1NU1K

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
53
structure length
53
Chain Sequence
MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVWATDWRLILDWVPYINGKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 13
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nu1K00
2LKMA 1NTKK 2J59M 1SQVK 2WSCH 2FYUK 2WSFH 2WSEH 3CLQA 2OARA 1NTMK 5KLVK 1SQQK 3LW5H 4IFDK 1NU1K 1L0LK 1SQXK 2O01H 1SQPK 3M9QA 1L0NK 1SQBK 3G3ZA 1NTZK
chains in the Genus database with same CATH superfamily
2QJPC 3H1IE 2E74C 2B87B 3G9RA 4A7PA 1OMIA 1SQVK 4IOIH 4C46A 1ZLLA 2YMYA 4U3FJ 1KYOH 1SQPK 2E75B 2ZT9B 1VQ6P 4HB1A 1SVFA 1KFMA 1ZOYC 2KP8A 1QGKB 2IBZD 1ZRTD 1EZVD 1EDLA 3MHVA 1YYCA 2KS1B 2IBZE 4JPZB 2V7QH 1M1JC 2KYVA 2MJZA 1DX7A 1KN7A 4L75A 1QLED 3P8CD 3L36A 2WPVB 1KILC 3QH9A 3KYQA 1FZCB 2FFDB 1FDIA 1NU1K 4Y99B 1KQFB 2KI7B 2PFXA 5AW0B 4U3FE 2XU6A 3RK3D 3B5ND 3BVHA 2NPSA 3H1KG 3CCQP 2LKMA 4L74A 2HODA 3P7KA 1OZHA 3VMXA 1H89A 1PGPA 3CWBJ 1S9KD 1YJ9P 2W6JH 1N7SD 3NTNA 4UB6E 2XDJA 1YBKA 2K9JA 2KXPB 1N8RQ 1L0NG 3JCUE 2RN0A 3HE5A 2WSSH 5APUA 3BATA 3A7OA 3AE4C 2M0BA 2I1JA 5BU8B 3WUUA 5AW4B 3HD7A 2G8YA 5CCHC 1JOCA 3HRNA 5KKZC 3JSVC 3CWBD 2OQQA 4ASWA 1LJ2A 3VN0A 2R5DA 1YITP 1N86A 3L71E 1KD1Q 2WPQA 1YQ3C 1IO4A 2QIWA 3M0AA 1RF1A 3HE4B 4JYCA 2H89C 1URQB 2Q9IA 2KIKA 3V2PA 1UIIA 2KNCB 1FS0E 4XE5B 2JJLA 5CJ4A 2PGDA 2P7JA 4D6TD 1HH0A 4YTPC 2N9BA 5TISE 2QJPB 2E74B 1OW6A 1W5CE 1SQXG 1VPCA 1NTMJ 5KLVJ 1A02F 1E5WA 2E76D 1CI6A 1L0LK 2P1JA 2J5UA 4UB8E 1OVUA 1L4AD 2A06E 3H6PA 3L72J 3V2RA 2Y0CA 3MTUE 3L35A 5BVZA 3VMZA 2WSFJ 1MUUA 4R4LA 3SWYA 1OW8A 2WSEH 2A45H 1PIXA 2QJKC 1Z56A 2OARA 4RO0A 1BGYJ 4EIJA 1NVOA 1BDDA 1M1JB 1GU4A 1H0TB 5CJ0A 1NU1J 1ZP0C 4PD4H 4HKZH 1JMMA 1KZUB 1NTMD 4N3YB 1ZW0A 2FYZA 2NPSD 3RL0g 4IFMA 3H25A 1KILB 1LWUA 1Y9BA 2C9NY 3PP5A 3L72D 2QSIA 1DEBA 5KLVE 3C8VA 3G4SP 2JEEA 2R32A 2AXTH 2ZYGA 2N1TA 3V5BA 3D6YA 3MUDC 2A45I 1BGYD 2FYNC 2Y9YA 5AW5B 5DJTB 2GUVA 5M1BA 3AEDC 1NU1D 4IFFA 1U7MA 2KSJA 4PD4I 1WT6A 3CLQA 3LW5J 5AVQB 3VP8A 1IFNA 1YTZT 4TLFA 1K8AQ 2O1JA 1IZNB 2D2CC 3EFFK 1QEXA 2QM8A 2O01N 3FX0A 1IK7A 2KSEA 3CCSP 3ZDMA 1VQKP 5KKZB 4GODA 1M57D 4K35A 3L75E 3PH0A 1LTJA 1M7LA 2YIUB 3GLMA 1U57A 3RK3C 2QM7A 1RE3C 3A5TA 3B5NC 4JYBA 2OYHC 1KQGB 5TJHA 2M8RA 2GM4A 2E43A 1QVFO 3II6A 2BEZF 2HG5D 1GW3A 2WZ7A 4DCKA 3SWKA 1RF0A 2ZXXA 3M06A 3AEEC 1N7SC 3B8EB 4W7YA 3CXHI 2FYUE 1VQOP 1IFJA 1LNQA 1SFCA 3AEGC 3CC4P 4D6TG 3H1LJ 1JUNA 1VF5D 1G2CA 3S1KA 2JWAA 4B86A 4OGQD 1ZR2A 1UIXA 1BCCE 2FXOA 2QEXP 2FXMA 3Q3DA 1KB9H 5CBNA 3W68A 1S5LX 1CSBA 2PP6A 2QJKB 2OYOA 3L70J 1GL2D 2HFED 3V2QA 1M8OB 1L0LD 1SQVG 3HUSA 3H1LD 4KJMA 1Q2NA 4WY4C 3UIAA 4U7JA 1SQPG 3D6ZA 2N1TD 2YNYA 2AEFA 2WTYA 2LXCB 2LR2A 2R3CA 2Y0EA 3R4YA 3L72G 2W6AA 1T6AA 3TGUJ 3VOPA 1KQSO 2ZXEB 1KB9I 1DEEG 1GK4A 3L70D 4I7ZC 3FXEA 2E76C 1MV8A 1BGYG 1L4AC 1LP1A 1S4XA 1AV1A 1JY3P 2KZJA 1NU1G 3RL0D 1SQBJ 3AE5C 3IN6A 1VQ9P 3AEBC 3VMYA 1VQPP 1M1KQ 3V2NA 1BE3G 3H1IJ 2D2CB 3TGUD 3OA7A 2BCCG 4PD4E 5AVYB 3L73E 2NPSC 1JNMA 1FJPA 1VQ4P 1DH3A 4LGDE 2V4HA 2B87A 2YMKA 5AW3B 1PFIA 2JWDA 3RK3B 3B5NB 1SQBD 2OYHB 3KPEA 1RY3A 1AVOA 1SQBE 3H1ID 2QRXA 2YKQA 3O6QA 3G3ZA 1PPJE 3L4FA 1QX8A 1N7SB 1Q86Q 1S5LH 2B89A 4DOJA 4KHXA 2NZ2A 3QWOC 2W27A 1W2EA 3NMDA 1KV4A 5C39A 2OYIB 1FZCA 4ZKUA 1NTMK 2M5AB 5KLVK 2FFDA 3CXHE 1JTHA 1R5LA 1CW5A 1JCDA 1E79H 1PGOA 3F5HA 1FZAA 1SQXE 3I55P 1SS1A 1K05A 3P32A 3S9OA 1NYHA 3AEFC 3Q5PA 4BRYB 1AFOA 1FOSF 5AW6B 2JO1A 3A0HE 4WB4A 1LTSC 1L0LG 4U3FD 4LLHA 4WY4B 2JKVA 2RH0A 1BSNA 1KYOI 4Y28J 2Z4EA 3A0BH 5E79H 2W83C 1N73A 3U1CA 1TU3F 1RQUA 2JDIH 2P67A 1VF5C 1HJBA 4WVZA 4I7ZB 3Q5SA 2E76B 2IX7C 5KAIH 3L71J 4OGQC 3WUVA 3CX5H 1LT1A 1L4AB 1QL1A 1JB0J 3VTPC 2QG4A 3CCJP 1KB9E 2Y0DA 1PV3A 2O01J 3LW5H 1GL2C 3WUTA 3AEAC 1LWUC 3KDPB 3O8ZA 4XFJA 1YHQP 1USEA 1OW7A 