5AW8B

Kinetics by x-ray crystallography: e2.mgf42-.2rb+ crystal
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw8B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw8B02
1S9KE 3P7KA 2H7HA 4GT1A 2R32A 2ZFCA 5APXA 5AW3B 1GD2E 2P7JA 3M91A 3TNUB 3KDPB 1CZQA 3M0DA 1GK6A 1GU4A 3A7OA 2R3CA 5CMZA 5AW2B 2WTYA 3HE4A 3V4WA 5AW5B 1SLQA 3NMDA 2QM7A 3HE5A 3IR9A 5APQA 4EOTA 3V5BA 4C46A 3A2AA 5AVQB 2XV5A 4C7NB 1CI6A 3M0AA 5AW8B 4AQRD 2Q5UA 2Z5HA 4I2LC 3TYYA 4DZOA 2N9BA 1G2CB 5APVA 5AW7B 1GTWA 4AUWA 5AVXB 5AW1B 2WT7A 1MFZA 2Q3IA 3TNUA 4AYCA 1S9KD 2P2UA 2VRSA 3VMXA 4JYBA 1HBWA 2R5BA 3KQGA 1OWAA 2C9LY 2Z5IA 3NXSA 4XE5B 3VMYA 5APWA 3TK1A 5AVWB 5AW4B 1NWQA 3OAKA 1T2KD 2WWWA 2E43A 3MD0A 1CI6B 3HE4B 4JYCA 2IPPA 1MUUA 1FAVA 3T97A 2QM8A 2W6AA 3M9HA 3MGNA 1KQLA 2W27A 5AVTB 2YO2A 3VYIA 3P32A 3SWFA 3LIDA 3HTKA 1NAFA 4M3LA 3I5CA 2WT7B 3UIAA 5AW9B 2BASA 3L36A 2XZRA 4KHXA 1MV8A 5AW0B 1JUNA 5APSA 5AVUB 2C9NY 2E42A 5AVVB 1A02F 4RETB 1GK4A 3M06A 3L35A 4LC1A 1H89A 3LIEA 1HUCA 5AVYB 2JJLA 1SP4A 5AVZB 4RESB 5AVRB 3B8EB 1GZLA 5AW6B 2WPQA 3NFQA 3VMZA 2WPRA 1CSBA 4I6MC 3O8ZA 3WGUB 2R5DA 2Q7CA 1IO4A 1GU5A 2KP8A 3V4QA 1FOSE 2ZXEB 3WGVB 3NTNA 1H8AA 4B86A 1HWTC 3L37A 4HYTB 2XU6A 2P67A 1YYCA 1T2KC 2YNYA 2YO3A 5APTA 1HJBA 1X8YA 3M9BA 5AVSB 4GKGA 2WPSA 3A5TA 1JNMA 1H88A 5APUA 4C7NA 5APYA 3VTPC 3P8MC 1OXZA 1A02J 1FOSF 3VN0A 1DH3A 3HE5B 3A3YB 1J2JB
chains in the Genus database with same CATH superfamily
4LLMA 4WENB 3L5JA 3G04A 5TDOB 1TO5A 1I3UA 3TNUB 1A3RL 4M6ML 4HIHB 1CBVL 4FXTA 2ZXWB 5IR1B 1CL7L 2F8OA 3PNWA 3PPSA 1JZHA 1I1AB 1XSOA 3CFMA 4CU7A 5BO1L 1MWAB 4U1MA 1DUYA 4WLCA 4U33A 5IQOA 5CLZA 4FFTA 4FI7A 4ZNCD 2XN9B 2YAQA 3TYFB 3UP1A 2N1TB 4DZBB 3U36A 1P5UB 3HJEA 5EG6C 3GI8L 4TNWF 4JUTA 4ZT1A 2V7QH 1VDGA 2N7BA 3ARFB 2CLZB 3Q5YA 2XSKA 4DW2L 3RVTD 3D85D 3WO3B 2PMZA 5D2LF 3X11B 2NQCA 2RQ8A 2OCFD 1YQVL 5ANME 2B3RA 3SYOA 1WBYA 4GKNB 3BFQG 3OLGA 1KMIZ 1NCUA 5CN1A 5D2NA 3T0EE 3PWPE 5HHPA 5GTHH 2P1YA 2NNFA 2AZAA 4QRAA 3AXLB 2XXGA 5HYIA 3TJPA 3OX8B 3VRIB 1YEJH 4AC2A 3RY5A 1WF5A 2AERT 2EDTA 2W65A 3FOLA 3O2DA 2Y6SC 3OXRB 5F9WC 3T0WA 4Z3HA 2ZYRA 1PFCA 3QORA 5D72H 1AHMA 4R26L 1FG9C 3RL2A 5ILTL 1L0NK 5KVDE 4X99B 4KKQA 1T2XA 1YY8B 3IN2A 1VFAA 3ZE1F 3ULUF 4MQTB 3RWCA 1HVVA 4Y7MA 2Z0UA 2PTTB 2XWJB 3UDWA 5E6IB 4Z3GA 4UTAL 1D5IL 1DDHB 4J8RA 3OKMA 2ITCA 3WBDA 3U82B 3RK2C 1QTSA 2H5UA 4IDJH 5IJKA 4XCCH 4CSZA 1U8PA 4YZWA 1AE6L 1QPPA 3TVMC 4L75A 2ITDA 1OAXH 5KTBA 2QKIC 3WKYA 1HH6A 2WNWA 3S88L 2QPUA 3AQYA 3PNWB 3L4FA 5IB4B 3LHPL 4S0SD 5KVFE 3WGVB 1CGUA 4X6BA 1U42A 2R29A 3A6BH 4QOKD 1ETJA 1NL0L 4KRNA 2DTSA 3RTQC 4OUUA 5A6LA 1M56D 1A7NH 2BRRH 3NZHL 4CW1A 1JGEA 1QNIA 3ARDA 1M7IB 2ZYHA 1HIMH 2N1TA 1AZNA 1W72B 3TIEA 3EO1A 4XMZA 1G7PA 1UT2A 2X4TB 4JFHD 4HLZH 2WC7A 1BYNA 2FJHA 4L73A 1KGXA 4FG6D 1B9ZA 2J1KA 2AK4B 4HKBB 5IW1B 3FBQA 1LVEA 2F5AH 1RHZB 3QUYC 4XAWH 1F3JB 1CDYA 1ZGLP 1A4BA 1WFNA 3DV6B 3MBEA 1JZ3A 3C5SB 2F58H 3DURA 3MXWH 4AQZA 1U4FA 1M57D 3GBML 3EO0B 4Y4KD 1S7VB 1JOCA 4XA4A 2R32A 1OCOB 2WJ5A 3ZSSA 2ITDB 2G0LA 3QUYB 2AKRA 3QG7L 3GT6A 4EDWL 4Z7QE 1KEGH 1GPOH 4DT0A 1AD0B 4HUXB 1RZ7H 4OIAA 3CSFA 1S5IL 4F8TA 2EXYD 3LH2H 1WMKA 2YAFA 4MB1A 1Y7VA 3EYVB 4KTDL 5GGTL 3L3GA 1KDIA 4X6CE 4B27A 1FDMA 1T7VA 4DKFL 2QTVA 1URQC 3O4LA 5TF0A 5BRZD 2EEBA 5DS8B 3TXAA 3N85H 2C3XA 1JBJA 1TUPA 5KVDL 4OLVL 4AV5A 5TE7L 1N0XH 3HUJE 2HA1A 4RMQA 3FULA 4LRNL 5I1KL 4K71C 1LK3H 4XAKE 3CMEP 5AW7B 3NN8B 4MJ4A 4XBGB 4G5AA 4Y4KB 4GO9A 4CILA 3MACL 1MVFA 3S9OA 1PMYA 4YHIA 2P2UA 2Z4TA 3LKQA 5HJ3B 3FU9A 5IF0B 3WFCH 2N0KA 2VDOH 2J1ZA 3P54A 4BHUI 1T03L 2F8VA 3UYPA 4E0RA 5T3XH 1C7SA 1UWGH 4ISVB 3AE9C 3WU2E 4LIQE 3EFGA 4PCTA 2WB1A 4LLUB 4NI6A 1HILA 4IRSD 3LW5J 1SQMA 4Y5VA 4YDVB 4QEGA 5EU4A 4X6FA 1D5MB 3ARGC 2QDWA 4PU2A 4NZUL 2DOCA 1MCDA 2Z35A 3VVVA 3BIKB 5CEYA 3X17A 3O2DL 5EZIH 3HTKA 5E6RB 3ZR6A 4JREB 1I8LA 5C92A 4N0FA 4LF3A 4OGQD 4LMQE 5HGAA 3QIWB 1NAMA 2IALA 4NB7A 5EUOE 1JUNA 3HPJB 1JY3P 4OJDH 4TVPE 2KZ1B 1BVNT 3G3ZA 1S7QA 3PGCA 2Q7YB 3BH8A 5IM7A 3C75A 1YNLH 5KJ7E 3LNGA 5I1EL 3IJEA 1OAKH 2EDYA 3IJHB 5DMKA 4MNGB 2N3JA 3DO3A 4DFHA 2K0RA 1RUAH 4HIJB 4KZDH 4BE5A 2DBLH 4L1LA 5LN4A 2E5TA 1N73B 5F0PB 1YMHA 5GPRA 1UKSA 2XXCB 1CXEA 4HK0A 4I77H 1A0QL 3LRSA 5FIEA 5FWRA 5T5NF 1AQHA 2JWDA 4N2GA 4G7YH 4CVXA 4BZ2H 1AXTL 3QUXD 4F58H 4QTHB 1NBYB 1RURH 4JKMA 5GJSL 3G6JB 1DQLH 3JWDH 2FWUA 1MEXH 3RIKA 1CYGA 5SWSB 2E76B 2PPAA 4B9FA 1ZOXA 1DEEB 2E75D 1MCKA 2FSEA 1MQKH 5ELIA 4CC4C 5DDHB 3QULA 5IMMA 4N2BA 5LXVA 2Q76B 4MZ3A 4A2GA 4B6ZA 5ICYA 5TK2A 1IZKA 4MXQC 1RIUL 4HCFA 1I7RB 4GI8A 2PN5A 2GW5A 3ARWA 4MNGA 4R2GB 4DGIL 3DX9B 1RZIA 4DP7X 4HKJB 4LEXL 3WXVH 4L9DA 3CIQA 3H42H 1GW3A 5BRZB 2Y2WA 3ULUH 2C7FA 4X6BB 1F58H 3H1JE 1JGVL 2HRHA 3W11C 4EI0A 3HFML 1BDCA 4I9WD 2ED7A 1MCFA 3CPWO 3GW6A 3O6MH 1NTZJ 5HBBA 3R4YA 3NSDA 3B9KB 3S5LG 3CSTA 2Z93B 5T5NG 3MLWH 4N8PA 5DUBB 2Y36H 3S4SG 4FQ1H 3DX6A 4MD0B 3PWPD 4XO5A 3IEAA 1KIUB 3UTSE 4JVWA 1IV8A 3CXHK 3SDXA 1KIPB 3S3BB 1I8UA 2PPDA 4AGOA 1F4XH 4RSYA 4F8LA 4AUWA 3WNKA 2CNYA 4E9YA 