5AW8B

Kinetics by x-ray crystallography: e2.mgf42-.2rb+ crystal
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw8B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw8B02
2WWWA 3HE4A 3VTPC 1CZQA 3HE5B 1G2CB 5AVWB 5AW2B 2E42A 5AW7B 2H7HA 3HTKA 3M06A 3VN0A 2QM7A 3UIAA 3M0AA 5AW8B 1SP4A 3SWFA 1NAFA 4I2LC 4C46A 2Z5IA 4B86A 4HYTB 3A3YB 5AVQB 5AVZB 5APSA 3VYIA 2C9NY 3A7OA 2P67A 2YO3A 3KQGA 4JYBA 1GK6A 3I5CA 1CSBA 1X8YA 2R5DA 3HE4B 3NMDA 3V5BA 5AVYB 5AW4B 1HBWA 3NTNA 1MFZA 2R3CA 2XV5A 2R5BA 4KHXA 1MV8A 1S9KE 3VMYA 2YO2A 4M3LA 1JNMA 5AVXB 3LIEA 3T97A 3NFQA 1FAVA 4AYCA 3P8MC 3TK1A 2WT7B 2Q3IA 1GK4A 1YYCA 2Z5HA 4RESB 5AVSB 3A5TA 1GTWA 1GZLA 2W27A 2P2UA 5APTA 5AVRB 1OWAA 3A2AA 5AW3B 4GT1A 3NXSA 2ZFCA 4AQRD 1GU4A 2E43A 2WT7A 3MGNA 5AW6B 5AVVB 4AUWA 1A02J 5CMZA 4LC1A 2VRSA 3M91A 1HWTC 5AW9B 2ZXEB 5APWA 1NWQA 5APXA 5AVTB 1GD2E 1DH3A 2R32A 3VMXA 3L37A 1JUNA 1FOSE 4GKGA 2WPQA 3M0DA 3P7KA 2Q5UA 3TYYA 1J2JB 1FOSF 1CI6B 1H88A 3KDPB 3LIDA 5AW1B 3WGUB 5AW5B 3V4WA 2N9BA 1HJBA 3M9BA 3P32A 1T2KD 2WPSA 1SLQA 5APUA 1IO4A 4C7NB 2KP8A 1CI6A 2W6AA 3MD0A 2BASA 3L35A 1KQLA 2XZRA 2XU6A 3TNUA 2IPPA 1MUUA 2YNYA 4I6MC 4RETB 3O8ZA 2QM8A 4C7NA 1S9KD 1A02F 5APVA 2P7JA 5AW0B 3IR9A 1H8AA 2C9LY 3B8EB 1OXZA 1T2KC 5APYA 4DZOA 3WGVB 5APQA 4EOTA 1H89A 3OAKA 3HE5A 3TNUB 1HUCA 3V4QA 2Q7CA 3L36A 3VMZA 5AVUB 1GU5A 4JYCA 4XE5B 2JJLA 2WTYA 2WPRA 3M9HA
chains in the Genus database with same CATH superfamily
4OZGE 4AGNA 5DSCB 1FAIH 4DK3A 1CE6B 2ZUUA 1DVYA 4O02L 4U1HB 2G5RA 3BUTA 5SWQB 4PRBA 3DJRA 1PYWB 1ZLLA 5EDSA 3GGWA 2C3GA 5KTEL 2JJUA 1SY6L 5F96L 3APNA 1M57B 4PWIA 4A7GA 2VO8A 1OGAD 3WFBL 3CMOH 4YSEA 1SVZA 3FQRA 1E67A 2JKVA 5EZJA 1A7BA 3K71A 5FYJL 2UV3A 3ZE1F 1GSKA 1HXMA 4HS6B 1BD2B 2WBWB 2MKVA 3H1KD 2ZOUA 4NLAA 5JIHA 5MERA 1M7LA 3FN0L 1RPUA 1THAA 3EOTL 2H32A 1JNHA 2WYZA 2IDSA 3QIWD 4QXTB 3WJLA 4HUCA 2D3NA 5HGBB 2CCWA 2OJEA 5EEVA 1WD9A 1U91A 1UZ6F 2Z5HA 4KKRA 3FQUA 3JZ7A 4FQLL 2DBLL 3FB6A 3JWNC 4I18A 1WFUA 3CXFA 4OI9A 4PJEE 4OV5A 2WWMD 4H1LH 1Z3RA 1SLXA 4GBXD 3NXSA 5FM8A 1H3XA 3OJ2C 4AQRD 5CZRA 3S35X 2Z35B 3ARTA 1PZBA 3ESOA 5DT1L 5A2LH 3HG0A 2F5AH 1QP1A 5BRZA 5MEQB 1SQVJ 4N0UB 2E4FA 3O3AA 2W88A 2C7FA 1C08B 3EAKA 2Z8VC 2EVFA 1RPKA 3LPWA 4LVOC 2QVIA 1YEDA 1KYOH 3VFPA 1LP9B 4YDVA 3GSXA 5KZCB 1X9VA 2QJYC 1FVDA 5I0DA 2VDNB 1DDHB 3INUH 2XV0A 2GK2A 1ZVHA 3O4LD 3QWOA 1XH2A 2VDQH 4LBEA 4WEBH 4D9LL 3GMPB 2ENQA 1D9KC 4N0RA 3H1JE 2FJGB 2OZ4L 4QDGA 1JGIA 3AS0A 5D55A 5HPMA 5J0BA 4L4VB 3WUWB 5DFWH 1HAUA 3RNQB 5KSAB 1FE6A 1ZIAA 4P2QA 1P0SE 1A6VL 4D0DA 5FW6A 1MVYA 4DPAX 2F7RA 1HVVA 2JR8A 4P4RA 2MIZA 1UEMA 4YPJA 2DQUH 2YMYA 1MUUA 1JVOA 3BVDB 5JXAH 2CMRL 4JFXB 1VESA 4IFMA 1V55B 1FA4A 1SQXK 1BQLL 4AEHL 1EDQA 2Y1AA 2OL3B 3NRFA 2WZ7A 1AQKL 1RZJC 2WQWA 5CCHA 1AKJB 1NCCH 4J28A 4L1TA 4HOXA 1FI8C 1E5ZA 4HAKA 2R8SH 1U33A 3KPRD 3P69A 3Q2NA 2HH0L 4MYWB 2QBWA 3EYSH 5I75C 1AHWC 1HILB 4PJ8B 4DOJA 3S35L 4I87A 3LD8B 4XWGL 3UCQA 4ZX5A 3SDDC 5DF0A 1U8JA 4NC1E 5A2FA 5L4MA 5B39B 3IJSA 2YSTA 3HCVA 4F8NA 1I3GL 4MXQD 5F72S 4GG6B 1U7JA 2BRRL 1SXBA 1SHSA 3GMNB 2Y6SD 2ZXWB 1IKFH 2DL9A 2EZ0C 1F6FB 3D85A 3EGSA 3P0GB 4TNEA 4X98B 3UX9B 4HJ0D 5D5ME 3MRFA 2YK1L 5GRJH 3Q8FA 4DO6A 3S9DB 3H1HJ 1KLFB 1WAAA 3BO8A 3MJ8B 2OZNA 4L9LC 5KAIE 5BU8B 5DEGA 3D7PA 1KCVH 4LCWE 1A3RH 3ZZ1A 1ADQA 2HKHH 3QQNA 2ZX9A 2IIJA 2DKUA 3VWKB 2VJXA 2HJLA 3ZY7A 4AG4H 2EDTA 1X5AA 2EUVA 3O11A 1FL6A 4HXBH 1I7RA 35C8H 3ZDXF 2EDNA 2VSKB 4PMEA 3AEFC 2Z65C 3VXUD 3RGVB 3D6GA 4PRPA 2VR6A 1N8OE 5M95B 2N1KA 5D70L 3CCSP 1HIML 1UENA 1AXIB 4S2SA 3VG9B 1DEDA 2VM3A 3IWUA 3UEZA 5D6DC 1Q0XH 1IGJA 4NNPH 5DUBA 1FBIH 4NZRL 3SDCD 1XR9B 4WGWB 3SPVB 2GEEA 4NUGH 5IW1A 2H26B 1URIA 1WCBA 3BUIA 4DK6A 1U8MB 4LF3B 3VTTA 4EKJA 5MHSD 5KJRH 5C0AB 3K46A 3QXWA 3B3IB 1KJMB 3QQ9C 4GOFA 4OZIA 3GB7A 2AEJA 2K1MA 2VNCA 4B9FA 4LCVA 4RMRA 3EFOB 1U8CB 2WXPA 3L7FA 3DRQB 2BOBB 7FABH 2ZJSE 3APCA 3P3SA 4X5WB 4FNPA 3OMAB 1OSZA 5DQJA 4AK2A 2J3SA 1B4LA 1MFEL 4YGVA 1OGAA 4ZO9A 5DUJA 3QRFM 3WUVA 4HPYL 4X4YB 2W80C 1FGVH 2D2CD 2FL5A 5AZEL 1RP9A 1ZGLP 3U1AA 2FUQA 4J12A 4UT6L 4N6RB 1JHKL 1MQKL 2A1WL 3GSUB 4PWGA 1LT1A 4GQ9L 3QRGL 3QIWA 5GGSB 3B4NA 5B66E 3WUTA 3O0LA 4MD5B 4YDIL 3IFPA 1HQ4A 3IR9A 5J56B 4KKQA 4QRTB 3F12A 2RTTA 4LCYA 1PGPA 2X4TB 4HIQA 3DOIA 4LLWA 3HZYB 4QHKJ 3IJYB 3MRMB 4JAMA 4GBXA 1H5BB 3MLZL 1G2CA 1N8ZA 2XX0A 2BDNL 4UF7C 1L9SA 4PI0A 4PUBH 3HC0B 1J9TA 4YDLB 1QSVA 4K7PY 1IGCL 2A83A 3SDYH 3BCCD 4HWUA 4JX0A 2DIAA 4WWID 2GA1A 3OGCB 1S9KC 4JG1H 1MFCL 1X9UA 4MJIE 2C4FT 4MS6A 3EOYG 5CAYB 4NIYE 1O0VA 1PW3A 3MREB 2FYYA 5IB3A 2EYRB 4DQOL 1CZQA 4NO0D 3O4LA 1JPTL 4QCIA 5HBBA 1JMMA 2PYEB 2CD0A 5DZLA 2HLAB 2H6PA 3KYNA 5BXFB 2NZ2A 3TBWA 1XWVA 4KDTC 2WSPA 3FHEA 3HS0C 1FSKB 4GT0A 1HNYA 5DEFB 4H5SB 2I9LA 5L2KE 4OLYH 1OAQL 3TV8A 3M7FB 2DF3A 2E7LA 2K1AA 2HN7A 1T2XA 3PP4L 3JTBA 2A7BA 5GRZA 3RI5F 3MRPB 1UHVA 3IN2A 2D3VA 3MACL 1YC8A 2CBPA 3PPEA 4OVNF 4Z0XB 4TVPH 1BE3D 4OR1A 3VXOB 5IP4A 15C8L 2FX7H 3FU3A 4JPVH 4KXZH 3KPRA 2K9JA 5AZ2L 2WSEJ 2IQAB 5KVDH 1RIHL 1SHMA 4U0RC 