3TNUA 1G1JA 3P8MC 2WITA 3IF4A 1S72P 1URQA 5L8RJ 5K5GB 3H1JG 2KB7P 1HTLC 2KNCA 4L76A 3L37A 2FYUK 3CCRP 5APVA 2OTLP 2N1TC 2NPSB 3L71D 2E75D 2ZFCA 3H32B 3PHLA 4NPDA 4YXWH 2HODB 1OX3A 2R5BA 1GDTA 1XTCC 4HH2A 2Y9ZA 2KZIA 1PL5A 3AE9C 5EFWB 1GK6A 3PRJA 3CI9A 3KXDA 1YJWP 1NHLA 2QA4P 3FXDA 2FY8A 2IFMA 3RK2D 1OWAA 3TSIA 1LTBC 1YTZI 1FOSE 1SQQE 3RL0C 3GHGC 1M1JA 2A06D 2Q6QA 1JM0A 3D70A 4BXLA 1AA0A 1X0TA 1U7JA 3OJAB 3GG2A 3FGAD 1LTJC 1KILA 1LTGC 1NH4A 1NJIQ 3BRTB 2WQYC 4PJ0H 5APXA 2IBZG 1EZVG 2H88C 2YO3A 1AJYA 4H13D 1NTZE 1AVYA 1RF0C 1RHZB 2WT7B 2IPPA 3SWFA 2CPBA 1WRGA 5KLIC 2OGUA 5KLVD 1JY2O 2V7QJ 1P84H 3CL3D 1PGQA 3U59A 3CCLP 1FZEA 4U3FG 1X8YA 4H44D 2ZAEB 5H2FH 1OVVA 1GZLA 1SQVE 1EDIA 1QL2A 1CI6B 1IFIA 3ITKA 1S5LE 1LT9C 1KYOD 4N6JA 4DZOA 2E5YA 1SQPE 4JF7A 3L75J 4EI2A 1RH5B 5GTIH 3FWNA 1FC2C 4C7NB 1KYOE 1A02J 3KQGA 1KORA 4IL6X 1RQVA 4OGQB 4GOFA 4I2LC 2KUBA 2GA1A 3AECC 1HGVA 2M3BA 4AYCA 1VQ8P 1HF9A 2WSCH 3HUSC 3CMAP 4I1LA 3L74J 3HD7D 2C9LY 1KTMA 1BSHA 1GL2B 2XV5A 3GW6A 2FYUJ 1SQBK 1LWUB 3BCCE 1Q82Q 3MP7B 1NAYA 3L75D 2IYOA 5KTBA 4ASVA 1X22A 1GMJA 2N1TB 3E1RA 1LTIC 1Q90D 1BCCJ 3LIDA 3USSA 2ZYDA 5E79E 3CWBG 3TK1A 4PV1D 5AW8B 1PGJA 2BCCE 3L74D 4TT3H 2YXRB 4W80A 2KK7A 3L74E 2FYUD 5KAIE 3CX5E 4H0LD 3CCVP 1PP9E 1DD3A 3GMAA 4AUWA 5APSA 1AQTA 1FDOA 2W90A 1YIJP 3RL0B 3GHGB 3PJSK 2YKPA 1EQ7A 1BCCD 3NFQA 3H1HE 1KILE 2A06G 1FZFA 4GDOA 1K9MQ 3E7KA 1NTKE 4I6MC 1LTJB 3AE8C 2P2UA 5APTA 1FZGA 2XKMA 3V4WA 2WWWA 1NKNA 5APQA 5AVWB 1J1EC 1K73Q 2IZ0A 1YI2P 3EQ2A 3H1KJ 2WPRA 2HLOA 4UB6H 3MUDA 3KZIH 4O9BA 2WSEJ 2POHA 4IL6H 4LC1A 1JY3N 1NTMG 5KLVG 1D7MA 2WPSA 2DW3A 1DD4A 4RJTA 3RK2C 1YJNP 4M3LA 3L73J 2B9BA 2C0WA 2FXPA 1VQNP 1L0NJ 1LT9B 3HTKA 4GKGA 1FDMA 2L91A 1NO4A 2O3JA 5B66H 2FYNB 3H1KD 2Q1KA 1AQ5A 3AE1C 4HJGH 3MZWB 4QMAA 1GD2E 1S3JA 3H1KE 2H8PD 4PJ0E 2W6BA 3MD0A 3HUSB 3B5NA 4H13C 3W67A 2OYHA 3PTZA 2YKOA 4PD4D 3L73D 1L0ND 5TISH 4ZKPA 2H43A 1FBMA 4GIFA 1N73C 5KAFH 1LTTC 2XZRA 1L2PA 2MKVA 1SQQK 3A3YB 1L0NE 5B5EH 3KHUA 3L75G 2P58A 4H44C 3IR9A 3H1JE 2R3SA 1SQXJ 2AXTE 2CK3H 1LP1B 1VQMP 1EXIA 1JO5A 2OYIA 2M5AA 2ZYAA 2R44A 1PPJD 3IAOA 1SFCD 4ZNCA 1CZQA 1GTWA 2RMZA 3TF5A 3VYIA 1NTZK 1HWTC 4L73A 2KS1A 5CCGA 2M3EA 1J2JB 4BRYA 3T97B 2HPCB 1VDFA 3M0DA 1Q7YQ 1J1DC 3IFMA 1FE6A 3HD7C 1S2EA 4IFDK 2JR8A 3CXHD 3SFEC 1NAFA 2K9YA 3TDKA 5AVUB 2PRRA 2Z5IA 1BCCG 1SQXD 4JQ0D 4WY4A 1EC5A 2Q5UA 2WSFH 3M9BA 1FZBA 2FBWC 1J1EB 1RF1C 1ZN5A 1WMKA 3Q5RA 2G3AA 4PV1C 4RKUJ 1M56D 1T3UA 2J58A 3PLNA 2IFNA 3O6QB 2N9YB 4HYTB 4W7ZA 1L4AA 4YPCA 1ZRTE 1EZVE 3EFGA 3H1LG 3MIWA 2D2CD 5AVXB 2FKWB 2IZ1A 2L5GB 3CCEP 3AE2C 4H0LC 5AVZB 2H7HA 3N7NA 3RK2B 2UWJE 3B71A 3G71P 1JTHB 3P8CE 4NPFX 1KFNA 3L70G 1KB9D 2WMMA 1RE4A 2Q7CA 4DJGA 3H32A 4ZMDA 3RK3E 3RBXA 2AEMA 2A45G 5KJ7A 1EDJA 3MGNA 3GF7A 5AVVB 4H13B 5BU5A 3R2PA 3HE4A 5APWA 1VQ5P 4JBZA 1SQQJ 3U1AA 3KZIE 1NOHA 1ZXGA 3L73G 1S9KE 1QVGO 2LXBA 3TGUG 3K5BA 1N73B 4RESB 4IL6E 1OVRA 2IYPA 5GTHH 3A2AA 3M9QA 2ZT9D 2IDBA 3CX5I 4H44B 3G6EP 4D6TJ 3BRVB 1NTKK 2OTKE 5CCGD 3C9IA 2PAJA 1NTZJ 2YIUC 2BEQD 3V6IA 1SQBG 5B66E 4YXDC 2K9JB 1SQQD 1PPJG 3C1LA 3CWBE 3M91A 3H1IG 1VQ7P 3HE5B 2HYNA 1HJ0A 1W2BO 4WY4D 3TNUB 1XTGB 1J1DB 3VMAA 2WT7A 1H0TA 3HD7B 1IJDB 1SLQA 1SQVJ 3VP9A 1JY2N 1SQPJ 2NRGA 2J59M 4BWNA 1NTZD 4D6TE 5KAFE 3I5CA 5APYA 4WWIA 1KQLA 1ZV8A 1USDA 5B5EE 3AE7C 1RF1B 4OH8B 1T2KD 2E5TA 4PV1B 4CPGA 3Q1MA 4C7NA 1JEKA 1ZMEC 1EDKA 1VQLP 2RKLA 1SFCC 1SQVD 1X9VA 1VL2A 1JY2P 2Q3EA 3BCCJ 5CHXA 1GW4A 1FJKA 1LTAC 4H0LB 1SQPD 1T3JA 2JP3A 5AW9B 1GL2A 3RBZA 4EOTA 1IFPA 1JCCA 2E42A 5AW2B 1BE3J 1IFMA 1T8ZA 2QVAA 1NTME 1VF5B 3AE3C 5KJ7D 2QJYC 5AVTB 5CMZA 1L0NK 3WU2H 3JC22 3Q2YA 2SPZA 2AEJA 2BCCJ 1HGZA 1IK9A 3L72E 5CCHA 4AQRD 3BASA 4OVNF 1URQD 3SSUA 1IC2A 1P84I 3BCCD 2CPSA 1PP9J 1BGYE 4KT0J 2B88A 1MZ9A 1Y8AA 2E74D 1JMBA 4NPEA 