5AW8B

Kinetics by x-ray crystallography: e2.mgf42-.2rb+ crystal
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw8B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw8B02
4EOTA 1A02J 1H88A 2YNYA 3OAKA 1HUCA 3V4WA 1NWQA 3TNUB 1HBWA 3KQGA 3P32A 1S9KD 3WGUB 5APXA 4JYCA 3KDPB 1H8AA 3L37A 3UIAA 5AVZB 3NFQA 1FAVA 3A7OA 3TK1A 3VMZA 3M06A 4AYCA 1FOSF 5AVVB 3A3YB 5AVRB 2WPRA 1GK4A 5AVXB 4C7NA 5APWA 5AW7B 2Q5UA 3LIDA 2N9BA 1DH3A 2QM8A 4I2LC 3M9BA 3P8MC 3TNUA 3O8ZA 5AVUB 3L36A 3B8EB 2IPPA 2R5BA 3M9HA 5APQA 5AW3B 2R32A 2WTYA 5AW2B 1HWTC 3HE4B 2JJLA 4C7NB 4AQRD 1CSBA 2WWWA 2VRSA 5AVTB 1OXZA 4HYTB 1GD2E 1CI6B 1MUUA 3VYIA 3M91A 1T2KC 5AVWB 3NXSA 5AW6B 1GU4A 2C9NY 4AUWA 2YO3A 3VMXA 3HTKA 4GKGA 2XU6A 2C9LY 3MD0A 1SP4A 3HE4A 1NAFA 3A2AA 5AW9B 4DZOA 3TYYA 3VMYA 1GTWA 2R3CA 2ZFCA 1CI6A 3L35A 5APUA 1A02F 1J2JB 1GU5A 5AW0B 5CMZA 3HE5B 3SWFA 5APSA 4B86A 1GZLA 2Q3IA 1G2CB 2YO2A 4KHXA 3MGNA 3M0AA 5AW1B 2KP8A 1OWAA 3VN0A 1HJBA 1YYCA 3I5CA 2ZXEB 5AW5B 1JNMA 1SLQA 3M0DA 3A5TA 2E43A 2BASA 2E42A 3HE5A 2P67A 3IR9A 5AW4B 2W6AA 3NMDA 4RESB 2R5DA 5AVQB 1IO4A 4GT1A 4I6MC 3WGVB 1MV8A 4M3LA 4RETB 5APTA 2P2UA 2H7HA 1T2KD 1JUNA 2W27A 3T97A 2Z5HA 4C46A 4LC1A 2WT7B 5AVSB 2Q7CA 3NTNA 3V4QA 1FOSE 5AVYB 1KQLA 3V5BA 3P7KA 2Z5IA 1CZQA 5AW8B 1MFZA 2XV5A 1X8YA 4XE5B 2WPQA 3VTPC 5APYA 1S9KE 1H89A 2WT7A 3LIEA 2P7JA 5APVA 4JYBA 2QM7A 2XZRA 2WPSA 1GK6A
chains in the Genus database with same CATH superfamily
1MQKL 2IANB 2N7AA 1UQSB 5HHXH 5SWSA 2OP4H 4JJ5A 4P06A 2ZSWB 3KDPB 2H6OA 4HPHA 1HINL 3BVDB 1CGVA 3GHGC 1FI8C 1CGWA 4PJAA 1UENA 1GL4B 1DQLH 5DWUH 3VTMA 2XVGA 1AQTA 1QAWA 3LNFA 2YZ8A 3MGAA 1J1PL 2V8MA 4BEIA 5DZ9A 2OTUA 3RUGB 1XIWA 2H41A 1BHGA 2VM3A 3U7YL 4G1MA 3UIYA 3VI3A 4HWBH 5J6GA 1NBQA 1IGCH 1VHPA 1LJ2A 1BM3H 2HJKB 4D6TE 1JNHB 2XXFA 4PJ9D 3IMVA 1KXTA 4Y2OB 3MLXH 5LNEA 2DF3A 1I75A 2PUQT 3VMAA 2Z64C 4S1RH 1F1GA 1G1IA 2HJFB 1E5WA 3OXRA 1TTFA 5D4QA 4Z7WF 3GUTB 2IQAA 3VVVA 1YN7A 5CJ4A 5KKZB 1PAZA 1M1KQ 2KZKA 3S4SA 3SCMA 4JREC 3IMBA 2RALA 3BUTA 1OVRA 2IFMA 2AS5M 2KQNA 5C0NC 2A6IB 5L2KD 4H5SA 3TBBA 2X3AA 1U41A 3CHXA 3SE9H 2WTOA 1PJ9A 1OCCB 3EHBC 4PRHE 3V0EA 1CFVH 1CXIA 1MKMA 1A8ZA 4IIQC 4MNQE 4DESA 4LFHG 1A6VH 5F97E 2B9BA 4PP2A 1Q9OB 4G8IA 2X6CA 4L5FH 2JLPA 4OLXL 4FFVC 4QTHA 3BD3A 3DGCR 3AB0B 2MJWA 2K1AA 4B41A 2P5ED 5GGSB 3FQWB 1QL2A 1VL2A 1E9OA 1CYWA 1XGZA 5BV7L 3QJOA 1EVTC 1RZGB 3OJVC 2R4SL 2X70B 3GJFB 1KULA 3IVKA 5E6YA 2FQEA 4Q9RL 4G2AA 4J3TA 1ZPUA 3J2PA 3VXME 3FRUB 1EJFA 1S3KH 2OYMA 3GTVA 4E42B 3TGUE 2XWTB 5A43C 1BV8A 3EYUH 2P5PA 1HJBC 5DJ6A 1AE6H 2B4CL 3LSOA 4PJHE 2RBLA 3DI3B 2JB6A 4MRBA 4QYOB 3TFKD 3VFRB 4HKJB 5GS1A 3OPZH 4GXFA 3BN3B 3IGFA 3S36H 5JHDA 4WO4C 3OR7A 1KUMA 2XXGA 2EKJA 4XNDA 4RMBA 3HMXA 3EOTH 2QGBA 4XI5D 3I3DA 1KOAA 4EI5D 1D6EA 1XGYH 3FXIC 3LQAL 4XP1L 3MN8A 4JJ5B 4M5TA 5SWSB 1OOWA 4LOUC 3VNZA 2VQTA 1DX7A 4BE6A 5KJ4A 3FU7A 3SEPA 1T1XA 4PJEF 2MCAA 4PJAB 4TRPH 2WXHA 2P3YA 4BWTA 2KPNA 4AVHA 1J10A 1H88A 5AZ2L 4P05A 4YPJA 2HODA 3TT3L 3BCDA 3NIDE 2OTUB 4GEIA 3VI3B 1XIWB 4AIEA 5J6GB 4G1MB 1SLVA 4G6FD 4XB8A 5DRXA 5A2CA 4EI0A 3P4NA 5D6CA 1KXTB 3DPDA 4JQIL 3LNEA 4JFDE 1FO0L 3SKJH 5EZLA 2YMXL 5BS0E 2B59A 5C0DA 3OXRB 4OAWA 2ZONA 1UA7A 5DJXA 1YN7B 2OYOA 2E5EA 1JPTL 2Y7NA 2C8NA 3S4SB 3HNTL 3SCMB 2WCSA 4RFNB 3BH9A 3MUY1 1Z0NA 3TJEL 3AS2A 1KB9K 2F1AA 5CCKH 5DS2A 3BAIA 2EXWD 4HBCL 1IGYA 4H5SB 1N26A 2YAPA 2QBWA 1IT9L 2BS9A 4CVUA 2VO5A 5IMLA 2EDKA 5IBTL 1NGZA 4JBSA 4JANA 2A9ML 2QE7H 3TNMA 3VAEA 2VLRB 3BP7A 5DUBA 3A24A 3HG1A 2OYHA 4BWWA 4G8IB 4HLZG 1FV1A 2X4TA 4QTHB 4UYQA 1UD2A 5CWSA 3HC4L 5DD5H 3K6NA 4IU3A 3MRBA 3OKDA 1XXFC 3TYGH 2AC0A 3IDNA 2V7HA 1G9NC 4GRLC 4RBPK 2D7MA 1RZ7L 1E9OB 1L0NK 4WKZA 5D5MB 3V55A 2CZNA 3RK2B 2XPYA 3BEWA 2X4UA 1HI6A 3IVKB 3EDKA 2FO8A 4PJ8D 5I23A 3GTTA 1YNTA 3CN0A 2C4XA 3EW3B 1NCDL 4QRBA 5KSAD 3T2NH 4GQ9L 3WL9A 4EBQH 3KLQA 4KKAC 3P2TA 2YAHA 4P2RE 3GYRA 2BASA 5DJ6B 2BVUA 2YD0A 3BVWA 1BD2A 1EJOL 1WEJH 3LSOB 4YBQD 1OARH 3GSOA 3MMEA 4M3LA 2NPSC 1T2QL 2JB6B 4K3GA 1GR7A 1VQ6P 4JPZB 2NUTA 3EDJA 4L76A 1DVXA 5GS1B 2NY2B 5D7EA 4WFEE 1XHHA 4BFBD 5JHDB 4XOCA 4XMKL 3VG0L 1CTMA 3OR7B 4JY5L 1VZGA 1PG7X 1RVFL 4IHOA 3WD5L 4EIBA 1NTKK 3QDJA 5G4NA 1XMEB 1VIWA 3FU7B 5HJGA 2QKIA 1PFIA 4OWFA 3BAEH 3HUSC 4O5LL 3PH0A 1CE1H 5AB2A 5JNYA 2EEDA 4LO9A 4LASL 2LAAA 4X99A 4D7BA 5ADOH 4CKVX 3WNNA 2HODB 4HD5A 1U0QA 4IFFA 1X5HA 2E27H 2BSBA 4QXGH 5DRXB 1NAYA 2ERJB 3BO8A 5D4JA 1XZ0A 5D6CB 2I1JA 4B53A 3SGKC 1O7DC 5I24A 3EJYD 5EZLB 2B59B 5C0DB 4NXSA 4OAWB 5DJXB 4K9EC 1INEH 1Q1JH 3KPLB 3FH8A 4WHDA 3VW3L 4WI3A 1EZVY 3BH9B 1OAJA 5LAPA 2YPVA 5AVZB 1TQBB 5GRVL 5JDSB 3W0WA 3CU1A 4UBDC 1AFVH 3ZR5A 5BRPA 4KJPD 1KZYA 3AG2B 1IGYB 5K9QG 4MYWB 2AJZA 1KPRA 5IMLB 4HH2A 3QNYA 2OYIA 1NGZB 2PABA 1ES0B 4AYEC 2NCMA 3BP7B 5DUBB 1JM0A 3HG1B 2OYHB 1MKFA 4OLZH 5IVXF 1FV1B 2X4TB 4HHGA 4HA1A 1E3ZA 1SOKA 5CWSB 1WZ1H 4N5EC 3MJ6A 5GZNA 4C7NB 4IU3B 1G7JA 3OKDB 2JKJA 4P2QB 1YNLL 4MD0A 3RI5F 3IDNB 4WI0A 1JSYA 4Q97A 1BIHA 1FFNA 4I4WA 4IRJC 1UACL 4WKZB 2I5YL 3DXAA 2QJKC 1F2XK 