1EDJA

Staphylococcal protein a e-domain (180), nmr, 20 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
56
structure length
56
Chain Sequence
AQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin-binding protein
molecule keywords STAPHYLOCOCCAL PROTEIN A
publication title Solution structure of the E-domain of staphylococcal protein A.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 18
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1996-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1edjA00
1X0TA 4ASVA 2KZJA 3S1KA 2B88A 4EYYQ 3FXDA 4NPDA 4K3AA 1JM0A 4ZMDA 2HR3A 1OVUA 1BDDA 2I8DA 2R44A 1NVOA 2B87A 2P58A 4IOIH 1EDIA 1LP1A 2JWDA 2ZAEB 2RKLA 3MHVA 1LT1A 1OVRA 2KZIA 4CPGA 1MFTA 4K35A 1FC2C 1H0TB 2OTKE 4HJGH 2K3RA 2KIKA 4MN4C 1S3JA 2QRXA 5DJTB 5EFWB 2M5AA 1Y47A 1ZXGA 3QWOC 1BDCA 2SPZA 3RGUA 1EDKA 4GOFA 5CBNA 1SS1A 5K5GB 2LXCB 3FXEA 4JBZA 4NPEA 5C39A 2KUBA 1ZW0A 1EDJA 2B87B 4KJMA 1OVVA 3ZDMA 1LP1B 2UWJE 4WWIA 4ZNCA 2B89A 4BXLA 4HKZH 1EDLA 1U7MA 2KS1B 2WMMA 5CBOA 1H0TA 4HB1A 2LXBA 2LR2A 2KI7B 3PH0A 2M5AB 1Q2NA 3MZWB 4NPFX 2Q1KA 5DJUB 4GODA 2QVAA 4GOEA 4ASWA 1JMBA 1EC5A 1DEEG 2M0BA 1U7JA
chains in the Genus database with same CATH superfamily
1K73Q 1SQQK 1M56D 1YBKA 4LGDE 4H13D 2WT7A 3NTNA 4I7ZC 1BCCE 5KAIH 2B87A 2YO2A 3H1ID 3P8MC 1HTLC 4PV1D 2L5GB 2FXPA 3BRVB 2YXQB 3CCRP 1ZRTE 2OTKE 1BE3G 1AVYA 1PGQA 1HJ0A 4GDOA 4YTPC 3AEAC 1IFMA 2W8ZA 3CCJP 4C46A 4GOFA 4N78E 2HG5D 1S4XA 1NKNA 1NTKG 2JJLA 3FX0A 3L71J 3GMAA 1KILC 1VQ9P 3CC7P 1RF0C 1LJ2A 2XNDH 3HTKA 3UIAA 3TF5A 1OVVA 2Y0CA 5CJ0A 4BRYB 1NWQA 1J1EC 1L4AD 2YIUC 2YKQA 1NOHA 1YQ3C 1VQ6P 3I56P 1T8ZA 3RK2C 3F5HA 1SFCC 3VP8A 2QJYB 2WPSA 1OW8A 3Q1MA 2N1TC 2KLVA 1HGVA 2WSCH 3RK3D 1JMBA 3O6QB 1KQFB 3RL0B 2B88A 3AECC 1PGPA 3FXDA 5KLIC 2IZ0A 3AEFC 1ZV8A 1SQBJ 3GF3A 1NTKK 2FBWC 2JWDA 3MHVA 1S2EA 2FFDB 4EDFA 3AEGC 1FC2C 2K3RA 1XTGB 2IBZI 2RMZA 1PFIA 5AW3B 1J1DC 3M0DC 3AEEC 3NMDA 3GW6A 2YKPA 5KJ7A 1SS1A 5H2FE 1QL2A 3RK3E 3IFMA 1SQQJ 2W6AA 2WT7B 3CXHD 3HE4B 4R4LA 2B87B 3KZIE 1E5WA 3H1LD 4U3FE 2QJPB 3GG2A 2RN0A 2AEJA 3C1LA 5AVWB 2WMMA 1H0TA 4WVZA 1M8OB 3TDKA 3CX5D 1Q82Q 1PP9G 5KLVJ 4IFMA 3V6IA 3L70G 1DEBA 3H6PA 5CHXA 1X22A 2KZJA 3H1HD 2E75C 3SFDC 3C9IA 3L74D 2AXCA 4D6TJ 1BGYD 1CSBA 3CXHE 3WUUA 2KSEA 2H8PD 3KZIH 3H1JE 1N7SA 1KB9I 1VQ7P 3B5NC 1GU5A 1JMMA 3L73J 2A45I 2E75D 2SPZA 4WB4A 1GW4A 3IF4A 1JUNA 3A3YB 1HWTC 4Z1MH 5CCHD 1CI6A 3H1HE 5AW5B 1URQD 4KJMA 1HBWA 3HUSC 1M1JA 3L74E 1NTKJ 1OZHA 1K9MQ 4DJGA 1U7MA 3I55P 2Q3EA 2E76C 2FYUG 2ITAA 2QJKB 3CWBG 3RL0D 1RE3A 2E5YA 4YXWH 4NPDA 5M1BA 3VP9A 5KTBA 3L36A 4IL6X 4DCKA 3AE2C 2FYZA 1VQNP 1YTZI 1LP1A 2RKLA 2ZYAA 3CC4P 2Q5UA 2PGDA 3OW2O 1H0TB 5BU5A 2D2CB 3Q2YA 2VRSA 3CCQP 2Q3IA 1JCDA 1NTMK 2QRXA 2ZYDA 1NTZD 4GIFA 1S9KE 1DX7A 1Y8AA 1GTWA 1T2KD 2R3CA 3RL0g 4C7NA 1HJBA 3V2QA 3BCCJ 3HD7C 2AEFA 2PFXA 1P84D 3TGUD 2QG4A 2IBZG 2QIWA 1FDIA 1GL2A 5APWA 2FKWB 2IYPA 4W7ZA 1FZEA 2YMYA 2FYNC 4L76A 1NU1D 2UWJE 1OFCX 2K1AA 3D6YA 2ZXEB 3EWKA 4IFFA 1CZQA 1PPJG 3VTPC 1JTHA 2LKMA 2WSFH 1A02J 2OTLP 1ZLLA 1L0LD 3AE1C 2WPRA 