2W8ZA 1NU1E 2YO2A 1BE3D 3H1HJ 4OWFA 2BASA 2K3RA 2XNXA 1EXJA 1NKZB 1NTKJ 1H88A 5AW7B 2BCCD 3N4XA 1BE3E 3FWLA 3A0BE 3CXHH 3RGUA 3GHGA 3L71G 3CD6P 2C0XA 1OIPA 5AW1B 1HVVA 3V4QA 4DT0A 3CX5D 3LIEA 1PP9D 2K88A 1SQXK 2OTJP 3A0HH 4GT1A 3M9HA 4GOEA 1SQQG 1G1IA 2Q3IA 3H1HD 1KILD 3E1IA 1NTKD 1KMIZ 1K04A 1Y47A 1OFCX 1DIPA 1YQ4C 1L0LJ 2ZVOB 2IBZI 1EZVI 2E75C 3CC2P 2ZT9C 2OYIC 1NTZG 5GTHE 1R5SA 1LT9A 3AE6C 3CCMP 2QE7H 5CCGC 5KLIB 5AVSB 3JCUH 3M0DC 2K37A 1SFCB 3CC7P 2XNDH 1KC8Q 4N78D 3NXSA 3CMEP 1G2CB 1N2DC 1FZCC 3ABVC 2FFDC 1L0LE 5CCHD 4N78E 4Y99C 3CPWO 4K3AA 3H1LE 1IFDA 3SFDC 4R4MA 2ITAA 3H1JJ 2HR3A 3I56P 2QJYB 1MKMA 1NGMB 3F89A 4MN4C 2KOGA 1RE3A 1JY3O 2KLVA 5CBOA 2O01H 2O1KA 2ZJSE 2ZVNB 3CCUP 3L70E 4EDFA 2P10A 1HUCA 3BCCG 1T2KC 1H8AA 2WSCJ 1P84D 3OW2O 1LGHB 1FAVA 3OAKA 1BDCA 2WVRA 1FU1A 1MFTA 2GUSA 1P84E 1N7SA 3H1JD 4UB8H 3T97A 2HPCA 1MFZA 1N7LA 2VRSA 3HTKB 4EYYQ 3D71A 5H2FE 1S1CX 4C7RA 3WMM0 1R8EA 1RE4C 4XA4A 3TGUE 2I1KA 2YXQB 2KLUA 2Z5HA 3GF3A 2I8DA 3L74G 5KJ7C 5GTIE 1SP4A 3WU2E 1GU5A 2AXCA 1NWQA 1X79B 1PP9G 2FYUG 1ZR4A 1M90Q 4Z1MH 4WBAA 3EWKA 1URQC 5AVRB 3TYYA 1PZQA 2K1AA 3H1HG 1Q81Q 1HBWA 3S4RA 5DJUB 1OXZA 1NTKG 3B4SA
chains in the Genus database with same CATH topology
3HUSA 3BRVB 4I2LC 1HGVA 1NTKK 2M3BA 4AYCA 1SQVK 2WSCH 4WY4C 3UIAA 3HUSC 4I1LA 5CCGD 3C9IA 4C46A 2PAJA 3HD7D 1ZLLA 2C9LY 2YMYA 2N1TD 2YNYA 2WTYA 1SQPK 1GL2B 2XV5A 1SQBK 1LWUB 2R3CA 1SVFA 3M91A 1KFMA 2KP8A 2W6AA 3HE5B 2HYNA 3VOPA 2ZXEB 1YYCA 4WY4D 3TNUB 1XTGB 1GK4A 5KTBA 1J1DB 2WT7A 3HD7B 1IJDB 1SLQA 2N1TB 1LTIC 1MV8A 1L4AC 1M1JC 3LIDA 2KYVA 3VP9A 2MJZA 1DX7A 3TK1A 1JY3P 5AW8B 1JY2N 3P8CD 3L36A 2J59M 1KILC 3RL0D 3KYQA 1FZCB 3I5CA 4W80A 5APYA 1KQLA 2FFDB 1ZV8A 1NU1K 4Y99B 3VMYA 5AW0B 3V2NA 1RF1B 2XU6A 3RK3D 4OH8B 3OA7A 3B5ND 3BVHA 4AUWA 1T2KD 5APSA 2NPSA 4C7NA 2LKMA 5AVYB 2NPSC 2HODA 3P7KA 3RL0B 1JNMA 1FJPA 3GHGB 2YKPA 1EQ7A 3VMXA 1H89A 1DH3A 1SFCC 3NFQA 4LGDE 1X9VA 5AW3B 1JY2P 1PFIA 1FZFA 5CHXA 1S9KD 1GW4A 1FJKA 1LTAC 1N7SD 3RK3B 1T3JA 4I6MC 3NTNA 3B5NB 5AW9B 1LTJB 2XDJA 2OYHB 1GL2A 2P2UA 5APTA 4EOTA 1FZGA 2XKMA 3V4WA 2WWWA 1NKNA 5APQA 1JCCA 3KPEA 5AVWB 2E42A 1J1EC 1RY3A 5AW2B 1IFMA 1T8ZA 3HE5A 3EQ2A 5KJ7D 5AVTB 2YKQA 5CMZA 1L0NK 5APUA 3BATA 2WPRA 3A7OA 3G3ZA 2HLOA 3L4FA 3MUDA 1HGZA 1IK9A 2I1JA 1N7SB 5CCHA 5BU8B 5AW4B 3HD7A 4O9BA 4DOJA 4KHXA 2POHA 4AQRD 2W27A 3BASA 5CCHC 1JOCA 1W2EA 3NMDA 1URQD 3HRNA 4LC1A 1JY3N 1IC2A 3VN0A 2CPSA 2WPSA 2R5DA 2OYIB 1FZCA 1N86A 4ZKUA 3RK2C 1NTMK 4M3LA 5KLVK 2FFDA 1MZ9A 1JTHA 2WPQA 2C0WA 1CW5A 1IO4A 1JCDA 3M0AA 1FZAA 1LT9B 1RF1A 3HTKA 4GKGA 2YO2A 1FDMA 3HE4B 4JYCA 3P32A 1NO4A 1URQB 2Q9IA 3V2PA 2BASA 2XNXA 1AQ5A 1AFOA 1FOSF 1NKZB 4XE5B 2JJLA 1H88A 5AW7B 5CJ4A 3N4XA 5AW6B 2P7JA 3GHGA 1HH0A 4WB4A 2N9BA 1GD2E 2H8PD 1LTSC 2C0XA 2W6BA 5AW1B 1HVVA 3V4QA 1VPCA 4LLHA 4WY4B 1A02F 1E5WA 3HUSB 3MD0A 3LIEA 3B5NA 1CI6A 1L0LK 2P1JA 1SQXK 2OYHA 2Z4EA 1L4AD 3H6PA 2YKOA 3V2RA 3MTUE 3L35A 1N73A 4GT1A 5BVZA 3M9HA 3VMZA 4ZKPA 3U1CA 2H43A 1FBMA 1MUUA 1G1IA 2Q3IA 4GIFA 1N73C 3SWYA 2WSEH 1LTTC 2A45H 2XZRA 1KILD 1Z56A 2OARA 2P67A 1HJBA 1SQQK 3A3YB 3E1IA 2IX7C 4EIJA 1L4AB 1M1JB 1GU4A 1QL1A 3IR9A 5CJ0A 3VTPC 1JMMA 1KZUB 1JO5A 4N3YB 2FYZA 2OYIA 2NPSD 4IFMA 1KILB 1LWUA 3LW5H 2C9NY 1GL2C 3PP5A 1SFCD 2OYIC 1CZQA 1DEBA 1GTWA 1LWUC 3KDPB 3O8ZA 1LT9A 3VYIA 3TNUA 1G1JA 3P8MC 2WITA 1NTZK 1HWTC 1URQA 2JEEA 2R32A 5CCGA 2KB7P 1HTLC 1J2JB 2HPCB 3L37A 2N1TA 1VDFA 3V5BA 3M0DA 5CCGC 2FYUK 1J1DC 5APVA 3IFMA 2A45I 3HD7C 5AVSB 2N1TC 2NPSB 4IFDK 3M0DC 5AW5B 2ZFCA 3H32B 1NAFA 1SFCB 2GUVA 2HODB 2R5BA 5AVUB 1GDTA 2Z5IA 1XTCC 4HH2A 4WY4A 4N78D 4IFFA 2Q5UA 3NXSA 1G2CB 2KSJA 1N2DC 1FZCC 2WSFH 3M9BA 1WT6A 3CLQA 2FFDC 5AVQB 3VP8A 1GK6A 1IFNA 5CCHD 1YTZT 4N78E 3CI9A 4Y99C 1FZBA 2O1JA 1NHLA 1IFDA 1J1EB 1RF1C 1ZN5A 2IFMA 1T3UA 