1LTA C;  3MIW A;  1KQF B;  2PFX A;  2OYH B;  3CXH H;  2B89 A;  2SPZ A;  3W68 A;  2MKV A;  1BE3 G;  1WT6 A;  4N78 E;  3AE7 C;  4LC1 A;  1P84 D;  4RES B;  1E5W A;  2QRX A;  1URQ A;  1LWU C;  3AEG C;  4IFD K;  2OYH C;  1RE4 C;  3SFD C;  4ASV A;  1GL2 D;  1SQV K;  2UWJ E;  3L70 D;  1SQQ J;  3MUD A;  2BCC J;  1SQX K;  3VYI A;  4C7N A;  1NTK J;  2WTY A;  1HGV A;  3RL0 B;  3GMA A;  3CCR P;  1OW8 A;  3Q5P A;  4JBZ A;  3L37 A;  4HB1 A;  2CPS A;  3A3Y B;  2QSI A;  1L4A B;  2AXT E;  3CD6 P;  1PGP A;  1FDO A;  2R5D A;  3A2A A;  3RL0 C;  2L5G B;  4R4M A;  3CX5 E;  1YTZ T;  1L4A C;  3ABV C;  1BCC G;  4DT0 A;  1SQB D;  1SP4 A;  4GOF A;  2JWA A;  2QJK B;  1RHZ B;  4K3A A;  3B5N B;  1LTG C;  4NPF X;  3A5T A;  3G71 P;  1KC8 Q;  4I7Z C;  2P58 A;  3H1L J;  5CMZ A;  1L0N G;  4N3Y B;  4XA4 A;  1DEE G;  3H1J J;  2BEQ D;  1LNQ A;  1EZV G;  1EXJ A;  3H1I G;  2FYU E;  3B5N C;  1LTT C;  1ZXG A;  1HH0 A;  3K5B A;  3USS A;  3KYQ A;  1FDI A;  1PV3 A;  3CX5 D;  2R3S A;  5GTH E;  1URQ D;  3L75 J;  4NPD A;  1IK9 A;  2K1A A;  1BE3 E;  1CI6 B;  4KT0 J;  2JR8 A;  2QM8 A;  1IFP A;  2V4H A;  3C8V A;  1PPJ E;  1VQO P;  2O3J A;  2M0B A;  2IFN A;  4IL6 H;  3M9B A;  3KZI H;  2IX7 C;  3HUS B;  1FJP A;  1HJB A;  1VQK P;  1ZN5 A;  1J1E B;  3H1K G;  1W5C E;  1YJW P;  1R5L A;  1FOS F;  2E74 D;  2FYU D;  1NTM K;  2KZJ A;  3A0B H;  4JF7 A;  3BCC J;  3IR9 A;  3NFQ A;  3R4Y A;  2IYP A;  2E5Y A;  3HUS C;  3P8M C;  5AW4 B;  5BU5 A;  2E42 A;  5DJU B;  3ZDM A;  2Y9Z A;  1J1E C;  3VP8 A;  4YPC A;  2Q5U A;  1BE3 D;  2A06 G;  3KXD A;  1OWA A;  4EYY Q;  3VMA A;  1PPJ D;  1CW5 A;  1BCC E;  2QJY B;  1T2K C;  1SQP J;  2J59 M;  1JY3 N;  4O9B A;  1M7L A;  2CK3 H;  1JO5 A;  3FX0 A;  3MTU E;  3AE2 C;  3VN0 A;  3RBX A;  2A45 I;  2QJY C;  2W90 A;  1EC5 A;  1NU1 E;  2RKL A;  1IFI A;  1EZV E;  1IFN A;  1M1J C;  2Y0D A;  3CMA P;  3H1I E;  5KAI E;  1LTI C;  1LTJ B;  1KQS O;  3L74 G;  4H0L D;  3CWB J;  3U59 A;  1JTH A;  4CPG A;  1AVO A;  3VTP C;  2AXT H;  1XTC C;  1BCC D;  3SSU A;  4BRY A;  1R5S A;  5L8R J;  1LTJ C;  3JCU E;  2PRR A;  1ZME C;  2FFD B;  3TNU B;  3LID A;  2E75 B;  1NTZ J;  1GW3 A;  3V2R A;  3HD7 B;  1SQV E;  2G3A A;  4OGQ B;  1L0L K;  2I8D A;  