2BDNL 2W0FB 3BEWB 1L0LK 1HI6B 2X4UB 4PR5A 4FEMA 2GTWA 3HTKA 1YNTB 1VGEL 4DT2A 3JTBA 3WL9B 2BJML 1VFMA 2JLLA 3T3PF 3LH9A 1HCYA 2HH0H 1KTMA 3F7KA 1K05A 3L75D 1FHGA 2WZPD 1BD2B 4K2UH 2OMYA 2W80C 5G4MA 2KBGA 5IKCA 3GSOB 2JELH 3MMEB 2MWCA 4HF5H 5EZPA 3TO4D 2NUTB 4H20L 4CA4A 1DFBH 5MEQA 1QSEA 3QWRD 3PP3K 4FQ1L 1EVUA 4LHUG 4B7IA 1ERNA 1ET5A 3W68A 1R19A 3K8LA 4U7MA 4NT6A 2VH5H 2V5SA 4IHOB 4RESB 1OEZW 1WGOA 4FA7B 1Y47A 2AJXH 2E76D 3H1LE 3QDJB 5A40E 5IWLC 2ZWLT 5SX4I 2CRIA 2QKIB 2CUHA 2DRUA 2QEJA 5HGBA 4XNZC 3EG9A 5JNYB 2NZ2A 4X99B 2YPLD 4E9WA 1H8LA 3VSTA 3Q8BA 4P2OC 3AE9C 3FN0H 4P4KD 5EUKA 3OB8A 1FL5A 4YX2L 3SBWA 2O4EA 1FJPA 3VP8A 4MAYD 2XOTA 3BO8B 2ENJA 1XZ0B 1RF1A 5LO7A 1BFVH 4KFZC 3K8MA 5DGQA 4M43H 4Y19E 3W9DA 2ZYGA 4Y5XC 3SIKA 1JRHI 4G7SB 2ID5A 2AEOA 4KROD 4S0SD 4NIYE 2WY3B 4W9IC 4M7LH 2WXRA 3CWGA 5D7IA 2FT7A 3JYCA 1MFAH 1MFCH 4HP5A 1NEZA 2D2OA 3LIZH 3W0WB 3VXTA 1F58L 4PP1C 4ZQKA 2OARA 1DQML 5IBLC 2AJZB 1KPRB 3ULVL 1HUCA 2ATAA 3MACL 3QNYB 2OYIB 1V3KA 1NJIQ 4PW3A 3I55P 1KEMH 5HJBA 3ARXA 5CGYC 3BVUA 5JHLH 4HJEA 3L5XL 4RCAA 4LSUL 1AH1A 1XTLA 5DI8A 1SS1A 4S10A 3QSKB 3EJZD 2CJSA 1Y1UA 1G7JB 5B1BB 3RNQA 3A4EA 1DJYA 4MD0B 1TF4A 4WI0B 4NZRL 3MV7A 1R3LA 1FFNB 3MOAH 2LGNA 3WN6A 2HFTA 4OGXL 4UTCA 1XGQA 5AUMA 4E68A 4HMDA 4UQ3A 5MERA 5AYUH 3L3OA 3HA0A 2EDBA 4CPGA 2FO1A 4PR5B 1AZCA 4K94L 5IQ9A 2GTWB 3HTKB 5D55A 5LCVA 3VFWA 3F01A 3N04A 3ULUH 3UABA 4POUB 2BRRH 4YL4A 5IVOA 4IRSC 5E6IC 1LTBC 2NZIA 3S8FB 4WI7A 2OMYB 4PG2C 1IFIA 4PH8A 5IKCB 1CG9A 2VXSH 3D05A 5J1AA 3EBAA 3V5HA 1HYRC 4QAMB 4F5CE 5MEQB 2PWEA 3S9OA 4AW4A 4DQOL 2ROXA 1CI6A 2BM3A 4NT6B 1DQDH 4YE4L 4PLKD 2GI7A 3B2XA 2OKMA 2ZYIA 2AEJA 4G6AC 4RGMB 3UC0L 5JZ7C 1Y1DA 3K2UL 5D7HA 1IZKA 4IBUA 1KBWA 3CI9A 4F1SA 2VQ1A 3MTXA 3MCLH 4DZBA 1OTSC 5JW5A 2PFXA 3EG9B 3W39A 3EXJA 1QFWH 1SBBA 4CILA 1CL7L 2J21A 4Z1MH 3CUPA 3NEOA 5ANHA 2FB4L 1TJGH 3D9AL 5EUKB 2K6WA 2YJQA 1PNDA 15C8H 5I1AA 3KZIH 1FL5B 1TQSA 1I8LA 3WXVH 3CLEL 3PWNA 1UWFA 3E0GA 2BOLA 5DHVA 1RF1B 1PPJG 2O5NA 1F4AA 4PIBA 2V5MA 5E9DD 5APTA 4K7PY 1XCWA 5KLIB 3W9DB 1DVSA 5JIHA 1YECL 1MWAL 4PV9A 1QI3A 2P49B 3BD4A 4L23A 2ENSA 2VDML 4LMQE 3WLBA 1EIBA 5D7IB 3FB6A 3L72J 1WLHA 3S5LG 4V1DB 1GGBL 3M45A 2ZG1A 1NEZB 3QZWA 5DHDA 3H1IJ 3S9DB 2AEFA 4XBPA 4DFHA 4ORGB 1A25A 3VXTB 1NGPL 3D33A 4F8QA 3C60D 3GINA 1QLEL 1MZZA 2YBGA 4JCMA 4ZQKB 2WW8A 3QCUL 4IK7A 3SE3C 1XSJA 4Q8BA 2HPTA 4M93B 5H37H 4KZDH 1IGMH 5KANI 3AAZA 4J3WA 1CGTA 1L4AC 2KLVA 1QPPA 2GK2A 2WTRA 3A6CL 1T2XA 1RF0A 2JKXA 5C9JA 4HCRL 2A77L 3BUBA 5E4EB 5DI8B 4PGBA 1HQ4A 2FE0A 3RNQB 1N6VA 5DVNA 2IH3A 3P77A 1QRNA 4WUKL 1EHNA 3MV7B 1F4YL 1R3LB 3X1FA 3CCMP 4OCRH 4WY4A 1DL7L 2EP6A 3QEQE 5D8JH 1XGQB 5AUMB 4ZRGA 4UQ3B 4PS4L 1N0LA 1PGOA 4JYCA 1RZFL 3WGUB 1PFCA 3L3OB 5CBAA 5FKAA 3CZSA 5C09D 5BPPA 5IQ9B 1MF2L 3NTCL 1U4FA 1V3LA 1F45A 2H32H 4PJGF 3VFWB 4PEEA 1YNKL 2P1YA 2XKMA 4Q89A 3UTTE 2WPRA 2XBDA 1T22A 2EC9U 2PW2A 3QPQC 4NUJA 1ZLSL 3C6SA 1CXEA 2QSQA 4FL4C 3UAJC 4X7EC 4MA7L 4ZMZA 1CG9B 1WZMA 5I15H 2CMRH 2E56A 5J1AB 5ISZD 3V5HB 1KENH 4XP5H 2ILLA 3BSZH 4IMKC 2K45A 3WUVA 3RQ3A 1HXMA 4OUOA 1CI6B 2ZCZA 1GL2C 1X3DA 3GEFA 3T8XA 2ZX6A 3AE4C 1YEFH 2J6EA 2VZOA 5JIQA 1HGVA 1GA2A 4AOFA 3UBGA 4X6CE 2Z8VC 5ADPH 3MRRA 1FNHA 1JDDA 1MEXH 3FKUS 2VQ1B 5JW5B 4HEPG 1AZUA 2VDQH 3W39B 3LNDA 4LQFH 3A0BE 3CUPB 2WJ5A 4EDXA 2EH8H 4B0MB 2ZZUT 4QRRE 4DGVH 3L4XA 5I1AB 4LPUA 3R0NA 1F4WH 1J0YA 2H4EA 4FABL 2CO7A 3PWNB 1FN4A 3KWXA 5DHVB 2XWDA 3V2QA 5F7EH 4A66A 3I5CA 1UWGL 3IMSA 4NO0D 1HCZA 3M7FB 2PN5A 2ZT9D 4OFVA 1I8IA 4Q6YA 3VQMA 4JRYA 5BUAA 4PV9B 3PHLA 4PY8I 3SQOL 5BVZA 1BXUA 2WXMA 3VH8G 4OM1H 1S5LX 3WLBB 2EUVA 3FB6B 3N1GC 3GMQA 4P4RA 3BKYH 1VQ5P 3PE9A 3QZWB 2H26A 1BCIA 4XBPB 3PFUA 4JFDA 3MUDC 4R9HA 4XNYL 5GISH 4OY9A 2DWEA 5H37G 1M1JA 2J55A 7CGTA 5JOFA 2C9PA 5T3ZL 2AJYH 4KHXL 1RP8A 5A6IA 1X0TA 2LKMA 3AAZB 3B8YA 1JTOA 3T2LA 3U0PA 2EO1A 1MJ8L 3DX8A 5GGTA 3AEDC 3KPRA 2WTRB 1CDGA 3HBGA 2HB0A 4U31A 4BZ1L 1W72A 1YEIH 1WCQA 4PGBB 1RHZB 4UZGA 4YDVA 4WGKA 1HQ4B 3ZDYE 4ELMF 3ZHFA 4FQXD 1TQWA 2IH3B 3GSVA 3P77B 2DI8A 4PCTA 4XXCA 3U4BH 3ZYIA 4G9FD 4AC2A 4WY4B 1RSFA 1KACB 3D3VD 5E95B 1N0LB 4L2LA 3AG3B 5CBAB 5FKAB 4ABVA 3RKPA 5IOKA 3TZVD 1EHLH 4IGBC 4M7KH 1A3QA 2C34A 3EJSA 3LN9A 3HKFA 2WIIA 1T22B 2YD6A 4LHJB 1UZ8B 3HC3L 1CFNA 3C6SB 3PDGA 1Q38A 4CC1A 2DTML 4GQRA 3TA3A 1YEWA 5J1TC 1UTDA 2YSSB 3FW6A 1KV4A 4U0QB 1ZVNA 3TIEA 4JY4A 1B4JL 5I0WA 5HDOA 3DSFH 2RD0A 3L16A 3QFJD 1HXMB 1NFAA 1R6VA 4P2RA 4WWPA 3T8XB 4Y1SA 4LIQH 4OQTA 3JTTA 2FBJL 5GGQH 2BSEA 3MFGB 3WIHH 4UB6E 5KLVE 3KWTA 2HVJA 3MRRB 4XNAA 2WTYA 4U6TA 1QW9A 4KK5D 4L8SC 5C6TH 1XQ4A 5GRYA 4KH9A 4U1KA 1VPCA 1EXJA 2BSCA 1P84E 1EXIA 3LKQA 4CDGC 5J13B 3PAVA 3C8KA 2XPZA 4HBQA 5IW1B 2XQYA 1TZOA 4EDXB 5KSBE 1C5CL 3P02A 5E9NA 3WJJC 5DZOA 2J8HA 2CO7B 1FN4B 1QR4A 3UEQA 4ZUTA 2CIKA 3WFDH 1A22B 4JZNA 3DJ9A 4GFTB 3A4DA 3DGDA 4K4KA 4K35A 4ZZKA 2DPKA 1X7SA 4JRYB 2ZG2A 2O6EA 3H1KE 1BDDA 2BWQA 3BEVA 4TMPA 1T03L 3BDYH 1X44A 2CBQA 4HFUH 1A21A 3NIDB 1LO0H 4RMUA 3UP1A 1XF5A 3B9AA 1LXMA 3GMQB 4P4RB 