3RK2D 1OWAA 2QM8A 2J58A 3TSIA 1LTBC 2IFNA 1YTZI 1FOSE 3RL0C 4HYTB 3GHGC 4W7ZA 1L4AA 1M1JA 3EFGA 2KOGA 1RE3A 1JY3O 3MIWA 2KLVA 2O01H 2O1KA 1LTJA 3OJAB 1M7LA 5AVXB 2FKWB 2L5GB 3RK3C 2QM7A 1RE3C 3A5TA 5AVZB 2H7HA 3B5NC 1HUCA 1LTJC 4JYBA 1T2KC 1KILA 1LTGC 2OYHC 1NH4A 1H8AA 3N7NA 2M8RA 3BRTB 3RK2B 2GM4A 2E43A 1LGHB 3II6A 1FAVA 3OAKA 2HG5D 1GW3A 2WZ7A 5APXA 1JTHB 1FU1A 2GUSA 1RF0A 3P8CE 1N7SA 2YO3A 3T97A 2HPCA 1MFZA 1N7LA 2VRSA 3HTKB 3M06A 1KFNA 1RF0C 1N7SC 3B8EB 1RE4A 4W7YA 2WT7B 4C7RA 2IPPA 3WMM0 3SWFA 2CPBA 1WRGA 2Q7CA 1IFJA 3H32A 1RE4C 1SFCA 4XA4A 2I1KA 1JY2O 2A45G 5KJ7A 2Z5HA 1JUNA 3MGNA 3CL3D 5KJ7C 1G2CA 3U59A 1FZEA 4B86A 5AVVB 1SP4A 5BU5A 1ZR2A 1GU5A 1X8YA 1NWQA 1X79B 3R2PA 1GZLA 2FXMA 3HE4A 5APWA 1QL2A 1CI6B 1IFIA 3U1AA 1ZR4A 1NOHA 1LT9C 1S9KE 4N6JA 4WBAA 1URQC 4DZOA 4JF7A 5AVRB 1N73B 4RESB 3TYYA 1CSBA 2PP6A 1GL2D 2HFED 3V2QA 4C7NB 1HBWA 3A2AA 3M9QA 1A02J 3KQGA 1OXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKM A;  1NTK K;  2J59 M;  1SQV K;  2WSC H;  2FYU K;  2WSF H;  2WSE H;  3CLQ A;  2OAR A;  1NTM K;  5KLV K;  1SQQ K;  3LW5 H;  4IFD K;  1NU1 K;  1L0L K;  1SQX K;  2O01 H;  1SQP K;  3M9Q A;  1L0N K;  1SQB K;  3G3Z A;  1NTZ K; 
#chains in the Genus database with same CATH topology
 2QJP C;  3H1I E;  2E74 C;  2B87 B;  3G9R A;  4A7P A;  1OMI A;  1SQV K;  4IOI H;  4C46 A;  1ZLL A;  2YMY A;  4U3F J;  1KYO H;  1SQP K;  2E75 B;  2ZT9 B;  1VQ6 P;  4HB1 A;  1SVF A;  1KFM A;  1ZOY C;  2KP8 A;  1QGK B;  2IBZ D;  1ZRT D;  1EZV D;  1EDL A;  3MHV A;  1YYC A;  2KS1 B;  2IBZ E;  4JPZ B;  2V7Q H;  1M1J C;  2KYV A;  2MJZ A;  1DX7 A;  1KN7 A;  4L75 A;  1QLE D;  3P8C D;  3L36 A;  2WPV B;  1KIL C;  3QH9 A;  3KYQ A;  1FZC B;  2FFD B;  1FDI A;  1NU1 K;  4Y99 B;  1KQF B;  2KI7 B;  2PFX A;  5AW0 B;  4U3F E;  2XU6 A;  3RK3 D;  3B5N D;  3BVH A;  2NPS A;  3H1K G;  3CCQ P;  2LKM A;  4L74 A;  2HOD A;  3P7K A;  1OZH A;  3VMX A;  1H89 A;  1PGP A;  3CWB J;  1S9K D;  1YJ9 P;  2W6J H;  1N7S D;  3NTN A;  4UB6 E;  2XDJ A;  1YBK A;  2K9J A;  2KXP B;  1N8R Q;  1L0N G;  3JCU E;  2RN0 A;  3HE5 A;  2WSS H;  5APU A;  3BAT A;  3A7O A;  3AE4 C;  2M0B A;  2I1J A;  5BU8 B;  3WUU A;  5AW4 B;  3HD7 A;  2G8Y A;  5CCH C;  1JOC A;  3HRN A;  5KKZ C;  3JSV C;  3CWB D;  2OQQ A;  4ASW A;  1LJ2 A;  3VN0 A;  2R5D A;  1YIT P;  1N86 A;  3L71 E;  1KD1 Q;  2WPQ A;  1YQ3 C;  1IO4 A;  2QIW A;  3M0A A;  1RF1 A;  3HE4 B;  4JYC A;  2H89 C;  1URQ B;  2Q9I A;  2KIK A;  3V2P A;  1UII A;  2KNC B;  1FS0 E;  4XE5 B;  2JJL A;  5CJ4 A;  2PGD A;  2P7J A;  4D6T D;  1HH0 A;  4YTP C;  2N9B A;  5TIS E;  2QJP B;  2E74 B;  1OW6 A;  1W5C E;  1SQX G;  1VPC A;  1NTM J;  5KLV J;  1A02 F;  1E5W A;  2E76 D;  1CI6 A;  1L0L K;  2P1J A;  2J5U A;  4UB8 E;  1OVU A;  1L4A D;  2A06 E;  3H6P A;  3L72 J;  3V2R A;  2Y0C A;  3MTU E;  3L35 A;  5BVZ A;  3VMZ A;  2WSF J;  1MUU A;  4R4L A;  3SWY A;  1OW8 A;  2WSE H;  2A45 H;  1PIX A;  2QJK C;  1Z56 A;  2OAR A;  4RO0 A;  1BGY J;  4EIJ A;  1NVO A;  1BDD A;  1M1J B;  1GU4 A;  1H0T B;  5CJ0 A;  1NU1 J;  1ZP0 C;  4PD4 H;  4HKZ H;  1JMM A;  1KZU B;  1NTM D;  4N3Y B;  1ZW0 A;  2FYZ A;  2NPS D;  3RL0 g;  4IFM A;  3H25 A;  1KIL B;  1LWU A;  1Y9B A;  2C9N Y;  3PP5 A;  3L72 D;  2QSI A;  1DEB A;  5KLV E;  3C8V A;  3G4S P;  2JEE A;  2R32 A;  2AXT H;  2ZYG A;  2N1T A;  3V5B A;  3D6Y A;  3MUD C;  2A45 I;  1BGY D;  2FYN C;  2Y9Y A;  5AW5 B;  5DJT B;  2GUV A;  5M1B A;  3AED C;  1NU1 D;  4IFF A;  1U7M A;  2KSJ A;  4PD4 I;  1WT6 A;  3CLQ A;  3LW5 J;  5AVQ B;  3VP8 A;  1IFN A;  1YTZ T;  4TLF A;  1K8A Q;  2O1J A;  1IZN B;  2D2C C;  3EFF K;  1QEX A;  2QM8 A;  2O01 N;  3FX0 A;  1IK7 A;  2KSE A;  3CCS P;  3ZDM A;  1VQK P;  5KKZ B;  4GOD A;  1M57 D;  4K35 A;  3L75 E;  3PH0 A;  1LTJ A;  1M7L A;  2YIU B;  3GLM A;  1U57 A;  3RK3 