5GGRA 3VD2A 5FXCH 3FCSA 4XA4A 1O75A 1RE4A 1N7SC 2YBRB 4ZSOB 2UZXB 4JHVA 5DJ8A 2AEFA 1A02J 3E6FA 2A06D 2HG5D 1ET5A 5FUOH 1X4XA 1YMMD 1KIUB 1C5CL 3FUHA 3HE7B 4PJIA 2H0FA 3B5NB 5J13C 5E2VH 4KHXH 5J6HA 2YJLA 4KFZC 3V6FB 2A0LC 3H32B 4YJZL 2VC2H 4LQFH 2QKIC 1DH3A 1WICA 2FXMA 3FT2B 1I1AC 1JCVA 3AE8C 2ILLA 1A9BA 1NOAA 1YEKH 2BCKA 5I76A 3H55A 5FYJU 4KJYA 1DLHA 2P5WE 3B9KD 4FZEH 4ORGA 5D1ZC 1ZOYC 2Y7OA 5EN3A 1VRSA 3L3DA 1SFHA 1S7UB 2OI9C 2WGNB 2J71A 3AU1A 3O41A 3BKYL 4HG4J 3DX0A 4LGRB 4H20H 3V4VH 5DWUL 1CBJA 4X9IA 3CLEH 2G3XA 3SQBA 1QLEH 3WHE0 5L2JB 1ACZA 3KPSD 1FC2C 2E56A 5E7BA 1KQLA 5DJ6B 1QRNA 2NQ3A 5B1AB 2CRZA 2J8UE 2BHUA 1IM3B 1CVSC 3PP3K 3BAJA 4QRAA 3S96A 3VXUA 4BZ2A 1OTTC 1S46A 1EDIA 4GOSA 1JERA 4ODSL 5CLXA 1NMAH 3WKQA 3DVNB 5I66B 2F7PA 1QYGL 3PY9A 3SDCA 1KIQA 3DDFA 3C6LC 3CPLA 3FH5A 5FLVA 3TOPA 1FNEB 4B6ZA 2XWZA 4UUJA 4M3KB 4NWTH 2QPFA 2G3ZA 1SYVA 2J1ZA 4K23L 4XB7A 3EYUH 3IMUA 3ZQ9A 4MQXD 5F6IB 1CBVL 3IFNH 3OZKA 4GW4A 4PW3A 2ADYA 1MREL 3LEVL 3WSQL 4KXDA 4QHLB 1BZ9A 1JP5A 1SEQL 3UZQA 3FQYA 4WJKB 4MXWL 1X7SA 4JM2A 4U6YB 4JW3A 4KI5C 5ESAA 3QDMA 1HS6A 1QBMH 1GSMA 3JV4B 3VFWA 3X13B 2X2IA 5DJXB 2DLHA 4H88H 5TPWL 3JZYA 1ZLSL 3PWPE 3ZGIA 1U8LA 1XB8A 5BS0E 3GXNA 4G7QB 2OR9H 2E74C 1YG9A 4WRLA 5F88A 1MIML 1W2EA 2AJVH 3SWYA 3DECA 4N6QA 2F74A 4IIZA 3AEBC 4BA0A 1F13A 3ZKND 4G6AC 4MS8D 1TETH 4JZJC 2C8NA 1IGFH 3GINA 4PRBB 5F71A 4JZOA 3D33A 4I13B 4PJGF 3O2VH 3GGWB 1T0NA 2HVBA 1ITBB 3G04A 2WXHA 4HXAH 4J3WA 4LMQE 4GMSH 5CCKH 1KEML 1MFVA 2A38A 3FQRB 4QRRB 5EZJB 2IBZY 3N44B 3K71B 1H8OA 1Q1JL 5AVRB 2KZBA 1KGJA 1LVEA 2YUZA 5ALBL 1HXMB 2B87A 2X1WL 4JQIL 4X8CA 5K59E 1NIFA 1CK0H 2A4CA 5HJDA 1KENL 5T1KD 4KUZL 4FABH 1JNHB 3F5HA 1GIGL 1KB5B 4JRLA 1JL8A 2Q5BA 1ZKAA 4WQOA 2OJEB 5DZNA 4QJ4B 4J3OD 5K5YA 2ZXEB 5KJ7C 3FQUB 5I26A 1MJ8H 3FB6B 5ENWA 4G71B 4OV5B 4NO0A 4HK3N 1E5WA 4KRNA 5B1KA 1XL4A 1JBJA 3LXUX 1H6EA 4EIJA 3RIAK 4FS0A 4FQQB 3NRPA 1CDYA 4JJ5A 4O2CA 3P4OB 3RTQD 4LCIL 2PABA 3O3AB 4N2FA 1TU2A 1U9KA 1DBAH 4PWKA 5DLML 3TYGL 1DP0A 2CK2A 5CMAB 4DGIL 1JV5A 1JZDC 4K94H 3WXWH 1YEDB 1OCWH 2ENPA 1ZLUH 4MNQE 3SOTA 4YDVB 3GSXB 4XPTH 1FVDB 1IIKA 3DA0A 3P4LA 1F4XH 3QWOB 3ARFC 1AGCA 2QQQA 3PTZA 1CXFA 1QW9A 2R9HC 4XWOC 4H2AA 3V9CA 4B97A 2QQLL 5I0YA 2AQPA 5I1JH 4QRPA 4MAYD 4FFYA 5DJZA 3LNHA 5EZIH 5HPMB 5KLVK 3ALPA 4JFEE 4Y7MA 3R7QA 2P46B 2PR4H 3ARWA 2Q6QA 2YXVA 3GLEA 2EIDA 1OLZA 3U9PL 4HIJA 4P2QB 3LKOB 4D0DB 1A6TA 4FG4A 5B38G 4P4RB 1S5LE 2R0ZL 3HHSA 2BZ7A 1JZFA 1UCBH 1HHIB 1UXLA 2HG5A 2HWZL 3JWOH 4YSOA 4EZKA 1YMMA 2AKRA 3MU3A 5IBTL 2HRPH 3VA6A 3JCUH 3QEHB 4M7LL 5I6NA 3ABVC 3SBWC 4HYTB 2JELH 3IXAA 3Q0HA 5D7IE 3PAVA 3MCKA 2WTPA 1U8JB 2QEXP 3UTTB 2EXYC 3QHTC 1RF1C 1EHXA 3S9OA 3HC3H 2VLRE 4QF1A 4XCNA 5KANG 4B86A 3GHGC 3IJSB 2DEWX 3EOAA 3HCVB 3O8XD 7TAAA 1DD4A 4GRLD 2LXBA 1UWXK 3K1KC 3KPSA 2WLYA 1FV1B 2XYCA 3VX1A 3IKKA 3VVVA 4N0YH 3D85B 3EGSB 3EXLA 4Z7AA 1KIPA 1U8PA 1MHPL 3BZ5A 2N0KA 4TKWA 2JCWA 1BXUA 2H1PL 2XN0A 2XYBA 2E27H 3MRFB 4LDCA 4OTXL 4ZUSA 3BO8B 1E9PA 3CH1B 1JJUA 1NU1K 2YIUB 3K8KA 4PG9A 3LSOA 2CK0L 3QUHA 5AG8A 1MCPH 4GXVL 4X7SH 4RESB 2Y07L 3BDBA 1K8DA 3MRRA 5D6CB 2KERA 4HUVA 3VMPA 5DC9B 2HJLB 3P73A 1UD2A 5JR1H 4FNRA 25C8L 1CLOH 1FL6B 1PIFA 1I7RB 4OGAD 2I24N 1E4WH 4L4TD 1RZKH 4PRPB 1VA9A 3GDBA 3VGFA 1SXSA 3NJJA 2K4AA 3DX6A 4U6HA 3IDXL 4NXSA 1NWQA 4Y4HC 5EOCL 2BFGA 2P47B 4DN3L 4RMBA 5DUBB 3VRLF 2DYPD 1UWEL 3AWFA 3Q2WA 2BNQD 5T33H 1O7VA 5DMIL 3KLAA 3RZCB 1QO3B 3GXMA 5IW1B 1WCBB 4WU5A 4GKGA 2BVEA 4TL5A 5HYJB 3VD5A 1N5AA 3ROOA 1E3XA 3FBKA 3V0JA 3UTPE 3DARA 1KD1Q 3I9GL 4OZIB 3GB7B 3UYPA 3IBOA 4R97B 1AC6A 3G5YA 1OIPA 1AFVL 4K73A 2FJSA 4M6OL 5SX4I 1MCLA 2EDXA 2Z4TA 2W9DL 3DROA 4PBVC 4O9BA 3F64A 3MBED 2OMUA 1OSZB 4FXGB 2XU6A 2Z1KA 5DQJB 3THML 1GGIL 3ML9A 3QEQA 2IDCA 4PGDA 4L8DA 5KVEH 1OEZW 4JPIA 3ZE0F 3K6OA 4FLSA 5E6IC 4HF5L 3MX0A 2W0PA 1QBAA 3VYOA 4JO2H 2AHIA 3WNJA 3RK3E 2FL5B 2FT6A 2JCCE 4R26H 1S3JA 2LU4A 3NZ8B 2DDQL 2FIRT 4QWWC 1ZAGA 3QXVA 1AXTH 4ZXBD 5T1KA 3QIWB 3D4CA 3CPWO 1USDA 3PS6A 3JVFC 4W4NA 1DYZA 2YMOA 2MNJB 5K5GB 2AK1H 3QNYB 2DMCA 2HRGA 1B2YA 5LNEA 5I28A 5KSBA 3IFPB 1HQ4B 3P0VL 1SQQK 4XVSL 1IFDA 3UAJC 3F12B 4LCYB 4LLWB 1RP8A 4JAMB 4V2BA 3QAZB 4GBXB 1KB9D 2Q86A 3UO1L 1KZQA 1G2CB 1N8ZB 4XH2B 5T1DH 2WHVA 4OZGF 4MVBC 1ZHBA 2HXAA 5K93A 3MV8D 4JFDD 4BSVA 2J44A 4DTGH 2DYSB 4GLRH 2OYHA 3CFJA 4M7KH 5B1BB 3RTQA 2A83B 3HNVL 4WFFE 4NQDE 3F3HA 3TSIA 3TT3L 3EJRA 4BSWB 4IS6A 3TFKD 1XF4A 2FYYB 1VQ7P 3IM1A 5IB3B 4XPBL 4QAMB 4MJHA 1VACA 3O4LB 4UZUA 4QCIB 3MNZA 3T04D 4C55A 2RMNA 1H8SA 2R51A 2WKLA 3W1ZA 1TTAA 2H6PB 2FBJL 4GAAA 2Q76A 4ZQTA 2ZT9C 5HYIA 4GSDL 4MAYA 1GAFH 3MV9D 3TZVC 4BE5A 4GKSA 4Y8AA 4WFHD 5FDYA 2W6BA 1VADA 2F68X 1YJDH 4ODBD 2KQMA 2HN7B 5DJCB 5GRXG 1BEYH 1FHGA 2PP6A 4KQ3L 4UOZA 1TCRA 4PJEF 2XG5A 4TLUA 1BGXL 3CBJB 4LCCA 1YNLL 1EMTH 4H0GA 1BWWA 3WUWG 3CCJP 3K8LA 5C0IB 5I15L 2HVKA 2IYOA 3PP5A 1R0AH 3L74D 1IV8A 1DQLH 3KPRB 2GBTA 2R0LL 4A7QA 2QZ5A 4BQ6A 4JR9H 4OCYH 5GGRB 1WDAA 3FCSB 4HX1B 1ZLWK 3MMEA 3VRIB 3N85H 4DP2X 5L4FA 1CGWA 5AB0A 