1NU1K

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
53
structure length
53
Chain Sequence
MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVWATDWRLILDWVPYINGKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 13
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nu1K00
2OARA 3G3ZA 2LKMA 1NTKK 1SQBK 5KLVK 1NTMK 1L0LK 1SQQK 2FYUK 2WSEH 1NU1K 1SQVK 1SQPK 3M9QA 1NTZK 2WSCH 3CLQA 4IFDK 2WSFH 1SQXK 2J59M 3LW5H 2O01H 1L0NK
chains in the Genus database with same CATH superfamily
4PJ0E 1EXIA 1JCCA 3MP7B 3H1KD 4I2LC 3VP8A 1E5WA 3CCRP 2HODA 3FXDA 1RE3A 2HYNA 1L2PA 5AVZB 3L70E 1ZRTD 3IN6A 2K9JB 4JF7A 3MTUE 3WUUA 1Y47A 1OW7A 1QVGO 1K8AQ 4D6TE 3I55P 3GMAA 1RE4C 2KB7P 3H6PA 3TK1A 2OYOA 5E79H 1NTMG 3KYQA 1IJDB 3V2RA 1L4AC 1NTMK 3H1LD 5KLIB 3L71D 2NZ2A 3EQ2A 3WUTA 1L0ND 1KILC 1L0LJ 1K73Q 4PV1C 1KQGB 1SLQA 2KK7A 1P84H 1DEBA 1KZUB 1RE3C 4GIFA 2WSEJ 1NAFA 2D2CB 4IFMA 5KLVG 4EI2A 1SP4A 2OYHA 1JY2N 1SQVE 3VMXA 3II6A 1VQ5P 1NKNA 1CSBA 1KTMA 1ZW0A 3L72J 3C8VA 1FZCB 4IFDK 1FE6A 2FBWC 3R4YA 2NRGA 1S2EA 1LTGC 1NO4A 2GUSA 1AFOA 4MN4C 1M1KQ 5BU5A 1LTJB 3GF7A 3UIAA 2BCCJ 1NJIQ 5L8RJ 3EFFK 2V4HA 1KFNA 4QMAA 3H1JE 1N86A 3C9IA 4LC1A 3Q5SA 1GU5A 4XFJA 3CCJP 1NTMD 2QJKB 2RH0A 3HRNA 1Q7YQ 3AEEC 2KNCA 2HPCB 1JEKA 4O9BA 2PAJA 3D70A 2GA1A 3H1KJ 2R5BA 4C46A 1NYHA 1RF0A 4Y99B 1FOSE 2OYHC 2YNYA 2QEXP 1PGPA 2DW3A 2JDIH 1H88A 3TF5A 4JYBA 5AW8B 1KORA 2R44A 3RL0B 2C0XA 1G1IA 3CL3D 2OARA 3B5ND 5KLVD 1SQXG 3V4WA 2CPBA 3CWBG 3M9QA 1X0TA 4H13B 1SQXK 2R3CA 5C39A 3NTNA 1FZEA 2W27A 1JNMA 5AW9B 2E75B 1PIXA 2IFNA 3H1LJ 4UB8E 3HUSB 2KS1A 2W6JH 3L71J 3L4FA 3TDKA 2OTLP 1L0NJ 1FZCA 4W80A 1KYOE 3BCCG 3VOPA 1VQ8P 2BEZF 1R8EA 2C0WA 1YTZT 3LIEA 4H44B 2QSIA 1LTJA 3CX5E 4OH8B 3B8EB 3AEAC 1M90Q 2AEFA 3A7OA 1YITP 1PGOA 5KLIC 2NPSA 1DD3A 1KMIZ 2KOGA 1R5SA 3SWYA 3GG2A 4ZKUA 1BGYG 1GD2E 3H32A 1GMJA 1EZVE 3G4SP 4U3FE 5AVRB 1M7LA 1SQQG 4Y28J 3MUDA 1KQSO 5AVWB 4JYCA 1TU3F 3P8MC 1JMMA 1SQQK 2O1KA 2E76B 3M91A 2Q1KA 1EDJA 1JY3P 3AE4C 3GHGB 2D2CC 2PP6A 2V7QH 2O01H 1P84D 4W7ZA 3E1IA 2FYUG 2W83C 2FYUK 1T6AA 1H89A 5APSA 1HH0A 1FZCC 3CWBD 1LJ2A 3GLMA 2H88C 1NGMB 1NTMJ 3RBXA 5M1BA 1LTJC 1RHZB 1Y8AA 1PP9G 3VMAA 2R32A 2NPSC 3NXSA 4I6MC 3N4XA 1FZGA 3BCCD 2I1JA 3HUSA 4KT0J 3PTZA 4GKGA 3MUDC 2QJKC 1ZR2A 4HH2A 1VPCA 1N73B 5CCGD 1G2CB 2N1TA 3AEFC 1BGYD 1GTWA 1DEEG 5KLVJ 1FDMA 2HR3A 1D7MA 3USSA 1VQ4P 4Y99C 5AVVB 1AV1A 1L0LE 3BVHA 1SQQD 2WSSH 1FAVA 4PD4E 5CJ0A 3O8ZA 2WPRA 4JBZA 4H0LD 3RL0C 3FXEA 5B66E 1VQ6P 4R4MA 3PJSK 3RK3B 1CI6B 1YJ9P 2P1JA 3AEBC 4C7RA 2IX7C 2FYUD 1VQOP 3CMEP 5APUA 3ABVC 1YYCA 3GHGA 1KV4A 1LNQA 1RY3A 5H2FE 4WB4A 4UB6E 3G71P 2GUVA 2H8PD 2Z5IA 3HUSC 4WBAA 2AEJA 3U59A 3JCUH 4JPZB 3P32A 3D6ZA 2Q9IA 1FZAA 2BCCE 1PP9D 3CC2P 4EDFA 2VRSA 1KFMA 2N1TC 4KHXA 2IBZE 2W8ZA 5KAIH 2XKMA 1M1JB 2ZT9B 2XV5A 1AVYA 2Z5HA 2Z4EA 1N7SD 2WZ7A 1LTIC 2AXTE 4TT3H 1YI2P 1A02J 2M8RA 3WU2E 1IFDA 3A0BE 3KZIH 3HTKB 1VQNP 3H1KE 3M0DA 1NU1G 1SQXJ 1KQFB 1VF5C 3CWBJ 1N73A 2E76C 4AYCA 1J1DC 2A06G 1NU1K 3T97B 1NOHA 1ZRTE 1X22A 2O1JA 3GHGC 3M0AA 3KXDA 3L74G 2WPSA 1S5LX 2ZYDA 3V2NA 4HKZH 2K3RA 4B86A 3JC22 3RK3E 5TISE 2LXCB 2Q6QA 3HD7A 1USDA 3BCCJ 2HLOA 5K5GB 1XTCC 5TJHA 5GTIH 2B9BA 1LTBC 3ITKA 1X8YA 4DOJA 5DJUB 2POHA 2P10A 3SSUA 1U7MA 2QRXA 2KLVA 2C9LY 3H1LE 3JSVC 2C9NY 3L71E 1BGYJ 4IL6E 5AW6B 1Z56A 3TGUG 1L0NE 2Q3IA 4GODA 1GL2B 2H7HA 1SQQJ 1SQBD 5KAFH 4KJMA 1ZMEC 3M0DC 3KQGA 4CPGA 3B5NB 1URQB 5KKZC 4AQRD 1N73C 1U7JA 2Y0DA 4DZOA 2ZYAA 2WSFJ 1L4AD 3W67A 1FU1A 1ZV8A 3Q1MA 2FYUJ 4I1LA 1DD4A 5B5EE 1S72P 3HE5B 4K3AA 2QM8A 2L5GB 1MV8A 1VQPP 1NU1D 3AE3C 5KJ7D 1S4XA 1M8OB 2HG5D 2XNXA 3HD7C 4PV1D 3RK3C 2A06D 3CCQP 3CX5I 1NTKG 3L74D 1K04A 1NTKK 2ZYGA 2QJPB 1PP9J 1E79H 2G3AA 2FXPA 3WMM0 1OZHA 3K5BA 2W6AA 2XU6A 4NPEA 1PPJG 3S9OA 1Q90D 1Y9BA 1SQPE 1OVVA 5KLVK 