C;  2QM7 A;  1RE3 C;  3A5T A;  3B5N C;  4JYB A;  2OYH C;  1KQG B;  5TJH A;  2M8R A;  2GM4 A;  2E43 A;  1QVF O;  3II6 A;  2BEZ F;  2HG5 D;  1GW3 A;  2WZ7 A;  4DCK A;  3SWK A;  1RF0 A;  2ZXX A;  3M06 A;  3AEE C;  1N7S C;  3B8E B;  4W7Y A;  3CXH I;  2FYU E;  1VQO P;  1IFJ A;  1LNQ A;  1SFC A;  3AEG C;  3CC4 P;  4D6T G;  3H1L J;  1JUN A;  1VF5 D;  1G2C A;  3S1K A;  2JWA A;  4B86 A;  4OGQ D;  1ZR2 A;  1UIX A;  1BCC E;  2FXO A;  2QEX P;  2FXM A;  3Q3D A;  1KB9 H;  5CBN A;  3W68 A;  1S5L X;  1CSB A;  2PP6 A;  2QJK B;  2OYO A;  3L70 J;  1GL2 D;  2HFE D;  3V2Q A;  1M8O B;  1L0L D;  1SQV G;  3HUS A;  3H1L D;  4KJM A;  1Q2N A;  4WY4 C;  3UIA A;  4U7J A;  1SQP G;  3D6Z A;  2N1T D;  2YNY A;  2AEF A;  2WTY A;  2LXC B;  2LR2 A;  2R3C A;  2Y0E A;  3R4Y A;  3L72 G;  2W6A A;  1T6A A;  3TGU J;  3VOP A;  1KQS O;  2ZXE B;  1KB9 I;  1DEE G;  1GK4 A;  3L70 D;  4I7Z C;  3FXE A;  2E76 C;  1MV8 A;  1BGY G;  1L4A C;  1LP1 A;  1S4X A;  1AV1 A;  1JY3 P;  2KZJ A;  1NU1 G;  3RL0 D;  1SQB J;  3AE5 C;  3IN6 A;  1VQ9 P;  3AEB C;  3VMY A;  1VQP P;  1M1K Q;  3V2N A;  1BE3 G;  3H1I J;  2D2C B;  3TGU D;  3OA7 A;  2BCC G;  4PD4 E;  5AVY B;  3L73 E;  2NPS C;  1JNM A;  1FJP A;  1VQ4 P;  1DH3 A;  4LGD E;  2V4H A;  2B87 A;  2YMK A;  5AW3 B;  1PFI A;  2JWD A;  3RK3 B;  3B5N B;  1SQB D;  2OYH B;  3KPE A;  1RY3 A;  1AVO A;  1SQB E;  3H1I D;  2QRX A;  2YKQ A;  3O6Q A;  3G3Z A;  1PPJ E;  3L4F A;  1QX8 A;  1N7S B;  1Q86 Q;  1S5L H;  2B89 A;  4DOJ A;  4KHX A;  2NZ2 A;  3QWO C;  2W27 A;  1W2E A;  3NMD A;  1KV4 A;  5C39 A;  2OYI B;  1FZC A;  4ZKU A;  1NTM K;  2M5A B;  5KLV K;  2FFD A;  3CXH E;  1JTH A;  1R5L A;  1CW5 A;  1JCD A;  1E79 H;  1PGO A;  3F5H A;  1FZA A;  1SQX E;  3I55 P;  1SS1 A;  1K05 A;  3P32 A;  3S9O A;  1NYH A;  3AEF C;  3Q5P A;  4BRY B;  1AFO A;  1FOS F;  5AW6 B;  2JO1 A;  3A0H E;  4WB4 A;  1LTS C;  1L0L G;  4U3F D;  4LLH A;  4WY4 B;  2JKV A;  2RH0 A;  1BSN A;  1KYO I;  4Y28 J;  2Z4E A;  3A0B H;  5E79 H;  2W83 C;  1N73 A;  3U1C A;  1TU3 F;  1RQU A;  2JDI H;  2P67 A;  1VF5 C;  1HJB A;  4WVZ A;  4I7Z B;  3Q5S A;  2E76 B;  2IX7 C;  5KAI H;  3L71 J;  4OGQ C;  3WUV A;  3CX5 H;  1LT1 A;  1L4A B;  1QL1 A;  1JB0 J;  3VTP C;  2QG4 A;  3CCJ P;  1KB9 E;  2Y0D A;  1PV3 A;  2O01 J;  3LW5 H;  1GL2 C;  3WUT A;  3AEA C;  1LWU C;  3KDP B;  3O8Z A;  4XFJ A;  1YHQ P;  1USE A;  1OW7 A;  3TNU A;  1G1J A;  3P8M C;  2WIT A;  3IF4 A;  1S72 P;  1URQ A;  5L8R J;  5K5G B;  3H1J G;  2KB7 P;  1HTL C;  2KNC A;  4L76 A;  3L37 A;  2FYU K;  3CCR P;  5APV A;  2OTL P;  2N1T C;  2NPS B;  3L71 D;  2E75 D;  2ZFC A;  3H32 B;  3PHL A;  4NPD A;  4YXW H;  2HOD B;  1OX3 A;  2R5B A;  1GDT A;  1XTC C;  4HH2 A;  2Y9Z A;  2KZI A;  1PL5 A;  3AE9 C;  5EFW B;  1GK6 A;  3PRJ A;  3CI9 A;  3KXD A;  1YJW P;  1NHL A;  2QA4 P;  3FXD A;  2FY8 A;  2IFM A;  3RK2 D;  1OWA A;  3TSI A;  1LTB C;  1YTZ I;  1FOS E;  1SQQ E;  3RL0 C;  3GHG C;  1M1J A;  2A06 D;  2Q6Q A;  1JM0 A;  3D70 A;  4BXL A;  1AA0 A;  1X0T A;  1U7J A;  3OJA B;  3GG2 A;  3FGA D;  1LTJ C;  1KIL A;  1LTG C;  1NH4 A;  1NJI Q;  3BRT B;  2WQY C;  4PJ0 H;  5APX A;  2IBZ G;  1EZV G;  2H88 C;  2YO3 A;  1AJY A;  4H13 D;  1NTZ E;  1AVY A;  1RF0 C;  1RHZ B;  2WT7 B;  2IPP A;  3SWF A;  2CPB A;  1WRG A;  5KLI C;  2OGU A;  5KLV D;  1JY2 O;  2V7Q J;  1P84 H;  3CL3 D;  1PGQ A;  3U59 A;  3CCL P;  1FZE A;  4U3F G;  1X8Y A;  4H44 D;  2ZAE B;  5H2F H;  1OVV A;  1GZL A;  1SQV E;  1EDI A;  1QL2 A;  1CI6 B;  1IFI A;  3ITK A;  1S5L E;  1LT9 C;  1KYO D;  4N6J A;  4DZO A;  2E5Y A;  1SQP E;  4JF7 A;  3L75 J;  4EI2 A;  1RH5 B;  5GTI H;  3FWN A;  1FC2 C;  4C7N B;  1KYO E;  1A02 J;  3KQG A;  1KOR A;  4IL6 X;  1RQV A;  4OGQ B;  4GOF A;  4I2L C;  2KUB A;  2GA1 A;  3AEC C;  1HGV A;  2M3B A;  4AYC A;  1VQ8 P;  1HF9 A;  