3RL0B

Truncated snare complex with complexin (p1)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
59
structure length
59
Chain Sequence
ALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 2
publication title Complexin cross-links prefusion SNAREs into a zigzag array.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/exocytosis
total genus 27
structure length 59
sequence length 59
chains with identical sequence F, J, N, R, V, Z, d
ec nomenclature
pdb deposition date 2011-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3rl0B00
1N7SA 1GL2A 4JF7A 5CCGC 1KILA 2M8RA 5CCGD 3RL0B 3RK3B 2NPSA 2XDJA 5CCHA 5KJ7C 3VOPA 3RK2B 3RK3C 3RL0C 1JTHB 3HTKB 5KJ7D 3RL0D 3RK3D 4LGDE 5CCGA 3M0DC 3HD7C 1NHLA 3PP5A 3HD7D 1SFCB 2KOGA 1XTGB 1URQB 3B5NB 1L4AB 4N78E 1SFCC 1JTHA 1URQC 3B5NC 3HD7A 4WY4B 3B5ND 1GL2B 3RK2C 4W7YA 2HFED 1KILB 3RK2D 4W80A 4WY4C 1GL2C 4WY4D 2N1TB 5KJ7A 1HVVA 1T3JA 3B5NA 2YMYA 2N1TC 4OH8B 2N1TD 1SFCD 3P8CE 1L4AC 1URQD 1N7SB 4WY4A 1L4AD 3TSIA 2WZ7A 2NPSB 1N7SC 2PP6A 1N7SD 1GL2D 1KILC 2N1TA 2H8PD 1SFCA 1KILD 2NPSC 1URQA 2NPSD 4W7ZA 5CCHC 3HD7B 1L4AA 5CCHD 2HG5D 3KYQA
chains in the Genus database with same CATH superfamily
1R5LA 3AE9C 1J1EC 4NPDA 3BCCE 1VL2A 1DD3A 3TYYA 2XDJA 1NH4A 1Q86Q 3L75J 3RK3D 1KYOH 1FZEA 1EZVD 2OYIA 2I1KA 2KUBA 5B5EH 3TDKA 1LJ2A 3I5CA 4PD4H 1CSBA 1JMBA 1PPJD 4RJTA 1BGYJ 3CCUP 1KN7A 2KSJA 1QL1A 1KB9D 3MUDA 5BVZA 3HTKA 2XV5A 5AW9B 4TT3H 2I1JA 3BCCG 3G4SP 1FZCB 1OW8A 2NZ2A 1SQXD 4U7JA 3Q2YA 3GG2A 2NRGA 1GL2C 3CX5E 3PHLA 1OW6A 4HKZH 3E7KA 2P1JA 3AE4C 2Q1KA 2A45I 1HGVA 3M0DA 1JOCA 3P8CD 4WY4A 1BCCE 2K9YA 1VQ9P 4A7PA 1BSNA 1N7SC 4RESB 1GL2D 4DJGA 1SQPJ 3H32A 3CMAP 2BCCE 1VQMP 3L75E 3BRVB 1OIPA 3II6A 2J59M 1OVVA 2W6BA 4JYBA 5AVQB 2WTYA 1P84H 2H89C 3KPEA 1FC2C 3VTPC 1RE3A 1Z56A 1NTKD 1G1JA 3RK2B 1BCCG 2P67A 5AW7B 1OFCX 3GF3A 2KNCA 3WU2E 1JY3N 5AVWB 1J1DB 3M9BA 2WSCH 3Q5SA 2WITA 3CMEP 1K04A 4H13B 3L75G 1AQ5A 3H6PA 2W8ZA 3IR9A 1IFIA 1SFCC 3H1LJ 2RKLA 1YJNP 4UB6E 1BGYG 1HJBA 2AXTE 4OVNF 2OYHB 3M9QA 1MKMA 1EZVI 2Y9ZA 3MGNA 1M1JB 2E74D 1X22A 1SQPE 1PP9D 2Y9YA 1SFCD 2FY8A 2Q3IA 1L0LD 3Q5PA 2WSEH 4AYCA 4U3FG 1YJ9P 1M1KQ 1YQ3C 1NU1K 1KB9I 4XFJA 4AUWA 1S4XA 3H1KD 4PD4D 1IFDA 1NU1J 1SQXJ 2D2CB 2K37A 2OYIC 4Y99C 1JM0A 2IDBA 1SQPG 5H2FE 3G6EP 3M0AA 4OGQC 2KLUA 4K3AA 3LW5J 3S9OA 4GDOA 2AXCA 3VOPA 5KJ7D 2OYOA 3MUDC 1KQFB 3H1LE 1HH0A 3D70A 3U1CA 1NHLA 1LT9A 2KS1B 2WPVB 2ZXEB 1GU4A 4OGQD 1FDIA 3GHGB 4N78D 3RK3E 2FFDA 2OTKE 4BRYA 2OTLP 2W90A 1FU1A 4WY4C 1QVFO 2OARA 3FWNA 3A0BE 1QLED 3H1LG 4L75A 1A02F 5KLIC 1PV3A 3WUUA 5KKZB 4C46A 5AVVB 1P84D 5APVA 4IL6E 1Q81Q 5AVZB 1NU1E 1SQXE 3PTZA 2WMMA 2NPSB 1T2KC 3AECC 4UB6H 1FOSE 1KILD 1RE3C 3AE6C 3EFGA 3K5BA 3OJAB 4I2LC 2C0XA 2JJLA 2KXPB 2YNYA 5BU5A 1FDOA 3USSA 3AE3C 1GZLA 3BCCD 3W68A 4C7NB 2QJPB 3A0HE 1HWTC 1NU1G 1SQXG 1W5CE 4L74A 4IOIH 1L0LJ 4BXLA 1U57A 2B9BA 4H0LC 2KB7P 3CCJP 4H44D 5KLVJ 3PP5A 3HD7D 4N3YB 1OW7A 1YIJP 4PD4I 3H1KJ 2POHA 4HJGH 1JTHA 2B88A 1NWQA 1LTJB 1LGHB 2QIWA 1X8YA 2YIUC 3AE8C 2O01J 1NTZJ 3CX5D 2JP3A 2WPRA 2YXRB 1SQQK 4YXWH 2OYIB 4Y99B 2E75C 1NTMK 1L4AD 2IBZE 3EQ2A 1ZXGA 1KD1Q 2XKMA 2P58A 3BVHA 2W83C 2ZFCA 2QJYB 2JDIH 2ZYAA 2QE7H 1SS1A 1SQQJ 5M1BA 2BCCD 1SQBK 1G2CB 3PRJA 4EOTA 4O9BA 3L75D 1NTMJ 1LWUA 1W2EA 3A0BH 5APXA 1H89A 2E75D 1HUCA 1GL2A 5KLVE 2QVAA 1KYOE 4IFFA 2Z5HA 1LT9C 5CJ0A 1P84I 4IL6H 3SWFA 1HF9A 2IBZG 5B5EE 1VF5C 2K9JA 4PV1D 2CPBA 2QSIA 4UB8E 2CK3H 3LW5H 1PFIA 2FFDC 1ZP0C 4C7RA 3V2PA 1PP9G 2QRXA 1NTZE 5AW2B 3H32B 3CC7P 1L0LG 3B5NB 4DOJA 2WSCJ 5KLVG 3GMAA 3H1KG 1ZR4A 3C1LA 4JQ0D 4I7ZC 1HBWA 3SFEC 