4XE5B 1LT9A 3MD0A 1SS1A 3VYIA 3FGAD 3EWKA 3M9BA 3TGUD 3H1JG 1QGKB 3CCSP 5CCHD 4RESB 2ZT9C 4I7ZB 3Q2YA 1N2DC 1FC2C 2XZRA 5GTHE 1GL2A 1NVOA 4U7JA 2E74D 5AVSB 4WWIA 5AVXB 1PL5A 2K9JA 1HJBA 2ZXXA 2YKPA 3A2AA 2V7QJ 4L73A 2O01J 4GOFA 1URQA 3L73E 1RQVA 3SWKA 2WTYA 3VN0A 2YIUC 2KIKA 1NTKD 1JY2O 1MZ9A 3SWFA 3D71A 1MFZA 3RL0g 2WT7B 5AVYB 2E5TA 1LT9C 4DCKA 2WSFH 3M06A 3MIWA 1SFCB 1JY3N 2JKVA 4PD4I 2JR8A 1IC2A 1PPJD 2GM4A 1NTZG 2YMYA 5E79E 3H1IG 2QJYB 1HJ0A 1NTZK 1GL2C 2OTKE 1LTAC 1BE3E 3NFQA 5AW0B 3H1JD 4H0LB 1NU1J 1K05A 1YQ3C 1IFMA 2P67A 2ZJSE 1URQC 2IDBA 3L74J 4R4LA 2B87B 1P84E 3LW5H 3TSIA 3AEGC 1KQLA 2HFED 1NKZB 2ITAA 2LKMA 3CXHE 1DX7A 2YO3A 3G9RA 4BRYB 1X9VA 1OMIA 1VDFA 3H1HG 1LP1B 1SQXE 3VTPC 2MJZA 2JWDA 2IBZI 2IPPA 3CWBE 3KPEA 1JY3O 1Q2NA 1PGQA 1GZLA 2QG4A 4L75A 2YMKA 2YKQA 3VMYA 4BXLA 1XTGB 3AE5C 2FY8A 1EDIA 2I1KA 2QJPC 4RO0A 2A45I 1J1EB 2HPCA 3AE2C 3TGUJ 1JO5A 2KSEA 1HWTC 5APTA 4EIJA 1N7SB 5CHXA 4ZKPA 3AEDC 4IOIH 3QH9A 2H89C 3KDPB 1NTZD 2P58A 1JCDA 3S4RA 3H1ID 1ZOYC 1SFCA 2IZ1A 1EXJA 3A0HH 1BGYE 2SPZA 4WY4B 4I7ZC 1SQQE 4NPFX 2A45H 2NPSD 3CX5D 1BDCA 1M56D 3RGUA 3FWLA 3L35A 2LR2A 5AW1B 3HE4B 3CC7P 1AJYA 1YIJP 3AE1C 2XDJA 2O01N 1NTKJ 2ZVOB 5AW5B 4M3LA 1UIIA 3RBZA 4TLFA 1MUUA 1QEXA 2FXMA 2ZVNB 1YBKA 3C1LA 2FYUE 2BASA 4GT1A 1S9KD 2WPVB 1OVRA 1S3JA 1S5LH 3AE8C 2B87A 3H1HD 1GU4A 4LGDE 3S1KA 1BSHA 1AQ5A 3H25A 1JTHB 1CZQA 1HGZA 1LP1A 3RL0D 5DJTB 1PP9E 1KB9E 1PV3A 3H1JJ 3V2PA 4PJ0H 1SFCC 2YXRB 1T2KC 2J59M 1N7LA 1WMKA 1NWQA 4N6JA 3P8CE 3Q5RA 4OWFA 1L4AB 2QJYC 2M3BA 1QL1A 4OGQD 1IK9A 2K88A 5APWA 1IK7A 4H13C 3L72E 3B71A 1T3UA 4H0LC 4N3YB 1BCCG 2E75C 3E7KA 2PGDA 3L75G 2J5UA 1VQLP 2N1TD 3CMAP 2A45G 3RK2D 2HODB 1CW5A 4WY4A 1NHLA 2Y0CA 3G6EP 2R5DA 1Q82Q 2UWJE 4H44C 3BASA 1SQBG 1HGVA 1FOSF 3HE4A 1SQBK 1PZQA 4PD4D 2OQQA 2WSCH 1KN7A 5APVA 1VQMP 3CD6P 1VF5D 3R2PA 1JMBA 1NTZJ 4BWNA 3H1IJ 4N78D 1OWAA 1G2CA 1NH4A 1OIPA 3F89A 5BU8B 3V6IA 2IYPA 4EYYQ 5AW3B 2Q3EA 1OFCX 2Q7CA 3MGNA 2KUBA 2E74B 2KXPB 2IYOA 2Y9ZA 1W5CE 3NMDA 1AVOA 3SFDC 2WMMA 1CI6A 1IFPA 3L70G 2E42A 4WY4C 1K9MQ 1ZN5A 4HYTB 1RQUA 3IF4A 3O6QB 2N9YB 1BCCD 1X79B 1NU1E 1USEA 3H1HJ 1H0TB 4NPDA 3CI9A 2BEQD 3L75D 4D6TG 4YXWH 1FZFA 2A06E 2B88A 2KI7B 1HVVA 5KJ7A 1FJPA 4IL6X 3L74E 5AVQB 1HBWA 1U57A 1HTLC 2QE7H 3TNUB 3G3ZA 3B4SA 2FFDB 2K9YA 1IZNB 2FXOA 1UIXA 4XA4A 3L36A 2CPSA 1M1JA 5BVZA 3V4QA 4GDOA 3N7NA 3HD7D 3ZDMA 4K35A 3RK3D 1KYOI 1RH5B 1P84I 1KILD 1QLED 3TGUE 3JCUE 2KNCB 3CXHI 3HTKA 2O3JA 2FKWB 4YPCA 5CBOA 3CPWO 1SQVG 1SQPG 5CCHA 5KAIE 3T97A 2KLUA 2RKLA 1SQVK 4W7YA 1SQPK 2FYNB 3PH0A 1EZVI 2OTJP 2ZFCA 5KJ7C 3L70D 1QX8A 4UB8H 3IAOA 1LT1A 3LW5J 2CK3H 2P2UA 1NTME 2JWAA 1PFIA 1KYOH 3KZIE 3Q5PA 1AQTA 1YHQP 4D6TD 1EC5A 3CXHH 2ZT9D 1T8ZA 3CX5H 1NTKE 3O6QA 1QL2A 2FYZA 1M1JC 1H0TA 1KC8Q 2E43A 3EFGA 2J58A 3F5HA 2JJLA 3L73G 2KS1B 2R3SA 3I5CA 2QIWA 3AE7C 5CBNA 2ZXEB 1MKMA 5APYA 1Q81Q 2P7JA 3TNUA 2FFDA 3OW2O 5KLVE 5GTIE 1PPJE 5APXA 3B5NA 3IFMA 5CCHC 1W2BO 2WWWA 1GK4A 1MFTA 2JO1A 1FJKA 2NPSB 1GK6A 2G8YA 1BCCJ 3H32B 2E74C 3HE5A 2ZAEB 3CCEP 3L75J 3GW6A 3CCMP 1SQVD 1SQPD 5KAFE 3P7KA 1OVUA 4WVZA 2WVRA 2N9BA 1BE3G 1PGJA 4YTPC 1SQBJ 2OYIB 2M0BA 1QVFO 2IZ0A 2M5AB 2AXCA 1N8RQ 1GW3A 3PHLA 4AUWA 5AW2B 1KB9I 1GW4A 2WPQA 4ASWA 1GL2D 2OGUA 2Y0EA 2QM7A 3Q3DA 1R5LA 1OX3A 5AW7B 3AECC 5KTBA 1URQD 2FFDC 1FDIA 1JY2P 2W6BA 1LTTC 1IFIA 1JB0J 1IFJA 3B5NC 3L73D 3IR9A 5AVUB 2PRRA 4OGQB 4RKUJ 2AEMA 3W68A 4PD4H 1EZVG 2B89A 4U3FG 1EQ7A 3GF3A 1KB9H 5B66H 1NTZE 2H43A 1WT6A 3I56P 3H1IE 2WSEH 4HJGH 3L70J 1ZLLA 1EDLA 2N1TB 2WQYC 3BRVB 2QA4P 2MKVA 1SVFA 3OA7A 1VQ9P 3RK2B 1RF0C 3KHUA 1FDOA 4JQ0D 1HUCA 4D6TJ 1OXZA 5H2FH 1YTZI 1FBMA 2D2CD 4UB6H 2FYNC 3BCCE 3MZWB 1BE3D 3D6YA 2XNDH 4IFFA 4ASVA 2YO2A 4ZMDA 3FWNA 1S9KE 2K37A 2WT7A 3H1HE 1VF5B 2LXBA 3L37A 1J1DB 3CLQA 2OYIA 1HF9A 1KYOD 