2WSC H;  3HUS C;  3CMA P;  4I1L A;  3L74 J;  3HD7 D;  2C9L Y;  1KTM A;  1BSH A;  1GL2 B;  2XV5 A;  3GW6 A;  2FYU J;  1SQB K;  1LWU B;  3BCC E;  1Q82 Q;  3MP7 B;  1NAY A;  3L75 D;  2IYO A;  5KTB A;  4ASV A;  1X22 A;  1GMJ A;  2N1T B;  3E1R A;  1LTI C;  1Q90 D;  1BCC J;  3LID A;  3USS A;  2ZYD A;  5E79 E;  3CWB G;  3TK1 A;  4PV1 D;  5AW8 B;  1PGJ A;  2BCC E;  3L74 D;  4TT3 H;  2YXR B;  4W80 A;  2KK7 A;  3L74 E;  2FYU D;  5KAI E;  3CX5 E;  4H0L D;  3CCV P;  1PP9 E;  1DD3 A;  3GMA A;  4AUW A;  5APS A;  1AQT A;  1FDO A;  2W90 A;  1YIJ P;  3RL0 B;  3GHG B;  3PJS K;  2YKP A;  1EQ7 A;  1BCC D;  3NFQ A;  3H1H E;  1KIL E;  2A06 G;  1FZF A;  4GDO A;  1K9M Q;  3E7K A;  1NTK E;  4I6M C;  1LTJ B;  3AE8 C;  2P2U A;  5APT A;  1FZG A;  2XKM A;  3V4W A;  2WWW A;  1NKN A;  5APQ A;  5AVW B;  1J1E C;  1K73 Q;  2IZ0 A;  1YI2 P;  3EQ2 A;  3H1K J;  2WPR A;  2HLO A;  4UB6 H;  3MUD A;  3KZI H;  4O9B A;  2WSE J;  2POH A;  4IL6 H;  4LC1 A;  1JY3 N;  1NTM G;  5KLV G;  1D7M A;  2WPS A;  2DW3 A;  1DD4 A;  4RJT A;  3RK2 C;  1YJN P;  4M3L A;  3L73 J;  2B9B A;  2C0W A;  2FXP A;  1VQN P;  1L0N J;  1LT9 B;  3HTK A;  4GKG A;  1FDM A;  2L91 A;  1NO4 A;  2O3J A;  5B66 H;  2FYN B;  3H1K D;  2Q1K A;  1AQ5 A;  3AE1 C;  4HJG H;  3MZW B;  4QMA A;  1GD2 E;  1S3J A;  3H1K E;  2H8P D;  4PJ0 E;  2W6B A;  3MD0 A;  3HUS B;  3B5N A;  4H13 C;  3W67 A;  2OYH A;  3PTZ A;  2YKO A;  4PD4 D;  3L73 D;  1L0N D;  5TIS H;  4ZKP A;  2H43 A;  1FBM A;  4GIF A;  1N73 C;  5KAF H;  1LTT C;  2XZR A;  1L2P A;  2MKV A;  1SQQ K;  3A3Y B;  1L0N E;  5B5E H;  3KHU A;  3L75 G;  2P58 A;  4H44 C;  3IR9 A;  3H1J E;  2R3S A;  1SQX J;  2AXT E;  2CK3 H;  1LP1 B;  1VQM P;  1EXI A;  1JO5 A;  2OYI A;  2M5A A;  2ZYA A;  2R44 A;  1PPJ D;  3IAO A;  1SFC D;  4ZNC A;  1CZQ A;  1GTW A;  2RMZ A;  3TF5 A;  3VYI A;  1NTZ K;  1HWT C;  4L73 A;  2KS1 A;  5CCG A;  2M3E A;  1J2J B;  4BRY A;  3T97 B;  2HPC B;  1VDF A;  3M0D A;  1Q7Y Q;  1J1D C;  3IFM A;  1FE6 A;  3HD7 C;  1S2E A;  4IFD K;  2JR8 A;  3CXH D;  3SFE C;  1NAF A;  2K9Y A;  3TDK A;  5AVU B;  2PRR A;  2Z5I A;  1BCC G;  1SQX D;  4JQ0 D;  4WY4 A;  1EC5 A;  2Q5U A;  2WSF H;  3M9B A;  1FZB A;  2FBW C;  1J1E B;  1RF1 C;  1ZN5 A;  1WMK A;  3Q5R A;  2G3A A;  4PV1 C;  4RKU J;  1M56 D;  1T3U A;  2J58 A;  3PLN A;  2IFN A;  3O6Q B;  2N9Y B;  4HYT B;  4W7Z A;  1L4A A;  4YPC A;  1ZRT E;  1EZV E;  3EFG A;  3H1L G;  3MIW A;  2D2C D;  5AVX B;  2FKW B;  2IZ1 A;  2L5G B;  3CCE P;  3AE2 C;  4H0L C;  5AVZ B;  2H7H A;  3N7N A;  3RK2 B;  2UWJ E;  3B71 A;  3G71 P;  1JTH B;  3P8C E;  4NPF X;  1KFN A;  3L70 G;  1KB9 D;  2WMM A;  1RE4 A;  2Q7C A;  4DJG A;  3H32 A;  4ZMD A;  3RK3 E;  3RBX A;  2AEM A;  2A45 G;  5KJ7 A;  1EDJ A;  3MGN A;  3GF7 A;  5AVV B;  4H13 B;  5BU5 A;  3R2P A;  3HE4 A;  5APW A;  1VQ5 P;  4JBZ A;  1SQQ J;  3U1A A;  3KZI E;  1NOH A;  1ZXG A;  3L73 G;  1S9K E;  1QVG O;  2LXB A;  3TGU G;  3K5B A;  1N73 B;  4RES B;  4IL6 E;  1OVR A;  2IYP A;  5GTH H;  3A2A A;  3M9Q A;  2ZT9 D;  2IDB A;  3CX5 I;  4H44 B;  3G6E P;  4D6T J;  3BRV B;  1NTK K;  2OTK E;  5CCG D;  3C9I A;  2PAJ A;  1NTZ J;  2YIU C;  2BEQ D;  3V6I A;  1SQB G;  5B66 E;  4YXD C;  2K9J B;  1SQQ D;  1PPJ G;  3C1L A;  3CWB E;  3M91 A;  3H1I G;  1VQ7 P;  3HE5 B;  2HYN A;  1HJ0 A;  1W2B O;  4WY4 D;  3TNU B;  1XTG B;  1J1D B;  3VMA A;  2WT7 A;  1H0T A;  3HD7 B;  1IJD B;  1SLQ A;  1SQV J;  3VP9 A;  1JY2 N;  1SQP J;  2NRG A;  2J59 M;  4BWN A;  1NTZ D;  4D6T E;  5KAF E;  3I5C A;  5APY A;  4WWI A;  1KQL A;  1ZV8 A;  1USD A;  5B5E E;  3AE7 C;  1RF1 B;  4OH8 B;  1T2K D;  2E5T A;  4PV1 B;  4CPG A;  3Q1M A;  4C7N A;  1JEK A;  1ZME C;  1EDK A;  1VQL P;  2RKL A;  1SFC C;  1SQV D;  1X9V A;  1VL2 A;  1JY2 P;  2Q3E A;  3BCC J;  5CHX A;  1GW4 A;  1FJK A;  1LTA C;  4H0L