1DH3A 2N1TB 1HGZA 2IYPA 2N9YB 4ZNCA 3AE5C 4I1LA 4HB1A 1NO4A 2QA4P 3CWBE 3CLQA 1CZQA 1SP4A 1SQQE 2KNCB 1USDA 1H88A 2ZVOB 1NTME 3U1AA 2FYNC 3TNUA 1NTZG 3VP8A 2QJKB 3V5BA 2O1JA 2W27A 3ABVC 1KQGB 3AE2C 2H8PD 2WSEJ 1SFCA 3D71A 1SQBE 1SQVK 2B87A 2B89A 5APYA 1MV8A 3CX5I 5AVRB 1NYHA 1PGOA 2P2UA 1IK7A 1N7LA 1SQQG 1FE6A 3RL0B 2WSSH 3IN6A 3OA7A 4WBAA 4HH2A 3RK3C 3CCMP 2LKMA 1EDIA 3L72D 3P7KA 1RF1B 2FYUJ 1PGPA 1AVOA 3V2NA 1ZRTE 4L76A 2BCCJ 3AE7C 4NPFX 4H13D 1GDTA 4GIFA 1GW3A 4UB8H 2FXMA 1KC8Q 5AW6B 1VQ4P 2R5DA 2O01H 2PRRA 3B8EB 5GTIH 1ZR2A 1OVRA 1LWUC 1NU1D 4IL6X 2UWJE 3WUTA 2ZVNB 3AEAC 2QG4A 1KQSO 1CI6A 2JWAA 2V4HA 1GD2E 1YI2P 1DIPA 4BRYB 5CCHD 3AEGC 3MHVA 2FYUE 3JC22 1M90Q 3F5HA 1KILA 3L73E 2I8DA 3H1HD 2ZT9B 2K88A 2D2CD 2HODA 5BU8B 1OX3A 1U7MA 1OZHA 2M3EA 3WUVA 3H1IJ 1JY2O 4I7ZB 5KAFH 4LGDE 2IZ0A 3OAKA 2H7HA 3KZIE 1FS0E 2Q5UA 2MKVA 1BE3D 3PH0A 3CCVP 4B86A 2E76D 1S5LH 2WT7B 2FYUG 1G1IA 5E79H 1KORA 3BASA 2GA1A 1URQC 2A06D 3HD7A 1VQKP 3IAOA 3L70E 1LT1A 3TF5A 1PIXA 3S1KA 4GOFA 2BCCG 4ASWA 4D6TJ 2WPQA 2J5UA 2E74C 2ZXXA 2O1KA 2QM7A 1JY2P 2ZYDA 4OH8B 3L72J 1R8EA 2R3CA 2E43A 1URQD 2IFNA 5CJ4A 3RL0g 2IBZD 2QM8A 5DJUB 4RO0A 2IPPA 3CI9A 1Q7YQ 1H0TA 1J2JB 2NPSD 3E1IA 1L4AA 3H1IE 1J1EB 4OWFA 4I6MC 1FZAA 4KHXA 5KLVD 3L71J 5CCGD 1WRGA 5KTBA 1JB0J 1KYOD 1VQNP 1LNQA 1RE4A 5KJ7C 3RBXA 2HYNA 4WWIA 3A7OA 3CXHH 3CCRP 3IF4A 3CC4P 1NTZD 3H1IG 1T6AA 4D6TE 2LXCB 3QWOC 3VMYA 1NJIQ 1LWUB 1HJ0A 3L72E 5AW1B 1GL2B 3ZDMA 1S72P 1L0NK 4W80A 3H1HJ 3G3ZA 2J58A 2YKOA 1HVVA 4ASVA 1X9VA 2K9JB 3CWBD 3KZIH 1ZMEC 3NXSA 1SQQD 1NTMD 1N7SB 3L74J 1DD4A 1FBMA 3RGUA 1GMJA 4D6TG 1S3JA 3PJSK 1BE3J 3L71E 4IFDK 1MFZA 1KILC 1LP1A 3L72G 4Z1MH 1NTKK 2YXQB 1Q90D 1SQBD 2AEMA 3BRTB 2ITAA 1JMMA 5K5GB 3M91A 2O01N 2R44A 2RN0A 1IK9A 4K35A 5B66E 3VMAA 4CPGA 3O6QA 3OW2O 5AW4B 5CHXA 2W6AA 2IBZI 3H1JJ 2ZJSE 3TNUB 3L71G 3AE1C 4H44C 2Z5IA 4ZKUA 1S2EA 3HUSC 3HD7C 5AVYB 3H1HE 2M0BA 1SFCB 1NKNA 1XTGB 1Q82Q 1FJPA 2A45H 1ZRTD 1HTLC 3QH9A 1GK6A 2P10A 3MD0A 3B5ND 2KIKA 1KYOI 1WT6A 2GUVA 3L74E 1Y9BA 1BE3E 1OVUA 4EYYQ 1S1CX 3AEEC 1RHZB 4TLFA 1DEEG 4BWNA 3N4XA 5TISH 2N1TD 1AVYA 2A06E 5DJTB 3H1HG 1L4AC 2AEJA 2RMZA 1X79B 1M7LA 1M57D 2BASA 3AEFC 3CXHD 3V2QA 3H25A 1AV1A 2G8YA 3L74G 1FZBA 1RE4C 3H1JE 4EIJA 1MUUA 1BE3G 3R2PA 4OGQB 2VRSA 2FYUD 3L73D 1PL5A 3TGUJ 2A06G 5CCHA 3GF7A 2H88C 3CC2P 1FOSF 2XNXA 3CWBJ 4PV1C 3HTKB 1JUNA 3RL0D 1SVFA 1LTAC 3G9RA 3C9IA 2LXBA 1JCDA 3H1JG 1MZ9A 3GLMA 1SQBJ 5B66H 1FZGA 4WY4B 1KB9H 3ITKA 5CMZA 3MP7B 2K1AA 3L70D 1KILB 5KLIB 5AVTB 2HODB 3D6YA 1EDLA 3F89A 5GTIE 5L8RJ 3EWKA 4IFMA 3FWLA 3GHGA 2FXPA 2HR3A 3VMZA 3MZWB 1M8OB 2PP6A 3TGUE 2YKPA 1DEBA 3Q5RA 1URQA 3WMM0 4W7ZA 3HD7B 4WVZA 1QL2A 3H1ID 2Q7CA 4JF7A 4KJMA 3EFFK 1E79H 3P32A 2NPSA 1VDFA 5KAFE 1AFOA 4QMAA 1SLQA 4H0LB 2RH0A 3Q1MA 2ZT9D 4GODA 2C9NY 1WMKA 2FXOA 2LR2A 2H43A 1KQLA 5CCGA 3CPWO 2P7JA 3L37A 3TGUG 2M5AA 1N2DC 2N9BA 3MIWA 1S5LE 3CWBG 1J1DC 1Y8AA 5E79E 2KOGA 3NTNA 4D6TD 1CW5A 1NTMG 4GOEA 1K05A 1L4AB 1KFMA 2BEQD 4H13C 1SQVJ 5AVUB 4YTPC 2E5TA 2YIUB 3RK2D 2YO3A 1YTZI 3L73J 2DW3A 1ZLLA 1SQBG 1RQUA 3AEBC 5KJ7A 3A2AA 2KLVA 1T3JA 2E75B 4ZKPA 3D6ZA 2OYHC 3MTUE 3M06A 1GTWA 2KYVA 3NFQA 1LTJA 3CD6P 5AW5B 1KZUB 2JWDA 3T97A 1NAFA 3L71D 4PV1B 1N86A 1VQOP 1FDMA 1YJWP 5APSA 2IZ1A 2OGUA 1AJYA 2KZIA 4Y28J 5CCHC 2HLOA 4R4LA 3L70J 3VN0A 1LT9B 3CCEP 2AEFA 2OTJP 1BDDA 2D2CC 2IX7C 3SWKA 3CXHE 1VF5B 4DZOA 1NKZB 3VMXA 1SQVE 2FFDB 2XZRA 1G2CA 1JY3O 3JCUH 1JNMA 2WQYC 1NGMB 2YKQA 2WPSA 3FXEA 1LP1B 4U3FJ 2E76C 1SQPK 2C9LY 3HE4A 5GTHE 3V6IA 4WB4A 1N8RQ 1JCCA 3GHGC 5C39A 3L74D 1L0ND 3HE5A 1K9MQ 3FGAD 3FX0A 3O6QB 