5AW8B

Kinetics by x-ray crystallography: e2.mgf42-.2rb+ crystal
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw8B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw8B02
2P67A 5AW5B 3UIAA 2YNYA 3VYIA 2R5BA 2WT7A 5AVWB 2YO2A 1GU5A 2ZFCA 3HE5A 1T2KC 2Q7CA 5AW6B 1GK6A 1H88A 3KQGA 1S9KD 1DH3A 3V4QA 3M91A 4JYCA 1FOSF 2Q5UA 3A3YB 3MD0A 4M3LA 1MFZA 5APWA 2E43A 1MV8A 3VMYA 3HE4B 3I5CA 2E42A 4I6MC 2QM8A 3TNUA 2Z5IA 1FOSE 3V4WA 2IPPA 5APSA 1GK4A 2KP8A 3NXSA 4C46A 2XZRA 2ZXEB 2WWWA 1J2JB 1CI6B 2QM7A 5AVRB 2WTYA 3P7KA 3V5BA 4C7NA 1IO4A 4RETB 3WGVB 3P8MC 2WPQA 1GZLA 3VN0A 2W6AA 2XU6A 3TK1A 2R32A 1SLQA 5AVXB 4AYCA 3L35A 1GU4A 2WT7B 2C9LY 3L37A 5AVSB 3HE5B 5APTA 1H89A 1HUCA 2JJLA 3M9BA 1A02F 1KQLA 1NAFA 4JYBA 1A02J 1CSBA 1MUUA 3M9HA 4AQRD 3VTPC 5AVUB 3NFQA 2WPRA 3IR9A 4LC1A 1G2CB 4KHXA 2YO3A 1FAVA 3B8EB 3T97A 4B86A 1T2KD 1S9KE 4EOTA 2H7HA 5CMZA 1OWAA 3TNUB 3SWFA 5AW1B 3L36A 4GKGA 4DZOA 4GT1A 5APQA 3VMXA 5AVVB 1OXZA 5APVA 1HWTC 2P2UA 1HBWA 3LIDA 4C7NB 3M06A 3O8ZA 3A2AA 5AW3B 3VMZA 3M0DA 5AVYB 5AVQB 3NMDA 4HYTB 3A7OA 2WPSA 1X8YA 1NWQA 5APUA 3MGNA 1JNMA 5AW0B 5AW2B 1SP4A 3P32A 1GTWA 3WGUB 4I2LC 3HE4A 3KDPB 1CZQA 2N9BA 3M0AA 3NTNA 2P7JA 3TYYA 2R3CA 2Z5HA 4AUWA 5AW7B 5AW9B 2VRSA 1GD2E 2R5DA 5AVZB 1JUNA 2W27A 2XV5A 1H8AA 5APXA 3A5TA 1CI6A 3LIEA 1HJBA 5AVTB 1YYCA 2Q3IA 5AW4B 3HTKA 4RESB 5AW8B 2BASA 4XE5B 2C9NY 3OAKA 5APYA
chains in the Genus database with same CATH superfamily
4JFVA 4G1MB 1UB6B 2AEQL 5DQDL 4WK0B 2CPCA 3RVTC 2A6JA 2HWZH 3QPKA 1PW3A 2XWBA 4XWOD 1JCCA 4OCWH 1AD9A 1JGUH 5JPMB 2HG5B 1XGPB 4H1LG 1HVXA 5JIPA 5K9KB 4U3FG 1TITA 1A7NH 4JL2A 5JPNA 1XMEB 4N0UE 4WY4D 2C3WA 4NO3B 4OWFA 1AZUA 3G5YB 2VMJA 1M1KQ 2DLIA 4ZMQA 1KCSL 1JZIA 1FV1A 2CNYA 2Z91A 3BE1H 5F71A 2MQCA 3SE4A 2IZ1A 4J2XA 2TRYA 4NYLA 1N4XL 3W0WD 2AGJH 3FQUA 3QJHA 4J1UA 4PWIA 4B9YA 4J3TA 3WEXB 5IKCB 5HSFA 5C0BE 3AU0A 1DZBA 3KS0J 3MJ7A 4IMLB 1JZHA 1IEHA 2MJZA 3BUIA 4ZYKB 5FFLA 2WMPA 3S9DB 2XWJB 4B9KC 1RQUA 3DMMA 3VI4E 3U36B 1YN7A 4A63A 1OE3A 3H2PA 1SDDA 3UTPD 5B1JC 5DHYB 3I02B 5F44A 4GW5B 2VM3A 3CFEA 3OA7A 4X5QA 5HYSA 5MENB 4ANUA 4TNGA 1ZLWK 1A4JB 4KRLB 3FT4B 4AUUA 5BJTA 1HEHC 3Q1SH 4OGQD 4OCSL 1EZVG 4GINA 2X53A 4FLOA 3ARFC 3CFTA 1AFVL 2BSBA 4U1LB 5GGVH 1MFAL 2MKVA 3BRGC 3O2DA 4HLJA 4BQ8A 2BW5A 1ML0A 4ZOEA 4YMPA 2QSQA 3DK2A 3KL3A 4EVNA 3AEEC 1EANA 2BSTA 2EDRA 1G4MA 2WYIA 3DRTA 4JG0L 5EULV 1ZE3C 1JM0A 2NY6B 2OXGA 3LZOA 4HKJB 3BJLA 3EZJB 3PJNA 4IRJC 5INDA 4OH8B 2UZPA 4KJMA 2YN5A 5KTBA 3VGBA 4QXVA 3AU1A 4WWIA 5L6YH 1A14L 1AJ7H 4FFYL 4MN4C 3QHZL 3FH7A 2EKSA 4EIZC 4HQQL 3L4TA 2K7PA 3FTZA 1L9NA 1T89C 1NKNA 3MA9L 4J2QA 5KSBA 2FYUE 1IEAA 3TA3B 3V4LA 1II4E 2KZ1B 1LVEA 1RHHA 2WZAA 1N3NB 3CH8A 3KPSA 2X4RB 4NKOA 1OGTB 3P4MA 1RXLA 3WFCH 4XPHL 5DRZB 4URTB 3L5HA 3SQBA 4AQOA 2HVBA 4ZAKB 1F3JA 3V0HA 1AMXA 1IM9A 2BFGA 3FRPB 4ZSOE 1JHLH 3E38A 3CWGA 3QXAA 3ZDZF 5C0RH 4HAKA 1LLAA 4PN6A 1I4FA 2QMJA 1PPIA 1S5LE 3GSWA 3N06B 3QAZB 1OGPA 3NCFB 1OAKL 3KPLB 3D5OF 3S2AA 4DQAA 5CEXB 3Q3GB 1INQB 3L81A 4GFXA 4FABL 3MNMA 3L72E 1VACA 1FS0E 1WZ1H 1ZANH 1VQOP 4FQXA 5HHOB 2HJLB 1MCWM 1L0QA 2P4AB 2VITA 3MRNA 2APFA 5FUCE 5LXGH 3AREA 2XNAA 1AKJA 4GNKB 4QHUB 2JKLA 3GM0A 3DNKA 1Y8AA 2A0LC 2YD4A 1MCHA 3POCA 2KMWA 1TO4A 4J4PA 2IXQA 1A8JH 3ZKMD 3QYNA 2D4FA 3RX5A 1KZUB 3IDYC 1JL8A 1FZGA 3EKCA 2EDTA 1YBKA 5C0JB 4JANA 4B9IA 1CU4L 2XNDH 3SKOA 3F84A 1U95B 1ZPLA 3BDYL 1EO8L 2AC0A 5BQ7A 5LNEA 3V6OC 3L3KA 4M03A 3H1LJ 2X0WA 4XCFL 1ZT1B 5I76A 4ZXBB 2F1BA 4Y16A 1CC3A 3FFOA 3DUHA 4JE4B 3H4FA 1BEXA 1GYUA 2NLJB 1BE3G 2KUTA 2QPSA 1SMOA 4NP9A 5C07D 1JYWA 3IVKA 1R5WA 4DK3A 1WIOA 1PZAA 1CZQA 2XN2A 2I9TB 3UTSA 5B1KA 1LHZA 3SY0B 2ICWA 1RUKH 1OT4A 1JGLL 2F9BT 1GW3A 4J3OG 4K5MA 4QRFA 5H2BA 3NJHA 3DPBA 2AEWA 1Y0LA 1YEJH 2FZ3A 1SUHA 5IMKA 1RPQA 2V5MA 3BZFA 4FQCH 4TUKH 2J55A 2JB6B 1U8CA 2CRZA 2YBRB 3CWBG 3JV4A 3MUJA 1SM3L 3N43F 2CDGB 1T04A 3NTCL 3CXHH 3PFQA 4N8VG 4ZZFA 4IDJH 4UB6H 1J5OL 3NCYP 2ROYA 3AEGC 4JZOA 3MV7A 5KZCD 2MMXA 4XN5A 5HGAB 1LWUA 2J8UB 2O30A 2X1XR 3IPEA 4M5SA 2QTEA 4WKXA 1EAPA 5BUAA 1KJVA 4G8IA 2R1XB 5DJZA 4DO4A 4KZDL 5IY5B 2XKSA 2XXFA 3VFPA 3ME0B 2VAAA 3RWJA 4LASL 3AS3A 3C08H 3B7YA 4HIIA 2AQNA 2P48B 5ETUB 2OYKA 3L3DA 1DL7L 3OG4B 5EZIH 2XTJB 4GB9A 1J0ZA 1IAKB 1S7TB 5LAXB 3ARPA 1QUNA 5DS1A 2NZIA 4U05A 4OV5A 2WVSA 3GBDA 3C2AL 3MBWA 1BFSA 4NM8L 2ZJSH 5K69A 1A7BA 1FNFA 2EH7H 2ITEA 2XQYG 3MRLB 3CSYA 4RFEB 3RPKA 5I66B 5JOPE 3AB0C 1OD7A 4E41A 1PFCA 2BVQA 3S2CA 3ZDWA 4H8WC 1MZZA 5JR1L 1G7PB 3HB3B 4CN4A 1YEGL 1SLQA 3HBQA 1LEIA 1DUZB 1KB5L 3WTSA 4HIEB 4IGBB 4MB4A 4Y0GA 3FQRB 5B66H 4NKDA 4FXKC 3ZL2A 1EDJA 2KYVA 4F3FB 1G7MA 4G59C 3LYRA 4ODUA 4AL8H 3VFTB 1X7QA 5DFWH 3W67A 4NJAL 3CZUB 1GIGL 4XVSL 3K74B 2P24B 3BIKB 3RK3C 2ZZUT 4NLAA 4P2QD 5CSZA 1DN0B 4KH2A 3WKPA 3DIFB 1TJIL 3LSOB 2EO1A 3LKRB 5FKAA 1SQVD 5F96L 5IBLC 1ICTA 2ZOWA 2V8MA 4RNRB 3U2SA 4PJEA 2I60H 5E6ID 1JZ2A 2AXFA 1Z32X 3VFWA 5LGJB 4Z1MH 2EDEA 4GIOA 3V7MA 1KYUA 1PBYA 1VZIA 2VXTL 2LR2A 1FN4B 2VXUL 3ARZA 4FZEL 4LSDA 5E8OA 5JW5A 3FTGA 4FLQA 