1EDJA

Staphylococcal protein a e-domain (180), nmr, 20 structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
56
structure length
56
Chain Sequence
AQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the E-domain of staphylococcal protein A.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immunoglobulin-binding protein
molecule keywords STAPHYLOCOCCAL PROTEIN A
total genus 18
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1996-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1edjA00
4ZNCA 1H0TB 1Q2NA 1LP1B 2B87B 4BXLA 2LR2A 4GOFA 1U7JA 4NPFX 1DEEG 2WMMA 4ASWA 4GOEA 1S3JA 2SPZA 1JMBA 2KIKA 4NPDA 4HJGH 3MHVA 1H0TA 1BDCA 1ZW0A 4ASVA 1OVUA 2OTKE 2I8DA 2KZJA 5CBNA 5DJUB 2R44A 2M0BA 2B88A 3PH0A 1EC5A 2QRXA 2ZAEB 2B87A 1LT1A 3S1KA 4CPGA 1OVRA 1ZXGA 4EYYQ 5C39A 4JBZA 2P58A 2LXBA 2RKLA 1EDIA 1EDKA 4HKZH 3ZDMA 1MFTA 1U7MA 2JWDA 3RGUA 2M5AA 1OVVA 2K3RA 2M5AB 4K3AA 4NPEA 4MN4C 3MZWB 2KS1B 2B89A 2KUBA 1JM0A 4GODA 4KJMA 2KI7B 2UWJE 2KZIA 5K5GB 4HB1A 1EDJA 2QVAA 2LXCB 1X0TA 1NVOA 4ZMDA 2Q1KA 4K35A 1EDLA 5DJTB 2HR3A 5CBOA 1SS1A 3QWOC 4IOIH 3FXEA 4WWIA 5EFWB 3FXDA 1LP1A 1Y47A 1FC2C 1BDDA
chains in the Genus database with same CATH superfamily
4ZNCA 2FFDB 1T3UA 4GDOA 4YXDC 1LP1B 2B87B 3F5HA 5M1BA 2P1JA 3WMM0 2WT7B 1Q90D 3L71G 4M3LA 1U7JA 3NTNA 3FGAD 3RL0B 1K9MQ 1VQ7P 2KSEA 5B5EE 4NPFX 4Y28J 4H44B 2XDJA 2FYUE 5AW8B 3VP9A 4H13C 1IFNA 2WT7A 5BVZA 1PPJG 1P84I 2I1JA 2E76C 2SPZA 1YBKA 2WSEJ 3A3YB 1JY2O 2YO2A 2NPSC 3L74G 3O8ZA 4RO0A 1NTZG 2B9BA 2KIKA 2OARA 1NTZD 1ZOYC 3B5ND 3FX0A 4N6JA 4C7NB 1R5LA 1NTME 1EZVG 3H1JE 4KT0J 1S5LX 2E43A 1L0NG 3CC2P 1KFMA 1M8OB 1Q82Q 1X22A 2N1TC 1L4AC 3MHVA 2M3BA 3AEEC 3HD7C 1ZW0A 3O6QB 1T3JA 3SFDC 4ASVA 4I6MC 1KMIZ 1HTLC 1LTJC 1VQ5P 1M7LA 3U59A 1L0LD 1SFCA 4I2LC 2JP3A 4DT0A 2KZJA 3H6PA 3AEBC 3RK2D 1Q86Q 1ZMEC 2HODB 2OYOA 3II6A 5AVZB 1ZR4A 1N7SD 5CJ0A 1JY2P 2CPBA 3P7KA 3TNUB 2M0BA 3USSA 1MZ9A 2MKVA 3LIDA 4TLFA 3BCCE 3T97B 3RK2C 5L8RJ 1SQVK 4WY4A 1NTZK 2KB7P 1TU3F 2LKMA 4RESB 2I1KA 4JYCA 2KSJA 2GA1A 1NKZB 3LIEA 4I1LA 2YKQA 1S5LH 1QL1A 2D2CB 2K88A 3H32A 5AVYB 1RF1C 1YYCA 3AECC 1X79B 3P8CE 1BCCG 1GL2A 1L0LK 2H8PD 2O01J 1QVGO 4YXWH 3HUSA 3H1IE 2A45G 1OW8A 1VDFA 2KS1A 3HUSC 3SSUA 1SQQK 5AVQB 1VQPP 5CCHD 2YMKA 4HKZH 1KYOD 2G8YA 1ZRTD 4IFMA 3RL0D 3JSVC 3N4XA 3OA7A 1N7SB 1LTIC 2AXCA 3H1KD 3ZDMA 2WWWA 1J2JB 2BEQD 2BCCE 2AEJA 1L0LE 3AE5C 3L74J 5GTHE 4Y99C 3BCCJ 1GK6A 2P10A 2E5YA 1ZV8A 1LWUA 1SQPD 2QJPC 3TDKA 2Y0DA 3L75G 2C0WA 1NJIQ 1LNQA 1IFMA 1PZQA 2K3RA 4K3AA 1RE4C 1XTCC 1K05A 3L70D 1GDTA 5B5EH 4D6TG 1URQC 5APYA 1HJBA 4UB6H 1CZQA 1M1KQ 2AXTE 2YNYA 5APQA 1YI2P 3H1HE 1S1CX 1AJYA 2K9JA 1PGOA 1NTKD 2A45H 5CHXA 3RL0g 1FDMA 1JM0A 3AE3C 1N7SA 1M1JB 3H1HG 1J1DB 3CX5H 3H1KJ 1KYOH 2ITAA 1L0NK 2ZT9D 4W80A 1JOCA 5APWA 1GK4A 2W27A 3CWBJ 4H44D 1KILC 4KHXA 4U3FJ 5K5GB 5TISH 1NU1J 3CPWO 2CK3H 1GL2B 2E74C 3RBZA 5KLVK 3BRVB 3VP8A 1SQPK 1OX3A 1WMKA 5AW6B 1SP4A 3KXDA 2E42A 1FJKA 3SWKA 1KB9I 3PP5A 3EQ2A 1NO4A 1SQPE 4AQRD 4BWNA 2Q3IA 1EDLA 2KNCB 5AVVB 1FZFA 1BCCJ 3T97A 1JY3O 3S9OA 3MUDA 1M1JC 