1SQVG 4N6JA 1X0TA 1A02J 5AW8B 1GU5A 4GT1A 1N73A 3B5NA 2FYNB 2E42A 1T8ZA 1JY3P 4EI2A 1U7JA 3L73G 1IFMA 3HUSA 1M56D 5KKZC 4GKGA 1ZOYC 1LTSC 1OWAA 2Q9IA 5APWA 1BGYE 4L73A 1N7SD 2N1TA 2IFMA 2NPSC 1RF0C 1VQPP 2YO2A 4MN4C 1ZW0A 3H1JD 3W67A 1UIXA 3HRNA 2C0WA 2HG5D 5CCGC 2M8RA 5KAIH 2HPCA 2E5YA 3B71A 3RK3B 1E5WA 4U3FE 4XE5B 1K8AQ 3JSVC 3GW6A 2R5BA 1JTHB 1ZN5A 3L70G 4JBZA 4NPEA 3N7NA 1JY2N 2QJPC 2XNDH 1IC2A 1K73Q 1PGJA 3VP9A 2SPZA 1QVGO 2OQQA 1KV4A 4HYTB 1S9KE 2YMKA 2KZJA 1IFPA 3I55P 2WSFH 2JEEA 1RF1A 2KK7A 1AQTA 1SQXK 1LTGC 1LTJC 1USEA 5AVSB 1RQVA 5TISE 1IO4A 4AQRD 2JR8A 3L4FA 5CBOA 3SSUA 3V4QA 1PZQA 3CX5H 2IYOA 2KP8A 2A45G 2Y0EA 5GTHH 2CPSA 3TGUD 2V7QH 1LTIC 1YHQP 2QJYC 5CBNA 1RY3A 3TK1A 1PGQA 2WVRA 1UIIA 1R5SA 1GW4A 1L0NJ 1FZCA 1Q2NA 2E76B 1YYCA 4LC1A 2JKVA 3A3YB 4DT0A 1NOHA 5EFWB 1JO5A 1EZVE 1RH5B 3VYIA 3M9HA 1XTCC 3M0DC 1NAYA 3LIEA 3WU2H 1PPJE 3U59A 1LTTC 3S4RA 3RBZA 2Z4EA 1NTKJ 1URQB 1KB9E 1S5LX 1N73C 1VQLP 1VQ5P 3B5NC 4R4MA 2Y0CA 3PLNA 2E74B 2L5GB 5APUA 4WY4D 2PFXA 2PGDA 4YXDC 2WWWA 1EZVG 2R32A 2AXTH 2ZYGA 2N1TC 2WT7A 2B87B 1NVOA 1QGKB 1PPJG 3P8CE 1L0LK 3L36A 2M5AB 1L2PA 1QEXA 3I56P 2FKWB 1L0NE 5KLVK 3KQGA 2FYZA 1YBKA 1EC5A 2QJKC 1T2KD 2JO1A 1PP9J 2FBWC 2Q6QA 2KSEA 1VQ6P 3LIDA 1YQ4C 3CCQP 3KYQA 2BEZF 5APTA 4PJ0E 3V2RA 4DCKA 1NTZK 2OYHA 1W2BO 4RKUJ 1IJDB 1NTKE 4JPZB 5AW0B 3RL0C 5H2FH 1M1JA 4XA4A 1L0NG 1SQVD 3SWYA 5TJHA 3G71P 4KT0J 3T97B 4H0LD 1EQ7A 1RF1C 1EDKA 3CL3D 1BSHA 1LTBC 3KXDA 4EDFA 5AW3B 2O3JA 1VQ7P 3UIAA 1BCCD 1IFNA 1VQ8P 1FAVA 3V4WA 3A5TA 1NTKG 3KDPB 2KI7B 5APQA 1CI6B 1BDCA 1H8AA 1PP9E 1Y47A 1KFNA 3B4SA 1EXJA 1L0LE 2L91A 4ZMDA 3L35A 1MFTA 1FZFA 3CCLP 2WZ7A 2KS1A 1FZCC 1BGYD 3H1KE 1KMIZ 3HE4B 1IFJA 3O8ZA 2GM4A 4PD4E 1GK4A 1DX7A 3R4YA 2Y0DA 3HE5B 1N7SA 3IFMA 2QEXP 2W6JH 1TU3F 1N73B 2XU6A 4U3FD 3JCUE 1KTMA 2ZT9C 4H44B 4JYCA 1YITP 3HUSB 1ZV8A 2M3BA 2ZAEB 1VF5D 2PAJA 4LLHA 1D7MA 2MJZA 3A0HH 2K3RA 1FJKA 3BCCJ 1T3UA 1YTZT 3FXDA 1RF0A 2G3AA 1VPCA 1SQPD 3Q3DA 1S9KD 1JEKA 4N78E 4M3LA 4PJ0H 4YPCA 1AA0A 3RK2C 2HFED 4W7YA 3C8VA 3CXHI 3KHUA 2HPCB 3P8MC 1EDJA 3E1RA 2Q3EA 2WSFJ 1H0TB 3BATA 1OMIA 2YMYA 2R3SA 5AVXB 4C7NA 1P84E 1QX8A 1OXZA 3CCSP 2FYUK 3TSIA 1EXIA 3SFDC 1KILE 3AEDC 1IZNB 3NMDA 3H1LD 2GUSA 5KAIE 1M1JC 1BCCJ 2V7QJ
chains in the Genus database with same CATH topology
3M91A 1HUCA 1GL2A 1IK9A 5CCGC 1J1EC 2M8RA 2HPCA 3RK3B 4IFFA 1E5WA 2Z5HA 1LT9C 3TYYA 2XDJA 4XE5B 5CJ0A 5AW4B 1NH4A 3SWFA 5CHXA 2R5BA 2W6AA 1JTHB 1ZN5A 3RK3D 2CPBA 1FZEA 3TNUB 3N7NA 3LW5H 1JY2N 2OYIA 1PFIA 1IC2A 2I1KA 2Z5IA 4ZKUA 2FFDC 3HUSC 3HD7C 3VP9A 4C7RA 3I5CA 1CSBA 3V2PA 5AVYB 5AW2B 1SFCB 2KSJA 3H32B 1NKNA 1QL1A 1XTGB 4HYTB 3B5NB 1FJPA 2A45H 4DOJA 3MUDA 1HTLC 5BVZA 1S9KE 1GK6A 3HTKA 2XV5A 3MD0A 5AW9B 2I1JA 3B5ND 2WSFH 1WT6A 1FZCB 2JEEA 2GUVA 1RF1A 1SQXK 1ZR4A 1LTGC 1LTJC 1HBWA 1GL2C 5AVSB 1DH3A 2N1TB 1IO4A 1HGZA 4AQRD 2P1JA 4I1LA 3L4FA 3V4QA 1NO4A 3CLQA 1CZQA 1SP4A 3N4XA 2KP8A 2A45G 2N1TD 2A45I 1H88A 1HGVA 3U1AA 3M0DA 1JOCA 3P8CD 3TNUA 1L4AC 3VP8A 4WY4A 3V5BA 2O1JA 2W27A 1X79B 1N7SC 2CPSA 1M7LA 2BASA 4RESB 1GL2D 2H8PD 1SFCA 3V2QA 1LTIC 3H32A 1RY3A 3TK1A 1FZBA 1SQVK 3BRVB 1RE4C 3II6A 4EIJA 1MUUA 5APYA 1MV8A 3R2PA 2J59M 5AVRB 2VRSA 2W6BA 1GW4A 2P2UA 4JYBA 1FZCA 5AVQB 1N7LA 2WTYA 3KPEA 3RL0B 3VTPC 1RE3A 1YYCA 1Z56A 3OA7A 4LC1A 4WBAA 5CCHA 4HH2A 1G1JA 1FOSF 2XNXA 3RK3C 2P67A 3A3YB 5AW7B 2LKMA 3RK2B 3HTKB 1JUNA 1NOHA 3RL0D 1SVFA 1LTAC 1JO5A 3P7KA 1JY3N 1RF1B 5AVWB 3VYIA 1J1DB 1XTCC 3M9HA 3M9BA 2WSCH 3M0DC 3C9IA 1JCDA 2WITA 3LIEA 3U59A 1LTTC 2Z4EA 1MZ9A 3V2NA 1AQ5A 1URQB 3H6PA 3IR9A 1IFIA 1SFCC 1N73C 3B5NC 1GDTA 1FZGA 