2M5AA 1VQ7P 4C7NB 2JP3A 2WSCJ 1BSNA 2M3EA 5CCGA 1LWUB 2RN0A 3BATA 3AE9C 4LLHA 1S1CX 2AXTH 3A3YB 3CXHD 4A7PA 4DJGA 1RF1B 5EFWB 3WU2H 3CC4P 3BRTB 1SQXD 3A0BH 1OW6A 1J2JB 1SQVJ 1L0LG 1SQPJ 1YQ4C 1EZVD 1ZP0C 2K1AA 4U3FD 1L0LK 3FX0A 2RMZA 2KYVA 1NAYA 2JEEA 3PP5A 1H8AA 3VMZA 3CCUP 3U1AA 5TISH 1EDKA 4BRYA 2YKOA 4ZNCA 2YXQB 1SFCD 1T2KD 1JUNA 5KKZB 3PRJA 1G1JA 3L72G 3SFEC 2OYIC 1BDDA 1LTSC 4GOEA 5CCGC 2IFMA 3L73J 4IL6H 3VP9A 4H13D 2QVAA 1IO4A 1AA0A 1GDTA 1YJNP 2BCCG 3HD7B 4HB1A 1N7SA 2E75D 2IBZG 1KILB 4YXDC 4PV1B 1JOCA 4N78E 2PFXA 1ZR4A 1T3JA 1JM0A 3V5BA 4C7NA 4H44D 3M9HA 3OJAB 4OGQC 1LWUA 1W2EA 3E1RA 1FZBA 5B5EH 2L91A 2KP8A 1FS0E 3LIDA 3H1KG 1RF1A 1L0LD 4EOTA 1YJWP 2KZIA 1BE3J 1KB9D 3QWOC 4L74A 4DT0A 3CCVP 1KD1Q 3WUVA 3RK2C 1BCCE 3A0HE 3AE6C 1Q86Q 2E76D 3P8CD 3L75E 5AW4B 1J1EC 1WRGA 5CJ4A 3CCLP 3OAKA 1VQKP 1N7SC 1JTHA 1OW8A 3L72D 2Q5UA 1SQBE 5CMZA 4RJTA 4OVNF 2WITA 3PLNA 1DH3A 3H1LG 3MHVA 4WY4D 3U1CA 1DIPA 3L71G 4Z1MH 1VL2A 3TYYA 1RE4A 1L0NG 2BCCD 1S5LE 1M57D 1LWUC 4U3FJ 2YIUB 1L0NK 2IBZD 1A02F 5GTHH 2I8DA 1L4AA 2KZJA 1RF1C 2OYHB 5APQA 4L76A 1LGHB 1ZXGA 2KSJA 2Y9YA 1KILE 5AVTB 1LT9B 1KILA 3V2QA 2E5YA 3A5TA 1IFNA 2W90A
chains in the Genus database with same CATH topology
3VMYA 1XTGB 4C7RA 1JCCA 2I1KA 2IX7C 2A45I 4I2LC 5APXA 3B5NA 3IFMA 3VP8A 5CCHC 1E5WA 1J1EB 2HPCA 5APUA 2WWWA 1GK4A 2HODA 1JO5A 1RE3A 1YYCA 1FJKA 3GHGA 1HWTC 2NPSB 2HYNA 5APTA 5AVZB 4EIJA 1RY3A 4WB4A 1GK6A 1N7SB 3H32B 3HE5A 5CHXA 2GUVA 4ZKPA 2H8PD 4JF7A 2Z5IA 3HUSC 4WBAA 3MTUE 3U59A 3KDPB 3P32A 3P7KA 2Q9IA 1JCDA 1FZAA 1SFCA 2N9BA 2VRSA 1RE4C 2KB7P 1KFMA 3H6PA 2N1TC 3TK1A 4KHXA 2OYIB 4WY4B 1GW3A 4AUWA 3KYQA 2XKMA 1M1JB 5AW2B 1IJDB 3V2RA 2A45H 2NPSD 1GW4A 2WPQA 1L4AC 1GL2D 2XV5A 2Z5HA 1NTMK 2Z4EA 1N7SD 3L35A 2WZ7A 5AW1B 3HE4B 1LTIC 2QM7A 2XDJA 1A02J 2M8RA 3EQ2A 4M3LA 5AW5B 1MUUA 1IFDA 1KILC 5AW7B 3HTKB 5KTBA 1URQD 2FXMA 1JY2P 2FFDC 2W6BA 1LTTC 3M0DA 2BASA 1IFIA 4GT1A 1S9KD 1IFJA 1SLQA 3B5NC 1N73A 3IR9A 4AYCA 1J1DC 1DEBA 1NU1K 5AVUB 1NOHA 1KZUB 1RE3C 1GU4A 2O1JA 3GHGC 4GIFA 3M0AA 4LGDE 1NAFA 1AQ5A 2WPSA 4IFMA 3V2NA 1JTHB 1SP4A 2OYHA 1EQ7A 1CZQA 1HGZA 1JY2N 4B86A 3RL0D 3VMXA 3II6A 2H43A 1WT6A 1NKNA 1CSBA 3HD7A 2WSEH 1ZLLA 2HLOA 3V2PA 1SFCC 1XTCC 1FZCB 4IFDK 1T2KC 2J59M 1LTBC 2N1TB 3BRVB 1N7LA 1X8YA 4DOJA 1SVFA 1NWQA 3OA7A 4N6JA 3RK2B 1LTGC 3P8CE 1NO4A 1RF0C 2POHA 2GUSA 1AFOA 2KLVA 5BU5A 1LTJB 2C9LY 1HUCA 1L4AB 1OXZA 2M3BA 3UIAA 1QL1A 1IK9A 1FBMA 1YTZI 5APWA 2C9NY 5AW6B 1Z56A 2Q3IA 1GL2B 1KFNA 1N86A 2H7HA 1T3UA 3C9IA 4IFFA 4N3YB 2YO2A 4LC1A 1GU5A 1S9KE 2WT7A 3M0DC 3KQGA 3B5NB 1URQB 2N1TD 3L37A 4AQRD 3HRNA 1N73C 2A45G 1J1DB 2HPCB 3RK2D 2HODB 1CW5A 3CLQA 4O9BA 4WY4A 2OYIA 1NHLA 4C7NB 2PAJA 4DZOA 1L4AD 2R5DA 1LWUB 5CCGA 1FU1A 1ZV8A 3BASA 4I1LA 2R5BA 4C46A 1RF0A 4Y99B 3BATA 1FOSE 2OYHC 3HE5B 4LLHA 3A3YB 2QM8A 1HGVA 2L5GB 1MV8A 2YNYA 1FOSF 3HE4A 1RF1B 1SQBK 5KJ7D 3BRTB 1H88A 2HG5D 2XNXA 3HD7C 4JYBA 5AW8B 3RK3C 2WSCH 1J2JB 5APVA 3RL0B 2C0XA 1G1IA 3CL3D 2OARA 3B5ND 3R2PA 1NTKK 4N78D 1OWAA 1L0LK 3V4WA 2CPBA 2KYVA 1G2CA 3M9QA 1NH4A 5BU8B 2JEEA 3PP5A 3WMM0 1SQXK 1H8AA 2R3CA 5AW3B 3VMZA 3NTNA 2W6AA 1FZEA 3U1AA 2XU6A 2Q7CA 2W27A 1JNMA 3MGNA 5AW9B 2IFNA 2YKOA 3HUSB 1SFCD 5KLVK 3L4FA 4XE5B 1LT9A 3NMDA 1T2KD 3MD0A 1JUNA 1FZCA 4W80A 3VYIA 1G1JA 1CI6A 2E42A 3VOPA 3M9BA 2OYIC 4WY4C 1ZN5A 4HYTB 1LTSC 2C0WA 5CCGC 1YTZT 2IFMA 3LIEA 5CCHD 1LTJA 4RESB 1X79B 4OH8B 3B8EB 3VP9A 1N2DC 3CI9A 3A7OA 2XZRA 1IO4A 2NPSA 1FZFA 2KOGA 1GDTA 1GL2A 3SWYA 4ZKUA 3HD7B 5KJ7A 1HVVA 5AVSB 1GD2E 1N7SA 1FJPA 5AVXB 3H32A 1HJBA 5AVQB 1HBWA 1HTLC 1KILB 2YKPA 3TNUB 3A2AA 3G3ZA 5AVRB 2FFDB 1M7LA 1JOCA 3MUDA 4N78E 5AVWB 1URQA 4JYCA 1ZR4A 3P8MC 1T3JA 1JMMA 4XA4A 1SQQK 3L36A 3V5BA 2O1KA 3M91A 4C7NA 3M9HA 3OJAB 1JY3P 1LWUA 1W2EA 2WTYA 1FZBA 3GHGB 3VN0A 2PP6A 