4R96A 1R8EA 3H6AA 1NCNA 4NQSA 3VXMB 2M3BA 3KM2A 3OSKA 4P07A 3L3IB 1QVFO 1JWUA 3GMAA 1KIRB 2C4XA 2XU9A 4X7TB 4YSDA 4PJCA 4B96A 2BNRD 2CHXA 1UTDA 3QORA 2H0EA 5AYUH 5IK3B 4MNGE 4JZNB 5AG8A 4YDIH 3IDUA 4MAUL 1NTMJ 4KKLC 1T5XA 3SZ6A 1MCIA 3FQXA 2XV5A 4GRLA 1DEEB 1TPXB 4N2HA 2WXRA 3P8CE 3GPEA 2HFED 1IRAY 3B3IB 3KCPB 4DVRH 3UPRA 2WWNA 5L9DL 2QJDA 2XQYK 4PG2C 2BASA 3II3A 3RX8A 1TU3F 4GSQA 3EO9L 4ODWA 2EUWA 3MBED 5FHAH 1NTDA 4R26L 1QKZH 2E6JA 5KYWB 1L6ZA 2A74B 4ES8A 5IWLA 2MCG1 1I75A 4HKZB 2G3NA 2XYBA 2Z8RA 4LEXL 1YSOA 1UM5L 4JRYD 2NW3B 3IU4L 1RJLB 1SGKA 5H94A 2NY7L 1DBMH 4AX3A 5EC1B 4WV1C 3M91A 1N0LB 1IJDB 3QHZH 5DJ2A 1ZA3A 4GRMB 4L37B 2AQRA 4B5EA 3U6XA 3B5TA 3NRFA 4TVPL 2CK2A 2F15A 1CR9L 3L08A 1M6UA 4WEBL 3GBLA 1F2XK 3N6YA 2JB5H 3RIKA 4A67A 1CZ8L 3O6LL 1XEUA 1KJ2B 1L3WA 2DIEA 4QTFA 5F97E 4P49A 1HH6A 3B83A 3G6AB 1XGQB 1EERB 1NTZE 3II1A 3TP4A 3VDCA 3EJRA 5GZNA 1C12A 5IG7A 1YG9A 4PVMA 1BFVH 1U8JA 1UOWA 3PWPD 4MYWB 3CXHD 5DEGA 5TTRA 4KRPB 3CXDL 4ORZC 3L48A 5GGRA 2AI0H 1VGEL 3FYIB 1CDGA 4IU3B 2N1TC 3B2UC 4O02A 3TVMC 2IWFA 5EU6D 4AEEA 4DUXA 2A99A 2H8PD 5B39B 5AUMB 4FYTA 4M6NH 1Q0XH 4NQVA 1HHKA 3L37A 1HINL 1AG6A 1NAML 5BO1H 1NCHA 2X38A 4S1DD 3S98A 1TOXA 1DJHA 1YMMD 3MV8A 1ORSB 5F7LB 1BXXA 4ZTOH 4LSPL 3VH8A 3X3GL 3VW3H 3H85A 4DETA 4XXDB 1MH5B 4Y5VB 1T0OA 3NQKA 4YE4H 1LO5B 2ZKXA 3NEOA 4P46A 1T66D 4EPSA 2HLFC 4ANKA 4OZ4A 2QKIB 3K2UL 3OM3B 1TQCB 3V5DA 3FTXA 5JDSB 2D03H 5BO0D 3GMNA 3QFGA 1T7ZA 1TZGL 2XA3A 3KWVA 4OGQB 2HX9A 2ADYA 3UP1A 4YHMH 1YJDL 3MXWH 5EO0A 4F58L 1MHPH 1X6NA 1TTBA 3IGAB 3WEMA 1FE6A 2Y7QB 3MLWL 2BY0A 3WV0A 2WNGA 3SD2A 1LNUA 1TZHB 3GS0A 2VSDA 5ESQA 4YWGH 2PPDA 1S9YB 1ZEAH 3ZHKA 4DVBA 5HHPA 4PRBA 3MRJB 3M8OL 4JFEB 4HLEA 3C5ZA 3H1IJ 2GUSA 4NP4H 1N5YL 3BRDA 1YQVL 2ILLA 1BSHA 1Y9BA 3FWLA 4F92B 1NU1D 3T2NH 2E5YA 1V3KA 1WFTA 1G7JB 2VXQA 4LNRA 3TIEB 4D7BA 5DHEA 3L75G 4CDHA 2YXQB 4A7VA 3RVXC 4QXUH 3D39E 4YSUA 1YDPA 2ADGA 3WKMH 2HA1A 2VDRB 3QXTA 2WSFH 3RAJH 3CFMA 3V4VA 4LARL 1EA9C 1VB9A 1U3HC 1A6VL 4XCYB 3OJ2C 5CN1A 4X8XA 3VNYA 1MY5A 3C9IA 1L0NJ 1RPKA 2ALWA 1NSNH 1OW6A 1PZUB 2Y23A 4I88A 3MPCA 3TBVA 4Z7QB 1EHLH 2X42A 2YQ2A 1KGYE 2NYZA 1M7IB 2O5YL 3F65A 4N2LA 4IOIA 4W9IC 2ERJB 3VSUA 2YAOA 4TUOA 1N5AB 3FN0L 2Q7CA 4HS8L 4R4ND 3G5VA 3IJEA 2YSSA 3N1PC 5SX5H 3SDCD 2XVKA 3PP3H 2EEFA 4OY9A 2C7UA 1V7NH 3QO1A 3CVHH 4TQEH 1AVOA 2HJFA 1RPUA 1K4CA 4M00A 2ADJB 5SV4A 3RKDD 2O72A 4Q8BA 2H2PD 3MV9E 4Z8FL 2KLRA 4CILA 3IAQA 3HZVA 5I17B 4S2SA 5ADOL 5D7JB 1BCCD 1HEJC 3MYZA 3QUZA 3PFUA 4YEFA 3Q5OA 1OP4A 1D5MB 2R7EB 4IOFD 4N8CL 2OYIB 4DGIH 1DLFL 1HL9A 5LBSL 3NCCB 3U25A 4RAUA 1L9OA 3PPSA 3ZL4H 2FD6L 3LEVH 1I1AB 3SPJA 4JFDE 3VXSD 1IT9L 3RWIB 4AE0A 1IGML 4JM2A 1RF1C 3PWLA 4KNUA 4TVUA 4R4BA 1LTJB 2IDSA 3L2NA 4GUCA 2YPVA 3TPUB 1RKRA 2GIYA 3ECVA 5AVUB 3ESVF 2ZOTA 4YN3A 1MCEA 2D2OA 2XX1A 4GXUM 3ATEA 3KYNB 1LTTC 2YO3A 4XX5A 5IF0B 3KPRD 4CVWA 3QXWA 4P04A 2WXPA 5IW6A 4WNSA 1J5HA 1QWNA 5EU5A 1Z3GH 2KLSA 1K8DA 4FLSA 5KYNA 1AIFA 1AMYA 3SDXA 1FDIA 1X5AA 2AEJA 4IYKA 4JAMB 1ZHLB 3MRKB 3UIZA 1WT5C 4M8UA 2GM4A 1A6AB 1A1NB 3W5MA 3LQAC 1DVZA 3P9MA 4ACPA 4J6IA 2YD3A 3B2DC 3IKCB 1HL4A 2DKMA 1NGPH 5E9DD 5C07B 1FVDB 5DRXA 3ULUF 1A3RH 5HPOA 2YPLB 8FABB 1SP4A 1JXDA 1WIUA 4OFIA 4MNQD 5HHQB 1D5ZA 3RVUC 1GGBL 3IMBA 3B9KA 2X09A 4XNBA 3RY6A 4RMRA 4HUUA 1IZNB 4MDJA 5C39A 3LXAA 3JBG7 4Y4KD 1DFXA 2EDHA 1H8AA 4J7RA 3O2WH 5IESL 4WKZA 1M05B 5EC2A 1TTCA 4J3SA 4JKMA 3I9IA 3BH8B 4RESB 2FBJH 4OQTH 2N0MA 3K46A 4E5XB 5J13C 3HC3H 5FWQA 3ARDA 5D6DA 2R4SH 4KKBD 1MNUH 1BIIA 1FZOB 2JK5A 2CG9X 2OL3L 2X4NB 4XP6H 1X5KA 3U0TA 5J12B 5KW9H 5BMFL 1PCSA 4H44D 4JGNA 5ICYB 2CNZA 5HP5A 5B3NA 4D9RE 3OF6D 4KJWC 3X1EA 1EZSA 2B2XH 1YRKA 3FU7A 1JYVA 3TIDA 4LHUD 4BFIB 4FQQB 5BZDA 1PP9E 3O4OC 5CR1A 3EIFA 1K2DA 4J3XA 2WZPD 4LXFA 2KDGA 1UG9A 4LLVA 4YL9A 4ZMVA 3FOMB 2QHRL 4AYFA 4AJWA 2UZIL 5KSUB 5IP4A 3ARTA 2AABH 4DT2A 2YXRB 3AS1A 3CCUP 4GMTL 3OMAB 2P8PA 4R7LA 1LO2L 1U2YA 3FO9B 4RISH 3DTXA 1M2VA 2BXYA 5E8NB 3T0BA 3VXPB 5MENE 5D7KE 2NY7H 5L7XL 4PJ8C 1GTNA 2Z35A 1BZ7B 3P8MC 3NJIA 1GCFA 4F1ZA 4PJ7A 2K3RA 1F4WL 3LMJL 4AENA 3LRSB 3SBQA 5FA3B 3ETSA 5DO2D 2XV3A 4YXHL 4F33B 2AMGA 3P2TA 1XZ0B 3PDOB 4PREA 3A4EA 2Y25A 9PCYA 1JF1B 4OIIL 1E9PA 4NIKB 2FL5A 4YPCA 2PPCA 4MX7B 1CQYA 2YRZA 3L3GA 1L0PA 4A7GA 3QXVA 3PRJA 1YC8A 4MA3B 1ZA6B 1EJFA 1ZJAA 2B1OA 2P8MB 1OGAA 3SJVA 3OW2O 1U3NA 2RACA 4N25A 3MGAA 5KTEL 3HMXL 2OR8A 4KUCF 1H8NA 4X0NA 3P73A 3RUGA 2O6DA 3G6DL 1DEBA 3I3DA 1SQQG 3L71G 3RU8L 5BVJA 2YD5A 2J8UF 4WNQB 1KBBA 3RI5F 5HVHB 5DRNB 4ODHL 4BQ9A 3L3OA 4ZO9A 1ADQA 3PJSK 4HYTB 2H26A 3QW9A 4M8RA 3A7OA 1JF6A 2MEJB 4QRUA 2WINA 5C0IA 1MJ7L 1QBML 5C09B 1SFDA 3BAWA 4HF5H 3F12A 3L5JA 3IYLW 3MODL 1XGRA 2LKMA 1FPTH 4OGAC 5E94A 2YKLL 4NC0B 3ULVL 1KJMB 4LCIL 4UDTB 3ULUE 3BAJA 1WZLA 4H4NA 5HI3C 1CGSH 2HFEB 5C3LD 4ISVB 4DW2L 3DOIA 1VQLP 2OS7A 1FSKC 3OAZK 2A4EA 3HFFA 3N44B 1JE6A 3KYAA 2D9CA 5E2TL 4P2OA 1HYSC 3S35L 4FQIH 1CFQA 5HHOE 4CJ1A 5KKZB 3K6OA 3TO4A 3KE0A 2R39A 2CA3A 2R2EA 4JFQB 2IALB 4JRYB 3L3JB 3JVGA 3BPOB 4QHKJ 