5AW8B

Kinetics by x-ray crystallography: e2.mgf42-.2rb+ crystal
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw8B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw8B02
5APUA 5APVA 3L36A 3HE4B 3HE5B 2YO2A 4M3LA 5AW9B 3VMZA 2WWWA 4JYBA 3A2AA 3SWFA 1GZLA 2Z5HA 3V5BA 1NWQA 1KQLA 2Z5IA 3A3YB 3M0DA 3TNUB 1IO4A 2E43A 3TNUA 3M06A 5AW2B 5APXA 2BASA 2Q7CA 3HTKA 1HBWA 3NXSA 1NAFA 1J2JB 2JJLA 3TK1A 3VMYA 3VTPC 4AYCA 1CZQA 4RETB 2IPPA 5AVYB 1MUUA 1JUNA 4JYCA 5APYA 3NMDA 2P67A 5AVTB 3UIAA 1HWTC 2R32A 4GKGA 5APTA 5AVZB 2W6AA 5APWA 2QM7A 4LC1A 1GU5A 1GK4A 1G2CB 2R3CA 2XU6A 1H88A 2E42A 5AW5B 4I2LC 4XE5B 4EOTA 3A7OA 3VMXA 2VRSA 2Q5UA 5AVXB 2WPRA 2XZRA 3VN0A 1MFZA 5AW4B 5AVVB 3KQGA 5AVUB 5AVSB 1GTWA 4AUWA 2YNYA 3M0AA 4GT1A 3WGUB 1H8AA 2H7HA 1GD2E 3NTNA 3LIEA 3KDPB 2YO3A 1MV8A 3I5CA 3MGNA 3P7KA 2R5DA 2P7JA 2WPQA 2ZXEB 2C9LY 3L37A 1GU4A 1CSBA 3NFQA 4HYTB 1H89A 4AQRD 3V4WA 5AW1B 1T2KC 3V4QA 3TYYA 1SP4A 3LIDA 4B86A 5AVRB 3IR9A 3O8ZA 5CMZA 3A5TA 1CI6B 5AVWB 1S9KE 3T97A 3MD0A 1A02J 5AVQB 2WPSA 2P2UA 5APQA 1DH3A 2KP8A 1FOSF 3WGVB 5AW3B 5AW6B 4KHXA 2N9BA 4C46A 3B8EB 3HE5A 1FOSE 1YYCA 3M9HA 4DZOA 1JNMA 3P8MC 2C9NY 4I6MC 2QM8A 5AW0B 3VYIA 1X8YA 2ZFCA 1T2KD 2Q3IA 5AW8B 1OWAA 2XV5A 2R5BA 2WT7B 1SLQA 1A02F 5APSA 2WT7A 2W27A 4RESB 3M91A 1HJBA 3M9BA 3OAKA 1OXZA 2WTYA 3P32A 1FAVA 1HUCA 4C7NA 3L35A 5AW7B 1S9KD 4C7NB 3HE4A 1CI6A 1GK6A
chains in the Genus database with same CATH superfamily
2E74D 3O6KL 3L36A 3TNNA 5FECB 1BPLB 2VLJE 1TTRA 3L9BA 2IBZE 3GLDA 2UWJE 1L0PA 2CCLA 4MXWL 1XCTB 5GXBB 1WPCA 4JFQA 2P24A 1U8JB 4IU2A 4ZNCD 1ZGLP 1QWUA 4DFHA 2H8PB 5DUBA 2ZSVB 1T04A 1HBWA 1QA9A 4WGVB 3WNIA 4HKBB 3QB7C 1Z7JA 2B0SH 1T7ZA 1EHAA 4KTEH 4PJ5A 1OL0A 2M5AA 3CC2P 2OJZH 1YNLH 4G7YH 3WXWH 1FCGA 1ZY9A 2LR2A 2AJ3B 4JDEB 1NC2D 2YUXA 5KW9L 1FDMA 4MN4C 3BFQG 2UUDK 4LLUB 1GGCH 3IPEA 5GS1C 3RPIB 1VFOA 2LR4A 3OAYH 4MJ5B 4DKFH 2V2XA 5IBTH 1JGIA 4L3EA 1PCSA 3HLKA 1C12A 1IC5H 3SPHA 1M2OA 1YAZA 1T1YA 4JHWH 4QR7A 5IBLC 1ZLUH 4AVJA 3N50A 3VD7A 5L4MA 2OARA 3NQKA 4CADB 4UTAL 1D9KD 1DFBL 4I89A 3BQUA 2IXQA 3SDDC 2LAAA 1X6NA 2OMVB 2ZCKH 5EUOE 4F2MB 4HHAA 5A6IA 3SDXE 3QQ9D 1KYOI 4R0LB 1T1ZA 3BH8A 3P69A 4GSDH 1E2WA 2E8ZA 3QDMB 2WNGA 5I73B 2QG4A 3A4AA 4JY6A 5FM8A 2K6YA 3VB9A 1SQBD 1NFDA 4N20A 1P5VA 2VRAA 1NMCB 3VFWA 4HCRL 2WVRA 2GBVA 2D03L 1J1PH 1SFCB 1XF4B 4QDGA 4WWNA 1F0LA 3TA3C 4EZLA 4J4PA 3QEUB 5HHOD 1QHOA 3M1CA 1MPAL 3SDDA 4JKLA 1TMQA 3T65A 5CSZB 3BRDA 2XTLA 4HIIB 2HUHA 1S7XA 1CLZH 4TNGA 4Y5VA 3JTTA 1MFCL 2FB4L 4XMKH 1WS7A 4ZQKA 4ZMZA 3O3AA 4LGSB 4Y1AD 3RK3D 1R3HA 3MDJA 5E4IA 5SWQA 5JOFA 1FN4B 5KVDL 1YEKL 4OZHB 1JNMA 3OHXB 5GGVH 3VD0A 3EFDL 3K8LA 3CI9A 2F61A 2J4WH 5C3LD 3MRPA 2PW1A 5BMFL 1P7KA 1QSFE 4TUOB 2N1TE 4A7GA 2VZVA 1EJOL 4MZIA 4LOFA 3ZE0B 3F7PC 4UOJA 4GO9A 4K3AA 3D4GA 3QIUD 1W2BO 4D9RD 4UQIM 2LFEA 4NKQB 3HNTL 4Z7OB 3APFA 3FJTA 3H54A 3KH4A 1HXYB 4LQ1A 3NCCB 3LIZA 4G3YH 3BWUC 3CDGB 5IVXF 3ARED 5D6DC 4WCYL 4N2BA 1N12A 3FQXB 1UASA 5FA3B 1ND0B 4ZODA 3H1HE 1W5CE 1A1MA 1R5IA 3UTQA 4KQ4H 3N9GH 1U8PA 1NGZA 2VZUA 5EU5A 4K94L 1IARB 1KIPA 4HEPG 3PGCB 4I18C 2Q0ZX 5ELIA 4BINA 5JHLH 5GGQH 1RF0C 4FFVD 5KTBA 2XZQH 3MCLH 1GIGL 5ABAA 4OVVA 4JFFB 4OV6F 1ED3B 1NTKD 3KW8A 1Z3GL 2ZOLB 4NZFA 4Q4EA 3PWNA 4U05A 2DWDA 3DGCR 2WK2A 5IROD 5E7BA 2EEAA 3MRCB 4UNTA 3X11B 3UTSA 4LDCA 4TTDC 3L1EA 3AMKA 3H1IE 1RULH 5F1IB 3WFHB 1ZLVK 1P6WA 2FBOJ 3I50L 1SUJA 5GIRA 3DX1A 1SEBB 1BPVA 1YMME 4U3FD 1KB3A 4LP5A 4W9DC 2O5YL 3HG2A 4YDVA 3TWCL 1FIGL 2W0KA 2XKSA 2XXGA 5FO9B 4LLVA 1BFVH 3GBLA 3GBNH 2GBTA 4DWHA 3GPEA 3KAAA 5ENWA 5IQ9B 5K9OA 1MJ7H 1U8LA 2H7HA 3BZDA 4Q9QL 4FYRA 4JHZA 1Z9PA 4AT6A 1HSBA 1RZ8A 3UTTD 4AE1A 3NSXA 1OGAD 1TQBB 1UQSA 3ZDYE 3PHAA 4KI5E 1IBBA 1NKRA 2LGNA 2ED7A 5HI3C 4EIUA 5K5YA 5FR3A 1VFBB 3R4DA 4RDQG 4XHJD 1WSST 2CO7B 2L4OA 4KV5E 4N3TA 4ZMAT 3V95A 1DQQA 2D2CD 1BGYE 2Q3AA 3H0TA 4RFNB 5C0RH 2A9MH 5CU9A 3CX5K 1QMUA 4Y9BA 5I0XA 4EDWL 4GUQA 4G6JH 4NQXA 1FORL 4FLOA 1E8XA 3HE7D 3ZUNC 4ZQTA 5HYJA 3L7FA 3F7VA 4O5LH 4TVPL 1KFAH 2ZG1A 1PZAA 3DOIA 5D1XC 4F7CB 4RAVB 2BNUB 1K8DA 43CAB 3TIDB 3QFGA 1YEFL 4AIZB 3L8QA 1EJFA 3DVNA 3KBPA 4GW5A 1ET7A 4FLHA 2NQDA 1X9LA 3CN0A 4ABUA 5HVGB 2AW2A 4KKZA 4OCMC 2YKQA 3H1KJ 3I3DA 2APSA 1P0SE 2CDGB 1BEXA 1G9HA 4NPEA 4NWUH 1F4HA 1MCEA 1NFIB 3ARBA 4HV8A 1UWYA 3MRQA 1I1AC 1HCYA 3SHSA 1GZPA 1NGQH 4HLZG 2IFFH 4BFRA 2PYEA 2Y2YA 2ZUTA 2UWEF 2P5WD 7FABH 1NCDH 2EVGA 1YN6A 4GW1A 1XGTA 3MCKA 3MLPA 5J9PA 3SSUA 1DP0A 2UZPA 3PV6A 1UACH 1DE4B 2BIIA 3KR3L 3NCJH 1S3JA 5FGCB 1FJPA 3HBGA 4L8CB 1V7NL 3UBGA 2QELA 2HH0L 1S4XA 1FBIH 3TA3B 3SDYH 2GUVA 3EOBB 3FW6A 5D7JC 3RZCB 4CILA 2DTMH 4UBDD 4HZLB 4JKPH 1HI6A 4ZYKA 1D9KB 4J8QA 4M9PA 1NQBA 2OX5B 3X14B 4AYBA 2ZWNA 3LY6A 4HXBL 1SQVG 3OJAB 3SKMB 2IZ1A 4ADGA 1KBVA 3CWBD 1ILSA 1A6AB 4JFTA 4R0LC 3OZKA 4P3DA 5CN2A 2ICWJ 5ALCL 3L3GA 5T1KA 2BEQD 2VNCA 4XZ4A 4PJ0E 5KSAC 4QWWC 3IDGA 3JUYA 4XNXL 2PWEA 3ME0A 1MJ8L 1ZHBB 2V5RA 5GGRB 2XQBL 2IG2H 1XCTA 4HUXA 3H9SB 5FK9A 2P8LA 4ZX6A 1QPPA 4X80H 3B5NC 2WLHA 4DPAX 4LSQH 2DDQL 