4WY4B 5CMZA 1KILB 1HJBA 2L5GB 4GIFA 5APUA 1GW3A 2OYHB 4WY4D 5AVTB 2HODB 3M9QA 2WWWA 3MGNA 1M1JB 2FXMA 2R32A 4IFMA 5AW6B 2N1TC 2R5DA 3GHGA 2WT7A 2O01H 3B8EB 1SFCD 2Q3IA 3P8CE 1L0LK 1ZR2A 3L36A 2WSEH 4AYCA 1LWUC 3VMZA 2FKWB 5KLVK 1NU1K 4AUWA 3KQGA 2FYZA 2PP6A 1T2KD 2YKPA 1DEBA 1CI6A 1GD2E 1URQA 3WMM0 4W7ZA 3HD7B 1QL2A 5CCHD 3LIDA 2Q7CA 3KYQA 1IFDA 4JF7A 2OYIC 4Y99C 1KILA 5APTA 3M0AA 3P32A 2NPSA 3V2RA 1NTZK 1VDFA 2OYHA 1AFOA 2HODA 1IJDB 5AW0B 5BU8B 3VOPA 3RL0C 1M1JA 1SLQA 5KJ7D 4XA4A 2C9NY 3SWYA 1JY2O 2H43A 4LGDE 1KQLA 5CCGA 1HH0A 2P7JA 3OAKA 3L37A 3U1CA 1NHLA 1LT9A 1N2DC 1EQ7A 2N9BA 2H7HA 3MIWA 2Q5UA 1RF1C 2ZXEB 1GU4A 1J1DC 3CL3D 2KOGA 3NTNA 1LTBC 1CW5A 1L4AB 1KFMA 4B86A 2WT7B 3GHGB 4N78D 5AVUB 1G1IA 3BASA 1URQC 2FFDA 3HD7A 5AW3B 3UIAA 1IFNA 3RK2D 1FAVA 3V4WA 3A5TA 2YO3A 1FU1A 1YTZI 3KDPB 4WY4C 1ZLLA 5APQA 2OARA 2WPQA 5KJ7A 3A2AA 1CI6B 2KLVA 1T3JA 4ZKPA 1H8AA 1A02F 2OYHC 2O1KA 2QM7A 3M06A 3MTUE 1GTWA 4C46A 1JY2P 4OH8B 1KFNA 2KYVA 5AVVB 3NFQA 2R3CA 5APVA 2E43A 1LTJA 1URQD 3L35A 2IFNA 5AW5B 5CJ4A 1KZUB 5AVZB 2QM8A 1FZFA 3T97A 1NAFA 2WZ7A 2NPSB 1N86A 1T2KC 1FDMA 1FZCC 2IPPA 5APSA 3CI9A 1FOSE 3HE4B 1KILD 1IFJA 1J2JB 1RE3C 3O8ZA 2NPSD 3EFGA 3OJAB 3E1IA 5CCHC 4I2LC 2GM4A 1L4AA 2C0XA 1GK4A 1DX7A 1J1EB 2JJLA 2HLOA 4I6MC 2YNYA 1FZAA 3HE5B 3VN0A 5BU5A 1N7SA 4KHXA 1LT9B 3IFMA 1GZLA 5CCGD 1WRGA 5KTBA 1N73B 2XU6A 2IX7C 4DZOA 1NKZB 1RE4A 5KJ7C 4C7NB 3VMXA 2HYNA 1HWTC 4JYCA 2FFDB 3HUSB 2XZRA 1G2CA 1ZV8A 1JY3O 2M3BA 3A7OA 2PAJA 1JNMA 4LLHA 2MJZA 2KB7P 3PP5A 2YKQA 3HD7D 1FJKA 4N3YB 2WPSA 1T3UA 1YTZT 1RF0A 2POHA 1VPCA 2C9LY 1SQPK 3HE4A 1S9KD 4N78E 3VMYA 1LWUB 4M3LA 1JTHA 1NWQA 4WB4A 1LTJB 1JCCA 1LGHB 5AW1B 1GL2B 1X8YA 3GHGC 3RK2C 2HFED 4W7YA 1L0NK 3HE5A 4W80A 2HPCB 3P8MC 3G3ZA 4N6JA 1A02J 2J58A 5AW8B 1GU5A 4GT1A 2YKOA 1N73A 1HVVA 3BATA 1X9VA 2WPRA 3B5NA 2E42A 2YMYA 1T8ZA 3NXSA 1JY3P 1SQQK 4C7NA 5AVXB 2OYIB 4Y99B 1IFMA 3HUSA 1NTMK 1OXZA 1N7SB 1FBMA 4GKGA 1L4AD 2FYUK 3EQ2A 3TSIA 1LTSC 1OWAA 2XKMA 3BVHA 2ZFCA 2Q9IA 5APWA 4IFDK 1N7SD 1MFZA 1KILC 2N1TA 2IFMA 1NTKK 2NPSC 1RF0C 2YO2A 3NMDA 1SQBK 1G2CB 4EOTA 4O9BA 2GUSA 3HRNA 1LWUA 1W2EA 2C0WA 1M1JC 2HG5D 5APXA 1H89A 3BRTB 1JMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7S A;  1GL2 A;  4JF7 A;  5CCG C;  1KIL A;  2M8R A;  5CCG D;  3RL0 B;  3RK3 B;  2NPS A;  2XDJ A;  5CCH A;  5KJ7 C;  3VOP A;  3RK2 B;  3RK3 C;  3RL0 C;  1JTH B;  3HTK B;  5KJ7 D;  3RL0 D;  3RK3 D;  4LGD E;  5CCG A;  3M0D C;  3HD7 C;  1NHL A;  3PP5 A;  3HD7 D;  1SFC B;  2KOG A;  1XTG B;  1URQ B;  3B5N B;  1L4A B;  4N78 E;  1SFC C;  1JTH A;  1URQ C;  3B5N C;  3HD7 A;  4WY4 B;  3B5N D;  1GL2 B;  3RK2 C;  4W7Y A;  2HFE D;  1KIL B;  3RK2 D;  4W80 A;  4WY4 C;  1GL2 C;  4WY4 D;  2N1T B;  5KJ7 A;  1HVV A;  1T3J A;  3B5N A;  2YMY A;  2N1T C;  4OH8 B;  2N1T D;  1SFC D;  3P8C E;  1L4A C;  1URQ D;  1N7S B;  4WY4 A;  1L4A D;  3TSI A;  2WZ7 A;  2NPS B;  1N7S C;  2PP6 A;  1N7S D;  1GL2 D;  1KIL C;  2N1T A;  2H8P D;  1SFC A;  1KIL D;  2NPS C;  1URQ A;  2NPS D;  4W7Z A;  5CCH C;  3HD7 B;  1L4A A;  5CCH D;  2HG5 D;  3KYQ A; 
#chains in the Genus database with same CATH topology