4RJTA 5CCHA 3HRNA 3Q2YA 3TNUA 1T2KD 1SQXG 2V4HA 1FBMA 3BRTB 5EFWB 1AA0A 1LT9A 3L70E 3V5BA 1CI6B 1IFIA 2W90A 3CXHE 4U3FG 3B4SA 3I5CA 3V2QA 2HPCA 1GW3A 1BSHA 1SLQA 1Y47A 3VN0A 1PGPA 3KYQA 1T8ZA 2DW3A 3H1HD 2P7JA 1L4AD 3P32A 5KLVD 3CCVP 3CC4P 1RH5B 1BDDA 3BATA 2OTLP 1YHQP 3V4QA 1A02J 3PTZA 4AYCA 2KLUA 5E79E 4WVZA 3CCSP 5KJ7A 2WSCJ 3JC22 1RF0A 5B66H 1VQ9P 4BXLA 2LR2A 4GOFA 1UIIA 3WU2E 3D71A 3V2PA 2KK7A 1SQBK 4YTPC 3V2NA 3KZIE 1N73B 3A0HH 3AE9C 3IAOA 3M06A 1SQXK 4GOEA 1S3JA 1H0TB 5GTIH 1S2EA 1N7LA 2E75B 1RHZB 1JMBA 2OGUA 2N9YB 3B71A 1NAYA 2KP8A 3IF4A 2IZ0A 3FWLA 5APXA 1RQVA 1VQKP 5CCGA 1R8EA 3PHLA 1M56D 5KAIE 1YJNP 1L2PA 1BDCA 3MGNA 2KYVA 3CCQP 2PRRA 3AEAC 4ZKUA 1NH4A 1SQXE 3G71P 5KAIH 1ZN5A 3KZIH 5CBNA 2P2UA 2HLOA 2QJKB 1JCDA 3MD0A 1DD3A 1SQBD 5AW0B 5KJ7C 1H88A 1FDOA 2IX7C 5AW4B 1PFIA 3D70A 2B88A 1P84D 2ZXEB 3K5BA 1EC5A 2QRXA 2RH0A 4L73A 3IFMA 1D7MA 2GUSA 4UB8E 1FJPA 2N1TB 1LWUB 1LT1A 1SQVD 3L72G 1URQA 4DCKA 4Z1MH 3S1KA 3CWBD 2POHA 3CCJP 2PFXA 2C9NY 5BU8B 2OTJP 2OYHA 1RF1B 2BCCD 4EYYQ 3ITKA 1N2DC 5CMZA 2MJZA 3WUUA 2Z5HA 1LJ2A 3CMAP 3B8EB 2P58A 1EXJA 3GG2A 1SQVJ 2IFNA 4PD4I 5KKZC 1CSBA 2W6BA 2FXMA 2Q5UA 2WSCH 3L71D 2NPSD 2AEMA 3CXHI 3CD6P 1LTGC 4JQ0D 1BSNA 2N9BA 1FZGA 1HVVA 4JYBA 3H1KG 3V6IA 1G1JA 2Y0CA 3TGUG 5CCHC 1VQ6P 1U7MA 2FBWC 1IZNB 3H32B 4OH8B 3L73E 3CX5I 4L74A 2J5UA 3MIWA 3B5NC 3HD7D 1NTMK 4N78D 3RBXA 1PPJE 2R3CA 1N8RQ 1WRGA 2ZVNB 3OJAB 5B66E 5KLVE 5CCGD 3VMXA 1GL2D 2RN0A 1LTSC 2IYPA 3IR9A 2M5AB 3JCUE 1PL5A 1YITP 2OYHC 1HJ0A 1MFZA 4IL6H 3V4WA 4EDFA 1BGYG 3LW5H 1M90Q 3PRJA 1H8AA 3CCEP 3H1LG 1Q7YQ 1K04A 2FYUK 1T2KC 5APSA 3A2AA 1VF5C 1YIJP 1SFCC 3L74D 3L75E 2KUBA 3WUVA 1YJWP 1FZAA 4IFFA 4N3YB 1N7SC 4YPCA 1QGKB 1LGHB 1PP9D 2FKWB 1BCCD 1VL2A 1LWUC 2IZ1A 3O6QA 1JTHB 2QJYB 5APTA 3I56P 3HE5B 3CX5E 4PD4E 1FDIA 2PP6A 1LTBC 2Q7CA 5KTBA 1NGMB 4ZKPA 1E79H 2R32A 1URQD 3NMDA 1W2EA 3H1HJ 3TGUD 1ZR2A 1JNMA 3CCLP 2M3EA 3CXHD 4PV1B 2LXCB 1JY3N 2BCCJ 1HH0A 3AEGC 1GU5A 1NWQA 1PPJD 1AQTA 3AEDC 4H13D 4K35A 1RY3A 1SVFA 3GLMA 1IK7A 1S5LE 3HTKB 3L73D 5KAFH 1PP9J 3EWKA 2FYUD 5CJ4A 4IOIH 1IO4A 1YJ9P 1AVYA 3FXEA 2NPSA 3AE6C 3CCRP 2M8RA 3TSIA 2OYIB 2A45I 4BRYB 1SQXD 1SQBE 4W7YA 1OW7A 2W83C 3AE1C 3FXDA 3VMYA 4DOJA 1QLED 3AE7C 1KFNA 1LP1A 3BASA 1W5CE 2Q9IA 3L35A 2FFDA 3EFGA 2YXRB 1M57D 4PJ0E 3L70J 1RF1A 1BCCE 2RMZA 1N73C 1NTZE 1MUUA 1SQVE 2GUVA 3CX5D 3TYYA 1Q2NA 2W8ZA 3D6YA 3H25A 2WSSH 2QJYC 1CW5A 1PP9E 1Y8AA 2WPQA 1LTJB 1G2CB 2FXPA 3NXSA 2L5GB 2NZ2A 4PJ0H 4D6TJ 1HGZA 2WSFJ 2H43A 3CI9A 3RK3D 1KTMA 4ZMDA 4I7ZC 3VTPC 1IJDB 3KQGA 2IPPA 2JDIH 1Z56A 1JO5A 1G2CA 1OZHA 2E5TA 1FOSE 1NTKG 4DZOA 3CWBG 3GF3A 4H44C 4NPDA 3A0HE 1PIXA 1DIPA 1K73Q 3M91A 4XE5B 4WB4A 4D6TD 4OGQB 1KQSO 3BVHA 1KYOI 3FWNA 3KHUA 1AFOA 3OW2O 3AE8C 3AEFC 3B5NB 2WZ7A 1P84E 1H0TA 2C0XA 4OWFA 3GW6A 4XFJA 1SQPG 2JWAA 1Q81Q 1FZEA 4JF7A 1NOHA 1OVUA 4W7ZA 4BRYA 1J1EB 4LGDE 2I8DA 1LTAC 3H1ID 2IBZI 1NTMG 2FYUJ 3E7KA 3H1JG 5AVRB 2QE7H 2R44A 1SQVG 2H88C 2ZT9B 2WQYC 3L72D 3L75J 3P8CD 4U7JA 1GMJA 1E5WA 4EOTA 1S9KE 3H1KE 3HTKA 5KAFE 2KOGA 2W6AA 4GKGA 1MV8A 1FOSF 3TGUJ 