1E6JL 1LD9B 4OAWA 4Y4FC 5AOJA 1T0MA 1WFOA 3ECUA 5JPNC 4JB9H 5E4AA 3SCMD 1D7DA 1WBZA 3A6OA 3D18B 2FUQA 4G8GD 3APCA 4FNPA 3ZT6A 4E9XA 5TJWK 2Z4QB 4ZFQA 4PV1D 4LVNB 1XF4B 4KITB 2HFTA 5EBMA 3DX7A 3NFPA 3KLSA 3OGCA 1BQ5A 2CDGA 4O02L 1KBKA 3AM8C 3N55A 4HH8A 3UFIA 1RZPA 1Z9PA 1U8CB 3MREA 4IBZA 4J1UB 1UXWB 3FSZA 5IR1A 4F3FA 3MRQB 1JNLH 1TVBA 4P2RA 3TC9A 1QL1A 3AECC 2CDFB 2WQXA 1RHHB 3F6JA 4W9ZA 3TZVA 5B1AB 5B7MA 4NM8H 3QEGL 5GRVK 2JB5L 1MJJA 4FQJL 4PD4K 1XB3A 1EDQA 2ARJA 4PV9A 3ZDXE 1FVEB 1OHZA 3MJ9H 2AGJH 5HPOA 1NAMH 3M06A 5F71A 3RDTB 5EDSA 3ML9A 1XXDC 3FW6A 2GEEA 1N6VA 2FXMA 4JL1A 4M62H 3LS5H 4NZFA 2HH0H 3RFZC 1GOFA 3BQUD 2E4FA 4X4YB 5L88L 4GI9A 3O8ZA 5KZCB 4F2EA 1QKZL 5I8CB 1DUZA 3T9WA 3MX0B 1DVQA 3GJEA 3O2VH 2FJGA 1MZ9A 3VGEA 2HFFB 3EOAA 2XN9E 4FS0A 5DXWA 2HVKA 2W60A 5DZOA 2AXFA 2BMKB 3GXNA 1WAAA 3WTWA 2X3AA 1LTXA 1NGQL 2I9TA 5F7DA 4PJAE 3EDJA 1NU1D 5IMOA 4MAYD 3V4PA 2OP4H 4PVMA 4YEEA 1Z32X 4ZMTA 3KPQA 4JPWL 4EQ3A 4W93A 1LP9A 2YEQA 5ADOL 2W9EL 2NYYC 1BAWA 4P5MA 2CPBA 4GKOA 3LN9A 1SQVG 1S5LE 3ZUNC 4JY5L 1DBJL 3QQ9C 3MV01 4FL4C 2L91A 1OAQL 1NH4A 1ML0A 4ZMLA 5J6GB 5G4OA 2G75B 3VYPA 3PWPB 1A3LL 4XBPB 2V8LA 3ZJAA 5AQ0A 2NW3A 4NWUL 2OFQA 2VXQL 1DQQA 3WNPA 3H2QA 3D12B 3VP8A 1KPUA 2EE6A 2DD8L 2Y1VA 1HDMA 4XAKD 4N8CL 4TLSA 1QUPA 2F7PA 5BRPA 1XGTA 4JNXA 2WXJA 1IEAA 4YGVA 2QKSA 3D25A 3LEVL 4L37A 1ET8A 2I1JA 4F2ME 4YH6A 2YUXA 3SYAA 1DBAL 5FO8A 1CD9B 2NY4D 2NPLX 2FFDC 3LN4A 4O2EB 1OFCX 5CN2A 5BMFL 2VQ4A 4LLYB 3WUVA 1OE1A 1T2JA 3HG4A 4N2HA 1Q81Q 1FGNL 4Y2OB 5A2LH 3KPPB 3NQKA 4FC3E 3V9CA 3PL6B 1AD0A 4AEIH 1H5BB 3KXFE 1ZV2A 5CZVL 4MASA 4ZO7A 3SBPA 3ULAB 1G0XA 2AKRB 1MWOA 1CLYL 5L8KB 1G1JA 4M8VA 3LZRA 1N8ZB 2BP0B 1E4WH 3DIDA 1D6VL 3MLTA 4FXKB 3NABL 4OLYH 4DGVL 5JORA 2NLJB 1JYNA 3K71B 3VMYA 4FNLL 5IZ7A 1A8JH 1FFOB 1M05B 2AQ2A 2O01J 1CQKA 1CDCA 1T04B 3CC5A 3QG6A 4H4NA 3C2AH 3J8F7 3L73J 5FYLH 3T97A 2FYUE 4UB6H 2COQA 4ZUVB 4W68A 3CCVP 3H1IJ 2R4RH 2ZCKH 3H56A 5DD1L 1QEXA 1CF1A 1QX8A 2P5WD 3C6LA 3NACL 3VD7A 3NAAH 1CTOA 1KDJA 2CKBA 2VZVA 3FN0H 1Q9LB 2VUKA 3NG5A 1R5LA 1G94A 1BGXH 1IE4A 1NYHA 2VLRB 3VRLE 2KSJA 3ARBA 4Z77A 4CKQA 1KBGL 3H3BC 4M93C 2OMTB 2XZQL 3QI9D 4H20H 5HTSA 1Q0EA 3F65A 4JHWH 3IJ8A 1R46A 1BQHB 4OZFH 3N42B 1KV3A 4JRYD 4Y19E 4GW4B 2FAUA 4LCWB 1QD0A 2E7LC 3EOTL 4UWQB 1U9KA 3LSOB 2GCYA 3QXWA 3WG7B 2IFFH 4HC1H 1YAIA 2PTVA 3QIUC 4WO4B 3K6DA 5BVZA 1KMGA 3ZTDC 4N2MA 2HLOA 1USEA 3EBAA 3OXSB 3K2UH 2GK2A 4ZQKB 4LOFA 2KNCA 1XIWA 4Y88A 3FTVA 4KBPA 3GM0A 3MCKB 4YDJB 4BBWA 3AT0A 1IFDA 5AZEL 2CO7B 2X05A 3TA3D 4XNZB 3C60A 4MQXC 4KTEL 4MDJB 3MLSH 1DQMH 2X44D 5JXEC 2AJUL 4RGNB 5LBVA 1SN0A 4R3SB 2E46A 3S35X 5I1CH 5C9JA 1IKFL 3ZYIA 2UWEF 4L5FE 1GXEA 2CPCA 2F2HA 3D33A 1G6RA 3ABLB 4PB9H 3ILDA 5I2IA 1QSFA 1TJHH 5D4QA 3L71E 3QR2A 4F8OA 3QRBA 3CVIL 2AFNA 3I6GA 2IF7A 3S5LA 4D8OA 3RWCB 3OG4B 3UPRA 4PUBL 4AQOA 4YL4A 1ZV9A 1AXSA 2IGTA 1X4ZA 5FA4A 4DUXA 3N9GH 1G9MC 4FG6C 1DSYA 4OW6A 2V17L 3JUZA 1BFTA 2YBGA 1FAKT 3B9KD 3EFOA 4NQEA 5DQJA 5CMZA 4XN2A 4KAQL 4N1EA 3KM2A 5BQDA 1T5XA 3W9DA 4QNPF 4OF7A 3KDMB 1OANA 2X4PB 1U0QA 2DI9A 1GGIL 2OYHB 4G70B 2ZP9A 1TKWA 2NXZD 4HS3A 3HKFA 4WV1C 3P9LA 5HYEA 1QZ1A 3G9VA 1KXQA 1JGEB 3ARDB 2CRMA 3ZHKA 1N64H 3N4XA 1BIIA 2PETA 3MCLL 1JCVA 4UB6E 3JV4B 4FDWA 4P8QA 3HC0B 1J5OL 4N0UA 5FYJH 4PM1A 3WO4B 2OSWA 4BK5C 4D0CA 4U1KA 4HJ1A 2CMRH 1RQUA 2BVQA 1VQ5P 1FNGB 4DZ8B 2W83C 2OR8A 3MUDC 3MRRB 5E9DD 4KX9A 4V2BA 4G6AD 3Q6GH 3HUSA 3KDMA 1SQXD 2YMOA 1UCBL 1O5PA 2C9UA 3EYVA 3PIQA 3FONA 2DQIH 2AQQA 4S1DC 4PW3A 5BRZE 1KFGA 4DN4L 5JXAH 1OQXA 4FZ8H 5L8LB 3ZE0B 5J12C 1QBBA 3V0WH 4HOMA 1DN0B 1GYWA 4HG4J 3WSQL 3L3DB 1A6ZA 1LWJA 3F6IA 4DHLA 2BVOB 4GKSA 2Z8VC 4GSQA 4PRDB 5HDOA 1PGPA 2LKMA 1MN4A 2DIAA 3TF5A 5KVEH 2OK0L 2F54E 2AQ3A 4UM8B 1P6AB 2XVKA 3QK0A 3B9EA 1IQDA 2CUIA 1AO7E 3T0VA 2VQ1A 3SBRA 4NT6B 4JFXB 5SWZB 5TDPB 2BHUA 1H3TA 1L7TH 4IL6E 1S3KL 2VLJA 3G5VB 1OM3H 4BM7A 4JUSA 3OKOB 1FH5H 4PV8A 1RULH 4P46D 1MZYA 2YGQA 5KUMA 3FU7A 3VXPA 4BJLA 2BZ7A 2Q86B 3T3MB 2AHIA 5D7JA 3JSVC 4W7ZA 4ODXA 5ID0B 1BWWA 3DK2A 4R9HA 1N6UA 4K3DL 5I15H 4H8WH 5FYLL 2BDNH 4G71B 1PGQA 2DF3A 1L9SA 1NGWA 3SKJL 4R5XA 4ABQA 4PP1D 4H2AA 4GUPB 2BW4A 1NC4B 2JXMA 3ZTJH 1ACYL 4GSDL 5FB8B 4LCWA 4Z7VA 3GF7A 5I5IA 1QVGO 5DJXB 1PZ3A 2HKFH 5C08E 3IMUA 1L9MA 2V3FA 5E00B 5EBWA 3VSQA 1OW0A 1IQDB 3IKCB 3LB6D 5B1BB 1TZGH 1ZA6B 3DHUA 3HNSH 3LPGA 1MWAL 1BAFH 5DK0A 3IVKB 3L4ZA 1T89C 4K3EH 2JKXA 4K7FA 1AO7A 3BPNC 3TV3H 4MMZA 4PJIA 4CMHC 3HC3H 4HFWA 1TQTA 1KT2A 3IDXH 3QJUB 4MMYA 2G0KA 3FUNA 4ZPTA 1ZDQA 1KJ2B 4X4XA 2BNQD 3IF1B 1L9PA 2F74A 3N40P 4BDVA 1MCCA 1QSFB 1RU9H 4I85A 1ZS2A 4TQ8A 3PIQB 2IO5A 4O51B 4XC1L 1SOSA 4J3SA 3BVXA 1AQDB 1H8SA 2H88C 2JH2A 3EHBC 3EH4B 3TTSA 4I0KA 3LIZH 4UT9H 4YJZL 2Y3NA 3MV11 2X7LA 4BH8A 3GXTA 3IS1X 3ZTCC 4LEEA 3D52A 4B9PA 2X6VA 1I8KB 2OAAA 3EO9H 4PUBH 4D6TJ 1EFQA 5JHLA 3IDNA 1M9SA 3IDMA 3MNWB 4NIYE 1JPGB 1OM9A 3VGAB 2QLYA 5BO0D 2FIRT 4JFPA 3O9WA 3U36B 3KGTA 1UOKA 3QWOA 4CMMA 4K8RH 1OTTD 1UJ3B 2CGRH 2VLLB 1RZKL 3KNBA 1M3JA 2LU5A 4NENA 3QIWC 4EXPX 