1FZCC 2A06G 3C8VA 4BWNA 2Q6QA 3GHGC 1X0TA 2M3BA 4ASVA 3VMZA 3WUTA 2MJZA 1NTZJ 2XU6A 3Q5SA 3L70J 1YQ4C 1RF1A 4M3LA 1BDDA 2OYIC 1FE6A 4UB6E 2IFNA 2P58A 3TGUE 1L0NJ 5KAFH 3KXDA 1M1JB 1SQBG 3E7KA 1RHZB 1LT1A 2KZIA 3AE4C 1Z56A 2AXTE 1R8EA 3L72J 1HVVA 1HGZA 5APVA 1NU1E 3BATA 5AW1B 3CMEP 1KTMA 3PJSK 3EQ2A 4WY4C 3SSUA 3USSA 1VF5B 1KYOE 1EXJA 2WSEJ 1Q7YQ 1L0LE 4BRYA 2E43A 2Y0EA 5K5GB 1LT9C 4L74A 3MUDA 4RKUJ 4NPEA 1H88A 3OA7A 1J1EB 2XNXA 1VL2A 3JSVC 1LNQA 2A45G 1SQQG 2CPSA 1LP1B 1SFCB 4UB6H 3A5TA 4OGQB 2NPSA 3O6QA 1RE4C 1JY2O 1G2CA 3N4XA 1R5SA 2N1TB 3M9BA 3MD0A 1SQBK 1LGHB 3U1AA 2AXTH 1VQ5P 1KFNA 2WPQA 1SQXD 2HYNA 5AW6B 1NTMJ 3M9HA 3JCUH 3MP7B 4H13C 5KJ7D 4U7JA 5KLVG 3S4RA 1KYOH 4PV1C 4Y99B 2O01H 1IJDB 1KMIZ 3D70A 1KV4A 2QE7H 1EDIA 2FYUE 2V7QH 1JNMA 4D6TG 1CW5A 2R5DA 4ZKPA 2D2CD 1E79H 1PGJA 1J2JB 1S3JA 1IFDA 4KT0J 5B5EE 3HE4A 1EZVG 3TK1A 4W7YA 3M9QA 1BCCJ 2K9YA 1SQXE 2PRRA 3L73G 2M3EA 3L75D 2YNYA 1MZ9A 4XA4A 1FDMA 3FXEA 1AQ5A 1RF1B 5KLVK 1SQPD 1L4AC 1UIXA 2C0WA 3CCSP 4AUWA 3EFGA 1FZFA 1YI2P 3P32A 1FJKA 3PTZA 5GTIH 1N7SD 4HB1A 1SQVE 3RK3C 1YTZT 3CL3D 3NFQA 4GT1A 1M1KQ 5AW0B 5CCGA 2IBZE 3AEDC 2BCCD 2O3JA 3VOPA 1OWAA 1K05A 3II6A 1HUCA 5B5EH 3L71E 3H1KD 3L37A 4ZKUA 3M0AA 1Q86Q 2WZ7A 2O1JA 1GZLA 1RE3C 3AE3C 3V2PA 3H1IJ 5AW8B 3L75E 2FY8A 1SLQA 3PRJA 3WUVA 1SQPE 1FU1A 1K8AQ 2NPSB 3TNUB 3B5NB 1ZR4A 1G2CB 3A0HE 1MFTA 3KPEA 1FBMA 4MN4C 1QLED 3KQGA 1LWUA 5AVUB 4U3FD 1KQLA 4H0LB 4DOJA 4PD4I 5APQA 3RGUA 2H43A 1EDKA 3BVHA 3G9RA 3H25A 2BCCE 3B71A 3HUSB 4YPCA 3H1KE 2KUBA 4A7PA 3BCCG 3F89A 1GL2C 1SVFA 3D6ZA 2ZT9D 2BEZF 3E1RA 4OGQD 3AE5C 1LTJC 1N73A 3QH9A 3V2RA 3A0HH 2I1JA 1GK4A 1KB9E 3W67A 1X79B 3H1JD 1S72P 3Q5RA 1SQQE 1FS0E 2ZVNB 1GL2D 2HR3A 1NTZG 2R44A 2POHA 1IFIA 3M91A 1IFPA 2FXMA 1USEA 1OVRA 1L0NG 4CPGA 2E74B 1BE3D 4EIJA 2OQQA 3SWKA 3L72G 1G1IA 2C0XA 3AEBC 1KZUB 5CCHC 1KB9H 2HODA 1JO5A 2QM7A 2OYHA 1URQC 3CC2P 5AW7B 2W6JH 3Q3DA 1YHQP 3H1LJ 2A45H 1W5CE 1G1JA 3H32A 4B86A 5AVQB 1HF9A 3RBXA 1ZP0C 2WITA 2JP3A 2QJYC 1NH4A 1NTZK 3KDPB 1KQGB 2JWAA 4I1LA 3L73E 1LWUB 2LR2A 3RL0C 2WWWA 2RH0A 1L0NK 1BE3E 4H44B 3A7OA 1AJYA 1FOSE 1Q2NA 2Q1KA 2GUSA 3T97A 3HRNA 3H1HJ 2IPPA 1EC5A 1R5LA 1WT6A 1DEEG 4JQ0D 3BRTB 1NTMG 2YMKA 3L74J 3V4WA 3VMAA 1GD2E 4ZMDA 1S9KD 1BGYJ 2NRGA 3D71A 4C7RA 3CCUP 2FFDC 1NTKE 1NVOA 3PHLA 1NYHA 1S5LH 2NPSD 3M06A 1BSNA 2IYOA 1N73B 1KILA 4WY4B 2OARA 4N3YB 1KD1Q 1RF0A 1T2KC 3CXHI 4H0LD 1EZVI 4OH8B 4UB8E 3OAKA 1SFCA 4I6MC 1EQ7A 1X9VA 2N1TA 1BCCG 3CX5I 4JBZA 1JY3O 1OIPA 2MKVA 2H88C 1GDTA 4DZOA 2R3SA 2Q7CA 2G8YA 2KS1B 3G3ZA 1DD4A 2CK3H 5KKZB 2C9NY 1PP9D 2K88A 5KAFE 2KXPB 4EI2A 4PV1B 5APYA 2HODB 2OYHB 1MKMA 4UB8H 1JB0J 5AVVB 4K3AA 5AVZB 1AFOA 1JM0A 3K5BA 3H32B 3M0DA 4JF7A 3VN0A 2JEEA 1W2BO 1RH5B 1KYOD 3L35A 5APTA 3H1IG 3B4SA 4WBAA 1FZAA 2E74D 4I7ZB 4O9BA 3FGAD 3HE5A 1M90Q 4RO0A 5CCGD 1HH0A 2R5BA 3CLQA 2AEMA 1BSHA 2B9BA 3U1CA 2M5AA 3CCEP 3SFEC 3T97B 1PP9E 2KNCA 1IO4A 1IC2A 3L70E 3TGUJ 1XTCC 2LXCB 3R2PA 2E5TA 3JCUE 1NU1J 1JOCA 1NAYA 2Z5HA 2HLOA 1PZQA 3LW5H 2HFED 1KILB 3CI9A 3OJAB 2WSSH 1H89A 2W90A 1SP4A 1L0LJ 5KJ7C 