2CPSA 2O01H 1M1JA 1JY2O 2KP8A 5BVZA 1MZ9A 3E1IA 4W7ZA 3SWFA 3LIDA 1RF1A 1MFZA 3V4QA 3N7NA 3HD7D 4EOTA 3RK3D 2WT7B 5AVYB 2FYUK 1LT9C 1H89A 1KILD 1HH0A 5APSA 1FZCC 2WSFH 3M06A 3MIWA 3HTKA 1SFCB 1JY3N 3RK2C 2FKWB 1IC2A 3P8CD 1LTJC 2GM4A 5CCHA 5AW4B 1J1EC 1WRGA 2YMYA 3T97A 5CJ4A 4W7YA 1SQVK 2R32A 1SQPK 2NPSC 1NTZK 3OAKA 1GL2C 3NXSA 4I6MC 3N4XA 1LTAC 2ZFCA 5KJ7C 1FZGA 3NFQA 1N7SC 5AW0B 1JTHA 2I1JA 2Q5UA 5CMZA 3HUSA 2P2UA 1IFMA 2WITA 1PFIA 4GKGA 2P67A 1DH3A 1URQC 4WY4D 3U1CA 1ZR2A 4HH2A 1VPCA 3TYYA 1N73B 1RE4A 5CCGD 1G2CB 2N1TA 1T8ZA 1GTWA 1LWUC 3LW5H 3TSIA 1FDMA 1QL2A 4Y99C 1L0NK 2FYZA 5AVVB 1M1JC 1KQLA 1A02F 2HFED 3BVHA 1NKZB 2LKMA 1DX7A 2E43A 3EFGA 1L4AA 2YO3A 1RF1C 2J58A 2OYHB 5APQA 1LGHB 1X9VA 1FAVA 2JJLA 2KSJA 1VDFA 5CJ0A 3O8ZA 3VTPC 3I5CA 2MJZA 2WPRA 2IPPA 5AVTB 1LT9B 3KPEA 1JY3O 3RL0C 2ZXEB 5APYA 2P7JA 3RK3B 1GZLA 1KILA 3V2QA 1CI6B 3TNUA 3A5TA 2FFDA 1IFNA 2P1JA 2YKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OAR A;  3G3Z A;  2LKM A;  1NTK K;  1SQB K;  5KLV K;  1NTM K;  1L0L K;  1SQQ K;  2FYU K;  2WSE H;  1NU1 K;  1SQV K;  1SQP K;  3M9Q A;  1NTZ K;  2WSC H;  3CLQ A;  4IFD K;  2WSF H;  1SQX K;  2J59 M;  3LW5 H;  2O01 H;  1L0N K; 
#chains in the Genus database with same CATH topology
 4PJ0 E;  1EXI A;  1JCC A;  3MP7 B;  3H1K D;  4I2L C;  3VP8 A;  1E5W A;  3CCR P;  2HOD A;  3FXD A;  1RE3 A;  2HYN A;  1L2P A;  5AVZ B;  3L70 E;  1ZRT D;  3IN6 A;  2K9J B;  4JF7 A;  3MTU E;  3WUU A;  1Y47 A;  1OW7 A;  1QVG O;  1K8A Q;  4D6T E;  3I55 P;  3GMA A;  1RE4 C;  2KB7 P;  3H6P A;  3TK1 A;  2OYO A;  5E79 H;  1NTM G;  3KYQ A;  1IJD B;  3V2R A;  1L4A C;  1NTM K;  3H1L D;  5KLI B;  3L71 D;  2NZ2 A;  3EQ2 A;  3WUT A;  1L0N D;  1KIL C;  1L0L J;  1K73 Q;  4PV1 C;  1KQG B;  1SLQ A;  2KK7 A;  1P84 H;  1DEB A;  1KZU B;  1RE3 C;  4GIF A;  2WSE J;  1NAF A;  2D2C B;  4IFM A;  5KLV G;  4EI2 A;  1SP4 A;  2OYH A;  1JY2 N;  1SQV E;  3VMX A;  3II6 A;  1VQ5 P;  1NKN A;  1CSB A;  1KTM A;  1ZW0 A;  3L72 J;  3C8V A;  1FZC B;  4IFD K;  1FE6 A;  2FBW C;  3R4Y A;  2NRG A;  1S2E A;  1LTG C;  1NO4 A;  2GUS A;  1AFO A;  4MN4 C;  1M1K Q;  5BU5 A;  1LTJ B;  3GF7 A;  3UIA A;  2BCC J;  1NJI Q;  5L8R J;  3EFF K;  2V4H A;  1KFN A;  4QMA A;  3H1J E;  1N86 A;  3C9I A;  4LC1 A;  3Q5S A;  1GU5 A;  4XFJ A;  3CCJ P;  1NTM D;  2QJK B;  2RH0 A;  3HRN A;  1Q7Y Q;  3AEE C;  2KNC A;  2HPC B;  1JEK A;  4O9B A;  2PAJ A;  3D70 A;  2GA1 A;  3H1K J;  2R5B A;  4C46 A;  1NYH A;  1RF0 A;  4Y99 B;  1FOS E;  2OYH C;  2YNY A;  2QEX P;  1PGP A;  2DW3 A;  2JDI H;  1H88 A;  3TF5 A;  4JYB A;  5AW8 B;  1KOR A;  2R44 A;  3RL0 B;  2C0X A;  1G1I A;  3CL3 D;  2OAR A;  3B5N D;  5KLV D;  1SQX G;  3V4W A;  2CPB A;  3CWB G;  3M9Q A;  1X0T A;  4H13 B;  1SQX K;  2R3C A;  5C39 A;  3NTN A;  1FZE A;  2W27 A;  1JNM A;  5AW9 B;  2E75 B;  1PIX A;  2IFN A;  3H1L J;  4UB8 E;  3HUS B;  2KS1 A;  2W6J H;  3L71 J;  3L4F A;  3TDK A;  2OTL P;  1L0N J;  1FZC A;  4W80 A;  1KYO E;  3BCC G;  3VOP A;  1VQ8 P;  2BEZ F;  1R8E A;  2C0W A;  1YTZ T;  3LIE A;  4H44 B;  2QSI A;  1LTJ A;  3CX5 E;  4OH8 B;  3B8E B;  3AEA C;  1M90 Q;  2AEF A;  3A7O A;  1YIT P;  1PGO A;  5KLI C;  2NPS A;  1DD3 A;  1KMI Z;  2KOG A;  1R5S A;  3SWY A;  3GG2 A;  4ZKU A;  1BGY G;  1GD2 E;  3H32 A;  1GMJ A;  1EZV E;  3G4S P;  4U3F E;  5AVR B;  1M7L A;  1SQQ G;  4Y28 J;  3MUD A;  1KQS O;  5AVW B;  4JYC A;  1TU3 F;  3P8M C;  1JMM A;  1SQQ K;  2O1K A;  2E76 B;  3M91 A;  2Q1K A;  1EDJ A;  1JY3 P;  3AE4 C;  3GHG B;  2D2C C;  2PP6 A;  2V7Q H;  2O01 H;  1P84 D;  4W7Z A;  3E1I A;  2FYU G;  2W83 C;  2FYU K;  1T6A A;  1H89 A;  5APS A;  1HH0 A;  1FZC C;  3CWB D;  1LJ2 A;  3GLM A;  2H88 C;  1NGM B;  1NTM J;  3RBX A;  5M1B A;  1LTJ C;  1RHZ B;  1Y8A A;  1PP9 G;  3VMA A;  2R32 A;  2NPS C;  3NXS A;  