3RL0B

Truncated snare complex with complexin (p1)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
59
structure length
59
Chain Sequence
ALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Complexin cross-links prefusion SNAREs into a zigzag array.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/exocytosis
molecule keywords Vesicle-associated membrane protein 2
total genus 27
structure length 59
sequence length 59
chains with identical sequence F, J, N, R, V, Z, d
ec nomenclature
pdb deposition date 2011-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3rl0B00
3HTKB 2HFED 1N7SC 3RL0C 1GL2D 3RK2D 1T3JA 3RK2B 1XTGB 1GL2B 1SFCA 3P8CE 3HD7C 1JTHB 4WY4C 2PP6A 3HD7D 4N78E 3VOPA 1GL2C 3RL0D 1URQB 1KILA 4JF7A 2N1TC 4LGDE 5CCHC 3B5NA 1L4AC 1KILD 2N1TB 4W7YA 5KJ7C 3RK3D 1N7SB 3HD7A 3RK3C 2H8PD 2HG5D 3B5NB 1SFCC 1HVVA 4WY4A 1JTHA 2WZ7A 1L4AB 4WY4B 1GL2A 3PP5A 2NPSB 1KILC 1SFCB 1URQA 2NPSD 5KJ7A 5CCGC 5CCHA 3B5NC 4WY4D 1N7SD 1SFCD 2N1TD 2KOGA 3B5ND 2NPSC 3RL0B 2XDJA 1N7SA 3RK3B 3HD7B 5CCHD 4W80A 3RK2C 1URQC 1KILB 5CCGA 1L4AD 2N1TA 3TSIA 2M8RA 3M0DC 1L4AA 3KYQA 1URQD 4OH8B 1NHLA 5CCGD 2YMYA 5KJ7D 4W7ZA 2NPSA
chains in the Genus database with same CATH superfamily
1CI6B 1S1CX 2B87A 1SQBJ 2K9JB 4OWFA 4YTPC 1CI6A 1NTZE 2B87B 2HFED 2K9JA 2R32A 3CX5I 1L0LD 1N7SC 4H44B 2IFNA 2VRSA 3VMAA 1Q82Q 1L0NJ 3II6A 3KXDA 3CX5H 5L8RJ 1M1KQ 1OWAA 3V6IA 5B5EE 4IL6E 1VQ4P 2FYNB 1WMKA 1W5CE 1XTGB 1GL2B 2IYOA 2FKWB 5APSA 3EFFK 1KYOI 3H1JJ 3JC22 2IBZI 2IYPA 5KKZB 3H1KE 5DJUB 2ZYDA 1PPJE 2P2UA 2WSEJ 2QM7A 3BCCJ 1K04A 1QGKB 2PP6A 1SQVK 4N78E 3TF5A 1J1DC 2WSCJ 3KZIE 2J59M 3L36A 4UB8H 1FC2C 2M0BA 1JO5A 2Y0CA 4LLHA 3BATA 1NTMD 1ZP0C 2MJZA 1OW6A 2N1TC 1JY3O 2N9BA 3AE2C 1N7LA 3MD0A 4BXLA 2C9NY 1NTKE 4HKZH 1N8RQ 2WQYC 2FYUJ 1LTTC 4MN4C 1IK9A 2P10A 2YIUC 1NU1E 2QRXA 3A0BH 1GTWA 4O9BA 1K73Q 4HB1A 5B66H 1FDIA 5GTHH 1NTMJ 2K37A 2YMYA 1EC5A 4KT0J 4PD4E 4W7YA 4TT3H 2WPRA 4XE5B 3MTUE 3H1JE 1JMBA 3A2AA 4AQRD 4GIFA 1OIPA 3MP7B 3MIWA 1HGVA 1LT9A 1H0TA 1LTBC 1HJ0A 3WUUA 2LXBA 5CJ0A 1N7SB 1R5SA 2H8PD 1EDJA 2HG5D 1T6AA 3CWBJ 1VQ5P 1L2PA 3CLQA 5TISE 2ZVOB 2QE7H 1KMIZ 1YI2P 3IF4A 2V7QJ 1HUCA 1KORA 2ZVNB 1SLQA 2M5AA 4JPZB 3S4RA 2ZXXA 3OJAB 1LTGC 2K3RA 3L75D 3H1LJ 1DEBA 5AVYB 1PZQA 3L72G 4C46A 4WY4A 1UIXA 2O01N 2WZ7A 1CW5A 1EDIA 1SQQG 4WY4B 1VQ7P 1QVGO 2YIUB 3TNUB 1IO4A 1IZNB 3PP5A 4LC1A 2YKQA 1SQPK 1SQVE 1SFCB 1URQA 3PRJA 1LTJB 4N3YB 3W67A 2NPSD 3AE8C 1AVOA 2K9YA 2OYHC 3A0HE 2SPZA 3G6EP 5AW5B 4L74A 1KB9I 1RY3A 5KAIE 1NTZD 4C7NB 2E5TA 1BCCD 2WSFJ 1L0LE 4C7NA 2JJLA 2N1TD 5AVZB 5KLIC 1BCCE 3SSUA 2KNCB 3TGUE 1YQ3C 1PPJD 2QA4P 1EDLA 2KP8A 2KNCA 1SS1A 3CC4P 1FBMA 2O01J 3AE5C 1EXIA 2KB7P 3G9RA 2I8DA 1NAFA 1LJ2A 4H0LD 4PD4I 2E76B 4DJGA 2QEXP 1VQLP 1SQPJ 3L70J 3B5ND 2FYNC 2E5YA 1QLED 4OGQC 1OW7A 5APVA 1BSNA 3USSA 3F89A 2OTJP 3WU2E 1PP9E 3C9IA 2V7QH 1KQGB 3CCMP 1MFTA 1R5LA 4PJ0H 3V4QA 3H1IE 1SVFA 3BASA 3RL0g 3CCLP 3HE4B 5C39A 3RK2C 1AQTA 3BCCD 1URQC 3M0AA 1EDKA 5KLVK 2FY8A 4HH2A 1NTKD 1E79H 4R4LA 1JCDA 1IFNA 1L0LJ 1FZCA 2N1TA 4L73A 1IC2A 3P8MC 3TK1A 4A7PA 5KAFH 2W6AA 5APTA 4GOFA 1FJKA 3FGAD 3CPWO 3NTNA 2IZ0A 3CC2P 2ZFCA 4C7RA 4OVNF 1QVFO 1Z56A 2E74B 3KYQA 1LGHB 1LT1A 1M7LA 1URQD 2WSSH 1GK6A 2JR8A 3C1LA 1JMMA 3H1JD 3L73J 2W6BA 4OH8B 5GTHE 3Q5PA 2KS1B 3CCSP 3L74G 5AW4B 2KS1A 3V2NA 3AEEC 5KJ7D 1N7SD 3L75E 2OYIA 2YMKA 1X22A 3HTKB 1T2KD 3HTKA 3B4SA 3OAKA 4EI2A 3L71J 5KLVJ 4B86A 3FXEA 3RK2D 1FAVA 2WPVB 3G4SP 1T3JA 3G3ZA 1IFIA 2WSEH 4NPEA 1WT6A 1MZ9A 5AVSB 2AXTH 2KSEA 2M5AB 2QIWA 2Y9YA 3CWBD 3RK2B 1KN7A 3L75G 1UIIA 3MHVA 5APUA 1KYOE 1YQ4C 3AE3C 4KJMA 1GZLA 2KI7B 4BRYB 1FZCC 4OGQD 3CXHI 1GU4A 1SQXG 4WY4C 1G2CB 1DD4A 2Z5IA 1SQVD 3HD7D 4EOTA 2LKMA 3I5CA 1P84D 3PLNA 1Y47A 3Q5SA 2WVRA 3RL0D 1Q90D 1URQB 1NTME 2CK3H 1VQ6P 3S9OA 5DJTB 2G3AA 5EFWB 4I1LA 1L0NK 2WSFH 4LGDE 1NU1J 2QG4A 4PV1C 4I2LC 5CCHC 2E43A 1KQSO 2Q1KA 1QL1A 2OYIC 2XZRA 1SQBK 1NAYA 1N86A 1PP9D 5KLIB 3RGUA 1BSHA 1M1JA 