4NO2A 2V6HA 1MRDH 2FYUJ 2K6YA 2DWTA 5TH2A 4DH2A 4JFDB 3CMEP 1JERA 2H6UA 1M1JB 1OTUD 3OHMB 5IW3A 1G9MC 2BNRE 4AQAA 1FH5H 2V4HA 2Y3NA 4CN6A 2EDWA 5JOFB 3LRKA 2BPBA 1WC7B 4ZMNA 4X8XA 2YLKA 1ZA6A 2DH2A 5T1KD 3U0PB 4KI5E 1OP9A 3DX8B 1A6PA 1RMFL 4DO5A 3GK8H 1IM3D 1W72B 1NKNA 4YFLF 2BHUA 3ZDMA 1PZ3A 3F6IA 3C12A 3GSVB 1M3IA 5BQDA 3VXRE 4BQBA 5KVEL 4JX0A 4JM0A 2MCG1 5IR1A 4NQXA 2XV6B 4MKMA 3TSIA 1NLBH 1P5UA 1OVZA 1FC2D 1NDGA 5EN3A 1MXDA 1PIFA 4XBEH 3X1EA 3OM3B 2HSIA 2GSIA 3PGCA 1CZQA 1OAYH 3HN3A 2WIIB 4AY0A 4OIFA 2M26A 1CFNB 3LY6A 5E1HB 4N2GA 4K8RD 5HHXL 3TA3B 2OP4L 3TH3T 3EF7A 2EYTA 3GKZA 5F0LB 1JYWA 4DT0A 3DUUB 1IAOA 2UWEE 3TIEB 4JY4B 4DN3H 3QPXL 2QA4P 1TCMA 4JKPL 5DWUL 1OCWH 4P2RB 4ERSL 5IFJB 4LP5A 1IVLA 5DQ9A 5EFIA 1UGNA 5IEHA 1SNRA 4YLBA 3NT0A 2HT2C 3JV6A 4HWBL 3KVQA 1BM3L 1BG9A 2HVJB 5CKGA 1M9WA 2PXYD 5CIPA 1BGXH 4HJ0C 2EVFA 4U1KB 3MLXL 3O2DA 3PWVA 3LKQB 4NWTH 3KHUA 4NNPH 3CSTA 3C8KB 3D1MC 5GJSH 3ULUF 1HZHH 1RP9A 2PP9A 4E9YA 3P8CE 1J8SA 1URIA 5I8KL 1N73A 2FCBA 1IB5A 3AGVA 3S37H 1BAWA 4ODUB 5FYLH 2PNDA 5LBGA 4ZUTB 1KYUA 2CIKB 2IFNA 4GH7B 4JZNB 2DM2A 1V7MH 4IOIA 2CXKA 2JH2A 5TDPA 3BEVB 1SXAA 2RR3A 3Q5TA 3VSUA 5IQLA 1XF5B 5B5EE 1A6VL 4NO2B 3WKMH 3R8QA 4UIKL 5LG6A 2Y0SA 4PRIA 4G7QB 4GBXD 2DQIH 5BOZG 1D7FA 3H6PA 4AQAB 2GC4C 4BSWA 5FDWA 4PV1B 5I1GH 3PTZA 1ZA6B 1VQ8P 2E75C 4FI7A 4UQDA 5ACZA 1SQBG 4WFFE 3FPXA 4LSDA 3ZE2F 3C8VA 4AM0Q 4KQ0A 3T0VA 2Z7UA 3EYUL 4H44C 2KL6A 3MR9A 5I74C 3SY0B 4ANWA 1MDAA 2DBJA 3M1BA 5IR1B 4NQXB 1L9NA 4X5WA 3WGVB 3KGTA 1XO8A 1FVDA 4XPFH 3GMAA 4Z3IA 1NDGB 5ID0A 4DSYA 5FLVA 1FNLA 2IBZY 2Z4QA 1AZZC 3OPZL 3QJZA 4RMRA 5CJXA 5FM5M 3K6SA 4UV4H 3PGCB 2GSIB 3S36L 1UHVA 3RGUA 2OS7A 3D71A 3FBKA 2C1OA 2OMTA 2JP3A 1NAKL 1U8IA 4HDIA 1P7HL 1PGQA 1JGUL 3LMJH 1MAMH 4OZIE 1JN6A 4Y4FC 5DJZA 1YSOA 5F89A 2EYTB 5MEND 2UXTA 4YZFE 1IAOB 4IBSA 1RHHA 3HW7A 2CUMA 3B3IA 4GOSA 1S7VA 2FYVA 3P4MA 1BVOA 1VLXA 2YQBA 3R1GH 4NCC2 2Y36H 3UJIH 3RVUC 4PJ7A 1MN4A 1XR8A 3MRLA 5IVZA 5EFIB 4JFUA 2RB8A 5IEHB 2K8QA 3A21A 4A6YA 4XCNA 3JV6B 1AYRA 3UPAA 5L2JA 4HJJH 4RAUA 3HPLA 4PJFA 5CIPB 3P1VA 3PWVB 3DJTA 3IFPA 2FXPA 3WEMA 3AY4A 4HZAA 2Q87A 5I6KA 2W88A 4I13B 1NHLA 2ORBH 4GIAA 1N73B 1EANA 3KBFA 1FDLH 5DRZA 4ODHH 1WRFA 3SE6A 4F2FA 1VADA 3OD3A 1X4XA 5DGRA 4ZK8A 3N41B 1G7PA 1ZEAH 5E8EA 3HD7C 5AVVB 2OBGA 4IOIB 5HHQA 3HAEA 1VPOH 3B2PA 2YARA 2PYFA 5D1XA 5TDPB 3TN0C 1R34A 4Z6AT 4XMUA 3EOAA 3K46A 5D7SL 2WKOA 4FEIA 4AEFA 4GRWE 1DJSA 2AEPH 3FSZA 4MCYA 2WM0A 4C57C 1EGJA 1YEEH 2DMGA 4PRIB 2N01B 5DD5L 4ONGH 5I1IH 2WSCJ 2BNUA 2HX9A 3C8HA 2CCLA 3TYGL 2EDJA 5FDWB 4BSWB 3N3EA 3ULAB 2NY5H 4Y4KA 1GGCH 2CDFA 1AQKL 5AD0A 1MJJB 2B5IC 4M6MH 4ICXA 4HOMA 1KQSO 3CXDH 3X17A 4I18A 2ZOKA 1NC4B 4FJ6A 5KANG 5C08E 4EBQL 1DDTA 4MDJA 2W0KA 3EF4A 2FUTA 3MR9B 1K73Q 3SWFA 5E6RB 3M1BB 2D0HA 1C1EH 2POHA 1WEJL 2D7PA 2WXLA 2B0SH 3BZ4B 5D7KE 3RJDA 1OARL 3LV3A 1FVDB 4NKIL 3QT2A 4X42A 5ID0B 3FHAA 3V7AE 2Z4QB 1U2YA 1WIOA 4EZLA 4NCC1 3K6SB 3V6IA 1JYVA 3MJ9L 2OMTB 1U8IB 3IWUA 1Y0LA 1JN6B 1PX4A 1PLCA 3SYAA 4MXQC 5F89B 1XFPA 5C07D 2IDUA 4PJXF 3AMLA 1P6AB 4WWID 1RHHB 5T8IA 3ZUNC 3B3IB 3FCTA 4X5PA 1S7VB 1HAWA 1UD3A 3UTTA 3P4MB 3WY2A 4UOJA 1JWMA 5ADOL 1X4ZA 1JL8A 1XR8B 3EBIA 2V9QA 3MRLB 4PJ7B 5IVZB 5C0ND 1WZAA 4A6YB 4XCNB 4G6KL 3IN0A 4QXGL 5L7XH 5L2JB 3EHBD 3L3DA 1OANA 3O45A 5ILTH 4RAUB 3HPLB 3DMMA 4PJFB 1HTLC 2VQUA 2UUDH 5CLZA 1YAZA 1O7VA 3QQXA 4HG4K 5FCUL 4N8CH 3IFPB 3QXTA 5PAZA 5HDBE 3GUFA 3KCPA 4G8FA 3QDGD 4A39A 1KJ2A 3RJOA 1Q1JL 3CWBE 1QQDA 1OFCX 5DRZB 4XWGH 1VADB 2Q3EA 1SHXA 1PCSA 1UZGA 1Z5YD 1G7PB 3BT0A 5E8EB 4CSTA 5J56B 1AFVL 4FNSA 2DL2A 1A02J 1AS8A 5JQHC 5HHQB 4GUOA 4N1HB 4LOVA 3DPBA 2PYFB 4YDJA 5D1XB 3V0GA 4PCSA 2A9BA 3P0YH 4M5YH 4N6RA 3IFNH 3EOAB 3F8UB 3TH4T 4I48A 4QMEA 1SMAA 4MCYB 4K5LA 3NH7H 4ALAH 3BE1H 3ZYZA 5EEVA 1JPFA 4YSRA 2BNUB 3NPSC 4MJIA 5F9JA 5APWA 1CYXA 2Y22A 4XPTH 3BZEA 5IB5A 4JZJC 4WI8A 2IX7C 1OPGH 1PY0A 4Y4KB 2KZJA 2DWSA 3V2RA 1Z0MA 2CDFB 3QIWA 5AD0B 2FYNB 1M42A 3T4AC 2VDKH 3CH1A 1HWTC 3O0RH 4K7PH 4MN4C 3CNKA 4I18B 4FAAB 3A47A 3GLEA 4MDJB 1G7HB 2HH0L 3QG6B 3EH1A 4M8UA 1P6FA 3ETSA 1RH5B 2BSTA 2EIZA 2WB7A 1X6LA 1PY9A 2ARWA 2FFDA 2FIRT 3I9IA 2DYRB 1N68A 2JELL 3LV3B 3NGBB 2D0FA 4HF5L 4AUJA 5JPMC 4TS6A 4JVPA 4GMTH 1PBYA 4LGPB 2L4OA 3A23A 2APVA 4IBYA 4XNXH 3LZNA 1G1YA 2ZICA 4XX1E 3U0WH 2ZCLL 5F3FA 3CCUP 1NIEA 1JD9A 5I0ZA 1X22A 2HFFA 4F7PA 1Y0LB 1C9SA 4YHKL 3SDDC 4AX3A 4DP9X 1WFTA 4ENZA 4H44B 1SQPE 3FCTB 5HYSA 1W2BO 2ZE0A 1NCJA 3K74B 4PRPA 4QKXB 1Q2NA 3UTTB 4F91B 3D52A 1K3ZA 2QVKA 5E7BA 1DEDA 3DJZA 3ABGA 4RSYA 4NUPA 1JWMB 4QF1A 4HWZA 2EIJB 2UVFA 4JN1L 4YHOH 3L71E 4IBLT 4RETB 1ZTXE 5KVGL 1CDYA 1QVOA 5KVDE 3L3DB 5DD3H 3MHZA 3O45B 5BVJB 3DMMB 5JQ6H 2N9YB 4KH2A 2NZ1A 1ZVSA 3FQNA 1AMXA 3PP4H 3CK0L 3KCPB 1TIUA 4G8FB 1KJ2B 1SJMA 4M7LL 1JZHA 3ZZSA 3IPEA 1QQDB 3T65A 1MFAL 1W15A 1MFCL 5BU8B 3LOWA 3QUKB 4KRMB 4F3FA 3LIZL 3CQPA 5EF3A 3T2OA 3PWPE 4WWNA 3DPBB 5H4YA 1BQLH 2LR4A 3Q43A 4YDJB 4XO4A 2GYSA 1H6FA 4N6RB 1AAJA 3VFOA 2WT7A 3SGEI 1KEML 1BXVA 3RK3E 5F1IA 