4QHMB 1OIOA 5D9SA 1IC7H 4AGNA 4CBZA 25C8L 1IGIH 2BHZA 4Q56A 4NQUA 1KQSO 2DZEA 5CLTA 3IS0X 5GTHH 1S9XA 4R97B 3O0LA 5FW8A 5CGMA 1GGIH 1S9WB 1G9NH 4RRPM 1JM0A 3EH2A 5KSAD 1CR9H 1FH5L 3B9DA 4JX0A 4FEMA 1KGJA 5GGTA 3VXNA 1S2EA 3MIWA 4POZD 5I9QB 2YNYA 2EO9A 2R8SL 3ZTEA 4FQ1L 1CBJA 2YXQB 1FCCA 3MRRB 3RPKA 4ZTOH 5F9WB 1G7QB 4P4KA 3EG9B 2XN9E 4IBWA 3WSQH 2KLRA 4FQQB 1XGPA 5T5FA 1HOEA 4BFIB 3QDAA 3ZE1F 5C39A 4P57B 2J72A 5E56A 4JLRA 1CD1B 1J1XH 1EEYA 3GFUA 4MZ3A 2I60L 3C8VA 2OW6A 3AU0A 3CVHL 3HFML 5TD4A 3FT2A 3JWDL 4QTIH 4FQ2L 5KOVC 4HGMA 1AGEB 5F9OH 1AZZC 4CC4A 2A0LC 4YGVB 1N18A 3BH8B 3V0IA 5GS0H 4H44C 3DJRA 2FNWA 4MCMA 2D2OA 3HG0A 1HC1A 2YGNA 4KRNA 2OP4H 5F93C 3OAYK 3RY6A 2VITA 2UVFA 4IIQC 3CIAA 3RK3C 2ETWA 2AQSA 2GJZA 4IGBA 4JDZA 3E2HB 1IKFL 2F74B 3PWLB 4C58B 1P4UA 3PAVA 4PJBA 1SLQA 2BY0A 4BRYA 5C0AD 3LNHA 4XBGA 1XF5A 3GZPA 1BG9A 2ZSVA 4J3OH 1BE3D 1IK9A 3A4DA 4KMTL 2KMWA 4JO2H 4RGOL 2NY5H 4BFNA 1AKJA 3UZVB 1NCGA 2A6DB 2BOLA 2QQLL 1CO1A 4ZTPH 2BP8B 1HHGA 3O41B 1N6VA 1USZA 3VA6A 4YQXL 5I8KH 3UH8A 1W15A 3V4LA 2L7JA 4PP2B 4OKDA 5JW3H 3G5VB 1PZ3A 2CIKA 1B0GA 1NGWA 4M48L 4ONHA 3RGVA 1U6AL 4MXVF 5KVEH 4KXAA 5F44A 4PJGF 4DKEL 4N78D 5IOPB 2J4WL 3P11L 4P5RA 3TA4D 4DEWA 2XV2A 5C0BE 1LTAC 3RK2B 2X5PA 1AMXA 1GGYA 3QQ3A 4ZUVB 4DN4L 4ZD3H 2LLNA 1OGAB 1SQVD 4J12A 1MVYA 2BXZA 3MLSL 3FRPA 1CQYA 5HPMA 3LHPH 1HWGB 3ULVL 4IOSD 2RKLA 5CM1A 3JYBA 1JMXA 4F20A 1O6SA 1O6TA 5EEWA 1BFOB 1Q4NX 3GHBL 5DQJB 2YLHA 4AXWA 1KELH 4CDHA 2AK1H 1L9TA 3N2JA 1A1MB 1EK3A 1KJ3L 1J1OL 2WXKA 5FLUA 1S9VA 4K5NA 5F9JB 4UMGA 2DF3A 1P4IL 3IJ8A 5GQBA 2ZX6A 1ZWIB 5KBLA 4YFLI 2VDPH 1HDMB 1OP5K 4ZOBA 2CHNA 4MMYB 3AUVA 2Q3XA 4UI2A 1EEUA 3SE9L 1K8IB 2VLKB 2PWDA 1PSKH 2QPEB 3CLFL 5DYOA 1JGEA 3Q1MA 2YXWA 1WRGA 2IDFA 4R26H 3BAYA 3VFNA 3E80A 1QASA 1UM4H 2W0LA 1VF5D 1FYTB 4EN2A 2EKSA 5JIQA 2F7IA 3GIVB 4YSPA 4BZ1H 3TH3T 3RL0C 2YFNA 4L5FH 4WWKC 2ZKHH 1XR8B 2UZIH 2HAZA 4RSVA 2BINA 4CVWA 4QY8B 3L74J 3BIKA 1VQKP 1XV8A 1AR1D 3FU0A 2BOBA 4N0YL 3JWOL 3MBEA 2F54E 4IJ3C 4HWZA 2Y7OA 2VDOL 1HJ0A 3T3ME 1XH3B 1L9RA 5D70H 4PJEF 1WD9A 2FO4A 4UQ3A 2VH5H 1NC2A 5LGJB 3TT1H 4D3CH 3V4VA 5KBPA 3M86A 3VX0A 3RDTC 5A40E 1T21B 3B5NA 3HC3L 2NNAA 2ARJB 4MNHA 2EYSA 4AV0A 4J3OD 5JMRA 3PY9A 1SHWA 3W39B 2WSSH 4Z7VA 2N9YB 4KOCA 1YNTA 1SQQG 3FSZA 3HOGA 3IN0A 2MSPA 4MZRA 3VE0B 2Y7QB 5HYJB 3MNDA 2B1AL 1NBVL 4WHYG 2OI9B 5E0QA 5D71L 3VSTA 4H8WL 4N1HB 4F7CA 2JIXD 3VA2C 5D1XB 2RMNA 4H13D 2KERA 5EO0B 5LBSL 5B3SB 1JD9A 5E6ID 4DO4A 4KQ4L 4YSTA 1BM7A 1YEHL 2ATKA 3AC0A 1VJSA 2NYYC 1BSIA 3HE6C 4I3SH 1IIIA 1Z9NA 2RQ8A 2DDQH 4PV9B 3MJWA 4LU5H 4KJYA 3V9CA 4PS8A 3QAZB 1T4KB 3RY4A 1AO7E 2GUOA 3C1LA 3C08H 2VDLB 3DETC 1OB1A 4HIHB 1JGVH 1GXEA 1KJ2B 5DRWA 5HY9A 1TZIB 2EXTA 1U3HD 4YDVB 1KNOB 4XX1G 2IPKB 2ZYRA 1RZJH 2D4DA 2A6IA 1GYVA 4XCNB 2BJML 1TNNA 2X4NB 1TVBB 5EC2B 5AVYB 3FTGB 4GI8A 3GINA 1KCUL 3FT3A 2Q76B 4NZRL 1H3PH 1E28B 3LKQA 2QEXP 2OSYA 1XAUA 5DHVB 4AT6B 4UT9H 4NKMA 3V6FA 2HH0H 4JPKL 1XB8A 3RY6C 2I60H 3HFMH 1AD0A 2JNZA 5KOMC 5JIPA 3QZLA 1WD8A 3H1KG 5T1KB 3ZO0A 1QFWI 1QRND 4D6TE 2GJ6A 5AVXB 1ZHKB 4LHUD 1J18A 1M7IB 2AQPA 3QDGB 2ZCLL 4PRBB 1KCSH 2OQQA 1MCPH 2CUAA 1RPKA 3KLAA 4U1GC 5C0EA 4IOFD 3IEAA 4BSJA 2B3RA 5HDWA 1KC5L 3EZJB 3L7FB 1DDHA 3WYRA 3ZRCC 4YO0B 3UPAA 5I6MA 4NP4H 5E2VH 1ZLWH 1KYDA 4JRWA 2L7QA 1QFWL 5KLIC 5GGUA 4N0UB 1RJCA 3GDBA 4OJCA 2O6CA 4JK0D 5C7XH 4K3DL 4NQSA 1BQ5A 1J0ZA 1VCAA 2GTZB 5KVFE 5ITBH 2PCPB 1QSFB 3F7YA 4PGBB 2DQGL 1WK0A 5IFJB 3U1CA 1QSEA 2P9RA 1CDGA 4JN2A 3FB8B 5EU7E 3HR5A 1OGTA 4RGOH 5J3HC 5ACMA 5CBEB 5CS7A 1O6VA 3L70E 1B4RA 1L0LD 1M57D 2B14A 3QPQD 2A74C 2ADYA 1UD4A 4ZMOA 2G2RA 3CPLB 4NZJA 2WXJA 2ZWLT 3PL6A 1W91A 4Y7OC 2MCAA 2M26A 3TBSA 1WA1X 3V5DA 4YHNB 3KMDA 4KQ0A 3Q01A 2VXQH 3BZ4A 3M46A 2FFDC 2FWUA 2NY3D 3IJSB 1VKXB 2EE6A 2DYSB 4PJCE 4NBZB 1INDH 1KB9D 3CBKB 3IM1A 4M6AA 1F86A 1ZHLB 1CYXA 3TH2T 4P9HC 2ESVB 2RACA 5JQHC 4OFIA 1HI6B 3GMQA 3QIBB 5MENA 5KUMA 2ADJA 4U1HA 1MZZA 1F00I 1L4AB 1G9ML 2J6EH 1MG3C 2W65A 2F8XC 3MFFA 5INDB 4KROC 1ZS8A 3SQOL 1T1WA 1BVNT 5I1AB 4A55A 2L91A 5C07A 4GG8B 5IV2B 1VQOP 4PJDA 4PJ8C 4YMPA 1WHOA 3HUJF 3P3UA 2VR8A 4PLKC 4L76A 2YK1L 3QWOB 4KK8C 5KJ7C 1JMZA 3NZHL 3B8YA 5EU6B 2CM5A 1Q9KB 4OD3L 2KYVA 4H8WH 4KVPA 4Y19D 3NTCL 1G7LA 1I8KB 1QKZH 3MOAL 5JIHA 4B9ZA 1QFUH 4QOKA 4ZT1A 4BCYA 2AV7A 6FABH 3DX9A 3B3IB 4EDXA 5GJSH 4CVZA 4DGVH 3MNZA 3QG7L 4YDJA 2IAMD 2X4UB 1AQDA 3HTKB 2P1JA 2C7FA 3NJGA 2ZP9A 2CBMA 1AZNA 1UB5B 3GSNL 1J5OL 2J1KA 3IF1A 3MKKA 4ONFH 1NAKL 2NY5L 4IL6H 1DN2A 5DEFB 2LT9A 1DUZA 3CE1A 3O6FB 4TN9A 5HI4D 1XCQA 3UIAA 1RUKH 4XMVA 4F15C 2FJFA 1JV2A 4XWOD 3AS2A 3MRRA 2NRGA 3U2SA 4APQC 5H37H 3LS4L 3RL1B 2WQXA 4OJDH 4AEFA 4XO3A 4HJJH 3B2UD 2Y9RT 4MSWA 1WBZA 1YUHA 4U1MA 1GTNA 3MC0A 1H3PL 1AE6L 4MB4A 1NU1E 1G1KA 3EXJA 1USEA 1EJOH 5IVOA 4X6BB 3KXFB 3GF3A 2Y69B 1Q9WB 1RH8A 1XIWC 2J1ZA 4U1SA 4JFSA 1AC6A 2N1KA 2OMWB 1X5FA 3UMNA 4OCYL 3LSOA 4RMQA 3WNKA 4MA7H 4FQIH 5GSRB 2FSEA 2K4WA 1A3RH 2YN3A 4NIYE 5EO1A 1NBYB 2HT4D 1MCPL 3B7YA 4GOEA 2UY6A 4GNKB 2AK1L 1G2CA 4LHUA 