1JB0J 2NRGA 3NFQA 1L0LJ 1BE3E 5E79H 5KLIC 2WITA 5AW1B 2ZXXA 2A06E 4OGQD 5BU5A 5KLIB 3QH9A 3E1RA 1SQQJ 2O01H 2O01N 3C8VA 1HUCA 1JTHA 2WPVB 2WSEH 2YKOA 3ABVC 2KXPB 3OAKA 1OVRA 4D6TE 2XZRA 3MP7B 4EIJA 3Q1MA 1ZLLA 4OGQC 2FXOA 1DX7A 2QG4A 1SQQD 1NTKE 3L72J 4R4MA 2ZVOB 4B86A 1RE3A 1EDKA 1LT9B 1FAVA 1FZCC 1KQGB 3PJSK 2QJPB 3IN6A 1JMMA 3M0AA 4GIFA 4H0LD 1VQLP 3C1LA 3VOPA 3H1LD 2KNCA 2PAJA 3JCUH 2ZYAA 3S4RA 1K8AQ 1KZUB 4Y99B 3RGUA 2HG5D 1JEKA 1S4XA 2D2CD 3L73G 1NU1K 2AXTH 1OVVA 1N86A 1GD2E 1OXZA 4LLHA 1EZVD 3L71J 1SQPJ 2E74B 2R5DA 2Y0EA 3MZWB 5APVA 1Y9BA 1KYOE 2AEFA 5AVUB 1KILB 2QM8A 3C9IA 1R5SA 1NTMJ 2FYUG 3H1JJ 5KLVG 2JR8A 2O1KA 4GODA 1VQOP 3D6ZA 5AVXB 1IFJA 3AE2C 2YIUC 3HD7A 2KI7B 3RK2B 2KZIA 2YKPA 2YO3A 3RK3E 2OYIC 1L0ND 2P67A 5CCGC 2OYHB 1KQLA 3RK3B 1URQB 3GF7A 4HB1A 1HGVA 4U3FE 3E1IA 1VQNP 1GU4A 2K1AA 2Z5IA 3M9HA 1KQFB 5TISE 1RE4A 2QVAA 4AUWA 4C7RA 2H7HA 3GMAA 2IBZG 1G1IA 2R3SA 5DJTB 2HR3A 1IFPA 4QMAA 2IBZE 1L0NJ 1LTTC 3BCCG 2V7QH 4EI2A 5KLVJ 2WTYA 1XTGB 2FYNB 1RF0C 1YQ3C 2HYNA 1S9KD 4I7ZB 1DD4A 1X9VA 4PV1C 3HUSB 1GZLA 4PD4H 3HE4A 4A7PA 3GHGB 1UIXA 2ZYDA 3L75D 2ZYGA 3MTUE 4IFDK 1RQUA 1FS0E 1FC2C 4OVNF 4H13B 4UB6E 2HFED 3KDPB 2H89C 4PV1D 1EQ7A 2E76B 2FYNC 2IDBA 1BE3G 1USDA 3GHGA 3GHGC 1BE3D 3HE4B 4PD4D 1L0NE 5AW3B 3WUTA 2A06D 5H2FE 2QSIA 1BGYJ 1VF5B 2D2CC 1N73A 1PV3A 3MUDC 3H1IG 4HH2A 1J1DC 3L70G 3RL0C 1IC2A 1JY3P 1DEEG 2KLVA 3WU2H 3I55P 2FFDC 2C9LY 3CXHH 3R4YA 1JCCA 1OMIA 2BEZF 2WMMA 1BE3J 1KORA 1SFCD 3PLNA 4R4LA 4ASWA 2Q3EA 3W68A 1EXIA 4JPZB 1KB9D 1SQQE 2BCCG 2WPRA 1KC8Q 3TF5A 5AVTB 1NU1E 4DJGA 5AW5B 1PGQA 4HJGH 2JEEA 2OQQA 1BGYD 1LTJA 4L76A 2IFMA 2YIUB 1PP9G 4IL6E 4TT3H 3A0BE 3M9BA 4LC1A 3RK3C 2E75C 4WY4D 1SQXJ 2HPCB 1CI6A 3CWBE 2WSFH 2Z4EA 1QX8A 3HD7B 2OTKE 1AV1A 1IFDA 3A7OA 5DJUB 1FE6A 2XNDH 1QL2A 1IK9A 2XV5A 3L37A 4H0LC 1KILA 2ZT9C 1HF9A 2OYIA 2NPSB 5AW7B 1AQ5A 3L71E 3PH0A 2WVRA 3A5TA 3Q5PA 1NYHA 3F89A 3SFEC 2QJKC 2E76D 4RKUJ 2JKVA 2ZAEB 1NKNA 2FYZA 2B87A 3M0DA 4U3FD 1NU1D 1QVFO 3Q3DA 4N78E 4CPGA 1KB9E 1BGYE 1LT9C 1EZVI 1JY2N 1NHLA 1ZXGA 2Y9YA 3H1LE 2N1TD 1DEBA 1X8YA 3N7NA 5C39A 4JBZA 2GM4A 1L0LG 1M1JA 3HE5A 1HWTC 5APUA 2FY8A 2JJLA 2ZFCA 3CC7P 1S72P 2K9JB 1SQQG 2LXBA 2RKLA 1FZCB 1EDIA 2IBZD 1YTZT 3G9RA 3G6EP 1PGJA 3R2PA 1EZVE 1MFTA 1OIPA 1W2BO 3A0BH 1NTKJ 1MKMA 3L72E 5KKZB 3TK1A 3L36A 1RE3C 1NTMD 1USEA 2JWDA 2YMYA 3EFFK 2WPSA 3H1JD 3VMAA 1L4AB 3CCUP 1NAFA 2K9YA 1KB9H 2Q6QA 1OW6A 5H2FH 4O9BA 2M5AA 1GW4A 1WT6A 1KD1Q 2J59M 1AVOA 2XU6A 4NPEA 1A02F 3M9QA 2QM7A 4HYTB 4MN4C 2CPSA 2V7QJ 3M0DC 1KN7A 3AE4C 1ZP0C 1VPCA 3LW5J 3P8MC 2E75D 2KS1B 4WY4C 2B89A 1FZBA 3BCCD 2G3AA 2W6JH 3CLQA 3G3ZA 1U57A 5TJHA 1KILD 2QIWA 3SWFA 2YXQB 3Q5RA 3CCMP 1J1EC 1FU1A 4C46A 2E74D 2UWJE 1YQ4C 4KJMA 1HBWA 1JUNA 3W67A 1SQBG 3B5NA 2VRSA 2O3JA 2XNXA 2ZJSE 1EDJA 2A06G 2K37A 1OFCX 4WY4B 5AW2B 1H89A 1VQ4P 2JO1A 5AVSB 5AVWB 5GTIE 4L75A 1VQMP 3U1CA 3CMEP 4UB8H 1X0TA 1NVOA 1OWAA 2IYOA 2Q1KA 1L4AA 2XKMA 2N1TA 3VMZA 4H0LB 3G4SP 2QEXP 4WBAA 1YTZI 2PGDA 3V2RA 1T6AA 2BASA 2HODA 3L74E 3U1AA 5CBOA 2L91A 1SS1A 3SWYA 1GL2C 3QWOC 1KV4A 5AW9B 3H1IJ 1P84H 1ZRTE 5KJ7D 1NTKK 4GT1A 1SFCB 1VQ8P 4WWIA 3L73J 2Y9ZA 3CL3D 3L4FA 1NU1G 1FZCA 2J58A 1KILE 1QEXA 1SQBJ 2R5BA 4IL6X 1DH3A 3VYIA 2QA4P 1VF5D 3Q5SA 4XA4A 1GTWA 3UIAA 3H1LJ 1NTZJ 3KPEA 2O1JA 4C7NA 5GTHH 3TGUE