4I48B 4QRUA 2NNCA 4JFFE 4GG6F 1SDAB 1O7SA 3WNJA 2MKVA 1JPFB 3PWJA 2V7NA 1VZIA 2QV4A 4MJIB 5F9JB 4FX5A 4N25A 3BZEB 4KDWA 3T5WA 5IB5B 1W2EA 3MOAL 2CK2A 2H89C 1EHKB 1VFOA 4FULA 5APXA 1FSKC 2P4AB 2ZUQB 3QIWB 5AYUL 3PWLB 4DTGL 2HLEB 5HYQA 1KXVC 3S36X 4D6TJ 5C0GA 3CH1B 1DEEG 3OW2O 4MAUH 2FECL 3FSVA 3U48A 5DU7A 3E8VA 4BUQA 3C5ZA 3AE1C 2ZD0A 1GIGH 2BRRL 1AXTH 3RVVC 5C2UB 3M9BA 2BOBA 1ADQH 3OF6D 3P4LA 2BSTB 2EIZB 5BRZD 1VRSA 1YJWP 2FFDB 1ZK9A 3FH7A 4Z5RA 3WUZA 2VXSL 4HK3J 4XT1C 4BK4A 4FTVA 4JMNA 2OXHA 3T3ME 4XZUA 3RYMA 1CR9H 3IDYC 1Y18A 1MFNA 2ZYRA 4KKRA 2QGCA 4BRVA 1UD4A 4YSOA 2HFFB 4F7PB 1DQDL 1RY3A 4QR7A 5I0XA 4S1DD 5HD8D 2LW3A 1F4HA 4TOYL 4EZKA 1NEUA 2XY2A 1OZUA 4G72B 2VDLL 4K0OA 4PRPB 3L72G 2XX1A 3GBLA 3MCLL 1TVBA 3EJCA 1XGUA 3FZUC 3NAAH 2W91A 4NUGH 3H1IG 5AW0B 2ZXDA 3QIUC 3QCTH 2VB5A 1GXEA 4QF1B 2AABH 3IXTA 1T1YA 1TJGL 4HWZB 1FLTX 4UBDD 4UF7C 15C8L 3INUL 3JCUE 4Z7VE 3RTQC 1TEGA 3PGFH 1OHZA 1QVOB 4ADJA 2E4TA 1ZHKA 3JV5A 4RGOH 3TGUJ 3K6IA 3MLRL 3IJ8A 4XAWH 4IRZA 3ZDZE 2HT4C 1QWUA 3ETBJ 3BQUC 1BFSA 2YAMA 4L4TE 1ZVSB 4QPEA 3FQNB 3Q5OA 3V9FA 4YHYC 5KS9A 3VFUA 1E8ZA 1HZLA 4NQCE 1A0QH 5IF0A 3KNBA 1OWWA 4N5ED 1LD9B 2E6PA 3BC9A 2GEEA 3T65B 5AAWA 4DIXA 3NP4A 4F3FB 1C16A 4EN3C 2W95A 1DJIA 1T83A 2ODHA 3S48A 3ISRA 3H0TA 3FRPA 4GO6B 1J18A 4DKAA 2QMJA 1FORL 3B2VL 3DVIA 3LNHA 3ZQ9A 1WCBA 2XTSA 1KJ3H 4KZDL 4AK2A 3VFOB 4LRIC 1A6WL 4KY1H 2WT7B 5E03A 5BCAA 1K4CA 1DDHA 1LO2L 5F1IB 4QRUB 3F7LA 1AZRA 1QPXA 1MIMH 3D69A 4E2OA 5IY5B 4LCCC 4I3SH 3P7KA 3PWJB 5GQBA 5GZOC 3PQYD 1KPVA 3B4NA 3GJFH 3PHOA 4N2MA 4IFDK 2QFRA 4HH8A 3NN8A 5DA4A 1BE3E 4OCRL 2HA1A 1JGVH 4N3UA 4ZW7A 4G82A 5DA0B 1T1WA 2GTZA 3W2DH 2WQVA 5HYQB 4OLYL 2B08A 4ABUA 2WD0A 5C0GB 4N0CD 3WO3B 2LVCA 3ULUD 1MFBH 4OIIH 1S9XA 3APMA 2GA1A 1M71A 3C5ZB 4MXVF 3AQZA 3GMPA 1CTNA 4C4KO 2BOBB 4NZJA 2MIZA 1YITP 1JNNH 4BK8A 4FXGC 1AGFB 5CHXA 3L4WA 4MS8D 4Z5RB 4IW4C 3NPSB 2CMRL 3C09C 5DJYA 1A1MA 1PP9E 3E3QC 2Y06L 4FTVB 4XP5L 3SKMA 4AVIA 2OXHB 4P2OD 3L08A 4BQ6A 4TTGA 1JE6A 3PU7A 4XZUB 5IV2A 1NC2D 4XTRD 5CEZD 1Y18B 5GS2D 1HHKA 2OI9C 4FJYA 2W92A 4P5TA 3T4AB 3HRZC 1UJTA 1K2DA 1WGVA 3D08A 4OFQA 3RX8A 3B2DC 4RZCA 4N68A 3WO4C 5ADPL 3CMAP 4GRMA 1I1CA 1TVBB 2VDQL 1XGUB 3E9TA 3QFGA 3UPRA 2VABA 4LK4A 4PJCE 3Q8FA 5KYNA 4MNQD 4OZIA 5CCHD 3HBZA 3IXTB 1T1YB 2XACC 1FJKA 5JO5A 3IFOA 2XV0A 4PP1D 4GKGA 1NUNB 2CHDA 2CQVA 3QORD 5IBLD 4DCKA 1ZHKB 3HE4A 1PSKH 5F7EL 4P5KA 4PUBH 3L35A 1B4TA 2F8OA 5DVKA 3ZHDA 1BOYA 1GU5A 5CGYD 5KS9B 4Y1AD 5APSA 1QYGH 4HS6A 3VFUB 4AIZA 3EQ2A 5IF0B 1OE1A 1JXKA 3KNBB 3QS3A 3BKYL 3VXMD 3RL2A 4XVTL 1NWPA 4FQQA 5CJ8A 1C16B 4LB8A 3TGUD 3VXUD 2JI1A 3RPKA 2FJSA 3H0TB 2QMKA 1LWRA 1WCBB 2AJYL 2CBMA 2FZ3A 3DETC 4GQZA 4PN6A 3TU6A 4I3GA 4KJYA 2YEVB 2IVFC 4HEME 1K4CB 2B8OT 4J3OH 2Z65C 3ZT6A 4IRSD 1KILD 5E6ID 1YEIL 3D69B 2VTFA 4D3CH 1P4IH 3VJ6A 3Q2NA 1KPVB 4U3CA 2NXYB 3PHOB 3U4BL 1EAPA 3NN8B 1QVGO 5I71C 2HZHA 1QHOA 1T1WB 2GTZB 5DT1H 1AVOA 4OQ1A 2AK4A 3AQYA 1RPKA 3MV9A 5D4IA 1ID5I 3DLQR 4PBWD 3KJ4C 1AKJD 1M71B 1FZOB 1ZDSA 3FQRA 4G6AD 2Q8AH 3SKOA 2BW4A 3GMPB 4G5ZH 1WBYA 1DE4B 1A6AA 4AEEA 1URQA 1J05A 1T6WA 1E65A 3AE5C 1IC7L 1OTSD 5C0RL 4ZS7H 1P4BH 1A1MB 1ZS2A 4GKLA 4HPYH 2ALWA 3HMXH 3SKMB 4XP6H 3B1UA 2V9TA 3DSFL 5IV2B 5BS0D 5GS0H 2Y6TE 1BCCD 4NM4L 3MFFA 1HHKB 4KT0J 4P5TB 1WFJA 2AEQH 2QZ5A 4JRLA 3KQGA 5JLZA 3R19A 3TONA 3O8XD 1K2DB 2F8IA 5E8OA 3IN6A 2WJ7A 1F3RB 3LPPA 1E9QA 4RZCB 4WI5A 4L75A 3BKML 1X5MA 4HXAH 1LEKA 5C6TL 4GRMB 3FQ2A 2W81C 3QZMA 1GK4A 3K80A 4R97C 2F54A 2GUVA 2FYUG 5K9JL 1R0AL 2VABB 2JJWA 2Y1ZA 1W5CE 4W68A 3L7FA 2OMWA 2YUXA 4OZIB 4J39A 5LQBH 4KZEH 1H15A 4DEUA 1ACCA 3RIKA 4OZGA 1WJ3A 5JO5B 3MLYH 3IFOB 1IQWL 5E6ZA 3BRVB 5BZDA 5LDUA 4EF3A 4ZMOA 4KKCC 3HE4B 3BGFB 1W8OA 1ZXGA 3WFDL 1Q0YL 4HYTB 4P5KB 1PU0A 1MUUA 1L4AD 3CC4P 1K6QH 3BPNB 3G5ZA 4DVRH 3ARFC 3LDBB 2ISDA 2QSIA 3QCVH 4HS6B 2F68X 3BDYL 5FYJH 4HFUL 4AIZB 1LO0L 2HUHA 4OKDA 2VZVA 3II2A 1MRDL 5EEYA 1LT1A 3RL2B 5F0MB 4FQQB 2BS8A 3RK3C 3DVNA 4PRDA 3HC2A 3QDMD 3PUCA 4YDIH 1FH5L 2FZ3B 1RIUH 1DFXA 2PLTA 4OJEH 4OUUA 1EQWA 3S8WA 3L4ZA 3H1LJ 4BQCA 3H25A 2APBA 2LV4A 3BISA 3QPQD 3T8VA 2FT8A 1DO6A 4HB1A 4WFED 3D12B 5IESH 1S7TA 3VJ6B 3UAJD 1IC4L 5I17A 1KBKA 1DQKA 1EAPB 3BMWA 2NY0B 5MHSE 2ESVE 2OMXA 3JV0A 3O9WC 2Z31D 4GRWB 1I1RA 1UT2A 2AK4B 1GL2D 2FGZA 2DI7A 2IMNA 4XBEL 2DAVA 1BPLB 1JG9A 1DN2A 3OG6B 1OAYL 3HBPA 3KDMA 3SKOB 4NFDA 2HFGH 1WBYB 2JKSA 3CSGA 3HG2A 5J8OA 3D51A 5JIIA 1A6AB 1URQB 1J05B 2BIHA 2OSYA 4WUUA 4B9PA 3NIFE 4Y4HC 4NO5A 2FHCA 4NKDA 3TASA 4PD4D 1E5ZA 1T0NA 5AYQA 4YEEA 3S96A 3TVMC 3RVXD 2RMZA 2Z5IA 4WFGD 1USZA 2O01H 1AGEA 2A38A 3H55A 3MFFB 2RKLA 2ZYAA 4ATTA 5JLZB 4W4OA 4LZKA 4OGQC 5E8OB 5EU5A 1KEGL 3MLZH 1E9QB 1QMUA 3DX0A 5GRXG 5APVA 3I6SA 4LSPH 1QASA 2VXTL 3ARBA 1LEKB 1KYOH 4WIQA 1BGXL 4TVPH 3US1A 5ITBL 2CKNA 2F54B 3C5SA 4NWTL 1F13A 5GJSL 5BQ7A 2NQ3A 3C09B 3L7FB 2OMWB 3T09A 3QG7H 1H15B 4Y0GA 4OZGB 1ODUA 3OG4B 3VGEA 3TK1A 5BZDB 3QISA 3S3CB 3JWNH 1LILA 3V4VA 5JYLA 2DS4A 2QEXP 1TDQA 4FG2A 4HS3A 1SM3L 5IGXH 4OH2A 1XGPA 4NX0A 