1EXIA 4H44D 5AW4B 2FYUD 2YIUB 3G6EP 2W27A 3AE8C 3CWBD 3RK2B 1U7JA 3TNUA 3S1KA 3B5NA 1MUUA 3LIEA 1NGMB 2I8DA 1W2EA 1Q90D 2D2CC 5E79E 1LTIC 4IOIH 5KLIB 5APSA 1NTME 1P84I 3HUSA 2YKOA 2QEXP 1ZXGA 1JEKA 3QWOC 1BDCA 5GTIE 1NKZB 4XFJA 1VQKP 2WSEH 1SQVD 2XKMA 1J1DB 1JY2P 1KC8Q 3CWBE 3W68A 2WTYA 3IR9A 2IBZD 3KYQA 1JCCA 3GLMA 3AE7C 1EDJA 2DW3A 5GTHE 1N7SC 1NO4A 2Q9IA 3L71D 3H1LG 3ZDMA 3RBZA 2B89A 3S9OA 1PPJD 4HKZH 1EDLA 4I2LC 5E79H 3P8CE 2NZ2A 4OVNF 2I1KA 3HE5B 2N9YB 2KP8A 1IK7A 1SQXJ 1IFJA 1K04A 1S1CX 2M5AB 2JR8A 1MV8A 2KNCB 2A06D 3TYYA 1TU3F 4L75A 2WSCJ 5AVXB 4PD4E 1YYCA 4EYYQ 1N7LA 3H1HG 3CPWO 3CD6P 1M1JC 1USDA 1PL5A 3TSIA 2P2UA 1OVUA 3L74G 3FWLA 1SQVJ 4W80A 4JYBA 2E75B 1SQBD 3VYIA 3HD7A 1BGYG 3I5CA 2ZAEB 2JKVA 1RY3A 5GTHH 1KN7A 2KYVA 2YXRB 2P10A 1VQPP 2KIKA 1LTAC 2KK7A 3SWFA 1VF5C 4TT3H 1PPJE 1N2DC 3PLNA 2WQYC 1Y47A 2W6BA 1JY2N 1URQB 3L75J 1OW7A 2A06E 3H1IE 1SQPJ 4IL6E 4JPZB 1KB9D 2WPVB 1FZCA 2ZT9C 1FJPA 4PD4H 4OGQC 3GHGA 1SQQD 1VF5D 1L2PA 2Z4EA 1KILD 2BEQD 2O01N 1ZN5A 2OYIA 1SQBE 2O1KA 5CBOA 1M7LA 2BCCJ 1NJIQ 1DH3A 4OWFA 3PP5A 3CMAP 3U59A 3LIDA 3RK2D 3H1KJ 4GOEA 1SFCD 1YIJP 2E76B 5KLVD 4Y99C 3CCLP 2R32A 2N1TD 1RQVA 2V4HA 4WY4A 2ZVOB 2Y9ZA 4QMAA 3A0BE 4IL6H 1AQTA 2ZJSE 1D7MA 4L73A 1T3JA 4D6TD 1LTTC 1LT9A 2G3AA 4U3FJ 4XE5B 4EOTA 3R4YA 1KILE 4TLFA 3IN6A 1OMIA 1KQSO 1PIXA 5DJTB 1EZVD 1RE4A 1RF1C 1GK6A 3L73D 5CBNA 1VQMP 5KLVE 2QM8A 2KS1A 5CJ4A 3TGUG 1KFMA 2C9LY 3N7NA 1PV3A 2CPBA 2K9JA 1VQOP 4IFDK 1YJWP 3HD7B 2IZ1A 1Q81Q 1NU1G 1YJNP 1Y9BA 3A0BH 2KOGA 2E42A 5BVZA 5TJHA 2Z5IA 4D6TE 4LLHA 1NTKD 2FYNB 5H2FH 1S5LE 5L8RJ 2W83C 3H1JJ 3HTKB 4DT0A 1L0LG 3MUDC 5DJUB 1ZR2A 1WMKA 2JO1A 5BU8B 2M0BA 1EZVE 3H1LE 2P1JA 2OTJP 1FZCB 3WU2E 2NPSC 3AE6C 1DD3A 3VMXA 4AQRD 1T3UA 3GHGB 1YJ9P 3CX5E 4AYCA 3V5BA 2GA1A 1AV1A 1BE3J 4HH2A 3SWYA 3WMM0 3GF7A 2XV5A 2OYIB 4H0LC 2IDBA 4K35A 2HPCA 3G4SP 1DIPA 2IFMA 4HJGH 1L4AA 1IK9A 1NU1K 1VQ8P 3CCVP 3KHUA 2GUVA 2XDJA 1QX8A 2Y9YA 3B5ND 1ZOYC 1BGYE 1L0LK 5APUA 3CXHH 1QL1A 3BCCD 2QSIA 2OYOA 1FOSF 1UIIA 3WU2H 1LT9B 3G71P 4RJTA 4BXLA 2QA4P 1NAFA 3CX5H 2WSFJ 1YITP 1FDOA 1MFZA 5B66E 2QJPC 2LXBA 2J58A 3ABVC 2KSJA 3MZWB 4NPFX 1ZMEC 2KB7P 1SQXG 2E76D 2BASA 2K37A 2P67A 3L4FA 1GMJA 5AVTB 1VQLP 3MIWA 4H13B 2K9JB 3FWNA 2E74C 3AE9C 1H8AA 3L70D 3BCCE 5CCGC 3BASA 2FYUK 2FXOA 1SQVG 1L0ND 3V4QA 3MTUE 2H89C 3A2AA 1M57D 1VDFA 3L72D 4KHXA 1JY3P 5EFWB 5TISE 1LTJA 3LW5J 1QGKB 3L71G 2L91A 5B66H 1FZGA 2PAJA 1FZBA 1OW6A 1WRGA 3E1IA 3L75G 1N7SB 1SQXK 4GKGA 1AA0A 2H7HA 5C39A 1SQPG 3HD7D 3Q5PA 1LTSC 1LWUC 4HYTB 4WWIA 1QVGO 1NTZE 4ZNCA 1RQUA 4H44C 1PP9J 4JYCA 2HPCB 2M8RA 3CCMP 1L4AB 2WVRA 1CI6B 1VPCA 1VQ4P 3ITKA 2N9BA 1L0NE 4R4MA 1SQVK 1OXZA 1PGOA 3PH0A 2J59M 3IAOA 5AW9B 3VMYA 1P84E 4YXDC 2BCCG 4GODA 2KLUA 3L72E 2QVAA 1NHLA 1A02F 4N6JA 3RK3B 1GU4A 1NTMD 5TISH 3H1KG 5APXA 3V2NA 2P7JA 2GM4A 2QJKC 1N73C 2XZRA 1IZNB 1AVOA 2O01J 1S5LX 5CCHA 4RESB 2V7QJ 2JDIH 2YO3A 1URQA 1SQPK 1U57A 1X8YA 1JY3N 2IX7C 3P7KA 4PJ0E 1QEXA 4U3FG 1GW3A 3EFFK 3P8CD 2ZT9B 5AVYB 1LTBC 1P84H 4WY4D 5KAIE 1BCCD 1FAVA 4LC1A 1ZW0A 3O8ZA 1IFNA 2ZXXA 5AVRB 4PD4D 1LTGC 2J5UA 5KKZC 1ZRTD 2ZYGA 4C7NB 1T6AA 2PP6A 1KORA 2ZFCA 2FFDA 2FYUJ 1OX3A 3NXSA 5AVSB 3MGNA 2OGUA 1GL2B 2Y0DA 2KI7B 3CWBJ 2OYHC 5CMZA 1LTJB 1N86A 1KYOI 4PJ0H 3B8EB 3JC22 1N8RQ 4N78D 4Y28J 4ASWA 3H1JG 1QVFO 1JTHB 5AW2B