1NU1 D;  1KIL A;  2NPS B;  1OXZ A;  1SQX E;  3C9I A;  4JQ0 D;  3Q1M A;  5H2F E;  3CCU P;  1JCC A;  1EZV D;  3H1K E;  2FXP A;  2FFD C;  1NTM G;  3L71 G;  1JY2 N;  1JY3 O;  2HR3 A;  2E75 C;  3GF7 A;  4EOT A;  2N1T A;  4OGQ C;  1LT9 B;  1HJ0 A;  3L70 J;  4WY4 B;  3CI9 A;  2NPS C;  2E76 D;  1J1D B;  4BWN A;  4ZKP A;  1SFC C;  2M3E A;  2KSE A;  5BU8 B;  3TNU A;  2A06 E;  3HE4 A;  3HD7 A;  2KYV A;  1LT9 C;  4YXD C;  3RBZ A;  4WY4 C;  1SQV D;  3O6Q B;  4RO0 A;  1VF5 D;  2L91 A;  1VQ7 P;  4L76 A;  1J1D C;  1IO4 A;  3P8C E;  1LJ2 A;  2M5A B;  1K9M Q;  3V2N A;  1SQX D;  2AXC A;  1GL2 B;  2OTK E;  5CCH D;  2PAJ A;  3H1K D;  2JKV A;  4JPZ B;  1M8O B;  2RN0 A;  3BVH A;  1YJN P;  4D6T G;  1AVY A;  1EXI A;  1LTS C;  1KB9 E;  3L72 G;  5AVQ B;  3GHG C;  1SQB J;  3TK1 A;  2WSC J;  5CJ0 A;  3L73 G;  4H44 C;  4I6M C;  1GL2 C;  1HF9 A;  2OYI B;  2ZYA A;  3L74 E;  2K88 A;  3CXH I;  1IC2 A;  2Y0E A;  3MGN A;  5CCG C;  5C39 A;  2YIU C;  1PZQ A;  5KLV K;  2ZYD A;  3FXE A;  1JY2 O;  2C9L Y;  1BGY G;  1VDF A;  1OVV A;  2ZJS E;  3O6Q A;  1PGQ A;  2HLO A;  2WSE J;  3BRT B;  3GW6 A;  2M5A A;  2LR2 A;  4WB4 A;  1WMK A;  2AEF A;  1HBW A;  3P8C D;  4KHX A;  3RK2 D;  1FZC B;  1EDK A;  1NYH A;  1KIL D;  2YXR B;  3WU2 E;  1H88 A;  5CBN A;  1FS0 E;  3LW5 H;  1L0L G;  1KB9 D;  1U7M A;  1NVO A;  1FJK A;  3M9Q A;  2N1T D;  1Y47 A;  1MKM A;  1EQ7 A;  5APU A;  2G8Y A;  2OYI A;  1FZC C;  2Z5I A;  1FU1 A;  1NTM E;  4KJM A;  3L71 E;  3L74 D;  3U1A A;  1S1C X;  4DZO A;  2YXQ B;  1PP9 G;  4NPE A;  2WZ7 A;  3CLQ A;  2R3C A;  2FYU J;  2FBW C;  3B4S A;  1URQ B;  4EDF A;  1Y9B A;  3CCE P;  1AQT A;  1L0N K;  2KXP B;  1NHL A;  2WSF J;  2IBZ I;  1NOH A;  3IFM A;  5B5E H;  3E7K A;  3Q5S A;  4H13 D;  3JCU H;  4C7N B;  1H0T B;  1BE3 J;  2FYZ A;  1PGO A;  5AW1 B;  1URQ C;  3A0H E;  3M0D A;  1NTZ D;  5B66 H;  3L71 D;  4W7Y A;  4M3L A;  4D6T E;  3L72 E;  3V5B A;  3MUD C;  2WPV B;  2XKM A;  3HTK B;  2E74 B;  2RMZ A;  1RH5 B;  3AE4 C;  1H8A A;  2WQY C;  1JNM A;  2XZR A;  1HVV A;  5H2F H;  2I1K A;  1M56 D;  4EI2 A;  1NH4 A;  2O1K A;  5KLV G;  2A45 G;  2P10 A;  5AVX B;  2OTL P;  3PTZ A;  3V2P A;  3EWK A;  1BGY E;  2FKW B;  2E74 C;  3VMZ A;  2E5T