4BHUI 4LPYA 3G5ZB 3CDYA 3NRPA 2YPVH 3DHMA 2PWHA 5M94B 1YEHH 5BV7B 2GPZA 2Y5EA 2N1TE 4WVZA 3HUJF 5KZCB 2G0LA 5T1MA 3U82B 1GD2E 3MRJA 2DQIL 3CCJP 2BIOA 4PRDB 2ZAGA 1PLAA 4ZD3H 5HDBB 1SN0A 2WQXA 3RUGF 4NIKB 3TS8A 3UG4A 4OUUB 1XAUA 4IGBD 2PYED 4NQSA 4QRFA 5E1AB 1JZ5A 1E4KC 2CNZA 3ASWA 4A7QA 1A7QH 2CRMA 1JWSA 2EICA 2R0WH 4KDTA 1S7TB 2X89A 4EMZA 2EDNA 2W9DH 4XN5A 4QO1A 4KX8A 5I17B 1B0IA 1J5OH 1GZLA 2R8SH 4BIKA 3TWYA 3VM7A 3L4FA 5FYKE 3V4UL 3TESA 1QATA 4LL1A 1A7NH 3FTYA 2CWRA 5C7XH 5IHLB 1W9XA 2P8PA 2WB1A 1VSCA 3LTVA 4UV4L 5KBKA 5I1LA 3KDMB 5CD3A 3U7WL 5GGVL 3LMJL 4JQVA 4G7VH 3S3PA 1G9NH 4WUUB 2FBRA 2Z9TA 3Q1EA 4XMWA 4NO5B 5D2LA 2KZBA 4NKDB 5KVFE 1T0NB 2BVTA 3S96B 3KPMA 2Q6QA 4KITB 2DIBA 1BYPA 4Y19D 3M7OA 1INQA 1AGEB 1MW0A 5HP5A 4I2XA 3SDCA 3T97A 1MFDH 3R1GL 4JKLA 1XTGB 2Y36L 2WXFA 3FB7A 1OLZA 1CB4A 1LP9E 2P8LA 5EU5B 1UH2A 1QP1A 3HI1A 4KBPA 3KJ4B 2KS0A 3KXFA 1O6SB 1IZJA 2X4OA 4RLDA 1TVHA 3Q6GH 3ARBB 3BWUF 5C6PB 1SMOA 2A6JB 4EKXA 1UM6L 1IGJA 3C5SB 1U57A 1A02N 4QHUA 3G9RA 5BQ7B 2ZP9A 4YHPA 2W83C 1JZIA 3RBGA 2OJ1A 2B87A 4TKWA 2ORBL 1E5BA 2H43A 3FOLA 1SQQJ 3IRZA 1FDLL 5EOCJ 4ODHL 3WN5C 3FTGA 4XOAA 1CWVA 3V4VB 1ZEAL 2COVD 5DZPA 1J8KA 1QL1A 5T5FA 1G5AA 3PUUA 2AVFA 3EUDA 3V4WA 1NDTA 1VPOL 2WCPA 4OI8A 2MPAH 1E9PA 1BSNA 1FP5A 1KIPA 2ITDA 1JCKA 5DZLA 3UIAA 3FTUA 3KPPB 1ZP0C 4EAEA 2SPZA 4FD0A 4PJAF 1YEEL 4JFSA 1ORSA 5T1MB 4X4MA 4ONGL 3MRJB 5I1IL 4BQ9A 1BVZA 3O81A 2E7DA 4L4TA 3ARRA 1MXGA 2NNXA 3VI3F 3VD3A 5BW7A 2NY5L 4NQSB 5ICZA 1Q7YQ 4C47A 1ZVYA 4LGDE 4IBVA 1RE3C 3N1PC 3VD7A 4QLWA 1JWSB 3CXDL 4N20A 3PS6A 1C7TA 1OW0A 4JGUA 2BVYA 1IX2A 4XE0A 3ES6A 3K5SA 4I87A 1P53A 4N3TA 4H8HA 1EZVD 4YVUA 3LHAA 5C3TA 2B0SL 1IM9A 2NTFA 3RE0A 5A2JH 4ADIA 1JTTA 3RK3B 2F8XC 3EDDA 2ICWB 3LD8C 2P8PB 2ZF9A 4G43A 4A37A 4U1HA 2G3NA 2BWDA 4QYAA 5I1LB 4FQLH 5CD3B 2Q2LA 3K71A 2A1WH 2HT2D 1A14H 4WV1C 3PRZA 3ARDA 5D2LB 1T6VN 5D72H 2WXIA 4OCWH 3DO3A 4DKDC 1S9YA 3E6FA 4R8WL 5BNXD 4J3OF 1T8ZA 4CSZA 3KPMB 3QIBC 3WFEH 3ZL4H 2BZ7A 1S7WB 1U3HC 2O5XH 3L3IB 5D5MF 1INQB 1WUNT 4I2XB 2QLVB 3SDCB 3T97B 2DI9A 2Q5BA 3FB7B 1UWYA 1ZLLA 3F62A 2P8LB 4RZKA 4WDIB 3HI1B 1GYAA 1YQ4C 3HCVA 2ED7A 2X4OB 1HKLH 2BERA 2OMBA 1QTPA 4HJUA 5ILTL 1TVHB 3S5YA 3GMRA 2YIUB 1WT6A 3VACA 1HKFA 2YGNA 2W27A 4PSRA 1IGJB 2EC8A 2OAAA 4QHUB 5BUGA 1Y8AA 3WKQA 4YHPB 2KUBA 5BU5A 5DHVH 2P42B 2GM4A 3FOLB 3GI9L 2WITA 3ALPA 3FTGB 4XWGL 1N7SC 4YHIA 1UOLA 3AU0A 3K0YA 1P7BA 4YO0A 4M9PA 5L4IA 1NEZG 2E75D 4O2EA 4JB9L 4CN4A 5DMYA 2ZX7A 3QEQD 2VO8A 1E27A 2A9AA 2W59A 4M5YL 1E9PB 1X9VA 1NM9A 2ITDB 4MVBC 4UNUA 1KFAL 1SQQD 4CADA 1FNSH 2QADD 3GS0A 3BE1L 2EIBA 3VRIA 4F58L 1ORSB 4TNWF 5CD5D 2MJZA 2ARJA 1NJ9A 3IJ7A 1GGTA 3VFTA 5IB3A 4M48H 3ZDZB 2L5GB 4XPTL 4L4TB 3I9GH 2VRKA 3ISWA 4NZDA 5AB9A 3K5RA 2DY2A 3TEXA 2G5BA 5ICZB 4X5QA 5FGSA 2NQCA 1HJ0A 1E2ZA 5KLVJ 4W9HC 2DWDA 5JOEA 1T21A 1MHHA 1U21A 4HKZA 3U36A 4GXVH 5B3JF 2EEAA 3A3YB 4R4ND 5K1NA 4Y4FD 4ZAKD 1P84J 3X11A 4Y9GA 2F7IA 2X40A 4PTTA 1R5SA 4Q14A 4CW1A 5C3LD 1E6JH 3ES6B 3L2NA 1XCTA 2NTFB 2X6VA 1AG6A 4IBWA 5LBVA 4GMTL 1QG3A 3RVUD 1UA3A 4G43B 4XNXL 4U1HB 2AMUA 5CR8A 3U0WL 1QA9A 3VGGA 3K71B 3H1KJ 3TURA 1RERA 3JYBA 3N5AA 4YPGB 2Z7ZA 5HI3C 5LNDA 2X4RA 1YUKB 2JKRM 1JGLH 2YMTA 4HZ1A 1S9YB 3E6FB 4WSGA 5EBGA 4KX9A 1NGWA 2WN2A 1SFCD 2J6EH 2OTPA 1CXKA 1Y6NR 1SQVJ 5T1JA 3IDGA 3DWTA 1DJWA 5DC4B 3FXDA 4GW4A 4AG4H 2YA0A 1MWAA 4FXKC 3BKCH 1YNTF 3MROA 1RURH 5C6WH 4A2GA 2PPDA 3HCVB 1IKOP 2QQKH 4FRWA 3QRFM 5DD3L 5LXGH 3IYLW 3GMRB 4R2GB 3TN0D 4ZXBA 5B4MC 5JQ6L 1OO2A 4LOEA 3QJHA 3SBRA 4XPGL 1OGTA 5KAFE 1WWCA 3QAQA 3ARVA 5EG6C 3QFDA 3D4GA 3IMTA 3NCYS 4PLJC 1FA4A 5I9QC 2BY1A 4H0LC 1NEPA 1LWUC 4YHIB 5TK4A 3HVNA 4BFNA 2N1TC 3MBEA 4YO0B 3WIIL 4IS6A 4RMSA 3WNOA 4D6TG 4HJIA 1IGFH 4EI6A 1AD0A 1NU1E 4O2EB 1FZEA 3VB8A 4C55A 2LHAA 1E27B 2I27N 2I7SA 4PGDA 4HUWB 3HG5A 5GTHE 1E50A 4TLKA 4CADB 4OM0H 1KXQE 4ECNA 3VRIB 2Z7YA 2ARJB 1JPGA 1NJ9B 2EADA 3V52H 3VFTB 1HVXA 5IB3B 2IALA 3RURA 3SY6A 2VMFA 4KXZH 1X8YA 5GGTH 1W72H 2G5BB 2IOOA 1QI5A 4Z1PA 1EDQA 2DWDB 3DDFA 1T21B 1MHHB 1TO4A 1VFBA 4HKZB 1AD9A 3U36B 5J3HC 1M7XA 2GJPA 1K5NB 3X11B 1PIXA 3QZLA 4PTTB 4CW1B 4MXQD 2Q3ZA 2XU9A 3RY6A 1ADQL 1IFHH 2GIMA 1HHIA 3WU2H 1XCTB 5ESQA 5DVLA 1XMWA 1L6PA 4O9BA 1T7YA 1TJMA 3QUYD 2OK0H 5KLVD 4OGAC 1K04A 2BX5A 4FLSA 3QZOA 2WBXA 4MTMA 3N91A 5E99H 1RD6A 4G59C 2JCCE 2H8PB 5AW7B 1CR9L 1QA9B 4JM2A 4BFEA 2XA3A 4CL7A 5DJUB 1A6ZA 3TGUG 2ESVA 3MYZA 4BA8A 2GUOA 1N67A 3ET9F 2X4RB 4MLIA 4RRPA 5DDHA 4Q7DA 3D6ZA 4RX4A 5F0PB 1NGWB 3KL0A 4OQTH 2G60H 4I89A 1Z5LA 3WOVA 3CU7A 1AHMA 4A1RA 3IDGB 3FAWA 2K9UA 3QBTB 2AABL 1WIPA 4GW4B 1JGEA 2YO3A 3P3TA 1MWAB 5CZRA 4I0PA 1WA0X 4Y2DC 2DQ6A 2VDMB 3D39A 2J58A 4RGOL 1NBYA 4ZXBB 3SN6N 4QCIA 5I82A 3VWJC 1JHTA 4W7YA 3HZMA 2RH0A 3QJHB 1BZOA 4XAWL 1FFTB 3JZ7A 4BBWA 1OGTB 1SQVD 1X5GA 2CGYA 4NOBA 2J4WH 5TE7H 3LS4H 1QLEB 4Z7NE 2BY2A 5CCGA 3NA9L 2Y2YA 5E0QA 1A0QL 3GZPA 2XZQH 3PXHA 4KHXA 3EADA 3QFDB 4J27A 5DWPA 1P4LB 3D2UA 1OX3A 1UB6A 2EZ0C 5B8CC 3AU1B 3G4SP 2L7UA 4OCXL 3MBEB 4D94A 1K5WA 5JR1H 