chains in the Genus database with same CATH topology
1X0TA 4ASVA 2KZJA 3S1KA 2B88A 4EYYQ 3FXDA 4NPDA 4K3AA 1JM0A 4ZMDA 2HR3A 1OVUA 1BDDA 2I8DA 2R44A 1NVOA 2B87A 2P58A 4IOIH 1EDIA 1LP1A 2JWDA 2ZAEB 2RKLA 3MHVA 1LT1A 1OVRA 2KZIA 4CPGA 1MFTA 4K35A 1FC2C 1H0TB 2OTKE 4HJGH 2K3RA 2KIKA 4MN4C 1S3JA 2QRXA 5DJTB 5EFWB 2M5AA 1Y47A 1ZXGA 3QWOC 1BDCA 2SPZA 3RGUA 1EDKA 4GOFA 5CBNA 1SS1A 5K5GB 2LXCB 3FXEA 4JBZA 4NPEA 5C39A 2KUBA 1ZW0A 1EDJA 2B87B 4KJMA 1OVVA 3ZDMA 1LP1B 2UWJE 4WWIA 4ZNCA 2B89A 4BXLA 4HKZH 1EDLA 1U7MA 2KS1B 2WMMA 5CBOA 1H0TA 4HB1A 2LXBA 2LR2A 2KI7B 3PH0A 2M5AB 1Q2NA 3MZWB 4NPFX 2Q1KA 5DJUB 4GODA 2QVAA 4GOEA 4ASWA 1JMBA 1EC5A 1DEEG 2M0BA 1U7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X0T A;  4ASV A;  2KZJ A;  3S1K A;  2B88 A;  4EYY Q;  3FXD A;  4NPD A;  4K3A A;  1JM0 A;  4ZMD A;  2HR3 A;  1OVU A;  1BDD A;  2I8D A;  2R44 A;  1NVO A;  2B87 A;  2P58 A;  4IOI H;  1EDI A;  1LP1 A;  2JWD A;  2ZAE B;  2RKL A;  3MHV A;  1LT1 A;  1OVR A;  2KZI A;  4CPG A;  1MFT A;  4K35 A;  1FC2 C;  1H0T B;  2OTK E;  4HJG H;  2K3R A;  2KIK A;  4MN4 C;  1S3J A;  2QRX A;  5DJT B;  5EFW B;  2M5A A;  1Y47 A;  1ZXG A;  3QWO C;  1BDC A;  2SPZ A;  3RGU A;  1EDK A;  4GOF A;  5CBN A;  1SS1 A;  5K5G B;  2LXC B;  3FXE A;  4JBZ A;  4NPE A;  5C39 A;  2KUB A;  1ZW0 A;  1EDJ A;  2B87 B;  4KJM A;  1OVV A;  3ZDM A;  1LP1 B;  2UWJ E;  4WWI A;  4ZNC A;  2B89 A;  4BXL A;  4HKZ H;  1EDL A;  1U7M A;  2KS1 B;  2WMM A;  5CBO A;  1H0T A;  4HB1 A;  2LXB A;  2LR2 A;  2KI7 B;  3PH0 A;  2M5A B;  1Q2N A;  3MZW B;  4NPF X;  2Q1K A;  5DJU B;  4GOD A;  2QVA A;  4GOE A;  4ASW A;  1JMB A;  1EC5 A;  1DEE G;  2M0B A;  1U7J A; 
#chains in the Genus database with same CATH topology
 1K73 Q;  1SQQ K;  1M56 D;  1YBK A;  4LGD E;  4H13 D;  2WT7 A;  3NTN A;  4I7Z C;  1BCC E;  5KAI H;  2B87 A;  2YO2 A;  3H1I D;  3P8M C;  1HTL C;  4PV1 D;  2L5G B;  2FXP A;  3BRV B;  2YXQ B;  3CCR P;  1ZRT E;  2OTK E;  1BE3 G;  1AVY A;  1PGQ A;  1HJ0 A;  4GDO A;  4YTP C;  3AEA C;  1IFM A;  2W8Z A;  3CCJ P;  4C46 A;  4GOF A;  4N78 E;  2HG5 D;  1S4X A;  1NKN A;  1NTK G;  2JJL A;  3FX0 A;  3L71 J;  3GMA A;  1KIL C;  1VQ9 P;  3CC7 P;  1RF0 C;  1LJ2 A;  2XND H;  3HTK A;  3UIA A;  3TF5 A;  1OVV A;  2Y0C A;  5CJ0 A;  4BRY B;  1NWQ A;  1J1E C;  1L4A D;  2YIU C;  2YKQ A;  1NOH A;  1YQ3 C;  1VQ6 P;  3I56 P;  1T8Z A;  3RK2 C;  3F5H A;  1SFC C;  3VP8 A;  2QJY B;  2WPS A;  1OW8 A;  3Q1M A;  2N1T C;  2KLV A;  1HGV A;  2WSC H;  3RK3 D;  1JMB A;  3O6Q B;  1KQF B;  3RL0 B;  2B88 A;  3AEC C;  1PGP A;  3FXD A;  5KLI C;  2IZ0 A;  3AEF C;  1ZV8 A;  1SQB J;  3GF3 A;  1NTK K;  2FBW C;  2JWD A;  3MHV A;  1S2E A;  2FFD B;  4EDF A;  3AEG C;  1FC2 C;  2K3R A;  1XTG B;  2IBZ I;  2RMZ A;  1PFI A;  5AW3 B;  1J1D C;  3M0D C;  3AEE C;  3NMD A;  3GW6 A;  2YKP A;  5KJ7 A;  