chains in the Genus database with same CATH topology
4ZNCA 1H0TB 1Q2NA 1LP1B 2B87B 4BXLA 2LR2A 4GOFA 1U7JA 4NPFX 1DEEG 2WMMA 4ASWA 4GOEA 1S3JA 2SPZA 1JMBA 2KIKA 4NPDA 4HJGH 3MHVA 1H0TA 1BDCA 1ZW0A 4ASVA 1OVUA 2OTKE 2I8DA 2KZJA 5CBNA 5DJUB 2R44A 2M0BA 2B88A 3PH0A 1EC5A 2QRXA 2ZAEB 2B87A 1LT1A 3S1KA 4CPGA 1OVRA 1ZXGA 4EYYQ 5C39A 4JBZA 2P58A 2LXBA 2RKLA 1EDIA 1EDKA 4HKZH 3ZDMA 1MFTA 1U7MA 2JWDA 3RGUA 2M5AA 1OVVA 2K3RA 2M5AB 4K3AA 4NPEA 4MN4C 3MZWB 2KS1B 2B89A 2KUBA 1JM0A 4GODA 4KJMA 2KI7B 2UWJE 2KZIA 5K5GB 4HB1A 1EDJA 2QVAA 2LXCB 1X0TA 1NVOA 4ZMDA 2Q1KA 4K35A 1EDLA 5DJTB 2HR3A 5CBOA 1SS1A 3QWOC 4IOIH 3FXEA 4WWIA 5EFWB 3FXDA 1LP1A 1Y47A 1FC2C 1BDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZNC A;  1H0T B;  1Q2N A;  1LP1 B;  2B87 B;  4BXL A;  2LR2 A;  4GOF A;  1U7J A;  4NPF X;  1DEE G;  2WMM A;  4ASW A;  4GOE A;  1S3J A;  2SPZ A;  1JMB A;  2KIK A;  4NPD A;  4HJG H;  3MHV A;  1H0T A;  1BDC A;  1ZW0 A;  4ASV A;  1OVU A;  2OTK E;  2I8D A;  2KZJ A;  5CBN A;  5DJU B;  2R44 A;  2M0B A;  2B88 A;  3PH0 A;  1EC5 A;  2QRX A;  2ZAE B;  2B87 A;  1LT1 A;  3S1K A;  4CPG A;  1OVR A;  1ZXG A;  4EYY Q;  5C39 A;  4JBZ A;  2P58 A;  2LXB A;  2RKL A;  1EDI A;  1EDK A;  4HKZ H;  3ZDM A;  1MFT A;  1U7M A;  2JWD A;  3RGU A;  2M5A A;  1OVV A;  2K3R A;  2M5A B;  4K3A A;  4NPE A;  4MN4 C;  3MZW B;  2KS1 B;  2B89 A;  2KUB A;  1JM0 A;  4GOD A;  4KJM A;  2KI7 B;  2UWJ E;  2KZI A;  5K5G B;  4HB1 A;  1EDJ A;  2QVA A;  2LXC B;  1X0T A;  1NVO A;  4ZMD A;  2Q1K A;  4K35 A;  1EDL A;  5DJT B;  2HR3 A;  5CBO A;  1SS1 A;  3QWO C;  4IOI H;  3FXE A;  4WWI A;  5EFW B;  3FXD A;  1LP1 A;  1Y47 A;  1FC2 C;  1BDD A; 
#chains in the Genus database with same CATH topology
 4ZNC A;  2FFD B;  1T3U A;  4GDO A;  4YXD C;  1LP1 B;  2B87 B;  3F5H A;  5M1B A;  2P1J A;  3WMM 0;  2WT7 B;  1Q90 D;  3L71 G;  4M3L A;  1U7J A;  3NTN A;  3FGA D;  3RL0 B;  1K9M Q;  1VQ7 P;  2KSE A;  5B5E E;  4NPF X;  4Y28 J;  4H44 B;  2XDJ A;  2FYU E;  5AW8 B;  3VP9 A;  4H13 C;  1IFN A;  2WT7 A;  5BVZ A;  1PPJ G;  1P84 I;  2I1J A;  2E76 C;  2SPZ A;  1YBK A;  2WSE J;  3A3Y B;  1JY2 O;  2YO2 A;  2NPS C;  3L74 G;  3O8Z A;  4RO0 A;  1NTZ G;  2B9B A;  2KIK A;  2OAR A;  1NTZ D;  1ZOY C;  3B5N D;  3FX0 A;  4N6J A;  4C7N B;  1R5L A;  1NTM E;  1EZV G;  3H1J E;  4KT0 J;  1S5L X;  2E43 A;  1L0N G;  3CC2 P;  1KFM A;  1M8O B;  1Q82 Q;  1X22 A;  2N1T C;  1L4A C;  3MHV A;  2M3B A;  3AEE C;  3HD7 C;  1ZW0 A;  3O6Q B;  1T3J A;  3SFD C;  4ASV A;  4I6M C;  1KMI Z;  1HTL C;  1LTJ C;  1VQ5 P;  1M7L A;  3U59 A;  1L0L D;  1SFC A;  4I2L C;  2JP3 A;  4DT0 A;  2KZJ A;  3H6P A;  3AEB C;  3RK2 D;  1Q86 Q;  1ZME C;  2HOD B;  2OYO A;  3II6 A;  5AVZ B;  1ZR4 A;  1N7S D;  5CJ0 A;  1JY2 P;  2CPB A;  3P7K A;  3TNU B;  2M0B A;  3USS A;  1MZ9 A;  2MKV A;  3LID A;  4TLF A;  3BCC