4I6M C;  3N4X A;  1FZG A;  3BCC D;  2I1J A;  3HUS A;  4KT0 J;  3PTZ A;  4GKG A;  3MUD C;  2QJK C;  1ZR2 A;  4HH2 A;  1VPC A;  1N73 B;  5CCG D;  1G2C B;  2N1T A;  3AEF C;  1BGY D;  1GTW A;  1DEE G;  5KLV J;  1FDM A;  2HR3 A;  1D7M A;  3USS A;  1VQ4 P;  4Y99 C;  5AVV B;  1AV1 A;  1L0L E;  3BVH A;  1SQQ D;  2WSS H;  1FAV A;  4PD4 E;  5CJ0 A;  3O8Z A;  2WPR A;  4JBZ A;  4H0L D;  3RL0 C;  3FXE A;  5B66 E;  1VQ6 P;  4R4M A;  3PJS K;  3RK3 B;  1CI6 B;  1YJ9 P;  2P1J A;  3AEB C;  4C7R A;  2IX7 C;  2FYU D;  1VQO P;  3CME P;  5APU A;  3ABV C;  1YYC A;  3GHG A;  1KV4 A;  1LNQ A;  1RY3 A;  5H2F E;  4WB4 A;  4UB6 E;  3G71 P;  2GUV A;  2H8P D;  2Z5I A;  3HUS C;  4WBA A;  2AEJ A;  3U59 A;  3JCU H;  4JPZ B;  3P32 A;  3D6Z A;  2Q9I A;  1FZA A;  2BCC E;  1PP9 D;  3CC2 P;  4EDF A;  2VRS A;  1KFM A;  2N1T C;  4KHX A;  2IBZ E;  2W8Z A;  5KAI H;  2XKM A;  1M1J B;  2ZT9 B;  2XV5 A;  1AVY A;  2Z5H A;  2Z4E A;  1N7S D;  2WZ7 A;  1LTI C;  2AXT E;  4TT3 H;  1YI2 P;  1A02 J;  2M8R A;  3WU2 E;  1IFD A;  3A0B E;  3KZI H;  3HTK B;  1VQN P;  3H1K E;  3M0D A;  1NU1 G;  1SQX J;  1KQF B;  1VF5 C;  3CWB J;  1N73 A;  2E76 C;  4AYC A;  1J1D C;  2A06 G;  1NU1 K;  3T97 B;  1NOH A;  1ZRT E;  1X22 A;  2O1J A;  3GHG C;  3M0A A;  3KXD A;  3L74 G;  2WPS A;  1S5L X;  2ZYD A;  3V2N A;  4HKZ H;  2K3R A;  4B86 A;  3JC2 2;  3RK3 E;  5TIS E;  2LXC B;  2Q6Q A;  3HD7 A;  1USD A;  3BCC J;  2HLO A;  5K5G B;  1XTC C;  5TJH A;  5GTI H;  2B9B A;  1LTB C;  3ITK A;  1X8Y A;  4DOJ A;  5DJU B;  2POH A;  2P10 A;  3SSU A;  1U7M A;  2QRX A;  2KLV A;  2C9L Y;  3H1L E;  3JSV C;  2C9N Y;  3L71 E;  1BGY J;  4IL6 E;  5AW6 B;  1Z56 A;  3TGU G;  1L0N E;  2Q3I A;  4GOD A;  1GL2 B;  2H7H A;  1SQQ J;  1SQB D;  5KAF H;  4KJM A;  1ZME C;  3M0D C;  3KQG A;  4CPG A;  3B5N B;  1URQ B;  5KKZ C;  4AQR D;  1N73 C;  1U7J A;  2Y0D A;  4DZO A;  2ZYA A;  2WSF J;  1L4A D;  3W67 A;  1FU1 A;  1ZV8 A;  3Q1M A;  2FYU J;  4I1L A;  1DD4 A;  5B5E E;  1S72 P;  3HE5 B;  4K3A A;  2QM8 A;  2L5G B;  1MV8 A;  1VQP P;  1NU1 D;  3AE3 C;  5KJ7 D;  1S4X A;  1M8O B;  2HG5 D;  2XNX A;  3HD7 C;  4PV1 D;  3RK3 C;  2A06 D;  3CCQ P;  3CX5 I;  1NTK G;  3L74 D;  1K04 A;  1NTK K;  2ZYG A;  2QJP B;  1PP9 J;  1E79 H;  2G3A A;  2FXP A;  3WMM 0;  1OZH A;  3K5B A;  2W6A A;  2XU6 A;  4NPE A;  1PPJ G;  3S9O A;  1Q90 D;  1Y9B A;  1SQP E;  1OVV A;  5KLV K;  4XE5 B;  1LT9 A;  3MD0 A;  1SS1 A;  3VYI A;  3FGA D;  3EWK A;  3M9B A;  3TGU D;  3H1J G;  1QGK B;  3CCS P;  5CCH D;  4RES B;  2ZT9 C;  4I7Z B;  3Q2Y A;  1N2D C;  1FC2 C;  2XZR A;  5GTH E;  1GL2 A;  1NVO A;  4U7J A;  2E74 D;  5AVS B;  4WWI A;  5AVX B;  1PL5 A;  2K9J A;  1HJB A;  2ZXX A;  2YKP A;  3A2A A;  2V7Q J;  4L73 A;  2O01 J;  4GOF A;  1URQ A;  3L73 E;  1RQV A;  3SWK A;  2WTY A;  3VN0 A;  2YIU C;  2KIK A;  1NTK D;  1JY2 O;  1MZ9 A;  3SWF A;  3D71 A;  1MFZ A;  3RL0 g;  2WT7 B;  5AVY B;  2E5T A;  1LT9 C;  4DCK A;  2WSF H;  3M06 A;  3MIW A;  1SFC B;  1JY3 N;  2JKV A;  4PD4 I;  2JR8 A;  1IC2 A;  1PPJ D;  2GM4 A;  1NTZ G;  2YMY A;  5E79 E;  3H1I G;  2QJY B;  1HJ0 A;  1NTZ K;  1GL2 C;  2OTK E;  1LTA C;  1BE3 E;  3NFQ A;  5AW0 B;  3H1J D;  4H0L B;  1NU1 J;  1K05 A;  1YQ3 C;  1IFM A;  2P67 A;  2ZJS E;  1URQ C;  2IDB A;  3L74 J;  4R4L A;  2B87 B;  1P84 E;  3LW5 H;  3TSI A;  3AEG C;  1KQL A;  2HFE D;  1NKZ B;  2ITA A;  2LKM A;  3CXH E;  1DX7 A;  2YO3 A;  3G9R A;  4BRY B;  1X9V A;  1OMI A;  1VDF A;  3H1H G;  1LP1 B;  1SQX E;  3VTP C;  2MJZ A;  2JWD A;  2IBZ I;  2IPP A;  3CWB E;  3KPE A;  1JY3 O;  1Q2N A;  1PGQ A;  1GZL A;  2QG4 A;  4L75 A;  2YMK A;  2YKQ A;  3VMY A;  4BXL A;  1XTG B;  3AE5 C;  2FY8 A;  1EDI A;  2I1K A;  2QJP C;  4RO0 A;  2A45 I;  1J1E B;  2HPC A;  3AE2 C;  3TGU J;  1JO5 A;  2KSE A;  1HWT C;  5APT A;  4EIJ A;  1N7S B;  