A;  3IF4 A;  2JWD A;  4GT1 A;  2GUV A;  1U7J A;  1H0T A;  1DD4 A;  3I56 P;  3U1C A;  5KKZ B;  3AEE C;  3T97 B;  2OGU A;  1KOR A;  3HTK A;  4D6T D;  3MD0 A;  1RY3 A;  1P84 I;  1L0L E;  1J2J B;  3LW5 J;  1BCC J;  1ZR4 A;  1FBM A;  1K05 A;  1NKN A;  3EFG A;  1FZF A;  3OAK A;  3IN6 A;  1N7S D;  1VQ9 P;  4HH2 A;  4N78 D;  5KKZ C;  2BCC G;  3CCM P;  1K8A Q;  2XND H;  4WVZ A;  1GZL A;  1KYO H;  4H0L B;  1N73 B;  1NU1 J;  1PP9 E;  1JMB A;  3CL3 D;  1VQ4 P;  3VP9 A;  4GOD A;  1RF0 A;  1R8E A;  3T97 A;  1YTZ I;  5GTI H;  1S5L E;  2JP3 A;  3Q5R A;  4H0L C;  2QJK C;  1MFZ A;  5AW3 B;  2HG5 D;  1GW4 A;  2XNX A;  2YO3 A;  4BXL A;  3WU2 H;  1GD2 E;  1HTL C;  1G1I A;  1N73 A;  1MFT A;  1QX8 A;  1SQV J;  1IK7 A;  1G2C A;  3PHL A;  1N2D C;  1PP9 D;  1SQX J;  2D2C D;  1GU4 A;  3H1J G;  2K3R A;  3H1K J;  1ZRT E;  3WUT A;  2OYO A;  1DEB A;  5KLV E;  2DW3 A;  1JEK A;  3D6Y A;  1S5L X;  3PJS K;  4GDO A;  1P84 H;  5TJH A;  5KLI B;  3AE6 C;  4R4L A;  3L75 G;  4DCK A;  3S4R A;  1K73 Q;  4L73 A;  1VF5 B;  4JYB A;  1AA0 A;  3V2Q A;  2YKP A;  5E79 E;  2WWW A;  1FZG A;  2WT7 A;  1L2P A;  4L74 A;  2H88 C;  1IZN B;  1KQG B;  1NAF A;  1SS1 A;  1H89 A;  1AQ5 A;  5AVR B;  3CPW O;  3AED C;  2BCC E;  2BEZ F;  1VF5 C;  1JTH B;  3A0H H;  2N9B A;  1ZRT D;  1AV1 A;  3MHV A;  2K9J A;  1NAY A;  3RGU A;  1N8R Q;  2M3B A;  1UIX A;  3BCC G;  4BRY B;  2AEJ A;  5M1B A;  3QWO C;  3L74 J;  4DOJ A;  5AVV B;  3H6P A;  1FZB A;  3GF3 A;  1L0N E;  5CCH A;  3VOP A;  2E43 A;  2WSC H;  3RK2 B;  3D71 A;  3HE5 A;  2HOD B;  2QIW A;  5AVY B;  2XV5 A;  5CJ4 A;  2QEX P;  1KIL B;  2QE7 H;  2ZXX A;  4Y99 B;  3NTN A;  3CCJ P;  3Q2Y A;  1SQP G;  3D70 A;  2FYN B;  1BSH A;  2QA4 P;  2N1T B;  2WSE H;  2IBZ G;  3RK2 C;  1OFC X;  1KIL C;  4Y99 C;  4U3F G;  5APX A;  2OQQ A;  1Z56 A;  2ZVO B;  2FYN C;  1SQB K;  5DJT B;  2K9Y A;  1PIX A;  3HE4 B;  2N1T C;  1DD3 A;  4ASW A;  3OA7 A;  3CX5 H;  4QMA A;  3L71 J;  1VQL P;  1ZV8 A;  3CWB G;  1VQN P;  1RE3 A;  5AW8 B;  2HOD A;  1L0N D;  3RL0 g;  1PL5 A;  1W2E A;  3O8Z A;  5KTB A;  3H1I D;  4GIF A;  1GMJ A;  3CXH E;  3UIA A;  3B71 A;  3HD7 C;  1KTM A;  4IFF A;  4H13 B;  1RF1 B;  1JY3 P;  1SLQ A;  2H8P D;  3R2P A;  1S5L