3B5TA 5K59E 1KLUB 4JN2A 5DJ8A 3BP5A 2JCCF 5D7IF 5J89A 1M3IA 3G3LA 1NAFA 3EW3B 2P44B 3AY2A 5EOCL 3V8OA 1ZY9A 4M7ZC 3EQ2A 2WBJA 4KKCD 4LZKA 2C9NY 1JDCA 3WEMA 2RIKA 2FHCA 1WA2X 2Z6FA 1AKJB 2X70A 3GPEA 1OK8A 1ZHNA 1MAJA 1SJMA 4PJCF 5KVGH 1RJYA 5E8DH 2WPQA 1YNTF 1Y1UA 3U2SB 1L3NA 4QRSA 1BD2E 2PO6C 3HI5L 2E56A 1KD1Q 2D7NA 2UUDK 4ONGH 5IQ7L 1ZRUA 2BLFA 2F1AA 2PO6B 3P73B 4H8WC 4IOSD 2E7LA 4IEFA 4LQFH 7FABL 4E41E 1DN0A 5DZAA 4K71B 1RH5B 1FN4B 2HLFC 2Y7QB 2DQGH 3ZL4L 1F6AA 2B4CL 1T8ZA 3OM3B 3P3SA 4ZPVA 1XGQB 2DLFH 5EPMA 3R0MA 2X4NA 1UG9A 4D0BA 5APTA 2BERA 3FO1A 3M1BB 3QWNA 4WIQA 5C09B 3RHWK 4F2FA 5HVWA 3CHPA 1SLWA 1AHWB 2CJSA 3HUSC 1GDTA 1J88A 3DK0A 1R9FA 5LGHH 4M6AA 2XIBA 5ITBH 1QSFD 2NR6C 3N06B 1FSKB 1MLBA 1R3IL 5EC1A 4MDJA 5KSUA 3PUCA 4M5SA 4LRIA 2AS5M 1S9XA 9PCYA 3SYCA 3BVHA 1N5AA 3B8SA 5L8RJ 4PRBA 1A65A 3M91A 1NMBL 1YEHH 2LTQB 5GS0L 4N9GA 3GS7A 4FFYA 2FXPA 3QP3A 1FH5L 2ICEC 3AVEA 4KNTA 4MLIA 4X5WA 4I48A 5D1ZI 1Z5HA 1J48A 2WNKA 1IGYA 1W8EA 5E08H 3SDAD 2EVHA 5E1AA 2OTPA 2NXZB 1DL7L 3INUL 2CG9X 4L3CA 4GQZA 2JQMA 3NJKA 4XPTL 2R4SH 4G1MA 5LVEA 1EHLL 5E00A 5E99L 5EBWB 1M7IA 3PTZA 3L6FB 2C0WA 3TBTA 1IL1A 1LQBC 4P07A 5DLMH 3P40A 4NQEB 4IFMA 3VYNA 4OF8A 3BZ4A 5SWZE 3SKNB 3V0JA 5I74B 2NY4C 2YQ2A 1AXIB 3EKCA 3DRQA 4FAAB 1Z66A 3FB5A 4ES8A 4TQHA 5K9OA 3NH7H 2IGFH 2XQ0A 3QXVA 3CVHA 4Y1AE 3FUEA 4PJ8B 1B4LA 2APBA 3U2JA 5GGRA 2XCMC 2FK9A 2JKTM 3QO0A 1S1CX 4XGZA 2OYHA 1HC1A 5MEND 2XWXA 4LSTH 1R5SA 1HWHB 4MNHB 3ABVC 2ZD0A 1PIFA 3L9RB 1MREL 2E7DA 2E7MA 5SX4I 3NSXA 1J8HB 4A6YH 1I8AA 4ZW3A 5DD0H 2XV0A 1ZMYA 1BX2B 5DQJB 1TTCA 1HHHB 1KQSO 1NPUA 3NUKA 3F84A 3QFDA 1J8RA 1XGTB 2QQNH 2VAAB 3CXFA 1O7VA 4YHKH 5FGCB 4F1SA 1N86A 3OSVA 5ESQB 4ZFZB 1XIWC 1C9SA 4OCSL 3CC4P 3B7YA 4XP5L 3Q48A 5C0IB 1ILUA 2ZE0A 4UNVA 3HHSB 5IW6A 2AQSA 1NPNA 1TVHA 3MO1B 2R59A 3RILA 2WLYA 1FPTL 1RJLB 1HUCA 2W9LA 3MXVH 5CSZA 5F6HI 4IGBA 4NUGL 3V6FA 5KBPA 1PQZA 2WZPA 3EGXA 4PGZA 2ZG1A 3A0HE 3GMOA 5HHQB 4IU2B 4YBHA 3QUKA 3NJFA 4M7KH 5L4MA 3BP6A 4AZ8B 3QDJB 4QXGL 2QIWA 1OT1A 1ZJBA 3FUJA 5F2FA 3PHQA 1P2CA 4IW4C 4CGUB 2NY6C 4YFDB 1ED3B 1QBLL 2DQUH 1PLGL 5C0BB 3ARFC 4Z5RB 1HYSD 5FPIA 3IU4L 1N7ML 3S36L 1UXSA 4QRQB 1TYEB 2BMKA 3FMGL 5D1XE 3R0NA 1SDAB 4APXB 1TNMA 4P2AA 4PV8B 2DMHA 3MRKB 2QGBA 5ABAA 2P46B 2EKSB 3FH5A 1A5FL 4XCNA 2WB7A 4OVVA 1V7NH 1PG7L 3IJ7A 4HHGA 3CHQA 3FH8A 4PGDB 2WWNA 2BJMH 2UZIH 1TVDA 3B2PA 5ID1B 2VJXA 1YEKH 1E42A 3HB3D 1VA9A 3KH3A 4HJGA 3W81A 1UASA 3W5MA 2V7NB 4UQ3B 2R2HB 4U3SB 4NQQA 1VQ8P 5CJ0A 1E8YA 1W8OA 5B8CC 2R0KL 2VMEA 1PGRB 4PD4J 1HZHH 1Q38A 2GTQA 3MV7A 2GSGA 2G75A 3Q8EA 2IDTA 5FM5O 5LBSH 4WI9A 1OAZL 3IU3B 1XIWB 4I8DA 3STBA 3JWOH 3BH9A 4WF7A 4W7YA 4J3OD 1N7SB 2XQBL 3EYFA 3L13A 2VKXA 5JHMA 2FX9L 5CD3B 1NZRA 1TZIA 1WC7A 1B6UA 5EZOH 2PWEA 3EJQA 3N85L 3WIIL 1RHFA 3HS9A 4UIMA 2ICCA 4NM4H 4AQRD 4PS3A 2QHRL 1SJXA 3JYCA 4ETQA 1T21B 4QTIL 2BH0A 5EO9B 1KGUA 2EH8L 2FJFA 4P05A 4XPAL 5EBLA 2R69A 3EZ8A 4L23A 2DY2A 3VFPB 1Z9OA 2VDNH 3MUDA 3Q1SL 4LAQH 4U3SA 3KYNA 2Z5IA 1HFUA 2V7HA 3Q5PA 5GS2D 3AITA 3DSFH 4WQOA 4NCC2 3RZCA 4YHOH 4JM4L 1L0NG 2R23B 1XCTA 2EDHA 1CBVH 3AE6C 3VJ6B 3D5OF 1WAEA 3FOMB 3K72B 3N2JA 4UDUA 5EO1B 2AXHA 3L4WA 4AV0A 1GKOA 3B2UC 3PJNA 3ZRSA 4P5TC 5BO1H 3QS2A 1F02I 2YKLH 4GPVA 2HJFB 1ODAA 2VQTA 3UGEA 3VXMD 2P58A 3OGOE 3NGBB 4BFFA 2CLRA 1EBAA 1QBMH 4S1DD 5F9JA 3WIHH 5E7BA 1JIBA 4QXUH 1LWUA 4W6YB 4R7XA 4KKPA 4F7MB 1JY3N 4OQ1A 2OTUA 4PIBA 2B14A 3O41A 3RGVC 4CVUA 4KTGA 1VJSA 1K8AQ 2A6DA 4I7ZC 4NRZA 3FU3A 3QRGL 5EBMB 4OIIH 1CU4H 2F7RA 4BWNA 1NKNA 1A1OA 5KVFL 1RK1B 4KZ0A 4NFDA 4U1LA 2IH3B 4X8XA 1P1VA 1E79H 2IFGA 2J20A 5EFWB 4ELME 3MRQA 1QSFE 3X1EA 1WD8A 2JK5B 4H26B 3RUGA 2DQJH 3W0WE 2UXTA 2ORBL 1E5YA 3IDIB 1RFDH 4FF9A 4PY8J 3LNFA 1JV5A 4NQDB 4AYID 5EB9A 3Q9QA 3OD3A 3QNFA 1IK7A 1PKOA 4GDOA 4AUUA 1SQPE 1YN7A 3CLFH 4YFLI 1ZAGA 2HAZA 3RFZB 1BBDL 1MI5D 4OVNF 1UGKA 2D3LA 2G4EA 2ZSVB 3QDHA 4K23H 2FQGA 2VW6A 3PRZA 4EVNB 1S9KE 4KO6A 4KO9A 3T2NL 1VPCA 1WFTA 2J1WA 2P7JA 1CZQA 2NT1A 4JHVA 2VDPL 3UX9B 1HL5A 2AXFB 3T77B 2CK0H 2JJSA 2KZJA 3KAAA 4NLAA 1KY7A 4EOTA 1AGDB 4NC1E 1GY2A 3VI4E 5AAMA 1HILB 1XVSA 3GUFA 2LW3A 3PRJA 5IWLA 4NO5A 1OSPL 3V6IA 1PF3A 3L4CA 3NGBC 1NTKK 3WHXB 3RGBA 3VTMA 3WMSA 1RUPH 4PW9A 3WD5L 1PL5A 2CJ3A 4G7VL 5AVXB 3NPZB 1UHVA 4WUUB 5MERA 1VKXB 1DEBA 3KPSA 3HNVL 1WWAX 4BH7A 2ED6A 3KZIH 4YUEL 1FC1A 3HE6C 3MLVL 3P9MB 1XBDA 4C8XA 1D3CA 3SY0B 3SQBA 3NSCA 2FO4B 2VLKE 3ATEA 4AIOA 2YZ8A 3QFGA 2FGWH 4LGDE 2KUTA 2VXTL 5KSAC 1NH6A 3GSVA 5EFIA 2AQPA 2QHLA 5JW4Q 4M6NL 2Q20A 4Z8FH 1U91A 4YBQD 4E9RA 3L3HB 4W9DC 3MRRA 4WGVB 1MCOL 2LLLA 3QPQD 4IIQA 2EICA 4ZD3L 4PYHA 3SODB 5CINL 3N1FC 3IS0X 5CUSH 3ZZQA 1FZGA 2CH8A 2XN9D 1YY9C 3KEDA 4W9HC 1CTNA 3OVUB 4XCFL 2YWZA 1DVFC 4GXVH 3D09A 1A7RH 3X13B 5TFSL 3ARXA 4LRNH 5C0JA 4AIEA 3QVAA 2XKNB 4LC1A 4F8PA 4TPRL 5FYKE 3GG2A 1GHFH 1UUSA 2VQUA 4GOSA 3TH3T 2FYUJ 4HBCH 4QRPD 5EEWA 1K73Q 5HHPB 2XZCH 2G4GA 2B88A 4O5LH 1T03H 1JZGA 1S7WA 5I8KL 2WMPB 4JHAL 5F1IA 2HFGL 5C0CE 1J87A 1I7ZA 3DO7A 2UVFA 4UV7H 3MLYH 2IH1A 