5DJ8B 1T4WA 5IJVA 3E6FB 3BQUB 3PDOB 3PNRB 3A47A 2ZYAA 3L95A 1LE5A 3O8XA 1BFVL 1JNNL 3CVIH 4E9LA 2XZAH 3GF3A 2EO9A 4GRLA 4P3DA 4F5CA 3SPGA 3KZ8A 1AKPA 3PGFL 1CD9B 4UV4H 2RR3A 1J1EC 4QTHB 5HHOE 2Y5TA 3MRLA 5JZ7C 1QSFD 1A9BB 5I76B 2BCKB 2BOCB 4AQ1C 4P59L 2Z91A 5DD3H 1JCKA 3QRBA 4H26A 4KJYB 1DLHB 4ORGB 1A7OL 1KJ3H 5DZVA 1OL0A 1HYSC 3CHRA 5B39G 2OMVA 4FQPA 4KNSA 1E3FA 4WKZA 3NCJH 3L3DB 4GIFA 1PGOA 3O41B 4XNYL 5IHZB 2Q8BL 3RVUD 3VMNA 5FF6A 2VQUA 1NTME 1HINH 1SMDA 1E9QA 1BLIA 3SQBB 3L72J 5EBGA 2H2PD 3L3IB 4YHYB 4BQ8A 3O4OB 2DYRB 1QRNB 1NDTA 4K3EL 3B5TA 1S78C 4L4TA 3S96B 3VXUB 2E8YA 1WA1X 2QJKB 3GSNH 1GVIA 4XPFL 1GW6A 5TF0A 1TDQA 3EYQD 4APXA 2DQIH 4D6TD 3N2JA 2K3TA 1A14L 3GPEA 3V0EA 2DYPA 5FGRA 4BQBA 1ZTMA 1VJSA 3SDCB 1KIQB 2BNQA 1CGVA 3I9AA 1A5FL 1R3LA 2X0WA 3CPLB 2OR7A 2E6PA 2W6JH 1I3RB 4GS7B 4XAKE 5FOBB 2I07A 4OGXL 4PJ7E 2QEJA 4YE4H 3VXSD 1SYVB 2NPLX 4WFEE 1KF9B 4LSRH 1OP3K 1CL7L 1MAKA 4BZYA 4GH7B 4GW4B 2B15A 5D5MF 2VMFA 4L05A 4U1IA 4WY4D 1TSRA 2KI7B 3WIHA 3P3RA 3ISRA 4JM2B 5ESAB 3RFZC 3QDMB 3MBEA 1JPEA 4HWBA 3VFWB 2IF7A 4N9OB 2ZUTA 2WXNA 3F04A 1U8LB 5EIIB 4JHZA 3WN5C 5CP7A 3MVSA 1FO0L 2QQNH 2QVKA 2W07A 5IK3A 3TJPA 4BFIA 2K37A 4N0UE 1NTZK 5F88B 5GRUL 2D2CB 3CSGA 2F74B 3HJEA 4PP2B 5FUZH 2ITAA 2WBJC 3LXCA 1FNLA 1S7TA 1BBDL 3GLDA 4M3JA 1P4BH 4NENA 2X2YA 3TA3C 3DMMC 3QDJE 4ZMNA 4PM1A 2Q10A 2FQDA 4ZXBA 4LHQB 2QFPA 1T0NB 3G04B 1NL0H 3D2UD 4XMLL 2CA4A 4U1NA 4B95C 1XH3A 1YEJH 4HEMA 4LFHG 4LMQI 1NLDH 3IDNB 1PGJA 4GKNA 1T1ZA 3LHPH 4LASL 2ADGB 2B87B 4NZ8A 3KVPA 3MV8A 4JFDA 2EDMA 2IWFA 3Q6GH 4N2OA 1YEFH 3HAEH 4PJ9D 3RJQB 3MRJA 3CN3A 2UXGA 4FL4B 4B27A 3O6ML 5I18L 1LM8V 4K71C 2IBZD 1XEDA 2N9BA 3QB7C 4PN6A 3QNFA 2J5LC 4ORZC 3UBFA 2UUDK 2VXTH 2W8CA 1HXYA 5ENWB 5F1OB 4R7NB 5TDOA 5CHXA 3JYCA 1KJVA 4ZBJA 5LWYL 3B43A 4H0LD 3EZ8A 4NO0B 3W56A 3GMMA 3CXHI 1EAQA 2DWDA 1C7TA 3L35A 1Q7YQ 4YBQC 4JJ5B 3TN0A 4AV0A 2Y0SA 3MV9A 3HUJA 1TU2B 1OT4A 3B9DA 4U2YA 5T3ZD 1TZOA 1JV5B 3MNVA 2ZNWA 5GS1B 3G6DH 5IQLA 3OMNB 4UQBA 5KYYA 1FZCA 3BPLB 1RFDL 5HDQH 5SV3A 4I1PA 2ZUXA 4GG6E 2YQGA 3OAKA 5KYWA 2G4EA 2Q9OA 3VTMA 5I5IA 3QPQD 2Z7ZA 1AGCB 5TE4H 3TF4A 2H43A 2ARJA 1NBVH 2MMXA 1K8IB 2G9HB 4QRPB 5DJZB 4LPYA 3FUEA 5F7EL 5LBGA 4K9EH 3LH2L 4S10A 3FTXA 2E75D 4KDWA 1NGZB 2AMUA 5I30L 2VLJB 1PNDA 1AZZC 2QMKA 2WMPA 3ETBF 3L9RB 2GC7C 3FCGA 3NCYS 1NBCA 2DLTA 5IQNA 1MOEA 2P49B 4M61A 1RLBA 3GRWH 3HHSB 4ZW7A 3KAAA 1RZJH 4M7ZC 3CC2P 4YVNA 1YMMB 2AKRB 4AJYV 2UYLA 1ZCRA 2FRGP 2AXGB 3KBPA 3VNYA 1F86A 1F42A 4GKZA 4QO1A 1AE6H 1QSFA 3ABZA 1CFNA 1J9RA 1KC5H 4Z8FL 1OHZA 4B96A 1TTGA 3MCKB 3Q7JA 1Q9LA 5CFHA 1N2RA 2HLFD 4Y2DD 1UJ3B 2WAQA 4X9BA 3NACL 4QF1B 2KNCB 4XCNB 3F00A 1OVZA 4XPHH 2WWNA 1MHCA 4DAGH 4G6KL 2BSTB 4OIIH 3Q5OA 2CPUA 3LZFL 3PQYE 5AOMA 4AH2B 3HA0A 3KPSB 2ZTBA 2YKLL 3OBAA 2O6DA 4LAJH 1T0OA 1U8PB 2IDQA 3IETA 1MCIA 3GMQA 2E43A 1P4LA 3FMGH 2LTQB 4ZUSB 5E4OA 1KB9K 4WI5A 1E9PB 1MRDH 4GEJA 1G9MC 3GF8A 4HJGB 1LDSA 4KQ4L 2DY2A 4PG9B 4ZMWA 3IGAA 1T66C 1WO2A 3GI9L 2DH3A 3CN2A 3BKMH 3ZIYA 3MRRB 4YXLL 5CBOA 1JFHA 1YPZA 4HUVB 5E51A 5T1LD 5E79E 1J0IA 3P73B 2NY1D 1QQDA 4XB3A 2JNZA 5F7LB 3VXSA 1JUNA 5BVPL 3D05A 3GWJA 3WFDH 3LKPA 1WP6A 5C9JB 4ZUWB 3DHPA 3BHBA 4B50A 2XQYG 4NJAL 5DFAA 5HJBA 5JQHC 5T5FA 4RFOH 1RZ7L 4WO4C 4WJ5B 2JJTC 2G5UA 4WY4A 3DX6B 4U6HB 4XMWA 1SNRA 3RVWC 3LOWA 1I8IB 4FYTA 2X7LA 5LGYA 1CGYA 4OCNC 3KLAB 1J9QA 1K72A 2CUIA 2C9UA 4YBHA 4FFWD 4WU5B 5IMKA 2BO0A 2DQFB 1NAML 4P5TD 2ZICA 1BA9A 2IGTA 1GXEA 1F3RB 4L3CA 2CHZA 1EFXD 3EH4B 1DBKH 3UYPB 2J8UF 4Z7WF 1NKNA 1QA9A 1SQXG 4X7TA 4EQ2A 3O6LH 1T5WA 4ENZA 3ULVL 2X12A 4XZUB 5D93C 3DROB 2A77L 1ZT4A 2OMUB 2PYEE 3OLEA 4LEXL 3QT2A 3QEQB 1KCRL 2OMZA 4PGDB 3LPGA 4M00A 1PS3A 1DO6A 2BVOB 3D2UA 4OLVL 1TXKA 4I48A 4JPIB 1OCZB 4EZLA 2NY2B 5BRQA 3MX0B 4ZODA 1KGWA 3CHOA 1EO8L 4JQ0D 2PYFA 2E7CA 3TT1H 4J3SA 3UTOA 7PCYA 5GS0L 4E2OA 1F90H 2XVKA 2R4SL 4IW4C 5DYFA 4HIPA 4B9ZA 1JGLH 2YAPA 3DGGA 4JKKA 4BKLA 2NQCA 1QPKA 4PJ9A 2XX1A 4PPTA 5CJ8A 5HVHC 2MPAH 3BN9D 4OD1L 2KKQA 3NIGB 9PCYA 1WQVT 4IRJD 4AKPA 5B8CB 5FYLL 1QR1B 2BLFA 5E9AA 2D9QB 5IVZA 3MSPA 4ZMXA 2X70A 4S1SH 3CD4A 1AVOA 5LCVA 3SBRA 4B9KC 5HHQB 4P9MH 4M1CC 1CE1H 5I6PA 3H2WA 2Q86B 4BCYA 2M83A 1ZXGA 2IPTH 3F7PC 3OLGA 2W94A 1ZHBB 1LGHB 1GYWA 1UUSA 1I8LC 1F8TL 4ZSOE 2EH7H 2VDOH 3E8UH 3RTQB 1RSFA 4GY4A 4BD4A 1GZHA 2QTVA 1HF9A 4S1QH 2B1HL 5DMYA 2H41A 4LSQH 2Y9ZA 4IS6B 4W9HC 1XF4B 1IBZA 3PE9A 1WK0A 4TTDD 5FYKL 4HEPA 4JG0L 5KANI 5TD4A 3CX5K 2RBLA 5I8OH 3CVHH 3F83A 1YCSA 5CEZE 2AXTE 1TJIL 3B1TA 4I3RH 2OS7A 2ZZUT 4LOVA 5DRZB 4KOBA 1FF5A 1RZGA 1YECH 3VFTA 3WTXA 3CXDH 5F3HB 2DWTA 5EULV 4GUCA 3IMVA 5ANME 2CIKA 1VADB 5I74B 3OJDA 1OM9A 4PB9H 3LXAA 2WSFJ 4A6YH 1P1VA 5HGDB 1G6RA 4PS4H 3ULAB 4ICXA 2X1OA 3AJ7A 2BJMH 3HRZC 2XG5B 5AOZA 2Z93A 3ATEA 4LCCB 2COQA 1Q9OB 4O2FA 2Y25A 4FZ8H 4FLOA 5D72H 2HVKB 1XR8A 2JJSC 1IBYA 1OZUA 4UV7L 2OJZL 4FEIA 4NERA 2Q3XA 1T6BX 3NN8A 3ISYA 3CFNA 1L0NJ 2VDPB 3SE8L 4AMKL 4Y2DA 2W6AA 1YEWA 3MMEB 3LS5H 3RWDA 5BO1H 2DJ4A 1ZE3H 2JKSA 4UTCA 5IJVB 1CZ8L 3L95B 4XN7A 