E;  3T97 B;  3RK2 C;  5L8R J;  1SQV K;  4WY4 A;  1NTZ K;  2KB7 P;  1TU3 F;  2LKM A;  4RES B;  2I1K A;  4JYC A;  2KSJ A;  2GA1 A;  1NKZ B;  3LIE A;  4I1L A;  2YKQ A;  1S5L H;  1QL1 A;  2D2C B;  2K88 A;  3H32 A;  5AVY B;  1RF1 C;  1YYC A;  3AEC C;  1X79 B;  3P8C E;  1BCC G;  1GL2 A;  1L0L K;  2H8P D;  2O01 J;  1QVG O;  4YXW H;  3HUS A;  3H1I E;  2A45 G;  1OW8 A;  1VDF A;  2KS1 A;  3HUS C;  3SSU A;  1SQQ K;  5AVQ B;  1VQP P;  5CCH D;  2YMK A;  4HKZ H;  1KYO D;  2G8Y A;  1ZRT D;  4IFM A;  3RL0 D;  3JSV C;  3N4X A;  3OA7 A;  1N7S B;  1LTI C;  2AXC A;  3H1K D;  3ZDM A;  2WWW A;  1J2J B;  2BEQ D;  2BCC E;  2AEJ A;  1L0L E;  3AE5 C;  3L74 J;  5GTH E;  4Y99 C;  3BCC J;  1GK6 A;  2P10 A;  2E5Y A;  1ZV8 A;  1LWU A;  1SQP D;  2QJP C;  3TDK A;  2Y0D A;  3L75 G;  2C0W A;  1NJI Q;  1LNQ A;  1IFM A;  1PZQ A;  2K3R A;  4K3A A;  1RE4 C;  1XTC C;  1K05 A;  3L70 D;  1GDT A;  5B5E H;  4D6T G;  1URQ C;  5APY A;  1HJB A;  4UB6 H;  1CZQ A;  1M1K Q;  2AXT E;  2YNY A;  5APQ A;  1YI2 P;  3H1H E;  1S1C X;  1AJY A;  2K9J A;  1PGO A;  1NTK D;  2A45 H;  5CHX A;  3RL0 g;  1FDM A;  1JM0 A;  3AE3 C;  1N7S A;  1M1J B;  3H1H G;  1J1D B;  3CX5 H;  3H1K J;  1KYO H;  2ITA A;  1L0N K;  2ZT9 D;  4W80 A;  1JOC A;  5APW A;  1GK4 A;  2W27 A;  3CWB J;  4H44 D;  1KIL C;  4KHX A;  4U3F J;  5K5G B;  5TIS H;  1NU1 J;  3CPW O;  2CK3 H;  1GL2 B;  2E74 C;  3RBZ A;  5KLV K;  3BRV B;  3VP8 A;  1SQP K;  1OX3 A;  1WMK A;  5AW6 B;  1SP4 A;  3KXD A;  2E42 A;  1FJK A;  3SWK A;  1KB9 I;  3PP5 A;  3EQ2 A;  1NO4 A;  1SQP E;  4AQR D;  4BWN A;  2Q3I A;  1EDL A;  2KNC B;  5AVV B;  1FZF A;  1BCC J;  3T97 A;  1JY3 O;  3S9O A;  3MUD A;  1M1J C;  4RJT A;  5CCH A;  3HRN A;  3Q2Y A;  3TNU A;  1T2K D;  1SQX G;  2V4H A;  1FBM A;  3BRT B;  5EFW B;  1AA0 A;  1LT9 A;  3L70 E;  3V5B A;  1CI6 B;  1IFI A;  2W90 A;  3CXH E;  4U3F G;  3B4S A;  3I5C A;  3V2Q A;  2HPC A;  1GW3 A;  1BSH A;  1SLQ A;  1Y47 A;  3VN0 A;  1PGP A;  3KYQ A;  1T8Z A;  2DW3 A;  3H1H D;  2P7J A;  1L4A D;  3P32 A;  5KLV D;  3CCV P;  3CC4 P;  1RH5 B;  1BDD A;  3BAT A;  2OTL P;  1YHQ P;  3V4Q A;  1A02 J;  3PTZ A;  4AYC A;  2KLU A;  5E79 E;  4WVZ A;  3CCS P;  5KJ7 A;  2WSC J;  3JC2 2;  1RF0 A;  5B66 H;  1VQ9 P;  4BXL A;  2LR2 A;  4GOF A;  1UII A;  3WU2 E;  3D71 A;  3V2P A;  2KK7 A;  1SQB K;  4YTP C;  3V2N A;  3KZI E;  1N73 B;  3A0H H;  3AE9 C;  3IAO A;  3M06 A;  1SQX K;  4GOE A;  1S3J A;  1H0T B;  5GTI H;  1S2E A;  1N7L A;  2E75 B;  1RHZ B;  1JMB A;  2OGU A;  2N9Y B;  3B71 A;  1NAY A;  2KP8 A;  3IF4 A;  2IZ0 A;  3FWL A;  5APX A;  1RQV A;  1VQK P;  5CCG A;  1R8E A;  3PHL A;  1M56 D;  5KAI E;  1YJN P;  1L2P A;  1BDC A;  3MGN A;  2KYV A;  3CCQ P;  2PRR A;  3AEA C;  4ZKU A;  1NH4 A;  1SQX E;  3G71 P;  5KAI H;  1ZN5 A;  3KZI H;  5CBN A;  2P2U A;  2HLO A;  2QJK B;  1JCD A;  3MD0 A;  1DD3 A;  1SQB D;  5AW0 B;  5KJ7 C;  1H88 A;  1FDO A;  2IX7 C;  5AW4 B;  1PFI A;  3D70 A;  2B88 A;  1P84 D;  2ZXE B;  3K5B A;  1EC5 A;  2QRX A;  2RH0 A;  4L73 A;  3IFM A;  1D7M A;  2GUS A;  4UB8 E;  1FJP A;  2N1T B;  1LWU B;  1LT1 