2AK1H 3CL3D 3L75G 4LLHA 2PCFA 1NCAL 1L4IA 2VLRA 1NHLA 3Q2CA 3QZWG 3GKWL 4RQQA 2BWDA 2O01N 3OAZH 3NCFB 4AM0A 4DO6A 3L4TA 3EJYC 4DZBA 3H1HE 1MJ8L 2D2CB 4HKBA 3UTSA 3H6AA 3WNJA 1NM9A 3N40F 2IMNA 2JNZA 4KHXL 4LPTA 2IV8A 4PHZA 3K6OA 1FZOA 1WLHA 2E76C 1FYTE 2X3BA 1CZ8H 4Q2ZA 3GLEA 4X7DC 3KWUA 2YGOA 4FTVA 1JK8B 3Q13A 3KPSB 1OF2A 3FCGA 3BUIA 2EVIA 2CO7A 1BG9A 1EDLA 3H2WA 5BVJA 1N7SD 4G2AA 4WSKA 1AKPA 1LEIA 2X0WA 2KNCB 4NN6C 3U6RA 1SQBJ 3SFEC 2EVGA 1DSFL 3EJZD 5ITFA 4Y4HB 2AEMA 5L0QB 1I1RA 3MFFA 4J39A 4HT1H 4PAZA 3DMMD 2OCCB 3G6JE 3KE0A 3OXRA 3PWUB 4EF3A 3PGDA 3SJVE 4L2LA 2FR4B 1PBYA 5D2LB 2A9AA 2DQJL 5CBEB 4XMPH 3RKDD 4PRNA 2FHFA 3HI6L 5E6IA 1ZXKA 4R4BB 1HL4A 1TO4A 3F7QA 4MZIA 4HJUA 4EI5D 1ZCRA 4NSKA 5CCJA 1RFDL 4YHIB 5CZVH 4N6JA 4L74A 4L3EA 2K4AA 4AYCA 1OE3A 4ODUA 5IT2L 3CFDA 1OAJA 4NO0D 5CSBA 5KLVG 1SM3H 4ODVL 3I2CL 1NTZD 3AEGC 1V8HA 4WBAA 4LEXH 3I74A 4O2FA 1U3ZA 1AGBB 3VWJA 3T0EA 1IU1A 2Y2YA 4LCUA 5JZ7D 1IBGH 3M17B 1DLHA 1I85A 2PCYA 2XBTA 1H15B 4HUXA 3ALWA 4I3RH 4Y4HA 4DSYA 4OUUB 1DVXA 2WXFA 3IMSA 4JPKH 3WY4A 4B96A 1WG3A 2R1XB 4XVJH 1T1XA 3OKKB 4UMSA 4I0PA 2H3KA 3H3PL 3MODH 3ZHFA 3MRNB 1EX0A 4PY7A 1AG6A 2BVPB 2H1XA 4MFHA 1ETA1 1F3JA 2UVEA 4YZFE 1IK9A 4RISH 1Z5LB 5T1MA 1KYFA 4NYLA 4EIBA 4OFKA 1CYXA 4RGMB 3L74G 3FFDA 3KPTA 4HWBL 4V1DD 5IVXA 4O9HH 5DQ9A 1XZ0A 3OC8A 3T8XB 4MMXB 4LDEB 2V2WB 4O2FB 3AWGA 1IE5A 5I26A 3HE6B 2QQKL 4EMZA 1U58B 3VFWA 3UTTB 2GAZB 1A9BB 1IAIH 4MDRA 3GIVB 4GT7A 1WWWX 1JI2A 1UWFA 5E2JA 1RSFA 4KROB 2WTPA 1BCCG 3LD8C 3A6CH 2NNRA 2NW3B 3GLMA 3GSWA 1MI5E 4H8UA 4XP6H 1ZT1B 4KKRA 4YLQT 1F90L 2ZYIA 5AVSB 3F5WB 4FYTA 3RX7A 2B5IC 2EYTA 3UTPE 4R7LA 5IEKB 3R4RA 3FZUD 3KBHE 1AFVL 3OAYK 1KULA 3N7NA 3VXRA 4TXVB 4ICWA 4P2QA 3APFA 4LSVL 3BJ91 4PJCE 1AQKH 3BVUA 3GSQA 3CCMP 3S98A 2Y06H 2EXWD 3L5IA 3IJHA 4BZYA 1N70A 1MWAA 2JK5A 4U1MB 5GQBA 1LO4L 2KQNA 4YLCA 1YUHA 3Q8AA 4PJ7F 3FFCE 4WCYH 1NBCA 3TBVA 5IG7B 3QUYD 3BKML 1YNKL 3ZMNA 1MFUA 2EINB 3FJTA 4GG6B 4AOFA 1QYGH 5EU6D 2Y1YA 3B9VA 3M6DA 3QISA 1J05B 5I8KH 5I0ZA 3BDYH 1ED3A 2NQDA 1K6QH 1FV1B 4XP1H 1LM8V 4UTAA 1Q1JL 3PHQB 5LXGH 3GTNA 1SN2A 5EUOA 2G9KA 2EDNA 2ADIB 2KL6A 3RVWC 1I82A 3T6XA 1MRFL 2XPZA 5D2NB 1OGPA 1R47A 1IFPA 3CTTA 3KYKH 3SE8H 2Y1AA 5CZXD 5IQMA 2Z65C 4WU7A 3ZIYA 1SQXE 3MRIA 4ACPA 1NKGA 2W9EH 3H1LE 4XX5A 1CFTB 3MCLH 3CVBA 1S7UA 1HZKA 5GRXG 4LLAA 3SGKC 3FQYA 4GW1A 1QP1A 4QCIA 3ZDZE 4ZTOL 4HS8L 3C2SA 1CDJA 2X2UA 3WEOA 5ID1A 1E6OH 2E9GA 3I50L 5F9OL 4UOW0 4WI7A 4ZXBC 1FZCC 4OKVA 4NGHH 4J1UA 5D8JH 2E27H 3V2NA 1MAMH 4PRID 2LLNA 3DPBA 3LNEA 4CGTA 3NCYS 5JIMA 1QX1A 1I1YB 1VACA 2V3EA 4PTUA 1DEEG 4U3FG 1PX8A 2QM8A 1JPSH 4AJYV 1JDAA 1KXQE 3POHA 3G08B 3MYJA 4KJQD 5I5JA 4YSAA 4O58H 5K9JH 5ISZE 4LPYA 3BSZA 2WCPA 1F1DA 2KXPB 1SJEB 2BPBA 4XMXA 5B5EE 1OOWA 4LSUL 4XVSH 2MIZA 5EZLB 3RNQA 4BXSV 3WTVA 1S7TA 3CBJB 1MF2H 2KLUA 3LRLA 4RFNC 1CXFA 1RZGB 2VC2L 4JFOA 1ZS8A 1MH5A 2WJ7A 5ICXA 2ZWLT 5DVLA 1IFRA 4N87A 5DT1H 1CFVH 1U8LA 4YDLC 4YX2H 4YDKH 3PP4L 2GJ6B 3TONA 1ZKAA 3RGVD 3GB7A 4NS0A 4TOYH 1JHTB 2XKMA 5JR1L 1E40A 2JCCB 1HNFA 2UXFA 3FL7A 4LL4A 5D7IB 5SWSD 4AW7A 3MUGB 3BP5B 3QFDB 25C8L 4LCWE 4LBEA 5E5LA 1W91A 2H32H 4HYTB 1LT9A 1JMMA 2DQTL 5FC9A 5AYUL 3HMWH 3QDGA 1BLNB 5ALBH 2B9BA 5EV7A 5IBUG 5CAYB 2R2CA 4QOKB 4PJ7B 5I8EA 1IC5L 1X44A 5HDLA 3V52H 1G9MH 4AMKH 4AJWA 3H4HA 2LVCA 4I2XA 5IOPA 2OBGA 3HRZB 1SXBA 2FB4L 2VO5A 3HBPA 4KKCC 2DMBA 4DETA 3R1GH 3KPSE 1FDOA 3S8GB 1U3JA 2CBQA 2E9JA 5I9QC 2XY2A 1JRHI 4QO1B 1M1XA 1P2CB 5AW3B 3JWNH 3ZMEA 3EJPA 1XGQA 5H35A 3H25A 2EDEA 2VM3A 5MHSE 3M0DA 2X4QB 4KZCA 4NQSA 4KDTC 5DLLA 5ICZA 3V4UL 3L4XA 4HETA 1DBMH 3D85A 1QUNA 2J1XA 2QM7A 1I9JH 1UZ8B 5GRUL 1NFIB 1QWUA 2D3NA 1HINL 4XO9A 5HJDA 2H6PA 5JYMA 1SQQK 3CVHL 1GL4B 3QARA 1AHWA 2WYTA 3V79C 2MPAH 3RUGB 4Q9QH 1T7ZA 4KJWD 4KXZH 3K0YA 5LHDA 4WWOA 3IFPA 4HEME 2NY6B 4EI6A 1WZKA 2ZOLA 4NNXA 1S9KD 4NRXB 2FJFB 3T4YB 5KSUB 4FFZL 3SJVB 1RF0A 4NO2B 3LPOA 3L75D 4PV1B 2WWKT 3GUTB 4QRTA 2WQWA 1GJIA 2OZ4L 4JQIL 1MRDH 2E43A 4OLEA 3D3VA 3IXAB 3EYFB 4JBSA 2BRRL 5DJ2A 3SPJA 1IM3B 4DJGA 3STLA 3TZVD 1LEIB 3N43F 1F1GA 3WJMA 1I1FB 1M7UA 3VXUA 3WLBA 3DRQB 5IMOB 4LARH 4Z7UE 2I60L 2WT7B 1XWVA 1HSBB 3OLDA 3FF7A 3QPQC 4IQHA 5IIEA 4M1CD 5AAPA 3TA3A 2G60L 3VD3A 1Q9WA 5DU7A 1N59B 4UNIA 3QXTA 4RETB 3VMAA 1T89A 2A45I 2DQ6A 1KYOI 3TGUE 2IDSA 2ZOKB 3DYOA 1X5HA 1XQ4A 2NCEA 2QR0A 3DIFA 5H94B 1RZFH 3CPLA 5LNEA 3NJMA 1OCWH 5KG9A 1F86A 1KUMA 4M7LT 3KPSD 1RJZB 4HS8H 3JTTA 2NYKA 1PKQE 3BHBA 3EYSH 5B7EA 3PHOB 2YS4A 3QQ4B 3AADB 2CWRA 4UAOB 2M5AA 1M7DA 1WYJA 3OAUH 3FT2B 4WDIB 3PL6C 2FT7A 2KP8A 3WEAA 1GL2A 3QFJB 5CU5A 2QADB 3L1EA 5D1QE 2HX8A 2ZYSA 4WHYH 2W91A 4YBLC 2H3NA 5CNHA 4QHNA 1HJBA 2OXHA 3HG1D 4TSCL 1AQDA 1A9BA 2YD2A 4B7IA 1P1ZA 2IDFA 5DJUB 4CSTA 1DX7A 4KJYB 1KCUH 1WRFA 2X40A 3D8MA 3CFBA 1ECYA 2UZYA 3FAXA 3RBGA 5C0JB 1IAOA 2I9LA 4GKZB 3ECVA 2BS9A 5DRXA 3B6SB 4TUJA 5IB3B 4WY4D 2JB6B 2LTQC 3CH1A 4NJAH 1CGXA 1NCDH 4LPWA 3RNKA 4NYLB 3U30C 4NI3A 5JW3H 4XI5D 4GUPA 3H4FA 3VFRB 3VXOB 3WKML 3WIFB 3MGOA 4JVPA 4AT6B 5E2VL 5E1IA 