H;  1MUU A;  3L4F A;  5K5G B;  1YI2 P;  3IAO A;  1X8Y A;  1HUC A;  4HJG H;  2Y0C A;  5APT A;  3VMX A;  4L75 A;  4ZMD A;  2XU6 A;  1QGK B;  4H13 C;  2WSF H;  4YTP C;  3G3Z A;  4AUW A;  1IJD B;  3TGU G;  5GTH H;  4D6T J;  2PP6 A;  3L72 J;  2O01 N;  1OX3 A;  1ZR2 A;  1GK4 A;  2W6B A;  2YMY A;  4PD4 E;  2B9B A;  1OW7 A;  2KUB A;  2Q3I A;  3E1I A;  3CXH D;  1RF1 A;  1VQ5 P;  5EFW B;  2KLV A;  1QVF O;  2FYU K;  2KK7 A;  3FGA D;  1DH3 A;  1LP1 A;  4MN4 C;  2WPR A;  3HRN A;  1X9V A;  3PLN A;  1RQV A;  2ZYG A;  4N6J A;  1NKZ B;  1FC2 C;  2WVR A;  3M0A A;  3H1H G;  1HGZ A;  3AE3 C;  2ITA A;  4OWF A;  2W8Z A;  1MZ9 A;  2A06 D;  2P7J A;  3WUV A;  3RK3 E;  1KN7 A;  1JOC A;  4YXW H;  5E79 H;  1N7S B;  1JY2 P;  1UII A;  1OZH A;  1AJY A;  4U3F E;  1KD1 Q;  2OYI C;  3M06 A;  2IZ1 A;  1SQB G;  4HYT B;  4TT3 H;  3D6Z A;  4PD4 D;  1K04 A;  1IFM A;  2J58 A;  3CWB E;  3P7K A;  1USD A;  1LGH B;  5APS A;  3PRJ A;  5AW9 B;  2QJP B;  1PP9 J;  4JYC A;  2H7H A;  1SQQ K;  1JUN A;  2IZ0 A;  3A7O A;  2KSJ A;  3S1K A;  1YQ3 C;  3G6E P;  1KZU B;  1KFM A;  1OVR A;  1NTK K;  2WMM A;  1N7L A;  1N7S A;  3RK3 D;  1CSB A;  1QLE D;  3CME P;  2ZT9 D;  5KAI H;  3FXD A;  3MP7 B;  2MJZ A;  4IL6 E;  3NXS A;  3KZI E;  3M0D C;  3FWN A;  2Q7C A;  1FAV A;  2CPB A;  2E75 D;  1KYO I;  4PV1 D;  3C1L A;  4I2L C;  2Q3E A;  2J5U A;  2YMK A;  4OGQ D;  3TGU E;  1DX7 A;  1Q90 D;  3V4Q A;  2D2C B;  1RQU A;  3S9O A;  2IDB A;  3V4W A;  1SFC D;  4K35 A;  2YKO A;  4HKZ H;  1NTM D;  1NU1 K;  1KV4 A;  3MZW B;  1FDM A;  2R5B A;  2FYU G;  2D2C C;  1ZOY C;  3AE5 C;  5KJ7 A;  4GOE A;  1YBK A;  4UB6 E;  5APW A;  3L73 E;  1TU3 F;  1U57 A;  2ZXE B;  1LWU B;  2YKQ A;  3H1H E;  3CC4 P;  3LIE A;  1JB0 J;  4IL6 X;  2W83 C;  1Q82 Q;  3SWK A;  2WPQ A;  2B88 A;  3TGU D;  3CCS P;  3KQG A;  1YJ9 P;  1QL2 A;  1PPJ G;  4H44 D;  1VQP P;  3AEA C;  1SQB E;  4IOI H;  5CCG D;  3Q3D A;  4UB8 E;  2P1J A;  4EIJ A;  3SWY A;  3JC2 2;  2P67 A;  3L72 D;  2Z4E A;  3EFF K;  1S4X A;  3SFE C;  1LWU A;  1D7M A;  3L73 D;  1SQQ G;  3SWF A;  2OYH A;  1RE4 A;  5CBO A;  3WMM 0;  1RF0 C;  4PD4 H;  1OIP A;  1DIP A;  3H1H D;  3KDP B;  1NTK G;  3P32 A;  3N7N A;  1KB9 H;  5APY A;  3L35 A;  