4IS6B 1XTMA 4EI6B 3QB7C 1AD0B 1PS3A 3TGXA 4FQJL 4LEEA 3D09A 2PTUA 3STZA 2K70A 1UWXH 4PGDB 3ZRSA 3D0VA 4KY1L 1WT5A 3DX4A 1S9KC 3ZGHA 1F86A 2DYSB 2P46B 4Q6IA 1HOEA 4N6QA 4I3SL 5A7BA 1JPGB 1NTZE 3CLQA 4XR8C 2IALB 2CO1A 1E8XA 1WAPA 4ILDA 1JGVL 9CGTA 2EQDA 1LK2A 2H1XA 3NTNA 3ZL2A 1VFBB 3MRGA 4Y89A 1AD9B 3ERXA 2RGSA 3FN9A 4JN2A 4E41D 1MFBL 4OIIL 4PTUA 1NCUA 3PPEA 2BVOA 7PAZA 3VYPA 3JTSA 4G7YH 3IMWA 1NBVL 1DBML 1HHIB 5D7IF 1JNNL 3EJPA 4UM9B 3IE9A 4RO0A 4A2FA 4N86A 4MB1A 5A6MA 1YJDC 1PZQA 2D73A 1BIIA 5DQDH 3FT3A 5LXVA 4ZX3A 4HX1A 3MXWH 4H13C 3QUXA 4JM2B 2FYUK 1MREH 4YSUA 5JYMA 2CSPA 1A6ZB 2ESVB 1CC3A 2GUOB 3HI6L 5HHME 2IFFH 2VL4A 2XQBH 5L88H 3KG5A 5D96B 1F3JA 2QVMA 5DDHB 1JZ3A 5B66E 3NACH 5CJXC 3WYRA 3SFDC 1Z5LB 1H3WM 1NIDA 5JHMA 1IK9A 1XH0A 4WWKA 3FT0A 1W6WA 1S9WA 1XT5A 2QJPB 4S1SH 5DTFA 1JGEB 5CIPH 1L9OA 3NIFB 1D9KC 4I0PB 3VFPB 4KRPC 3G6JF 3FULA 3O2DH 5FYJU 3ZTEA 1OSPL 1BZDA 3D39B 3HR5A 5KBNC 1PSKL 4AQRD 2XN9A 5E0FA 3BRGC 1NBYB 1X5ZA 4QCIB 3O0LA 1JHTB 3O4LE 4PUBL 3HZMB 3GO1H 3ZKXB 4BINA 5AWNL 3WLWC 2XYBA 4N9GA 1A3ZA 3POHA 1LP9A 3GEWB 2PPFA 3DTDA 1MY7A 5ITFA 2J20A 1YYLH 1HL8A 2CA3A 1UB6B 4IOIH 3D2UB 3GBDA 3WKNA 2K7QA 3ARGC 4GG8A 2ED8A 2VUKA 4HIEA 2OMNA 1XBDA 1G43A 3OX8A 4JFWA 3CFIC 5EEXA 3HE6A 1BMGA 5I75C 2X6BA 2DZEA 5J6SA 5L6YH 2P5WE 4EIGB 3STZB 4Z95H 1OSEA 3D0VB 3QXAA 2J8UA 4OCMC 4WEMB 1JPEA 3KPEA 3RVVD 3W38A 2O1KA 4Q6IB 2N7SA 5CFHA 4BYHA 1QPKA 2WXGA 1LTGC 5D1ZA 3KWUA 4P49A 3QA3A 4PI2A 4LPVA 2J7LA 1Z32X 4QTFA 2O1JA 5E8PA 1LK2B 4QKTA 1RZJH 5DT1L 3A0HE 2Z7WA 1B88A 4HU8A 2OR9H 3MRGB 5F6HJ 5ABDE 1R5LA 4JN2B 1JDAA 4GSXA 2J5LB 4OZHE 2BVOB 2Q8AL 5JA8B 2X6UA 4Z8FH 3JTSB 1IFJA 2WVRA 1LQBC 2JV6A 4YDKH 2NZ9C 3U1CA 3ZZ1A 3FZUD 2EIKB 4ZS7L 1P4BL 3QIUD 2MRYA 3HMXL 3TWCL 1BIIB 4LSSL 1BAGA 3FT3B 1RE4A 1XAKA 4PGZA 4X7TA 4HX1B 2W07A 3KPSA 3QUXB 4LLAA 5AAMA 3RTQD 4AGMA 3MNWA 2MTAA 5DURB 1VQ9P 4G11A 4P46B 4U6XA 1X79B 3X3GH 2XWEA 1Q72H 4ORZC 1XGRA 3HS8A 3U9PL 4GUQA 1F3JB 3M8OL 3BQUD 2R0ZH 4HXAL 5JXAL 1MLCA 5DHEA 5CKAA 5JA9A 4WWKB 3U30B 4X6FA 7TAAA 4BFOA 1A6UH 1S9WB 4OD2A 4A6YH 4ELDA 1GC1H 1UCBL 1C5BH 4M6NH 5DTFB 3TTSA 5LQBL 1RZQA 4KZEL 2RMNA 2LLNA 1KGXA 1UH4A 3LXBA 1H3PL 3HR5B 2YGQA 2XN9B 1JZEA 3H1LG 3CIAA 4UT7H 2HWZH 3VWKC 1EX0A 5EOQH 4A7SA 1YQ2A 5EF0A 3LB6C 2VL5A 3U1QA 1K6QL 1OP5H 3TCXA 4DETA 5IJKA 2WLIA 2ZJSH 1ILUA 4N9GB 3GXTA 3SB3A 4I77H 4Y16A 4DVRL 1M56B 1SVFA 1LP9B 4JRFA 5ITFB 4LLVA 3RNKA 4U7JA 1T80A 3F7QA 5L2KE 4GG8B 4LVOC 3D18A 4HIEB 5A6LA 3ETBF 3OX8B 4I0CC 1WV7T 3FF7A 3HE6B 2CM5A 3NCXA 1B2WH 3VTTA 2E7LA 4HCFA 4OGYL 1FYTA 1ZY9A 2K3TA 2P58A 1EGJH 1QUNA 2G9KA 1GAFH 3MRQA 3QXAB 2J8UB 1P6WA 3ZL1A 5I6XC 1DUYA 1U7MA 3A2AA 5DC2A 5A3IC 1SQPJ 3B43A 4J5VA 2FEDC 4F7CB 2CUAA 3FOMA 5IESL 2F61A 3HVDA 2XTJD 4EVNA 4MWFA 5D1ZB 4DEPB 1D5BA 1PLGL 1SXSA 3QA3B 5FA4A 3BGAA 5FLUA 1NINA 4HSCX 1KCUL 4WU7A 3R0MA 3WUTA 2C1PA 2FBOJ 2VKXA 4YVNA 4R0LC 3L71J 3KH4A 1D7MA 1RZ8B 5KYUA 3B34A 3LQMA 1OIPA 4HAGA 2XVBA 2VRQA 5IROC 5ESVA 1UD6A 2HFGL 2UV3A 1M7LA 4X7SH 3NIDF 1BJ8A 3RGBA 5JDJA 1CCZA 3UAFA 4B9KC 3ZE0E 3IGUA 4N0FA 4DN4L 5GS0D 2A83A 2R59A 4X7TB 1KG0A 1DVQA 1MCSA 1N64L 3DX9A 2PKDA 1NCBH 2A9NH 3KPSB 4LDEB 3FN3A 3FQYA 5AL8A 3VGFA 4RFOH 3MNWB 2JK5A 4LGSB 1CLVA 2VDRB 4YHNA 2HTLC 3MLTA 4LSRH 2HX8A 2YD8A 4U6XB 1UIXA 1BQUA 3MLZL 3V4PA 2CGRL 1KN2L 1XGRB 3KXDA 4NQDE 5DC0A 4LSPL 2ICWJ 2IIJA 5F7MC 1MSPA 4PJGA 5AOLA 3DNKA 4U3SA 3BIKA 1MLCB 1IJDB 3QI9C 4WRLA 4X6FB 4OD2B 1TU3F 1EERB 2FUQA 2HN7A 3OSKA 4QHMA 4GI6A 4U1JB 4U49A 1AC6A 4AWJC 3RZCA 3IAOA 3HE7A 2IBZD 5F9WC 2ZAEB 2HYNA 3RGVA 4HWNA 4ETQA 3IXAA 4P59H 3DETD 1BF8A 3HNSL 2XC8A 3VFGH 1KJ2H 3BLPX 1LDSA 5CSZA 1U92A 3A6BH 1H19A 5DVMA 2WLIB 1Q9LA 2B9AA 3ARTA 3AS1A 2Y9ZA 4Y16B 4U33A 2YPVL 5MP6H 2CO3A 2DYPD 2NY7H 4TSCH 4OF0A 12E8L 2AI0H 2YXRB 1OAKL 4LLVB 1TO5A 5GRJH 1OF2A 4JKKA 3FB5A 5CP7A 1KTLB 1AQ8A 2JJTA 3A0BH 3D18B 1DHKA 3HN5A 5TQ2L 4YH6A 3L4TA 5GSRA 2V7QJ 4MFHA 3ZZQA 1FYTB 4F15B 1CICC 3K1KC 1QUNB 4ACTA 3MRQB 4B27A 1ETJA 2ICEA 4Y28J 1IQDA 1DUYB 1TQCB 1ZA3A 3L5HA 2R0WL 5C0CE 3FOMB 2A06D 3QZNA 2W9DL 4EVNB 4MWFB 1D5BB 5FA4B 3MJ9A 1PMYA 2C9NY 1KCVH 1CVSC 3AGWA 3PNWA 3NCCB 1J5OL 4LHUA 2C1PB 1PG7W 3K4DA 4UQEA 5CSGA 3LS5H 1NH4A 3RX5A 1A7NL 1XSKA 5KYUB 5C7XL 1A4KA 4HISA 4IJ3B 1SQPD 1GTWA 1OGAE 3F00A 3I9AA 3QAZB 4J4PA 4NRXA 3MLVH 1N70A 3KYOA 5E2WH 3A22A 1DJHA 4P2AA 5ESVB 1OVUA 5D2NC 1ZLUH 1E5YA 2NPLX 4MD5A 3QJQB 1G9NL 4O2FB 4ZMVA 3KBEA 2CNYA 4FKKA 2Q10A 3O6QA 3KLKA 4HUKB 3CFMA 1AHKA 1CLOH 3D06A 2VW4A 4KNTA 4YNYA 1FG9C 3LHPH 4YPCA 3ALXA 4O02A 4U6HA 1WMKA 4N0FB 2EDTA 2AXFA 4AH2A 3L70D 2A83B 2WO4A 1MRFH 1KG0B 3H3PL 1J8HE 3QDJD 3DX9B 3KYKH 3W67A 1MFDL 4FLRA 2JK5B 4YHNB 1ACZA 4KKCD 3MLTB 2XUWA 1DUZA 4WGVB 3V4PB 3MNVA 1BJMA 4U1SA 3FUIA 4B9CA 4WHTA 3ARFD 4W9JC 1P69B 5IVNA 3Q6GL 1DBKH 4U3SB 3BIKB 2APSA 3EZJB 3PWPD 2AJUL 1S3JA 3ROOA 5DR5L 2PO6C 3WU1A 1YHQP 1BE3J 1ID2A 2HN7B 4QHMB 5T5NG 4X0KA 4FQCH 5BUPA 1EXHA 4H8WH 5I16A 1WITA 1IO4C 2Q7CA 3RZCB 2E5TA 3VD0A 1N8ZB 2EDDA 3HE7B 2NW2A 5F6HI 4JFFD 2NXZB 3QVAA 3RGVB 4H88H 