A;  1SQV D;  3L72 G;  1URQ A;  4DCK A;  4Z1M H;  3S1K A;  3CWB D;  2POH A;  3CCJ P;  2PFX A;  2C9N Y;  5BU8 B;  2OTJ P;  2OYH A;  1RF1 B;  2BCC D;  4EYY Q;  3ITK A;  1N2D C;  5CMZ A;  2MJZ A;  3WUU A;  2Z5H A;  1LJ2 A;  3CMA P;  3B8E B;  2P58 A;  1EXJ A;  3GG2 A;  1SQV J;  2IFN A;  4PD4 I;  5KKZ C;  1CSB A;  2W6B A;  2FXM A;  2Q5U A;  2WSC H;  3L71 D;  2NPS D;  2AEM A;  3CXH I;  3CD6 P;  1LTG C;  4JQ0 D;  1BSN A;  2N9B A;  1FZG A;  1HVV A;  4JYB A;  3H1K G;  3V6I A;  1G1J A;  2Y0C A;  3TGU G;  5CCH C;  1VQ6 P;  1U7M A;  2FBW C;  1IZN B;  3H32 B;  4OH8 B;  3L73 E;  3CX5 I;  4L74 A;  2J5U A;  3MIW A;  3B5N C;  3HD7 D;  1NTM K;  4N78 D;  3RBX A;  1PPJ E;  2R3C A;  1N8R Q;  1WRG A;  2ZVN B;  3OJA B;  5B66 E;  5KLV E;  5CCG D;  3VMX A;  1GL2 D;  2RN0 A;  1LTS C;  2IYP A;  3IR9 A;  2M5A B;  3JCU E;  1PL5 A;  1YIT P;  2OYH C;  1HJ0 A;  1MFZ A;  4IL6 H;  3V4W A;  4EDF A;  1BGY G;  3LW5 H;  1M90 Q;  3PRJ A;  1H8A A;  3CCE P;  3H1L G;  1Q7Y Q;  1K04 A;  2FYU K;  1T2K C;  5APS A;  3A2A A;  1VF5 C;  1YIJ P;  1SFC C;  3L74 D;  3L75 E;  2KUB A;  3WUV A;  1YJW P;  1FZA A;  4IFF A;  4N3Y B;  1N7S C;  4YPC A;  1QGK B;  1LGH B;  1PP9 D;  2FKW B;  1BCC D;  1VL2 A;  1LWU C;  2IZ1 A;  3O6Q A;  1JTH B;  2QJY B;  5APT A;  3I56 P;  3HE5 B;  3CX5 E;  4PD4 E;  1FDI A;  2PP6 A;  1LTB C;  2Q7C A;  5KTB A;  1NGM B;  4ZKP A;  1E79 H;  2R32 A;  1URQ D;  3NMD A;  1W2E A;  3H1H J;  3TGU D;  1ZR2 A;  1JNM A;  3CCL P;  2M3E A;  3CXH D;  4PV1 B;  2LXC B;  1JY3 N;  2BCC J;  1HH0 A;  3AEG C;  1GU5 A;  1NWQ A;  1PPJ D;  1AQT A;  3AED C;  4H13 D;  4K35 A;  1RY3 A;  1SVF A;  3GLM A;  1IK7 A;  1S5L E;  3HTK B;  3L73 D;  5KAF H;  1PP9 J;  3EWK A;  2FYU D;  5CJ4 A;  4IOI H;  1IO4 A;  1YJ9 P;  1AVY A;  3FXE A;  2NPS A;  3AE6 C;  3CCR P;  2M8R A;  3TSI A;  2OYI B;  2A45 I;  4BRY B;  1SQX D;  1SQB E;  4W7Y A;  1OW7 A;  2W83 C;  3AE1 C;  3FXD A;  3VMY A;  4DOJ A;  1QLE D;  3AE7 C;  1KFN A;  1LP1 A;  3BAS A;  1W5C E;  2Q9I A;  3L35 A;  2FFD A;  3EFG A;  2YXR B;  1M57 D;  4PJ0 E;  3L70 J;  1RF1 A;  1BCC E;  2RMZ A;  1N73 C;  1NTZ E;  1MUU A;  1SQV E;  2GUV A;  3CX5 D;  3TYY A;  1Q2N A;  2W8Z A;  3D6Y A;  3H25 A;  2WSS H;  2QJY C;  1CW5 A;  1PP9 E;  1Y8A A;  2WPQ A;  1LTJ B;  1G2C B;  2FXP A;  3NXS A;  2L5G B;  2NZ2 A;  4PJ0 H;  4D6T J;  1HGZ A;  2WSF J;  2H43 A;  3CI9 A;  3RK3 D;  1KTM A;  4ZMD A;  4I7Z C;  3VTP C;  1IJD B;  3KQG A;  2IPP A;  2JDI H;  1Z56 A;  1JO5 A;  1G2C A;  1OZH A;  2E5T A;  1FOS E;  1NTK G;  4DZO A;  3CWB G;  3GF3 A;  4H44 C;  4NPD A;  3A0H E;  1PIX A;  1DIP A;  1K73 Q;  3M91 A;  4XE5 B;  4WB4 A;  4D6T D;  4OGQ B;  1KQS O;  3BVH A;  1KYO I;  3FWN A;  3KHU A;  1AFO A;  3OW2 O;  3AE8 C;  3AEF C;  3B5N B;  2WZ7 A;  1P84 E;  1H0T A;  2C0X A;  4OWF A;  3GW6 A;  4XFJ A;  1SQP G;  2JWA A;  1Q81 Q;  1FZE A;  4JF7 A;  1NOH A;  1OVU A;  4W7Z A;  4BRY A;  1J1E B;  4LGD E;  2I8D A;  1LTA C;  3H1I D;  2IBZ I;  1NTM G;  2FYU J;  3E7K A;  3H1J G;  5AVR B;  2QE7 H;  2R44 A;  1SQV G;  2H88 C;  2ZT9 B;  2WQY C;  3L72 D;  3L75 J;  