3O8XB 3SE9H 3Q2VA 1Y47A 3ULUE 4GRLB 4WTQA 3MGOA 4RMVA 5IFHL 1A6UH 1MJ7L 4YSCA 1OSPH 3VFOB 5E9DB 3WU2H 1KDIA 2Y5TB 1W5CE 1JZ6A 3MRLB 3S3PA 2R56H 2ZKYA 1SQXE 2Q9IA 2VR9A 3GTNA 1BQKA 2Z91B 3GF7A 4YLQT 5EU7C 3G5VB 4I0PD 3QZLA 3D51A 2ZUVA 2OMVB 5DQ9A 1YNTA 2VDLB 3F01A 4WKZB 3H85A 3CC5A 3NDYE 4NN6C 4JYCA 5FF6B 4CSPA 1WFOA 2YARA 2EACA 4GI9A 2J6EL 1E9QB 3SOBL 1DX7A 3MR9A 1RF0C 1JGVL 5T1LA 4UNTA 5FWRA 5A16A 1QUNA 4LCUA 1KYFA 4RCAA 1F3DJ 3AQZA 4KTGA 1GYCA 1FJ1A 1QKZL 3GS0A 4YX2L 4L4TB 4QTIH 5D7IF 1XGQA 3RY4A 1CDGA 3VFGL 3FUJA 2GJ6D 1DVFD 2ZCHL 1HC1A 4OAWA 4WK0B 4O00A 2YAEA 1INQA 2DYPB 4R4FL 2BNQB 3KQGA 43CAA 3IDMA 2APSA 1BM3L 5F8QC 4JRFA 1EEYA 4P5TA 4OU3A 1F56A 4UBDD 4HHGA 2I69A 4RMTA 3UABA 1EFXA 4YWGH 1UOKA 2FB4L 4MBOA 4YDMA 4CGUB 3BPOC 4X8XA 4U1IB 2Q3IA 1F00I 3L70E 3H1JJ 5JYLA 3C09C 1JTTA 1TVBA 4FFVC 4YSDA 3S7GA 3OAZK 1NGMB 1MVUA 3MBEB 3T6VA 2LVEA 3RL1A 4OCSH 3RGUA 1PY4A 4OJFH 4J4PC 5A7BA 2LR4A 4BFIB 4QRQA 5KSVA 3N41F 1JTPA 4HT1H 3T1FA 1Z9LA 2V3FA 1T20A 3KLKA 2KOGA 3N5AA 1VQ5P 1WGOA 2FQGA 4NENB 5TK4A 4KY2A 4F7MA 4JFFD 1N3NA 1F4AA 1E30A 2CKBL 4ZXBB 4E9TA 3TA4D 2I5YL 3P7KA 3TF5A 4IRJA 4OZHB 5MENE 5CXPA 2ZOKA 1JWUB 2ZVOB 4NBZB 1DQKA 5ITFB 1VQ8P 1UM6H 1XH3B 3AY4C 3M9BA 1VGEH 3MXVL 3KGTA 3Q05A 5EUOA 1MG2C 4HPHA 4PJ6A 3H1KG 1R4XA 2HB0A 3H56A 2HT3D 5I1LA 1T1ZB 1N5YH 2WZAA 1AMXA 4P2QE 3MV8B 1CI6A 3ATBA 2PP9A 4IMLA 4JFDB 4LIQH 2WINA 4KI1A 3MRJB 4Q0XL 5DD1H 1JK9A 3HMWH 4FQHA 4KBPA 3ZTJH 1GZPA 2KHAA 3V4PL 1HXYB 1GKEA 1IT9L 4GODA 5CCHE 5TDOB 1KJVB 2C7UB 1KLUA 2BCCD 4IDJH 3GMMB 1J48A 3TONA 3HC4H 4PLKD 5EIVA 1SUJA 2DWDB 4MQ7A 2JCCF 4IKIA 3IPFA 4M3HA 3N1GC 2YIHA 3NCXA 4RDQF 4S0TD 3TN0B 3KHQA 3HUJB 4PBWD 4L1LA 5CINL 3RLSA 4N2GA 4EDFA 1GZQA 5FS5A 3E2HC 1Y8AA 3FH7A 3NFPA 4E9RA 4Z3GA 4OM1L 3RA7L 3K5RA 1UD5A 5KYYB 4PGBA 1MNUH 2Z31C 4B60A 1MCOH 2XVLA 4DQAA 1GS7A 4QR7A 1FZJA 5KYWB 4DP8X 1YTZT 1PPIA 4G5ZH 3QI9A 2BPBA 3EJZD 2ARJB 3OL2A 3FL7A 4P05A 4R7DA 1ECYA 3TVMB 2GCYA 5I2IA 2QVAA 4LDEB 4K9JA 4PS8A 1WAAE 4YHML 3WKPA 3W39A 1GMEA 5ID1A 3ELAT 5SWSD 1NAKL 1S72P 4FFZL 3VACA 1U8NA 3MO1A 2XJKA 2G30A 4R90H 3H1LD 4OGQB 4Y5XC 2I25N 1P7QD 4M61B 4LLAA 4JANB 5GISH 2L7JA 2R5BA 1JHLL 1IJ9A 1NQBA 5E5LA 2MOGA 4ILDA 2UYLB 4F2MA 3QDAA 1MWAL 2ERJB 4WY7L 3BEWA 3SJVD 4JF7A 4GKZB 1KV3A 3L5XL 2ZCLL 1QSFB 3VYNA 2F15A 1SBBA 4CILA 1PP9E 1BDCA 2F53D 4I0PA 4IRSB 4LP8A 1Q9LB 2EDFA 1N2RB 3RILA 1JZGA 2FECL 4BZ1H 4X0KA 1E4XL 2J88H 5DURD 3SYQA 3ZT6A 3VWJC 2UX6A 2RALA 4MZ2A 1L0XA 4EXPX 1V7ML 1PIXA 5JOFA 3BAYA 1MNNA 4OZIE 1SQVK 5L0QC 2QE7H 5LGHL 1LTIC 5AW9B 2GTQA 4O2EB 5APWA 1SF5A 1KXHA 5IM7B 4FKKA 1QX1A 1T7VA 2YLKA 2FWOA 3GMQB 1P4LB 3IETB 4RFEB 5JO5A 1AOZA 4KJMA 3QJZA 5DTFA 5HI4C 4A63A 4MRCA 3WNLA 2BSCA 3BIAX 2FJUB 2GJ6A 1DVFA 1EV2E 3CH8A 4YXKL 3IGAB 1OGAE 4EZMA 2WTRA 4U4IA 2VMCA 1NICA 4DERA 1YPZB 2JB6B 1IO4A 3ETBJ 1B88A 3BAXA 5GGVH 5JXEC 4YSQA 4XMKH 3VXSB 3H1KE 3UTSD 4CDGC 5FYKU 1IBGL 3PPSA 2Z64C 3BHBB 5TQ2H 1DJGA 4AV4A 4OWFA 4X6CA 3NPSC 4ZO7A 4LKCA 2ODIA 2B9AA 4WY4B 4RZKA 1BSIA 1T5KA 4FQ1H 1PFCA 3IFLL 5FHAH 4AGPA 2ZPKL 5CSBA 1B9ZA 4KY1H 5KLVG 2X7LB 2VZVA 3E8VA 1J1PL 4M1DH 2Y36H 2Y4SA 2UXFA 3HR6A 4UIKH 5IMKB 3T9WA 5ACZA 4C58B 2GHWB 2OBGA 1U30A 3S88L 3BDYH 4L3CB 5EU6D 5JUEH 2N1TA 1MY5A 3K91A 3CX5H 3H53A 4MAUL 4X7TB 4NJ9H 2NW2A 2C26A 1T5WB 2GAZA 3BASA 2X6CA 4JFFA 4Y8DC 4ZNCD 4JM4L 3O4LE 1ZT4B 1C12A 2IGFL 1HKLH 3S37X 3LKQA 4QYAA 1DSWA 1FFTB 4FXTA 4WGKA 3D2UB 3RWHA 4CU8A 3GJFH 1E4HA 1A65A 4PJ7F 3SYPA 2ICES 3TPUA 1PZSA 2CNYA 3GTVA 2ZWNA 5D1QD 4CRPA 1UIXA 3L7EA 2YEZA 1KV7A 3QJSB 4IOSD 2XRAL 3QQXA 5L8RJ 1AO7D 3DGGB 4KNTA 3ZK0A 4BKLB 5HDRA 1U6AL 3UC0H 12E8L 3KYKH 3QXDA 2AVGA 2VZTA 4GOEA 1DZ0A 5IVZB 3UACA 3GW6A 3RY6C 3VG0H 5GJSL 2R0WH 2X70B 3WJJA 5LQBH 1HJCA 5C3LD 1NU1G 4H0LB 2RJMA 3KPRE 2AEOA 4G9FB 1CICA 1H19A 4XP6H 8FABA 3FUKA 2JMRA 4ZPVA 5IB5B 4F2FA 1A6ZB 5EBMA 3JBG7 5DHVA 1FFRA 4Q97A 1P5VB 1IGYA 4TUUA 3TO4D 4R7LA 4JLRA 2YFNA 5CJ5A 2J8OA 3W3BA 3W11C 4PJIE 1JAEA 2AXFA 1Q1PA 1J86A 2PTVA 1FE8H 3AWGA 5CZXD 3ZSSA 5LG6A 4FYRA 3TWCL 1MJJA 1HH9A 4OKVA 1KWKA 1OGPA 3B9AA 3GKWH 2VGLM 4IOIA 4LKXA 3O9WD 1JHTA 1C16A 4HUXA 3MLVH 5BU5A 4R8WH 1LTTC 1RZGB 1UT2A 1V3KA 5DUML 4P4KB 3VFTB 4BUHA 4G5AA 4YMPA 5I23A 2CIKB 2E75B 1JPGB 5DMJB 5SWSA 1T2KD 2APXA 1ZEAL 4U49A 3BP4A 2IH9A 3FPYA 1JZIA 1RAMA 2MQ3A 5TTRA 4AYBA 3FQXA 1X5IA 1G6RB 1S7WA 4ELMA 1P7QA 4MB4A 4ZO8A 2MQCA 3GUTA 2IWKA 1A2YA 4BCZA 2Z93B 1PD1A 2PTTA 1UATA 4X50A 3CL3D 3SIKA 1GYVA 2WXOA 3CX2A 3KZIH 4O2FB 1IAIL 3VXUE 1HCYA 5H2BB 1XR8B 2WLJA 3SJVA 2DIEA 3NN8B 1PEZA 2A4EA 3G9AB 1FVCB 2F53A 2CR6A 4RBPH 1SQPJ 3N42F 2A06G 3L71D 1ZT7A 3RWDB 5J89A 4GG6F 3Q1MA 4HK0A 3V2AR 3E9TA 5MHSE 1JV2B 3WE1A 3VGHA 1UXSA 4LRIC 3MGOB 2SODB 4HIXL 1LJMA 4JN2A 4L74A 3OKLA 5G4OA 2APVA 1SQQG 2YD5A 3IKCB 3GSOA 5D9SA 5IT2H 4R5VA 3RPBA 4IRZL 2NMSA 2A9BA 2HTLC 5DHYA 1UZ8A 1KCUL 5DQ9B 1YNTB 4EBQL 3CFDA 4PV8A 4AVJA 4FLHA 2NW3A 5LLIC 3P11H 1ML0A 4R7XA 4M6ML 2AJXH 3N9GH 1AY1H 1OPGH 4WHCA 3RWIA 2WLMA 2FX9L 3ZL1A 5T1LB 3C8KA 3SN6N 1FL5A 5A16B 4G6ML 2GPZA 1QEXA 