5M1BA 3A0BE 1YTZT 3GF3A 2QJKC 2KZJA 1CZQA 1SQXE 2A45I 5BU8B 4WBAA 1SQXD 1X79B 1AFOA 2XNDH 1SQBD 1J1DB 3L74D 3MZWB 2D2CB 5APQA 1AA0A 4XA4A 2JDIH 4KHXA 1ZV8A 1H89A 1L0ND 2YO2A 1ZW0A 4IFDK 4GT1A 1JUNA 3B5NB 3O6QA 3VN0A 2K88A 1VF5C 3FX0A 3QH9A 3FWNA 2MKVA 1ZLLA 4NPFX 1U57A 3L74J 1K9MQ 1VQ8P 1YBKA 3H25A 1L0LG 2IZ1A 1S4XA 1S5LH 1ZRTE 1HVVA 1SFCC 1JY2N 1LTJC 3V2PA 4ASVA 1J1EB 2ZT9B 1IFPA 1X0TA 1JTHA 2P67A 4JYBA 2DW3A 2JKVA 1QX8A 2WPSA 3CMAP 2XV5A 1GDTA 2G8YA 1HBWA 1X9VA 2NPSB 1KQFB 1T2KC 4JBZA 1KILC 2AEMA 2O1KA 5TJHA 5AW7B 3AEGC 1SQQE 2PGDA 3V5BA 5CBNA 2WMMA 5CCHA 1FS0E 3L72J 1PGJA 4WY4D 1S3JA 1TU3F 2JWDA 3M0DA 5AW2B 1EQ7A 2Q3EA 2FYUK 4ZMDA 2KLVA 1GW4A 1HH0A 2OGUA 2PRRA 1D7MA 4Y28J 2GM4A 1SQQK 1Y9BA 3CX5D 2ITAA 2C0WA 2H7HA 2AXTE 2E75C 1ZR4A 3H1IG 2K1AA 1LWUB 1EXJA 1LTSC 1VF5B 1VQPP 3T97A 1NWQA 1DH3A 2OARA 3AE9C 1Q2NA 5AW3B 1KYOD 2NZ2A 2R3SA 1NKZB 1RQUA 2BASA 3T97B 3D6ZA 4GODA 2QJYB 4RKUJ 3HUSA 1JCCA 1PV3A 1J1EC 1CSBA 3GMAA 4N6JA 3WU2H 1USDA 4IL6H 2WPQA 1SQQJ 1JNMA 2D2CD 2QJPB 5H2FH 3CCEP 4IL6X 3GW6A 3H32B 1KV4A 2YXRB 3RK3E 3MUDA 3WUVA 1NTKK 5APWA 1NKNA 1FU1A 3TSIA 2KIKA 2KXPB 1DEEG 3L74E 3A5TA 2FXPA 3GLMA 3L75J 1SQXK 1L4AA 2WWWA 4L75A 4Y99C 1NGMB 1OVVA 3U59A 5CBOA 1SQVG 2A45G 3B71A 1LT9B 3H6PA 4Z1MH 3CCRP 4K3AA 4YXWH 3Q5RA 1OW8A 4EYYQ 4I6MC 3VMYA 1W2BO 1NHLA 1EZVI 1OMIA 1KYOH 5CHXA 4R4MA 2E76C 2W8ZA 2OTLP 1XTCC 1NTZJ 3CC7P 1LTAC 1JM0A 2KZIA 1FZEA 1OXZA 2NRGA 3R2PA 3M91A 1JY3N 5KTBA 1LP1A 1PGOA 2M3BA 3HUSC 1NTMG 1RE4A 1MV8A 1GL2D 2AEFA 1K05A 3JSVC 3KDPB 3GG2A 4BWNA 4D6TD 4UB6H 3D71A 2FFDC 2FXMA 1NTZK 2WSCH 2Q9IA 2JP3A 5AW9B 3VP9A 3CXHH 3IR9A 2QSIA 3P8CD 4H44D 2Q3IA 3SFDC 1YTZI 1SFCA 3P8CE 2HPCB 3HD7C 2ZT9C 1N73A 1JTHB 3AEDC 1DIPA 1QEXA 2M3EA 1SQXJ 1X8YA 1FE6A 2FBWC 2GUSA 2WT7A 3V2QA 3CMEP 1BCCG 1NTKJ 1KILA 3MUDC 4EIJA 1FDMA 2QJKB 1PL5A 3VMXA 2IDBA 1FZCB 1L4AC 1ZOYC 3BCCG 3CX5E 3HRNA 1AQ5A 5KAFE 2R44A 1FZAA 2QVAA 3L35A 2LXCB 3B8EB 4WWIA 5KKZC 4HJGH 1DD3A 3P32A 1NO4A 1S5LE 1LWUA 2HLOA 3H1KJ 4GDOA 2HYNA 5AVTB 1BE3J 4AYCA 5KJ7C 2KSJA 1RF1C 1H88A 4L76A 5APYA 1PGPA 3L72E 2FYUD 2ZJSE 2L5GB 5AVVB 3EQ2A 3HE4A 3RK3D 1YJNP 3D6YA 1NU1D 3U1CA 2OTKE 1RE4C 3ITKA 4DZOA 3Q3DA 1HJBA 3HUSB 3L71D 5KLVD 1WRGA 1NVOA 4TLFA 2B88A 1FZGA 1N73C 1JB0J 1KQLA 1N2DC 2A06D 1YJ9P 1GD2E 1VQNP 4I7ZC 1KC8Q 1ZXGA 1HTLC 2Y9ZA 3BRTB 4H13C 1FZBA 2QJPC 2O1JA 1SQQD 1PP9G 2RH0A 3H32A 1IFJA 2YXQB 3M9HA 3M9BA 4GKGA 2N9YB 5CJ4A 3H1HJ 3Q2YA 2J5UA 2P58A 1JOCA 1P84H 2XU6A 3AEBC 2OYOA 1L4AB 4JYCA 4Y99B 3N4XA 3WMM0 1GL2A 1H0TB 3H1IJ 1M1JC 3KPEA 2KK7A 3FWLA 3TGUG 3WUTA 5CCGC 1NYHA 1KFNA 2KLUA 3B5NC 3V4WA 4ASWA 1JY2P 1J2JB 2JEEA 2OQQA 3AE6C 3MGNA 5BVZA 1YJWP 2H43A 1PP9J 1FOSE 1SFCD 1M8OB 2W83C 3H1HG 1LP1B 2Y0DA 1G1JA 3GF7A 2IX7C 3KHUA 1P84I 4YPCA 3LW5J 5AW0B 1SQPE 3L70E 3UIAA 1Q81Q 2B89A 3CI9A 4PJ0E 5AVWB 5AW1B 2UWJE 3M9QA 4RESB 1VL2A 2ZYGA 3A7OA 3QWOC 2JO1A 1GU5A 1BE3D 1NOHA 1PFIA 1BGYE 2YKPA 2H88C 3L72D 5AVRB 1LTJA 3RL0B 3KQGA 3K5BA 3TGUD 1RF0A 1ZN5A 3GHGB 3HD7B 1N73B 3NXSA 4PD4D 3EWKA 3OA7A 1PGQA 3CCVP 1IJDB 2POHA 4OGQB 1JEKA 2HODA 3VP8A 1LNQA 2QM8A 3V2RA 2HODB 4H13B 2ZXEB 2WT7B 1KILB 1NU1K 1GW3A 2CPSA 2O3JA 3L4FA 3TGUJ 1YHQP 1K8AQ 4UB6E 1BE3G 1L4AD 5H2FE 1KB9D 4RO0A 1Q7YQ 5B66E 3L37A 1E5WA 1SQBE 1OFCX 1IK7A 1VPCA 2M8RA 2R3CA 3M0DC 3H1JG 3E7KA 3M06A 4U3FG 4D6TJ 3CD6P 3CWBG 4DOJA 2BEQD 3L71E 5KLVE 1BDDA 2WTYA 5GTIE 3RBXA 3AECC 4BRYA 5AVXB 4CPGA 1RF1B 1NU1G 4ZKPA 1LWUC 3KZIH 4UB8E 2FXOA 1S72P 2GUVA 2KUBA 1NTKG 2BEZF 4W7ZA 2O01H 1DX7A 1IFMA 1YIJP 2ZAEB 4IOIH 2KYVA 5E79E 1VQKP 1FDOA 2E74D 1RF0C 3RL0C 5B5EH 1PIXA 1AVYA 1T3UA 3GHGC 3L73D 3RBZA 1OVRA 2L91A 3SWYA 4PV1B 4U7JA 2XNXA 2R5BA 1RHZB 3ZDMA 5BU5A 1MKMA 4PV1D 1KD1Q 1AJYA 1PPJG 3IN6A 3TDKA 1VQMP 2IBZD 3H1KG 4AUWA 1LT9C 3IFMA 1Q86Q 2IBZE 2J58A 3I56P 1A02F 1EZVG 3H1LD 5AW8B 4GOEA 3CXHE 1JY3P 3HE5B 1AV1A 2W6JH 1SP4A 5AVUB 4HYTB 2A06G 2OYIB 3AEFC 1RE3A 2XKMA 3VOPA 1GL2C 1L0NG 1G1IA 2H89C 3A0HH 3L71G 5KLVG 1BDCA 2BCCE 1L0LK 3E1IA 