3P8C D;  4U7J A;  1GMJ A;  1E5W A;  4EOT A;  1S9K E;  3H1K E;  3HTK A;  5KAF E;  2KOG A;  2W6A A;  4GKG A;  1MV8 A;  1FOS F;  3TGU J;  1JB0 J;  2NRG A;  3NFQ A;  1L0L J;  1BE3 E;  5E79 H;  5KLI C;  2WIT A;  5AW1 B;  2ZXX A;  2A06 E;  4OGQ D;  5BU5 A;  5KLI B;  3QH9 A;  3E1R A;  1SQQ J;  2O01 H;  2O01 N;  3C8V A;  1HUC A;  1JTH A;  2WPV B;  2WSE H;  2YKO A;  3ABV C;  2KXP B;  3OAK A;  1OVR A;  4D6T E;  2XZR A;  3MP7 B;  4EIJ A;  3Q1M A;  1ZLL A;  4OGQ C;  2FXO A;  1DX7 A;  2QG4 A;  1SQQ D;  1NTK E;  3L72 J;  4R4M A;  2ZVO B;  4B86 A;  1RE3 A;  1EDK A;  1LT9 B;  1FAV A;  1FZC C;  1KQG B;  3PJS K;  2QJP B;  3IN6 A;  1JMM A;  3M0A A;  4GIF A;  4H0L D;  1VQL P;  3C1L A;  3VOP A;  3H1L D;  2KNC A;  2PAJ A;  3JCU H;  2ZYA A;  3S4R A;  1K8A Q;  1KZU B;  4Y99 B;  3RGU A;  2HG5 D;  1JEK A;  1S4X A;  2D2C D;  3L73 G;  1NU1 K;  2AXT H;  1OVV A;  1N86 A;  1GD2 E;  1OXZ A;  4LLH A;  1EZV D;  3L71 J;  1SQP J;  2E74 B;  2R5D A;  2Y0E A;  3MZW B;  5APV A;  1Y9B A;  1KYO E;  2AEF A;  5AVU B;  1KIL B;  2QM8 A;  3C9I A;  1R5S A;  1NTM J;  2FYU G;  3H1J J;  5KLV G;  2JR8 A;  2O1K A;  4GOD A;  1VQO P;  3D6Z A;  5AVX B;  1IFJ A;  3AE2 C;  2YIU C;  3HD7 A;  2KI7 B;  3RK2 B;  2KZI A;  2YKP A;  2YO3 A;  3RK3 E;  2OYI C;  1L0N D;  2P67 A;  5CCG C;  2OYH B;  1KQL A;  3RK3 B;  1URQ B;  3GF7 A;  4HB1 A;  1HGV A;  4U3F E;  3E1I A;  1VQN P;  1GU4 A;  2K1A A;  2Z5I A;  3M9H A;  1KQF B;  5TIS E;  1RE4 A;  2QVA A;  4AUW A;  4C7R A;  2H7H A;  3GMA A;  2IBZ G;  1G1I A;  2R3S A;  5DJT B;  2HR3 A;  1IFP A;  4QMA A;  2IBZ E;  1L0N J;  1LTT C;  3BCC G;  2V7Q H;  4EI2 A;  5KLV J;  2WTY A;  1XTG B;  2FYN B;  1RF0 C;  1YQ3 C;  2HYN A;  1S9K D;  4I7Z B;  1DD4 A;  1X9V A;  4PV1 C;  3HUS B;  1GZL A;  4PD4 H;  3HE4 A;  4A7P A;  3GHG B;  1UIX A;  2ZYD A;  3L75 D;  2ZYG A;  3MTU E;  4IFD K;  1RQU A;  1FS0 E;  1FC2 C;  4OVN F;  4H13 B;  4UB6 E;  2HFE D;  3KDP B;  2H89 C;  4PV1 D;  1EQ7 A;  2E76 B;  2FYN C;  2IDB A;  1BE3 G;  1USD A;  3GHG A;  3GHG C;  1BE3 D;  3HE4 B;  4PD4 D;  1L0N E;  5AW3 B;  3WUT A;  2A06 D;  5H2F E;  2QSI A;  1BGY J;  1VF5 B;  2D2C C;  1N73 A;  1PV3 A;  3MUD C;  3H1I G;  4HH2 A;  1J1D C;  3L70 G;  3RL0 C;  1IC2 A;  1JY3 P;  1DEE G;  2KLV A;  3WU2 H;  3I55 P;  2FFD C;  2C9L Y;  3CXH H;  3R4Y A;  1JCC A;  1OMI A;  2BEZ F;  2WMM A;  1BE3 J;  1KOR A;  1SFC D;  3PLN A;  4R4L A;  4ASW A;  2Q3E A;  3W68 A;  1EXI A;  4JPZ B;  1KB9 D;  1SQQ E;  2BCC G;  2WPR A;  1KC8 Q;  3TF5 A;  5AVT B;  1NU1 E;  4DJG A;  5AW5 B;  1PGQ A;  4HJG H;  2JEE A;  2OQQ A;  1BGY D;  1LTJ A;  4L76 A;  2IFM A;  2YIU B;  1PP9 G;  4IL6 E;  4TT3 H;  3A0B E;  3M9B A;  4LC1 A;  3RK3 C;  2E75 C;  4WY4 D;  1SQX J;  2HPC B;  1CI6 A;  3CWB E;  2WSF H;  2Z4E A;  1QX8 A;  3HD7 B;  2OTK E;  1AV1 A;  1IFD A;  3A7O A;  5DJU B;  1FE6 A;  2XND H;  1QL2 A;  1IK9 A;  2XV5 A;  3L37 A;  4H0L C;  1KIL A;  2ZT9 C;  1HF9 A;  2OYI A;  2NPS B;  5AW7 B;  1AQ5 A;  3L71 E;  3PH0 A;  2WVR A;  3A5T A;  3Q5P A;  1NYH A;  3F89 A;  3SFE C;  2QJK C;  2E76 D;  4RKU J;  2JKV A;  2ZAE B;  