2AZAA 3WFBL 3DK0A 5AB9A 1T7YA 4APQB 1E5ZA 5CUSH 3VI4A 2WXHA 4K7FA 4O51A 3D9AH 3EG9B 2E5EA 4C7RA 3M1OA 4G7QB 4H2CA 4P5KB 2ICWI 4ZD3H 2FH8A 2FYUJ 4N68A 4O2CB 4YDZA 3JSSA 3RTQD 1ZT4A 4L29A 5J8OA 3HNSH 1BQHA 3AE9C 1WAAA 3UBXG 1E4KA 4KKCC 4GAYB 3T65A 4QR7A 2L91A 2F8IA 3HUJB 4RRPM 1QP1A 5E99H 1J9QA 3RZCD 4KNSA 4GJTB 3ELAT 4DN3H 1U41A 4DP8X 1JZ4A 4U0RC 5FOBA 3WO4B 1QLFA 1SQQK 1THCA 4RBPK 4R5VA 4XNUL 3IFNH 3P7KA 1NCJA 5I8EA 1E4XL 2N0KA 4A2EA 1DJIA 3D12B 4NKIH 3S4SB 4NSKB 2P5EA 1NC4B 4DKTA 4G2AA 4LEOA 5J1TC 4NO0D 1S6NA 3D85D 2H8PB 3UPCA 4MXVF 4JLRB 4YDVB 2C5DC 2Z92B 1E5AA 1L7TH 4M6OL 1MCFA 3KEHA 3UG5A 3L72J 1XDTT 4LBEB 3MVSA 3HE5B 3K72A 3PH0A 1KC5L 3RDJA 1JZ8A 3QWRD 5IHLB 3MJ9L 1YMMB 2P7TB 2GUOA 3HBGA 3VOPA 1BLNA 4UT9A 1QGKB 2YAEA 3QUXB 4YHYB 4HOZA 2R9HD 1Y6NR 3NUKA 1NGXA 3WS3B 4BUGA 4HWNA 3WMQA 2E6PA 4JL1A 1IBDA 4ZO8A 2UY6B 3BSGA 2PWEA 4QRRB 2E4FA 1BDDA 3AE7C 2QSVA 3IBOA 4GBXC 3DV6B 4GLRI 4LSVL 3NZHL 1JSYA 4A04A 1MAJA 1O6SB 5APVA 4GMSH 2CR6A 3WU2E 3AEDC 3D2TA 4H0HB 2QADC 4LVEA 3TYGH 3ARBD 1EEZA 1QNZH 4HH9B 4JO4L 1BAWA 4A2MA 4YDNA 1UZ8A 2M8RA 2BCKA 12E8H 2IQ9L 5CMAB 2A4ZA 1U93A 2AJUL 4WUUA 3RKPA 2V2XB 4NAJA 1NCDL 2J8UE 3C8DA 5L8KB 3VDBA 3IETB 1B9KA 5DUPH 3EZ8A 3PGFH 2Z5HA 2HFFB 2Q8BH 4N90E 5EN2A 4IFFA 5J9PA 5GGQL 2V4LA 3KZIH 1N8ZA 4C47A 1CLZL 2WLNA 3AQXA 3BP5A 4JVPA 3PAUA 1FF5A 4KJQD 2WJ5A 3EFDL 2QFPA 2DWSA 1G5GA 4WFGE 2IH8A 4ZPTB 2XTJE 4QXGL 2ICEC 1QLED 1P7KA 3MNWA 3TGUD 2FBRA 2IGFL 4XZUA 1R3IH 1EHNA 2Q3XA 4L3ED 4BRVA 4EIBA 3QIBA 1J1OH 1YEIH 3P4NB 2VZ3A 3PP4L 3SDCB 2VLJD 5JOFA 4MJ5A 1UVQB 1Y18A 2Y5TB 4LKCA 4MCZA 4A7UA 1M6OA 1JGEA 2XSKA 1KCRH 4IBTA 3BSHA 4WEUD 3UEZA 3VTTA 4I7ZC 3RLSA 2VZSA 3M9QA 2R8SH 4MJID 4G7RB 5D6CB 1S1CX 2X0UA 2EYSB 1YYMH 5CZVH 4ZUUA 4DESA 1TKWB 2C1PA 1KNOA 3TNUA 3QWOA 4Y1TA 1FG9C 1REIA 3QNZA 3OLIA 3TL5A 2K88A 4GOSA 4LK4A 1VPCA 4LOVA 1BEYH 1MG2C 4TSBL 4UUJB 3EH4B 4LPXA 1WWWX 3TV3H 3GSVB 1VQMP 5EU7E 3LNDA 3VD3A 1IAIM 5IREA 3JWOC 1ZWIB 4YSPA 4PP2A 3VXSB 5BXFB 2YKPA 3CX5H 4JHWH 1JMMA 1EZLA 2J20A 3BWUC 4CMMB 4I1RA 4CVXB 4Y5XC 4Y99B 4QRSB 3LKNB 2JJTC 4LQ1A 5F7FA 1OCRB 3US0A 1TSHA 1KB9J 2WUCL 4L8DB 4XP5H 5C08D 1G4RA 3VXME 5I9QC 3ZX1A 1BMWA 1MUUA 4MXVE 2IBGA 1ET8A 2XZCL 2VL5B 2R0ZL 4K23L 1WA1X 2MCMA 3ZE2B 5BVPH 2UZYB 4LL9A 3KPRB 1SFCD 1IAOA 3K2KA 4N78D 5DYOA 3LD8B 3TJHD 3LVEA 1H0DB 3M45A 4ZFFA 1EDLA 4PJBB 3PAYA 1WYJA 5SWZA 5IFHL 3AACA 5I1KH 3HR5A 2WB1A 4Z7QF 1CBVH 2ORBH 5MEOA 5TQ2L 3U1PA 5E4EB 3PV6B 2FXOA 4ZPVB 1A22B 4N28A 4PJAB 3FUDA 2DMBA 2DB8A 2WXKA 4WFED 4LLAA 4OIIH 2PO6A 5E9DB 5FS5A 5C0CA 1KPUA 5I1EH 4LLHA 3RWHA 5I28A 4CPGA 3DGGB 4NC2B 3HUSC 2X70A 4MNQB 4UQ9A 1NUGA 1TJGH 2YOCA 1IFDA 4LLYA 3CC4P 4AUYA 1FWXA 4BV1A 3CFDA 2P7JA 5E6ZA 5IUCA 2JKSA 3WMSA 3Q5YA 2FFDA 3TNNB 1KPVB 4L0ZA 1EHAA 3K5SA 4Y4KB 2WSSH 3LN9A 2ZT9B 1P2CB 2GC7C 3UBXB 3AADB 3OHMB 3L5XH 3OKEA 2B5IC 4IRJA 4I18C 1QFUH 2NPSB 3FT2A 4AG4H 3IE4A 3E6FB 2A6DB 3JZ7A 3OB0K 3RWDB 4AYMC 4MQ7A 2O1AA 4TQ8A 5DZPA 4NUPA 1O7SA 3LPPA 1QBMH 4JMXA 1DQVA 1T89A 3T2QA 4K9EH 5DI8B 2DQIL 4LQFH 4QYOA 1AGCA 4PGBB 4RFOH 3SDAA 1WCBA 2I8DA 4ELDA 3IB4A 5D7SH 2RN0A 5EFIB 5GISL 5IM7A 4UIKL 2P5WD 4BSVB 3WY3A 3IFLH 2E74C 4NQCD 1YITP 4ZX6A 1N9PA 1UM6L 3PAVA 2BRRL 4J8QA 3AWFA 1OO2A 4CMHB 3UZQB 1NAKH 1J18A 1P7QA 4F7CB 2NY3C 1D7DA 2XG4B 4RLDA 1DJYA 3UTPE 4HXAL 4WJKB 3T4YA 2G4GA 3AECC 5IB4A 1KMGA 2Q0ZX 3UROR 4AQAA 3WS6A 4JJ5A 1QI4A 3O3BB 3PL6A 1G6VK 4LCCB 3MLPA 3P4OB 5AYQA 4W80A 3WFBH 4IJ3B 1PIXA 2R44A 1J5DA 1BF2A 3BQUB 3CHSA 3I75B 3OMIB 3P3UA 4C56D 2QQLL 4HIHB 1C5DB 3SE3C 1PL5A 1H3VA 2VMEA 4KUZL 3OBAA 3V52L 4S0HA 3ARGA 5HGBB 1I9JL 3VRLF 5IB1B 3FQ2A 1ROCA 1FZKA 1NTZJ 4X7DC 4RDQG 5DGRA 1RHZB 4HCGA 4BINA 4F37K 1A02F 3DXAA 1TQWA 5I74C 3G04B 3CVHB 4Y2DB 3Q6FA 2GQHA 2HPCA 3BC9A 4FNSA 4EDWH 5C7XH 3HN8A 4JFEE 1RZGB 4HEMA 1NCBL 3BO8A 4W9FC 5F7WC 5E9AA 4DPBX 4L8CA 4XAWL 3T97A 4MSWA 1U8MA 3MRRB 5AOIA 3CC5B 3VD4A 5IQMA 3PPEA 1XR9B 1IU1A 1X7SA 4P4KC 2EDFA 4FI8A 1FNSL 3N85H 1A9VA 2CO7B 3DGDA 3BCCD 4UV7H 1I8MA 4AH2A 3STLB 4JO2L 2H9GB 3C75A 3AE4C 4U3CA 4C7NB 2AJVH 4OT1H 5DZJA 3S36L 1DYZA 4HFWB 4DKFL 3TN0D 3BD5A 4TSAL 4H8WL 5IW3A 5ESVB 1RZJH 2KNCB 1NJ9A 5GIRB 1RJZA 3MUDA 3E3QE 5KAQG 4Z7QE 1X8YA 1RCYA 1Z7JA 3MCLL 5I1JH 1F13A 4LIQH 5FO9B 4D0CA 5E2UL 2PCFA 3UABA 3ZIMA 3QUHA 5A7EA 3A0BE 4M6ML 4M3KB 2DQCH 3C6LA 1MQKH 2WWOA 3D0VB 2O5XL 5DJCA 5CAYB 1EZUA 5F8QC 2BH0A 4MCNA 3CVDA 2LHAA 2F1AA 1T8ZA 3WENA 2VDOL 3T4AB 3EYVA 1EZVX 4PP1C 4BXVA 1SNRA 2CLZB 2AJYH 5HJBA 3EDDA 4KDTC 3OAKA 2YS4A 3N40P 4S1SH 3H1KG 3S7GA 4N9GA 3VXRD 4Z6AT 3OR7B 3H32A 4JO1H 4NCC1 1QASA 3SQOH 1MHHA 4JG1L 4MVBD 3LNGA 1WLHA 3QUML 4HKBB 3LRLA 2WSDA 1YY8B 4LP4A 3NFSH 3AWEA 5I1CH 1NGYB 3MLRH 1WS8A 1TZOA 2EC8A 4FN0A 4D8OA 3UAJA 5ITBL 4U6XA 2OMVB 1AY1H 1FZBA 1QFOA 3REWB 3D25A 4Q0XL 5DVNA 5ENWA 3ZE1F 1HI6B 4CGUB 3AC0A 4CRPA 1U8KA 2OULB 5T33L 3TCLB 3GRWA 1KYOJ 1NIDA 5EOTA 2IYPA 4XT1C 4ZOBA 5L2JA 3H9SD 1HGZA 4OJYA 2QJPB 3NSJA 4FG6C 4QCIB 4R90L 4W70A 5I8OH 1PIFA 2FLRT 3C5JB 1YQ3C 3BGFC 1F6AA 1BYOA 1M9WA 3ILPB 5LO7A 