1NTZG 2AEJA 4JF7A 5GTIH 1SQBG 1HGZA 3BVHA 2FYUE 2E76D 3B5NA 3BRVB 3O6QB 1HF9A 3LW5H 1BGYJ 4H0LB 2W27A 1SQVJ 1KZUB 2D2CC 3L73G 1L0NE 2B9BA 2CPBA 4N78D 1KILD 1Y8AA 4YXDC 2N1TB 1M90Q 4H13D 1RQVA 2A06E 4ZNCA 1T8ZA 3Q1MA 1KFMA 2AXCA 1LTIC 1S9KD 1ZR2A 2E75D 1S9KE 2P1JA 1BGYD 2Z5HA 3PJSK 1VDFA 2FFDA 2FFDB 2C9LY 2Q6QA 4RJTA 3CCUP 2RKLA 2I1JA 3G71P 1GMJA 2PAJA 1KB9H 1VQ9P 2HR3A 3GHGA 3HD7A 1M57D 3LIEA 3RK3C 3S1KA 4EDFA 3CL3D 5KAIH 1IFDA 1RH5B 3A3YB 1SQPG 3L70G 4D6TG 2FYZA 3F5HA 4DT0A 3TYYA 4U3FD 2I1KA 3H1HE 3AEAC 4PD4H 1MFZA 3FXDA 3CCJP 1M1JB 3W68A 1KB9E 4JQ0D 1ZMEC 3ABVC 3H1LE 1GK4A 3CXHD 4U3FJ 4H0LC 1OZHA 2WITA 4M3LA 1USEA 1SQPD 1W2EA 3L70D 4NPDA 2Z4EA 3CWBE 1VQOP 3PHLA 3AE1C 2A45H 5KJ7A 1RF1A 3D70A 1FOSF 2BCCD 2LR2A 3VTPC 1G2CA 5K5GB 2Q5UA 4D6TE 1BE3E 4XFJA 1FZFA 4DCKA 2P7JA 3NFQA 1R8EA 2BCCG 2ZYAA 5TISH 2C0XA 2W90A 4H44C 1S2EA 2IPPA 1P84E 2IFMA 3O8ZA 1VF5D 3AE4C 2BCCJ 4IFFA 3SFEC 1H8AA 1KILE 1YYCA 4K35A 1JY2O 2HPCA 1S5LX 3AE7C 3PH0A 3JCUE 1EZVD 3H1LG 4I7ZB 3SWFA 1EZVE 2NPSC 2IBZG 3H1KD 3SWKA 1BGYG 2E74C 1U7MA 2JWAA 3VYIA 2PFXA 2YNYA 1M56D 2RN0A 2XDJA 1N7SA 1NTMK 3HE5A 3IAOA 3RK3B 5CCHD 2GA1A 5AW6B 3I55P 4W80A 1BCCJ 3VMZA 1RE3C 2RMZA 4ZKUA 2YKOA 3CCQP 3BCCE 5AVQB 1NH4A 3H1HD 3P7KA 5E79H 5CCGA 2E75B 3C8VA 1NJIQ 2R5DA 3PTZA 2ZT9D 3U1AA 1YITP 2YO3A 2V4HA 1MUUA 4WVZA 2E42A 1FJPA 3EFGA 3H1ID 2Q7CA 3TNUA 1A02J 4WB4A 5CMZA 1HWTC 1OVUA 2QJYC 3R4YA 3NMDA 3L73E 1KTMA 4QMAA 2OYHA 1U7JA 2Y0EA 1ZRTD 3E1RA 4IFMA 1QL2A 3LIDA 4U3FE 2OYHB 5CCGD 1OX3A 3N7NA 2FYUG 5APXA 2KOGA 3JCUH 2NPSA 3OW2O
chains in the Genus database with same CATH topology
1CI6B 1CI6A 2HFED 2R32A 1N7SC 2IFNA 2VRSA 3II6A 1OWAA 1XTGB 5APSA 1GL2B 2FKWB 2P2UA 2QM7A 2PP6A 1SQVK 4N78E 1JO5A 1J1DC 3L36A 2J59M 4LLHA 3BATA 2MJZA 2N1TC 2N9BA 2C9NY 1JY3O 3MD0A 1N7LA 1LTTC 1IK9A 1GTWA 4O9BA 4W7YA 2WPRA 4XE5B 3MTUE 3A2AA 4GIFA 3MIWA 1HGVA 1LT9A 1LTBC 5CJ0A 1N7SB 2H8PD 2HG5D 3CLQA 1HUCA 1SLQA 3OJAB 1LTGC 1DEBA 5AVYB 4C46A 4WY4A 2WZ7A 1CW5A 4WY4B 3TNUB 1IO4A 3PP5A 4LC1A 2YKQA 1SQPK 1SFCB 1URQA 1LTJB 4N3YB 2NPSD 2OYHC 5AW5B 1RY3A 4C7NB 4C7NA 2JJLA 2N1TD 5AVZB 1JUNA 2KP8A 1FBMA 2KB7P 1NAFA 3B5ND 5APVA 3C9IA 3V4QA 1SVFA 3BASA 3HE4B 3RK2C 1URQC 3M0AA 5KLVK 4HH2A 1JCDA 1IFNA 1FZCA 2N1TA 1IC2A 3P8MC 3TK1A 2W6AA 5APTA 1FJKA 3NTNA 2ZFCA 4C7RA 1Z56A 3KYQA 1LGHB 1M7LA 1URQD 4OH8B 1GK6A 1JMMA 2W6BA 5AW4B 3V2NA 5KJ7D 1N7SD 2OYIA 3HTKB 1T2KD 3HTKA 3OAKA 4B86A 3RK2D 1FAVA 1T3JA 3G3ZA 1IFIA 2WSEH 1WT6A 1MZ9A 5AVSB 3RK2B 5APUA 1FZCC 1GZLA 1GU4A 4WY4C 1G2CB 2Z5IA 3HD7D 4EOTA 2LKMA 3I5CA 3RL0D 1URQB 4I1LA 1L0NK 2WSFH 4LGDE 2E43A 4I2LC 5CCHC 1QL1A 2OYIC 2XZRA 1SQBK 1N86A 1M1JA 1YTZT 1CZQA 2A45I 5BU8B 4WBAA 1X79B 1AFOA 1J1DB 5APQA 4XA4A 4KHXA 1ZV8A 1H89A 2YO2A 4IFDK 4GT1A 3B5NB 3VN0A 1ZLLA 1HVVA 1SFCC 1LTJC 1JY2N 3V2PA 1J1EB 1JTHA 2P67A 4JYBA 2WPSA 1GDTA 2XV5A 1HBWA 1X9VA 2NPSB 1T2KC 1KILC 2O1KA 5AW7B 3V5BA 5CCHA 4WY4D 3M0DA 5AW2B 1EQ7A 2FYUK 2KLVA 1GW4A 1HH0A 2GM4A 1SQQK 2C0WA 2H7HA 1ZR4A 1LWUB 1LTSC 1NWQA 3T97A 1DH3A 2OARA 5AW3B 1NKZB 2BASA 3HUSA 1JCCA 4N6JA 1J1EC 1CSBA 2WPQA 1JNMA 3H32B 3MUDA 1NTKK 5APWA 1NKNA 1FU1A 3TSIA 3A5TA 1SQXK 1L4AA 2WWWA 4Y99C 3U59A 2A45G 3H6PA 1LT9B 4I6MC 3VMYA 1NHLA 5CHXA 1XTCC 1LTAC 1FZEA 1OXZA 3R2PA 3M91A 1JY3N 5KTBA 2M3BA 3HUSC 1RE4A 3KDPB 1MV8A 1GL2D 2FFDC 2FXMA 1NTZK 2WSCH 2Q9IA 5AW9B 3VP9A 3IR9A 3P8CD 2Q3IA 1YTZI 1SFCA 3P8CE 2HPCB 3HD7C 1N73A 1JTHB 1X8YA 2GUSA 2WT7A 3V2QA 4EIJA 1KILA 1FDMA 3VMXA 1L4AC 3HRNA 1AQ5A 1FZAA 3L35A 3B8EB 3P32A 1NO4A 5AVTB 1LWUA 2HLOA 4AYCA 5KJ7C 2HYNA 1RF1C 2KSJA 1H88A 5APYA 5AVVB 2L5GB 3EQ2A 3HE4A 3RK3D 3U1CA 1HJBA 1RE4C 4DZOA 3HUSB 1WRGA 1FZGA 1N73C 1N2DC 1KQLA 1GD2E 1HTLC 3BRTB 1FZBA 3M9HA 2O1JA 3M9BA 3H32A 4GKGA 1IFJA 5CJ4A 1JOCA 2XU6A 1L4AB 4JYCA 4Y99B 3N4XA 3WMM0 1GL2A 1M1JC 3KPEA 5CCGC 3V4WA 1KFNA 3B5NC 1JY2P 1J2JB 2JEEA 2H43A 3MGNA 5BVZA 1FOSE 1SFCD 1G1JA 2IX7C 5AW0B 3UIAA 3CI9A 5AW1B 5AVWB 3M9QA 4RESB 3A7OA 1GU5A 1NOHA 1PFIA 