1OTUD 4ODBD 5BJTA 1DQVA 1O6SA 4QHLB 4U3FJ 5E8OA 3FQ1A 3RBXA 1PW3A 1G6RH 5E8PA 4PI2A 4KUZH 3CBKB 5JPNB 4LOEA 4L8CA 1KCLA 2DRUA 4IKNA 2WTYA 5HYSA 3O6FB 4S1SH 1MHEB 3O2WL 3HZKA 5BS0A 3PH0A 3OQRA 1BF8A 2DLTA 1TCRA 1FE6A 3MRCB 3L74D 4EBQL 2O6FA 4U1GB 5MENE 1EXHA 3RA7H 2I24N 3G6AA 5HHVH 2OTKE 1CC3A 2CM5A 3QNYB 2DV6A 1Q9OB 1WH0A 1JHLH 4MMYB 4XODA 3GIZH 4ENZA 1HI6B 1HWWA 3OA7A 1DVYA 3RKDC 2KZWA 4R4NC 1JGDA 5KW9H 3GNMH 1R75A 4HGMA 3WHXA 3OR6A 2C7UB 3RAJL 1L3WA 3F5HA 1A6AB 1FZMB 3FT9A 4D9QD 4HIXL 4LCCA 2R15A 1SQ2N 3QJHB 4U2YA 1RSYA 3D06A 5JA9A 3OHXB 4Z7WB 1MREH 1LGHB 1A7QH 3D05A 3MCYA 4OT1H 5TF1L 5INDA 1T7XA 5KVEE 4NPEA 3VW3L 4PJXA 4RWYL 1S5LH 4Q0XH 1UD6A 2V9RA 2VLMD 5CD5C 3D3VD 1JPST 4JG1H 3RIAK 5D1QD 1CW5A 4EN3A 1BXAA 3WFCL 5TD4A 1A6ZB 1VENA 1H5BC 1J7VR 3AS3A 4BFJA 3IXTB 3VWKA 2YAMA 3WJJA 2F61A 5M7QA 3DHMA 1LGVA 1NC2D 3O6LL 1MV8A 3UC2A 1T3UA 1A6WH 1UVQA 2E7CA 2Q10A 5HPMB 3V4VA 4IHBA 1E9QB 3T65A 1HXYA 1OP3K 1J0ZA 1G4RA 3O4OC 4X98A 3VGGA 4E68A 2XFXB 2OMUA 1XFPA 4LCWD 1T20A 5HGDB 1KPRB 1UKQA 2DW5A 2ZJSH 2AQ1A 4CBZA 2UYLA 1FSKC 1NGPL 1E9OA 2XQYA 1XEDA 4NQUA 3GLZA 4Z7UF 4ZFFB 3TO4D 1IQWL 3ARGA 3BLKA 4FTVE 2J7LA 2QFRA 1IO4A 1HTYA 2XOTA 2X4PA 1JCCA 5HVHB 2IDQA 2IVFC 5FGBA 4X5WB 4ZFZA 5LGKA 1OD9A 1SQQE 3P0VH 4JY6A 3UZQB 3VXSE 1AJ7H 1W0WA 3MVSA 3GYRA 2Y1ZA 4JFFE 1E7VA 4NFBA 2FYUG 5K1JA 4DK6A 1QHQA 4AGQA 3DXAD 4KHTH 12E8L 1R6VA 1ZE3C 3UBFA 3WXWL 2P5ED 2Y7MA 4JGJA 4LVHB 1QQDB 4G7YL 1ZHKB 4HXBL 5I1IH 5C8JA 1C16A 5ETUA 5FYLE 4XAWL 1BYOA 4WW2C 1CGSH 1DLFL 5GS1C 2VC2B 1KC5L 3AACA 5C0AD 1MNNA 4EI2A 2YD5A 1YZZA 4OD3H 3RPIB 4DN3L 1PP9D 1W72L 1X9RA 1U2YA 1SBSL 2YFOA 4A66A 5B1CA 5FKAB 3VE0B 3U0TA 1E43A 5I75C 4AGMA 2P52A 4F15C 1ZVSA 1GK6A 5BVPL 4PJIF 3W1ZA 2PYEA 3QUML 1E5WA 5CEXB 4KXAA 4BKTC 5CLYA 2EABA 4R90L 1GZQA 1RUMH 2WLZA 3ZE2E 3WNNA 5HGBA 4JO3H 3ZL1A 1OGAD 3FO2B 5D7LA 1JP5A 1AVYA 4EYYQ 1WIOA 1YJDC 4KQ4L 4U3FE 2G3MA 4KROC 3QWRD 4ADJA 3N50A 2NXZC 4OGQB 2Q3IA 5F7FA 3RPIA 1KGYE 2EIBA 3FN9A 2GJ6E 2FHBA 2JP3A 5TE4H 1M6OB 2GK0B 2Q7NA 2DWSA 2HLEB 3FTYA 3EGDB 4HGKC 3SKMB 4A55A 1D5BA 2Y36L 3CU7A 3MBXH 4K5MA 2Y4SA 1W6WA 2B0SH 3CWBD 3B5GA 3W37A 2HSIA 4AZ8A 5KBLA 1LO2H 2R56H 4MMZC 1I4FB 1Z0NA 3WE6A 3P8CE 3CFCL 1NC2A 3WFDH 2ZXXA 2OMTA 2YQBA 3M9HA 2N1TC 3QUHA 2F54A 1S5LX 1CIUA 5ADOH 4GOFA 2ZJSE 4PR5A 4TS6A 3VA6A 5EZJA 4EN3D 2EIZB 3EDKA 5IKCA 2ODIA 3CZJA 1NUDA 2XXMB 3GMLB 5AW0B 1S6NA 4Q6IC 1WCQA 1KGJA 3S96B 2VMDA 3K6NA 2GITA 4FQXA 1EIBA 4OWFA 5E7FA 3LS4L 1BQLH 3FUMA 3BWZA 1BVLB 3MRKA 1KBBA 1NQBA 4ZUWB 3V4VH 1KJVA 1JGUH 3L54A 4I77L 2P8PA 1L9QA 2A74A 4R2GD 5F7WC 4BDVB 4GW5B 3BLPX 1IC2A 1ZV8A 4BRYB 1YBKA 3LTVA 5IBUB 4P23A 2N0MA 5FA4B 1VFAB 5KAFH 1AZCA 3L74J 2ZXEB 4PR5B 4L4VA 5EOQL 4LHUA 4Z6AT 1F42A 1S9WB 4TNFA 1F4YL 5GJTL 5HVHC 4U3FD 5JW5B 4L18A 1CICC 4ETQB 3FB7B 4OH2A 1X5XA 3FQWA 4JZOA 2XQYK 3N1GC 3B5NC 1N5YH 5FDWB 2O6EA 3V5HB 1G6VK 3NEEA 4UTAH 3RWHB 5E0FA 4J3OH 4JKKA 3K6IA 4JJ5B 3CX5H 1FG2A 4YHLL 1BSHA 1SYSA 3L95B 5E5MA 2HFEA 4C58B 3FQ4A 4WTQA 3TNMB 1JPTH 4TNVK 1TCMA 3LB6C 1XR8B 4ZNEE 3CD6P 1N18A 2B20A 3A7OA 1INQA 1IEHA 3R2PA 5A7EA 2MQ3A 5I0YA 2PWFA 3HB3B 1TQSA 1P4UA 1RQ5A 4TN9A 3IRPX 2FYNB 2WWMC 4QHMB 1IL1B 1QFHA 1M7XA 5C0BE 3TV8A 3HUJB 1B4JL 3ZU8A 4GKZA 3IMBA 4HJ0C 1R19A 3T2PA 3TCXA 4X8JB 3FMGH 3NPSC 1S7SA 1ZTXH 5K93A 2Z5HA 1OGAA 5IVOA 1CDUA 4YSOA 2OXHB 1NAMB 2IALB 2WKOA 5FO9B 3T0DA 4Q6KA 4WI8A 2J8UB 1ZR2A 2G8YA 2V37A 1FC2D 4PBVC 3C6SA 4JFED 4QHUA 5DD6B 4RJTA 1ZA3B 2NYYD 1S5HB 3FQTB 4B0MM 1SZNA 4DN3H 3DRTA 3FCTB 4ALAC 3RIAF 3FSVA 1N0LA 4WUKH 2EDLA 2CHXA 4TRPL 5FYKD 5D6DA 3P0YL 1IGYB 4GBXD 1MFAH 3PXHA 5EH1A 3FT1A 2A83B 1NFIA 2ENQA 3T4AA 2CK3H 5CGYC 2NDFA 1JF1B 1PNDA 1S4IA 3KLQA 1EXJA 1E4WL 1OTTC 1QW9A 3IF4A 2YA2A 1TYRA 2HVKB 4EZMA 3PL6A 5B39A 1A6AA 3QIWD 4Z7WE 1AACA 2VL5A 3ZHDA 1BXUA 1C5DB 1ZLSL 2FATH 4PGCB 3AG2B 2WINB 2J59M 1TSHA 4NQDE 4OV6F 1AJYA 2X89A 4ZDHA 3X1FA 5DMJB 4PTTB 4DO4A 4EI5C 3AWFA 1FLRL 1W2BO 4LHJB 3VRLF 3NEOA 4PGEB 5CILL 1ZTMA 1JZ5A 2KMWA 1MFDL 3VXMB 1PY4A 2GPZA 3GLDA 2BIQA 4CN6A 5T3ZD 3WFZA 1E0OB 3RBZA 4GOEA 1KN4L 4YSPA 3GMRA 1JVKA 2QVAA 2BSSB 2WSFH 3PWVA 4Y5XB 1UVQB 5FB8A 4UINL 3TT3L 4ABWA 4ES9A 4QRRA 4NO0B 5J6GA 3WY3A 1FQ9C 1FF5A 3CCLP 4KPHH 4BZ2A 5GZNC 2GEQA 1WE5A 3VXTA 4PSRA 3FX0A 3L5XH 4OCYH 2P5EB 2XU6A 3V0EA 2GKIA 5FO2A 1CN4A 5GS0D 4OGXH 5KSAA 2F53B 3FNKA 2FBJL 3A4FA 2LAAA 4NQVB 2N7AA 4LCYA 2HFED 2BVYA 2Z91A 4DEUA 3WL9B 5IHUH 1BLNA 2KZIA 1X9LA 2X12A 2K3HA 3TF4A 5CSZB 4JZJC 4Y9BA 5JHAA 1UD5A 2XTJB 5J4MA 3GO1H 3PS6A 1WCBB 3ULUE 3U1SH 4DPCX 3QI9C 4WY4C 4FXGA 3WNLA 3OPZL 1DEEA 3W2DL 4RFOL 5J3HD 3NIGE 2WXOA 5CKGA 5GISL 4XZUB 4ZFFA 4LSPL 5ABZA 3W0WB 4CJ0A 1U95A 1CCZA 2MPVA 1FDLL 2ATPB 3CLEH 5E6SB 3P3TA 2BCCG 5DJ6A 2YJQA 5ICYB 1A66A 2C34A 2HLAB 4W6WB 1NIDA 2R8SH 4XMPL 2EUZA 1QUNB 2O1AA 2HTLD 3S3DB 3IDNB 3VNYA 1TU2B 1N9PA 2F9BT 4R96A 4AKQA 4KJYA 1P84H 3C8KA 1CS6A 3FTZA 1HQRA 1JUFB 4G9FA 3VMOA 2HYNA 2WOYA 3A24A 3HCVB 4FTDA 3BKJH 1L0LD 3AU0A 2MSPA 5C0FB 3NEXA 4V2CB 1QABA 5IK3A 3K2MC 4HSCX 3P77A 4BK4A 2HKHH 