 1R5L A;  3AE9 C;  1J1E C;  4NPD A;  3BCC E;  1VL2 A;  1DD3 A;  3TYY A;  2XDJ A;  1NH4 A;  1Q86 Q;  3L75 J;  3RK3 D;  1KYO H;  1FZE A;  1EZV D;  2OYI A;  2I1K A;  2KUB A;  5B5E H;  3TDK A;  1LJ2 A;  3I5C A;  4PD4 H;  1CSB A;  1JMB A;  1PPJ D;  4RJT A;  1BGY J;  3CCU P;  1KN7 A;  2KSJ A;  1QL1 A;  1KB9 D;  3MUD A;  5BVZ A;  3HTK A;  2XV5 A;  5AW9 B;  4TT3 H;  2I1J A;  3BCC G;  3G4S P;  1FZC B;  1OW8 A;  2NZ2 A;  1SQX D;  4U7J A;  3Q2Y A;  3GG2 A;  2NRG A;  1GL2 C;  3CX5 E;  3PHL A;  1OW6 A;  4HKZ H;  3E7K A;  2P1J A;  3AE4 C;  2Q1K A;  2A45 I;  1HGV A;  3M0D A;  1JOC A;  3P8C D;  4WY4 A;  1BCC E;  2K9Y A;  1VQ9 P;  4A7P A;  1BSN A;  1N7S C;  4RES B;  1GL2 D;  4DJG A;  1SQP J;  3H32 A;  3CMA P;  2BCC E;  1VQM P;  3L75 E;  3BRV B;  1OIP A;  3II6 A;  2J59 M;  1OVV A;  2W6B A;  4JYB A;  5AVQ B;  2WTY A;  1P84 H;  2H89 C;  3KPE A;  1FC2 C;  3VTP C;  1RE3 A;  1Z56 A;  1NTK D;  1G1J A;  3RK2 B;  1BCC G;  2P67 A;  5AW7 B;  1OFC X;  3GF3 A;  2KNC A;  3WU2 E;  1JY3 N;  5AVW B;  1J1D B;  3M9B A;  2WSC H;  3Q5S A;  2WIT A;  3CME P;  1K04 A;  4H13 B;  3L75 G;  1AQ5 A;  3H6P A;  2W8Z A;  3IR9 A;  1IFI A;  1SFC C;  3H1L J;  2RKL A;  1YJN P;  4UB6 E;  1BGY G;  1HJB A;  2AXT E;  4OVN F;  2OYH B;  3M9Q A;  1MKM A;  1EZV I;  2Y9Z A;  3MGN A;  1M1J B;  2E74 D;  1X22 A;  1SQP E;  1PP9 D;  2Y9Y A;  1SFC D;  2FY8 A;  2Q3I A;  1L0L D;  3Q5P A;  2WSE H;  4AYC A;  4U3F G;  1YJ9 P;  1M1K Q;  1YQ3 C;  1NU1 K;  1KB9 I;  4XFJ A;  4AUW A;  1S4X A;  3H1K D;  4PD4 D;  1IFD A;  1NU1 J;  1SQX J;  2D2C B;  2K37 A;  2OYI C;  4Y99 C;  1JM0 A;  2IDB A;  1SQP G;  5H2F E;  3G6E P;  3M0A A;  4OGQ C;  2KLU A;  4K3A A;  3LW5 J;  3S9O A;  4GDO A;  2AXC A;  3VOP A;  5KJ7 D;  2OYO A;  3MUD C;  1KQF B;  3H1L E;  1HH0 A;  3D70 A;  3U1C A;  1NHL A;  1LT9 A;  2KS1 B;  2WPV B;  2ZXE B;  1GU4 A;  4OGQ D;  1FDI A;  3GHG B;  4N78 D;  3RK3 E;  2FFD A;  2OTK E;  4BRY A;  2OTL P;  2W90 A;  1FU1 A;  4WY4 C;  1QVF O;  2OAR A;  3FWN A;  3A0B E;  1QLE D;  3H1L G;  4L75 A;  1A02 F;  5KLI C;  1PV3 A;  3WUU A;  5KKZ B;  4C46 A;  5AVV B;  1P84 D;  5APV A;  4IL6 E;  1Q81 Q;  5AVZ B;  1NU1 E;  1SQX E;  3PTZ A;  2WMM A;  2NPS B;  1T2K C;  3AEC C;  4UB6 H;  1FOS E;  1KIL D;  1RE3 C;  3AE6 C;  3EFG A;  3K5B A;  3OJA B;  4I2L C;  2C0X A;  2JJL A;  2KXP B;  2YNY A;  5BU5 A;  1FDO A;  3USS A;  3AE3 C;  1GZL A;  3BCC D;  3W68 A;  4C7N B;  2QJP B;  3A0H E;  1HWT C;  1NU1 G;  1SQX G;  1W5C E;  4L74 A;  4IOI H;  1L0L J;  4BXL A;  1U57 A;  2B9B A;  4H0L C;  2KB7 P;  3CCJ P;  4H44 D;  5KLV J;  3PP5 A;  3HD7 D;  4N3Y B;  1OW7 A;  1YIJ P;  4PD4 I;  3H1K J;  2POH A;  4HJG H;  1JTH A;  2B88 A;  1NWQ A;  1LTJ B;  1LGH B;  2QIW A;  1X8Y A;  2YIU C;  3AE8 C;  2O01 J;  1NTZ J;  3CX5 D;  2JP3 A;  2WPR A;  2YXR B;  1SQQ K;  4YXW H;  2OYI B;  4Y99 B;  2E75 C;  1NTM K;  1L4A D;  2IBZ E;  3EQ2 A;  1ZXG A;  1KD1 Q;  2XKM A;  2P58 A;  3BVH A;  2W83 C;  2ZFC A;  2QJY B;  2JDI H;  2ZYA A;  2QE7 H;  1SS1 A;  1SQQ J;  5M1B A;  2BCC D;  1SQB K;  1G2C B;  3PRJ A;  4EOT A;  4O9B A;  3L75 D;  1NTM J;  1LWU A;  1W2E A;  3A0B H;  5APX A;  1H89 A;  2E75 D;  1HUC A;  1GL2 A;  5KLV E;  2QVA A;  1KYO E;  4IFF A;  2Z5H A;  1LT9 C;  5CJ0 A;  1P84 I;  4IL6 H;  3SWF A;  1HF9 A;  2IBZ G;  5B5E E;  1VF5 C;  2K9J A;  4PV1 D;  2CPB A;  2QSI A;  4UB8 E;  2CK3 H;  3LW5 H;  1PFI A;  2FFD C;  1ZP0 C;  4C7R A;  3V2P A;  1PP9 G;  2QRX A;  1NTZ E;  5AW2 B;  3H32 B;  3CC7 P;  1L0L G;  3B5N B;  4DOJ A;  2WSC J;  5KLV G;  3GMA A;  3H1K G;  1ZR4 A;  3C1L A;  4JQ0 D;  4I7Z C;  1HBW A;  3SFE C;  1DH3 A;  2N1T B;  1HGZ A;  2IYP A;  2N9Y B;  4ZNC A;  3AE5 C;  4I1L A;  4HB1 A;  1NO4 A;  2QA4 P;  3CWB E;  3CLQ A;  1CZQ A;  1SP4 A;  1SQQ E;  2KNC B;  1USD A;  1H88 A;  2ZVO B;  1NTM E;  3U1A A;  2FYN C;  3TNU A;  1NTZ G;  3VP8 A;  2QJK B;  3V5B A;  2O1J A;  2W27 A;  3ABV C;  1KQG B;  3AE2 C;  2H8P D;  2WSE J;  1SFC A;  3D71 A;  1SQB E;  1SQV K;  2B87 A;  2B89 A;  5APY A;  1MV8 A;  3CX5 I;  5AVR B;  1NYH A;  1PGO A;  2P2U A;  1IK7 