2YKPA 5AVRB 1LTJA 3RL0B 3KQGA 1RF0A 1ZN5A 3GHGB 3HD7B 1N73B 3NXSA 3OA7A 1IJDB 2POHA 3VP8A 2HODA 2WT7B 2QM8A 3V2RA 2HODB 2ZXEB 1KILB 1NU1K 1GW3A 2CPSA 3L4FA 1L4AD 3L37A 1E5WA 3M0DC 2M8RA 3M06A 1VPCA 2R3CA 4DOJA 2WTYA 5AVXB 1RF1B 4ZKPA 1LWUC 2GUVA 1DX7A 4W7ZA 2O01H 1IFMA 2KYVA 1RF0C 3RL0C 1T3UA 3GHGC 3SWYA 2XNXA 2R5BA 5BU5A 4AUWA 1LT9C 3IFMA 2J58A 1A02F 5AW8B 1JY3P 3HE5B 1SP4A 5AVUB 4HYTB 2OYIB 1RE3A 2XKMA 3VOPA 1GL2C 1G1IA 1L0LK 3E1IA 4JF7A 1HGZA 3BVHA 3B5NA 3BRVB 3LW5H 2W27A 1KZUB 4N78D 2CPBA 1KILD 1FZCB 2N1TB 1T8ZA 1KFMA 1S9KD 1LTIC 1ZR2A 1S9KE 2P1JA 2Z5HA 2FFDA 1VDFA 2FFDB 2C9LY 2I1JA 2PAJA 3GHGA 3HD7A 3LIEA 3RK3C 3CL3D 1IFDA 3A3YB 2FYZA 3TYYA 2I1KA 1MFZA 1M1JB 1GK4A 4M3LA 2WITA 1W2EA 2Z4EA 2A45H 5KJ7A 1RF1A 1FOSF 3VTPC 1G2CA 2Q5UA 1FZFA 2P7JA 3NFQA 2C0XA 2IPPA 4IFFA 2IFMA 3O8ZA 1H8AA 1YYCA 2HPCA 1JY2O 3SWFA 2NPSC 3VYIA 2YNYA 2XDJA 1N7SA 1NTMK 3HE5A 3RK3B 5CCHD 5AW6B 4W80A 3VMZA 1RE3C 4ZKUA 2YKOA 5AVQB 1NH4A 3P7KA 5CCGA 2R5DA 3U1AA 1FJPA 2YO3A 1MUUA 2E42A 3EFGA 2Q7CA 3TNUA 1A02J 4WB4A 5CMZA 1HWTC 3NMDA 2OYHA 4IFMA 2OYHB 1QL2A 3LIDA 5CCGD 3N7NA 2YMYA 5APXA 2KOGA 4AQRD 2NPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HTK B;  2HFE D;  1N7S C;  3RL0 C;  1GL2 D;  3RK2 D;  1T3J A;  3RK2 B;  1XTG B;  1GL2 B;  1SFC A;  3P8C E;  3HD7 C;  1JTH B;  4WY4 C;  2PP6 A;  3HD7 D;  4N78 E;  3VOP A;  1GL2 C;  3RL0 D;  1URQ B;  1KIL A;  4JF7 A;  2N1T C;  4LGD E;  5CCH C;  3B5N A;  1L4A C;  1KIL D;  2N1T B;  4W7Y A;  5KJ7 C;  3RK3 D;  1N7S B;  3HD7 A;  3RK3 C;  2H8P D;  2HG5 D;  3B5N B;  1SFC C;  1HVV A;  4WY4 A;  1JTH A;  2WZ7 A;  1L4A B;  4WY4 B;  1GL2 A;  3PP5 A;  2NPS B;  1KIL C;  1SFC B;  1URQ A;  2NPS D;  5KJ7 A;  5CCG C;  5CCH A;  3B5N C;  4WY4 D;  1N7S D;  1SFC D;  2N1T D;  2KOG A;  3B5N D;  2NPS C;  3RL0 B;  2XDJ A;  1N7S A;  3RK3 B;  3HD7 B;  5CCH D;  4W80 A;  3RK2 C;  1URQ C;  1KIL B;  5CCG A;  1L4A D;  2N1T A;  3TSI A;  2M8R A;  3M0D C;  1L4A A;  3KYQ A;  1URQ D;  4OH8 B;  1NHL A;  5CCG D;  2YMY A;  5KJ7 D;  4W7Z A;  2NPS A; 
#chains in the Genus database with same CATH topology
 1CI6 B;  1S1C X;  2B87 A;  1SQB J;  2K9J B;  4OWF A;  4YTP C;  1CI6 A;  1NTZ E;  2B87 B;  2HFE D;  2K9J A;  2R32 A;  3CX5 I;  1L0L D;  1N7S C;  4H44 B;  2IFN A;  2VRS A;  3VMA A;  1Q82 Q;  1L0N J;  3II6 A;  3KXD A;  3CX5 H;  5L8R J;  1M1K Q;  1OWA A;  3V6I A;  5B5E E;  4IL6 E;  1VQ4 P;  2FYN B;  1WMK A;  1W5C E;  1XTG B;  1GL2 B;  2IYO A;  2FKW B;  5APS A;  3EFF K;  1KYO I;  3H1J J;  3JC2 2;  2IBZ I;  2IYP A;  5KKZ B;  3H1K E;  5DJU B;  2ZYD A;  1PPJ E;  2P2U A;  2WSE J;  2QM7 A;  3BCC J;  1K04 A;  1QGK B;  2PP6 A;  1SQV K;  4N78 E;  3TF5 A;  1J1D C;  2WSC J;  3KZI E;  2J59 M;  3L36 A;  4UB8 H;  1FC2 C;  2M0B A;  1JO5 A;  2Y0C A;  4LLH A;  3BAT A;  1NTM D;  1ZP0 C;  2MJZ A;  1OW6 A;  2N1T C;  1JY3 O;  2N9B A;  3AE2 C;  1N7L A;  3MD0 A;  4BXL A;  2C9N Y;  1NTK E;  4HKZ H;  1N8R Q;  2WQY C;  2FYU J;  1LTT C;  4MN4 C;  1IK9 A;  2P10 A;  2YIU C;  1NU1 E;  2QRX A;  3A0B H;  1GTW A;  4O9B A;  1K73 Q;  4HB1 A;  5B66 H;  1FDI A;  5GTH H;  1NTM J;  2K37 A;  2YMY A;  1EC5 A;  4KT0 J;  4PD4 E;  4W7Y A;  4TT3 H;  2WPR A;  4XE5 B;  3MTU E;  3H1J E;  1JMB A;  3A2A A;  4AQR D;  4GIF A;  1OIP A;  3MP7 B;  3MIW A;  1HGV A;  1LT9 A;  1H0T A;  1LTB C;  1HJ0 A;  3WUU A;  2LXB A;  5CJ0 A;  1N7S B;  1R5S A;  2H8P D;  1EDJ A;  2HG5 D;  1T6A A;  3CWB J;  1VQ5 P;  1L2P A;  3CLQ A;  5TIS E;  2ZVO B;  2QE7 H;  1KMI Z;  1YI2 P;  3IF4 A;  2V7Q J;  1HUC A;  1KOR A;  2ZVN B;  1SLQ A;  2M5A A;  4JPZ B;  3S4R A;  2ZXX A;  3OJA B;  1LTG C;  2K3R A;  3L75 D;  3H1L J;  1DEB A;  5AVY B;  1PZQ A;  3L72 G;  4C46 A;  4WY4 A;  1UIX A;  2O01 N;  2WZ7 A;  1CW5 A;  1EDI A;  1SQQ G;  4WY4 B;  1VQ7 P;  1QVG O;  2YIU B;  3TNU B;  1IO4 A;  1IZN B;  3PP5 A;  4LC1 A;  2YKQ A;  1SQP K;  1SQV E;  1SFC B;  1URQ A;  3PRJ A;  1LTJ B;  4N3Y B;  3W67 A;  2NPS D;  3AE8 C;  1AVO A;  2K9Y A;  2OYH C;  