5F7WC 3UTSA 1AS8A 4DEUA 1V10A 5ILTL 5AD0A 2OK0H 1WUZA 2WQAA 1XGQB 4U3FD 3U25A 3CFCH 3OAWA 4G3YH 4OB5L 4H7VA 4R2GC 3W9DA 2ZQKA 4OAWB 1N73B 1X5YA 4GEIA 1V3LA 4V33A 2F5BL 3V6ZA 1L0QA 1NIDA 3ARRA 1IBBA 43CAB 3IDMB 4N90D 2VR7A 1NCHA 3LNGA 4P5TB 1T22B 2EYTA 2YPVH 3PWJA 1MHEA 2ZYGA 3F62A 4FEMA 3BCCE 4L5FE 4S1RH 3H3PH 3BZFB 5GGUB 3WFCL 4KK9C 5CGMA 1D9KD 1ZVNA 4FNTA 4TUKH 3FB8A 2FO4A 4U6VH 2C9VA 5H35A 3BRTB 1A7QL 2E9GA 4AGOA 4EE2A 4CC0A 1TVBB 1JOIA 3EFFA 1MVUB 1WBXA 3X12A 4ZNCA 2NXYC 1K4DA 3RL1B 3G6JB 2X38A 2HJKA 2PETA 2X4NA 3POCA 5KSVB 1M1SA 4QRQB 4WUUD 3EQ2A 2A45I 3T1FB 1QFUL 1U95A 2BZDA 5D7LD 2YMXH 5IVXE 1JRHH 3HMXL 1T20B 4HG4K 3WNKA 4XXWA 2WXGA 4IIQA 4TQIA 4UB0H 1W2BO 1L7IL 4R4NC 4IOSA 4LLDA 4F7MB 1AO7A 3S8WA 3GDCA 4APQC 3NZHH 4OFVA 5BV7C 3SDDD 1KJ2H 4IRJB 4CC4A 4MRBA 1BE3E 2ZOKB 4YBLC 3KPNB 3T4AA 2OMWA 4A68A 4XNUL 3ET9F 2R0KL 4G6JL 2XY1A 5C8JA 1BJ1H 3KPOA 1LHZA 2PN5A 1YEGH 1CGSL 5EUOB 5DR5H 5I1LB 3LKSA 3KJ4B 2FTAA 3KVDD 4ODVH 1R3HA 1VQ6P 2K9UA 1J8HE 2EZ0D 5FX3A 1JIBA 2WINB 2UZIL 5LXGH 2A06E 1JK9B 2XUWA 3TO4A 1B3IA 4FQHB 4KKCC 1NH6A 2WV3A 3MOAH 3VD1A 3DK2A 1CR9L 3NAAL 3L75D 1BSHA 3PV6A 1KLUB 3GC3A 1FN4B 4LU5H 1R47A 3DX3A 3O9WA 1EX0A 5E8OA 4MQ7B 2BSDA 4HUMB 3A24A 5BJTA 3LDBB 3PL6C 1DQTA 3H6AA 4LVHC 5AW8B 1GZQB 2J12B 3IWVA 1RUQL 3G08A 1X22A 2YQ3A 3S2AA 3VGGA 5ADOL 4POZC 4NEHB 4PGBB 1QGKB 4CVUA 3EGXA 3OJVC 3KPSE 4GUPA 4KC3B 1GTFA 1FZJB 4UYPA 4M1GL 1OAXH 2P44B 4H44D 4P23C 1FAIL 2XV5A 3QI9B 5C2UB 4R7DB 1KG0A 3Q8EA 4ANUA 2GCYB 5I2IB 2OULB 3QQ9D 2EDEA 3UJJH 4I9XA 2X28A 5ID1B 3H8NA 1VFMA 1NTZG 4P46A 3AE3C 4HLJA 2Y2TA 1S7XA 3CMOL 4F9LA 3IMBA 1U8NB 3MO1B 4WW1B 3IJ9A 1PCXA 3FTVA 2Z92B 1MRFH 1UA6H 4ZMZA 3HOGA 4JDTH 3BW9A 4F2MB 3L72D 4J2XA 4G11A 3HEIB 4PIBA 3BEWB 4MXVE 2JXMA 3D39D 3BRDA 1MZ9A 1MKFA 4KXCA 2D31A 4K3HA 4KRLB 3R19A 3FB7A 1RQ5A 4Z7IA 3UP6A 5ETUA 4H4NA 4X0KB 5DZOA 4TN9A 3CJJA 1MCCA 1U2HA 2NPSC 1M1XA 2ARWA 3QIBC 4GMTH 2LW3A 3SDXA 2E5EA 2F5AL 1ADWA 3RBXA 3D2TA 5F7MC 1EHNA 3F7RA 4C7RA 2NXZC 4NIKB 2DTMH 3Q6FA 5KW9L 1W6WA 5HI3C 5JO5B 2FWOB 1CIDA 4PJCA 4ZX3A 1G9MH 1T5XA 3O6FC 1ZA6A 3STBA 3INUL 3NSJA 4L4JA 3S2CA 2GJ6B 1DVFB 2VDQL 3I74A 5CP3H 2WTRB 4JB9H 1S9KD 3I6SA 4WEBL 3SGEI 3CZJA 1T4KA 2PPDA 4PJ5D 3RQ3A 3ULUF 3E7KA 3EOTH 2AQ2A 4NHUA 3V0DA 3BYTA 4CMMA 1NTDA 1A64A 4OD3H 3KCWA 4YFEA 4CN4A 2E7DA 5EU3A 2V0AA 1QOKA 1PY9A 1XIWC 3NIGE 1D9KA 5I5MA 4U3SA 4LKCB 5KSBE 2DQUL 2PPAA 5JXAL 1WTGT 3CFEA 1S7SA 3EHBC 2WPRA 1GA2A 1JS4A 3M1OA 1VFBA 4KZEH 2GJRA 2ZUQC 1NCCL 4PEEA 1HEHC 4E9YA 4X6DB 2R8SL 3L6FA 4K55A 4FERA 4WWOA 3EYSL 3BSZA 4WUUA 4OGYL 1MFNA 3QZBA 3M0AA 4WB4A 5D7LA 4HC1H 2N1TB 4OJYA 2MCAA 3FTZA 2GAZB 2K3HA 1AHWA 3I5CA 1ONQA 2AQ3A 2R7EA 5AYUH 1U57A 2V17H 1C12B 1HHGB 3N44F 3AEGC 1N7SD 3SDDA 3LKQB 3TIDA 4KKNA 3ZZLA 1UB6A 3B2PA 1JG9A 3RWHB 1A1NA 1IKFL 5HJ3A 3VMYA 2BSSA 2X89D 1HL5A 1JTHA 2VH5H 5GRJL 2M2DA 2OAAA 3K7UA 2DLGA 4P0DA 1RLWA 2A0LD 4R9HA 4Y5VC 3L7EB 1EVUA 2HPCA 2YEZB 3HE6C 1KCVL 4HJTA 1A3RL 1I1AD 2V6HA 4OIFA 4B9YA 1M1KQ 1M9WA 2ALAA 2HKHL 4Y9BA 5T3XH 1J05B 1ET8A 1HQRA 1W2KT 5D1ZD 4HUKB 4AG4L 1E3ZA 3QXDB 4MYPA 1Q38A 2PUQT 3H4FA 1D3CA 4L9LA 3STZA 4HXBL 1HXKA 1UACH 4ZMTA 35C8L 4MMXC 3H1ID 2FZ3A 4KITB 1CICB 1NTMJ 3B7SA 4JK0D 3DTUB 1ZY9A 2O6FA 4BGDA 1U2YA 3CPUA 1MELA 2HODA 3B37A 1Q0XL 5DJTB 4NNPL 4DGWC 1CDUA 1FBIL 1DJSA 4NN7B 4W93A 4NUGL 4LRNH 3SSUA 5LAXA 4PHXA 4BWNA 1CJYA 3QQDA 1OTTD 3OG6B 1CLYH 4JHUA 5E4EB 3WEXA 4F5CE 5KJRL 2XFGB 2AXFB 4TF4A 1LK3H 5D6DA 2VXUH 4AL8H 4OKVB 1YYMH 1JGEA 3C6LD 3VJ6A 4IOIB 1CUOA 1IRAY 4UDUA 3UDWC 1DLFH 1H15A 3RU8H 2M26A 1JHTB 4JFOA 4F7EA 1C16B 4HUXB 3TP4A 3KS0J 4JGJA 7FABL 5FM4A 7CGTA 1JF5A 1HHJB 3CIQA 4WI0A 4WSJA 4P5KA 1PNCA 3ILPB 4JG9A 3ULSA 2ZKXA 5SWSB 3R06A 1XB3A 3K4DA 3BP4B 3QSKB 3H9SD 4NC0B 2CLRA 2P8PB 3O81A 1P6WA 3GZOA 5D8JH 1TJXA 5K9OA 1FGVL 2D7TH 3FQXB 4ELMB 1S7WB 1P7QB 2D0HA 4KI5D 4RFNB 5D70H 1H89A 3QZWA 2XIDA 1A2YB 5H4YA 3UG4A 3N0AA 2PTTB 5BZDA 3M17A 3INOA 1WRGA 2E74D 3NJHA 3SJVB 3D39A 4XE5B 2V2XB 3D0VB 3L08A 2RB8A 1ZWIA 2BNQE 2F53B 3EYOA 4RLDA 1ZT7B 4TNFA 5GZOC 5I6XB 4CU6A 4FQXC 4HK0B 2EKSA 5B7EA 2H7HA 3F85A 2I60H 4LGSB 5IKCA 2AI0H 4FQCH 1UXSB 4PUBL 3OJMB 2CE6A 2NX5D 3QDHA 4IMKC 4DOHB 4Q74A 3SE3C 4RISH 4JN2B 4GRWH 3SDYL 3ZVVA 4ETYA 3MCLH 3OKLB 4LARH 1M2OA 1WAAF 4FA8A 3GSOB 3CD6P 5CR8A 3CSYA 4JG1L 4XN2A 5D9SB 5JW4R 3WKMH 1GK6A 1X8YA 3AG1B 5LAPA 4BINA 5KN5A 4IBWA 3P3UA 4CBZA 1JGDA 5DHYB 1MCSA 2K78A 3CFDB 4PV8B 2NYKA 3FCUB 2NW3B 2BK8A 4BWWA 1XGRA 5J12C 3OR6B 5KJ7D 5E5MB 4PJ5A 2YKPA 4PJDA 4WCYH 3C8KB 1KCBA 3PXHA 1FL5B 5AOJA 1UTDA 3KPLA 3KPQA 4OLYL 1NEZA 3ME0A 5AD0B 1OY3B 3SCMC 1L6XA 3AREC 4KDTA 3IRPX 3UIZA 1NYHA 3HS0A 4FFTA 3W9DB 1N6UA 3GK8H 4Y99B 4QXUH 3L5WA 4HLZG 4TVPL 2KMWA 4HEME 5IQ9A 3U2IA 1PD6A 3V6ZB 2A74C 3IFOA 3IU4H 2FX7L 1HZKA 1KB9E 2B59B 2EQDA 4LLMA 1A21A 2F54D 2XXCB 4JPVL 2A4ZA 4PLJD 4U7KA 5BQ7A 2R32A 2P43B 4FQIH 4CL7A 3ARFD 5KVDL 3MV8E 2EYTB 4JFDE 4OFPA 3PWJB 3LW5H 2JLLA 1MHEB 1SXZA 1QFWH 4OY9A 5LBSA 1N8RQ 2FSDA 2KDGA 2R9HD 3IEAA 2J59M 4QIRA 2ZAGA 4BWTA 