1I8KA 1DBKL 1PDKA 1BQLL 2ZAGA 3FU3A 1SQXG 4HKXB 3H1HD 4JDEB 4QRQA 5DRWB 3CFNA 2KIKA 2UYLB 4Y19B 3D85B 4IL6H 4QTIL 2VMFA 4S10A 1F8TL 2J71A 5C0EA 3F83A 3FFDA 4U3FD 1MJ8L 3GSUB 4OJFL 4PRIA 5ISZA 2C9LY 4C54A 1J8HD 4F2MA 4N9OB 5D4JA 5D5MB 1R4XA 2JF1A 1CE1L 4NFDA 4G9DA 3D0LA 1ZHKA 5C07E 4XTRC 4YE0A 2YPLE 4NUJB 1L0LK 3VRLE 5JHDA 4BFBD 4J8RA 5DFAA 4X6BB 3B8EB 3HLKA 3TGXA 1FJ1B 3L9BA 2AXJA 1IQWL 1EHKB 3N44F 2IFFL 4QUOA 3U30B 3SGJC 2AJXL 1CGYA 1FNLA 1AZCA 2OSLB 2K6ZA 2Q7AA 2PR4H 2G75A 3OX8A 4Q6IC 2J5UA 2GAZA 4Y4HA 4AGLA 5ES4B 1NLDL 5E2WL 1QL2A 3ARBB 1IZJA 1TIUA 5D93C 5I1DB 5C0GB 2XHNA 5FWRA 4NZFA 2WPSA 1ACYH 3LRKA 5D1ZA 4DP4X 5I1GH 2IAND 4AV5A 4FLRA 1DSFH 4YPGB 1PPJE 2HN7A 5ABZA 1M9SA 2O01J 5F7DA 4WY7L 1Q90D 2EIDA 2Q5BA 4QT5A 1SPDA 3HUJF 5IVNA 2GJ6B 3BT0A 3QQ4A 2I7OA 2JQMA 5IQNA 5GGUA 5CIPH 3OKKB 3TFKC 1XGYH 4Z3JA 3P9LB 3IFOB 3C87A 1EDKA 1B6UA 4U1HB 3DX1A 3QEGL 3CXFA 5CCKH 4OTXL 1M1JC 1SQXK 1VZHA 1WTGT 2Z31C 3CDZA 3J7HA 4KVCL 2VOTA 1XXFC 3EBGA 2K9JA 4JFDA 1IL1A 5FDYA 4FTVD 1FVCA 4MBOA 3VI3A 1TCRB 3ZQ9A 1QSZA 5JZ7C 2EE9A 4PG2A 1OP5K 3WIFB 2A06G 4ZI8A 3JTTA 5CCGE 1OCWH 2DWDA 2WXFA 1S7SA 1GC1L 3DSNB 1QVGO 1FZJB 1E30A 3ATBA 2VLJB 2KZBA 4GG8B 4UB8H 3PGCA 3F6IA 1DH3A 3EYFA 4HMEA 4HP5A 4PV8A 5DJXA 3X11B 3KH4A 3FCTB 5IIEA 2VYRE 1KN4L 1N2DC 4PS7A 1PNDA 2V37A 3IDMA 5DS8A 2EYTB 2WBWB 4TYUA 5IEHB 1U4FA 2PTTB 5IHUH 3ZOAA 1SY6A 3Q8AA 1JOCA 4WU5B 5GHWL 4F2EA 3ZE1E 3Q8CA 1V8HA 4GXVL 4D9QD 4FCAA 3E9TA 2EC9T 2JFCA 4P2QE 2LTQC 4TNEA 3A67L 3DX6A 4KZEL 3GTNA 5DJ6B 1JTTA 3SKMB 1PP9J 4WI4A 1M7DB 4W9ZA 1J48A 1B3IA 3ZHLA 4P2RB 3EUUA 4EQ2A 4BQ6A 2XACC 3O8XC 3UZEC 5DR5L 1GKOA 1ET5A 3ZKXB 1K5NB 5KSAD 4NI3A 3P4LA 2PWHA 1NM9A 4WI2A 4MA7L 5C3IA 1EJ8A 3RKDC 4Y4FD 2Q8AH 2F5AL 2DMCA 2FCBA 4CDGC 2P80A 4WW2C 2XZAL 2R2BB 3QPQD 4FHJA 3R18A 4Z3HA 1QR1B 5C0AB 3PWNB 1SFCB 1AGBA 1D7FA 4P4RB 5DUBB 3JWDC 2WC7A 1OOAA 4M61A 2WBKA 2V5SA 5BUPA 1MRCL 4PRPD 4NBZB 4O5LL 2YPKA 3EYSL 4BK5C 2ESVD 3EW3B 5BV7H 3L7EB 2XN0A 4G6JL 4RAVA 1RIHH 4M48L 1QFPA 3S1KA 3AROA 4PJXA 2FGZA 4E42B 4ELMB 3IJHB 4XHJC 3A2AA 1RAMA 1XF5A 5I71C 3K5BA 3BLPX 3VXTA 5DDHB 3K6IA 1SMDA 1U21A 2P8LA 2VZTA 3ET9F 1DVTA 3CPWO 4XBGB 5AW2B 4BRYB 1OAXH 4CKVX 4JRYE 3UMNA 4XAWH 2G8YA 4N22A 1EAJA 1RZKH 5ADPH 1E2VA 5ALBH 4C58B 3CUPB 5C8JA 4OGXL 4Y2LA 4YO0A 3TT3L 4OBRA 2HSIA 5JO5B 2ZG3A 5CJBA 3Q2WA 5DJDB 4YR6A 3VG0L 4FRWA 4I89A 4NPDA 3QE5A 4ZFOA 3HUJE 3KGSA 3VX0A 5D72L 4WSJA 4ZBJA 3FSWA 2J56A 3FN9A 2V3FA 4S0TD 3A6CH 3CXHE 2RMNA 4N2NA 5ESAB 4AC4A 4UB6E 2KLTA 1LM8V 2ZNWA 1XWVA 3G6JA 4PLJD 5FK9A 43C9A 5J7CC 1HHIA 1TETH 1JNHB 1T2KC 2DLHA 3O3EB 4KBPA 3SODB 3VXUA 2P5WB 1KEGL 2G9HB 2PF6A 4V1DB 2B14A 1F42A 2X4TB 4J3OD 4NQCB 1CXEA 5DLLA 5J0BA 1L3NA 3QI9C 1S78C 1LXMA 3UJIL 1JWMB 1YMME 3KPNB 1XH3A 1T1ZA 4JRXA 4HW6A 4RGOH 3CWBD 1W0WB 4PJBF 3DTUB 2BNUA 4NZ8A 3FH5A 3IT8D 4XNXH 5B21A 3ABZA 5ABDE 2WWWA 3UEQA 2OQJA 3HTKB 3CVCA 4PJAF 3O81A 3QPXL 1NA8A 3JUZA 4MB3A 4QRTA 4C56B 4K7PX 4YIQA 4EIGB 4F27A 4XMZA 4QRRE 1E4XI 2ZJSE 1RLBA 2YIUC 3HFMH 4MQSB 4X4YA 3ECBA 2OR9L 1N3NA 1J88A 1Q9WB 4ZNEA 5F1NA 1UURA 4OJCA 2EDOA 4LCYA 1A7PL 2X6BA 4ZMXA 5FLVA 2NT1A 5E5LA 4L4TA 2Q86B 5B66E 3PYCA 2HRGA 1BAFL 1CFMA 1RF1A 3P0YH 1M1XB 4CKQA 2AK4A 1MY7A 3IDGA 2PABA 2XQBH 4ZNCA 1CBJA 4NQXB 3FB7A 1JN6A 5T3XH 4EN3D 3MHZA 3RGBA 1TEGA 5JIHA 4WHYH 5J6HB 3KWWB 4XMPH 4LCWA 3INUL 4HPHA 1N26A 3KYMB 3DJSA 5AL8A 5DJUB 4OGYH 2IFMA 2UVEA 2EP6A 5IJKA 3NAAL 3L2MA 4A68A 3V5KB 2FATH 1QX8A 5A6LA 4JFFD 1TVDA 1E9QA 2B0SH 3KBHE 2IGTA 4ZS7L 5FHBH 4E9LA 4F9PA 1CGVA 2WQAA 3IDJB 4JDZB 4XN7A 2DL2A 3VVWA 4BCYA 4FJYA 1WT5A 2NY1D 2DY2A 4Z3TA 2YKOA 3P11H 4JR9H 1FC2D 3NCEB 4RGND 4PY8I 1I82A 1ZDSA 4W4OA 3EYOA 3FO2B 3V0WH 3S37L 5F21B 1ZMYA 3MLXL 5AW9B 4L1DA 4U7MA 2XIIA 5K93A 1TXKA 4HXBL 1SOSA 5E79H 1IGYA 3H7BA 1IK9A 5IJCC 2ZCLL 3Q6GL 4RO0A 5DZ9A 1GMJA 1TJXA 3NJNA 2FEEL 1BCCE 3LIUA 3RP1A 1XAUA 1HOEA 3KLKA 3RY4A 4XZ4A 4BCXA 5HD8C 3O11B 3L73G 3EH5B 2QTVA 4PJDB 1GRWA 5EUKA 2ARWA 5FYKU 2BSEA 2Z65C 3QUYC 5F9WC 4KMTL 1OEZW 3COOA 4WGKA 4ZFZA 4ZS6C 1CLYL 3VXSE 1JRHL 1TZIB 1WO2A 3MTRA 5E0QA 2ZXWB 3OJAB 5CEZL 4F7MA 3P54A 3P3RA 1I53A 1UD2A 4WO0A 3EJZD 2Q9OA 4KXDA 2G4EA 4JZJB 1I7UA 1JY2P 1MCQA 2JO1A 1IGJA 4KVCH 3HD7D 1KFMA 2N56A 1BM3L 3ZE2E 5DJ0B 5E1AA 3ULAB 3KPRE 1R3HB 4R2GC 2BVUA 1HH9A 4W9GC 4DZBA 3NACL 4JCMA 4OCYL 5MEQA 5M94B 4HV8B 1G7HB 4O9HH 4WFHD 2IIJA 4XB3A 3UGEA 3ZGIA 1KMIZ 1Z66A 4PJBE 3WUWA 1OCZB 2PW1B 3OV6A 4HUXB 2PCPA 3BASA 4YOKA 5TK4A 3QG6B 2OYPA 4AGMA 3BVHA 3LHAA 1SXAA 2E46A 1PQZB 2BSSA 2HX8A 2PP7A 4NT6A 1MVFA 3N41B 5DVOA 3SCMD 3UTTD 4L8SC 5DD1L 2NUTB 2G3ZA 1GGTA 1F41A 2OJEA 1NKOA 1XD1A 2YEZB 1J8HB 2ZX5A 4PJAE 5FGSA 5IGXH 2X05A 4PJ8A 5AWNH 2DIAA 3G08B 5E9DE 4DP6X 4QXWA 2NPLX 5LGHL 1EVUA 4UTBL 3RDTC 5A6IA 1U92A 5CLWA 4X8GA 3K2IA 3WEBA 3T77A 4MNQE 1JZ7A 3N40F 4MJJA 1I85A 4YZFF 1FQ9C 1S5IL 4I1LA 4AM0B 3A67H 2J5LC 3T1FA 1EGJA 4XC3H 4PW4A 1MRFH 4NNXA 4YJZL 5IR1A 4M3HA 4U6HB 3H56A 3HJEA 4LDLB 4TRPL 1XTLA 5DD3L 3WIAA 3JSVC 3U82B 1RZ8A 2H88C 1W0VA 4GI6A 1D5BB 3DX4A 2FHFA 5DD6B 