4PSRA 4ALAL 3BESR 2DQEL 1T7WA 5BV7H 1W0WB 3QDME 3KDMB 2HT3C 3O8XB 5EZJA 5IVXA 4W4OA 5M1BA 1F6AB 2WLLB 1VFAB 4HJ1A 1HHIA 2XWBB 4Z7VF 5HHNA 4M1GH 2FQDA 5FGCE 5JNYA 2OK0H 4PRPE 4RGNB 5EUOB 1NVOA 2X4SB 3HI5H 4P5TC 5BV7B 1MZ9A 3DV4B 2J43A 1QGKB 3VCLB 1SQXD 4U6XA 3AADB 3F65A 4DOJA 1DEEG 4NYLB 2CIKB 1S7QA 2VO5A 3PP3H 4DSYA 4R4MA 2RAMA 1S7RB 1XWVA 3O4LA 3HS9A 3MUDA 4X6DA 4YQXH 2FUTA 1KILD 2OV0A 2R4SH 4ZTPL 5FUOL 4NQEB 1JNJA 1HX0A 4C56A 4ZPVA 1INDL 2FEEL 2HRPL 4OWFA 2AHIA 1GPOH 1NGPL 1WFJA 1VEOA 5L8LB 1AY1H 4Z23A 1JK8A 3GSUB 1LJ2A 1ZRTD 4XCCL 1HH9B 1TG8A 1EXGA 1IAKA 2YAQA 2CUMA 1T3JA 4KVNH 1CC3A 4UU9B 4NKIH 2RFXA 3VDCA 1FIEA 1BW8A 1OSYA 1QRNB 2CXKA 4G7QB 2IWFA 4LK4A 4Z7UE 3T0WA 2GA1A 4XMTA 4OZGA 4PJ0H 3UDWC 1BQRA 3AEFC 3H3BC 3EKCA 1D6EA 3CSYA 4QAMB 3SBWC 1H15B 2IEPA 3BZEA 3LHPL 3KLSA 4YIQB 5D5MA 4H1LB 3FO0H 3G5WA 1KB9I 2B5IB 5DGRA 5EZIL 1GS6X 3X1EA 3WNOA 3MRHB 4PGCA 1CFQB 5E1AB 3GSXB 3L2NA 3UAJC 1QKZL 2J1YA 1BCIA 3QHZH 5DUML 4HETA 3KGSA 4I3RL 4QD2E 1SY6L 3EO1A 2Z4EA 4Q9QH 4HQQH 5E00B 1OAZL 4YHIA 5T5NG 5KLVK 3BAEL 4JRFA 2WQAA 4LVEA 4LNRB 5CBAB 3F01A 5I23A 1HF9A 5G4NA 2MIZA 4FKHA 2BCCD 3L72D 1H3VA 2WWKT 3PWUB 3UP1A 3U0WL 4HBQA 1QAWA 4APXA 4F7MA 1N8ZA 3Q5RA 1XTLA 3RVWC 2J44A 3ZXAC 4DGIH 5DRWB 5GZNC 1GL2C 1KIRB 3NACL 1T80A 2CAKA 4LP8A 4PJ7E 1NDGB 4CN1A 4R96B 3RTQB 5TF0A 1W2KT 5ACLA 1M56D 5AW4B 5JHBA 4WW2F 3WTYA 1ODAA 4LLWA 2H0JA 1JZ8A 3C12A 4P2OD 5DFAA 3MBEB 1JHTA 1J9QA 4L74A 3MSPA 4NPYA 4W9EC 3ZO9A 1AZUA 2AMGA 3BKJH 1AE6H 4QO1B 4FXGC 1AI1H 1QWNA 4HJEA 4ZFOL 2E9IA 1CFSB 3IKKA 4M7ZB 1I7ZB 1CT8B 1L4AD 3WTSA 3G71P 1YJDH 2J20A 1QEXA 4I0KA 1FJ1A 3AB0C 1T21A 1W8OA 4UZUA 3C5ZA 4PS4L 3E7JA 4XCFL 3UACA 4JFHE 1KBGL 5C07E 1F18A 1PZ5B 3II3A 5D7JB 3MBXL 3RZCC 5AB2A 3UAFA 5DI8B 2NUTA 4OSUH 1R5SA 5LLIC 1YG9A 4FNSA 1G0DA 4HUUB 4EI5A 2DM3A 2FCBA 2VC2H 1ECZA 5I16B 5F3BB 2PKDA 4Y4HB 1HIML 2HX8A 3RWGB 3N5AA 4NWTL 4HIPA 5DD3H 3C2AL 3HB3D 3AE3C 2OYPA 3FTWA 2JKNA 4IW4C 4UTBL 3HBPA 5I1JH 4KHTL 4NC1C 4WTWA 4JKPL 1CLYH 2D7QA 3RNKA 3G5XA 3LKPB 2BIOA 5FYLE 4KAQL 2YSSB 1VDFA 1CI3M 1TU2B 4RSYA 2J57A 2BNRE 4NRXA 3CFBA 3BPCA 3DX2A 4QHLA 1II4E 2WXIA 1L7TH 2OYIC 2NZ9C 1KTDA 1FH5H 4LCCA 2R29A 3N40F 2VABB 3AEGC 3ZKSD 2G2RB 1D2OA 3OLIA 4L37A 1UXWB 5JW3L 1NDTA 5AKVA 4AQEB 4OBSA 1HK6A 3AEAC 1NDMA 2KZWA 4QT5A 3ZQXA 1B2YA 3G9RA 2KXPB 4DIXA 4NQTA 3KHUA 4KDTA 3D5OF 1AGDA 3X2QB 1E5ZA 2ZXAA 3MREB 3JV0A 2HLAB 2B2XH 2A9CA 4O9HH 2Z31C 4I5BA 3V5BA 3CVBA 3V0VB 1FVDA 1GPOL 4W68A 3B37A 3GM8A 1NFDF 1BHGA 4PTTB 2F68X 2WUBH 2WZPA 1DFXA 5LDUA 3P40A 2XCMC 2IH1A 3UYPA 4N2LA 3T2LA 2WKOF 1EDYA 2XTJD 3BSZL 5LCVH 3WXWL 4Y0GA 1SPDA 3U82B 1E4WH 2PP9A 3C8KA 3VXUD 3X1GA 3HMWH 4L1DA 4TVPE 4QXGH 2QLVB 2E3VA 1M1SA 3KZIE 1Q7YQ 1CD0A 2ICWI 1BAGA 2LU5A 5ADOH 1HQRA 3JV6B 3PQYE 1PQZB 3IWVA 3LQZB 4PW9A 1BQSA 4Z0BL 4K15A 3TBWA 3CC5A 3I02A 5IVZB 3SY0A 5MHSD 3L70D 3C5JA 3GBML 3MLTB 4JFVA 5DC4B 3C8HA 4KDTC 4RISH 3BDXA 3ZHDA 4FG6C 1LM8V 4WV1B 4HG4J 2KHAA 4BKTC 1J8HB 2YAEA 3HHMA 4LIQL 2JJSA 3ESPA 3A22A 1WTGT 5CD5D 1RK7A 4XNUH 2QVTA 5CEXA 1TZOA 2HUEA 3SQBA 1IEBB 2EEBA 4AGLA 4QRSB 3U36A 3GUFA 2WN2A 1I8LA 1Z5LA 4YHNA 1QSFD 1IGCH 2WPQA 3CXDH 3WS6A 1MFAH 1UC6A 1YDPA 4UQ2A 3T5WA 2UWEB 4UM8B 1DBAH 1RZPA 1QX8A 3WFZA 4IRSD 3TN0B 1OGAE 4HJJL 3U25A 2R59A 4HLZH 4PHXA 2WYZA 1T5WB 3QH9A 3PE9A 4FG4A 4XNYL 3QIBC 1XD0A 2VDKB 3ARDA 4N9GB 5CSZA 2BSTA 5F89B 3O45A 4ANWA 4LCYB 1URQA 1HHJA 4BSVA 4D9LL 4P3WA 5F1IA 4F37F 1V8HA 1ITCA 1JD7A 4GMTH 1E40A 1FNGA 3DV6B 4J6RL 1SEQL 4PG2C 1ZKAA 2W38A 5ISZE 3SE3C 4OLWH 4B9GA 4Y2DD 3APDA 4D8OA 4LLVB 1XXDC 2PPFA 4JFYB 3QEGH 3ZN6A 3N85L 1YEHH 3ZIMA 1JTPA 4N6JA 4HWEL 4CVZB 1KZQA 4L4TB 1MWAA 1RZFL 1NTKE 3T97B 2ICCA 3BD3A 3L6FA 2AJ3A 2BVEA 3KYAA 1VQ6P 1MW1A 4LO9A 4DGVL 3PREA 4HOWA 1SJEB 2BCMA 5IMMA 4FXGA 3U46B 3FQ4A 3B34A 5DEFA 1PGRB 4GSDL 4Y1TA 3WO4B 4ZNEE 2RJMA 3K6IA 2JB5H 3FTXA 1C12B 2WSCJ 4GUCA 4Y4KA 3JWNE 4X4ME 2JQZA 4PJHE 4UT6H 1K3ZA 4B27A 1HCVA 1M1XB 1X5GA 2ENJA 5E1QA 2QLYA 4XP4H 2M8XA 3ABVC 1KORA 2AJYL 3TIEB 3PF2A 4GRWB 2CPSA 1FLRH 4PJXE 4F2MA 1G43A 2YN5A 5HYFA 3ATDA 4KI5D 2W81C 3QA3B 5LAXA 5T3XH 3OKKB 2DWDB 5EV7A 3ARBB 2LVCA 2P44B 3CX2A 4ODUA 3MRQB 4JM2F 1JE6A 2W6AA 4S1SL 4WI9A 4H1LA 2Z4QB 4U4BA 1K9TA 3D05A 3SDCA 4D7BA 1F56A 1A7QH 2HVJA 3AE1C 1QNIA 1QR1B 3KPRE 2BS8A 3KXFD 2WO2B 1Z2KA 3CDZA 4KNTA 4BUHA 4CGTA 2YEVB 1S7UB 1DJXA 4FF9A 4PRPD 3FX0A 3ZKNC 5DA0B 4P07A 5D72H 5C0CE 3SCMC 3P3YA 2F7QA 4MDIA 3WAKA 4U49A 1CLYL 3DSFH 3O3EA 5JOFB 5SWQB 4MAZA 1D7FA 5JNYB 4MVBC 3X14A 3RL0D 2X4SA 1TFPA 4U3XA 3WENA 4JPVH 3MUUA 3OGCB 3LX9A 5HHXH 4H8WC 2WMPB 2JDIH 2JKJA 4W70A 1WV7T 4IDJH 3D06A 2IPUK 4X6DF 2DQUH 2POHA 2VXQA 3AQZA 3IFLH 3MV9D 4GAYA 4L5FE 2WO3B 3VWJC 3BGFB 2XXCB 4FHBD 1QBAA 1WGOA 2WSDA 4U2YA 5FCUL 3PHQA 4N2GA 1URIA 1SXCA 5ADPH 1GDTA 2DD8L 2K3RA 2AI0H 5AVQB 1I7ZA 1JNLH 1RIUH 5IFHH 4KNUA 5DC0A 3ZL1A 1PSKL 3BT0A 2B20A 1JGUH 5DJCA 3O9WD 2VN5A 5LHDA 2Y4SA 1M1KQ 3L4TA 5A2BA 3FUMA 2O1KA 1VERA 2FH8A 1SZNA 2EEDA 3QUZC 1CUOA 3VVVA 2WAQA 3A6CH 1QATA 4WU7A 4XPTH 2R1XB 1S5LE 