4LT7A 1O5PA 2FO4B 3ZZSA 5H35B 3G3ZA 5IV2B 4N2MA 5FUOL 1WBXB 3AEDC 2BC4A 4WUKH 3X12B 5E2VL 4FX5A 1K4DB 4KHXL 1NMBH 1N7SA 3ULVF 3IYLW 4LQFL 2HJKB 2FIKB 1WC7B 1JY2O 3QVAA 3N43F 1UGKA 2VDMB 4QHMB 1YEKL 2X89A 2P7TA 1IILE 3HUJE 3MV9E 1U95B 4FZEL 4DPBX 1WT6A 5ELIA 4WFHE 3ILEA 5EFWB 1F6AA 1CFSB 4KKZA 2P24B 3QYMA 3CVBA 4IIQB 3AQYA 2QKIA 2CGYA 4ATTA 4LLDB 5E6SB 3UTQB 4H20L 3V4VL 1AO7B 3W68A 3RI5K 3CLEL 1QLEL 3QJVB 4ELDA 2CDGA 3NG5A 3SB3A 4FHJA 4UU9A 2EXYD 3CHPA 5FECB 3EYVA 5A2IH 1JXGA 3K4AA 3T4AB 1CDIA 4C83B 4AV5A 3L74E 5C8JB 2Q0ZX 3VXTA 3N40P 4YDJA 3APMA 4WHYG 4Z0BH 2VQTA 1NMAL 4C47A 3QC6X 2CJSA 2KL6A 4ZMLA 1R3HB 3EOBA 2IFFH 3U0TA 2IBZG 2F6AA 3A0HE 3TO4B 1WJ3A 4YHOH 4Y88A 1KXVC 3ZE1B 4RWYH 1FP5A 4RIRA 1JK8B 2GSGA 1NBZA 1U3NA 2VDMH 4NWTL 1ILSA 3EYUL 3MGAA 5HDLA 1AAJA 2VUYA 1LEIA 5D1XB 3PV6B 3ARVA 1QLFB 3IFNL 3C6LA 3F6JA 2XN9D 1TQBC 5CN3A 2YGNA 3GJEA 3DSFH 1L5GB 2WYIA 3VM5A 3CWGA 3O9WB 1KY7A 4RSVA 5E8OB 5ECGA 3RZWA 2FJHA 5BJTB 2GIMA 4G82A 3VQLA 1YBKA 2OCFD 1IE5A 1QBML 3OWEA 4HJEA 4M3LA 1MCWW 4H88L 4PRAA 3FFOA 3G08B 2XWTA 1FZKA 4HCRA 4HEPG 3H9SA 4Y4HD 3KDMA 1ICTA 4AGMA 1ZLEA 2OR9L 3EGXB 4GKOA 2AJVL 4GUPB 1ZD6A 1E7VA 1TPXB 2E7MA 5L88H 4FI6A 4JO3H 4PQXA 3H25A 1TETL 3GD1C 1I8KA 3N1QC 3OKEB 1KG0B 2FECI 2J55A 4HKZB 1IGFL 5D2LA 2VERN 3MGNA 3JWDC 3O2VL 3MV01 5HHMD 4HXAL 4D6TE 4ANXA 2BY3A 2V8MA 4X80H 4GMSL 2IG2H 4P46B 5CCKL 3VW3H 1UZGA 4JZJA 4PJIF 1EO7A 1GYUA 4HGWB 1KNOA 3H4HA 1SJMA 3QXAA 3VXSE 1MREH 1IZKA 1MW1A 5I1CH 1NUNB 2VR5A 1C5DA 4DW2H 1D5XA 3IVKA 1NGQH 3K6DA 1CK0L 1UWGH 2NX5A 3PNWA 2KS1A 2A6DB 3U7WH 4DZ8A 5E6YA 5C0FA 1KBGH 1TJHH 5E6ID 4FABL 4M8VA 3FT4A 1XB6A 1A6AA 2VUKA 1ZR2A 4GYBA 1TVHA 1YQVH 2D31B 3T5WA 4XXCC 1IEAA 2VRAA 3GSWA 3FB7B 3MRCA 2GG1A 1MJ8L 3E1ZA 5ETUB 1MEXH 2H0PA 3D34A 4QWWD 2GYSA 3TS8A 3BYYA 3HN5A 4U3HA 2X5PA 1HAWA 1PZUB 1M1XB 3M8OH 4EQ3A 4J6RH 4YC2C 4ALAH 5KJ7A 3SY6A 3L4TA 4Q6IC 1C8PA 3QW9A 3V6BR 1DBAL 4Q9RH 4NNXA 4K94L 3WXWL 6PCYA 1OCWL 4OQTH 4MNHA 1G1JA 2LE9A 1XF3A 4XPTL 4BQ9A 1T5XB 1I9JH 3IRCA 1ZA6B 2H88C 2XV6B 3EJSA 3SBPA 2WXRA 1F4XL 4KVCH 2BERA 1Z6JT 1VQ4P 5C0BB 4HFWA 4KGJA 3IGUA 2CH8A 3QEGH 4LVOB 1BZOA 4PRID 1D5IH 1T4KB 2JJLA 1PZ2A 4RRPA 2VDRB 4XCCL 5GGTA 5I1JL 5EZIL 3ZN6A 3D18A 4NHUB 2EXTA 2F54A 3E6HA 2PR4L 4CMMB 3ARFA 3H2QA 4M4RA 4LOFA 3VTPC 1ROWA 3K0YA 1Y07A 2IBZE 1KXTA 3EO1B 4U3SB 5KVGE 4G72B 4AKQA 3DNKA 5CU5A 3TZVD 3CFEB 3VYPA 1UCBL 1S7SB 3JWOL 4D0CB 1BQHA 3GZPA 4MQTB 1VFBB 1FJPA 2H3XC 3ZDXB 4GNKB 2HRPL 4M56A 4Y2LA 2PO6B 1U3YA 5I5JA 3TYGH 3L6FB 4X9GA 2K6ZA 1KV4A 1T2QH 5GS3A 3SPJA 2V7HB 1D2PA 5T3ZE 2HA1A 5D7LB 5GHWH 3IFMA 5CIPA 1JNMA 2PXYC 2P5PA 4QRSB 3HC3L 3RPKA 5F0PB 4AYCA 4AIZA 1UB5A 3FU6A 2EC8A 5I75B 1AHWB 2J58A 3RVVC 2R7EB 1EZVD 5APTA 2G0LA 4FCAA 3TEUA 1PDKA 2Z7WA 5T8IA 3SDDB 3TIDB 4H25A 4I2XA 1RF1A 1UB6B 2GSMB 4N26A 1X9LA 4AC2A 1A1NB 4N0YL 1PFIA 4GW1A 2OV0A 3VXRE 1ETZB 3GHGA 2BSSB 2VMJA 2WAHA 1GPOH 1JTHB 1KIRA 2E27L 4NO5B 4Z7WA 3VFMB 3AXHA 1SQVG 2ZX8A 2V2TA 3GFUA 3KBEA 3O3DA 5JZ7D 1MCPL 2FFDC 1KCKA 1DVXA 1TQWA 4X7SL 2R23A 3EBIA 1ZPLA 2V7QH 2C3WA 2FEJA 3NCBB 1IFJA 1M71B 3GXIA 2ED7A 1HYSD 4PJ0E 3AFLA 4I85A 5JR1L 3OSVA 1CLOL 3STZB 4AZ8A 3AEAC 1E4WL 2FZ3B 1RZKL 1LYQA 1W8EA 2KXPB 5CBAA 5DO2C 3U4AA 2UX7A 4H8HA 4XBGA 5J6GA 2EC9T 2XN9A 5IVXF 2FH6A 4EI2A 2HODB 4TQPA 1OALA 2CAKA 3CDFA 5J5EA 3PJSK 5H2FH 2WQYC 5I1GH 5T33L 1AVYA 1S78D 4NLHA 3SODB 3HD7B 1RH5B 2J1XA 2J20A 2K45A 1OQXA 5DQDH 1WEJH 3QQDB 2QADC 4NRYA 3IAPA 3Q44A 4NQEE 2B0SH 4YE0A 1J18A 1TR7A 4KHTH 3U9WA 3IB4A 4JQXC 1JGEB 3VJ6B 1G0YR 3GHBH 4ZAKB 4TXVB 3ZMNA 43C9A 2L3BA 4H44B 3D1MC 2OYIC 1H15B 4F7EB 4BUGA 4JDZA 1MW3A 3ARSA 3I84A 4TQEH 1RCYA 3S3DB 4WI0B 4L8SC 1AGDA 3QUMH 4P5KB 1KTDB 4K35A 2NY0B 2Y2WA 3ULSB 2VYRE 4RA3A 3QISA 1IFNA 2X4OA 3B34A 2CLRB 4UQ3A 3L70J 5K9OB 4JO2L 5C09D 3QZWB 5L7XH 3LQAH 4R26L 2BZCA 1C8QA 1XF5A 2BSED 5JPNC 3CK0H 2ZWYA 4W6YB 1USEA 4BDVA 5BZDB 1KLGA 3FJTA 2X4PA 1AXTL 4I3GA 1T80A 3M17B 2QJPC 5E6IA 3D39B 4DP1X 3OVUB 3AY2A 4PJEA 1PLCA 2AK1L 3P40A 2EDLA 1PD0A 2WBJD 5AVZB 4JHWH 3H1HG 1ZWIB 4NWUH 1BFOA 1F58H 3EYOB 3BFQG 3TA3D 4Y9CA 4LSTH 2EKSB 3RGHA 1RIVH 4GIOA 3FUMA 5IKCB 3GXDA 2QGBA 4MX7A 5T1DL 3TTYA 2JQAA 1IGMH 2OTKE 4DTGL 3V8CA 1ZTXH 4M7KL 4DEPC 3RVTD 2VDKH 2WXQA 1D2OA 5I8KH 1BAFH 2IFGA 1N26A 3IAOA 1LILA 3CSYB 4MFHA 4N8PA 5E8NA 5KN5B 3U46A 3VUAA 5HPOA 1VL2A 1JGDB 2F19H 4MJ2A 1LWRA 1FZFA 1V5JA 1XGRB 5L2KD 4PRIA 3WUUA 1E4KC 2IALB 4PJ5B 1QFPA 2ZOLB 4AGLA 1GAFL 3KPLB 1P9MC 5KBMA 3KPQB 5J1AA 4MXVF 4X8JA 1NEZB 3B5GA 4OH8B 2BVTA 2Q1KA 3ME0B 1YJDL 3LTVA 5CEYA 2DPKA 2WNXA 2RACA 3QAQA 1BEYL 3GKZA 4TRPH 4HULB 5CBNA 3B3BA 2CXGA 1DBJH 3GBNH 1DBMH 3KM1A 3L5WB 5AW5B 5F7DA 3ZT7A 1EMTL 5IQ9B 5KAFH 1O6SA 5CBEA 3L9YA 5EUOE 1R0AL 2A99A 2FE0A 4LLMB 5FO9A 2O5XH 1DQLL 3JVGC 2HMIC 3WKYA 1E6OH 1KB9I 4JR9L 4OCYL 1JY2P 1MCHA 4DP5X 1AOHA 1IFGA 2XU9A 4NFDA 4ABUA 3N85L 3IF1A 1CURA 3U4KA 2C3HA 1UD4A 3FQWA 1K2DA 1SGKA 2HJFA 2VMEA 5C6WH 2XPZA 2Y7QA 1A3QA 3CVIL 2W38A 2D7NA 2XZAL 4OF3A 4U0RB 2BC4B 3D3VB 1ZP0C 2X44D 2XICA 3QHZH 4PU2A 4R4MA 