1FA4A 3C9NA 4MCNA 4NP4L 4XTRD 4BXVA 5DJAA 4E41A 5AZUA 2IBGA 3CH1B 3NCBB 5JLZA 3V6OC 1LTIC 5CSGA 4Z0BL 1DR9A 5I74C 1N3NA 5D7KD 1EEZB 4IFDK 1ONQB 3K4DA 4WUUD 5K39A 1CQYA 2DYRB 3ABKB 2CBPA 3JZ7A 3GZQA 4MAUH 3K46A 4AX3A 3EFDH 3WJJC 4U3HA 4K94L 5M94B 5EWIH 3HBZA 2JO1A 3DDGA 2XDJA 1G5GA 1LHZA 2A4CA 4JQVA 1G9NH 4FFVD 4UYQA 2CHNA 4IJTA 3TGXA 4F7TA 4Y9CA 3L36A 3POCA 3FT4A 1KFMA 4N9OB 4XPBH 5D1QC 5MP6H 3MRIB 1YPZA 4OD1L 3SE6A 1IUZA 1XGUA 3PHLA 1HSBA 3AB0B 3KWVA 1F4WL 3PDOB 2NY3B 5C0NC 3CXHI 3ORJA 2J5WA 3MA9L 4XPFH 5I1GH 1HJCA 2WNGA 1P4BL 5ENWB 1L9NA 1DUZB 1WD9A 3S2AA 3B8EB 1XSJA 1VACB 3U9UB 2H0FA 3UPRB 2ZX8A 3VFGL 3LPPA 4JG9A 3WDHA 1M57B 1MCIA 3CK0H 3HG2A 1O7DC 1DQDL 1MJ7H 1K9TA 4IYKA 2VN6A 3F7YB 4ZW7A 3F58H 5I9QB 3HIZA 2VXTH 1SXCA 2YBRA 2HKAA 4E2OA 2Z4EA 3D69B 2V6HA 4ZXBD 3AE5C 2CGYA 4WFGE 1E4XL 3FT2A 1TZHB 2IDCA 1CWVA 5LLIC 3K74B 3PWNB 5JOEA 5FO8B 5ALCL 1UOWA 2QPSA 5IB1A 4MA8H 1AQKL 1EFXD 3SDDB 3B2VH 1J8SA 5FM4A 4B9YA 4F8QA 1AANA 4NO3B 4L29B 3O3BA 4FLSA 1G7JA 3FC8A 4TNVF 4HUKB 2ZUTA 3MV9E 2A6IB 3OZLA 4UM9A 3WIHA 1YYML 2ERJB 5CILH 1MLCA 1YNKH 3B3IA 3MZGB 4XN8A 4PJ0E 1OGTA 2I9TB 4NHCL 3NESA 4FOMA 4FKEA 4XMUA 2HT4C 1SQQD 1CI3M 1NCCL 4M7ZB 3GBNL 4WU5B 4B9CA 1NKRA 1TITA 4YSRA 3L75J 4G9FD 2AQTA 1JN6A 4GAAA 1I85C 3IAQA 5I19L 2NY3C 2P5WE 2XT1B 4OFYD 5GZOA 3Q2WA 1A1MA 4RGNE 2Q8BH 1YQ4C 5F0JB 1HSAB 1VZIA 1EO8L 1TCRB 3TV3L 3L8QA 4TQPA 5C0AE 1P4LB 2K37A 3FO9A 1M1XB 3QDME 5ESAB 3MLTB 1U8MA 4M29A 1GA2A 2ZUWA 1NEZA 3MBEB 4KROD 4RH4A 5CR1A 3TYGL 4LL9A 4GRMA 3QIBB 4LSDA 2BOLA 3WLWD 1RZIB 2DTML 2ED9A 2Q3ZA 2YPVH 4HFUL 1JE6A 3VU2A 4URKA 4WHCA 4D0DB 3ZE0E 4IGBB 1JPEA 2V2WA 2VRAA 1NCWH 3SE3C 4JFXA 5FUZH 5SWZA 5TDPA 1CE1H 4OCXH 3CFTA 4NKIL 5DJCB 4PS4L 4Z9KB 3PNRB 2J25A 2BSBA 2WSPA 1KYAA 3P4OA 5IK3B 3CXHJ 1FO0H 2BXYA 3ZLQC 4WW1A 2N1TD 2A9MH 1CICA 3MUJA 4MBRA 2WQSA 5FOJA 3WFEL 1S9VB 1H8NA 4LLWB 2KDGA 4WHYG 2NPSB 2IAND 4P2QB 3QWRA 3OMAB 2A74C 4XC3H 3ZXAC 4F80A 4PI0A 4WO4A 1Q9KB 2ICES 3PWLB 3D4CA 2BP8A 2CHZA 4CADB 4LESA 4P23C 4X4ME 5SX5H 1U8IB 4HPOH 3HVNA 3U0PB 1T3FA 4IMLA 4TV3A 1QRKA 4AGNA 1YHQP 1TTRA 1FOSE 2VDRB 3OZ9L 4TLKA 1QGKB 2FQDA 4WHDA 1HWTC 4H44D 2GJRA 3MGTB 4MA7H 2G3AA 2R4RL 3Q06A 3VA2C 4RGND 4N0FB 1HTLC 4PG9B 1KILC 5IQ7H 1H88A 3H9ZA 4DP4X 4L5FH 1L0ND 2FYNC 2VM9A 3FN0L 3GI9H 1SF5A 3DMMA 2XG4A 3VGHA 4AG4H 1PYWB 1JTOA 2IBZE 2FWLB 2K1MA 4MS8C 4JANB 3SO3B 3P8MC 2FSDA 1FZFA 3BH8B 4KK8D 4UQCA 4X5RA 5FHAH 5GS3A 2IG2H 2EXSA 4WEUD 5KAFE 3VO0A 2P5EA 1NOLA 1ZHLB 1MEXL 2EUWA 2ALWA 3P7KA 4GT1A 4HCRH 1L9TA 1RH8A 4B9ZA 3BAJA 3CHSA 1GKEA 3L3KB 4MCYA 4PD4E 1PX4A 1IAIL 2VLKD 4UT7H 3BAXA 4ZUSA 4HW6A 3WN5C 3WKQA 1RIVH 2YSSB 3IKKA 3FU0A 3Q1EA 1TTFA 3D39A 3VSVA 1GGTA 4JO1L 3DPBB 4X9BA 3V6OE 1GW6A 4K3AA 3P30H 2N1TE 2HN7B 3BASA 4NZ8A 4Z95H 3EG9A 1XTCC 1TPXB 1A3RH 2BY2A 4BFNA 2KKQA 4PRHA 4D0CB 3H0TA 4KC3B 1G1KA 2GUSA 1QRNE 5C2BH 3W5NA 4HUVB 2NTFA 4X0KA 5EZIL 3GK8L 3CD4A 5HYFA 1DBBH 1J8KA 4HJTA 1IFGA 1SQPG 1BFSA 4R0LC 3V6ZA 1GSMA 3ILQD 2AEWA 4O2EA 3T0XA 3S8FB 5D6CB 3GRWH 4NUJB 5DRWA 1PLGH 1I8MB 4BK5A 5L2JB 3CPUA 2DMGA 3LKPA 5DLML 4KKBC 4AYFA 1JMBA 1B3JA 4MVBC 4HS3B 4OLUH 4QHKI 3H1LG 2IGLA 4JQXA 4FZEL 3KPRB 4QCIB 1SDDA 4U1GC 1ORSB 4S0TD 3RWDA 1CBJA 3X11A 3RZCD 2D0HA 2ESVE 5FA3A 1IZNB 1Z5LA 2AK4E 3UL4A 3LKQB 4KTYA 1FL3A 2HTKC 3LKSB 2PWHA 4P2YA 2Y7NA 5C0CA 4BA8A 3K81A 3RI5K 1A4KB 3OQ3B 3REWA 4AE1A 1JS4A 1NM4A 1MCLA 5T3ZH 4ZNEA 3PAZA 3BXNA 3EGSB 3NP4A 5AW6B 4RVBA 1VQKP 5AAWC 3VMZA 2FO1A 3TGUJ 4JE0A 1RZ7L 1BBJB 1AR2A 3MJ8B 1DLHB 4G1EB 1YIJP 3DXAB 2QEXP 3I50H 4JM0A 4NQDA 5F9OH 3UGUA 1RPQA 5HDQL 3L71D 5KAIE 4BFIB 2NLJA 3ILPA 4TVPL 5ICZB 2A9BA 1YEFL 3L3KA 4MCYB 5HHOB 1BEYH 3BLBA 5LN8A 5I8OL 3L3JA 3KXFA 3QA3B 3MJWA 1GCYA 4PCSA 4Q4IA 3CQFA 4ORGB 4NKQB 3SJVD 5J12B 2N9YB 4CUCA 5CXPA 3S34H 2N01B 3SE3A 3GGWA 4Y16D 1KTKE 1XT5A 3QCTL 1N73A 1OO2A 5FV2A 2BEQD 3EJYD 4BINA 5TGBB 4ZUTB 5GGQL 1J0IA 5DQ9B 4NQED 4XPHL 2X1XR 3RK2B 4P2OD 5DVOA 3L2LA 1JZ8A 1K4CB 2WSEH 3CFDB 3WKMH 2K1AA 2LU3A 5AD0A 3HI1A 3TF7C 4PJ7E 4W81A 3S36X 3ARTA 4BRYA 5LDUA 4NO5B 1VEPA 4IS6B 4BFBD 1V7NL 2PFXA 1K05A 4PBWD 4NO0A 3VFOA 2R1XA 2Q0ZX 2YIUC 2BNQB 3DUUB 3MV9A 3EFFK 2HXAA 3QDMD 1J8HA 1JWUB 1FYTA 4WTXA 1FFNA 2MHAB 3BDBA 2WLLA 5APQA 3KPRA 4MNHA 4Q58C 1MIEH 4AQ1B 3EWKA 3GMQA 2BIIA 2R2EA 3H1IE 3Q3GB 5IFAH 1UKTA 5IMMB 1DVSA 1QLRB 5FEBA 1PNCA 1IGIH 2DWDB 3ALXA 4ZUUB 3TPUA 5BOZG 3MROA 3IFLL 1S7RB 3CZKA 1QHOA 3QCVL 4N8VG 3P0GB 2RHEA 4OZGA 4NCC1 1HJBC 3E8UH 1AQ5A 3O0RL 2PW1A 3BP7B 1WZMA 4Y5YB 4BV1A 1QNZH 1WP6A 4W6XB 2WSFJ 2NZ2A 3COOA 3ROLB 5HHQA 2AJSH 3H1JD 2CO6A 2QMJA 5AW4B 4ACTA 4UM9B 1AY1H 3TFKD 1SQVD 1BBJA 4BQ9A 4B7LA 4Q7DA 4TF4A 2BNQA 2FT8A 2CBTA 2YIHA 3O9WC 3D25B 3RE0A 4HGWA 2P42B 1F00I 1R4XA 3P32A 2Y5TA 5DMGD 3PAVA 1F6LL 4RX4A 3U9PL 2PCPA 4UOZA 4CDGC 1PS3A 2HP4A 3QA3A 4Q4EA 3VM5A 2H2PC 1T0OA 3NABH 5LDSA 1JF1A 2BSTA 3I9IA 5F1IB 1DVTA 1P4IH 4IIZA 2E42A 1USDA 2LHAA 4Y1AB 2IAMB 2VE6A 4ORZC 1JYVA 4HLJA 3JV0A 2OMXB 3R8QA 3U79A 1KBVA 2JJLA 4NZUH 2FJSA 4U0QB 1XH0A 4AXWB 4ESKA 3O11B 4Y5VB 4YDVA 