3A0H E;  2SPZ A;  3G6E P;  5AW5 B;  4L74 A;  1KB9 I;  1RY3 A;  5KAI E;  1NTZ D;  4C7N B;  2E5T A;  1BCC D;  2WSF J;  1L0L E;  4C7N A;  2JJL A;  2N1T D;  5AVZ B;  5KLI C;  1BCC E;  3SSU A;  2KNC B;  3TGU E;  1YQ3 C;  1PPJ D;  2QA4 P;  1EDL A;  2KP8 A;  2KNC A;  1SS1 A;  3CC4 P;  1FBM A;  2O01 J;  3AE5 C;  1EXI A;  2KB7 P;  3G9R A;  2I8D A;  1NAF A;  1LJ2 A;  4H0L D;  4PD4 I;  2E76 B;  4DJG A;  2QEX P;  1VQL P;  1SQP J;  3L70 J;  3B5N D;  2FYN C;  2E5Y A;  1QLE D;  4OGQ C;  1OW7 A;  5APV A;  1BSN A;  3USS A;  3F89 A;  2OTJ P;  3WU2 E;  1PP9 E;  3C9I A;  2V7Q H;  1KQG B;  3CCM P;  1MFT A;  1R5L A;  4PJ0 H;  3V4Q A;  3H1I E;  1SVF A;  3BAS A;  3RL0 g;  3CCL P;  3HE4 B;  5C39 A;  3RK2 C;  1AQT A;  3BCC D;  1URQ C;  3M0A A;  1EDK A;  5KLV K;  2FY8 A;  4HH2 A;  1NTK D;  1E79 H;  4R4L A;  1JCD A;  1IFN A;  1L0L J;  1FZC A;  2N1T A;  4L73 A;  1IC2 A;  3P8M C;  3TK1 A;  4A7P A;  5KAF H;  2W6A A;  5APT A;  4GOF A;  1FJK A;  3FGA D;  3CPW O;  3NTN A;  2IZ0 A;  3CC2 P;  2ZFC A;  4C7R A;  4OVN F;  1QVF O;  1Z56 A;  2E74 B;  3KYQ A;  1LGH B;  1LT1 A;  1M7L A;  1URQ D;  2WSS H;  1GK6 A;  2JR8 A;  3C1L A;  1JMM A;  3H1J D;  3L73 J;  2W6B A;  4OH8 B;  5GTH E;  3Q5P A;  2KS1 B;  3CCS P;  3L74 G;  5AW4 B;  2KS1 A;  3V2N A;  3AEE C;  5KJ7 D;  1N7S D;  3L75 E;  2OYI A;  2YMK A;  1X22 A;  3HTK B;  1T2K D;  3HTK A;  3B4S A;  3OAK A;  4EI2 A;  3L71 J;  5KLV J;  4B86 A;  3FXE A;  3RK2 D;  1FAV A;  2WPV B;  3G4S P;  1T3J A;  3G3Z A;  1IFI A;  2WSE H;  4NPE A;  1WT6 A;  1MZ9 A;  5AVS B;  2AXT H;  2KSE A;  2M5A B;  2QIW A;  2Y9Y A;  3CWB D;  3RK2 B;  1KN7 A;  3L75 G;  1UII A;  3MHV A;  5APU A;  1KYO E;  1YQ4 C;  3AE3 C;  4KJM A;  1GZL A;  2KI7 B;  4BRY B;  1FZC C;  4OGQ D;  3CXH I;  1GU4 A;  1SQX G;  4WY4 C;  1G2C B;  1DD4 A;  2Z5I A;  1SQV D;  3HD7 D;  4EOT A;  2LKM A;  3I5C A;  1P84 D;  3PLN A;  1Y47 A;  3Q5S A;  2WVR A;  3RL0 D;  1Q90 D;  1URQ B;  1NTM E;  2CK3 H;  1VQ6 P;  3S9O A;  5DJT B;  2G3A A;  5EFW B;  4I1L A;  1L0N K;  2WSF H;  4LGD E;  1NU1 J;  2QG4 A;  4PV1 C;  4I2L C;  5CCH C;  2E43 A;  1KQS O;  2Q1K A;  1QL1 A;  2OYI C;  2XZR A;  1SQB K;  1NAY A;  1N86 A;  1PP9 D;  5KLI B;  3RGU A;  1BSH A;  1M1J A;  5M1B A;  3A0B E;  1YTZ T;  3GF3 A;  2QJK C;  2KZJ A;  1CZQ A;  1SQX E;  2A45 I;  5BU8 B;  4WBA A;  1SQX D;  1X79 B;  1AFO A;  2XND H;  1SQB D;  1J1D B;  3L74 D;  3MZW B;  2D2C B;  5APQ A;  1AA0 A;  4XA4 A;  2JDI H;  4KHX A;  1ZV8 A;  1H89 A;  1L0N D;  2YO2 A;  1ZW0 A;  4IFD K;  4GT1 A;  1JUN A;  3B5N B;  3O6Q A;  3VN0 A;  2K88 A;  1VF5 C;  3FX0 A;  3QH9 A;  3FWN A;  2MKV A;  1ZLL A;  4NPF X;  1U57 A;  3L74 J;  1K9M Q;  1VQ8 P;  1YBK A;  3H25 A;  1L0L G;  2IZ1 A;  1S4X A;  1S5L H;  1ZRT E;  1HVV A;  1SFC C;  1JY2 N;  1LTJ C;  3V2P A;  4ASV A;  1J1E B;  2ZT9 B;  1IFP A;  1X0T A;  1JTH A;  2P67 A;  4JYB A;  2DW3 A;  2JKV A;  1QX8 A;  2WPS A;  3CMA P;  2XV5 A;  1GDT A;  2G8Y A;  1HBW A;  1X9V A;  2NPS B;  1KQF B;  1T2K C;  4JBZ A;  1KIL C;  2AEM A;  2O1K A;  5TJH A;  5AW7 B;  3AEG C;  1SQQ E;  2PGD A;  3V5B A;  5CBN A;  2WMM A;  5CCH A;  1FS0 E;  3L72 J;  1PGJ A;  4WY4 D;  1S3J A;  1TU3 F;  2JWD A;  3M0D A;  5AW2 B;  1EQ7 A;  2Q3E A;  2FYU K;  4ZMD A;  2KLV A;  1GW4 A;  1HH0 A;  2OGU A;  2PRR A;  1D7M A;  4Y28 J;  2GM4 A;  1SQQ K;  1Y9B A;  3CX5 D;  2ITA A;  2C0W A;  2H7H A;  2AXT E;  2E75 C;  1ZR4 A;  3H1I G;  2K1A A;  1LWU B;  1EXJ A;  1LTS C;  1VF5 B;  1VQP P;  3T97 A;  1NWQ A;  1DH3 A;  2OAR A;  3AE9 C;  1Q2N A;  5AW3 B;  1KYO D;  2NZ2 A;  2R3S A;  1NKZ B;  1RQU A;  2BAS A;  3T97 B;  3D6Z A;  4GOD A;  2QJY B;  4RKU J;  3HUS A;  1JCC A;  1PV3 A;  1J1E C;  1CSB A;  3GMA A;  4N6J A;  3WU2 H;  1USD A;  4IL6 H;  2WPQ A;  1SQQ J;  1JNM A;  2D2C D;  2QJP B;  5H2F H;  3CCE P;  4IL6 X;  3GW6 A;  3H32 B;  1KV4 A;  2YXR B;  3RK3 E;  3MUD A;  3WUV A;  1NTK K;  5APW A;  1NKN A;  1FU1 A;  3TSI A;  2KIK A;  2KXP B;  1DEE G;  3L74 E;  3A5T A;  2FXP