5CIPH 5DS8B 3QXWA 3M9BA 3DKHA 4RQQB 4Y4HA 1FV1A 2ZKMX 1Q1PA 3WMM0 1FFPA 3ZYOA 3VGAB 4FJZA 1CICC 3P30L 2VERA 2LTQB 3EG9A 4XCYA 2VLLB 1YC8A 4DUVA 2F8IA 1DQML 4F8QA 4C4KT 4UV7H 1WZAA 5F7EH 1E3XA 1L9MA 2IBZY 3VD4A 1KQLA 2B1HL 4XVUC 1PIFA 5DRXB 2VH5L 1LDSA 3WNPA 4PUBH 3US1A 4PJCA 4ZMDA 4WFHD 3OKEA 1JZ4A 2VLRA 2VDLL 3QQXA 5FO8B 1O5PA 4CVXA 1KIRA 2LLGA 3G6JB 1ETJA 5GHWL 4YSEA 1S78C 1KN2H 3QNXA 5ILTL 2E5EA 1NH4A 2VSDA 4E9YA 3QXVA 1X5JA 1GSMA 2I7SA 4N0FA 4ABQA 3VRJB 4S1RH 3LQAH 2BJMH 4I18A 5IK3B 3MCLL 4PG9B 1PW3A 1A7PL 1U36A 2Z35B 1GTFA 5L7XL 4QHMA 3QEHA 4LEBA 4Y88A 3BPOC 1OF2B 1PGPA 3JV4B 4LOUD 3CNKA 4NWUL 1X5ZA 1MHHB 2V9RA 2JKXA 3OJMB 1HZLA 2CNZA 3RGVD 4NQXB 3L4VA 1GY1A 5CGYD 5HJ3A 2Q20A 5EOTB 1JOIA 3VXNB 3S5LA 4HUUA 4EI5B 4M43H 1B2WH 2GUSA 5I15L 3ZKXB 3KWWB 1OSPL 1NCAL 4OGXH 2NZIA 3VXOB 2BNRD 3AM8A 3SDYL 5AD0A 4HUVA 1IEAA 1S7WA 4D6TJ 1TENA 3MX0B 5CZXC 4RCAA 4FQQA 4UTAA 1WGVA 1RJLA 5KN5A 1KULA 3SYQA 5DZ9A 4DGWC 1PG7X 2DJMA 3LRGA 1JPTL 1B0WA 2WIMA 1OP4A 2YD4A 3S4SA 5C7XL 2IDCA 4JREC 5ITBL 3FSOA 1U33A 4CKQA 3CFBB 1TJMA 1I4FB 5A2AA 3D3VB 1YEGL 4FLRA 4OVUA 3WDJA 4L37B 4XP5H 1TJIL 1DEEA 2MTAA 2WPSA 1H8OA 4HUWA 4XNUL 2JCCA 5TH2A 3FL7A 1U8IB 3Q2YA 3QC6X 2E6QA 3TA3A 1HJCA 3K7UA 4DETA 3LW5H 1V3JA 3LD8C 3MOAH 1HH6B 2APTA 4HCRA 2BIPA 3M9QA 4NQEE 2HFFA 1T20B 2VZOA 3BIAX 5EPMB 4DK5A 2X89A 2EABA 4PCKA 4KXZH 3WNNA 3ZR6A 2ZXGA 5ICZB 1KLGB 4KMTH 1WIPA 4BH7A 3V4PA 3BT2L 5CEZL 5AL8A 2X2JA 5F8QC 3GK8H 1G9NL 3P32A 3II6A 4YDKH 4G5ZL 1QNZL 4HUNB 3DUUA 1SMDA 1RZGA 1A6VL 4NQDA 3CSFA 3UJJL 3SYAA 4AGOA 1FZMA 2YXMA 4UV4L 3KYNA 4NLHA 5FXCH 1L9NA 1JNHB 1SFCD 4M62H 4KK5D 3T0EC 5I0DA 5DURB 4WI0A 3VXQA 5LGKA 1XL4A 2B8OT 5J1SC 3G9VA 3OMIB 3MRMA 3TEWA 3KPEA 1AQTA 4Z7QF 1OAUL 1RF1A 4H8UA 3LPWA 1RP9A 4X9BA 7PCYA 3GMNA 1YPZF 2Z31D 1AFOA 4YX2L 3NK3A 4UOZA 1YY8A 2Y5QA 4Q6YA 3SWYA 2YD5A 3GHBH 4BK5C 3COOA 3TEZA 4LOUC 4ZUSA 4OM1H 4Z3JA 2KPNA 3C5SB 1ZVSA 2WYHA 3I9AA 4GT7A 1A3LL 1L6XA 1SUHA 1IBDA 1MAMH 4HEME 4X0KA 1PLAA 2HJLB 2FWSA 2EDTA 2XWZA 4Z7VB 4MJJA 3T0EA 1CBVH 4MQXD 3T2QA 4WO4B 3S8WA 3D18A 1L2PA 4N8CL 4XCEA 5DQ9B 2YK1H 2TSBA 1SQVE 1RUKL 4F80A 1AP2A 3JV5A 2NR6A 2XKNA 2B4CC 3NBNA 5K9KA 1AHWA 4KC3B 4OZIF 2J88L 1HL8A 3IVKA 1I82A 1PZ2A 1TDQA 3BN3B 3ALWA 5DGQA 3DO3A 1JNLL 2YBRB 3L71J 1EAPB 3Q06A 4HFWA 4M1GL 5D7LE 5SWSB 4HD5A 4XVUD 4LKXA 3TVMA 1SF3A 2MKLC 1QQDB 2EQDA 4G9DA 2FLMA 4FNQA 1RIHL 2Y1YA 4N0YH 5CFHA 5JOPD 2CU9A 2NR6C 3A6CL 2HPTA 1AVYA 3VP8A 4PJIF 1Q1JH 1UFGA 2J8UF 2BFVL 3FCSB 1RHHB 4R7DA 3BIKB 3GXIA 2R44A 1JZHA 2COQA 2A99A 1JMBA 4X9FA 1JXJA 2NY3C 2X9WA 4Q74A 4TYUA 3BH9A 4KRLB 3ZDXF 4NNPL 1MFBH 1G6RL 3CQFA 4U6VL 3CUPA 3HLAB 5HDOA 3WI9A 2BS9A 1MIML 4NM8H 3T6VA 3F62A 2Y9YA 3NJKA 1OE2A 4XBPB 3P73A 1MI5B 4B9KC 1KLFB 4J2XA 3HI5L 1B0RB 5D4HA 4A7QA 3D85B 3QO0A 5A43C 1AGCA 1RE3C 3ORJA 1MOEA 1M9SA 1VA9A 4IRSA 5LDSA 5C0EB 1JN6B 4PJ9A 1BAFL 1NJIQ 5APSA 4LCWE 1ZPUA 4OKVA 4R7LA 4RH4A 1QTSA 1DDHB 3FOLB 4ZFZB 4PGJA 1BCCJ 5TDPB 3EQ2A 1OGAA 3NRFA 1T2QH 2WWNA 2WWMC 4PTUA 4GRLB 3NCMA 2UZXB 2JH2A 2QRXA 1TITA 2VWEE 2EUWA 3BKYH 4NQCA 3ZE2F 1G1IA 2Q3ZA 1SLVA 1DBJH 2JB6A 4MNGA 5D2NC 1PEWA 5FYKD 1M42A 3I9IA 1YPZA 1AANA 1JTTA 2FSDA 2I5YH 2V17H 1N6UA 2BVOB 4Y8AA 2P46B 4WK2B 3LKSB 3L3JA 5EFIA 4WW1B 4PLOB 2BASA 1NINA 1UT9A 3DX0A 4GQRA 4TSAH 4WZ9A 2NNFA 3HNVH 1D5ZB 4ZMYA 1OB1B 1IGFH 1LP1A 2ZYIA 1AS6A 1CGVA 1F90H 4M48H 2Y5EA 3OJDB 4XCYB 4QXUL 4YOKA 1FZCB 1CK0L 3HZYA 3D2UA 1JGEB 3EJZD 2QBWA 1ET8A 4ECNA 2R51A 1WISA 1ZVHA 3TDKA 3KWVA 3P30H 1E28A 4IQHA 3LKQB 5MENB 3GMQB 3QIBA 4J3OG 5J0BA 2YPLB 4JZOA 2OQJB 4LCIH 3CMAP 1XBRA 1NTMJ 4M6NL 3WY2A 1JEKA 1LTGC 1IK7A 1FGNH 3MRJA 3T04D 1NANH 2EC9T 5IGXL 4L4VA 1UA3A 4YDNA 5IHLB 1LTJC 4PB9H 1LO2L 3QIBD 4XP6H 5TFSH 5MEQB 3RZCD 3FMGH 3KJ4C 4LHUG 2N56A 1SF5A 1G7LB 1I8KA 1UVQA 3C6EA 3O8XC 4GRWF 2OSWA 4JPSA 4FABL 5LGJA 3RYMA 3ZT5A 2IFMA 5FO7A 4BD4A 4AH2A 4FI7A 1M2VB 4G9FE 1NCCH 1Q81Q 1KGIA 1NKGA 2NUPB 2W91A 2D7OA 2VDNL 4ZOAA 3WIHA 2FY8A 2IJ0C 3CXHI 3H32B 2WQ8A 4HYTB 1F4YL 3L3IA 4NQQA 2H3XC 2XNDH 2OYIB 3U0WH 3FQYA 1SQQE 1NL0H 4LVHC 2W0FB 3FT1A 2D0FA 4X98B 3TT3H 4DKTA 3QJXA 2E7DA 1YN7B 1YECH 3SKOB 4TKWA 1FV1B 1AZVA 3QWRA 2E5YA 4P2AA 4ODXA 2JEEA 1EIBA 3TBSB 4HKXB 4X8CA 4YHPA 1EHLL 2VLLA 5TK2A 3BSZA 1KJ2L 4BE6A 5DD5L 4UT9L 3RNQA 1VQ8P 5EA0L 3TT1L 4D3CL 5FYLL 1ASOA 1HXMA 2ADJB 1YJDL 4X0NA 3A6OA 5B8CB 4JFHD 4UTAH 2X4TA 3HMWL 2JJTA 5BOPA 1NMCC 4XX1E 3QPKA 1RMFL 4WQOA 1KLUA 4XHJC 3W0WB 3AY4C 2VDOB 3OR7B 1FDOA 5E6ZA 4MNQD 1P1ZA 1SM3L 4L4TE 5JUEH 3NVQA 4BQ8A 1FO0H 3F00A 4L18A 4NWTH 5DD3L 4HBCL 1AD0B 4O9HL 4Z7NF 2Z35A 4NIKB 1FJKA 2P10A 1XB3A 2Q86B 2HX7A 1N7SC 2RGSA 1QA9B 4FXKB 5F72S 3VB8A 3NT0A 4OAWA 4X8JB 1USQA 5IB1B 3VMYA 3QNZB 4GXFA 2JLPA 3PP4L 4GG6B 2EDEA 1PX8A 4X5QA 4S0SD 4JKNA 1GC1H 3V5KA 5I8OH 5I8EB 1NTZJ 4P2OC 3AWGA 4YO0A 4E9XA 3GSOB 3GUTA 2PPEA 4HF5L 5CGTA 5CGBA 2VM3A 3KWWA 1OX3A 1PKQB 1RIHH 1L0LK 1RZJL 4B9JA 1CLOL 3CXDL 5ADOL 3BW9A 3TNMA 2EDOA 2GTZA 5DSCB 4JFEA 4AE0A 3MX0A 4JFZL 2BHUA 1W80A 2PR4L 4IOIH 2AEPH 3FB8A 1OVUA 3EYUL 4PWEA 