A;  1N7L A;  1SQQ G;  1FE6 A;  3RL0 B;  2WSS H;  3IN6 A;  3OA7 A;  4WBA A;  4HH2 A;  3RK3 C;  3CCM P;  2LKM A;  1EDI A;  3L72 D;  3P7K A;  1RF1 B;  2FYU J;  1PGP A;  1AVO A;  3V2N A;  1ZRT E;  4L76 A;  2BCC J;  3AE7 C;  4NPF X;  4H13 D;  1GDT A;  4GIF A;  1GW3 A;  4UB8 H;  2FXM A;  1KC8 Q;  5AW6 B;  1VQ4 P;  2R5D A;  2O01 H;  2PRR A;  3B8E B;  5GTI H;  1ZR2 A;  1OVR A;  1LWU C;  1NU1 D;  4IL6 X;  2UWJ E;  3WUT A;  2ZVN B;  3AEA C;  2QG4 A;  1KQS O;  1CI6 A;  2JWA A;  2V4H A;  1GD2 E;  1YI2 P;  1DIP A;  4BRY B;  5CCH D;  3AEG C;  3MHV A;  2FYU E;  3JC2 2;  1M90 Q;  3F5H A;  1KIL A;  3L73 E;  2I8D A;  3H1H D;  2ZT9 B;  2K88 A;  2D2C D;  2HOD A;  5BU8 B;  1OX3 A;  1U7M A;  1OZH A;  2M3E A;  3WUV A;  3H1I J;  1JY2 O;  4I7Z B;  5KAF H;  4LGD E;  2IZ0 A;  3OAK A;  2H7H A;  3KZI E;  1FS0 E;  2Q5U A;  2MKV A;  1BE3 D;  3PH0 A;  3CCV P;  4B86 A;  2E76 D;  1S5L H;  2WT7 B;  2FYU G;  1G1I A;  5E79 H;  1KOR A;  3BAS A;  2GA1 A;  1URQ C;  2A06 D;  3HD7 A;  1VQK P;  3IAO A;  3L70 E;  1LT1 A;  3TF5 A;  1PIX A;  3S1K A;  4GOF A;  2BCC G;  4ASW A;  4D6T J;  2WPQ A;  2J5U A;  2E74 C;  2ZXX A;  2O1K A;  2QM7 A;  1JY2 P;  2ZYD A;  4OH8 B;  3L72 J;  1R8E A;  2R3C A;  2E43 A;  1URQ D;  2IFN A;  5CJ4 A;  3RL0 g;  2IBZ D;  2QM8 A;  5DJU B;  4RO0 A;  2IPP A;  3CI9 A;  1Q7Y Q;  1H0T A;  1J2J B;  2NPS D;  3E1I A;  1L4A A;  3H1I E;  1J1E B;  4OWF A;  4I6M C;  1FZA A;  4KHX A;  5KLV D;  3L71 J;  5CCG D;  1WRG A;  5KTB A;  1JB0 J;  1KYO D;  1VQN P;  1LNQ A;  1RE4 A;  5KJ7 C;  3RBX A;  2HYN A;  4WWI A;  3A7O A;  3CXH H;  3CCR P;  3IF4 A;  3CC4 P;  1NTZ D;  3H1I G;  1T6A A;  4D6T E;  2LXC B;  3QWO C;  3VMY A;  1NJI Q;  1LWU B;  1HJ0 A;  3L72 E;  5AW1 B;  1GL2 B;  3ZDM A;  1S72 P;  1L0N K;  4W80 A;  3H1H J;  3G3Z A;  2J58 A;  2YKO A;  1HVV A;  4ASV A;  1X9V A;  2K9J B;  3CWB D;  3KZI H;  1ZME C;  3NXS A;  1SQQ D;  1NTM D;  1N7S B;  3L74 J;  1DD4 A;  1FBM A;  3RGU A;  1GMJ A;  4D6T G;  1S3J A;  3PJS K;  1BE3 J;  3L71 E;  4IFD K;  1MFZ A;  1KIL C;  1LP1 A;  3L72 G;  4Z1M H;  1NTK K;  2YXQ B;  1Q90 D;  1SQB D;  2AEM A;  3BRT B;  2ITA A;  1JMM A;  5K5G B;  3M91 A;  2O01 N;  2R44 A;  2RN0 A;  1IK9 A;  4K35 A;  5B66 E;  3VMA A;  4CPG A;  3O6Q A;  3OW2 O;  5AW4 B;  5CHX A;  2W6A A;  2IBZ I;  3H1J J;  2ZJS E;  3TNU B;  3L71 G;  3AE1 C;  4H44 C;  2Z5I A;  4ZKU A;  1S2E A;  3HUS C;  3HD7 C;  5AVY B;  3H1H E;  2M0B A;  1SFC B;  1NKN A;  1XTG B;  1Q82 Q;  1FJP A;  2A45 H;  1ZRT D;  1HTL C;  3QH9 A;  1GK6 A;  2P10 A;  3MD0 A;  3B5N D;  2KIK A;  1KYO I;  1WT6 A;  2GUV A;  3L74 E;  1Y9B A;  1BE3 E;  1OVU A;  4EYY Q;  1S1C X;  3AEE C;  1RHZ B;  4TLF A;  1DEE G;  4BWN A;  3N4X A;  5TIS H;  2N1T D;  1AVY A;  2A06 E;  5DJT B;  3H1H G;  1L4A C;  2AEJ A;  2RMZ A;  1X79 B;  1M7L A;  1M57 D;  2BAS A;  3AEF C;  3CXH D;  3V2Q A;  3H25 A;  1AV1 A;  2G8Y A;  3L74 G;  1FZB A;  1RE4 C;  3H1J E;  4EIJ A;  1MUU A;  1BE3 G;  3R2P A;  4OGQ B;  2VRS A;  2FYU D;  3L73 D;  1PL5 A;  3TGU J;  2A06 G;  5CCH A;  3GF7 A;  2H88 C;  3CC2 P;  1FOS F;  2XNX A;  3CWB J;  4PV1 C;  3HTK B;  1JUN A;  3RL0 D;  1SVF A;  1LTA C;  3G9R A;  3C9I A;  2LXB A;  1JCD A;  3H1J G;  1MZ9 A;  3GLM A;  1SQB J;  5B66 H;  1FZG A;  4WY4 B;  1KB9 H;  3ITK A;  5CMZ A;  3MP7 B;  2K1A A;  3L70 D;  1KIL B;  5KLI B;  5AVT B;  2HOD B;  3D6Y A;  1EDL A;  3F89 A;  5GTI E;  5L8R J;  3EWK A;  4IFM A;  3FWL A;  3GHG A;  2FXP A;  2HR3 A;  3VMZ A;  3MZW B;  1M8O B;  2PP6 A;  3TGU E;  2YKP A;  1DEB A;  3Q5R A;  1URQ A;  3WMM 0;  4W7Z A;  3HD7 B;  4WVZ A;  1QL2 A;  3H1I D;  2Q7C A;  4JF7 