A;  3GLM A;  3L75 J;  1SQX K;  1L4A A;  2WWW A;  4L75 A;  4Y99 C;  1NGM B;  1OVV A;  3U59 A;  5CBO A;  1SQV G;  2A45 G;  3B71 A;  1LT9 B;  3H6P A;  4Z1M H;  3CCR P;  4K3A A;  4YXW H;  3Q5R A;  1OW8 A;  4EYY Q;  4I6M C;  3VMY A;  1W2B O;  1NHL A;  1EZV I;  1OMI A;  1KYO H;  5CHX A;  4R4M A;  2E76 C;  2W8Z A;  2OTL P;  1XTC C;  1NTZ J;  3CC7 P;  1LTA C;  1JM0 A;  2KZI A;  1FZE A;  1OXZ A;  2NRG A;  3R2P A;  3M91 A;  1JY3 N;  5KTB A;  1LP1 A;  1PGO A;  2M3B A;  3HUS C;  1NTM G;  1RE4 A;  1MV8 A;  1GL2 D;  2AEF A;  1K05 A;  3JSV C;  3KDP B;  3GG2 A;  4BWN A;  4D6T D;  4UB6 H;  3D71 A;  2FFD C;  2FXM A;  1NTZ K;  2WSC H;  2Q9I A;  2JP3 A;  5AW9 B;  3VP9 A;  3CXH H;  3IR9 A;  2QSI A;  3P8C D;  4H44 D;  2Q3I A;  3SFD C;  1YTZ I;  1SFC A;  3P8C E;  2HPC B;  3HD7 C;  2ZT9 C;  1N73 A;  1JTH B;  3AED C;  1DIP A;  1QEX A;  2M3E A;  1SQX J;  1X8Y A;  1FE6 A;  2FBW C;  2GUS A;  2WT7 A;  3V2Q A;  3CME P;  1BCC G;  1NTK J;  1KIL A;  3MUD C;  4EIJ A;  1FDM A;  2QJK B;  1PL5 A;  3VMX A;  2IDB A;  1FZC B;  1L4A C;  1ZOY C;  3BCC G;  3CX5 E;  3HRN A;  1AQ5 A;  5KAF E;  2R44 A;  1FZA A;  2QVA A;  3L35 A;  2LXC B;  3B8E B;  4WWI A;  5KKZ C;  4HJG H;  1DD3 A;  3P32 A;  1NO4 A;  1S5L E;  1LWU A;  2HLO A;  3H1K J;  4GDO A;  2HYN A;  5AVT B;  1BE3 J;  4AYC A;  5KJ7 C;  2KSJ A;  1RF1 C;  1H88 A;  4L76 A;  5APY A;  1PGP A;  3L72 E;  2FYU D;  2ZJS E;  2L5G B;  5AVV B;  3EQ2 A;  3HE4 A;  3RK3 D;  1YJN P;  3D6Y A;  1NU1 D;  3U1C A;  2OTK E;  1RE4 C;  3ITK A;  4DZO A;  3Q3D A;  1HJB A;  3HUS B;  3L71 D;  5KLV D;  1WRG A;  1NVO A;  4TLF A;  2B88 A;  1FZG A;  1N73 C;  1JB0 J;  1KQL A;  1N2D C;  2A06 D;  1YJ9 P;  1GD2 E;  1VQN P;  4I7Z C;  1KC8 Q;  1ZXG A;  1HTL C;  2Y9Z A;  3BRT B;  4H13 C;  1FZB A;  2QJP C;  2O1J A;  1SQQ D;  1PP9 G;  2RH0 A;  3H32 A;  1IFJ A;  2YXQ B;  3M9H A;  3M9B A;  4GKG A;  2N9Y B;  5CJ4 A;  3H1H J;  3Q2Y A;  2J5U A;  2P58 A;  1JOC A;  1P84 H;  2XU6 A;  3AEB C;  2OYO A;  1L4A B;  4JYC A;  4Y99 B;  3N4X A;  3WMM 0;  1GL2 A;  1H0T B;  3H1I J;  1M1J C;  3KPE A;  2KK7 A;  3FWL A;  3TGU G;  3WUT A;  5CCG C;  1NYH A;  1KFN A;  2KLU A;  3B5N C;  3V4W A;  4ASW A;  1JY2 P;  1J2J B;  2JEE A;  2OQQ A;  3AE6 C;  3MGN A;  5BVZ A;  1YJW P;  2H43 A;  1PP9 J;  1FOS E;  1SFC D;  1M8O B;  2W83 C;  3H1H G;  1LP1 B;  2Y0D A;  1G1J A;  3GF7 A;  2IX7 C;  3KHU A;  1P84 I;  4YPC A;  3LW5 J;  5AW0 B;  1SQP E;  3L70 E;  3UIA A;  1Q81 Q;  2B89 A;  3CI9 A;  4PJ0 E;  5AVW B;  5AW1 B;  2UWJ E;  3M9Q A;  4RES B;  1VL2 A;  2ZYG A;  3A7O A;  3QWO C;  2JO1 A;  1GU5 A;  1BE3 D;  1NOH A;  1PFI A;  1BGY E;  2YKP A;  2H88 C;  3L72 D;  5AVR B;  1LTJ A;  3RL0 B;  3KQG A;  3K5B A;  3TGU D;  1RF0 A;  1ZN5 A;  3GHG B;  3HD7 B;  1N73 B;  3NXS A;  4PD4 D;  3EWK A;  3OA7 A;  1PGQ A;  3CCV P;  1IJD B;  2POH A;  4OGQ B;  1JEK A;  2HOD A;  3VP8 A;  1LNQ A;  2QM8 A;  3V2R A;  2HOD B;  4H13 B;  2ZXE B;  2WT7 B;  1KIL B;  1NU1 K;  1GW3 A;  2CPS A;  2O3J A;  3L4F A;  3TGU J;  1YHQ P;  1K8A Q;  4UB6 E;  1BE3 G;  1L4A D;  5H2F E;  1KB9 D;  4RO0 A;  1Q7Y Q;  5B66 E;  3L37 A;  1E5W A;  1SQB E;  1OFC X;  1IK7 A;  1VPC A;  2M8R A;  2R3C A;  3M0D C;  3H1J G;  3E7K A;  3M06 A;  4U3F G;  4D6T J;  3CD6 P;  3CWB G;  4DOJ A;  2BEQ D;  3L71 E;  5KLV E;  1BDD A;  2WTY A;  5GTI E;  3RBX A;  3AEC C;  4BRY A;  5AVX B;  4CPG A;  1RF1 B;  1NU1 G;  4ZKP A;  1LWU C;  3KZI H;  4UB8 E;  2FXO A;  1S72 P;  2GUV A;  2KUB A;  1NTK G;  2BEZ F;  4W7Z A;  2O01 H;  1DX7 A;  1IFM A;  1YIJ P;  2ZAE B;  4IOI H;  2KYV A;  5E79 E;  1VQK P;  1FDO A;  2E74 D;  1RF0 C;  3RL0 C;  5B5E H;  1PIX A;  1AVY A;  1T3U A;  3GHG C;  3L73 D;  3RBZ A;  1OVR A;  2L91 A;  3SWY A;  4PV1 B;  4U7J A;  2XNX A;  2R5B A;  1RHZ B;  3ZDM A;  5BU5 A;  1MKM A;  4PV1 D;  1KD1 Q;  1AJY A;  1PPJ G;  3IN6 A;  3TDK A;  1VQM P;  2IBZ D;  3H1K G;  4AUW A;  1LT9 C;  3IFM A;  1Q86 Q;  2IBZ E;  2J58 A;  3I56 P;  1A02 F;  1EZV G;  3H1L D;  5AW8 