5CHX A;  4ZKP A;  3AED C;  4IOI H;  3QH9 A;  2H89 C;  3KDP B;  1NTZ D;  2P58 A;  1JCD A;  3S4R A;  3H1I D;  1ZOY C;  1SFC A;  2IZ1 A;  1EXJ A;  3A0H H;  1BGY E;  2SPZ A;  4WY4 B;  4I7Z C;  1SQQ E;  4NPF X;  2A45 H;  2NPS D;  3CX5 D;  1BDC A;  1M56 D;  3RGU A;  3FWL A;  3L35 A;  2LR2 A;  5AW1 B;  3HE4 B;  3CC7 P;  1AJY A;  1YIJ P;  3AE1 C;  2XDJ A;  2O01 N;  1NTK J;  2ZVO B;  5AW5 B;  4M3L A;  1UII A;  3RBZ A;  4TLF A;  1MUU A;  1QEX A;  2FXM A;  2ZVN B;  1YBK A;  3C1L A;  2FYU E;  2BAS A;  4GT1 A;  1S9K D;  2WPV B;  1OVR A;  1S3J A;  1S5L H;  3AE8 C;  2B87 A;  3H1H D;  1GU4 A;  4LGD E;  3S1K A;  1BSH A;  1AQ5 A;  3H25 A;  1JTH B;  1CZQ A;  1HGZ A;  1LP1 A;  3RL0 D;  5DJT B;  1PP9 E;  1KB9 E;  1PV3 A;  3H1J J;  3V2P A;  4PJ0 H;  1SFC C;  2YXR B;  1T2K C;  2J59 M;  1N7L A;  1WMK A;  1NWQ A;  4N6J A;  3P8C E;  3Q5R A;  4OWF A;  1L4A B;  2QJY C;  2M3B A;  1QL1 A;  4OGQ D;  1IK9 A;  2K88 A;  5APW A;  1IK7 A;  4H13 C;  3L72 E;  3B71 A;  1T3U A;  4H0L C;  4N3Y B;  1BCC G;  2E75 C;  3E7K A;  2PGD A;  3L75 G;  2J5U A;  1VQL P;  2N1T D;  3CMA P;  2A45 G;  3RK2 D;  2HOD B;  1CW5 A;  4WY4 A;  1NHL A;  2Y0C A;  3G6E P;  2R5D A;  1Q82 Q;  2UWJ E;  4H44 C;  3BAS A;  1SQB G;  1HGV A;  1FOS F;  3HE4 A;  1SQB K;  1PZQ A;  4PD4 D;  2OQQ A;  2WSC H;  1KN7 A;  5APV A;  1VQM P;  3CD6 P;  1VF5 D;  3R2P A;  1JMB A;  1NTZ J;  4BWN A;  3H1I J;  4N78 D;  1OWA A;  1G2C A;  1NH4 A;  1OIP A;  3F89 A;  5BU8 B;  3V6I A;  2IYP A;  4EYY Q;  5AW3 B;  2Q3E A;  1OFC X;  2Q7C A;  3MGN A;  2KUB A;  2E74 B;  2KXP B;  2IYO A;  2Y9Z A;  1W5C E;  3NMD A;  1AVO A;  3SFD C;  2WMM A;  1CI6 A;  1IFP A;  3L70 G;  2E42 A;  4WY4 C;  1K9M Q;  1ZN5 A;  4HYT B;  1RQU A;  3IF4 A;  3O6Q B;  2N9Y B;  1BCC D;  1X79 B;  1NU1 E;  1USE A;  3H1H J;  1H0T B;  4NPD A;  3CI9 A;  2BEQ D;  3L75 D;  4D6T G;  4YXW H;  1FZF A;  2A06 E;  2B88 A;  2KI7 B;  1HVV A;  5KJ7 A;  1FJP A;  4IL6 X;  3L74 E;  5AVQ B;  1HBW A;  1U57 A;  1HTL C;  2QE7 H;  3TNU B;  3G3Z A;  3B4S A;  2FFD B;  2K9Y A;  1IZN B;  2FXO A;  1UIX A;  4XA4 A;  3L36 A;  2CPS A;  1M1J A;  5BVZ A;  3V4Q A;  4GDO A;  3N7N A;  3HD7 D;  3ZDM A;  4K35 A;  3RK3 D;  1KYO I;  1RH5 B;  1P84 I;  1KIL D;  1QLE D;  3TGU E;  3JCU E;  2KNC B;  3CXH I;  3HTK A;  2O3J A;  2FKW B;  4YPC A;  5CBO A;  3CPW O;  1SQV G;  1SQP G;  5CCH A;  5KAI E;  3T97 A;  2KLU A;  2RKL A;  1SQV K;  4W7Y A;  1SQP K;  2FYN B;  3PH0 A;  1EZV I;  2OTJ P;  2ZFC A;  5KJ7 C;  3L70 D;  1QX8 A;  4UB8 H;  3IAO A;  1LT1 A;  3LW5 J;  2CK3 H;  2P2U A;  1NTM E;  2JWA A;  1PFI A;  1KYO H;  3KZI E;  3Q5P A;  1AQT A;  1YHQ P;  4D6T D;  1EC5 A;  3CXH H;  2ZT9 D;  1T8Z A;  3CX5 H;  1NTK E;  3O6Q A;  1QL2 A;  2FYZ A;  1M1J C;  1H0T A;  1KC8 Q;  2E43 A;  3EFG A;  2J58 A;  3F5H A;  2JJL A;  3L73 G;  2KS1 B;  2R3S A;  3I5C A;  2QIW A;  3AE7 C;  5CBN A;  2ZXE B;  1MKM A;  5APY A;  1Q81 Q;  2P7J A;  3TNU A;  2FFD A;  3OW2 O;  5KLV E;  5GTI E;  1PPJ E;  5APX A;  3B5N A;  3IFM A;  5CCH C;  1W2B O;  2WWW A;  1GK4 A;  1MFT A;  2JO1 A;  1FJK A;  2NPS B;  1GK6 A;  2G8Y A;  1BCC J;  3H32 B;  2E74 C;  3HE5 A;  2ZAE B;  3CCE P;  3L75 J;  3GW6 A;  3CCM P;  1SQV D;  1SQP D;  5KAF E;  3P7K A;  1OVU A;  4WVZ A;  2WVR A;  2N9B A;  1BE3 G;  1PGJ A;  4YTP C;  1SQB J;  2OYI B;  2M0B A;  1QVF O;  2IZ0 A;  2M5A B;  2AXC A;  1N8R Q;  1GW3 A;  3PHL A;  4AUW A;  5AW2 B;  1KB9 I;  1GW4 A;  2WPQ A;  4ASW A;  1GL2 D;  2OGU A;  2Y0E A;  2QM7 A;  3Q3D A;  1R5L A;  1OX3 A;  5AW7 B;  3AEC C;  5KTB A;  1URQ D;  2FFD C;  1FDI A;  1JY2 P;  2W6B A;  1LTT C;  1IFI A;  1JB0 J;  1IFJ A;  3B5N C;  3L73 D;  3IR9 A;  5AVU B;  2PRR A;  4OGQ B;  4RKU J;  2AEM A;  3W68 A;  4PD4 H;  1EZV G;  2B89 A;  4U3F G;  1EQ7 A;  3GF3 A;  1KB9 H;  5B66 H;  1NTZ E;  2H43 A;  1WT6 