4GXUN 1EHNA 2Y22A 2YUVA 1TTUA 2QQNL 3I6GB 2IXQB 5HHQB 4U1SB 4JHWL 1I4FA 3H1HG 4ZW8A 3A24A 3VQ1C 6PCYA 2DLFH 3PP5A 1J8HE 3AECC 4G6KL 4GBXB 2WBJA 2XG5B 1CGTA 1WZ1L 3SE6A 3MRDB 4C56D 3T0BA 4G6JL 4QTFA 1ZHLA 4FG6D 3RFZA 3PWJB 1NFDB 3NJXA 5DJYA 3BJ91 1OAQL 3GMOA 1PX4A 3HNSH 3GF8A 4JCLA 4ODSH 3WMQA 3NIDF 5LQBL 1SFCA 1M4KA 1KLGA 3ZHKA 1B4LA 3L95A 3RBXA 1MNUL 3BEWA 3IU3B 4JVPA 1XSJA 4MLIA 4UDUA 1AC0A 3QJVB 5DUPL 1S7SA 4RZCA 4ZW3A 5IESH 4UAHA 3EJYD 5J6GA 5FYKU 3BVVA 4MX7B 5FCSH 3BDBA 3DDGA 3QJHB 4X4MA 1IL1A 1P9MA 2F54B 1N9PA 1SEBA 4ZX4A 1WYJA 3UL4A 4FFYA 2R9HD 2XPZA 4YAQB 1G0YR 3IDXH 1JNHA 4GPVA 4WBAA 3S35L 1OE3A 5D7IB 1VGEL 3CCRP 1QUNA 3MNZB 3ZVVA 1ZV9A 3DTXB 4XC1H 1IFMA 5FHAH 4WFEE 4N25A 2IAMC 1U92A 2FBRA 1J10A 1UH4A 2I9LA 3HE4A 3NQIA 4HK3N 4ZW6A 3STLB 1U8MB 4IMLB 1NLDL 5EORH 2NT1A 4YHZH 1DUZB 3ARFD 3L2LA 2ITDB 2W80C 3ENEA 3WHE0 5HYSG 4N26A 5MP6L 2G3ZA 4JFEE 2Z7UA 3FQRA 4B60A 1BE3J 5EIIG 4KUCD 2VQ1A 3GSRB 1RURL 3KWUA 2HLOA 2XWJA 2Z31B 3Q8EA 2EYTB 2ROYA 5C97A 1KIPB 4DERA 2FWLB 3QDJD 4OUUA 2DN7A 2J7LA 3LEXB 4N68A 2YMKA 2HCZX 1V3MA 3NN8A 1L0LE 1WCBA 4ONOA 4NFDA 4HH9B 3BP4B 5BW7A 2A83B 5GSVA 2HJKA 3WIIH 1I1FB 1M9WA 2EDYA 3QWQB 4AX3A 1FLRL 2WWKO 1A1OB 5ISZB 1TU2A 1IC1A 3APNA 1BZ7B 5C0FA 3HTLX 1KOAA 4ZXBA 1G2CB 1NA8A 2NPSD 5BU8B 2GQHA 1DSYA 2JIXB 1MCOH 4AOFA 4ZNEA 3RKDD 4FFWD 1YNTF 3L4ZA 2ADIA 3JVGA 5C0DA 3V6ZA 2JE8A 2I9TB 3IBOA 1CLOH 1LO3L 1BQKA 3RUGB 2BERA 2E27L 3W2DL 4PV1B 2VZTA 5GISH 1HHIB 2XWBA 3CXHJ 4OFVA 5BU5A 2ZF9A 1CJYA 2HT2C 2LW3A 4NRZB 1WFIA 3UTZB 3UABA 1DN0A 4LDOB 1UOKA 5CSGA 3N1MC 2QPSA 5TE4L 3VVWA 3ARZA 1NWOA 4WWOA 4UANA 1FL6B 1TJHL 3KD4A 4X6CA 4XBPA 4I4WA 2VLRD 4GYBA 4K35A 1NIAA 2IDTA 3MJ8A 1M6UA 5CD3A 4LLQB 2E47A 4PJDE 4RBPK 1JF1A 4ZPVB 3FONA 5D7EA 5GGRA 3TBVB 1UVQB 3L7EB 5LG1A 3WJMA 4Z7WA 2E9JA 1UM5L 1KCRH 2GYSA 3EH1A 5E70A 3VH8A 5I8KL 3WGVB 1RF1C 5T1JA 2OMNA 4UU9A 5KSUA 3SZ6A 1ES0B 4ZPTA 1WRFA 4Y16C 4Y5XA 5AYUH 4Z18A 3ZL4H 2VOTA 4G6AD 1K6QL 2B1HH 4OLUL 5DO2D 4OZFG 2AK4E 5BVZA 2AXGA 1YPZB 3EOTL 2CDGA 3G5XB 1MFCH 2FB4H 3QZOA 5C09B 3I74A 25C8H 4PREA 4NRXB 5GS2D 3CU7A 1XSOA 4LEXH 3KH3A 4DEPC 2CR3A 4L8DA 5ALBH 4C7NA 4HUCA 1Z9SA 1U4EA 4UQBA 4QHKI 1E9PA 2WLZA 3W0WD 3CSBA 3RFRA 1ZT1B 4PWIA 1GVIA 1MQKH 5TTRA 5FUOH 3NRQA 2YO2A 3WTVA 3ZKQD 3I56P 1ET5A 5L2JB 2WUBL 2ERJC 1I75A 3FCTB 1QVFO 4AZ8B 1CD1A 2DM2A 1E6OH 2C26A 2PYED 4E9QA 2CE6A 4HZLA 4LMQE 3D87B 3L3HA 4F7PB 3LS5H 4JZOB 5IHHA 3WUVA 1JPTH 2KSEA 1YY9C 1X79B 2K88A 5EO9A 2N3JA 4ANXA 3UYPB 3NXSA 3IDJA 2DTML 2ZUYA 5E51A 1EWHA 1CFTB 2Y25A 3ULVC 2IDSA 3VGEA 3N9GL 4G9FD 4Q9BA 4K9EH 1Q38A 2H0PA 4EZMA 5HI5C 2VITB 4J3OC 4HWEH 1XB6A 5M94B 3CMGA 1E65A 4WHYH 2VKXA 1AS7A 3H9SA 3JV6A 1QRNE 4JFYA 4XWOC 1E27A 1CE6B 2N7AA 3G04B 1IM3D 1GKOA 1MJ8H 4JGUA 4XPFH 1X5XA 3FN3A 3HD7A 4I2XE 2BY2A 3MOQA 4E42B 3IMBA 3BWUF 2VDRB 2EP6A 1HAUA 2NUTB 1RERA 2GG1A 5DI8A 3PWPE 5E5LA 2GSIB 4Z3EA 1RHZB 2AANA 1YEGH 5SWZD 3FQTB 5I8EA 4FQXC 3HFFA 2X41A 2HKAA 1BSHA 3FSWA 3SKOA 1OAXL 3KLQA 1XX9C 2BSCA 4OGAC 2FGWL 3D34A 3CTTA 4B9FA 2BP5M 3MGOA 2FYUK 4BJLA 3HBQA 4P59H 4ZDHB 1JCCA 3OGOE 1RL1A 2O6DA 4XR8C 3DVIA 5D1ZB 2CHDA 1B88A 1Z66A 1VGEH 2HKHH 3ABMB 3K46A 4KK8D 4JR9L 1FNHA 1Z0MA 4PJBF 1A25A 2QPFA 3TIEA 2DL9A 4Y7MA 2CLVB 4NENB 4XT1C 4F7EB 3BFOA 1KTDB 4LCCB 5F7UA 1LP9F 1PD0A 3QIWD 4NHCL 1BECA 4O4YH 5FA4B 5HVHC 2ZXQA 3OB8A 5DZPA 1YCSA 5J1AB 4PCYA 1PU0A 4DN3L 4AYEC 3BE1L 1BBJA 2K4AA 5F0JB 1PYWB 1XZWA 2WTOA 5H37G 4L0ZA 3HE5A 4X7FC 3E8VA 3CFQA 5EBLB 4DZOA 4C4KO 4G8EB 2HMID 2AJZA 2QJKB 1DBBH 2VXVL 5AW0B 1RZKL 4O02A 4PTTA 2XX1A 3QEQD 2OYHB 3BH4A 1ZE3H 2CR6A 3FUDA 3QCTH 3QZNA 4HUKB 3ZL4L 2R0ZH 1K6QH 4G80B 5EU6E 5BZZA 2XETA 4LASL 1GZHC 4IS6A 1CF1A 4W9LC 3LKOB 1URQD 2YGPA 4HIJA 4M8QB 1N10A 4UOW0 4OLXH 1ZSHA 2BP8A 1CTOA 4OLYL 4XB8A 5SX5K 4FXGB 3U46A 2IOIA 3R0NA 4KK5C 1U91B 3UO1L 3ZHNA 4PWKA 5JPNB 3M06A 1FIGH 1Q1JL 3MRIA 4I77L 4NNXB 1H3UA 1A64A 1FS0E 2DQTH 3FRPG 4IOFC 4E9SA 3IDXL 3RTQC 1AQHA 1NPNA 3F3HA 4FNLH 1I8MB 2G5UA 3T0AA 2X9XA 2HMIC 1U8MA 2KQMA 4IMLA 5C6TH 4PY7A 2D03H 1LEIA 2C9RA 1MH5A 1XF1A 3F89A 2P80D 1AO7D 3AG1B 3FPYA 2ED9A 5C08D 1IEBA 1RJYB 1KV7A 4H25B 4NJ9L 1THCA 1EXIA 3B83A 1M1JA 3BAIA 2FX7H 4P05A 1H6FA 4OGZA 4YHLH 3GXDA 3QXDB 4PJFE 4R4BA 3UPCA 1KV4A 5E9NA 3DO7A 3W1ZA 2C9QA 3FH8A 4R2GC 3EFDH 4K9EC 4LVHB 4ZXBD 1KC5H 3PNRB 1KGUA 3CG8A 3CDZB 2NCEA 1TSRA 1BGXH 4LSQL 1N3NA 5IHUH 1I9JH 1RZFH 2VLKA 5DRNA 2RH0A 2HG5B 4NUGL 4GMSL 4TXVB 2X4PB 4ZFOB 5J06A 5D2LA 3S3DB 2EIZB 1UD8A 3FU7A 5JXAH 4MDIB 3CH8A 5FHBH 4M93C 1CR9L 4LPYA 4YR6B 3CXHK 2VLRB 1KCBA 1SQMA 3SDCC 1XF2B 4OCSL 3IJHA 2JJSC 3KLHD 2N1TB 4D0DB 1WITA 4UB0L 1JDDA 5H2FE 4S1QL 2WZPD 1F90L 4W1TA 2H26B 4BZ1L 4K5MA 1U93B 2WSKA 4JFDB 1UKQA 2YJQA 3AXHA 3ABKB 1EV2E 2YOAA 3KYMB 1F45A 2B77A 4UQDA 2ICEB 5GGQL 3DX8A 3OG4B 4U1IB 3TO4D 5BMFH 3I84A 5CUSL 3CSTA 2UUDH 4HW6A 2DLHA 4UUJA 1Q86Q 1E6OL 2YPVH 1R8EA 2D7TH 3FS9A 5C0CA 4NC2B 4JG5A 4P5TB 1CXLA 4Z1PA 4PJ5D 3WAJA 5FHAL 1LQBC 4FQ2H 1MHHA 4BWNA 5I1CH 1RIVH 2VDMB 3KPMB 3P4MA 1WEJH 5HD8C 1QACA 4Y4KB 