2QVA A;  1BGY D;  1L0N J;  2POH A;  1G2C B;  2JDI H;  5TIS E;  1NWQ A;  3VMY A;  3H1I J;  1YQ4 C;  1WRG A;  4I7Z B;  1SVF A;  4XE5 B;  1GU5 A;  2O01 J;  2QM7 A;  1FOS E;  3BAT A;  1T6A A;  4OH8 B;  1N73 C;  3W67 A;  1L0L D;  3ITK A;  4RJT A;  3CC7 P;  1L4A A;  1SQP K;  5KJ7 D;  1X79 B;  1NU1 G;  3TF5 A;  4C7R A;  1FZA A;  3B8E B;  2WPS A;  2KP8 A;  2WT7 B;  3AEB C;  3H1L G;  2KNC B;  4WWI A;  1VPC A;  2VRS A;  2KB7 P;  1JMM A;  2AEM A;  1A02 F;  2E76 B;  2ZAE B;  3M91 A;  5AW5 B;  3H25 A;  3F5H A;  2Y9Y A;  2K9J B;  3B5N A;  2C0W A;  1VQ6 P;  1ZLL A;  5APV A;  5AW6 B;  2I1J A;  1T3J A;  3TYY A;  3PH0 A;  1SQV G;  3CX5 I;  2KS1 B;  4XFJ A;  2FY8 A;  2E76 C;  1SQX G;  2QG4 A;  1M1K Q;  2KNC A;  1NTZ K;  2OTJ P;  5KLI C;  3HE5 B;  2WSS H;  4WBA A;  2HFE D;  5AW0 B;  2YO2 A;  1PGJ A;  4IFM A;  1SQQ E;  1S3J A;  3KPE A;  2R32 A;  2JEE A;  1EDI A;  4ZNC A;  1NTK E;  3TDK A;  1CI6 A;  2LXC B;  3AE1 C;  5KLV D;  5CCH C;  2C9N Y;  3WUU A;  2GUS A;  4A7P A;  4UB6 H;  4Z1M H;  5AVS B;  1GTW A;  1NGM B;  1VQ8 P;  2KS1 A;  1NO4 A;  3HUS A;  3BRV B;  3RL0 D;  1Q7Y Q;  1QVG O;  3L36 A;  2H89 C;  2RH0 A;  1S72 P;  1KMI Z;  2O1J A;  4PJ0 E;  1L4A D;  1M1J B;  5AW7 B;  5KAF E;  1W2B O;  1YYC A;  2R44 A;  3F89 A;  4U3F J;  1PFI A;  3EQ2 A;  1SQQ D;  2WIT A;  2BCC D;  2H43 A;  1N86 A;  2GA1 A;  2B87 B;  3PP5 A;  1AFO A;  4DJG A;  1NTK D;  1RE3 C;  1EDL A;  4UB8 H;  3H1L E;  3OJA B;  1S9K E;  1M57 D;  1MV8 A;  5AW2 B;  3FWL A;  3B5N D;  3H1J E;  3RK3 B;  2Q6Q A;  1EDJ A;  1NTM J;  5B5E E;  2JO1 A;  3GG2 A;  2BAS A;  3AEF C;  1M1J A;  2IYO A;  2ZT9 B;  2P2U A;  1YIJ P;  4W7Z A;  1X0T A;  1KQL A;  3AE9 C;  2HYN A;  3I5C A;  1G1J A;  5TIS H;  1YIT P;  5B66 E;  1Q81 Q;  2N9Y B;  4PV1 B;  2C0X A;  3RK3 C;  3L75 E;  1BDD A;  1LT1 A;  1CZQ A;  2B87 A;  2ZT9 C;  1OMI A;  1ZP0 C;  1LTJ A;  3N4X A;  2FXO A;  1SFC B;  1Q2N A;  1NJI Q;  1NTZ G;  1LP1 B;  2NZ2 A;  3TGU J;  4PV1 C;  3H1L D;  2IFM A;  1S9K D;  1X22 A;  3H1J D;  1RF1 C;  4LLH A;  1IFJ A;  2XDJ A;  1EZV I;  1VQM P;  2V7Q H;  2FFD A;  4GKG A;  3BCC E;  5APQ A;  4LGD E;  1T8Z A;  4AYC A;  3L70 G;  3L73 J;  1FE6 A;  4ZKU A;  2Q9I A;  5AVT B;  1USE A;  3KHU A;  