5EU4B 2XNDH 4M5YL 2B4CC 5F1NA 1PLCA 4PTTA 2MTPA 4JFHE 1WUZA 1NAKL 4IHOB 3UTSB 1L0LG 4MWFB 4R84A 2IBZD 1MXGA 3WFBL 3CHOA 2GABA 1J5HA 2MWCA 2K3RA 4P2QE 3GMNB 1S9YA 2J4WL 2O5XL 4DQOL 4FN0A 1O9VA 1BZ7B 2ICWJ 4G9DB 4F33B 2LT9A 3TWCH 1MFEH 4LL1A 3ZKND 1JV2A 3KEHA 3IBEA 1QZNA 5EA0H 4C7NA 5D1QA 5BZWA 1GAFL 3P9WB 3TSIA 1C5CL 1MFBH 2Z92B 2L04A 2F53A 5FCUL 3QFJD 1ZT7B 3WEBA 4M3JA 1PZQA 1FNSL 5D1ZB 2N7SA 2A6JB 4G42A 1FE8L 3G7TA 1I7TA 3Q5TA 2CHDA 1RP8A 4PRBB 4JRXB 3MBED 4LLVA 3VB8A 3L72D 4P4KB 3H32B 1UA7A 2DL9A 3AS1A 3FXEA 4LSRL 2QJPB 3AABA 4Z3FA 5GHWL 1DQJB 5AW2B 3VD5A 2JLPA 4DESA 1IGFL 2R1YA 4GS7C 4PY8I 2DJMA 3F7YA 4MJ6A 4ADIA 5E1HB 1JM0A 2Y5QA 3BWUF 3NFSL 3WHE1 5GRJL 4AENB 4C46A 4Z78B 5TJHA 1YVLA 3VFTB 4YBLB 4GFXA 5TE7H 1P5UC 4HZ1A 5EC2B 2P24B 4AL8L 1FNHA 4Z7NF 5KAQG 3K8MA 4PJGF 3AE3C 2H32A 3A67H 4QXTA 3ZVVA 4PJ8A 2WSDA 3EYQC 2L0DA 3WS3A 1JUFA 4FRWA 3GLAA 3HZYA 5HVFB 1IFHH 3L9YA 4FXGB 2BXZA 3MTXA 4PJEB 3TT1H 2L7EA 3UO1L 4RKUJ 5LB1A 4WEBH 2CLZA 4H5SB 1X79B 4HHWA 4W4OA 1SY6L 1KB5A 1INDL 1YSOA 1O5DT 2B2XL 4KXZI 4L9LC 3TBTB 3GSXB 2OYIA 3IMRA 3JVGC 1CG9A 3G5XA 3QNXA 4M5TA 4P2OA 2Z93A 3C6LC 4ZOAA 3UAEA 2AXGA 3BT0A 4Z7WF 1FZMA 5IWLC 3MRMB 5A3ID 4HCIA 5D70L 1SQQG 1D2PA 3AEEC 3JUYA 4M43L 1TEFA 2MOQA 3C6LB 2JWYA 4XNUL 5GIRB 4K5NA 2V7QJ 4F7PB 3QFJE 2VZTA 4O02H 4HJ0D 1SOXA 1KYUA 3MRGA 1A3LH 1B2WL 1FUNA 2GHZA 5E5UB 3CMGA 1FZKA 3ATBA 5HP5A 2AXTH 5I17A 4PCYA 4DWHA 4OIFA 4XP9H 3LZLA 1SVBA 4J3UA 2DQIL 3SD5A 4V1DB 1TJHL 2H9GB 2IC2A 2ZCHL 3SDAB 2Q3EA 4BGLA 5B8CB 3MRJA 1G1YA 2NXYB 2XWJA 4RAUB 3V2QA 4NUJA 2FVNA 1MCJA 1W5CE 1NJIQ 2YKKA 5C08A 3VM7A 2EUXA 1C5DA 3FU7B 3VXPB 1HHJB 3BAWA 1PIXA 1H3PH 3P4OB 2LOEA 2YNYA 1BREA 1U8PB 2OSLB 3MR9A 1IAKB 3SB3A 5BS0D 1IAOB 2I9LB 3MJ8A 3VFTA 4GBXB 5APUA 4EUPB 4IEFB 4LDOB 4TQEH 4DIXA 1YEDA 1N5YL 2ZWSA 5CZRA 4ODVH 1J0JA 3OKLA 4P3CL 2NPSA 1UEYA 2RAMA 4EOWH 1ZPLA 4AQ8A 5D96C 3VH8B 3KYOA 1FFRA 1LDPL 3UTZB 2EIEA 4JPSA 3U25A 4JRYE 4BZ1H 5C2UB 4OFQA 2VH5H 3IFOA 3SGEI 4XOBA 4H25B 1HNGA 4AXWA 1EERB 3LHAA 4R7VA 2ZUVA 2J3SA 4U6HA 4YVUA 5J7CC 4UYPA 2R3CA 5DEFA 5C08D 4QXGH 3HVDA 4R0LA 3P73A 3QXUA 4JFFB 3BWSA 1Q82Q 2JKIS 4YHNB 1MLBB 4UILL 5CGBA 5AB0A 1U41A 3V5KB 1Z3GH 4UDUB 5EO1A 1LO3H 3ZKSD 5DQDL 1B2YA 2APSA 4AYBA 4F27A 2CD0A 1G7IA 2WSKA 2FT6A 2BNRD 1OLZA 2ZUXA 1A7NL 3QAZC 2OYLA 2XG4B 5C7XH 2YD6A 4BRVA 5HHOE 2CLRB 2VZ1A 4X5QA 3VSTA 5JDJA 1G2CB 3C8VA 5CCGD 1E6JH 3SPVA 2GM4A 3IGAB 4W9KC 5JW4M 3RPBA 3C12A 3U1CA 2JKLA 1GIGL 2P45B 4NZDA 4U4BA 4BUGA 2J2ZA 1QTPA 4LAJH 3AGWA 1G84A 1FO0A 2CU9A 4HZLB 4WVZA 3MV7D 3MUY1 3PP3K 1AGEA 3RDTC 2QGDA 2W5PA 5LQBH 2JJWA 1EAPB 4JDVB 2R0LL 3D6YA 3KJ6H 2F1EA 3ZN6A 1UUNA 4YHNA 3QE5A 4QHNB 2B87A 1TJGH 4TSBH 1KB5H 2NTSP 5EIIG 1BFVL 1DQKA 5IT2H 4NN7C 4YXHH 5I1LB 1S9WA 3B5HA 3K6FA 2KYIA 4DCQA 3FT3A 3FBKA 2X6MA 2X7LB 4BH8B 1TFPA 2VYRE 2UUDH 2VRQA 4CVZB 1A7PL 1CL7I 3FQRA 5KLVK 3HZVB 3R7RA 1NOFA 1BCCJ 1Q4NX 4PG2A 3SDYL 1SVZA 3BWAB 4KV5E 2CA3A 1JGLL 1BJMA 5DD1H 2BVQB 2J71A 2XVLA 3IGFA 3QJVB 1CF8L 3KPLA 4JCLA 1QKZH 4POZC 1KJMB 3QJHA 4QJ3B 5ACLA 3SE9H 4KZEL 1N3NB 4NNPL 1Q1JH 2PW1B 3BP7A 1DE4B 3VTTA 4U6TA 4UQ2B 4L8BA 2GITB 4NC0B 2ZPKL 3V4QA 1W8NA 3QJFB 3MHVA 2HWZL 1X7TA 5JZ7C 1KLUA 1ZLDA 5DJ8B 4KY2A 5C0DB 4KRLB 2GVYA 3C5JA 3F3HA 4HD5A 4QLRA 3BAEL 1OMIA 1YMMB 4Y19D 3EHBD 4HAKA 5JHLH 1R0AL 4RRPA 4UTBH 3VTPC 4UB8E 1QI5A 3G6DL 5CZKA 1CZ8L 5FFGA 1A9EA 3VWJC 3IDYC 3EZJB 4N85A 3OKMB 5AL0A 4RDQG 3R8BB 2W9DH 1DCEA 3CFJA 3FTXA 5IGXL 3NP3A 4WVRA 3NQIA 1CFSB 2VLJE 5TQ2H 5C0ND 5T5FL 3F64A 3C5ZB 3IDYB 4DPBX 3SKOB 2FX8L 4OCNC 2VM4A 1I1AD 5EN2B 3BUYA 3GKZA 2COVD 4G8GA 4P46B 5B1KA 4ATWA 4DQAA 5FDWA 5KN5A 1AXTH 4E9WA 3NA4A 4UT6A 1MW3A 4DP8X 5J1AB 3FSOA 2W65B 3I6LE 4R5TA 1TPXC 4TTDC 4AMXA 4AKPA 2VLME 2ZKHL 1SFDA 1LE5B 3IF1A 5KJ4A 4L29A 4N86A 3VG0H 4ENEC 5C9JB 5JQ6L 3L71G 3CSYB 4Y2DB 1XH1A 4NJ9H 3V0FA 4DGYH 2R39A 3FT3B 4ZNCA 1RZJH 1YA5A 2QEJA 4K7FB 3ZPDA 5DUMH 2ZICA 3ULVL 1X9QA 3ECBA 3V2RA 5CGTA 3BEVA 3NIFE 1SFCB 1UWXH 4YL9A 5L2KE 4XOAA 4FHKA 3WI9A 2KI6A 5DJYA 1IKNC 3VXME 4HC1A 3GSNB 2EXWC 1XSKA 1NVOA 3SE8L 4Z78A 4RDQF 2M2DA 3K2KA 5A2CA 3CCUP 2WWKO 3B7SA 4UBDD 1PEWA 2I85A 3L7FB 5CEXA 3NSJA 2HLFD 2ZOKA 3PXJA 2Q8AH 3CFKA 4M1GL 4NHUA 2AI0H 4JFPB 4PN6A 2IH8A 1NIFA 1DQJA 2R29L 1PLBA 1KWGA 3NDZE 4YXKL 3VXSD 1JOIA 4G5ZH 2KT6A 1T6BX 3DSNB 1Z3GL 3DBSA 4L4VE 5D72L 4ZS7L 2KDYA 2YSTA 2GT9A 3LH2L 2D31B 3F7PC 4JDTH 1VQ7P 1I8KA 4YSTA 4MGXA 1RPUA 4KOCA 3TN0B 5APSA 5JOPE 3L70J 1OSPH 2D9CA 4FMVA 5I75B 5KSBA 1CG9B 3G5XB 4RDBA 1FVDB 1T21A 4G7VH 5FLVA 4O58L 3UABA 2BNRA 2OR9H 4PB0L 1O7SA 3UACA 2WKLA 3VACA 3DKHA 2P3YA 5JIDA 3UAJA 43C9B 3MBWB 3TCTA 4XBEH 4AIZA 4OH8B 2HVJA 3FSWA 2Z64C 4UQAA 5E1GA 5DHVB 1J0HA 2PR4L 4OKDA 3QI9A 4N6RA 1D5XB 1LK2B 3ZTNL 5EN2A 4JN1H 1F2XK 2WXQA 3KCWA 2MPAL 3ZZ1A 4F8NA 1DD3A 1NL0H 3L37A 5FLUA 3I9GH 4N2FA 2GTZB 1LWHA 4Q52A 2H1PL 1QWNA 5HDBE 3MRJB 1T4KB 4OB5L 1GW0A 4PLNC 5HYQA 2HUEA 1P84I 2A9NH 4NFCA 4NZTL 3SDAA 3VG9B 4U1HB 1ZP0C 3GMMB 4C4BA 3IM1A 4C56D 1A7RL 4M1DL 1J9QA 1FDIA 3B34A 3EYUH 5FHBH 