5I5JA 2QM8A 3CJJA 4QI3A 5TPWH 3MV9A 4I2XB 3W67A 2UYLB 4XAKE 5AWNH 1DEBA 2CKBB 2XPYA 1U8QB 3A23A 3VE0A 3D69B 4URTB 5ACZA 2NQCA 3CFEB 1KGWA 3DHJA 1OGPA 3NCBB 3L71D 2VR3A 3KPNB 4YLQT 1BAFH 4RWHA 5AVUB 1CI6A 5B3NA 3ULUL 1UM6H 1DQJB 2XWEA 1F3JB 4K5OA 4WWKA 5DDHB 2WBXA 2ENQA 2ATAA 2VDKL 2Y0DA 4HT1L 1Y8AA 6FABL 5CP3A 3F7YB 3BP6A 4N6RB 2XZQL 1KC8Q 3ZDZF 4B3VA 2DYPD 3V4PL 2X7LA 5MEOB 1BM3H 1OGTB 5CAYB 3ABZA 3L5IA 5IGXH 4HIEB 4KH2A 2KPWA 2CO1A 1HINH 3SDCD 1FZBA 1J1DC 3FZUC 5C0JA 4RBPH 2RTTA 2WBJD 1IM9A 2FIRT 4X5LA 4UZGA 3RFZC 4JY5H 2EC9U 4FHKA 3BATA 2KI6A 2ZXBA 4XCNA 1M71B 3FCTA 2EADA 4G9FA 4YXWH 4PGDA 1NFAA 1G9NC 4N0FB 5AVTB 5DC9B 1YHPA 1FU1A 3N1PC 4LEEA 5AL0A 2VT0A 3EYUH 4ZD3L 4NO2A 4DN4H 3D4YA 2NOYA 2MOVA 4U0RB 2ZOOA 4OGQC 2G9HB 5HHMB 5KG9A 1OW0A 4IKKA 4POUB 4PU2A 2V17L 2WBJC 3B9KD 5EUKB 5D5ME 2P3YA 3OZ9L 1VQMP 3GTVA 3MTXA 3C2SA 3H1LG 3D25A 2W9EH 3FU9A 1N7LA 3TBVA 4PBWD 2CK0H 1MXDA 2HT2D 3PWPD 4M5YH 4FQHB 2X4OB 2QR0B 3B9EA 3RA7H 3F64A 4BWWA 4ILDA 3B3IA 3ARPA 3EOAB 3AABA 3MVSA 4PAZA 3FN0H 1IEAB 1S7WB 2JMRA 3LPGA 4ZMQA 2IDQA 3GMNB 4NUGH 5GRJL 9CGTA 2EH8H 4X99B 1AJYA 2EIJB 2WNKA 4QRUB 4ELMB 2EEFA 3QDGE 3CGTA 4PGEB 4YDLC 2WKLA 3CAFA 4NKDB 5DD6A 1DZBA 3QXUA 5JOPE 3JT2A 3D3VA 2BCKA 4ENZA 2VRQA 4JRXA 3QUMH 3WE1A 3ZX1A 1NSNL 2BSDA 2K9JA 1N19A 3TCTA 5I74B 3JCUE 2YEZB 2CIIB 1NIFA 2PLTA 3ARUA 3J27A 4UYQA 4W9IC 3R7RA 5KSBB 4R3SB 5C0BB 1FFQA 4RFEA 1EHXA 2Q3IA 2PF6A 2WQSA 4Y9FA 4JBZA 1AGFA 4I0CC 5C6TL 4YBLC 5PCYA 3UXFA 2OCFD 1BGYJ 3SZKC 4HIIA 3VFUB 4J6IA 1DD4A 4A6YA 4TULL 1YYLH 4EQ2A 3MV7A 1A6TB 5BRPA 5FUCC 3HE5B 2OPCA 4M43L 3FQNA 4HXBH 4MJIB 1A1NA 4JMXA 4H13B 4PRIE 4PJFA 4EZKA 4XO9A 4A2DA 3SN6N 3KPPA 1A8ZA 3FHQA 5D55A 3QRFM 5T33L 3EOYG 1JCKA 1GJWA 1CU4H 3MRPB 4QF1B 2R29L 3IFOA 4OLVL 3SBRA 4X6FB 4TLSA 3MV9E 3NTCH 1T83C 3FFCE 4Q14A 5GGRY 2CM6A 4M5TA 4HS8H 4Y4KC 3S5LB 4KPHH 4QYAA 1IGIL 2R2BA 3SDAB 2BZ7A 2EEXA 4U6XB 1AZBA 4FQLH 5E8DH 4ASVA 1UT1A 3PP4H 3GPSA 3O6FA 4G6KH 2P26A 3KPQA 3Q5OA 3QUZB 4P46D 4BWUA 4ZUTB 4WWKB 1K04A 4Z78A 2K6WA 2R7EB 3FUKA 3KNBA 3M17B 5HGGS 1KB9E 5D1ZA 5TDPA 3O2DL 1BJMA 4OB5H 1DD3A 3PWVA 3QCVL 1JYNA 1TEFA 1LTSC 4FMFA 1JHKH 4WFGD 2G8YA 1T0PB 4P46A 4TQIA 2LOEA 1FL3A 3DJZA 4PWGA 2P52A 5KAIH 4WKZB 3TV8A 2A77L 4JR9H 1NTKK 1MFEL 1UWFA 2ZKYA 4ZUUA 1UJ3A 2NW3A 3X3GL 4DTGH 1MIEL 3L70J 4CKVX 3DVGB 1BJ8A 4A2LA 4XODA 2VXUH 3UC0H 1EGJA 1YNLL 4G7YL 4OLZL 4IYKA 3UDWA 2ICES 1KPUA 1P5VB 5E4EB 2HFFB 1PZUB 4FYTA 1KT2B 3HZKB 2I85A 3BE1H 1BOYA 5C0IB 2OTJP 1NCJA 1IAII 2V3DA 3MA9L 4G8GB 4K0OA 2KQNA 1S3KL 2YAFA 1IGYB 2Q1EA 5DT1L 3VTMA 3ULUH 3MXVH 5DUBB 3TO4B 3ZRFC 3IPFA 2VM4A 3T2PA 4F7TB 5E1IA 2KSJA 3MNVB 2LABA 4MA1B 5I0ZA 1UWGH 2QMJA 4I1NB 5BV7L 3LXUX 3BWAB 4IBSA 3GMPB 3BISA 3MV7D 4KKLC 3QORB 4MDJA 3I9PA 1MLCA 2WBKA 4X42A 2IBZD 4J3TA 3GKWH 2I1KA 1ANUA 4TS6A 5C07D 1NCWL 2J1XA 4EKXA 1H5BC 5FHBL 5CP7B 3TBYB 1FH2A 4JM2A 1HINL 4M7LT 4APQB 2AXWA 1U91A 4AIOA 1JZJA 2VJ8A 2YD8A 1FYTD 2WT7B 1DDTA 3B6SB 3DHPA 2A0LD 1ZMEC 3LHAA 4QKTA 4LPWA 3O11B 3MZGB 5C08E 3T3MF 4NO0D 5EEXA 2ICEA 2E27H 4XAKD 2AERT 1DLFL 2J5LC 2RCSL 3MJ9A 2XZCL 3MRLA 2GK2A 5F1OB 4PTUB 3RL0B 1AG0A 3RWHB 3LS5L 4WEUD 1JF5A 1VQ9P 2D8KA 4DKEH 3FT9A 3CLFH 5KLVJ 3CDGA 5E23A 3DYMA 3C60A 5I1IH 2HJLA 2WVVB 4Z7WE 4G5ZH 3MV9B 4I2XA 1PZ5A 1HGZA 5KYWB 2H8PD 2CKBA 1FZAA 3J7HA 2EVFA 2DM7A 2CRIA 3VGAC 1A14L 1OW7A 4Y19B 3KCWA 5D96B 5DJUB 4KVNL 2E9WA 1A7NL 3MAWA 1BQHG 4B3EA 5IB4B 3UZEC 1J86A 5B8CC 1NUGA 2EDWA 1TZHB 1NAFA 4QRRB 1XEUA 3MRHA 1V3KA 4LB8A 1AO7B 1F3JA 1KJ3H 2QGBA 5DDHA 4DJMA 5J9PB 2KZIA 3R1GL 4M5YL 2FX8H 1R3LA 4XXWC 2BVTA 2HFGH 2O5XL 4H1LG 2PCFB 3Q2NA 1BIIB 1IB5A 5EUOF 3BP6B 4N6RA 12E8H 5IB3B 3BAKA 5J89A 2HKFH 4LKXB 2WZ5A 3QGVA 4QRQB 4LKCA 1BGXL 4NM8L 4M7JL 4L9DA 3FGAD 3BUBA 4V2BA 3IMUA 2PO6C 5HHMD 4JQ0D 2WJ7A 5TFSL 4MMZC 1QD0A 4LCCC 4R7DB 2BIMA 1X7SA 4KX9A 1IJNA 1CBVL 3D6YA 2PW1B 5CZVH 1J9SA 3ZDYB 4GW4B 4UT6A 5HHME 4K94H 5IG7B 1ZT4B 5E94A 1TNMA 1AMYA 3UADA 1H8AA 1FVDB 1HT6A 2AJSH 3LPFA 4U7JA 1YEFH 1X44A 5D6CA 5ESAB 4HUXB 4HG4K 5TDOB 5TK4A 4WNQB 5JHDE 1EMTH 4XNDA 3IAOA 2HVBA 3ULUE 1E67A 4XMUA 2VLJD 3U9WA 1ZT7A 4K4KA 1VFBA 4PJBE 3F6JA 3CHPA 3DPBA 2QSVA 3S8FB 2CO7A 1EERB 2A9DA 1KILA 4R5VA 5KYNA 4LLDA 2YA2A 3O6QA 3JWNH 2G60H 5D7SL 3DMMB 5D7JA 1M6OA 4UOW1 3L3IB 3WFCH 3GLAA 3DI3B 2OYIA 4BUGA 1U8PB 3QJFA 4UB8E 3AM8C 3MJ7A 1UZ6E 4AUYA 1JJUA 2DLGA 3EJSA 2WQVA 3RK3B 3VFOA 4HKZH 2Z0BA 4XAWH 3ZY7A 1LE5B 2G2PA 1SQBK 2L7EA 3QDGD 5LN4A 3ISWA 2X70B 4G6AC 5BO0D 3C5JB 3O2VL 1X9VA 3QCTL 2P5EE 2GIMA 1HYRC 1L9OA 3AW5A 3LPPA 4P57A 1PPJG 2NY1C 3AGWA 5KLVD 4ORGB 4W9JC 3UPRA 5DD6B 4PGEA 2OXGB 3RWIA 5GRUL 1TQUA 2W27A 5I5RA 2V5YA 1NCWH 2G3AA 3AG3B 3WTTA 5BJTA 3CXHD 5L2KA 3EYVB 4H8QA 4M4RB 5C0CD 3VFVB 4PD4E 1I1YA 3WKQA 4BQ6A 3THMH 1Z5LB 1BX2B 1UXLA 4N8PA 1IAOB 2AKRA 2O6PA 3PS6A 2YEZA 4M6ML 5DEZA 1OSZA 5A1AA 3HPJB 3EOBA 3RZCA 3A2AA 3H8NA 4G7SB 2X40A 4YPCA 4X83A 3ULVD 3OR7A 1QLEH 1T3FB 4YE0A 5KVGH 4R5XA 3RRQA 3HRPA 4QNPE 2H32B 2VXQL 4A39A 1WZMA 3S36L 2JCCE 4PJ7A 2PUQT 1SQ2N 4V33A 1LTTC 2V7HA 