1JCD A;  2NRG A;  3H1H J;  3L75 D;  2NPS A;  2A45 H;  3GHG B;  2JJL A;  3E1R A;  1SFC A;  4H44 B;  2K37 A;  3CCQ P;  1GK6 A;  1BGY J;  1KIL E;  1T2K D;  3NMD A;  2KI7 B;  1LT9 A;  3BAS A;  3AE8 C;  3H32 B;  1SQP E;  2YIU B;  1Y8A A;  2OAR A;  4WY4 A;  5CHX A;  1KYO E;  2Q1K A;  3OW2 O;  2IBZ E;  2LKM A;  1OVU A;  4AQR D;  1L0L J;  2FXM A;  2KOG A;  3BCC D;  5GTI E;  1OW6 A;  2GM4 A;  1A02 J;  2IPP A;  3GHG A;  3G9R A;  5BVZ A;  1N7S C;  3JSV C;  1GL2 A;  4C46 A;  1T3U A;  1M90 Q;  2W27 A;  1IFD A;  1QEX A;  3TSI A;  2M8R A;  4I1L A;  4Y28 J;  5AVU B;  1Q86 Q;  5CCG A;  1HWT C;  3H32 A;  2LXB A;  2KIK A;  3CCV P;  1YHQ P;  1BSN A;  1SQP D;  1E79 H;  1JM0 A;  3M9H A;  1KYO D;  1ZW0 A;  1KFN A;  2ZVN B;  4PJ0 H;  2IBZ D;  4W80 A;  5KAF H;  4OVN F;  1NTZ E;  2QJP C;  4U7J A;  3I55 P;  4PD4 I;  1VL2 A;  4U3F D;  4B86 A;  2HPC B;  2O01 H;  3II6 A;  1BDC A;  3V6I A;  2ZFC A;  1FZE A;  1XTG B;  1KB9 I;  1S2E A;  2W6J H;  3HD7 D;  3AEC C;  4TLF A;  1P84 E;  5AVZ B;  1FZC A;  5KJ7 C;  2V7Q J;  3CWB D;  3A0B E;  2NPS D;  3CC2 P;  3QH9 A;  3G4S P;  3L70 E;  4RKU J;  3GLM A;  3CCL P;  1LTB C;  1GDT A;  2KLU A; 
#chains in the Genus database with same CATH homology
 4HJG H;  1BDD A;  4ZMD A;  1OVU A;  1LT1 A;  4NPE A;  2B87 A;  2K3R A;  2KZJ A;  2B88 A;  4GOF A;  3S1K A;  2KZI A;  1Q2N A;  1OVR A;  1LP1 B;  4K3A A;  2WMM A;  5DJU B;  3ZDM A;  4NPF X;  2B89 A;  2SPZ A;  4WWI A;  4IOI H;  2P58 A;  2KUB A;  2I8D A;  3FXD A;  5C39 A;  2LXB A;  3FXE A;  1DEE G;  5EFW B;  1H0T B;  2KIK A;  2ZAE B;  2R44 A;  4EYY Q;  1OVV A;  2QRX A;  1JMB A;  1LP1 A;  4MN4 C;  2M5A A;  1JM0 A;  5DJT B;  4ASV A;  2HR3 A;  1ZW0 A;  2LR2 A;  5CBO A;  1ZXG A;  2UWJ E;  4ASW A;  4GOD A;  2B87 B;  1FC2 C;  1EDK A;  1SS1 A;  1EDL A;  3PH0 A;  2KS1 B;  5CBN A;  2QVA A;  1BDC A;  4K35 A;  4NPD A;  4HKZ H;  1U7M A;  3MHV A;  1NVO A;  3MZW B;  1EC5 A;  4JBZ A;  1Y47 A;  2RKL A;  3RGU A;  1EDJ A;  4HB1 A;  2KI7 B;  4GOE A;  4BXL A;  2JWD A;  4KJM A;  1U7J A;  5K5G B;  3QWO C;  1X0T A;  2M0B A;  2Q1K A;  1H0T A;  1S3J A;  1MFT A;  2M5A B;  1EDI A;  4CPG A;  4ZNC A;  2OTK E;  2LXC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...