4MNQB 3ARZA 3BPLB 2MKVA 5C08B 4HQQL 2ENJA 4HD9A 2OL3A 3AEBC 1KXVA 3BD5A 2VSCA 5CP3A 5T33L 3MBEC 5CBAA 3MLRL 3CDZA 1U2HA 4ODXB 5ID0A 1RCYA 4P23D 1U8CA 3MREB 2NSXA 3ZGHA 1GGYA 5AOZA 1VLXA 3LN5A 3MDJA 5F96H 2ADJA 1URLA 4XNAA 1JZJA 4L0PB 4M3HA 4L4VD 5KSBF 3GEFA 4K0OA 1ZW0A 2K6WA 2EXTA 4NUMA 4PGJA 4JQVC 1RZFL 2V5YA 4ZTEA 3X14B 4ZXBA 5A43C 4OLWL 1V7ML 3KVPA 4LNRA 4F9LA 1AO7B 4MX7A 4N0CC 4J2XA 4DJMA 2W88A 5G5DA 3VWKB 3FUFA 1FFPA 1MUJA 1KNOB 4KO7A 4XVUC 1N5AB 3RK2D 3HOGA 3L95A 2RQEA 5E2TL 4BRJA 3BPNB 5IGXH 3L48A 3AEDC 3DX4A 5DRNA 5JIHA 1YO4A 5AENA 2DQCL 5FV1L 4FQXD 2A74B 1SEQL 3KPPA 3PWJA 3QXAA 3DGGB 4S1RL 8FABA 3Q3DA 1BMGA 2F54D 3LNHA 5ICXB 3SQRA 1VQ4P 2ITCB 2ZAGA 2NY6D 2VOTA 1FFNB 2MHAA 5MEPA 1CLZH 1FCGA 2FO8A 1JZ7A 4XO4A 1ZK5A 1N8ZA 1QR1A 5FGSA 4PEEA 1NTKJ 3A0OA 4GSXA 1E7UA 5ITBL 3MJ6A 3D0LA 4ZTPH 2H6UA 4LNRB 3ABMB 2ZT9C 5D1XC 2YAEA 4ECNA 5EC2A 1OAKL 3Q6FB 3GXIA 4PVLA 1VIWA 4N2AA 3NZHH 3NZUA 1CL7H 4F7EA 1EXGA 1KTDB 3ARUA 4MRBA 3SGDH 1F4AA 4FQCL 4S1SL 2OTUB 2WQVA 5HYJB 3BMVA 1S9KC 5BPPA 3U4BL 4NRYB 3CAFA 3BQVA 1R3HA 1YEWA 5D7JD 3X3FH 4NZRH 5EIIB 2CXKA 1B0RA 1R3LB 2WBJB 2VNCA 2NCMA 5JHDB 4G6FB 5D9SB 2HJFA 3QNXB 1S9YB 4P2OB 3LSOA 4K2UH 1K8DA 3DX6B 4MD0A 3UJTH 1RI8A 4IKJA 1TDQA 2CR6A 4D8PA 4LLYA 1W80A 4AYEC 3D9AL 2PAJA 4OLZH 4ZFGH 2Z7WA 3UG3A 2VR5A 5C3TA 5LO7A 4A7GF 3OTTA 5EEXA 4MN4C 4P9HH 5JOFB 3O11A 4N3YB 1QLFA 2QADC 2XY1A 3I3EA 5I30L 4HU8A 4RQQB 3BAYA 3FQRB 4HIQA 1H8LA 1KFAH 5L4IA 4E9TA 4LP5A 3B5ND 1ZIBA 4A2FA 4HXAH 1HAWA 4A7QA 5I16B 3Q05A 4X2UA 4TNWK 1PY0A 1ZT1A 1F1AA 2FWOA 3LQAL 1N4XH 4UT7L 1L0XA 2NY7L 5LCVA 3IGUA 2VDKL 5HGHA 3MMEB 5F72S 5TE6H 3R19A 4A2DA 1G7JB 1MPAL 1BCCE 1UD2A 1UZGA 4DF9A 1F2QA 2BINA 5F44A 4TUOB 5BZXA 1GGBL 2NPSC 4LSSL 3TX4A 4MJIA 4HEPG 4C7NB 4WV1B 1JRHL 5CD3A 4E0RB 2AEFA 3BPOB 4YN3A 1MRCL 1YEGH 1S7TB 5HHNA 4OB5H 3H1ZA 1HX0A 1PZCA 1N59A 1DZBA 1I3GH 2ZWYA 4JRXA 2ZVNB 4N2IA 4PS7A 4W80A 4CU8A 1FZBA 4I5BB 3TGUG 2HJKB 2VUYA 3PGFL 4FQHB 4PJ5D 5DUPL 4F3FB 5CCGC 3E2HB 3BQUA 4CU6A 5GGSY 3D08A 1YQ3C 2Y07L 3CFJB 5I8CA 4HIIB 2FECL 1L7IL 4LPVA 3VFNA 3VQ1C 4AQEA 4Z7UB 3CXHH 2R2EB 3MFGB 1A4JB 2YR3A 3Q3GA 1ETB1 1SLUA 5I66A 1T83A 2OJ1A 3PV7A 4NKOB 3MRCA 5I5MA 5C09D 1KB5B 3US0A 4N0UB 1SVFA 1QOKA 2AEJA 3NH7L 1A21A 1NTDA 3QJXA 4ZRGA 4X83A 1BGYG 1B90A 4PWJA 2XWCA 2GUOB 1YTZI 5TH2A 2YA0A 1Z7JA 3HE7C 4H8VA 1MZZA 3SCMA 3CLWA 4C56A 2AJXH 3C87A 4HBQA 2QT6A 1MQ8A 3MYZA 4XXDA 1XDTT 3I55P 4KGJA 4UAOC 5FKPA 4POYA 2YGPA 5F3BB 3FQNB 4KMQA 4D94A 5IHZB 3GF8A 1JNNL 5KBDA 2JCCE 4JZNA 4PHXA 5D7IE 5DC4B 3A0BE 1AR1D 1SUHA 3AWEA 2JELH 1ZHBA 1Z5YD 4MNGE 3ZQWA 3WY1A 1TZ8A 3KMDA 3H1KD 2J6EL 4LBEB 4AQAB 1ZGLB 2PCXA 3F00A 1H19A 1AHWC 3SOBH 2HR3A 2RFXB 2JVUA 1OPGH 3D0LB 3HHRB 3CXDL 1RZGA 3UC0L 4RZCA 3DX2A 4AVJA 2FEEL 3OAYH 3W9EA 2XU9A 2H6PB 3RX8A 4Y2DD 4OVUA 4KQ0A 3HRZA 5FYKH 1P84K 3GTTA 4RAHA 4X7TB 1A7OH 3MR9B 1IT9L 3BCDA 5T3XL 5HHMD 1RIHH 1BQHA 3RK3B 4DOJA 3GSWB 2XJKA 3B9KA 3BE1L 4Y5VC 5I18H 2DS4A 3DJ9A 4QD2E 4U1KB 4GXUM 1RUQL 5FGBC 4PV1C 4J6RH 4CC0A 1E28B 3G5ZA 4UQ9A 1Q94A 4L8BB 3KBEA 1KXVC 1MCQA 4HJEA 3U4BH 2IFNA 4PJXB 4L8DA 1CVSC 3TO4C 3NMDA 3VRIA 3ATFA 4ZUVA 4EBQH 2DDQH 1V54B 3QCUL 2C3VB 3OHXA 4Z7WA 4TYUA 3N1QC 4RSVA 5KSVA 1MELA 1UH2A 2PABA 1PPJD 4Z77B 1NLBH 1LL1A 3L71J 3BAIA 5D1QB 5I1EH 4WFEE 3AQXA 5A2JH 1ND0A 4TTDD 1ZLLA 1NEZB 3TYYA 4XCYB 4PRDA 5C07A 4ONOA 3HEIB 5L8JB 3SDDD 4Y5YC 5F7EL 1SHWA 1E5UI 4LLVB 3NCJH 1JK8A 2WSCJ 2B1AH 4G7QB 1WFIA 1B88A 3WIIH 2QJPC 2VW4A 4BUHA 1HJ0A 1X5GA 5DK2B 4QAMB 5E94B 1PY9A 5I1AB 4LPCA 1BZDA 2DM3A 3JTTB 3LIUA 3KWWA 1NEPA 4ABVA 3GJFA 4JYCA 3MOQA 3UGXA 1E9OB 1KENH 3BKYL 1H3WM 3MGNA 3ZTJG 1HHKB 2HMID 3GXDA 1CICB 4N0RA 4JPQA 1XGYH 4K9EH 3E7JA 5DURD 5A6MA 3ILPB 2ARJQ 5DK3A 1F13A 1MCPL 1F6AB 4DERA 2EDFA 1QFPA 1IC7L 3RVVC 1T1ZA 3IGAA 1H0DB 1O9WA 2XBDA 3BUBA 3UP6A 3V5DA 2X1WL 3DVGA 4O4YL 4XR8C 2XV6B 1SDDB 3K2IA 4L3FA 1BF5A 4GIAA 1BV8A 5CJQH 4S11A 2ZWNA 3BGAA 1CXIA 1RL1A 5E2UL 1ZHKA 3O6KL 4WI6A 1ZRTE 1IB5A 2IBZX 4ODWA 4C83A 1S8DA 4J4PA 4FLOA 5E2WL 3QH3B 2EE2A 2DMKA 2K70A 2GQHA 5B3JE 3JQOB 4LKXA 4CL7A 4G43A 1LILA 3ASWA 2ZSWA 3EBIA 5BV7B 2WYHA 4AE0A 1TSRA 4PGBA 4JRFA 3TA3B 1Q94B 5KJRL 5FF6A 2IPKB 1I3VA 1KBGH 1M8OB 2I27N 4ZMNA 2P67A 4U1NA 5D5MF 2H8PD 1RUPL 3EXJA 2OQQA 1A1MB 1QACA 3O4LD 3C08H 5KG9B 2I60H 4K8RD 4Y7OC 5MHSD 1MHPL 1QLRA 4P99A 3QNYA 1HK6A 3DX3A 1USZA 4HT1L 4M8QB 3U0WL 4UM9D 4EN3C 1G7HA 3FFDB 3NRPA 3LDBC 1AO7D 4AQ1A 4E9VA 1OARL 1ZWIB 1KN2L 4HP5A 4K3JL 5IF0A 1RAMA 1KYOE 4KMLB 5I1JH 1I31A 1LO5A 3JSSA 2IH1B 4XMLH 1EC5A 2WO2B 3LMJL 4QRPB 4XX1E 2HX9A 1OVVA 1EEYA 3Q8BA 1QFUH 4BKLB 5BXFB 2EEAA 4MD4A 3O6FD 1J1OL 2FX9H 4IBWA 1WZAA 5JMRA 1EUUA 4ASWA 5C07D 4WNJA 1FBIL 5CGMA 2HG0A 3B6SA 3F5WA 5I6OA 1WQVT 1PSKL 3M0AA 4JFWA 4XHQA 8CGTA 2ZWZA 1VPOL 3PGDB 2R0WL 3USSA 4IRZA 3VB9A 5I82A 1N6QL 5K5GB 1PZSA 4X99A 1LEKB 5APVA 4QT5A 3SPHA 2ZQKA 1G1IA 1WA1X 2X89D 3WU2H 3AM8A 4PLJC 3FT0A 4TNGA 3W67A 1WFUA 4E42A 2HFGH 3FRUA 1CICD 3FCSB 3KQGA 2E4TA 5I71C 1T22A 4W1TA 1CXLA 1MRFH 3PUUA 4KK5D 1U8IA 1R3JA 1L0LK