1BVOA 4GBXD 3T4YA 2VLMD 4WHDA 4BKLB 1Y18B 4OLUH 4LARH 1TQSA 1CFVH 1H6EA 1J2JB 2E0PA 3HI6L 1K4CA 4AKOA 3DRTA 1A6TA 4ZO6A 4KXDA 3C60D 3LVTA 3BMVA 1Y0LB 1PPJD 3US0A 4K3JL 4AENA 1A7NH 3MN8A 5GRXG 3E1ZA 2J58A 4WEBH 2FHBA 1ZLLA 1LHZA 1DBKH 3GSOA 3O2WH 4G43A 1B6UA 3CN3A 4HALA 4MA3B 2J25A 3NGBC 1GZQA 1NLBL 2GM4A 2I07A 2JI3A 4AIZA 5LN8A 2PR4H 1DVFD 5HYQA 1SXBA 3FF7A 3TNMB 1NH6A 2Z65C 5DZAA 1S9WA 4YBHA 2FT6A 5DD0L 4A7GF 3PGFL 3TN0C 3JCUH 1LE9A 1ZDQA 4G8FA 3CDFA 1KMIZ 4M03A 2NTFB 3CN1A 1T0NB 2H0EA 4Y5VB 2V2TB 2HFEB 1O7DE 1YN6B 4GW1B 2HTLC 2DQGH 4DKAA 1ZPLA 4TQ8A 3QQ9C 3HN8A 5LXGL 1LLAA 3ZR5A 3SQBB 4HKXA 3O81A 2AAAA 3MGNA 3APMA 3MLXL 3U36B 3OAZH 4XNMA 4L8CA 3WS3A 4LESA 5DQDL 5JPNC 2W95A 4ASWA 4OZFH 3RVUC 2P42B 2XV0A 2BXYA 3KWTA 4AL8C 4AYFA 5G5DA 2AQ2A 3LEXA 4WI5A 4WV1C 1U57A 2NY2C 2WLJA 3V4QA 2WJ5A 5B8CA 4GH7B 2JCWA 2X1PA 4IRZA 3BRTB 4XI5C 2GCYB 2GHZA 1QSZA 2CHZA 4MA8L 3WEMA 2XKUA 1XT5A 2YAPA 1NAYA 1F11B 4OZFB 1BYOA 3NIFB 2O5NA 3Q5YA 3L3GB 4A6YB 4HS3B 3PL6D 3ZYIA 5C0GB 1WZKA 3H3PL 1WAAF 5AAWC 1H3GA 3L9RA 3V6IA 5J8OA 4ZX5A 2H9GB 3AG2B 4NPKA 4HF5H 4ZZFA 4A2MA 1C08B 4YL4A 1VAHA 1Z0NA 1JWMA 1UYWH 3SGEI 3RIAF 3FFCA 3CFMA 3H1ZA 3BKML 4EZJA 3LV3A 3QHZL 5CP3H 1BLIA 1RZKH 5DD5H 1IMHC 3ARVA 2Y6SC 5HI3D 3Q43A 1LDPL 1BZEA 4L0YA 3Q5PA 3QFJB 3JTSA 3VXPA 4J8RA 1RE3A 2QA4P 2XXFA 3LZNA 4V1DA 4HD9A 3TV3H 4A7VA 1J0KA 3ILQD 3N0AA 3LZFH 2Z5IA 1EAQA 1LK2A 1AJ7L 3TNUB 2BVQA 2EYSB 2FK9A 3ZBMA 4GG6F 3POCA 3IYLW 4MRBA 5B38G 4HLJA 2X3CA 2KDGA 4IDJL 5CBOA 5E8DL 5KSVB 3U1AA 1OM9A 2JVUA 3ZZQA 3UJIL 1F13A 3O4LE 4X6DE 3VH8B 1I7RA 5KJRH 2DBJA 2X1XR 5ENWB 4YBQC 4DPBX 4U7SA 5K9OB 1JPEA 4RMVA 3G08A 3FT2B 1FL3B 5TE6H 2UZYB 4OF5A 4R26L 4DJGA 3QA3A 1NFDE 2F7RA 3ZMEA 5TGBB 5FW7A 3TZVC 1WHPA 1CD8A 3E9TA 1IKNA 2Z7ZA 4FYSA 3ILPB 5JA8B 3H4HA 5E6RB 1BZ7A 4X4KA 5C0FB 3ISYA 1FFTB 4K07A 2EIEA 3ZDYF 1P84J 5D7IE 5C7ZA 1EZLA 5KYUA 2VRSA 3IAPA 2WPRA 3UO1H 4XVJH 2TRYA 3ARXA 1O7DC 4K3GA 3RWDB 5KBDA 4U3SA 3KS0J 4IRJC 2LAGB 3UTTB 1UD6A 1XCXA 2X4NA 3I6KB 1WFNA 5LNDA 2DBLL 3JQOB 3FQWB 2Q3EA 5I1EH 1KYAA 1IT9L 3R7QA 4TNWK 4HH8A 1FUNA 1HZHH 3ZMRA 2FRGP 2DEXX 3UAAA 2Y5TA 5K1NA 1A65A 2CO3A 5F70A 4HWUA 1E7UA 4PWHA 4YAQA 3K6OA 5F88B 3CZFB 3SDXB 2WMPA 3P0GB 3SE4A 2AXTE 1YSOA 1SQBJ 3GHGC 1BXUA 5KJ7A 2A5UA 2BOBB 3OXSA 1NSNH 4ATWA 4YHLL 2DQCH 1JF1B 1A7OH 3SE8L 4IRJD 2FJHB 4NQDE 1KACB 2EH7L 1F8TH 1U8OA 3QP3A 1IBYA 4YK4B 4S1QH 2CR0A 4L2YA 2Y2TA 4LP4A 1QLRA 1PD6A 4E68A 4AQOA 2GAZB 1CE6A 3UYRH 4CNIB 1YO4A 2WWMD 3DIVA 3P9LB 3U7YL 3CDYA 3VD5A 3LYRA 4BA8A 1N6QH 2ITDA 2VUKA 2JQAA 4XN5A 4ZZKA 1OF2A 3IMRA 3JV4A 4P2OB 2VIRA 1QPKA 2FEDD 3MBED 1F1GA 2QADC 4WUKH 4Y1SA 3UROR 4ZYKB 3FXIC 5EF2A 1DQKA 5IMLA 1X9RA 3BSZH 1FL5A 4P4RB 5C0AB 4XCCH 4OTXL 2CBOA 2EUZA 2F58H 1ROWA 4WFED 4XVSH 3U6RA 4UWQB 4Y2DB 2CKBL 4KUCF 2XWCA 1WEJL 1I8IB 3O6FC 4IHOA 3SKMA 4BZ2A 1A6AA 3EW3B 4H5SB 3T1FB 5I6XB 1MNNA 5IB4A 4C7NB 1IQDA 3IDGB 1L0NG 3BVXA 1LEKA 5HYEA 6CGTA 3CWBG 1LT9A 3ZDMA 1Y9BA 3SBQA 4YEEA 1VKXA 1I1FA 3FOMB 5DTFA 2B59B 1SY6A 1GZLA 5KTEH 1ZIBA 1PP9D 2WUCL 3W9DB 5IEHB 1U3NA 3VDAA 1VADB 5D9SB 3MQIA 3L5XL 1FZOB 2HFGL 2O5XH 4QRRD 4FOMA 1DQMH 3AXLA 1RAMA 1A21A 5CNHA 4XWGH 2BNQD 1TZIA 1E4XI 5FW6A 5E8PB 3QWOC 2DB8A 4CVXB 1XIWD 2FYYA 4WU5A 3AY2A 4CMHC 4PJDB 5M7QA 3G6JA 2JTDA 4P5KA 2PYEE 2X2HA 4B96A 4Z9KB 5F0LB 1CL7I 4F5CA 1T3FA 4B6ZA 2YQBA 1TJIH 4KK9C 3FT0A 1P84I 2IX7C 1I1AB 5CEYB 2A06D 1E4XL 1UGKA 4UQ3B 1ZRTE 2JKTM 5T1DL 4QOKB 4MNGE 1ZT7B 2N0MA 3QEHB 4HT1H 2GITB 3SY6A 2PWHA 3AZUA 3WE6B 3BRVB 5E08H 4HKBA 4U3FJ 1U58B 1DJYA 4B95C 4MJ6B 2P8PB 1NIEA 3CFIC 5BRZA 3VNZA 4DQAA 4HWBA 5DHYB 3BRGC 2HVKB 1V55B 1EJ8A 1QRKA 4JDEA 3AG4B 5DWPA 3WJMB 1A7QL 1OHZA 2DIBA 3KYNB 1BE3E 2AEIT 2H2SC 3E8UL 4QXGL 5D2NA 3G6EP 2YD9A 4PJEE 5KSUB 3VNYA 1AYRA 2GUYA 3MRMB 1ULVA 4JW3A 4XTRC 1IE4A 3NYKA 2B89A 2VE6B 3N85H 1C1EL 1I7UA 5JDSB 1AXSA 2K6ZA 3MROB 5FFGA 1QSVA 3T9WA 2H88C 4O4YL 4ETQB 1KTCA 2N7SA 5E5RB 5T1MB 4XP1L 3WKMH 4YGAB 4BQBA 5TJHA 1H5BA 4AGPA 1KCWA 2C1OB 4BUQA 2OMYB 1SDAB 1EXHA 1JWUB 2HFEA 4NHUA 2OMVA 2B4CH 2HLFD 2ORBH 3EYQC 2ZOUA 3JZ7A 3PL6B 4Z7QE 4JZJC 2F2HA 1WUNT 1JXKA 3QBTB 3RKDC 3EFGA 2WV3A 3OKLA 2KP8A 1DVFC 3BZ4B 2IQ9H 1WT6A 2MOQA 5JZ7D 3PPSA 5BO1L 1PYWA 1NCNA 1FYTE 1XGQB 4F24A 3CWBJ 1KFNA 1Q72H 1G7PA 2WQRA 1OD7A 2R69H 2VJ0A 3O0RH 4DP7X 4Y2OA 4BZ1A 4QMEA 4LDEB 5F7BA 2A7BA 4RNRA 4UQCA 5E2VL 2R29H 2PYFA 1MREH 3V7AG 1YY9D 1Z1WA 2OKMA 4NKMB 4PJAE 1D5BA 4TLKA 2OYHA 1ZS8B 2EDQA 3OC5A 2XVBA 1JI2A 5D2LB 2ED6A 3TESA 2BRQA 3A0OA 4NUJB 5L4JA 1SS1A 4L8SC 1KN4L 4HCRH 1IGTB 1PFCA 5KVGE 2EDJA 3MMEB 5D1QD 1KZYA 2JJVA 3QDGA 1EZVD 4YR6A 1A14H 2OMTA 1QQDA 2A06E 3KLAB 1R3HB 1O6SB 2Y0EA 4S1SH 3MRGA 1BFOA 4AENB 1LT1A 2MEJB 4U33A 3TX4A 3E6HB 4C57C 1L0YA 5KSAA 4J6RH 1HHHB 4PRPA 4L4VE 4YJZL 4F93B 2E7LA 1AACA 1U30A 3P2TA 1S7QB 1A6VH 5CJQL 3QR2A 4MA3A 5D4IA 3MRFB 3T2NL 4A2GA 5GGUB 4CC4C 1KUMA 3QAZC 1HAWA 1M3JA 1UYWL 2H2PC 2KZKA 1MUJB 3FUJA 4K3HA 4NZUL 4TMPA 5DJDB 3RZWA 5JPMC 1BF8A 4RO0A 2PCPA 2JELL 1MN4A 2YPKB 1GHFH 1ZEAH 3JTSB 2XDJA 3K5BA 