1SS1 A;  5H2F E;  1QL2 A;  3RK3 E;  3IFM A;  1SQQ J;  2W6A A;  2WT7 B;  3CXH D;  3HE4 B;  4R4L A;  2B87 B;  3KZI E;  1E5W A;  3H1L D;  4U3F E;  2QJP B;  3GG2 A;  2RN0 A;  2AEJ A;  3C1L A;  5AVW B;  2WMM A;  1H0T A;  4WVZ A;  1M8O B;  3TDK A;  3CX5 D;  1Q82 Q;  1PP9 G;  5KLV J;  4IFM A;  3V6I A;  3L70 G;  1DEB A;  3H6P A;  5CHX A;  1X22 A;  2KZJ A;  3H1H D;  2E75 C;  3SFD C;  3C9I A;  3L74 D;  2AXC A;  4D6T J;  1BGY D;  1CSB A;  3CXH E;  3WUU A;  2KSE A;  2H8P D;  3KZI H;  3H1J E;  1N7S A;  1KB9 I;  1VQ7 P;  3B5N C;  1GU5 A;  1JMM A;  3L73 J;  2A45 I;  2E75 D;  2SPZ A;  4WB4 A;  1GW4 A;  3IF4 A;  1JUN A;  3A3Y B;  1HWT C;  4Z1M H;  5CCH D;  1CI6 A;  3H1H E;  5AW5 B;  1URQ D;  4KJM A;  1HBW A;  3HUS C;  1M1J A;  3L74 E;  1NTK J;  1OZH A;  1K9M Q;  4DJG A;  1U7M A;  3I55 P;  2Q3E A;  2E76 C;  2FYU G;  2ITA A;  2QJK B;  3CWB G;  3RL0 D;  1RE3 A;  2E5Y A;  4YXW H;  4NPD A;  5M1B A;  3VP9 A;  5KTB A;  3L36 A;  4IL6 X;  4DCK A;  3AE2 C;  2FYZ A;  1VQN P;  1YTZ I;  1LP1 A;  2RKL A;  2ZYA A;  3CC4 P;  2Q5U A;  2PGD A;  3OW2 O;  1H0T B;  5BU5 A;  2D2C B;  3Q2Y A;  2VRS A;  3CCQ P;  2Q3I A;  1JCD A;  1NTM K;  2QRX A;  2ZYD A;  1NTZ D;  4GIF A;  1S9K E;  1DX7 A;  1Y8A A;  1GTW A;  1T2K D;  2R3C A;  3RL0 g;  4C7N A;  1HJB A;  3V2Q A;  3BCC J;  3HD7 C;  2AEF A;  2PFX A;  1P84 D;  3TGU D;  2QG4 A;  2IBZ G;  2QIW A;  1FDI A;  1GL2 A;  5APW A;  2FKW B;  2IYP A;  4W7Z A;  1FZE A;  2YMY A;  2FYN C;  4L76 A;  1NU1 D;  2UWJ E;  1OFC X;  2K1A A;  3D6Y A;  2ZXE B;  3EWK A;  4IFF A;  1CZQ A;  1PPJ G;  3VTP C;  1JTH A;  2LKM A;  2WSF H;  1A02 J;  2OTL P;  1ZLL A;  1L0L D;  3AE1 C;  2WPR A;  1FZC C;  2A06 G;  3C8V A;  4BWN A;  2Q6Q A;  3GHG C;  1X0T A;  2M3B A;  4ASV A;  3VMZ A;  3WUT A;  2MJZ A;  1NTZ J;  2XU6 A;  3Q5S A;  3L70 J;  1YQ4 C;  1RF1 A;  4M3L A;  1BDD A;  2OYI C;  1FE6 A;  4UB6 E;  2IFN A;  2P58 A;  3TGU E;  1L0N J;  5KAF H;  3KXD A;  1M1J B;  1SQB G;  3E7K A;  1RHZ B;  1LT1 A;  2KZI A;  3AE4 C;  1Z56 A;  2AXT E;  1R8E A;  3L72 J;  1HVV A;  1HGZ A;  5APV A;  1NU1 E;  3BAT A;  5AW1 B;  3CME P;  1KTM A;  3PJS K;  3EQ2 A;  4WY4 C;  3SSU A;  3USS A;  1VF5 B;  1KYO E;  1EXJ A;  2WSE J;  1Q7Y Q;  1L0L E;  4BRY A;  2E43 A;  2Y0E A;  5K5G B;  1LT9 C;  4L74 A;  3MUD A;  4RKU J;  4NPE A;  1H88 A;  3OA7 A;  1J1E B;  2XNX A;  1VL2 A;  3JSV C;  1LNQ A;  2A45 G;  1SQQ G;  2CPS A;  1LP1 B;  1SFC B;  4UB6 H;  3A5T A;  4OGQ B;  2NPS A;  3O6Q A;  1RE4 C;  1JY2 O;  1G2C A;  3N4X A;  1R5S A;  2N1T B;  3M9B A;  3MD0 A;  1SQB K;  1LGH B;  3U1A A;  2AXT H;  1VQ5 P;  1KFN A;  2WPQ A;  1SQX D;  2HYN A;  5AW6 B;  1NTM J;  3M9H A;  3JCU H;  3MP7 B;  4H13 C;  5KJ7 D;  4U7J A;  5KLV G;  3S4R A;  1KYO H;  4PV1 C;  4Y99 B;  2O01 H;  1IJD B;  1KMI Z;  3D70 A;  1KV4 A;  2QE7 H;  1EDI A;  2FYU E;  2V7Q H;  1JNM A;  4D6T G;  1CW5 A;  2R5D A;  4ZKP A;  2D2C D;  1E79 H;  1PGJ A;  1J2J B;  1S3J A;  1IFD A;  4KT0 J;  5B5E E;  3HE4 A;  1EZV G;  3TK1 A;  4W7Y A;  3M9Q A;  1BCC J;  2K9Y A;  1SQX E;  2PRR A;  3L73 G;  2M3E A;  3L75 D;  2YNY A;  