1NKN A;  2FYZ A;  2B87 A;  3M0D A;  4U3F D;  1NU1 D;  1QVF O;  3Q3D A;  4N78 E;  4CPG A;  1KB9 E;  1BGY E;  1LT9 C;  1EZV I;  1JY2 N;  1NHL A;  1ZXG A;  2Y9Y A;  3H1L E;  2N1T D;  1DEB A;  1X8Y A;  3N7N A;  5C39 A;  4JBZ A;  2GM4 A;  1L0L G;  1M1J A;  3HE5 A;  1HWT C;  5APU A;  2FY8 A;  2JJL A;  2ZFC A;  3CC7 P;  1S72 P;  2K9J B;  1SQQ G;  2LXB A;  2RKL A;  1FZC B;  1EDI A;  2IBZ D;  1YTZ T;  3G9R A;  3G6E P;  1PGJ A;  3R2P A;  1EZV E;  1MFT A;  1OIP A;  1W2B O;  3A0B H;  1NTK J;  1MKM A;  3L72 E;  5KKZ B;  3TK1 A;  3L36 A;  1RE3 C;  1NTM D;  1USE A;  2JWD A;  2YMY A;  3EFF K;  2WPS A;  3H1J D;  3VMA A;  1L4A B;  3CCU P;  1NAF A;  2K9Y A;  1KB9 H;  2Q6Q A;  1OW6 A;  5H2F H;  4O9B A;  2M5A A;  1GW4 A;  1WT6 A;  1KD1 Q;  2J59 M;  1AVO A;  2XU6 A;  4NPE A;  1A02 F;  3M9Q A;  2QM7 A;  4HYT B;  4MN4 C;  2CPS A;  2V7Q J;  3M0D C;  1KN7 A;  3AE4 C;  1ZP0 C;  1VPC A;  3LW5 J;  3P8M C;  2E75 D;  2KS1 B;  4WY4 C;  2B89 A;  1FZB A;  3BCC D;  2G3A A;  2W6J H;  3CLQ A;  3G3Z A;  1U57 A;  5TJH A;  1KIL D;  2QIW A;  3SWF A;  2YXQ B;  3Q5R A;  3CCM P;  1J1E C;  1FU1 A;  4C46 A;  2E74 D;  2UWJ E;  1YQ4 C;  4KJM A;  1HBW A;  1JUN A;  3W67 A;  1SQB G;  3B5N A;  2VRS A;  2O3J A;  2XNX A;  2ZJS E;  1EDJ A;  2A06 G;  2K37 A;  1OFC X;  4WY4 B;  5AW2 B;  1H89 A;  1VQ4 P;  2JO1 A;  5AVS B;  5AVW B;  5GTI E;  4L75 A;  1VQM P;  3U1C A;  3CME P;  4UB8 H;  1X0T A;  1NVO A;  1OWA A;  2IYO A;  2Q1K A;  1L4A A;  2XKM A;  2N1T A;  3VMZ A;  4H0L B;  3G4S P;  2QEX P;  4WBA A;  1YTZ I;  2PGD A;  3V2R A;  1T6A A;  2BAS A;  2HOD A;  3L74 E;  3U1A A;  5CBO A;  2L91 A;  1SS1 A;  3SWY A;  1GL2 C;  3QWO C;  1KV4 A;  5AW9 B;  3H1I J;  1P84 H;  1ZRT E;  5KJ7 D;  1NTK K;  4GT1 A;  1SFC B;  1VQ8 P;  4WWI A;  3L73 J;  2Y9Z A;  3CL3 D;  3L4F A;  1NU1 G;  1FZC A;  2J58 A;  1KIL E;  1QEX A;  1SQB J;  2R5B A;  4IL6 X;  1DH3 A;  3VYI A;  2QA4 P;  1VF5 D;  3Q5S A;  4XA4 A;  1GTW A;  3UIA A;  3H1L J;  1NTZ J;  3KPE A;  2O1J A;  4C7N A;  5GTH H;  3TGU E; 
#chains in the Genus database with same CATH homology
 4ZNC A;  1H0T B;  1Q2N A;  1LP1 B;  2B87 B;  4BXL A;  2LR2 A;  4GOF A;  1U7J A;  4NPF X;  1DEE G;  2WMM A;  4ASW A;  4GOE A;  1S3J A;  2SPZ A;  1JMB A;  2KIK A;  4NPD A;  4HJG H;  3MHV A;  1H0T A;  1BDC A;  1ZW0 A;  4ASV A;  1OVU A;  2OTK E;  2I8D A;  2KZJ A;  5CBN A;  5DJU B;  2R44 A;  2M0B A;  2B88 A;  3PH0 A;  1EC5 A;  2QRX A;  2ZAE B;  2B87 A;  1LT1 A;  3S1K A;  4CPG A;  1OVR A;  1ZXG A;  4EYY Q;  5C39 A;  4JBZ A;  2P58 A;  2LXB A;  2RKL A;  1EDI A;  1EDK A;  4HKZ H;  3ZDM A;  1MFT A;  1U7M A;  2JWD A;  3RGU A;  2M5A A;  1OVV A;  2K3R A;  2M5A B;  4K3A A;  4NPE A;  4MN4 C;  3MZW B;  2KS1 B;  2B89 A;  2KUB A;  1JM0 A;  4GOD A;  4KJM A;  2KI7 B;  2UWJ E;  2KZI A;  5K5G B;  4HB1 A;  1EDJ A;  2QVA A;  2LXC B;  1X0T A;  1NVO A;  4ZMD A;  2Q1K A;  4K35 A;  1EDL A;  5DJT B;  2HR3 A;  5CBO A;  1SS1 A;  3QWO C;  4IOI H;  3FXE A;  4WWI A;  5EFW B;  3FXD A;  1LP1 A;  1Y47 A;  1FC2 C;  1BDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...