B;  4GOE A;  3CXH E;  1JY3 P;  3HE5 B;  1AV1 A;  2W6J H;  1SP4 A;  5AVU B;  4HYT B;  2A06 G;  2OYI B;  3AEF C;  1RE3 A;  2XKM A;  3VOP A;  1GL2 C;  1L0N G;  1G1I A;  2H89 C;  3A0H H;  3L71 G;  5KLV G;  1BDC A;  2BCC E;  1L0L K;  3E1I A;  1NTZ G;  2AEJ A;  4JF7 A;  5GTI H;  1SQB G;  1HGZ A;  3BVH A;  2FYU E;  2E76 D;  3B5N A;  3BRV B;  3O6Q B;  1HF9 A;  3LW5 H;  1BGY J;  4H0L B;  2W27 A;  1SQV J;  1KZU B;  2D2C C;  3L73 G;  1L0N E;  2B9B A;  2CPB A;  4N78 D;  1KIL D;  1Y8A A;  4YXD C;  2N1T B;  1M90 Q;  4H13 D;  1RQV A;  2A06 E;  4ZNC A;  1T8Z A;  3Q1M A;  1KFM A;  2AXC A;  1LTI C;  1S9K D;  1ZR2 A;  2E75 D;  1S9K E;  2P1J A;  1BGY D;  2Z5H A;  3PJS K;  1VDF A;  2FFD A;  2FFD B;  2C9L Y;  2Q6Q A;  4RJT A;  3CCU P;  2RKL A;  2I1J A;  3G71 P;  1GMJ A;  2PAJ A;  1KB9 H;  1VQ9 P;  2HR3 A;  3GHG A;  3HD7 A;  1M57 D;  3LIE A;  3RK3 C;  3S1K A;  4EDF A;  3CL3 D;  5KAI H;  1IFD A;  1RH5 B;  3A3Y B;  1SQP G;  3L70 G;  4D6T G;  2FYZ A;  3F5H A;  4DT0 A;  3TYY A;  4U3F D;  2I1K A;  3H1H E;  3AEA C;  4PD4 H;  1MFZ A;  3FXD A;  3CCJ P;  1M1J B;  3W68 A;  1KB9 E;  4JQ0 D;  1ZME C;  3ABV C;  3H1L E;  1GK4 A;  3CXH D;  4U3F J;  4H0L C;  1OZH A;  2WIT A;  4M3L A;  1USE A;  1SQP D;  1W2E A;  3L70 D;  4NPD A;  2Z4E A;  3CWB E;  1VQO P;  3PHL A;  3AE1 C;  2A45 H;  5KJ7 A;  1RF1 A;  3D70 A;  1FOS F;  2BCC D;  2LR2 A;  3VTP C;  1G2C A;  5K5G B;  2Q5U A;  4D6T E;  1BE3 E;  4XFJ A;  1FZF A;  4DCK A;  2P7J A;  3NFQ A;  1R8E A;  2BCC G;  2ZYA A;  5TIS H;  2C0X A;  2W90 A;  4H44 C;  1S2E A;  2IPP A;  1P84 E;  2IFM A;  3O8Z A;  1VF5 D;  3AE4 C;  2BCC J;  4IFF A;  3SFE C;  1H8A A;  1KIL E;  1YYC A;  4K35 A;  1JY2 O;  2HPC A;  1S5L X;  3AE7 C;  3PH0 A;  3JCU E;  1EZV D;  3H1L G;  4I7Z B;  3SWF A;  1EZV E;  2NPS C;  2IBZ G;  3H1K D;  3SWK A;  1BGY G;  2E74 C;  1U7M A;  2JWA A;  3VYI A;  2PFX A;  2YNY A;  1M56 D;  2RN0 A;  2XDJ A;  1N7S A;  1NTM K;  3HE5 A;  3IAO A;  3RK3 B;  5CCH D;  2GA1 A;  5AW6 B;  3I55 P;  4W80 A;  1BCC J;  3VMZ A;  1RE3 C;  2RMZ A;  4ZKU A;  2YKO A;  3CCQ P;  3BCC E;  5AVQ B;  1NH4 A;  3H1H D;  3P7K A;  5E79 H;  5CCG A;  2E75 B;  3C8V A;  1NJI Q;  2R5D A;  3PTZ A;  2ZT9 D;  3U1A A;  1YIT P;  2YO3 A;  2V4H A;  1MUU A;  4WVZ A;  2E42 A;  1FJP A;  3EFG A;  3H1I D;  2Q7C A;  3TNU A;  1A02 J;  4WB4 A;  5CMZ A;  1HWT C;  1OVU A;  2QJY C;  3R4Y A;  3NMD A;  3L73 E;  1KTM A;  4QMA A;  2OYH A;  1U7J A;  2Y0E A;  1ZRT D;  3E1R A;  4IFM A;  1QL2 A;  3LID A;  4U3F E;  2OYH B;  5CCG D;  1OX3 A;  3N7N A;  2FYU G;  5APX A;  2KOG A;  3JCU H;  2NPS A;  3OW2 O; 
#chains in the Genus database with same CATH homology
 1CI6 B;  1CI6 A;  2HFE D;  2R32 A;  1N7S C;  2IFN A;  2VRS A;  3II6 A;  1OWA A;  1XTG B;  5APS A;  1GL2 B;  2FKW B;  2P2U A;  2QM7 A;  2PP6 A;  1SQV K;  4N78 E;  1JO5 A;  1J1D C;  3L36 A;  2J59 M;  4LLH A;  3BAT A;  2MJZ A;  2N1T C;  2N9B A;  2C9N Y;  1JY3 O;  3MD0 A;  1N7L A;  1LTT C;  1IK9 A;  1GTW A;  4O9B A;  4W7Y A;  2WPR A;  4XE5 B;  3MTU E;  3A2A A;  4GIF A;  3MIW A;  1HGV A;  1LT9 A;  1LTB C;  5CJ0 A;  1N7S B;  2H8P D;  2HG5 D;  3CLQ A;  1HUC A;  1SLQ A;  3OJA B;  1LTG C;  1DEB A;  5AVY B;  4C46 A;  4WY4 A;  2WZ7 A;  1CW5 A;  4WY4 B;  3TNU B;  1IO4 A;  3PP5 A;  4LC1 A;  2YKQ A;  1SQP K;  1SFC B;  1URQ A;  1LTJ B;  4N3Y B;  2NPS D;  2OYH C;  5AW5 B;  1RY3 A;  4C7N B;  4C7N A;  2JJL A;  2N1T D;  5AVZ B;  1JUN A;  2KP8 A;  1FBM A;  2KB7 P;  1NAF A;  3B5N D;  5APV A;  3C9I A;  3V4Q A;  1SVF A;  3BAS A;  3HE4 B;  3RK2 C;  1URQ C;  3M0A A;  5KLV K;  4HH2 A;  1JCD A;  1IFN A;  1FZC A;  2N1T A;  1IC2 A;  3P8M C;  3TK1 A;  2W6A A;  5APT A;  1FJK A;  3NTN A;  2ZFC A;  4C7R A;  1Z56 A;  3KYQ A;  1LGH B;  1M7L A;  1URQ D;  4OH8 B;  1GK6 A;  1JMM A;  2W6B A;  5AW4 B;  3V2N A;  5KJ7 D;  1N7S D;  2OYI A;  3HTK B;  1T2K D;  3HTK A;  3OAK A;  4B86 A;  3RK2 D;  1FAV A;  1T3J A;  3G3Z A;  1IFI A;  2WSE H;  1WT6 A;  1MZ9 A;  5AVS B;  3RK2 B;  