4UV4L 1LO3H 1N7SB 2BIIA 1L4AC 2DM7A 1ZHNB 4NFBA 2J5WA 2XTJC 5DJDA 2P7TB 3OG4B 4OGZA 5DD3L 2RCSH 1TKWA 1LJ2A 1KJ3L 2CNZA 4M8RA 4UT9A 5F7BA 3FYIB 1F6AB 1W72H 2R69A 3NCJL 1AA0A 3NIGF 3RRQA 5E24E 1IEHA 5KSBF 4J3OF 3BZ4B 3KW7A 1Q82Q 3BGMA 2LKMA 1ED3A 5DK0A 3UIYA 1HINL 5BV7H 2E4TA 3D0LB 3EO9H 4X7EC 1T1YB 1DCEA 5IHBA 2CDGB 1PP9J 4R5XA 3DYPA 2DBJA 1CS6A 1K04A 2IAMB 2OXHA 3M7OA 2X2JA 5EUKA 1LMKA 5C86A 1ZV2A 3EYVB 2ZX6A 3ROLA 1A25A 3NBNA 1NCGA 3FT9A 3LKNA 1BG1A 3H3KA 5E03A 2VXQH 3QDGB 2WUBH 3VXTB 3GSNL 4KJQC 2JLPA 3RVXC 2FDBP 4YDJB 4AEIH 3IJ8A 1RJZA 2DQIL 4PVNA 2OTPA 4N8VA 5DS2A 4IJTA 3U0TB 5I73C 3B2VH 4WSGA 2ENYA 2VR4A 4XNQB 5AB9A 4RIRB 2GSGB 2WO3B 1CDCA 1NBZB 4YE4L 4F2ME 3MIWA 5FYJD 3BWAA 1RURH 1T66D 4LSRL 3SYAA 3OPZH 1LEIB 3QUXB 3I56P 4CN1A 4XVJH 2R15A 2MPVA 3GJEB 3OAUH 3L5IA 1PSKH 3VFUA 4PJAA 4EJ1C 1X3DA 2Q3EA 2JI1A 1M53A 1VZIA 3EH5B 4KXAA 4UQAA 3V0HA 5CGBA 4PWJA 1LWUC 1OZHA 2TRYA 4NPYA 4WO4D 4PRAB 2XWTB 3QH9A 1FZKB 2IAND 2QQNL 1SQPD 3CV5A 3H9SB 4U1GB 4M8UA 3RVWD 3US9A 2CCLA 3QWRD 2R29H 5C09A 4MQSB 3TASA 5FUZL 5FKAA 1MCJA 1P4BL 2BSEA 5FCUH 1I8KB 5LN4A 4DH2A 1T03H 4JPKH 3WN5A 3RX5A 3B4SA 5FKPA 2E74B 2ADIA 4XGZA 3Q2YA 2GJ6E 3SGJC 4ZG1A 4S0HA 4C57C 1NL0L 1GYAA 1H88A 1X7TA 1HOCA 2WBJA 1RSYA 2NY4C 3DGDA 3H1LG 1QI4A 2B5IC 1PY0A 3TC9A 5KBPA 1KB3A 4W9IC 1XH1A 1YEJL 2B8OT 3DGCR 4ZPTA 3TA3A 4UILH 1NLDL 3WO4B 3QXAB 2GB2A 5B1JA 3V2RA 3FDWA 1RERA 3LHPL 2XCMC 3V5KA 1C5DB 3TO2A 5FFOA 1D5XB 3UERA 3IVKB 3PNWB 1XFPA 2NX5B 2KS1B 4DHLA 2FK9A 3Q6GL 4X6CE 5C0FB 1YEFL 2ZSWA 1N6VA 3OHXA 3UZVA 4D3CH 2IPKA 2GJZA 3FT4B 1A6AB 1WZ1H 4U33A 4EUPH 4YL9A 1IEAB 1F1AA 3GSWB 1TNMA 2VXTL 3GBEA 3MRCB 4I4WA 4LHUD 3RK3C 4N25A 1MCKA 2DWXA 5IROA 2YFOA 1R5VB 3H42H 4OF7A 4KROB 4NBYB 2YWZA 5L2KA 1V05A 5JW4M 4KOCA 1ZA3A 1CPUA 1TIUA 3OLIA 4G1EA 4LDOB 5HVWA 3PJSB 4HP5A 3ZDZB 5K9KA 2JKTM 1I3VA 3DX1A 4NNXB 3L3OB 3G6DL 4M1CD 1SN5A 4JFFE 3CWBJ 4MNHB 1KBVA 5CJXC 5HDQL 4N2EA 1UT1A 4NP9A 4A37A 5A2CA 1BQRA 1XZWA 1M3IA 1Z1WA 4AYMC 3S3CB 2WWKO 3J07A 4HFWB 4HPOH 4ONHA 5TE4L 3D69A 1NJIQ 1KCSH 2XBDA 4LE8A 4OZFA 1NBVL 5KVMC 3P4MA 5DRWB 2WQUA 3D18B 5TF1H 2WXKA 3E6HB 2F54B 2WYTA 5JDSB 1EH9A 1X5MA 4K9EL 1AVAA 4GIPD 3ARFB 4ZS6D 4M4RB 3STLA 2R5DA 1VERA 4WWPA 2NSXA 2CUAA 5AW4B 4UB8E 3NJGA 4AE0A 2QTEA 4F8OA 1YMHA 3RJDA 2JF1A 4PYHA 3GRWL 2BXYA 3WL9A 3SO5A 2H89C 4K3AA 1WZKA 3PHOA 2IBZI 1K05A 1RZJL 1XGZA 2WT7B 3D4ZA 4UNIA 2IOIA 2BCCE 2OKMA 2UXVA 4YPGB 5EORH 4YDKH 5BW7A 4JY6A 3T8XA 2AK4D 2P5WA 1Y1DA 3WNMA 1AE6L 1HL4A 5F1KC 5HHVH 3QIUA 1MUJA 1KC5L 3QULA 3KXDA 4B3EA 4Z23A 4ERSH 4RSYA 4ZJ9A 3OKOB 1BZ7A 5CCJA 2KZWA 1XF1A 2K7QA 4AIZB 4XPHL 1UB5B 4DAGL 1ASOA 2A6KA 4OIIL 3O3EA 2DD8H 4WKXA 3WDHA 1PDKB 3BUQA 4XB8A 4H25B 2B1AH 4G8FB 5KUKA 3ISWA 1EEZA 4J8RA 3OXSA 4CNIA 1ES0A 3GHGB 1B4TA 3DHMA 3FN3A 1KIRB 3FMGL 2F8VA 1R3KA 2E9WA 3DX8A 1I9IH 4Z7WB 1MRDL 4L9DA 4O02A 5AL0A 4RMQA 1QI3A 3MKKA 5SWSE 2UY7A 3SPIA 5IJDC 1U3HB 2V2TB 1T0MA 3BVVA 1WS8A 2R23B 3WE6A 3K2KA 2X6AA 1SY6A 3H1LE 3BKML 4ELME 4AXWA 3AG4B 4FNSA 1A0QH 2E76B 2VLMD 3WFDL 1Q0YH 5KVEE 3NSFA 5CBAB 3SJVE 2EUZA 1RZIA 3K74B 4RFOL 1F45A 2XN9B 2ZWSA 3HNSH 4F80A 4DK5A 3LN9A 1BVKA 1BQUA 1WWBX 4NKMA 4J2QA 1FDLH 4RJTA 2B77A 4NCDA 1J9SA 5C0CD 1OAUH 5TDNA 4WO4A 2JJTA 2XQBH 4OZGB 2IANA 3QO0A 4LZKA 1YJNP 2ZYIA 3QWRA 1DBKL 4FHBD 1WZLA 1CXEA 3P0YH 43C9B 4NN5B 3O6LL 1Z66A 2ZSVA 1KCLA 1RZQA 2Z9TA 2J1WA 3BSGA 4JDZB 3OPUA 3VOPA 4TUOA 3OZLA 5F2FA 3F8UB 3A21A 2XACC 1AGDB 5HHMB 3WI9A 2CU9A 3BCCJ 4KZCA 1H0DA 5TGBA 4HC1A 2G75B 1UKSA 2XWEA 4FFVD 4UQ3B 2H9GA 3F7KA 3VYIA 4Y7OC 2F1AA 3T97B 4UTBH 4F8TA 2R59A 2EAEA 3TT1L 3UTSE 4P2RD 1LEGA 4N22A 1XF5B 1F90L 2OCJA 4J4PD 4W7YA 2Q2LA 1JGLL 2X4PB 3BUYA 3EKCA 5E6IB 4Z76A 2MPAL 3CUPA 4Z95H 1BZQK 2OX5A 3MTXA 4PJEB 5DD5H 2H1XA 4K07A 3QUZD 3L71G 4LHUA 1BFOB 5ABAA 3U48A 2AS5M 2O61A 5ABDE 4S1SL 3UO8B 1I1FA 3DLQR 1R33A 2DJSA 4IL6E 2XKNB 4P9ML 1CE1L 3NEEA 2MWCA 4YSSA 2IPTL 5CGTA 1J88A 4MX7B 5EU6E 4YS4A 1JY3O 1IKNC 2EH7L 2I1KA 2VDOL 1BE3J 3E8UL 3NJFA 3RWJB 4E5XA 4ODHH 4S1QL 3L54A 1DIPA 3MBXH 4MMYB 3S3BB 4LSQL 1TOXA 4GQZA 1CU4H 1Z5LA 1BMWA 3U46B 1DCLA 1LK2A 1ERNA 1ZMEC 3DJZA 1I8LA 4J1UA 3TH3T 4MJ6A 5K9QG 5IQOA 3BISA 5I8OL 2NUPA 3CVHL 4PGEA 4JFEA 3UZEA 4JCWA 3JWNG 1HFUA 4PRIB 1MWOA 5ANHA 4I3RL 5HDBB 2FNWA 5D1QE 3JV0A 1YECL 3RUGA 2BVPA 1KMGA 4X5LA 1HJBA 3CXDL 1I8MA 4UQEA 3NVQA 1P7KA 4FNLH 4X8JB 4YFDB 5J1AB 1Z56A 2GABA 4U3FG 1QACA 1ETJA 1QBBA 1AO7E 4PB9L 5CEYB 4A6YL 2H3NA 4PJ8C 3OMIB 3FKUS 3LD8C 2MCG1 5AOIA 4PS4L 1M05A 2BJML 5DJUB 2NSQA 3HLAA 1G7MA 5F7DB 4FZ8L 3CDGB 1O6SB 5CBEB 5D72L 3R8QA 3S4SB 5APVA 4AQEA 4OLEA 5FO9B 3IS0X 4Q9QH 1OP9A 2MJWA 3A4AA 4PREA 2WZPD 1YQ2A 4NZTH 3HRZA 5AZUA 1SQPK 4W6XB 2VWEC 2X3BA 1Z9OA 4HV8A 1OTUC 3LS5L 2WLNA 3IF1B 5FYKH 2H1LM 5BO1L 3ZE1E 3FQWB 1K2DB 2HJFB 2HRHA 2JJSA 4LPUA 4BUQA 1RHFA 4MCYB 3GI8H 2HLEB 2Y7QB 5EWIH 3SE9L 2H6OA 2X53A 1A6UL 1EJFA 4KO5A 1OSPL 4GAGH 4TNWF 3USSA 5KOMC 2XNXA 2HKFH 1PLBA 1UZ6E 3C87A 2R56L 3CZUB 3VWKC 3GHEH 1N18A 5DJDB 1XH0A 2D73A 4K0OA 2RN0A 1TKWB 2J21A 2JWYA 