A;  3I56 P;  3H1I E;  2WSE H;  4HJG H;  3L70 J;  1ZLL A;  1EDL A;  2N1T B;  2WQY C;  3BRV B;  2QA4 P;  2MKV A;  1SVF A;  3OA7 A;  1VQ9 P;  3RK2 B;  1RF0 C;  3KHU A;  1FDO A;  4JQ0 D;  1HUC A;  4D6T J;  1OXZ A;  5H2F H;  1YTZ I;  1FBM A;  2D2C D;  4UB6 H;  2FYN C;  3BCC E;  3MZW B;  1BE3 D;  3D6Y A;  2XND H;  4IFF A;  4ASV A;  2YO2 A;  4ZMD A;  3FWN A;  1S9K E;  2K37 A;  2WT7 A;  3H1H E;  1VF5 B;  2LXB A;  3L37 A;  1J1D B;  3CLQ A;  2OYI A;  1HF9 A;  1KYO D;  2M5A A;  1VQ7 P;  4C7N B;  2JP3 A;  2WSC J;  1BSN A;  2M3E A;  5CCG A;  1LWU B;  2RN0 A;  3BAT A;  3AE9 C;  4LLH A;  1S1C X;  2AXT H;  3A3Y B;  3CXH D;  4A7P A;  4DJG A;  1RF1 B;  5EFW B;  3WU2 H;  3CC4 P;  3BRT B;  1SQX D;  3A0B H;  1OW6 A;  1J2J B;  1SQV J;  1L0L G;  1SQP J;  1YQ4 C;  1EZV D;  1ZP0 C;  2K1A A;  4U3F D;  1L0L K;  3FX0 A;  2RMZ A;  2KYV A;  1NAY A;  2JEE A;  3PP5 A;  1H8A A;  3VMZ A;  3CCU P;  3U1A A;  5TIS H;  1EDK A;  4BRY A;  2YKO A;  4ZNC A;  2YXQ B;  1SFC D;  1T2K D;  1JUN A;  5KKZ B;  3PRJ A;  1G1J A;  3L72 G;  3SFE C;  2OYI C;  1BDD A;  1LTS C;  4GOE A;  5CCG C;  2IFM A;  3L73 J;  4IL6 H;  3VP9 A;  4H13 D;  2QVA A;  1IO4 A;  1AA0 A;  1GDT A;  1YJN P;  2BCC G;  3HD7 B;  4HB1 A;  1N7S A;  2E75 D;  2IBZ G;  1KIL B;  4YXD C;  4PV1 B;  1JOC A;  4N78 E;  2PFX A;  1ZR4 A;  1T3J A;  1JM0 A;  3V5B A;  4C7N A;  4H44 D;  3M9H A;  3OJA B;  4OGQ C;  1LWU A;  1W2E A;  3E1R A;  1FZB A;  5B5E H;  2L91 A;  2KP8 A;  1FS0 E;  3LID A;  3H1K G;  1RF1 A;  1L0L D;  4EOT A;  1YJW P;  2KZI A;  1BE3 J;  1KB9 D;  3QWO C;  4L74 A;  4DT0 A;  3CCV P;  1KD1 Q;  3WUV A;  3RK2 C;  1BCC E;  3A0H E;  3AE6 C;  1Q86 Q;  2E76 D;  3P8C D;  3L75 E;  5AW4 B;  1J1E C;  1WRG A;  5CJ4 A;  3CCL P;  3OAK A;  1VQK P;  1N7S C;  1JTH A;  1OW8 A;  3L72 D;  2Q5U A;  1SQB E;  5CMZ A;  4RJT A;  4OVN F;  2WIT A;  3PLN A;  1DH3 A;  3H1L G;  3MHV A;  4WY4 D;  3U1C A;  1DIP A;  3L71 G;  4Z1M H;  1VL2 A;  3TYY A;  1RE4 A;  1L0N G;  2BCC D;  1S5L E;  1M57 D;  1LWU C;  4U3F J;  2YIU B;  1L0N K;  2IBZ D;  1A02 F;  5GTH H;  2I8D A;  1L4A A;  2KZJ A;  1RF1 C;  2OYH B;  5APQ A;  4L76 A;  1LGH B;  1ZXG A;  2KSJ A;  2Y9Y A;  1KIL E;  5AVT B;  1LT9 B;  1KIL A;  3V2Q A;  2E5Y A;  3A5T A;  1IFN A;  2W90 A; 
#chains in the Genus database with same CATH homology
 3VMY A;  1XTG B;  4C7R A;  1JCC A;  2I1K A;  2IX7 C;  2A45 I;  4I2L C;  5APX A;  3B5N A;  3IFM A;  3VP8 A;  5CCH C;  1E5W A;  1J1E B;  2HPC A;  5APU A;  2WWW A;  1GK4 A;  2HOD A;  1JO5 A;  1RE3 A;  1YYC A;  1FJK A;  3GHG A;  1HWT C;  2NPS B;  2HYN A;  5APT A;  5AVZ B;  4EIJ A;  1RY3 A;  4WB4 A;  1GK6 A;  1N7S B;  3H32 B;  3HE5 A;  5CHX A;  2GUV A;  4ZKP A;  2H8P D;  4JF7 A;  2Z5I A;  3HUS C;  4WBA A;  3MTU E;  3U59 A;  3KDP B;  3P32 A;  3P7K A;  2Q9I A;  1JCD A;  1FZA A;  1SFC A;  2N9B A;  2VRS A;  1RE4 C;  2KB7 P;  1KFM A;  3H6P A;  2N1T C;  3TK1 A;  4KHX A;  2OYI B;  4WY4 B;  1GW3 A;  4AUW A;  3KYQ A;  2XKM A;  1M1J B;  5AW2 B;  1IJD B;  3V2R A;  2A45 H;  2NPS D;  1GW4 A;  2WPQ A;  1L4A C;  1GL2 D;  2XV5 A;  2Z5H A;  1NTM K;  2Z4E A;  1N7S D;  3L35 A;  2WZ7 A;  5AW1 B;  3HE4 B;  1LTI C;  2QM7 A;  2XDJ A;  1A02 J;  2M8R A;  3EQ2 A;  4M3L A;  5AW5 B;  1MUU A;  1IFD A;  1KIL C;  5AW7 B;  3HTK B;  5KTB A;  1URQ D;  2FXM A;  1JY2 P;  2FFD C;  2W6B A;  1LTT C;  3M0D A;  2BAS A;  1IFI A;  4GT1 A;  1S9K D;  1IFJ A;  1SLQ A;  3B5N C;  1N73 A;  3IR9 A;  4AYC A;  1J1D C;  1DEB A;  1NU1 K;  5AVU B;  1NOH A;  1KZU B;  1RE3 C;  1GU4 A;  2O1J A;  3GHG C;  4GIF A;  3M0A A;  4LGD E;  1NAF A;  1AQ5 A;  2WPS A;  4IFM A;  3V2N A;  1JTH B;  1SP4 A;  2OYH A;  1EQ7 A;  1CZQ A;  1HGZ A;  1JY2 N;  4B86 A;  3RL0 D;  3VMX A;  3II6 A;  2H43 A;  1WT6 A;  1NKN A;  1CSB A;  3HD7 A;  2WSE H;  1ZLL A;  2HLO A;  3V2P A;  