B;  1SQP D;  1T3J A;  2JP3 A;  5AW9 B;  1GL2 A;  3RBZ A;  4EOT A;  1IFP A;  1JCC A;  2E42 A;  5AW2 B;  1BE3 J;  1IFM A;  1T8Z A;  2QVA A;  1NTM E;  1VF5 B;  3AE3 C;  5KJ7 D;  2QJY C;  5AVT B;  5CMZ A;  1L0N K;  3WU2 H;  3JC2 2;  3Q2Y A;  2SPZ A;  2AEJ A;  2BCC J;  1HGZ A;  1IK9 A;  3L72 E;  5CCH A;  4AQR D;  3BAS A;  4OVN F;  1URQ D;  3SSU A;  1IC2 A;  1P84 I;  3BCC D;  2CPS A;  1PP9 J;  1BGY E;  4KT0 J;  2B88 A;  1MZ9 A;  1Y8A A;  2E74 D;  1JMB A;  4NPE A;  2W8Z A;  1NU1 E;  2YO2 A;  1BE3 D;  3H1H J;  4OWF A;  2BAS A;  2K3R A;  2XNX A;  1EXJ A;  1NKZ B;  1NTK J;  1H88 A;  5AW7 B;  2BCC D;  3N4X A;  1BE3 E;  3FWL A;  3A0B E;  3CXH H;  3RGU A;  3GHG A;  3L71 G;  3CD6 P;  2C0X A;  1OIP A;  5AW1 B;  1HVV A;  3V4Q A;  4DT0 A;  3CX5 D;  3LIE A;  1PP9 D;  2K88 A;  1SQX K;  2OTJ P;  3A0H H;  4GT1 A;  3M9H A;  4GOE A;  1SQQ G;  1G1I A;  2Q3I A;  3H1H D;  1KIL D;  3E1I A;  1NTK D;  1KMI Z;  1K04 A;  1Y47 A;  1OFC X;  1DIP A;  1YQ4 C;  1L0L J;  2ZVO B;  2IBZ I;  1EZV I;  2E75 C;  3CC2 P;  2ZT9 C;  2OYI C;  1NTZ G;  5GTH E;  1R5S A;  1LT9 A;  3AE6 C;  3CCM P;  2QE7 H;  5CCG C;  5KLI B;  5AVS B;  3JCU H;  3M0D C;  2K37 A;  1SFC B;  3CC7 P;  2XND H;  1KC8 Q;  4N78 D;  3NXS A;  3CME P;  1G2C B;  1N2D C;  1FZC C;  3ABV C;  2FFD C;  1L0L E;  5CCH D;  4N78 E;  4Y99 C;  3CPW O;  4K3A A;  3H1L E;  1IFD A;  3SFD C;  4R4M A;  2ITA A;  3H1J J;  2HR3 A;  3I56 P;  2QJY B;  1MKM A;  1NGM B;  3F89 A;  4MN4 C;  2KOG A;  1RE3 A;  1JY3 O;  2KLV A;  5CBO A;  2O01 H;  2O1K A;  2ZJS E;  2ZVN B;  3CCU P;  3L70 E;  4EDF A;  2P10 A;  1HUC A;  3BCC G;  1T2K C;  1H8A A;  2WSC J;  1P84 D;  3OW2 O;  1LGH B;  1FAV A;  3OAK A;  1BDC A;  2WVR A;  1FU1 A;  1MFT A;  2GUS A;  1P84 E;  1N7S A;  3H1J D;  4UB8 H;  3T97 A;  2HPC A;  1MFZ A;  1N7L A;  2VRS A;  3HTK B;  4EYY Q;  3D71 A;  5H2F E;  1S1C X;  4C7R A;  3WMM 0;  1R8E A;  1RE4 C;  4XA4 A;  3TGU E;  2I1K A;  2YXQ B;  2KLU A;  2Z5H A;  3GF3 A;  2I8D A;  3L74 G;  5KJ7 C;  5GTI E;  1SP4 A;  3WU2 E;  1GU5 A;  2AXC A;  1NWQ A;  1X79 B;  1PP9 G;  2FYU G;  1ZR4 A;  1M90 Q;  4Z1M H;  4WBA A;  3EWK A;  1URQ C;  5AVR B;  3TYY A;  1PZQ A;  2K1A A;  3H1H G;  1Q81 Q;  1HBW A;  3S4R A;  5DJU B;  1OXZ A;  1NTK G;  3B4S A; 
#chains in the Genus database with same CATH homology
 3HUS A;  3BRV B;  4I2L C;  1HGV A;  1NTK K;  2M3B A;  4AYC A;  1SQV K;  2WSC H;  4WY4 C;  3UIA A;  3HUS C;  4I1L A;  5CCG D;  3C9I A;  4C46 A;  2PAJ A;  3HD7 D;  1ZLL A;  2C9L Y;  2YMY A;  2N1T D;  2YNY A;  2WTY A;  1SQP K;  1GL2 B;  2XV5 A;  1SQB K;  1LWU B;  2R3C A;  1SVF A;  3M91 A;  1KFM A;  2KP8 A;  2W6A A;  3HE5 B;  2HYN A;  3VOP A;  2ZXE B;  1YYC A;  4WY4 D;  3TNU B;  1XTG B;  1GK4 A;  5KTB A;  1J1D B;  2WT7 A;  3HD7 B;  1IJD B;  1SLQ A;  2N1T B;  1LTI C;  1MV8 A;  1L4A C;  1M1J C;  3LID A;  2KYV A;  3VP9 A;  2MJZ A;  1DX7 A;  3TK1 A;  1JY3 P;  5AW8 B;  1JY2 N;  3P8C D;  3L36 A;  2J59 M;  1KIL C;  3RL0 D;  3KYQ A;  1FZC B;  3I5C A;  4W80 A;  5APY A;  1KQL A;  2FFD B;  1ZV8 A;  1NU1 K;  4Y99 B;  3VMY A;  5AW0 B;  3V2N A;  1RF1 B;  2XU6 A;  3RK3 D;  4OH8 B;  3OA7 A;  3B5N D;  3BVH A;  4AUW A;  1T2K D;  5APS A;  2NPS A;  4C7N A;  2LKM A;  5AVY B;  2NPS C;  2HOD A;  3P7K A;  3RL0 B;  1JNM A;  1FJP A;  3GHG B;  2YKP A;  1EQ7 A;  3VMX A;  1H89 A;  1DH3 A;  1SFC C;  3NFQ A;  4LGD E;  1X9V A;  5AW3 B;  1JY2 P;  1PFI A;  1FZF A;  5CHX A;  1S9K D;  1GW4 A;  1FJK A;  1LTA C;  1N7S D;  3RK3 B;  1T3J A;  4I6M C;  3NTN A;  3B5N B;  5AW9 B;  1LTJ B;  2XDJ A;  2OYH B;  1GL2 A;  2P2U A;  5APT A;  4EOT A;  1FZG A;  2XKM A;  3V4W A;  2WWW A;  1NKN A;  5APQ A;  1JCC A;  3KPE A;  5AVW B;  2E42 A;  1J1E C;  1RY3 A;  5AW2 B;  1IFM A;  1T8Z A;  3HE5 A;  3EQ2 A;  5KJ7 D;  5AVT B;  2YKQ A;  5CMZ A;  1L0N K;  