4PS4L 4KROC 1SJEA 2QG4A 3MYJB 1FFPB 4XO8A 3GBML 5J6GB 5CCHC 2O5ZH 3NGBB 5D1QC 2X7LA 2XZAH 1D5IL 5E2VH 3O2DH 4DGYL 4RDBA 4P59L 3FQRA 3MRMA 3T71A 3FB6B 3HE4A 2Y7LA 1F2QA 4UMSA 3MZGB 3QA3A 4ELKB 1XCWA 4JX0A 4MJ6B 5G4OA 4X6FA 4KO7A 2Z0UA 4JGMA 3UADA 4PHZA 2NUPB 1XCTB 2AXHA 2PPFA 2W9LA 4GKZB 4UAOC 4FNTA 3MLUH 4WWNA 3E1F1 1QSFD 4HHGA 3VGDA 1Y7VA 1BFOB 5IFAL 2EDXA 1EDIA 2NR6C 1MREL 1Q1JH 2BCCD 2MWCA 5GGRY 5T3XD 4BQCA 5JHBA 3HG1D 2TSAA 5GZOA 3H2QA 2X3CA 3M1BB 3O45A 4YSCA 3I6GB 1JZGA 4FTVB 4ORGA 3RRQA 2BNQA 2VDPB 2OJZH 4HIJA 3WE6A 4A7QA 2G2RA 2NY4C 4P99A 3VFMB 4GFTB 2YGPA 3CZJA 1X4YA 4LVNB 3RIFK 5D5MF 2YBGA 1DVFC 4OIBA 1FIEA 4MA8L 1MFBL 2F8VA 1NO4A 4MD5A 5DT1H 5CP3A 1YNKH 1A7QH 4GAFB 5MHSE 1G9MH 3A3YB 1HH0A 5DHVA 3BYTA 1NCWH 3X17A 3PLNA 3VJ6A 4M9OA 1AC0A 1MWOA 3ZQXA 3QDGD 2HVKB 4UTCA 1XX9C 4IHOB 1Z9NA 1P6FA 1U8OA 1U91A 4EI0A 4WUKL 5IQ7L 2IDUA 1WWAX 2SEBB 1A65A 1OTUD 4P5SA 1KTDB 3MGTB 1KORA 1RL1A 1M42A 4OCRH 5TDNB 3WTXA 1NDGA 5K9OA 1TQUA 3CVIL 3FXIC 1QZNA 4ZTPL 3ILQD 3BEWB 3ZTNH 3MLVH 2SODB 5I16B 5EBWB 5C1MB 2XVBA 1CYWA 1TJMA 2IG2L 3EFGA 1OW0C 3HMWH 2N7SA 5JYLA 4EBQL 3ZMNA 1O6TA 2R23A 2H6PB 3KAAA 3VCLB 3R7RA 2CIIB 2YFOA 5EBGA 1SQPD 4KXAA 1IBGL 4IIQA 4NRYA 1T3UA 2IDQA 2HTLD 3AM8C 1P5VB 4U6VL 4UOW0 4I48A 1URQC 5HI4C 1ZPUA 3H1JD 4WY4A 2MHAB 2YAHA 4NZUL 4Z1PA 4PRPB 4HCFA 4ABUA 2PW2B 2E76D 2VN7A 5CSBA 5FYKD 2WBXA 1OQOA 2AF2A 2CJSA 2IH9A 5A2IH 4MWFB 4WO4C 3WSQL 3W0WA 4HUNB 3WAJA 1SLXA 3ABKB 4M4RA 4XCNB 1QWHA 1TDQA 3TNMA 2DQ6A 4IRZL 3OKOB 4BRJA 1SZNA 5JMOC 5AVQB 1YJWP 2XXCB 2H3NB 4IBWA 1NTKG 1H3GA 2R2HA 1MAMH 3K4AA 4TLKA 4YFLF 3TT1H 3WNNA 5I1LB 3CLFL 1HF9A 3CIAA 4MZ2A 5D2NC 2SPZA 5B22A 3VFVB 4RWYH 4LKXB 5IFJB 3QH3A 3QIWB 1R5SA 3STBA 4PJIB 3SE9L 2FX8H 1PJWA 4IGBA 4GXFA 1QFWL 1Q1PA 5FA4B 1SXCA 3T5WA 5JPMC 3IMVA 1EUUA 2WLYA 2XN9D 4D8PB 3IN2A 3AXHA 2VRQA 3JV5A 3A0OA 4ZS7H 5I15L 3I56P 1MIEH 4XPAH 3HE6B 3H6JA 1YHQP 2OXHB 4ZUWB 4JPIA 4B9PA 1OB1B 4L3FA 2OMTA 2WXLA 1WRGA 4HMCA 2OMWB 4JFPB 5D1ZI 1JZDC 3KGTA 2YNYA 5EDXA 1SVBA 4R7XA 3BHBA 3LZRA 1HHGB 2VQ1B 3LIZA 2ICEA 2YMXL 1NFKA 3DSFH 4Y19E 3K6FA 1DBAH 5DZOA 1PX8A 2XFXA 5B8CC 4UV4H 2NNAB 3WHXB 3D6GA 2DJSA 2XDJA 2VABA 3V6FA 4DNLA 1AXSB 4K2UL 1RV6X 2J1KA 4K07A 4MXQC 1WF5A 2FWOA 4OVUA 1YEHL 1ZLSL 2BERA 4Z3EA 5D5ME 5JOEA 3MTUE 5CJ5A 3BUBA 5I1HH 4WW1B 4WHYG 1LL1A 1KGWA 1YNLL 1Z5HA 1HXMB 4G7VH 5GS1B 5E00B 1DO5A 2V5TA 4L74A 1M56D 3F85A 4KDWA 1YMHA 1J2JB 3VFUB 4JPQA 4WEEA 5LHDA 4ELMF 4FULA 25C8L 3ZYIA 3C8KB 3DHJA 1TU2B 1OCCB 2JV6A 1J9RA 3IJSA 1X79B 2WXGA 4O58L 1T03L 3KPSD 3MN8A 3GSRA 3E80A 3NH7H 4OD3L 5IEKB 4C55A 3Q9QA 4G43B 4JQIL 4WTQA 4F5CA 3GJFK 1CDHA 5EHFA 2JKXA 1F3RB 2I1KA 1Q0EA 2ENJA 2JELL 3U0WH 2ZONA 4XMWA 1IM9D 4ACTA 3FH8A 4Y5XA 3FCGA 1L4AB 5FO7B 2JJTA 2BZ7A 3I55P 1KCUL 1PSKH 5F6HJ 3WAKA 2GJ6E 2N9YB 2P46B 4JPKH 3BH9B 4NOFA 4NPYB 2X4OA 1QVOA 4G5ZL 2PWFA 4FQXD 4WFFD 3D4ZA 3TH4T 4PD4H 1FCGA 1RUQH 2VN4A 2YAFA 3ARED 3HC2A 4APXB 4BK4A 1AKJD 5LUMA 3D18A 3BGAA 4L5FL 3ETBF 3NVQA 3PV7A 2G2NA 1KN7A 2D9QB 2ITAA 3II2A 4MAYD 5FM8A 3V7AG 4UTBH 1P5UB 1LE9B 4HIQA 3SPVB 2NY1B 3HN3A 1NCAL 2D7NA 3KBEA 2QQKL 2WZ6A 5CSGA 3KXFD 4M6AA 4J4PD 2VLJE 1S5HA 1XGTB 5H8DA 5GS0H 2F74B 2RR3A 1UOVA 4RZCB 1MCLA 2A3TA 1DQLL 2R5DA 3HUSA 4F93B 4O2EA 2YK1L 2AJZB 1QEWA 4BDVB 3ARWA 4MRBA 1XSKA 2F68X 1UXSA 4K8RH 4NQEA 4YZWA 5BV7B 4EAEA 4J23A 2WLLB 1ACCA 4EDFA 3OKNB 2ED7A 2ATAA 2D4DA 3QISA 3QAZC 3DKHA 3SPCA 2EVHA 3ERXA 1ZHLA 1CXKA 3O2VH 3TBSB 3CU7A 2B20A 3U1CA 2XX0A 4P5TD 3EFFA 4Y16D 1A5FH 2K9UA 1S72P 4HWEH 1LGVA 3GK8H 2NYYD 4OKDA 3CLEL 2GEEA 4P2RE 2FWUA 3QFJD 5TF1L 1FU1A 3BUTA 4H25A 1EIBA 2OTPA 3QCTH 4RFNB 5IFAH 4LB8A 1KXTB 3MHVA 2CGRH 2AERT 1P9MC 1FL5A 2DI7A 5L88L 3UTSD 2FO1A 2B87A 2AVGA 3HD7B 5HHMD 3TEYA 3BKJL 5HYEA 5C0AE 4JKKA 4IRSC 5TQ0L 3HRZB 1GL2D 4CVZB 1BXVA 1RY7B 1XL6A 4GS7C 1KV3A 3NN8A 4ODTH 3WD5H 3ZN6A 4UTAL 2VIRB 3CMOH 1DQIA 3NFNB 3I50H 2E7CA 4BHUI 2X4QA 4I77H 3WJMB 4X6DB 5AD0A 3SCMB 1OTSD 3QULA 3MV7D 3RBXA 1VFAB 2NOYA 3UTTB 3HAEA 4ENED 3M17B 4ELME 1RURL 5AKVA 1FZOA 3BT2H 3DI2B 5CZKA 7FABH 3E8UH 4CNIB 2OZ4H 1KBPA 3RWGB 2AJ3A 4WFEE 1Y6KR 4Y9GA 3U0PB 2A1WL 3HI5H 1E90A 3DVGA 2R3SA 4JPWH 3SE3A 3ZU8A 4HFUL 2C4FT 3FFCA 2VISB 5DJAB 2V9RA 3VTPC 3PAZA 4JQXC 2VDLH 3DROA 2DH2A 2QQNH 4AMWA 4FQQA 3K6NA 1G7IA 2NY0B 2CJUH 2J88H 3KLQA 3DETD 2ZCHL 4HK3N 3NSFA 4KNTA 2H7HA 1BD2A 3MUGB 3EH1A 4PI2A 3L1OH 4TTDC 2WM0A 1XF1A 4Q56A 3QZWG 4XBPB 3RHWK 2OI9B 1BP3B 1ZSDA 3TF5A 2NCEA 2V5YA 4P3DB 5JW3L 4K15A 5A2AA 5IROD 1CO1A 1OVUA 1DSYA 1CB4A 4PJDF 32C2B 4P4KA 4RZKA 4BFGA 4E41D 4Q2ZA 4ZUSA 3CC2P 1IGIL 3NJXA 4QRAA 4YHOH 5JQIB 1EXUA 2WO3B 1FG2B 4D3CL 1HHJA 1HCYA 1ID5I 3QJOA 5SX4I 5JXAL 1BGYD 2ZVNB 2W60B 3ALWA 2P5WE 2B88A 4V1DE 3SBWC 1S7XB 3MZTA 1NUFA 4NQCE 4WTZA 2NZ2A 2VXQH 1IBZA 1RVFL 1QSFB 1KDIA 2EXYD 1CVRA 5D7LD 4XCEB 4ZODA 1RK1B 4R0LC 1CI6A 2G9KA 2VC2L 3GJEA 2QSTA 5JHLA 5KVGH 4P2QA 2IZ0A 2EO7A 3HG1B 4IRZH 4XMKL 3KWXA 3V4VH 3BUYB 5LWYH 3W82A 3IJYB 3JTSB 4N2IA 3QQ3A 3AZUA 4U1NA 4DPAX 5E6IA 2OBGA 4M5YL 3N41F 1JCDA 3TONA 