1MZ9 A;  4XA4 A;  1FDM A;  3FXE A;  1AQ5 A;  1RF1 B;  5KLV K;  1SQP D;  1L4A C;  1UIX A;  2C0W A;  3CCS P;  4AUW A;  3EFG A;  1FZF A;  1YI2 P;  3P32 A;  1FJK A;  3PTZ A;  5GTI H;  1N7S D;  4HB1 A;  1SQV E;  3RK3 C;  1YTZ T;  3CL3 D;  3NFQ A;  4GT1 A;  1M1K Q;  5AW0 B;  5CCG A;  2IBZ E;  3AED C;  2BCC D;  2O3J A;  3VOP A;  1OWA A;  1K05 A;  3II6 A;  1HUC A;  5B5E H;  3L71 E;  3H1K D;  3L37 A;  4ZKU A;  3M0A A;  1Q86 Q;  2WZ7 A;  2O1J A;  1GZL A;  1RE3 C;  3AE3 C;  3V2P A;  3H1I J;  5AW8 B;  3L75 E;  2FY8 A;  1SLQ A;  3PRJ A;  3WUV A;  1SQP E;  1FU1 A;  1K8A Q;  2NPS B;  3TNU B;  3B5N B;  1ZR4 A;  1G2C B;  3A0H E;  1MFT A;  3KPE A;  1FBM A;  4MN4 C;  1QLE D;  3KQG A;  1LWU A;  5AVU B;  4U3F D;  1KQL A;  4H0L B;  4DOJ A;  4PD4 I;  5APQ A;  3RGU A;  2H43 A;  1EDK A;  3BVH A;  3G9R A;  3H25 A;  2BCC E;  3B71 A;  3HUS B;  4YPC A;  3H1K E;  2KUB A;  4A7P A;  3BCC G;  3F89 A;  1GL2 C;  1SVF A;  3D6Z A;  2ZT9 D;  2BEZ F;  3E1R A;  4OGQ D;  3AE5 C;  1LTJ C;  1N73 A;  3QH9 A;  3V2R A;  3A0H H;  2I1J A;  1GK4 A;  1KB9 E;  3W67 A;  1X79 B;  3H1J D;  1S72 P;  3Q5R A;  1SQQ E;  1FS0 E;  2ZVN B;  1GL2 D;  2HR3 A;  1NTZ G;  2R44 A;  2POH A;  1IFI A;  3M91 A;  1IFP A;  2FXM A;  1USE A;  1OVR A;  1L0N G;  4CPG A;  2E74 B;  1BE3 D;  4EIJ A;  2OQQ A;  3SWK A;  3L72 G;  1G1I A;  2C0X A;  3AEB C;  1KZU B;  5CCH C;  1KB9 H;  2HOD A;  1JO5 A;  2QM7 A;  2OYH A;  1URQ C;  3CC2 P;  5AW7 B;  2W6J H;  3Q3D A;  1YHQ P;  3H1L J;  2A45 H;  1W5C E;  1G1J A;  3H32 A;  4B86 A;  5AVQ B;  1HF9 A;  3RBX A;  1ZP0 C;  2WIT A;  2JP3 A;  2QJY C;  1NH4 A;  1NTZ K;  3KDP B;  1KQG B;  2JWA A;  4I1L A;  3L73 E;  1LWU B;  2LR2 A;  3RL0 C;  2WWW A;  2RH0 A;  1L0N K;  1BE3 E;  4H44 B;  3A7O A;  1AJY A;  1FOS E;  1Q2N A;  2Q1K A;  2GUS A;  3T97 A;  3HRN A;  3H1H J;  2IPP A;  1EC5 A;  1R5L A;  1WT6 A;  1DEE G;  4JQ0 D;  3BRT B;  1NTM G;  2YMK A;  3L74 J;  3V4W A;  3VMA A;  1GD2 E;  4ZMD A;  1S9K D;  1BGY J;  2NRG A;  3D71 A;  4C7R A;  3CCU P;  2FFD C;  1NTK E;  1NVO A;  3PHL A;  1NYH A;  1S5L H;  2NPS D;  3M06 A;  1BSN A;  2IYO A;  1N73 B;  1KIL A;  4WY4 B;  2OAR A;  4N3Y B;  1KD1 Q;  1RF0 A;  1T2K C;  3CXH I;  4H0L D;  1EZV I;  4OH8 B;  4UB8 E;  3OAK A;  1SFC A;  4I6M C;  1EQ7 A;  1X9V A;  2N1T A;  1BCC G;  3CX5 I;  4JBZ A;  1JY3 O;  1OIP A;  2MKV A;  2H88 C;  1GDT A;  4DZO A;  2R3S A;  2Q7C A;  2G8Y A;  2KS1 B;  3G3Z A;  1DD4 A;  2CK3 H;  5KKZ B;  2C9N Y;  1PP9 D;  2K88 A;  5KAF E;  2KXP B;  4EI2 A;  4PV1 B;  5APY A;  2HOD B;  2OYH B;  1MKM A;  4UB8 H;  1JB0 J;  5AVV B;  4K3A A;  5AVZ B;  1AFO A;  1JM0 A;  3K5B A;  3H32 B;  3M0D A;  4JF7 A;  3VN0 A;  2JEE A;  1W2B O;  1RH5 B;  1KYO D;  3L35 A;  5APT A;  3H1I G;  3B4S A;  4WBA A;  1FZA A;  2E74 D;  4I7Z B;  4O9B A;  3FGA D;  3HE5 A;  1M90 Q;  4RO0 A;  5CCG D;  1HH0 A;  2R5B A;  3CLQ A;  2AEM A;  1BSH A;  2B9B A;  3U1C A;  2M5A A;  3CCE P;  3SFE C;  3T97 B;  1PP9 E;  2KNC A;  1IO4 A;  1IC2 A;  3L70 E;  3TGU J;  1XTC C;  2LXC B;  3R2P A;  2E5T A;  3JCU E;  1NU1 J;  1JOC A;  1NAY A;  2Z5H A;  