1JK8B 3DRQA 4PN6A 2VYRE 5L8KB 3PH0A 5K5GB 1S5IH 2FO1A 4KDWA 3QWNA 3WUWG 1XCQB 2X6BA 1LWHA 1IFHH 5GGVL 3VFNB 2FFDB 4K23L 5CCGE 1HWTC 2H3NB 1RJYA 3H42H 4JBSA 3SIKA 5KVDE 4PJHF 5AB0A 2XZAL 5T1KD 5EF1A 2YA0A 4OQTL 3QNYB 5E8NB 2XU6A 4UDTB 4KKRA 4Z7UA 5T1LB 1F6FB 4O02H 5CU5A 2DQEH 3ZJAA 1HKFA 2DKUA 3D71A 4JFED 1CXEA 5SWSE 4FA7B 1J8KA 3L75G 2BWDA 4Y4KD 1BXVA 2XVKA 2NY0B 5DT1H 1HSAA 5IEKB 4JMNA 2KUBA 2R0ZL 1IC4L 4GXUM 4XP4L 5I1KH 3UAEA 4OJAA 1FQ9C 1LO0L 2DW3A 4Q89A 2FSEB 1N7SB 4TT3H 3VI4F 5KLIB 1BBJB 1IE5A 4GUPB 3A4EA 3MRCA 1Z9OA 2WQYC 4N0CD 3QIWA 1OZUA 1S9KC 5KYXA 3BGMB 2ARJA 4MNHB 4R83A 2AFNA 4PV1C 4F7MB 1AR1B 1UIIA 2AVFA 1XF3A 3OJDA 5CSBA 3ARBD 2XN2A 3NPSB 3JC22 1GIGH 1NDGA 3OLGA 4HJUA 5HJBA 3REWA 4WSJA 4DCQB 4DNLA 3FFCB 2OS7A 1GL4B 4HJIA 3GBEA 1WZLA 3IT8D 4POZC 5IM7B 3MJGX 1H3WM 2D31A 3SBWA 1IZKA 3O2DH 1S9KE 3KBFA 1JHTB 4NPYB 5DJ2B 4EUPA 3MD0A 4IFMA 4XMPH 4YN3A 3PAYA 3QT2A 4GODA 1CFSA 2A2QT 3OLEA 4J8RB 4UUJB 5TPWL 4NJAH 2KB7P 1TYRA 2KZJA 1ECYA 3IDMA 2NXYD 1KLFA 2HRLA 1BGYG 4ANVA 4DN3H 5IUSA 4BFBD 3GKZA 4YXHL 1J5DA 2XV5A 3IXTA 4PRHE 5FF6A 1U8QA 4WENB 1KJ2A 1PZBA 2DS4A 5LKNA 5KSVA 3V2RA 1QLEL 2WN3A 5KVGL 3A0BH 1JO5A 2DY2A 2ITCA 1YEJH 4NP9A 3QO1B 3B9KB 2VR7A 3RK2C 4KNQA 2RFXB 1OD9A 4NSKA 2F53D 3KLKA 1K9MQ 2Q7AA 2NNCA 4JAMA 3VWJB 4ACPA 4Z7OF 2OMWA 1T5XA 3EBAA 1FL5B 2F15A 4UBDC 3M0DA 3GT6A 1GS8A 4X6CF 3BZEB 4QHUA 5IJCC 5IMOB 4LSTL 3UTOA 3ILPA 3LKRA 3UIYA 2IAMB 1GZHA 4DGIL 5EU3A 1TJGL 4FFYH 2WM0A 2GJ6B 5HDBE 1FNFA 3O9WB 3RB5A 5DVKA 3WIHH 1LEKB 1R3JA 1DBKL 3O2WL 3RBZA 3FYIB 3SCMB 3VTAA 4HGKC 1L9PA 1I9IL 3F5HA 4HAGA 3KDMA 3NCXA 2Z8WC 3RX9A 2EIZA 2HLAA 1FZJA 3FU7B 1KSRA 1P4LA 3GGWA 1ZTXE 2JKVA 2QSTA 1YVLA 2RCSH 5EB9A 4HULB 3M0DC 1I8LC 3ASNB 3VXUA 1RIUL 1YEIL 3BPNB 5DXWA 1XF2A 1NGQL 5F7EL 1TZGL 1EO8L 1S5IL 1LMIA 4IKNA 4LLMB 4XN2A 4Z7QB 1IT9H 5EA0H 4DP2X 2EYRA 1RPUA 1PMYA 4K7PY 2OMBA 3W56A 4QTIL 3ASWA 4L1SA 1UENA 4LCIL 3V5HA 2V7NB 3KQGA 1DL7L 1S7RA 2CLRB 3CC1A 1U8OB 2UXFA 2COVD 3TO2A 2FJGA 2IADB 1F3RB 1CFBA 1OTUC 4QMAA 1PLCA 2HTKD 3KPSE 5E2TL 3QIUB 5FK9B 5I1JL 2XY1A 5MENE 3H55A 2P58A 2XUWA 3P9LA 5DMIL 3S5LG 2GITA 3EF7A 4J1UB 2C9LY 4AQ1B 4Y4FD 3A0HE 1QFHA 1ETB1 2ERJB 3ZKMD 3I2CH 2FYNB 4GKOA 5CZXD 3W81A 1EZUA 2E7CA 4PR5B 1W6WA 1QNZH 1NCCL 4BQ9A 3MJ9H 4LLAA 3U4EA 1ZDSA 4ZS7H 4PV8A 4RGND 1O9ZA 4TVPD 4XX5A 5L9DL 1C5BH 4S0HA 4NQCD 1GC1L 1ZW0A 3GBDA 3GSWB 3U2IA 4PRAA 4QOKE 1T0MA 4PBXA 4L4JA 4EI5D 4KX8A 3HUJE 3ECUA 3OAWA 1NCBL 4J2QA 4J4PD 4L8BB 1DQIA 5CWSB 4RMSA 2ZFCA 2VDPB 4KTYA 1WLHA 4P46B 3TSIA 1GL2A 1NC4D 3D85D 1C1EH 4O2CB 1T5WA 3GMMB 1XH1A 4ABWA 3BQUC 4BHUI 3ZSTA 4EI2A 2NW3B 3BLKA 2R8SH 2AEPL 3GHGB 3HUJB 2G9KA 2DEWX 2GSGB 4LAQH 1C7SA 3ARDB 3OZ9H 2BM3A 2C3GA 4M00A 4N9GA 4AQ1C 2BSTB 3TJEH 1XCWA 1AQKL 1MSPA 5F7NC 3PHOB 3DV6A 1I3GH 3D3VD 1IU1A 1H19A 1PZSA 5I0WA 1RUMH 4DVRL 5DJYB 2M3BA 3KPRA 4HSQA 3ULAB 3WNLA 3QS2A 3T77B 1JVOA 2DWEA 2VDPL 2NY7L 1OCOB 3DTUB 1ID5I 2VDML 5IJKA 4BRYB 3Q6FA 5KJ4A 5CF3A 4PRID 1ZJBA 3ECVA 4KZCA 3FT4B 2GPZA 1ZR4A 3VMPA 3L6FB 3B5TA 2VDQB 2BZDA 3ARFA 3OKNB 2R2HB 4LSTH 4P23C 4AMXA 2Q6WB 4UQ9A 2VZSA 3ZLQC 5DYFA 1MCCA 5L2KD 1NTME 2CJTA 3QJSB 5DMJB 3OMNB 2DQJH 2IFNA 1U4FA 3PJSB 4GDOA 4CL7A 5IVZA 5HGDA 4MCYA 3SY0B 4AGQA 3NZ8B 2ZYSA 5F7KC 4PJ8A 4BFKA 4HLEA 1BJ1J 1B0IA 4XXDB 4Y99C 2MPAH 3K71A 1G7JA 4QRUA 4ELMA 3D50A 2APWA 5FKPB 1CW5A 2YMYA 1KB9J 5HPMB 2WLLA 3RVVC 2C1OA 3LJ3A 4JRXB 3X13B 1BYNA 1ZA3A 4RZKA 3H1ID 1EGJH 2XQYA 4OH2A 3BCDA 4TSBL 3ZGHA 3B7TA 2YKLL 5I76A 1XGZA 2H3KA 4JZNB 5EC1A 4JJ5A 1N0XL 3IBEA 3OKLB 4Z7VE 4U3FE 5HXMA 2Z31A 4AYID 3GLMA 1PZDA 4OW6A 4ATTA 1GGTA 3S3PA 3H42L 5D7JD 3EUDA 4NYLA 4M1DH 1YUKB 2VSKB 4I5BB 5GGSB 3VSUA 1DJWA 1ZV5A 1A4BA 1OXYA 2NT0A 3GMOB 3PGDA 1S7UA 4GKNA 3ZK0A 1G7IB 4GI6A 4S1DD 2LVEA 2D3VA 3O45B 4RX4A 2IWGA 3MNVA 1MCFA 1JHLL 4XNBA 3HNSL 5D7LB 4KPHL 5CCKL 1FNGB 1L5GB 3HVDA 1RLBA 4MB1A 1XD1A 3BWAA 3NJLA 3EOTH 3KGTA 2A38A 3QJHA 4QRTA 2JIXA 5HGBA 1RKRA 3GK8L 3BFWA 4G1MB 3IDYB 3S5YA 3QUYC 4GOSA 1PQZA 4ZFGL 3LQZA 2Q9OA 3T8MA 2WYIA 1VFUA 1EDLA 2ZICA 5H8DA 2XU9A 4KBPA 4PGCB 1I9IH 1GCYA 2IMNA 4LLYB 3GBNL 1U8NA 4FQCH 3AFLA 3QARA 4TNVF 4WF7A 5TQ2H 1M8OB 3HE4B 4IL6X 2I9LB 3T2OA 1D5MB 3B2VH 3Q2CA 4MAYD 2YKPA 1MJ7L 4S0TD 5JW5A 3DX3A 1PAMA 1VZGA 1LDPH 5DJ6A 5KBNC 2PCYA 3EDDA 5CEXB 1EC5A 4YX2H 4JPKH 4K71C 4PD4D 3FQRB 4OCRH 3LRHA 5EHFA 4APXB 4AQAB 3AE8C 2CK3H 3B71A 1KFMA 3AU1A 4Q0XH 4MD5B 4M93B 5D7KD 1OW6A 2AEOA 2NY0C 5ICUA 3D0VB 4IBTA 2E74C 3NJHA 1SQVK 4AYMC 5F7LB 3WKNA 4Z8FH 2V4LA 2R0WL 3ARGC 1FFPB 2XHNA 2BSBA 1EHKB 1HSAB 1T6BX 4KO6A 4WKZA 5IEKA 3NGBB 3LEVL 2XN1A 4XPBL 2C34A 1JUNA 3NZSA 1UM5H 2A83A 5GSVB 4KJYB 4UINH 1HXKA 4JO1L 4LCYA 4OY9A 2IBBA 2FO8A 2Y23A 1DBJL 4N2IA 4OCWH 3FB5B 2IAMA 2R27A 4MFHA 3PRZA 4D7PA 1GK4A 2DL2A 2F58L 3OHXC 3OSVA 4MASA 3TCLB 2KUTA 2NPLX 2NY0D 4E9VA 5I8OL 5H2FH 3A7OA 2FD6L 5FYJD 1F42A 4A2FA 4G8GA 1YECL 4HIXH 3WN5C 2LKMA 3LRSB 2ADIB 3R19A 4RFNC 3V6ZB 4CU8A 5C0DB 5JHAA 2CPUA 1UUNA 4ZTOL 5IM7A 4XVJL 5IG7A 4UIKH 1N2RB 1Y6MR 1P4LB 3GGWB 3ULUF 1ZK5A 4FFTA