3LKQB 2GY7B 1K6QH 4C56E 4GKNA 3HC0A 2KQMA 5AZEH 5IHZA 3IMSA 4GQ9L 4NZDA 3K0YA 4LGPB 2GJZB 3L95B 5EU3B 3MD0A 3QQDB 1X5JA 4GUPA 4NN5B 2BNRA 3QDGB 1MWAA 4X4MA 3UMTA 2V7HA 1KQGB 3QORD 1JGVL 2KKQA 2Z7UA 1Z9LA 5GS0D 3HB3C 1HNYA 1WD9A 2A73A 2BVOB 2C26A 2CBMA 4ZRGA 3TO2A 3S8WA 1IMHC 2QM8A 4IGBC 2BVPB 3CXHJ 3QNYB 4M1DL 2FGWL 4HGWA 1S46A 2CDEB 5GGTA 4LHQB 2R27A 2VR4A 3JWNH 1X9RA 4ISVA 5EPMB 4C57C 3V2NA 2FUTA 4OW6A 2KSEA 4TSCL 4ZO6A 3MZWB 2Z7ZA 1WISA 3BWAA 3GSNL 4DGVL 3MBEA 1XQ4A 2KS1B 1L7IH 3BCCE 5ILTH 3RU8H 2Z8WC 2A6JB 5EU7C 1FLRL 2IALA 2XWBB 5KJRL 1BZQK 3TH3T 1AD9B 4BFEA 4GEJA 1MIML 2EILB 4Z7WA 2KXPB 5IBTH 5LDUA 2BRQA 1RK0A 2MQGA 2YPVH 3P30H 1CS6A 4TQPA 4YDKL 4CADA 5JPNB 3FMGL 4KV5F 4PSPA 4OI7A 4EOTA 3GI9L 1N0XL 1D9KD 4JFZH 2JDIH 3QNXA 3QFDA 2EH8L 1YYLL 3F7LA 1YVLA 3HPLB 5CILL 1FV1B 1H8SA 2J1YA 2Z91B 3LKOA 5HYJD 4WK2B 4NYLB 5DZAA 4IS6A 3KYQA 5GZND 4ZMLA 1J8KA 3MRDA 3PWPA 3FQUB 3QJHB 4J1UB 1Q4NX 3FYEB 4D9LH 3MJ7B 3SDDC 1QHOA 3F2LA 3H1LG 1QATA 4Q6IA 1KD1Q 1X5GA 5EU6A 1R0AL 1WGOA 2WMPB 1KTRL 1T6WA 4BFNA 4NZRL 1JF5A 4PJDE 5GRJL 2FJSA 4UAHA 3DMMB 3AE2C 1QRNA 4JFXA 5G4MA 2VJ0A 1YN7B 2A74C 2HRLA 5HTSA 2WPVB 3U83A 3MTXA 2DTML 2KC0A 2EDDA 5DMIH 1G6RL 5CGBA 5J56B 4G7YL 2IC2A 3JWDL 4KJPD 3CFEB 1RI8A 5GS2D 4P46D 1LWHA 1NANI 5F7EH 3MRQA 1U8PA 4I9WD 5H37G 3WJJC 5HYSB 3K1KC 3H9SE 4JEGB 5BJTB 2GI7A 1HZHH 3DX8A 2IAMD 3AS2A 1UYWH 1YAZA 4HEPA 4NUGL 1WFJA 1TYRA 4YQXL 4NGHH 1Q94A 1ZKAA 2QR0A 1AQDA 4ODVL 2WT7A 3BAEH 1TENA 1M1JA 3H1HE 4LHJB 2F5BH 2WZ0A 1NKRA 1OAQL 4R4FL 4EVNB 3NSYA 2AMUA 2BSTB 1HVVA 3LW5H 3DRTB 4KRPC 2NXYD 5AKRA 3IAGC 1JRHI 2OXGB 1J8HE 4AKPA 5CN3A 1ORQA 5INDB 4HCRL 4W9EC 5DURD 3D3VD 1DN2A 3AU1B 4Q6KA 2QPEB 4X2UA 2VDNH 2CDFA 4GKSA 3UYRL 2AW2A 2Y4SA 1M56B 1IJ9A 2EKSB 4FKHA 3REVA 4UBDD 1D5RA 1IEAB 4TVPD 1G1CA 1IO4A 1RD6A 3SOBH 2YC1A 4KO5A 3N3EA 1RHHB 3PIQA 4XPGH 5I0ZA 5TF1H 2QKIC 3F7KA 3PHQA 1AIZA 1AE6H 3X1BA 1Z6JT 3KPSB 2FJHA 1NBQA 4NKOB 4QAWA 5TGBA 1SHMA 2MCPH 1X5ZA 1NKGA 3P4MB 1HOCA 4XXCC 4PJIF 2XPZA 3N1MC 3K80A 3SQBB 5IVXB 1F3JB 3M9BA 3T1WA 3RA7H 1IM9B 3OAWA 3UZEA 3OG6B 2DQGH 3B2VL 3FSOA 3QXAB 5DA0B 4Y9CA 2EDYA 4WCYH 1I4FB 1NFIA 4GP4B 3GSWB 2WQUA 5DJ8A 1FORL 4A7PA 4WW2A 4IBQA 1VACB 3F58L 1QA9A 4Y88A 4FQXB 4DKEL 4KV5E 3MRNB 3B1UA 1BZDA 4P06A 3A47A 3DX7A 2OSXA 2VDQL 3AREB 5DMGD 3W1ZA 2DW5A 1AKJB 2XNAB 4L1LA 4GAGL 2VRKA 2VXSH 1UWXK 4H13D 1SQBD 4XODA 1ADQH 3EJYD 3RBGA 1OWRM 4FTVE 4JY4A 5J3HC 2QLVB 5M7QA 4E68A 3DHUA 2NNRA 1XH0A 3FB8A 1W72L 2BMKA 2IXQB 2ZCHH 3A0HE 3E3QC 1JOIA 4ADJA 1HDMA 3CFUA 2IDTA 4HCIA 4LIQE 1ZLVK 2L8AA 1CXLA 5J11B 2ERJC 4KQ3L 2R0LH 3W57A 5E5RB 4JANB 1RE3C 2XJLA 3CCVP 1ZT7A 3BI9X 5EF0A 3UERA 1OPGL 4AQEA 3SKOB 4GAJH 2BXZA 1NTMG 2KZWA 5BQ7B 4OZFG 4HIXL 4XR8C 2P3YA 3CCHB 3L3KB 1EV2E 3OQRA 2CMRH 4YUEL 3WTYA 4AMKH 4D9QE 5I76B 2OYMA 4Y16B 4M7KL 4V33A 2BWQA 3WXVL 2E27L 2ZXQA 1UM4L 5D7JC 2YXMA 2BPBA 4PJAA 1X3DA 1JXGA 1UA6H 3CK0H 3GZQA 1S9KD 4M1CC 2ETWA 1KYDA 1GS7A 3IVKB 3MCKA 1R5WB 1EXIA 1L0LD 3T2PA 4HOMA 1I1AC 1U0QA 1SFHA 5KBKA 3QWNA 2WSFJ 2OMBA 1YC7A 3UTSB 2O93L 1F90L 2ICWB 2EE0A 2CR3A 3TNNA 5HHMB 4Z3GA 5H2BB 3GF7A 3DPBB 3Q8BA 3DO3A 4NPJA 1Y0LB 5HHXL 1LTJC 2UWJE 2FZ3B 3H1KD 3GNMH 5IMKB 4JO3L 2V7QH 2WWKO 2WY3B 3X1FA 3IEAA 4XOBA 1KT2A 3BZFB 5I5RA 4D6TD 1A9BA 3PGDB 4PRPE 4XE0A 3ZGHA 1U8CB 3JV4B 1E5YA 4U3SB 4QMAA 1T04B 3U6XS 3HC4L 1J0JA 1AXTH 4JZOB 4TVSa 4B9CA 3MV7B 3ARDD 5FUOH 2H4EA 1LWUB 1RFDL 3GLZA 1KLUA 4IW4C 1EX0A 3IAOA 3QYCA 1A6UL 2H32A 4KY2A 1L9MA 3GM8A 3MQIA 5DI8A 2NQ3A 1EAPB 1FAIH 1KJVB 4G8IB 2CXKA 1I9RH 5D2LA 4Z0BL 2E9GA 2W9EH 5DJZB 2DM3A 3KGUA 2N7BA 4LHUA 1NC2D 2MIZA 3VFPB 2VAAB 4UT9H 4XC1L 4RH4A 3O0RL 3RWJB 1OAZL 1N64H 2C4FU 1Z9PA 3IS0X 4L76A 4PJIE 5F2FA 4HIIB 2WZPA 4BZ2A 5GS3A 4GIAA 2I32A 3L3DB 3QAQA 4F8NA 4GQPH 1NTMK 3MOBH 4OV6F 4R3SA 3UL4A 1QMUA 3QCUH 3PHOA 3V4UL 5I0WA 1ESOA 2TRHA 4NM4L 4OCXH 4ZMZA 1QUNB 2C3XA 4PB9L 3ZYOA 4OV5B 4XO5A 3HZYA 2DD8L 1AD0A 3MBWB 3LS4L 1AZVA 1UENA 1MPAL 3IDIA 4L0PB 2Q3ZA 2X12A 3CSYB 2GKIA 2CIKA 3HG4A 3PJLA 1WC7A 2NY2C 4E41B 4K94H 2BVQB 1XBRA 2K7QA 3UC0H 5EO9A 1LEIB 1BDCA 3KPEA 1EDHA 4MCYA 5HGBA 1VQNP 1F3DH 5KANG 2C0WA 3FMGH 3TJPA 5CGMA 4NKDB 4PHXA 4OJAA 4XX1E 1A7OH 4Q9RL 5IB1A 3ZZQA 2I1JA 3E8VA 4ODUB 3ZT6A 1X7QB 3UJJH 4JB9L 3UACA 3Q5PA 1X5XA 4G8EA 4P05A 1HEZA 4QLWA 3H1IG 3JWNG 3NCBB 1ZJBA 1QFWI 3O4LD 3LHPH 4ZW3A 3WXWH 3L4UA 5ECGA 3X14A 5CSZB 3KZ8A 3FO1A 3D69A 3BMWA 3HI6H 4R5XA 1VADA 3KJ4C 3IMUA 3BGMA 5FKAB 4LC1A 2X89D 5HDOA 5AALA 2BFVH 3SO3B 4X6DF 4HJSA 3U2SB 35C8L 1UGNA 2ALAA 4PJEB 1A3LL 2AXFB 3VFWB 4G1EA 1RIVL 3VYIA 2XXMB 3OJMB 4LOUC 2FLMA 3KVDD 1S2EA 4XOAA 5E8OB 5FECA 3IPFA 5JW5B 5TE7H 1DVXA 1L0NG 3FTGB 4ABVA 4R96B 4NQSB 3WTTA 3QZMA 3KQGA 3S35X 2X28A 4LRIC 3OAYK 1JWUB 2FIKB 2L3BA 5CCGC 4EQ3A 1SBSL 2C1OA 3EJPA 4PJCB 3BUPA 3QORB 1LTAC 4UB8E 1SXZA 2FB4L 3FSZA 3LH9A 3QUYA 2A6KA 4P48A 4ZFGL 2YGVA 3I6KA 1LT9C 5HI5D 1T5XB 2Z5IA 4L1BA 2X6AA 3FQXB 4A6YL 1JPEA 3AAZA 1KEMH 3BFOA 1JTHA 3O6FD 4GRLB 5IMOA 4NJ9L 2GPZA 2ZWKA 2RB8A 2XWEA 1E27A 3BKCL 3ITKA 3UPRB 1PIGA 