A;  4KJM A;  3EFF K;  1E79 H;  3P32 A;  2NPS A;  1VDF A;  5KAF E;  1AFO A;  4QMA A;  1SLQ A;  4H0L B;  2RH0 A;  3Q1M A;  2ZT9 D;  4GOD A;  2C9N Y;  1WMK A;  2FXO A;  2LR2 A;  2H43 A;  1KQL A;  5CCG A;  3CPW O;  2P7J A;  3L37 A;  3TGU G;  2M5A A;  1N2D C;  2N9B A;  3MIW A;  1S5L E;  3CWB G;  1J1D C;  1Y8A A;  5E79 E;  2KOG A;  3NTN A;  4D6T D;  1CW5 A;  1NTM G;  4GOE A;  1K05 A;  1L4A B;  1KFM A;  2BEQ D;  4H13 C;  1SQV J;  5AVU B;  4YTP C;  2E5T A;  2YIU B;  3RK2 D;  2YO3 A;  1YTZ I;  3L73 J;  2DW3 A;  1ZLL A;  1SQB G;  1RQU A;  3AEB C;  5KJ7 A;  3A2A A;  2KLV A;  1T3J A;  2E75 B;  4ZKP A;  3D6Z A;  2OYH C;  3MTU E;  3M06 A;  1GTW A;  2KYV A;  3NFQ A;  1LTJ A;  3CD6 P;  5AW5 B;  1KZU B;  2JWD A;  3T97 A;  1NAF A;  3L71 D;  4PV1 B;  1N86 A;  1VQO P;  1FDM A;  1YJW P;  5APS A;  2IZ1 A;  2OGU A;  1AJY A;  2KZI A;  4Y28 J;  5CCH C;  2HLO A;  4R4L A;  3L70 J;  3VN0 A;  1LT9 B;  3CCE P;  2AEF A;  2OTJ P;  1BDD A;  2D2C C;  2IX7 C;  3SWK A;  3CXH E;  1VF5 B;  4DZO A;  1NKZ B;  3VMX A;  1SQV E;  2FFD B;  2XZR A;  1G2C A;  1JY3 O;  3JCU H;  1JNM A;  2WQY C;  1NGM B;  2YKQ A;  2WPS A;  3FXE A;  1LP1 B;  4U3F J;  2E76 C;  1SQP K;  2C9L Y;  3HE4 A;  5GTH E;  3V6I A;  4WB4 A;  1N8R Q;  1JCC A;  3GHG C;  5C39 A;  3L74 D;  1L0N D;  3HE5 A;  1K9M Q;  3FGA D;  3FX0 A;  3O6Q B;  1SQV G;  4N6J A;  1X0T A;  1A02 J;  5AW8 B;  1GU5 A;  4GT1 A;  1N73 A;  3B5N A;  2FYN B;  2E42 A;  1T8Z A;  1JY3 P;  4EI2 A;  1U7J A;  3L73 G;  1IFM A;  3HUS A;  1M56 D;  5KKZ C;  4GKG A;  1ZOY C;  1LTS C;  1OWA A;  2Q9I A;  5APW A;  1BGY E;  4L73 A;  1N7S D;  2N1T A;  2IFM A;  2NPS C;  1RF0 C;  1VQP P;  2YO2 A;  4MN4 C;  1ZW0 A;  3H1J D;  3W67 A;  1UIX A;  3HRN A;  2C0W A;  2HG5 D;  5CCG C;  2M8R A;  5KAI H;  2HPC A;  2E5Y A;  3B71 A;  3RK3 B;  1E5W A;  4U3F E;  4XE5 B;  1K8A Q;  3JSV C;  3GW6 A;  2R5B A;  1JTH B;  1ZN5 A;  3L70 G;  4JBZ A;  4NPE A;  3N7N A;  1JY2 N;  2QJP C;  2XND H;  1IC2 A;  1K73 Q;  1PGJ A;  3VP9 A;  2SPZ A;  1QVG O;  2OQQ A;  1KV4 A;  4HYT B;  1S9K E;  2YMK A;  2KZJ A;  1IFP A;  3I55 P;  2WSF H;  2JEE A;  1RF1 A;  2KK7 A;  1AQT A;  1SQX K;  1LTG C;  1LTJ C;  1USE A;  5AVS B;  1RQV A;  5TIS E;  1IO4 A;  4AQR D;  2JR8 A;  3L4F A;  5CBO A;  3SSU A;  3V4Q A;  1PZQ A;  3CX5 H;  2IYO A;  2KP8 A;  2A45 G;  2Y0E A;  5GTH H;  2CPS A;  3TGU D;  2V7Q H;  1LTI C;  1YHQ P;  2QJY C;  5CBN A;  1RY3 A;  3TK1 A;  1PGQ A;  2WVR A;  1UII A;  1R5S A;  1GW4 A;  1L0N J;  1FZC A;  1Q2N A;  2E76 B;  1YYC A;  4LC1 A;  2JKV A;  3A3Y B;  4DT0 A;  1NOH A;  5EFW B;  1JO5 A;  1EZV E;  1RH5 B;  3VYI A;  3M9H A;  1XTC C;  3M0D C;  1NAY A;  3LIE A;  3WU2 H;  1PPJ E;  3U59 A;  1LTT C;  3S4R A;  3RBZ A;  2Z4E A;  1NTK J;  1URQ B;  1KB9 E;  1S5L X;  1N73 C;  1VQL P;  1VQ5 P;  3B5N C;  4R4M A;  2Y0C A;  3PLN A;  2E74 B;  2L5G B;  5APU A;  4WY4 D;  2PFX A;  2PGD A;  4YXD C;  2WWW A;  1EZV G;  2R32 A;  2AXT H;  2ZYG A;  2N1T C;  2WT7 A;  2B87 B;  1NVO A;  1QGK B;  1PPJ G;  3P8C E;  1L0L K;  3L36 A;  2M5A B;  1L2P A;  1QEX A;  3I56 P;  2FKW B;  1L0N E;  5KLV K;  3KQG A;  2FYZ A;  1YBK A;  1EC5 A;  2QJK C;  1T2K D;  2JO1 A;  1PP9 J;  2FBW C;  2Q6Q A;  2KSE A;  1VQ6 P;  3LID A;  1YQ4 C;  3CCQ P;  3KYQ A;  2BEZ F;  5APT A;  4PJ0 E;  3V2R A;  4DCK A;  1NTZ K;  2OYH A;  1W2B O;  4RKU J;  1IJD B;  1NTK E;  4JPZ B;  5AW0 B;  3RL0 C;  5H2F H;  1M1J A;  4XA4 A;  1L0N G;  1SQV D;  3SWY A;  5TJH A;  3G71 P;  4KT0 J;  3T97 B;  4H0L D;  1EQ7 A;  1RF1 C;  1EDK A;  3CL3 D;  1BSH A;  1LTB C;  3KXD A;  4EDF A;  5AW3 B;  2O3J A;  1VQ7 P;  3UIA A;  1BCC