2V5TA 3IXAB 4MX7A 4TQEL 7FABH 1JVKA 2AERT 1LHZA 5CSZB 1Z3GH 2GB2A 1U92B 5L0QC 2JR8A 1Q9LB 4UB6H 1RKRA 3THMH 4KMLB 5E79E 2N0MA 4UNTA 3UX9B 2YRLA 3W0WD 4K5PA 4F8LA 3C75A 4AQOA 5ECGA 3Q8AA 4RNRA 1R3KA 1P84H 2K6ZA 5F7BA 3SPJA 1PP9J 1OF2B 3TV8A 1FBIH 3FB5B 2YGPA 5CP7B 5HYJE 1H6UA 3IMRA 1C8QA 3JWOC 3O9WD 4PGCA 2P26A 3CFTA 2GSGA 5GSRB 1J8RA 4XNMA 4ZJ9A 4JNXA 2FLMA 4XOEA 5CS7A 1PJWA 1KF9B 1J7VR 1WWBX 4K9EL 1ETZA 3HMWH 3HNVL 2ICEB 4RGNB 1LE5A 5LVEA 3K4AA 4ZW8A 1ZA3B 5KJ7E 1YPZE 1N8OE 2V0AA 3DXAD 1R17A 3S3SA 1NVOA 4OCLC 3UTQA 1MJUH 2NY6C 4Y4HD 1BZQK 3Q01A 3BPCB 3O11B 1AJ7H 1F5WA 4QGYA 4H0HB 4LHUB 1SY6L 1DO5A 3N41F 2EH7H 1KXHA 1T7XA 3RWCA 1A4KB 5DQJA 2A6KA 1WRGA 1NFDE 3LZPA 3KYOB 5LN8A 4OGQD 1FFOA 1ZGLM 3L75E 3B8SA 2A1WL 3BSGA 4MD5B 1QSED 1X9QA 2WP3O 3QUZA 3U1AA 3CC2P 5D72L 2D3VA 2EIEA 4OJFL 2ED6A 4YNYB 2F53A 4U6HB 4O02B 5C0BA 4Z7QE 1TZGH 5K9KA 1CDUA 3ZL4L 4AH2B 2AXFB 2J88H 3VXQA 4ZNCD 5EBMA 3LYRA 3TC9A 1OAQH 3BZDA 1RAMA 5ANME 4R4MA 4LCUA 2FD6H 3CE1A 4NQCD 2I9TA 1DUZB 1HU8A 2ZPKH 5AKRA 3MNVB 4U1SB 5FV1L 4GINA 4WHTB 3QWNA 1II4E 3LRGA 4XVUD 1SUJA 1QEWA 4N2FA 1OK0A 4WSKA 1PFOA 2JCCB 2YPLE 2KLSA 3U2JA 3CMGA 3ROOB 3S5LA 1CXLA 3ISYA 1MVYA 4X0KB 1ZLEA 4XN4A 2IPTH 5I1CH 5I16B 3E6HA 2NW2B 3C6LA 4JFOA 4IRZH 4R84A 3WY4A 3L74J 1HN1A 4MX7B 4N9OB 4ODXA 4M62H 3SE8L 1VCBC 2GCYA 1GYUA 1XH1A 5KLVG 3ZHLA 4CMHB 5KAIE 2LLGA 3C8DA 1OSZA 3BAYA 4QLRA 1QFWM 2ZWNA 2N3JA 4JFZL 4N85A 2ZCKL 3B6SA 4RNRB 3DRTA 4KRNA 1R3KB 1QBLH 2I32A 4OJAA 3M1CA 3SQRA 2R27A 4YQXH 4DP4X 3QI9B 5CEZL 4WW2A 1HJCA 1CYGA 4GMSH 3CX5H 5D71H 1N7ML 2X9XA 3IJYA 2VDOL 4PGCB 4PJ7F 1P7KA 2OR8A 2GSGB 4L0ZA 4XNMB 4EZJA 3FHQA 4KY2A 5JTWA 4LAQL 4TLTA 4LP8A 2ICWI 3H1KG 1ETZB 4PJFF 1ZHNA 4RAHA 1PP9D 1YCSA 3ARUA 2ADIA 3ILPA 1S3RA 1LE5B 1UXWA 4GXVL 3WTYA 2ALAA 3WS3A 1UASA 3UTQB 5AALA 1X7QA 2YD4A 5B5EH 2DH3A 4DCQA 4MD4A 4ELKA 3IDXH 1IAIH 2K3RA 2AZUA 3CN1A 3LXUX 3P3SA 4MHHI 2RFXA 2EACA 3RWCB 5KW9H 2F7QA 4F57H 5DQJB 2Q1EA 5E70A 4L0YA 1MJ7L 2A6KB 2ZXCA 5D7LE 1RPQA 1MCBA 2Q5UA 1S78C 2CBPA 1AI1H 1FFOB 3KCWA 1IAMA 3G6AA 3DA0A 5C2BH 2VMJA 3GFUA 3UL4A 2WKOF 4FJZA 2EDLA 2R39A 4JL1A 4XI5C 3QUZB 4U2ZA 4N2BA 1JGLL 2WZAA 1I1AC 3LZOA 2ZSVA 5C0BB 1BAFH 2F53B 1WIUA 5K9KB 3VXQB 2CR0A 5EBMB 1ZLVH 2CHNA 3Q1MA 2MKWA 1KLGA 5AW6B 4LCUB 2WKLA 1X4YA 2I9TB 4M00A 2JKNA 3BKCL 1RURL 4EDFA 3BDBA 1W8EA 2GUYA 5TISH 1DSYA 2QQKL 1KLUA 2I60L 3FL7A 1IEAA 1QEWB 4P2YA 3VH8A 1EQ7A 1GS7A 1J2JB 2O3JA 4PMFA 2XZAL 4R4LA 4NZUL 4GI8A 5C9KA 3QP3A 4NUMA 2Q8BH 3T1FA 3E6HB 2VJXA 3B5NA 5H37A 4UMSA 3C6LB 4JFOB 1OE2A 4L1TA 3PHAA 5E9DE 3W5NA 4ODXB 1H3UA 5JXEA 2E47A 2I25N 2GCYB 2NNRA 3LH8A 1GY2A 4FOMA 1KC5H 1OSZB 2VSCA 2WYZA 4ABQA 1ODAA 4DNLA 1FZCC 3H53A 3INOA 4MJ5A 5T1LB 2WOYA 2H1PH 1JHKH 1UT1A 1J48A 3B6SB 4K7FA 3DRTB 1EO5A 2E8ZA 1L9PA 4PJ9A 4Q4IA 4OM0L 2NTSP 2Y9YA 4WW2B 3L74D 4EXPX 3GIZH 4XP4H 3V52L 2Y3AA 4GJTB 4AEHL 4Z7IA 3L9YA 4JDVA 3IJYB 2E9JA 2CO2A 3N43B 5GTIH 4YJZL 2LVEA 1OCRB 4FFYA 4HGWA 1EO8H 3PAUA 4TL4A 4IHBA 2WYIA 1QRND 4FNLH 1ZHNB 1VJSA 3ILPB 3V5BA 2ADIB 1G7LA 2D31A 3A67H 4RISH 1UXWB 4XPAH 1JOIA 5I1KH 2A74C 4PJ8C 2CCWA 3BCCE 3ESNA 2E74C 1MQKH 2E59A 3WS3B 1X7QB 3QEUA 5KSAC 5F9OH 4GRWH 2HPOA 2YUVA 4DCQB 4MD4B 4ELKB 1HINH 2YAQA 5C09E 4QRQB 5EULV 1GZQB 1NCWH 4TQ8A 2OK0L 1F18A 2RFXB 2G4EA 3CXHD 4M4PA 3MZWB 2N7BA 3NSYA 4Z7WE 2JJUA 2P5EA 2VDLB 4EOWL 1J1PH 3G6AB 4QAWA 4ODVL 3PIQA 4PHZA 5SV4A 1PNCA 4ZMPA 2JIXB 5ISZE 2NDGA 4DP8X 3K8KA 5EU3A 2ZSVB 1U9KA 5H4ZA 4ZOBA 3AUVA 2G60L 3RDTA 4OZHB 5EEUA 3MX0A 3SJVD 3PWUA 4F7MA 4HCGA 5CMAA 2XG4A 1KGWA 5HDWA 4HIIA 2K37A 1KLGB 2FX8L 5CF3A 3SYCA 3B8EB 1N7SD 5FW7A 3RP1A 1GGYA 1YMHA 2R5BA 1MI5E 1IVTA 1OK8A 1GYVA 2V5RA 1KLUB 3ZU8A 3EFOA 5AVTB 4KNSA 3WG7B 1IEAB 3VH8B 1OAUL 3CV5A 4MVBD 3FUDA 4N2EA 2AHIA 4EI5A 3LIUA 2J4WL 3GMOA 3LS4L 1CXFA 3MOBH 3NJGA 3I2CH 3S5ZA 2XZQL 3T1FB 3B5NB 3FFDA 2AJ3A 4G3YH 2E86A 4JRYD 4A2MA 4XNUH 1INDH 2ZFCA 5APUA 1TT6A 4DP1X 5JHAA 5JR1L 2IOIA 1BM7A 2FHFA 3C87A 3RG1C 5BV7H 5JMOC 4ZTOH 2R4SH 2AXTH 2Q3IA 4MJ5B 3RDJA 4L9LC 3WJLA 2PP8A 1DN0A 2GVYA 4K7FB 4KRLB 1TSRA 1B0RA 1CDHA 4PJ9B 4TTDC 5IK3A 4PJDA 4YN3A 3BLBA 1SLQA 1FNAA 4JDVB 4A38A 1A9EA 5KJ7C 3KPRD 2QQLH 3G5WA 3OPUA 1LGVA 4HGWB 4PWKA 2ZKMX 1QSZA 4W4NA 4PJEE 4U0RC 3UADA 4QWWC 4JBZA 3BGMA 5T1DL 1G7LB 3CD6P 2D31B 4TLSA 1GJWA 4P9MH 5L2KB 3VU2A 5CAYB 3FK3A 1CBVL 3FQ1A 3UPCA 3MTRA 4N0RA 1JVOA 3QEUB 1V3MA 1R5WA 3LQAH 1NTMJ 1GZPA 1I9EA 3D3VE 4G7YL 4H0GA 2QRXA 1B4LA 3ME0A 4EJ1C 2QG4A 2VMCA 1YLBB 2FGWH 4N26A 3RFZC 2HYMA 3G9AB 2IPUK 4MDIA 4AGOA 1DANT 2PAJA 3E1ZA 1XCXA 4DP7X 3L13A 2DJMA 2YRZA 3ZIYA 2P5EB 5AZ2H 3MUUA 4WENB 3NEEA 1MREL 3TT3H 3W9EA 3PIQB 1KTBA 2EJ1A 4YLQT 2IFFL 4FQIL 2XQBL 3PL6C 1ZHLA 4LLQA 5EU3B 1SQXE 3ECWA 3NACL 1YEKH 4KMQA 2YMXH 1DJXA 1RUML 2FQGA 3QFJE 3WKYA 2BSED 1F2QA 3OWEA 3PWUB 3V7AG 4F7MB 3ESOA 2XG4B 4PI0A 4PLJD 5CMAB 2D4DA 1OZHA 4S1SL 1GCFA 3GPEA 3RWHA 1BG1A 1F6LL 1YMHB 1Z1WA 3TJEH 1FAVA 3CXHI 3VX1A 4JKNA 3ZE0B 3V6OE 3EFOB 4MMXA 2R69A 1QBBA 3APFA 4MAYC 1IT9H 5E2UL 2ZXWB 3GO1L 1CK0L 3TF5A 2H47C 