4ZZKA 5AVRB 4Y1SA 4WSGA 1L9SA 1FRGL 2CLZA 4KXCA 1NBCA 3BDXA 1FGNL 4ODWB 4P2OD 3CL3D 3QZNA 4IBLT 1AA0A 2E7LC 5E6SB 2D2CB 5DEFB 3TO4D 1IIIA 1PLGL 3QQ9C 4JFFE 3ZHFA 1F1AA 4PW9A 5H94B 3BISA 1JHKH 1RZPA 5AZ2H 4WTXA 3ALXA 3MNDA 3W11D 5HVHC 5DJ2B 5LJYH 1ZA3B 3RTQA 4R8WH 1KILC 1PV3A 1IKFH 4KHXA 3D6YA 2FUQA 1M4KA 4MJ4A 3CTTA 5KSVB 1J1EC 1LQBC 4W4NA 3MBXL 4Y8DC 2DIJA 4QGTA 3AQZA 5FUZL 4FZ8H 4OFKA 1NWOA 1YAIA 4TV3A 4QY8B 3RZCA 1HH6B 1PYWA 5KYYA 2AK1L 5IMMA 5LVEA 2ZQKA 1E6JL 1MCCA 1C12B 5IG7B 1RMFL 1G43A 5GJTL 1RQ5A 4W81A 1OK0A 1U8JB 1Z2KA 2P26A 3MUZ1 1WRFA 5D4IA 5DEGB 4QPEA 1L0NK 1ZVSA 5GGRB 2W6BA 2MRYA 3CMEP 1NUNB 1ZR2A 2P5ED 3OPZL 4NO0A 4O02B 4KI5C 3ULSA 1HK6A 2YJQA 4MLSA 4YDJA 4NQVB 3EFFK 4DOJA 4TNVK 1HHKB 3ZR6A 3QWRA 5IHHA 1JWSA 5DF0A 3BZ5A 5CCHA 1U8QA 1USZA 2H2SC 1QW8A 3MV8B 5D1QA 1JNNL 2VDLB 3DDGA 5DSCA 3RQ3A 3VH8B 3BPOC 1KBKA 2F58H 4APQC 3B9EA 3PQYD 3GW6A 5APXA 5BS0D 4P46B 3U7WH 4OZ4B 3V5DB 2H6OA 1VQ9P 4G82A 3W39B 4TM9A 4BWWA 1OTTD 2FT8A 4XE5B 4PJFA 2HRPH 4JBZA 2O5NA 5EO0B 4POZD 4DP1X 2NR6A 3ZR5A 1NEPA 3LN5A 1RF0C 1W72H 4OAWA 5E03A 5T1KA 2FX7L 2WCSA 3FQNA 1LNUB 5ESQB 1EXGA 4X5RA 4M7ZB 4X6DE 4KU1A 5TISH 3V9FA 4DVBB 5HHPB 2X2YA 4KTDL 3UTTE 4PRBB 1G87A 1OCOB 2NXYB 4FYQA 2B8OT 2Q7YA 5EIIG 4UNVA 3LXBA 5GSVA 3K6DA 1ZHNA 2NNFA 3HOGA 4MMZC 4OD2A 1ZXGA 1DVFA 2J57A 2X6VA 3HG0A 4XVJH 4EOWL 4Q58C 2ZVOB 4LNRB 1CFNA 2EDNA 4P0DA 3SFEC 3VVVA 2ZP8A 1JPGA 1ASQA 3DGCR 2IAAC 1YDPB 2ADGB 5B5EH 4OSUL 2VLKA 2YA0A 4QXTA 4M7KH 1OGSA 3TBBA 4BA0A 3QUXC 4FQJL 1RU9H 2E4TA 3SYOA 2X1WL 3FU5A 1N6QL 4N3YB 4QNPF 5EZLB 1H9VA 5E70A 3VXQB 2R29L 1UACL 5KG9A 4L4VD 2DQDH 4YBLB 4IFMA 1KXQE 4J12A 3TBVB 5TE4L 4X98A 4IOIB 4L2LA 3PUCA 4L3EA 1G84A 3QRGH 4WENB 3O9WC 3ZK0A 1KOAA 2HH0H 3QIBD 4RRPA 4TUOB 4FFZL 4HULB 3CFKA 4PLKC 3G5VB 3IJEB 2YSSB 3U59A 4LLDA 1KQLA 1BBDH 3GYRA 4PLNC 2C7UB 3QO1B 2E5TA 2J7LA 3RVTD 3U7YH 2HJFB 1AQMA 1K4CB 4MJIA 4FF9A 3CHRA 2RCSL 4DN3L 4XPTL 4DTGL 1QBLH 3BIBX 3PTZA 1LMKA 3AM8A 2LU3A 3HZVB 4FQ1H 4XXWA 4AYSA 2H41A 3OJDA 4S2SB 4F7PA 1URQA 1QSFE 3QUZB 4YK4C 3S3CB 1P0SE 1YUHA 4LPTA 4P3CH 4X80H 4R7VA 2W0KA 4I87A 2Y06H 2BCCE 5T3XE 1AZNA 3HG1E 2N01B 1HQ4A 5DJ6A 1KIPA 3GHBL 4JY5L 1JPSL 4JM4H 1PY9A 2J1WA 4WO4A 4I0PC 1EMTH 4HH2A 2B1AL 4JM2B 3MSPA 3MGNA 3OTTA 3PWLB 5HGHA 5KN5A 2ZOLA 1YEDA 3BSZL 4R4BB 3Q5RA 1OZTG 3KR3H 1EEYA 5E56A 5FFGA 3R1GL 3MLSH 5FGBC 5C08A 3FCBA 1MVUA 2W81C 4EUPG 5DC0A 1P4BL 1OLZA 3VQLA 3NQIA 5K5GB 3QDGE 1GAFH 2IOMA 3ZL1A 4AEHL 1MKMA 1K3IA 2P45B 1SFCA 2X4PA 3GXPA 4TQIA 1ZV9A 1KFAL 4OU3A 3TFBA 5IW6B 5DFVC 5EU5B 2W94A 2YD6A 3UIYA 3EHBC 5E79E 1K8DB 1AIFB 3QHFH 3ETBJ 4MAYC 1LJ2A 4WIQA 2XVLA 3D7PA 4FERA 2IH1A 2CO3A 3DECA 1J5CA 4PH8A 3SPIA 3P9MB 5IVXF 3JV6A 2YGNA 4NERA 5DRXB 4HJUA 1LE5A 4GSXA 4FQHA 4FXGC 2RA1A 3R0MA 1RIUL 2FK9A 2RKLA 2DMGA 4W1TA 2B4CH 1D5ZB 3ARFD 4WI7A 1SQPE 4IK7A 3B9KB 4FQLL 4YSQA 5ERWA 3DX9A 3MI6A 1CFVL 3V7AE 5B8CA 2X2UA 4Y99C 2FYUG 4HUUB 4MZ3A 3ISYA 5CXPA 3GRWH 4MDJB 5IQ9A 3EJQA 2DQUL 2ZXBA 3H1JE 2ZXEB 3ULUL 1IVTA 4WKZB 5EC2B 5GRZA 2GSIA 4IRJD 5J4MA 3KEDA 3L73D 5TE6H 1O5DT 5FYKE 4F8PA 2NSQA 3GZOA 3MGOA 2Z4QA 1XSIA 1V54B 4WI3A 3ARDB 4G6FD 4BCZA 1HWHB 2JXMA 4MD0A 1WBXA 1KBGL 3LD8C 4Q4EA 4F7EA 1BIIB 2YMYA 4OLVL 1SBSH 2BJML 2JK5B 4LU5H 3U0TB 3WFEH 1JI1A 3NZSA 1B3JA 4QNPE 5ACZA 1FP5A 4S1QH 3QZBA 5DJTB 2LQRA 1LDPL 3GMPA 3KYKH 4PVNA 3TIDB 3RNKA 4C4KT 3RGHA 2AAAA 2NQDA 5BZDB 3L72G 4YSSA 1BVOA 3B7RL 4N2OA 4OLEA 1K2DB 2QVIA 1FYTA 2XNXA 2VDNB 4LLVB 5CMZA 1JWMA 1P7QD 4AYFB 15C8L 5DLMH 4W7ZA 1TT6A 3CX5J 2HZHA 2P8PB 1ZS2A 1LDSA 5MEPB 3DTXB 1Q2NA 1M2VB 1QO3A 5I82A 2ZKHL 3WIIL 1HILA 4LGDE 1IGCL 1LGHB 2ZT9C 1C5BH 3OHXA 3NABL 2Z35B 2HXAA 2X1OA 2NPSC 2HT2C 1U3YA 2P49B 2GTZB 4AENB 4E9QA 1JZ6A 3AT9A 4KKAC 4HUVA 1HCZA 4I2LC 3AXIA 4NRZB 1N7LA 3DETC 4PREB 2FT7A 3S36X 1E9PB 2A0LD 2FYUK 2EICA 2FL5B 4JF7A 1G5AA 2ITFA 1GD2E 2AK1H 1Q81Q 3L3GB 2MPAL 3P77A 4OZIB 3O4LB 4HWBL 3TSIA 1LYQA 1DJGA 2V7NA 4MNHA 5F7BA 4AV4A 1OGAB 3E7JA 3SJVB 4Z7VA 1TLMA 2NX5D 4CMHC 3P73B 3RUGB 1ZMEC 4OF3A 1NMAH 4ICWA 3CCSP 3GMRA 4JHUA 4S1RL 5BVJB 4G72B 1QX1A 2PWDA 4DOHB 1VAHA 2F7QA 1T2QH 3TN0A 5L2KA 3L3OB 2FX9L 2K4WA 2H26B 4WBAA 1T22A 4JFHD 4PUBH 4QRUB 4M9PA 2WINB 2LLGA 3KPSE 2BP8A 2R69A 4LSTL 2JJSC 3F12B 5SWSA 3PWJA 4D0BB 2OL3B 4X4ZA 2A45I 1TG8A 2ZAIA 3GXNA 1XGRB 1WAEA 5IVXE 1IEBA 4RGMC 1OV8A 2IWKA 5E94B 1IC4H 1I1RA 3MAWA 4G6MH 5DU7A 4M43H 1GOGA 1I8AA 4LRNH 1MUJA 1E67A 2Q7NA 4Y2DC 1P9MA 1SMAA 4PIBA 5D70L 3MO1A 3P0VL 2WNXA 4P2OB 3VGFA 3IFMA 1OAUL 4LBAA 1CFQB 1RULH 2RFXA 2R1WA 1LD9A 3VXRA 2JIXD 1R19A 4IRSA 4WFFE 5KLVE 3MUY1 3TK1A 3N1GC 4HWZA 3TO4B 5E08L 1VQ5P 1ZGLP 2R2EB 1MFMA 3DUSA 1MCPL 3K0WA 4ZQTA 4POUB 3FONA 3VI4B 1GGIH 1I3UA 1P6WA 4HUMB 4K7FB 4N5UA 4O51B 5EIQA 4ENZA 5EO1A 2QLYA 2CCLA 3CFJA 3EYQC 1ZT4B 3X3FH 4EKJA 2CO1A 2OA9A 2H89C 2QZ5A 3A22A 2X10A 3FQWA 4QF1A 3S8GB 1FE8L 1FDLL 1BQHB 3RB7A 4ZKUA 4JBSA 2HKAA 2O6CA 1MCOH 3T65B 5B3SB 3EOTL 3APFA 5D71L 3U4BL 4AGPA 4A66A 3BMVA 3H9SA 1RZQA 4JQXA 4U1KA 5FOBB 3DV4A 1QLFB 3VA2C 4HJJH 4PJEF 1PFIA 