4AQ8C 1IC1A 3RGVC 5BMFH 1KQGB 1EAPA 4DN4H 4YXDC 5I9QB 5I6KA 1LP1A 2N0MA 1MFAH 3BGMB 3EBGA 4HKBA 3VG9C 2OYPA 4DESA 3OMZA 2YO3A 4F33A 5IEKA 3VX0A 2ZX7A 2OXHB 4YHPA 5LVEA 3FQTB 2QIWA 2EDOA 3VWJD 1EO5A 4LLHA 4L48A 3AXLB 3E1RA 4MTMA 3ROLB 5BUGA 1WIOA 2FY8A 4QTIL 3F7QA 1U58A 2BY0A 5ICXA 3T0WA 1RF0A 4UT6A 2VO5A 4M7JH 2WXFA 5EZLA 1S6NA 1VEMA 5IZ7A 4MA3A 1DJXA 4N8VB 3QBTB 1BCCJ 4GINA 3L71E 1GCYA 1UOLA 5C0CA 2Z4QA 5CJOH 1H6FA 4N2IA 2TAAA 1H3PH 4HHAA 1MF2H 3CDCA 5HI4D 2OA9A 5KAIH 4LLUA 2ZYHA 1TLKA 4DGYH 3BWAB 3T3PE 3WS6A 4YWGL 4FKEA 1DO5A 3LXBA 3GSRA 5JXED 5EOQH 1XO8A 3VD3A 4F1ZA 4BYHA 2H8PA 4I5BA 1J11A 2O01J 2CXKA 1G7IB 1YDPB 4HQQH 1QL1A 4HH8A 1JCDA 4XC3H 4OCSL 4NPYB 4OJFL 5D2NC 4KH9A 4P2YA 3SDXE 2CHXA 2XI9A 2DQCH 1SF3A 1IBHA 1QKZH 1JXJA 2X9YA 3JWNE 4HT1L 1E6JH 2J2ZA 3LH9A 5DYOA 1YLBB 2BVYA 1CG9A 2UY6A 5FKAB 3BVHA 4E0RA 4P2RA 3RL2A 2MHAA 4J4PA 4PJCE 3JWDH 3L4UA 4DKFL 4U3FE 4UB6H 1ND0A 5FKPB 2PR9A 3IGFA 4GO9A 2ADIB 3PRZA 4YDLC 4XGZB 5SX4H 5CD3B 1E65A 3U59A 1HOCB 5GRVL 2M1KA 3QUZA 5IG7A 3O8ZA 1PG7W 3TBTB 4D8PB 1UM6L 1E50A 3X3FH 3QZWG 4ZPTB 4N90E 2FVNA 1VGEL 3MC0A 5AKTA 4AJWA 3ML8A 3L72G 2CZNA 3TO2B 2VISA 2XIIA 3UAFA 1XCQA 1DN0B 1SXAA 1UADC 4LIQL 1NC4D 3OHXB 5A7EA 2GJZB 5DD1L 2WQ8A 2XT1B 3LNFA 3HMWL 4PH8A 3LX9A 3FO9A 4FN0A 4U1SB 2AZUA 2W0KA 3ZHDA 4M7LT 4I4WB 3ATAA 5IQ7H 5E95B 1X9RA 4OCRH 5AAWA 5A40E 4IDJL 1JN6B 4RWHA 5EF3A 3HC4L 1Z2KA 3N55A 2PCFA 4WUUE 3K1DA 5L2KB 3G6AA 3LRGA 2GBUA 1GGUA 1ZA3B 1BXXA 5D7LE 1GL2B 3CCQP 5K9KB 1OMIA 1NCBH 4F9PC 3QS3A 1YHPA 3A4FA 5APSA 1M56D 2P67A 4I9WD 1MNUL 5J1TC 3HRNA 1MCOL 2LT9A 1SQ2N 6PAZA 2OTLP 4KK6D 4G5ZL 3SDAA 1N7LA 2WZ0A 4ONHB 4PMFA 3D69B 1GGCH 5GS2H 4OZFB 3W11D 3P4MB 2FEDC 1NEZG 2TSAA 3HE7C 4PJHA 3VH8A 4ABVA 5HYQA 1AP2A 4MN4C 5I5RA 3STLB 1FDMA 2YMKA 4R7VA 4ZUVA 2QPDB 5J7CC 4HCIA 4LAQH 1JZ7A 1AGBA 2NT0A 4R90L 2M5AA 5J11B 4M62H 1VCBC 1YMHB 1SEBA 3KBHE 3U9UB 5GISL 3WL9B 1GS6X 3JV6A 5EN2A 4FMKA 4QRUA 3L75E 3TF7C 2VJ0A 3NT0A 3G5XA 2ICWA 4J8QA 4JY6B 3KJ6H 1RU9H 2P5WB 3DHUA 4UM8A 3WMQA 1WZAA 3BN3B 4Y5XA 3MLWH 2FO1A 3WENA 4QHNA 3QIUB 1MUJB 5DA4A 3QULB 5MEPA 2NNAA 1IC4H 1JPST 1CFVH 4M7ZB 3VFVA 3B7YA 4Y2OA 4BZ1L 2HP4A 2J88L 1BZ7B 1E27A 4XNMA 4G8AC 4S11A 1T8ZA 3P02A 3KVQA 1I7ZA 3I6GA 3UPAA 3K3QA 2DOCA 4FQJH 2MRYA 1PEWA 1HWHB 5L8JB 1HDMA 4Q2ZB 1I9RH 5D7HA 2J8UB 3RWEA 1HKFA 4K8RL 5GSRA 5EUOF 1NZRA 4P5MA 4UOW1 1SLWA 1QTYT 3VWJA 1TZIA 2R1YA 4J8RB 3L4XA 4CNIB 1ES0B 5KKZC 3QXUA 4JFHE 5EH1A 2JKIS 1PLAA 1TQCC 4ES9A 2Y2YA 5DLLA 3WS3A 1TFHA 2RHEA 3PDGA 4NI3A 2UZYA 3DX8B 4FDWA 3FBQA 1CWVA 5F6IC 4MJ5A 4O02B 5JW3H 5FLUA 1G1YA 2GITA 2OMXA 2UY7B 3MRNB 1SXNA 4PJ7A 1OW6A 3U79A 2KLRA 3N3EA 2Y7SA 3QFDA 5DS8A 5E2UH 1YZZA 2HTLD 4OQTA 3WLBA 5GGVL 1YEEH 1IQDB 4DO4A 1I31A 3D08A 4XMKL 3H1IG 4L0YA 3RPIB 3L1FA 2QL1A 4XP9H 1AZBA 2NNFA 1BPVA 2WK2A 5TQ2L 3L17A 1RZIB 4ZX6A 1E4XH 4FXLA 4JQIA 4ZMOA 5C7XH 5FHAL 5JXEA 2PFXA 1BVKB 1CVRA 4FQ1L 4KK5C 1DUZA 4NKMB 4KY1L 4DETA 4KZ0A 4ODTH 3MRIA 4EVNA 4M1DL 2Y36L 1NKGA 1U7MA 4UIKL 5BRPA 1RQVA 4R2GD 2WLZA 1NTKD 2IANB 3ARDB 5E0FA 5K1VA 3VE0A 4KJPC 4EOWH 1WFMA 4K94C 5JUEL 3VQ2C 4Y16C 3QDJA 2IFNA 5C07D 1OAKH 1S7VA 2DMBA 3GSQA 3HKFA 5F7KC 4NJ9L 3QR1A 2ZSVB 4W9JC 2YOCA 1NA8A 4M93B 3WLWC 1SDDA 3FTWA 3GZQA 5L4IA 3GNMH 1KYAA 1I8AA 2E3VA 3MAWA 4X2UA 4TV3A 4NAQA 1HKLL 3PFUA 1JO5A 1ZHLA 4KK9D 2G9KA 1S9KE 2AJYH 1H0DB 3ES6B 5TGBB 2ED9A 4PJ5E 3M0DC 4PJDE 4HU8A 2I7SA 5CM1A 2H9GB 4N4YB 3IGLA 3IU3B 2GT9B 1CC3A 1P84J 3AB0B 2NXYD 3MDJA 1PFOA 2VE6B 1NIEA 1D5BB 5FUCC 5HXMA 2CSPA 3WU1A 3QZMA 5HJGA 3JWOC 2M3BA 2NTSP 1JY3P 1NC4A 4Z76B 2I27N 2NSMA 3CUPB 3UC0L 5JHLH 2OX5B 4KX7A 3KYKL 3TBSA 1FNFA 4W70A 1KMIZ 2W0FA 4LHUB 4M9PA 2ZD0A 3OTTA 4R4ND 2WVRA 2Z4EA 1NTMK 2R0WL 1X5XA 5HY9A 1I1FB 3VG0L 5LQBL 2QVTA 3EJYC 4XP6L 3RTLA 4APQD 4LOUC 4HGKC 4MCZA 4AH2A 3K81A 4MCNA 4BFJA 2YD4A 1L9NA 3N0PB 3BI9X 1WZMA 2OMYA 4NKDA 2MTAA 2UVFA 3L74J 4AT6A 1E2VA 3N1PC 1QHOA 5DMGC 5DRXA 1LK2B 3UXFA 2OARA 1FE8L 1NC2D 4C7NB 4J1UB 3WY4A 3Q5SA 1NWPA 3IAQA 4MJ6B 3VXMD 1NCAH 3GKWL 2NUPB 4KK8C 4LOEA 4PGEB 3V52H 4JFEB 3X11A 3ZE2F 4JNXA 5FGSA 4I89A 4KKCD 5C2BH 1S4XA 3MLVL 2IPPA 2HKAA 4R8WL 3RUGB 3RURA 2BVPB 3S36H 5FV2A 3CXHH 4X6CF 4ZX4A 4I88A 2B9BA 3ARBB 1EGJH 1FZGA 1Z7JA 2DMHA 4TL4A 1VSCA 1I7UA 2WO2B 3T3ME 1PMYA 3I2CH 1EDHA 3PL6D 3SYCA 1DQMH 1RZKC 3QR0A 1M05B 2DMKA 4MDRA 1XBDA 4J27A 2MNUA 3GBDA 3KWVA 1G7MB 4RRPG 3H1IE 3V4QA 2OGUA 3QUMA 1JDDA 4P2CG 2W0LA 4TNVK 2XWCA 1BDDA 1CI5A 4POZD 4AQEB 4YO0A 2VL4A 4Y1TA 2XKUA 3QP3A 2WSCH 3CDYA 1OFCX 3BSHA 3FWNA 1UFUA 4Y1AD 4PREB 3QS2A 3HRZB 3B9VA 2VLRB 3ZIMA 3D70A 4G70B 4P23D 4NKIH 1TTUA 3FU7B 4HV8B 2R1XA 4GI8A 3WY3A 1BQHG 3CMEP 4GP4B 1I85A 1TQSA 3S37H 1GJUA 1QG3A 2YIUC 2HFEB 3NQIA 3OAYK 4D6TJ 1V3JA 3VTAA 4ZW5A 1XMEB 5CKGA 2L91A 2B2XH 3O2DH 1G9HA 3NJIA 4PS3A 4KJWC 2WBXA 3C6SA 4GSXA 5IT2L 2X0VA 3TIEA 1RY7B 4LRIA 3TBBA 4JL1A 1NCWH 2RIKA 3PWVB 5I1KH 1AD0A 3CG8A 1EAPB 4MCMA 2NZ9C 1XF2B 3H9SE 1LP1B 1UXWA 3P11L 4HKBB 3N41B 2AJXL 3BX7C 3C08H 3N9GL 1AY1L 1OPGL 4B9CA 5IEKB 4KI5E 3QQ3B 8CGTA 4YHPB