2HLO A;  1PZQ A;  3LW5 H;  2HFE D;  1KIL B;  3CI9 A;  3OJA B;  2WSS H;  1H89 A;  2W90 A;  1SP4 A;  1L0L J;  5KJ7 C;  1EXI A;  4H44 D;  5AW4 B;  2FYU D;  2YIU B;  3G6E P;  2W27 A;  3AE8 C;  3CWB D;  3RK2 B;  1U7J A;  3TNU A;  3S1K A;  3B5N A;  1MUU A;  3LIE A;  1NGM B;  2I8D A;  1W2E A;  1Q90 D;  2D2C C;  5E79 E;  1LTI C;  4IOI H;  5KLI B;  5APS A;  1NTM E;  1P84 I;  3HUS A;  2YKO A;  2QEX P;  1ZXG A;  1JEK A;  3QWO C;  1BDC A;  5GTI E;  1NKZ B;  4XFJ A;  1VQK P;  2WSE H;  1SQV D;  2XKM A;  1J1D B;  1JY2 P;  1KC8 Q;  3CWB E;  3W68 A;  2WTY A;  3IR9 A;  2IBZ D;  3KYQ A;  1JCC A;  3GLM A;  3AE7 C;  1EDJ A;  2DW3 A;  5GTH E;  1N7S C;  1NO4 A;  2Q9I A;  3L71 D;  3H1L G;  3ZDM A;  3RBZ A;  2B89 A;  3S9O A;  1PPJ D;  4HKZ H;  1EDL A;  4I2L C;  5E79 H;  3P8C E;  2NZ2 A;  4OVN F;  2I1K A;  3HE5 B;  2N9Y B;  2KP8 A;  1IK7 A;  1SQX J;  1IFJ A;  1K04 A;  1S1C X;  2M5A B;  2JR8 A;  1MV8 A;  2KNC B;  2A06 D;  3TYY A;  1TU3 F;  4L75 A;  2WSC J;  5AVX B;  4PD4 E;  1YYC A;  4EYY Q;  1N7L A;  3H1H G;  3CPW O;  3CD6 P;  1M1J C;  1USD A;  1PL5 A;  3TSI A;  2P2U A;  1OVU A;  3L74 G;  3FWL A;  1SQV J;  4W80 A;  4JYB A;  2E75 B;  1SQB D;  3VYI A;  3HD7 A;  1BGY G;  3I5C A;  2ZAE B;  2JKV A;  1RY3 A;  5GTH H;  1KN7 A;  2KYV A;  2YXR B;  2P10 A;  1VQP P;  2KIK A;  1LTA C;  2KK7 A;  3SWF A;  1VF5 C;  4TT3 H;  1PPJ E;  1N2D C;  3PLN A;  2WQY C;  1Y47 A;  2W6B A;  1JY2 N;  1URQ B;  3L75 J;  1OW7 A;  2A06 E;  3H1I E;  1SQP J;  4IL6 E;  4JPZ B;  1KB9 D;  2WPV B;  1FZC A;  2ZT9 C;  1FJP A;  4PD4 H;  4OGQ C;  3GHG A;  1SQQ D;  1VF5 D;  1L2P A;  2Z4E A;  1KIL D;  2BEQ D;  2O01 N;  1ZN5 A;  2OYI A;  1SQB E;  2O1K A;  5CBO A;  1M7L A;  2BCC J;  1NJI Q;  1DH3 A;  4OWF A;  3PP5 A;  3CMA P;  3U59 A;  3LID A;  3RK2 D;  3H1K J;  4GOE A;  1SFC D;  1YIJ P;  2E76 B;  5KLV D;  4Y99 C;  3CCL P;  2R32 A;  2N1T D;  1RQV A;  2V4H A;  4WY4 A;  2ZVO B;  2Y9Z A;  4QMA A;  3A0B E;  4IL6 H;  1AQT A;  2ZJS E;  1D7M A;  4L73 A;  1T3J A;  4D6T D;  1LTT C;  1LT9 A;  2G3A A;  4U3F J;  4XE5 B;  4EOT A;  3R4Y A;  1KIL E;  4TLF A;  3IN6 A;  1OMI A;  1KQS O;  1PIX A;  5DJT B;  1EZV D;  1RE4 A;  1RF1 C;  1GK6 A;  3L73 D;  5CBN A;  1VQM P;  5KLV E;  2QM8 A;  2KS1 A;  5CJ4 A;  3TGU G;  1KFM A;  2C9L Y;  3N7N A;  1PV3 A;  2CPB A;  2K9J A;  1VQO P;  4IFD K;  1YJW P;  3HD7 B;  2IZ1 A;  1Q81 Q;  1NU1 G;  1YJN P;  1Y9B A;  3A0B H;  2KOG A;  2E42 A;  5BVZ A;  5TJH A;  2Z5I A;  4D6T E;  4LLH A;  1NTK D;  2FYN B;  5H2F H;  1S5L E;  5L8R J;  2W83 C;  3H1J J;  3HTK B;  4DT0 A;  1L0L G;  3MUD C;  5DJU B;  1ZR2 A;  1WMK A;  2JO1 A;  5BU8 B;  2M0B A;  1EZV E;  3H1L E;  2P1J A;  2OTJ P;  1FZC B;  3WU2 E;  2NPS C;  3AE6 C;  1DD3 A;  3VMX A;  4AQR D;  1T3U A;  3GHG B;  1YJ9 P;  3CX5 E;  4AYC A;  3V5B A;  2GA1 A;  1AV1 A;  1BE3 J;  4HH2 A;  3SWY A;  3WMM 0;  3GF7 A;  2XV5 A;  2OYI B;  4H0L C;  2IDB A;  4K35 A;  2HPC A;  3G4S P;  1DIP A;  2IFM A;  4HJG H;  1L4A A;  1IK9 A;  1NU1 K;  1VQ8 P;  3CCV P;  3KHU A;  2GUV A;  2XDJ A;  1QX8 A;  2Y9Y A;  3B5N D;  1ZOY C;  1BGY E;  