3IGLA 1HCFX 5TJWK 5I8EB 1CDBA 1OL0A 1PEZA 3B37A 2VCOA 4GRWB 2P5EB 1QLRA 4LEOB 1KB9I 3ISRA 5F3HA 3EH3B 5I1AA 3IF1A 4H1LA 1P84H 4OM0H 2F19L 4PJCF 1PZ5A 1VF5C 3L74E 5ISZD 3V0VA 2A83A 3ARXA 3K72B 5E6YA 4I13B 3TJEL 2PTUA 1ZTMA 2EINB 1OT1A 2PYED 2GUOB 1FVEA 1BLNB 4QWWC 3S5LG 2ZF8A 3V79C 3MNVA 1NGXB 4J3BA 1TEFA 2DYPD 2VZUA 3LZFH 2HT4C 4HUWA 5JHDD 3RNQA 1NCOA 2CBQA 4AIEA 3UTSE 1MI5A 2NY5L 4AKQA 2Q3IA 4HAFA 5HHME 1GZHC 2H3XC 1P4LA 1LK3L 1JPSH 1OAYL 2WLHA 4U1GB 4LLWA 4NUMA 4OUUA 4U6HA 2J8OA 2B1AH 1GPOL 2PR9A 4L3AA 3RK3D 1BZ8A 3OKLA 3SKNA 3BSZH 1Z5LA 1EEZB 2YO2A 4LSRH 3EJJX 3C8HA 3V8OA 1UZ8B 3MV7E 2BCKB 3ZDXB 4X7SL 5IBLD 1U93B 4WUUB 4JYCA 1FBIL 2IANA 1U8NA 3HG2A 3X12B 4E2OA 2FJGA 1ETZA 1ZSHA 4GP8B 3KH3A 4UYPA 1KB9K 1RZIA 2FKWB 2QSIA 5EN2B 5J9PB 3K8LA 1PGJA 2ZUXA 1N8ZB 1SUJA 5EOQL 1TTFA 3BP5B 4ZX4A 4PJ9C 2RJMA 3O6KL 4LEBA 1JVOA 3UTZA 1FHGA 5BU8B 2F53A 1X4XA 7PCYA 4OLXL 2ZXGA 1TFPA 1HESA 1NPUA 4KKLD 4L23A 3RVVC 1HL8A 2UWEA 2GYSA 3FF8A 3GSQA 1RE4C 3VN0A 1P7KB 1KJ2L 3AQDA 4RVBA 1A3QA 3U4EA 4XZUB 1P69B 5EZOL 5GJSL 1B4RA 3QIBB 3AJ7A 1CFVH 4E41E 3LQMA 1DQDL 1TFHA 4UT6L 3TZVC 4MJ5B 1LO4H 1Y18B 4MCZB 4LKCB 3U4KA 1KTLA 2HRHA 1M6OB 5D4QA 1JGEB 4JCLA 4TUJA 4FNRA 2EEXA 4OZHF 3S3JA 2WNKA 1MF2H 4I3SH 5HYQA 3BH4A 4H20H 1E43A 5SX4H 1NTZG 3NJGA 2IFGA 4ZUUB 2C1PB 2OV0A 2VJ8A 3CHPA 1UWEH 3TNUB 1SEQL 3QWOB 2CU9A 5C0FA 5DK2B 3QNZB 2KL6A 5C6TH 3T0AA 4JQVC 3AUWB 1INDH 2VH5L 4K5NA 2IPKA 3VQMA 2DQJL 1Y6MR 4RCAA 5FYJH 1B2WL 4G11A 5A2LH 3NRPA 3VFGL 3RK2C 3EYUH 2LXCB 3ROLA 2IWGA 3CZGA 5EMYA 1B4JL 4PP2B 2R4RH 1CL7H 2YXWA 4G8GD 1IGFL 1JBJA 4PJEE 4Z5RA 5FM5M 2P58A 3CZSA 5JNYA 2VZOA 4OF6A 4PWHA 3TV8A 5KSAA 4Y9FA 3S88H 3NYKA 4DAGL 1IFHH 4FG4A 4Y4FA 3SDDA 2FQDA 3FQTA 3FZUC 2WLIA 3MXVL 2N1TD 3B2UD 3TVMD 3CH1A 3FNKA 2HKFH 1HKFA 1UEMA 2P80D 4EKXA 3DI3B 4PJCE 5KVMC 2UX7A 3IFPA 4HD9A 3G3LA 2MKLC 4JKPH 1MW1A 3B2PA 4HS3A 1IAOB 3LEXA 2KLUA 5DYOB 4IU2A 3SIKA 3CPLA 1HSAA 1NPJA 1QBBA 4ZFFB 2ESVA 5IVOA 2XA8H 1HQRA 1AI1L 5SWZB 3Q05A 3CC7P 3WFDH 3UTQA 1S7QA 3HR5B 4WWKC 4C4UA 1IKNC 5MEOB 5EBMA 1UCBH 2HLFD 3AEFC 1YJDC 3WJJA 4PB0H 3MLZL 3ZLQC 5JXEC 1FHNA 2GITA 2VDRL 3SKJL 4LT7A 3KYOB 2PO6B 4W9KC 5C0CB 1KPUB 2J59M 3RWHB 5C2BL 2EZ0C 3BIAX 2VW6A 1FFQA 4M3LA 2X70B 2D73A 4BXSV 4LLYB 3FO0L 1MG3C 1S7VB 1A9EA 1NTZK 1E4WH 2D0HA 3BEVA 3CFDB 4KDVA 2FFDB 3ZKXC 1SF5A 3V55A 5CEYA 5JIMA 3GKWH 1ET7A 3RPIA 4M8VA 3ZDZB 3ZRSA 4KOCA 2J6EA 4IRJB 3OKEB 3FT2B 4OM1L 1YECL 4DWHA 4OLUH 2CE6A 3C1LA 3BPCA 4OF7A 3VQ2C 5IHWA 3WU2H 4G6FB 4MQ7B 1CGWA 2HFGH 3RVXD 1NMBH 3VU2A 4JM2F 2V3EA 1HNFA 4QYOB 1AGCB 4G8FB 3SDAB 4DQOL 3EO0A 5JA8B 3N4XA 1WCBB 1U3HD 4N1CA 4HVBA 5HDQH 5BUGA 1EBPA 5IM7B 3T08A 4NWTL 1KYOI 3D05A 1KELL 3UAAA 3K6SA 2QVAA 5KAIH 5MEPA 3IMWA 3FCSA 2I07A 2HWZL 5T5FA 5D70H 2C3HA 1P7QB 1THAA 4OCWL 3VWKC 1JGUL 5E8DH 3VXUD 1F6FB 4N8VA 4JRXD 4OKVA 4GKGA 5BZXA 3N7NA 2OMYA 4JRFA 4OZHE 3T0EC 3T4YB 2KZIA 5IB4B 1EGJH 4AQAB 4JJ5B 1A7NL 3VP8A 5KAQF 1AGEA 1D6EA 4I9WE 3FHEA 3Q44A 3LOWA 3VSVA 1EVTC 3S97C 4DFHA 3ZSSA 2CM5A 1A4AA 1KZYA 1OPOA 2DEWX 1AYOA 3HE7C 4BFKA 3BFQG 2OW6A 3O3DA 3BE1L 3HZMA 3ARGB 4FS0A 3RFRA 1LO0H 4ZO7A 3ISWA 2AGJL 1KY6A 4CADB 1FZKB 1GS8A 3M0AA 3CCJP 4KMLB 3RL0g 3DXAB 5FYLH 5D71H 5SWQA 4A2DA 4FQ2L 1ES0A 3Q6FB 2HPCB 1IB5A 4NKMA 4L4TD 2WXOA 3OKMA 1MFCH 4KK9C 4PGZA 3BO8B 4L8CB 1YNTF 4EIJA 3T97B 4KXBA 1U8MB 4MSWB 2J2ZB 3D3VE 4PR5B 1KYOK 2WKOA 1BZOA 2XQYA 4ZKPA 5LCVA 2CBOA 2H0PA 3ZHDA 3W68A 4UZUA 1WA2X 4EN3A 4CVUA 1I3RA 3S37X 5FYJD 4K0OA 5KVGE 1I8MB 5B3JF 4AH2B 3WNJA 4HC1A 4TVPE 1NL0H 4TLUA 3FRUA 4HHAA 5T1DH 2GI0A 4HK0B 2VDKH 4A37A 4JFFA 4GDOA 3AFLA 1KTMA 3N04A 1NJ9B 1RJZB 3Q1SL 2CQVA 3GTVA 5CP3H 1OVRA 1N73C 3B9DA 3WIHA 2PCFB 5DHVH 2IDBA 2NY5H 1NGQH 3C6LB 3RL0D 2V3DA 2C9SA 3AT8A 5DJCB 5I73B 4NB7A 1HHHA 4IKNA 4WRLA 2A2QT 3D52A 1EDQA 4UQEA 2CO6A 2CKBA 5GTIE 3KPQA 1L9RA 4KK6C 3WG7B 3WNOA 2X88A 3RVUD 3EYVB 6PCYA 5LKNA 4H5SA 2WZ7A 3PNRB 1AVAA 1X5FA 3NPSC 3MFGB 4JHVA 3RBZA 2DLFH 4IJTA 3JWNE 1K9TA 4Q9CA 3BVXA 5L6YL 3QEQA 4N9GB 3UDWC 4BIKA 1NTKJ 3H32B 2XKNA 2DQHH 1MHHB 2PXYC 1UATA 1PP9G 3VD2A 3K5RA 1SQBE 1WFIA 2BSED 3Q0HA 1U8IA 3I74A 2I69A 2G30A 2XXGA 5EOQH 1YCSA 4U6XB 3QSKB 4N20A 2YFNA 1I3GL 1NINA 2VR6A 3D25B 4OZIF 2X9XA 5ACMA 2E8YA 3NZUA 4EZKA 4TMPA 1U8KB 4WDIA 5IT2H 3WFCL 1SJVA 5EOTB 1EJOH 1WEJH 4LGSB 4KKPA 4KJWD 4YHZH 4PRDA 5L2JB 4LP8A 3THMH 4JKNA 1JHLL 5DQJB 4F57H 4MQTB 3RUGF 5L4FA 5APQA 2BC4A 5C0RL 5EH1A 2R1YA 5E0FA 2ZYRA 1F6AB 1BSIA 3V4PA 5BCAA 1I8KB 1UH3A 2W65A 3OAUH 5EZPA 1PDKB 3VU1A 4QRQB 4OB5H 3IJ7A 3NJLA 4ADIA 2DKUA 3WUUA 1FIGL 1ZANL 5C0EB 4PRIB 5ISZB 1DANT 3AB0B 5LXGL 4F2MB 1B0IA 2KERA 1J5IA 3HZKA 4PJ8D 3BN9C 3BPLC 4G9DB 3D0LB 1ZHKB 5G55A 3O6MH 2LVEA 3NP4A 3VP9A 1KLFA 4OR1A 1I1FA 4BELD 1L0LE 4WU7A 4U49A 5JHDB 4J8RB 3T6WA 3GBNH 5E9NA 1MJJA 3TEUA 4NC1E 4X99A 1KENH 2UXGA 3ZSTA 2CM6A 3QUKB 3AG4B 3SWYA 1DP0A 3NK3A 1JS4A 3M7OA 2EUXA 3CN3A 2EVFA 4Z76A 3WDHA 3H1LD 3OX8B 2G75B 4Y4HB 2A9MH 3TA4D 2GAZB 4AE1A 4EO5A 4D6TE 3AY4C 3L5WA 4U1MA 4BZ1A 2EUVA 4M7LH 3P2DA 5H4ZA 4LO9A 1BOYA