5APU A;  3BAT A;  2WPR A;  3A7O A;  3G3Z A;  2HLO A;  3L4F A;  3MUD A;  1HGZ A;  1IK9 A;  2I1J A;  1N7S B;  5CCH A;  5BU8 B;  5AW4 B;  3HD7 A;  4O9B A;  4DOJ A;  4KHX A;  2POH A;  4AQR D;  2W27 A;  3BAS A;  5CCH C;  1JOC A;  1W2E A;  3NMD A;  1URQ D;  3HRN A;  4LC1 A;  1JY3 N;  1IC2 A;  3VN0 A;  2CPS A;  2WPS A;  2R5D A;  2OYI B;  1FZC A;  1N86 A;  4ZKU A;  3RK2 C;  1NTM K;  4M3L A;  5KLV K;  2FFD A;  1MZ9 A;  1JTH A;  2WPQ A;  2C0W A;  1CW5 A;  1IO4 A;  1JCD A;  3M0A A;  1FZA A;  1LT9 B;  1RF1 A;  3HTK A;  4GKG A;  2YO2 A;  1FDM A;  3HE4 B;  4JYC A;  3P32 A;  1NO4 A;  1URQ B;  2Q9I A;  3V2P A;  2BAS A;  2XNX A;  1AQ5 A;  1AFO A;  1FOS F;  1NKZ B;  4XE5 B;  2JJL A;  1H88 A;  5AW7 B;  5CJ4 A;  3N4X A;  5AW6 B;  2P7J A;  3GHG A;  1HH0 A;  4WB4 A;  2N9B A;  1GD2 E;  2H8P D;  1LTS C;  2C0X A;  2W6B A;  5AW1 B;  1HVV A;  3V4Q A;  1VPC A;  4LLH A;  4WY4 B;  1A02 F;  1E5W A;  3HUS B;  3MD0 A;  3LIE A;  3B5N A;  1CI6 A;  1L0L K;  2P1J A;  1SQX K;  2OYH A;  2Z4E A;  1L4A D;  3H6P A;  2YKO A;  3V2R A;  3MTU E;  3L35 A;  1N73 A;  4GT1 A;  5BVZ A;  3M9H A;  3VMZ A;  4ZKP A;  3U1C A;  2H43 A;  1FBM A;  1MUU A;  1G1I A;  2Q3I A;  4GIF A;  1N73 C;  3SWY A;  2WSE H;  1LTT C;  2A45 H;  2XZR A;  1KIL D;  1Z56 A;  2OAR A;  2P67 A;  1HJB A;  1SQQ K;  3A3Y B;  3E1I A;  2IX7 C;  4EIJ A;  1L4A B;  1M1J B;  1GU4 A;  1QL1 A;  3IR9 A;  5CJ0 A;  3VTP C;  1JMM A;  1KZU B;  1JO5 A;  4N3Y B;  2FYZ A;  2OYI A;  2NPS D;  4IFM A;  1KIL B;  1LWU A;  3LW5 H;  2C9N Y;  1GL2 C;  3PP5 A;  1SFC D;  2OYI C;  1CZQ A;  1DEB A;  1GTW A;  1LWU C;  3KDP B;  3O8Z A;  1LT9 A;  3VYI A;  3TNU A;  1G1J A;  3P8M C;  2WIT A;  1NTZ K;  1HWT C;  1URQ A;  2JEE A;  2R32 A;  5CCG A;  2KB7 P;  1HTL C;  1J2J B;  2HPC B;  3L37 A;  2N1T A;  1VDF A;  3V5B A;  3M0D A;  5CCG C;  2FYU K;  1J1D C;  5APV A;  3IFM A;  2A45 I;  3HD7 C;  5AVS B;  2N1T C;  2NPS B;  4IFD K;  3M0D C;  5AW5 B;  2ZFC A;  3H32 B;  1NAF A;  1SFC B;  2GUV A;  2HOD B;  2R5B A;  5AVU B;  1GDT A;  2Z5I A;  1XTC C;  4HH2 A;  4WY4 A;  4N78 D;  4IFF A;  2Q5U A;  3NXS A;  1G2C B;  2KSJ A;  1N2D C;  1FZC C;  2WSF H;  3M9B A;  1WT6 A;  3CLQ A;  2FFD C;  5AVQ B;  3VP8 A;  1GK6 A;  1IFN A;  5CCH D;  1YTZ T;  4N78 E;  3CI9 A;  4Y99 C;  1FZB A;  2O1J A;  1NHL A;  1IFD A;  1J1E B;  1RF1 C;  1ZN5 A;  2IFM A;  1T3U A;  3RK2 D;  1OWA A;  2QM8 A;  2J58 A;  3TSI A;  1LTB C;  2IFN A;  1YTZ I;  1FOS E;  3RL0 C;  4HYT B;  3GHG C;  4W7Z A;  1L4A A;  1M1J A;  3EFG A;  2KOG A;  1RE3 A;  1JY3 O;  3MIW A;  2KLV A;  2O01 H;  2O1K A;  1LTJ A;  3OJA B;  1M7L A;  5AVX B;  2FKW B;  2L5G B;  3RK3 C;  2QM7 A;  1RE3 C;  3A5T A;  5AVZ B;  2H7H A;  3B5N C;  1HUC A;  1LTJ C;  4JYB A;  1T2K C;  1KIL A;  1LTG C;  2OYH C;  1NH4 A;  1H8A A;  3N7N A;  2M8R A;  3BRT B;  3RK2 B;  2GM4 A;  2E43 A;  1LGH B;  3II6 A;  1FAV A;  3OAK A;  2HG5 D;  1GW3 A;  2WZ7 A;  5APX A;  1JTH B;  1FU1 A;  2GUS A;  1RF0 A;  3P8C E;  1N7S A;  2YO3 A;  3T97 A;  2HPC A;  1MFZ A;  1N7L A;  2VRS A;  3HTK B;  3M06 A;  1KFN A;  1RF0 C;  1N7S C;  3B8E B;  1RE4 A;  4W7Y A;  2WT7 B;  4C7R A;  2IPP A;  3WMM 0;  3SWF A;  2CPB A;  1WRG A;  2Q7C A;  1IFJ A;  3H32 A;  1RE4 C;  1SFC A;  4XA4 A;  2I1K A;  1JY2 O;  2A45 G;  5KJ7 A;  2Z5H A;  1JUN A;  3MGN A;  3CL3 D;  5KJ7 C;  1G2C A;  3U59 A;  1FZE A;  4B86 A;  5AVV B;  1SP4 A;  5BU5 A;  1ZR2 A;  1GU5 A;  1X8Y A;  1NWQ A;  1X79 B;  3R2P A;  1GZL A;  2FXM A;  3HE4 A;  5APW A;  1QL2 A;  1CI6 B;  1IFI A;  3U1A A;  1ZR4 A;  1NOH A;  1LT9 C;  1S9K E;  4N6J A;  4WBA A;  1URQ C;  4DZO A;  4JF7 A;  5AVR B;  1N73 B;  4RES B;  3TYY A;  1CSB A;  2PP6 A;  1GL2 D;  2HFE D;  3V2Q A;  4C7N B;  1HBW A;  3A2A A;  3M9Q A;  1A02 J;  3KQG A;  1OXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...