1L0L K;  5APU A;  3CXH H;  1QL1 A;  3BCC D;  2QSI A;  2OYO A;  1FOS F;  1UII A;  3WU2 H;  1LT9 B;  3G71 P;  4RJT A;  4BXL A;  2QA4 P;  1NAF A;  3CX5 H;  2WSF J;  1YIT P;  1FDO A;  1MFZ A;  5B66 E;  2QJP C;  2LXB A;  2J58 A;  3ABV C;  2KSJ A;  3MZW B;  4NPF X;  1ZME C;  2KB7 P;  1SQX G;  2E76 D;  2BAS A;  2K37 A;  2P67 A;  3L4F A;  1GMJ A;  5AVT B;  1VQL P;  3MIW A;  4H13 B;  2K9J B;  3FWN A;  2E74 C;  3AE9 C;  1H8A A;  3L70 D;  3BCC E;  5CCG C;  3BAS A;  2FYU K;  2FXO A;  1SQV G;  1L0N D;  3V4Q A;  3MTU E;  2H89 C;  3A2A A;  1M57 D;  1VDF A;  3L72 D;  4KHX A;  1JY3 P;  5EFW B;  5TIS E;  1LTJ A;  3LW5 J;  1QGK B;  3L71 G;  2L91 A;  5B66 H;  1FZG A;  2PAJ A;  1FZB A;  1OW6 A;  1WRG A;  3E1I A;  3L75 G;  1N7S B;  1SQX K;  4GKG A;  1AA0 A;  2H7H A;  5C39 A;  1SQP G;  3HD7 D;  3Q5P A;  1LTS C;  1LWU C;  4HYT B;  4WWI A;  1QVG O;  1NTZ E;  4ZNC A;  1RQU A;  4H44 C;  1PP9 J;  4JYC A;  2HPC B;  2M8R A;  3CCM P;  1L4A B;  2WVR A;  1CI6 B;  1VPC A;  1VQ4 P;  3ITK A;  2N9B A;  1L0N E;  4R4M A;  1SQV K;  1OXZ A;  1PGO A;  3PH0 A;  2J59 M;  3IAO A;  5AW9 B;  3VMY A;  1P84 E;  4YXD C;  2BCC G;  4GOD A;  2KLU A;  3L72 E;  2QVA A;  1NHL A;  1A02 F;  4N6J A;  3RK3 B;  1GU4 A;  1NTM D;  5TIS H;  3H1K G;  5APX A;  3V2N A;  2P7J A;  2GM4 A;  2QJK C;  1N73 C;  2XZR A;  1IZN B;  1AVO A;  2O01 J;  1S5L X;  5CCH A;  4RES B;  2V7Q J;  2JDI H;  2YO3 A;  1URQ A;  1SQP K;  1U57 A;  1X8Y A;  1JY3 N;  2IX7 C;  3P7K A;  4PJ0 E;  1QEX A;  4U3F G;  1GW3 A;  3EFF K;  3P8C D;  2ZT9 B;  5AVY B;  1LTB C;  1P84 H;  4WY4 D;  5KAI E;  1BCC D;  1FAV A;  4LC1 A;  1ZW0 A;  3O8Z A;  1IFN A;  2ZXX A;  5AVR B;  4PD4 D;  1LTG C;  2J5U A;  5KKZ C;  1ZRT D;  2ZYG A;  4C7N B;  1T6A A;  2PP6 A;  1KOR A;  2ZFC A;  2FFD A;  2FYU J;  1OX3 A;  3NXS A;  5AVS B;  3MGN A;  2OGU A;  1GL2 B;  2Y0D A;  2KI7 B;  3CWB J;  2OYH C;  5CMZ A;  1LTJ B;  1N86 A;  1KYO I;  4PJ0 H;  3B8E B;  3JC2 2;  1N8R Q;  4N78 D;  4Y28 J;  4ASW A;  3H1J G;  1QVF O;  1JTH B;  5AW2 B; 
#chains in the Genus database with same CATH homology
 1X0T A;  4ASV A;  2KZJ A;  3S1K A;  2B88 A;  4EYY Q;  3FXD A;  4NPD A;  4K3A A;  1JM0 A;  4ZMD A;  2HR3 A;  1OVU A;  1BDD A;  2I8D A;  2R44 A;  1NVO A;  2B87 A;  2P58 A;  4IOI H;  1EDI A;  1LP1 A;  2JWD A;  2ZAE B;  2RKL A;  3MHV A;  1LT1 A;  1OVR A;  2KZI A;  4CPG A;  1MFT A;  4K35 A;  1FC2 C;  1H0T B;  2OTK E;  4HJG H;  2K3R A;  2KIK A;  4MN4 C;  1S3J A;  2QRX A;  5DJT B;  5EFW B;  2M5A A;  1Y47 A;  1ZXG A;  3QWO C;  1BDC A;  2SPZ A;  3RGU A;  1EDK A;  4GOF A;  5CBN A;  1SS1 A;  5K5G B;  2LXC B;  3FXE A;  4JBZ A;  4NPE A;  5C39 A;  2KUB A;  1ZW0 A;  1EDJ A;  2B87 B;  4KJM A;  1OVV A;  3ZDM A;  1LP1 B;  2UWJ E;  4WWI A;  4ZNC A;  2B89 A;  4BXL A;  4HKZ H;  1EDL A;  1U7M A;  2KS1 B;  2WMM A;  5CBO A;  1H0T A;  4HB1 A;  2LXB A;  2LR2 A;  2KI7 B;  3PH0 A;  2M5A B;  1Q2N A;  3MZW B;  4NPF X;  2Q1K A;  5DJU B;  4GOD A;  2QVA A;  4GOE A;  4ASW A;  1JMB A;  1EC5 A;  1DEE G;  2M0B A;  1U7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...