1J0KA 2WWMD 5IBTH 4EI5B 3GMOB 5SWZD 4KI5F 3V4VH 1UKTA 2DIJA 3L3JA 3FFDB 1J1DC 2DKUA 3HC4H 2MCMA 1MVFA 3S3JA 2L04A 1ED3A 4WNQB 1KB9H 2GBVA 3ECUA 5T3XD 3LZQA 4PJ6A 4UTAL 4ZSOE 4ZQTA 5FFLA 5HDQL 4ESKA 4NLAA 3WAKA 3KS0J 4D9QD 2EILB 5KVDH 2YXWA 2Z6FA 4PS3A 4Z95L 5J3HD 1TNNA 1D5XA 1DN0B 2MKLC 1NKRA 1B0RB 1NMCB 2WPGA 1UOVA 3AUWB 2PR4L 3GXPA 1SVBA 4PJDB 5IK3B 4JZOA 3TM6A 3CWBG 3UZEC 1S7SA 2AAAA 3FFCD 3K1DA 1EDHA 1SMDA 5CM1A 4PHXA 3F05A 3VU1A 3AS0A 1A9EB 1EJOH 3EJZC 1WHPA 4RBPH 4GODA 5IBUB 5FWRA 5LAXA 1T2QH 3UERA 1U4EA 1RZJL 4AVKA 4CJ0A 3DURA 1CFTA 3BGMB 4TSBL 2OR9L 4KKNA 3OKKB 3OMZA 3VG0H 4OI9A 4LVHC 2AW2A 4N78D 1AIFA 5AW4B 1M6UA 5KS9F 1A4BA 1LTJA 1R5WB 3WD5H 1GZPB 3TBSA 4DF9A 4OGZA 3O6KL 1G9ML 3ZSSA 3ME0B 3LKRA 4FMVA 4E9RA 2IF7A 3RVWC 3OHXA 4J3SA 4L3EE 1YPZA 5GRZA 1YDPA 4LASH 5DK3A 4XBMA 1ET8A 3AJ7A 2Y5TA 1I3RA 5EH1A 4EI2A 3GIVA 2WO3B 1NTMD 3W9EB 3GNML 3VA2C 3QUMA 4ZUWA 5F3HA 5K69A 3X3GL 2EDYA 5AVYB 1Q72L 2MSPA 4LLQB 1KB5L 2R0ZL 4L2YA 1LMKA 1NFDA 4OCNC 1KGYE 1OP5K 3BSHA 4YFEA 1ZLWK 1A6UL 4A6YL 3VW3H 1GC1L 4XX1G 4M6NL 3RWHB 1ITBB 2R0KL 3TO4A 3VGDA 5I8CA 4W9ZA 4A2LA 3QWRA 2YEQA 4MMXB 4EPSA 2YD3A 4UT7L 2V7QH 1YRKA 2KZWA 4NQEA 5EZJA 4JDZA 3T9WA 4AE1A 1NBCA 1EEZA 4JO8A 5ANMA 1XGTA 1SQPG 1S9KD 4YBHA 5CN2A 4I77L 2DW3A 2W60A 5F7DA 4R5VA 2LFEA 5D6DA 4YDLB 4NQVA 3L3JB 2GFBA 3FUMA 5J57B 4R5TA 5T5FH 4U4IA 4AYCA 1S5LH 3IRCA 3MJGX 3QH3A 3T3PE 5IFAL 1ED3B 3OAYK 1YNLH 3CX2A 3L71G 4HHWA 5DD0H 2O6CA 2YPLA 1LP1A 3JCUH 3NJNA 5TD4A 4P4KA 3DI2B 1OALA 3C60C 4KXDA 4XPHL 2GTQA 1EGJL 1MPAL 3M9HA 1GAFL 4AL8H 5APQA 4OF3A 1D5XB 2ZUVA 4GEJA 1C8PA 3EO0A 5DD1H 1VGEH 3RIFF 1RFDH 3D50A 4JL2A 4WI4A 3T0BA 4JG0H 2BJMH 4JZOB 1KBBA 1U8JA 1YMMA 2A5UA 2NRGA 1CLYH 4LLYB 4OZIF 2UZIL 3CSBA 1BEYH 4XH2A 1UJ3A 3L5IA 4GYBA 5LAXB 2IDBA 2DEWX 3B7UX 5FC9A 5H8DA 1QD0A 1WHOA 3DURB 1CFTB 2MHAA 1JJUA 3MREA 4FYQA 4JKWA 3FCGA 2LOEA 2NY3C 4XVOA 4LF3A 3H9SD 1N8RQ 1AIFB 1SQQK 1VZHA 3BWAA 4ZO9A 4W9DC 1LTJB 2YSTA 1FUNA 3S4RA 1MFEH 3TBSB 3NJJA 4E9XA 3LKRB 4GS7C 1BX2A 4UZSA 5F7NC 1YPZB 1YDPB 2HUEA 3DV4A 1AS7A 3NJLA 3PP3H 3JBG7 4OJYA 4U1GC 1NU1J 1I3RB 2Y5TB 2Y7QA 4KRPD 3GIVB 1F02I 4MHHG 4N5UA 4U0RB 4FZEH 2VT0A 4I6MC 4RFOL 3SPHA 3GRBA 5EOCL 3QUMB 3BVXA 2KYVA 3Q44A 4KDVA 2OZ4L 4LQ1A 5F3HB 4ZUWB 4YX2H 4Q2ZA 3EWKA 1WFOA 1WF5A 3F3HA 2QZQA 3GMNA 3WLWD 3CIQA 3AE7C 3L95A 3N42B 4UQ9A 4ABWA 1NFDB 5I73B 3DHUA 4IJTA 2CRZA 2R29L 3FDWA 2V3EA 5BVPL 3UBXI 1EBPA 3ARGD 5EN2A 3V79C 2IAMC 1T0PB 4GRWF 3MVSA 4PSPA 4YC2C 3TO4B 3LXAA 4B6ZA 4IBZA 5I8CB 1L5GA 1WH0A 4Z7QB 1MZ9A 4XNBA 5EZJB 4NQEB 3UBHA 5INCA 3G04A 1KJ2L 4JDZB 4Y88A 3RILA 3V0WH 4AYFA 3O3EA 1EEZB 5ANMB 5HHNA 3ULVH 3BFWA 3A6BL 1JAEA 1CD8A 1W0WA 5DEGA 4WVRA 2E76B 2NY7L 2VWEE 5F7DB 4NQVB 2AI0L 2GFBB 1BLNA 3E2HB 3WMSA 1LT9A 3L5JA 4XAKD 1VESA 1WFNA 3QH3B 4NGHL 3MKKA 4HAKA 4P9HC 4NN6B 4OLWL 3S8GB 2YPLB 4DGUA 2N56A 1U95A 4P4KB 1V3JA 2Y0EA 2EKSA 2YAOA 4ICWA 2FR4A 1USEA 5SX5K 3T71A 1WICA 3JWDC 4L5FE 3AM8A 3EO0B 4Q9CA 1J1OH 5E9DA 1YMMB 4W9FC 1ZLUK 1A1NA 4FFWC 1SN5A 2FX9H 4KROB 2NR6C 1PZ2A 3BPLB 4XH2B 1UJ3B 4ZX5A 4OZGF 4FQXC 2C5DC 3N2JA 4HPOL 4HKZH 1GRWA 3O6FC 4LGRB 4MQ7A 5C0AE 5AW3B 2WCGA 5BZZA 1N5AB 3LS5L 4PM1A 4ASVA 4DP6X 1KBGH 2MHAB 3TEWA 3MREB 4DQOH 4KXAA 1VB9A 4ZFQA 4LF3B 5F2FA 2R56L 3V2NA 3BWAB 1L7TL 4FHBD 3CCVP 3MBWA 1UM5L 3UC0H 3FMGH 3K2UH 1P5VA 4F9PC 1BX2B 2D8KA 1BE3G 1CLOL 1RLBA 4KUCF 1HT6A 4ES9A 5FXCH 3KBHE 4OCSH 4BCYA 1X7TA 4BRYA 3DV4B 4TULH 3LW5J 1ZR2A 2J1KA 1MRFL 3ECVA 5HDBF 1E43A 1CL7H 3AREA 3KYKL 2Y7QB 4KJWD 2FB4H 2BXYA 1NANI 3VWKD 3CLEH 5C07E 5C09A 4MMZC 4Q2ZB 3H4FA 3LB6D 4HOZA 5GS3A 2KLRA 3GMNB 2YLHA 3L95B 5FO9A 1DBKL 4FA6A 3DX3A 1NTZJ 3L3GA 4O4YH 4KK5C 5KLVK 1MWAH 1PP9G 4GIOA 5EPMA 2EEXA 2CKBA 3CFDA 2VDMH 1KTRL 3CLFH 5EN2B 3GJEA 4H8WL 2Q0ZX 2YC1A 4UILH 2ZX5A 4Y5YA 5D1QA 5LBSL 2EYSA 3P0VL 4N1EA 3CCHA 1B9KA 4H88L 1L5GB 1LO4L 1NGPH 2XSKA 1QLEH 2BFVH 4WBAA 3QCUH 3RBSA 2C26A 3G04B 5INCB 2WXJA 3M0DC 4M6OH 1Z3GL 5FWQA 3O3EB 5HHNB 1A4JA 1MG2C 3ZYOA 3UEZA 1T3UA 4BUGA 6PAZA 3QDGE 4FN0A 2KZ1B 1W0WB 5DEGB 5A3ID 2EABA 3M46A 4FQHB 2FEDD 4LKCA 1H0DA 1BLNB 3B9EA 3ZO9A 2A77H 1LT9B 2XFXA 5IHUH 3UO8B 4FERA 1IU1A 3CBJB 4H8PA 5HDQH 3LZLA 5L2KA 1U95B 1DEEA 2EKSB 1LTTC 2WIMA 3SGDI 1IBFA 2FHBA 4BM7A 2FR4B 4X6EA 3NTCH 2QM7A 1SQVK 1I3GL 3HMWL 4P3CL 4BSJA 5E9DB 4EOTA 1FAIH 4NO0A 2FJGA 1ZLSH 3RIAK 1AZNA 1A1NB 2OTKE 2VLKD 1XF3A 3S2CA 4MJ2A 5LGKA 4BFGA 4MA7H 4MQ7B 4GW1A 4D9LH 1T0MB 4M7ZB 4M7JL 2J1YA 1UVQA 2EH7L 5J6HB 2JI3A 2XXMB 4HS8H 2HG5A 3KGUA 1WAAA 3C60B 1OGSA 2HLFC 2R7EA 2F19H 3NIGE 5AVUB 2CPSA 3IWVA 4OKVA 2A2QT 3MBWB 4JLRA 4S2SA 4UTBL 3CVBA 4W6WB 4H0IA 4BFFA 1E42A 4I3RH 3S3BB 4ODSH 4C56E 4KVCH 1GCYA 1P5VB 2YMOA 1UURA 3L48A 3VG9C 2FXMA 1P9MC 4UAOC 4EUPG 2RAMA 4UDUA 1RQ5A 4BRYB 1ZANL 4JO2L 5CJQH 2J88L 2MOQA 1DLFH 3AREB 5AL0A 4G9FA 2MFNA 3GSWA 1UOWA 3SGJA 3IK2A 3TT1H 3D3VA 1VF5C 4LVNB 2FD6L 2V2WA 3UDWC 4PRPD 5C09B 4D9RD 4V2CB 2ZYDA 1OP3K 2LTQC 3TZVA 3H1HJ 4AUYA 3CVIL 4S0HA 1UWGH 1AHWA 3NESA 4G7RB 1PKQE 1E4WL 5E23A 5FO9B 4I7ZC 3IKKA 3CVHA