5APU A;  1FZC C;  1GZL A;  1GU4 A;  4WY4 C;  1G2C B;  2Z5I A;  3HD7 D;  4EOT A;  2LKM A;  3I5C A;  3RL0 D;  1URQ B;  4I1L A;  1L0N K;  2WSF H;  4LGD E;  2E43 A;  4I2L C;  5CCH C;  1QL1 A;  2OYI C;  2XZR A;  1SQB K;  1N86 A;  1M1J A;  1YTZ T;  1CZQ A;  2A45 I;  5BU8 B;  4WBA A;  1X79 B;  1AFO A;  1J1D B;  5APQ A;  4XA4 A;  4KHX A;  1ZV8 A;  1H89 A;  2YO2 A;  4IFD K;  4GT1 A;  3B5N B;  3VN0 A;  1ZLL A;  1HVV A;  1SFC C;  1LTJ C;  1JY2 N;  3V2P A;  1J1E B;  1JTH A;  2P67 A;  4JYB A;  2WPS A;  1GDT A;  2XV5 A;  1HBW A;  1X9V A;  2NPS B;  1T2K C;  1KIL C;  2O1K A;  5AW7 B;  3V5B A;  5CCH A;  4WY4 D;  3M0D A;  5AW2 B;  1EQ7 A;  2FYU K;  2KLV A;  1GW4 A;  1HH0 A;  2GM4 A;  1SQQ K;  2C0W A;  2H7H A;  1ZR4 A;  1LWU B;  1LTS C;  1NWQ A;  3T97 A;  1DH3 A;  2OAR A;  5AW3 B;  1NKZ B;  2BAS A;  3HUS A;  1JCC A;  4N6J A;  1J1E C;  1CSB A;  2WPQ A;  1JNM A;  3H32 B;  3MUD A;  1NTK K;  5APW A;  1NKN A;  1FU1 A;  3TSI A;  3A5T A;  1SQX K;  1L4A A;  2WWW A;  4Y99 C;  3U59 A;  2A45 G;  3H6P A;  1LT9 B;  4I6M C;  3VMY A;  1NHL A;  5CHX A;  1XTC C;  1LTA C;  1FZE A;  1OXZ A;  3R2P A;  3M91 A;  1JY3 N;  5KTB A;  2M3B A;  3HUS C;  1RE4 A;  3KDP B;  1MV8 A;  1GL2 D;  2FFD C;  2FXM A;  1NTZ K;  2WSC H;  2Q9I A;  5AW9 B;  3VP9 A;  3IR9 A;  3P8C D;  2Q3I A;  1YTZ I;  1SFC A;  3P8C E;  2HPC B;  3HD7 C;  1N73 A;  1JTH B;  1X8Y A;  2GUS A;  2WT7 A;  3V2Q A;  4EIJ A;  1KIL A;  1FDM A;  3VMX A;  1L4A C;  3HRN A;  1AQ5 A;  1FZA A;  3L35 A;  3B8E B;  3P32 A;  1NO4 A;  5AVT B;  1LWU A;  2HLO A;  4AYC A;  5KJ7 C;  2HYN A;  1RF1 C;  2KSJ A;  1H88 A;  5APY A;  5AVV B;  2L5G B;  3EQ2 A;  3HE4 A;  3RK3 D;  3U1C A;  1HJB A;  1RE4 C;  4DZO A;  3HUS B;  1WRG A;  1FZG A;  1N73 C;  1N2D C;  1KQL A;  1GD2 E;  1HTL C;  3BRT B;  1FZB A;  3M9H A;  2O1J A;  3M9B A;  3H32 A;  4GKG A;  1IFJ A;  5CJ4 A;  1JOC A;  2XU6 A;  1L4A B;  4JYC A;  4Y99 B;  3N4X A;  3WMM 0;  1GL2 A;  1M1J C;  3KPE A;  5CCG C;  3V4W A;  1KFN A;  3B5N C;  1JY2 P;  1J2J B;  2JEE A;  2H43 A;  3MGN A;  5BVZ A;  1FOS E;  1SFC D;  1G1J A;  2IX7 C;  5AW0 B;  3UIA A;  3CI9 A;  5AW1 B;  5AVW B;  3M9Q A;  4RES B;  3A7O A;  1GU5 A;  1NOH A;  1PFI A;  2YKP A;  5AVR B;  1LTJ A;  3RL0 B;  3KQG A;  1RF0 A;  1ZN5 A;  3GHG B;  3HD7 B;  1N73 B;  3NXS A;  3OA7 A;  1IJD B;  2POH A;  3VP8 A;  2HOD A;  2WT7 B;  2QM8 A;  3V2R A;  2HOD B;  2ZXE B;  1KIL B;  1NU1 K;  1GW3 A;  2CPS A;  3L4F A;  1L4A D;  3L37 A;  1E5W A;  3M0D C;  2M8R A;  3M06 A;  1VPC A;  2R3C A;  4DOJ A;  2WTY A;  5AVX B;  1RF1 B;  4ZKP A;  1LWU C;  2GUV A;  1DX7 A;  4W7Z A;  2O01 H;  1IFM A;  2KYV A;  1RF0 C;  3RL0 C;  1T3U A;  3GHG C;  3SWY A;  2XNX A;  2R5B A;  5BU5 A;  4AUW A;  1LT9 C;  3IFM A;  2J58 A;  1A02 F;  5AW8 B;  1JY3 P;  3HE5 B;  1SP4 A;  5AVU B;  4HYT B;  2OYI B;  1RE3 A;  2XKM A;  3VOP A;  1GL2 C;  1G1I A;  1L0L K;  3E1I A;  4JF7 A;  1HGZ A;  3BVH A;  3B5N A;  3BRV B;  3LW5 H;  2W27 A;  1KZU B;  4N78 D;  2CPB A;  1KIL D;  1FZC B;  2N1T B;  1T8Z A;  1KFM A;  1S9K D;  1LTI C;  1ZR2 A;  1S9K E;  2P1J A;  2Z5H A;  2FFD A;  1VDF A;  2FFD B;  2C9L Y;  2I1J A;  2PAJ A;  3GHG A;  3HD7 A;  3LIE A;  3RK3 C;  3CL3 D;  1IFD A;  3A3Y B;  2FYZ A;  3TYY A;  2I1K A;  1MFZ A;  1M1J B;  1GK4 A;  4M3L A;  2WIT A;  1W2E A;  2Z4E A;  2A45 H;  5KJ7 A;  1RF1 A;  1FOS F;  3VTP C;  1G2C A;  2Q5U A;  1FZF A;  2P7J A;  3NFQ A;  2C0X A;  2IPP A;  4IFF A;  2IFM A;  3O8Z A;  1H8A A;  1YYC A;  2HPC A;  1JY2 O;  3SWF A;  2NPS C;  3VYI A;  2YNY A;  2XDJ A;  1N7S A;  1NTM K;  3HE5 A;  3RK3 B;  5CCH D;  5AW6 B;  4W80 A;  3VMZ A;  1RE3 C;  4ZKU A;  2YKO A;  5AVQ B;  1NH4 A;  3P7K A;  5CCG A;  2R5D A;  3U1A A;  1FJP A;  2YO3 A;  1MUU A;  2E42 A;  3EFG A;  2Q7C A;  3TNU A;  1A02 J;  4WB4 A;  5CMZ A;  1HWT C;  3NMD A;  2OYH A;  4IFM A;  2OYH B;  1QL2 A;  3LID A;  5CCG D;  3N7N A;  2YMY A;  5APX A;  2KOG A;  4AQR D;  2NPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...