1SFC C;  1XTC C;  1FZC B;  4IFD K;  1T2K C;  2J59 M;  1LTB C;  2N1T B;  3BRV B;  1N7L A;  1X8Y A;  4DOJ A;  1SVF A;  1NWQ A;  3OA7 A;  4N6J A;  3RK2 B;  1LTG C;  3P8C E;  1NO4 A;  1RF0 C;  2POH A;  2GUS A;  1AFO A;  2KLV A;  5BU5 A;  1LTJ B;  2C9L Y;  1HUC A;  1L4A B;  1OXZ A;  2M3B A;  3UIA A;  1QL1 A;  1IK9 A;  1FBM A;  1YTZ I;  5APW A;  2C9N Y;  5AW6 B;  1Z56 A;  2Q3I A;  1GL2 B;  1KFN A;  1N86 A;  2H7H A;  1T3U A;  3C9I A;  4IFF A;  4N3Y B;  2YO2 A;  4LC1 A;  1GU5 A;  1S9K E;  2WT7 A;  3M0D C;  3KQG A;  3B5N B;  1URQ B;  2N1T D;  3L37 A;  4AQR D;  3HRN A;  1N73 C;  2A45 G;  1J1D B;  2HPC B;  3RK2 D;  2HOD B;  1CW5 A;  3CLQ A;  4O9B A;  4WY4 A;  2OYI A;  1NHL A;  4C7N B;  2PAJ A;  4DZO A;  1L4A D;  2R5D A;  1LWU B;  5CCG A;  1FU1 A;  1ZV8 A;  3BAS A;  4I1L A;  2R5B A;  4C46 A;  1RF0 A;  4Y99 B;  3BAT A;  1FOS E;  2OYH C;  3HE5 B;  4LLH A;  3A3Y B;  2QM8 A;  1HGV A;  2L5G B;  1MV8 A;  2YNY A;  1FOS F;  3HE4 A;  1RF1 B;  1SQB K;  5KJ7 D;  3BRT B;  1H88 A;  2HG5 D;  2XNX A;  3HD7 C;  4JYB A;  5AW8 B;  3RK3 C;  2WSC H;  1J2J B;  5APV A;  3RL0 B;  2C0X A;  1G1I A;  3CL3 D;  2OAR A;  3B5N D;  3R2P A;  1NTK K;  4N78 D;  1OWA A;  1L0L K;  3V4W A;  2CPB A;  2KYV A;  1G2C A;  3M9Q A;  1NH4 A;  5BU8 B;  2JEE A;  3PP5 A;  3WMM 0;  1SQX K;  1H8A A;  2R3C A;  5AW3 B;  3VMZ A;  3NTN A;  2W6A A;  1FZE A;  3U1A A;  2XU6 A;  2Q7C A;  2W27 A;  1JNM A;  3MGN A;  5AW9 B;  2IFN A;  2YKO A;  3HUS B;  1SFC D;  5KLV K;  3L4F A;  4XE5 B;  1LT9 A;  3NMD A;  1T2K D;  3MD0 A;  1JUN A;  1FZC A;  4W80 A;  3VYI A;  1G1J A;  1CI6 A;  2E42 A;  3VOP A;  3M9B A;  2OYI C;  4WY4 C;  1ZN5 A;  4HYT B;  1LTS C;  2C0W A;  5CCG C;  1YTZ T;  2IFM A;  3LIE A;  5CCH D;  1LTJ A;  4RES B;  1X79 B;  4OH8 B;  3B8E B;  3VP9 A;  1N2D C;  3CI9 A;  3A7O A;  2XZR A;  1IO4 A;  2NPS A;  1FZF A;  2KOG A;  1GDT A;  1GL2 A;  3SWY A;  4ZKU A;  3HD7 B;  5KJ7 A;  1HVV A;  5AVS B;  1GD2 E;  1N7S A;  1FJP A;  5AVX B;  3H32 A;  1HJB A;  5AVQ B;  1HBW A;  1HTL C;  1KIL B;  2YKP A;  3TNU B;  3A2A A;  3G3Z A;  5AVR B;  2FFD B;  1M7L A;  1JOC A;  3MUD A;  4N78 E;  5AVW B;  1URQ A;  4JYC A;  1ZR4 A;  3P8M C;  1T3J A;  1JMM A;  4XA4 A;  1SQQ K;  3L36 A;  3V5B A;  2O1K A;  3M91 A;  4C7N A;  3M9H A;  3OJA B;  1JY3 P;  1LWU A;  1W2E A;  2WTY A;  1FZB A;  3GHG B;  3VN0 A;  2PP6 A;  2CPS A;  2O01 H;  1M1J A;  1JY2 O;  2KP8 A;  5BVZ A;  1MZ9 A;  3E1I A;  4W7Z A;  3SWF A;  3LID A;  1RF1 A;  1MFZ A;  3V4Q A;  3N7N A;  3HD7 D;  4EOT A;  3RK3 D;  2WT7 B;  5AVY B;  2FYU K;  1LT9 C;  1H89 A;  1KIL D;  1HH0 A;  5APS A;  1FZC C;  2WSF H;  3M06 A;  3MIW A;  3HTK A;  1SFC B;  1JY3 N;  3RK2 C;  2FKW B;  1IC2 A;  3P8C D;  1LTJ C;  2GM4 A;  5CCH A;  5AW4 B;  1J1E C;  1WRG A;  2YMY A;  3T97 A;  5CJ4 A;  4W7Y A;  1SQV K;  2R32 A;  1SQP K;  2NPS C;  1NTZ K;  3OAK A;  1GL2 C;  3NXS A;  4I6M C;  3N4X A;  1LTA C;  2ZFC A;  5KJ7 C;  1FZG A;  3NFQ A;  1N7S C;  5AW0 B;  1JTH A;  2I1J A;  2Q5U A;  5CMZ A;  3HUS A;  2P2U A;  1IFM A;  2WIT A;  1PFI A;  4GKG A;  2P67 A;  1DH3 A;  1URQ C;  4WY4 D;  3U1C A;  1ZR2 A;  4HH2 A;  1VPC A;  3TYY A;  1N73 B;  1RE4 A;  5CCG D;  1G2C B;  2N1T A;  1T8Z A;  1GTW A;  1LWU C;  3LW5 H;  3TSI A;  1FDM A;  1QL2 A;  4Y99 C;  1L0N K;  2FYZ A;  5AVV B;  1M1J C;  1KQL A;  1A02 F;  2HFE D;  3BVH A;  1NKZ B;  2LKM A;  1DX7 A;  2E43 A;  3EFG A;  1L4A A;  2YO3 A;  1RF1 C;  2J58 A;  2OYH B;  5APQ A;  1LGH B;  1X9V A;  1FAV A;  2JJL A;  2KSJ A;  1VDF A;  5CJ0 A;  3O8Z A;  3VTP C;  3I5C A;  2MJZ A;  2WPR A;  2IPP A;  5AVT B;  1LT9 B;  3KPE A;  1JY3 O;  3RL0 C;  2ZXE B;  5APY A;  2P7J A;  3RK3 B;  1GZL A;  1KIL A;  3V2Q A;  1CI6 B;  3TNU A;  3A5T A;  2FFD A;  1IFN A;  2P1J A;  2YKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...