D;  1IFN A;  1VQ8 P;  1FAV A;  3V4W A;  3A5T A;  1NTK G;  3KDP B;  2KI7 B;  5APQ A;  1CI6 B;  1BDC A;  1H8A A;  1PP9 E;  1Y47 A;  1KFN A;  3B4S A;  1EXJ A;  1L0L E;  2L91 A;  4ZMD A;  3L35 A;  1MFT A;  1FZF A;  3CCL P;  2WZ7 A;  2KS1 A;  1FZC C;  1BGY D;  3H1K E;  1KMI Z;  3HE4 B;  1IFJ A;  3O8Z A;  2GM4 A;  4PD4 E;  1GK4 A;  1DX7 A;  3R4Y A;  2Y0D A;  3HE5 B;  1N7S A;  3IFM A;  2QEX P;  2W6J H;  1TU3 F;  1N73 B;  2XU6 A;  4U3F D;  3JCU E;  1KTM A;  2ZT9 C;  4H44 B;  4JYC A;  1YIT P;  3HUS B;  1ZV8 A;  2M3B A;  2ZAE B;  1VF5 D;  2PAJ A;  4LLH A;  1D7M A;  2MJZ A;  3A0H H;  2K3R A;  1FJK A;  3BCC J;  1T3U A;  1YTZ T;  3FXD A;  1RF0 A;  2G3A A;  1VPC A;  1SQP D;  3Q3D A;  1S9K D;  1JEK A;  4N78 E;  4M3L A;  4PJ0 H;  4YPC A;  1AA0 A;  3RK2 C;  2HFE D;  4W7Y A;  3C8V A;  3CXH I;  3KHU A;  2HPC B;  3P8M C;  1EDJ A;  3E1R A;  2Q3E A;  2WSF J;  1H0T B;  3BAT A;  1OMI A;  2YMY A;  2R3S A;  5AVX B;  4C7N A;  1P84 E;  1QX8 A;  1OXZ A;  3CCS P;  2FYU K;  3TSI A;  1EXI A;  3SFD C;  1KIL E;  3AED C;  1IZN B;  3NMD A;  3H1L D;  2GUS A;  5KAI E;  1M1J C;  1BCC J;  2V7Q J; 
#chains in the Genus database with same CATH homology
 3M91 A;  1HUC A;  1GL2 A;  1IK9 A;  5CCG C;  1J1E C;  2M8R A;  2HPC A;  3RK3 B;  4IFF A;  1E5W A;  2Z5H A;  1LT9 C;  3TYY A;  2XDJ A;  4XE5 B;  5CJ0 A;  5AW4 B;  1NH4 A;  3SWF A;  5CHX A;  2R5B A;  2W6A A;  1JTH B;  1ZN5 A;  3RK3 D;  2CPB A;  1FZE A;  3TNU B;  3N7N A;  3LW5 H;  1JY2 N;  2OYI A;  1PFI A;  1IC2 A;  2I1K A;  2Z5I A;  4ZKU A;  2FFD C;  3HUS C;  3HD7 C;  3VP9 A;  4C7R A;  3I5C A;  1CSB A;  3V2P A;  5AVY B;  5AW2 B;  1SFC B;  2KSJ A;  3H32 B;  1NKN A;  1QL1 A;  1XTG B;  4HYT B;  3B5N B;  1FJP A;  2A45 H;  4DOJ A;  3MUD A;  1HTL C;  5BVZ A;  1S9K E;  1GK6 A;  3HTK A;  2XV5 A;  3MD0 A;  5AW9 B;  2I1J A;  3B5N D;  2WSF H;  1WT6 A;  1FZC B;  2JEE A;  2GUV A;  1RF1 A;  1SQX K;  1ZR4 A;  1LTG C;  1LTJ C;  1HBW A;  1GL2 C;  5AVS B;  1DH3 A;  2N1T B;  1IO4 A;  1HGZ A;  4AQR D;  2P1J A;  4I1L A;  3L4F A;  3V4Q A;  1NO4 A;  3CLQ A;  1CZQ A;  1SP4 A;  3N4X A;  2KP8 A;  2A45 G;  2N1T D;  2A45 I;  1H88 A;  1HGV A;  3U1A A;  3M0D A;  1JOC A;  3P8C D;  3TNU A;  1L4A C;  3VP8 A;  4WY4 A;  3V5B A;  2O1J A;  2W27 A;  1X79 B;  1N7S C;  2CPS A;  1M7L A;  2BAS A;  4RES B;  1GL2 D;  2H8P D;  1SFC A;  3V2Q A;  1LTI C;  3H32 A;  1RY3 A;  3TK1 A;  1FZB A;  1SQV K;  3BRV B;  1RE4 C;  3II6 A;  4EIJ A;  1MUU A;  5APY A;  1MV8 A;  3R2P A;  2J59 M;  5AVR B;  2VRS A;  2W6B A;  1GW4 A;  2P2U A;  4JYB A;  1FZC A;  5AVQ B;  1N7L A;  2WTY A;  3KPE A;  3RL0 B;  3VTP C;  1RE3 A;  1YYC A;  1Z56 A;  3OA7 A;  4LC1 A;  4WBA A;  5CCH A;  4HH2 A;  1G1J A;  1FOS F;  2XNX A;  3RK3 C;  2P67 A;  3A3Y B;  5AW7 B;  2LKM A;  3RK2 B;  3HTK B;  1JUN A;  1NOH A;  3RL0 D;  1SVF A;  1LTA C;  1JO5 A;  3P7K A;  1JY3 N;  1RF1 B;  5AVW B;  3VYI A;  1J1D B;  1XTC C;  3M9H A;  3M9B A;  2WSC H;  3M0D C;  3C9I A;  1JCD A;  2WIT A;  3LIE A;  3U59 A;  1LTT C;  2Z4E A;  1MZ9 A;  3V2N A;  1AQ5 A;  1URQ B;  3H6P A;  3IR9 A;  1IFI A;  1SFC C;  1N73 C;  3B5N C;  1GDT A;  1FZG A;  4WY4 B;  5CMZ A;  1KIL B;  1HJB A;  2L5G B;  4GIF A;  5APU A;  1GW3 A;  2OYH B;  4WY4 D;  5AVT B;  2HOD B;  3M9Q A;  2WWW A;  3MGN A;  1M1J B;  2FXM A;  2R32 A;  4IFM A;  5AW6 B;  2N1T C;  2R5D A;  3GHG A;  2WT7 A;  2O01 H;  3B8E B;  1SFC D;  2Q3I A;  3P8C E;  1L0L K;  1ZR2 A;  3L36 A;  2WSE H;  4AYC A;  1LWU C;  3VMZ A;  2FKW B;  5KLV K;  1NU1 K;  4AUW A;  3KQG A;  2FYZ A;  2PP6 A;  1T2K D;  2YKP A;  1DEB A;  1CI6 A;  1GD2 E;  1URQ A;  3WMM 0;  4W7Z A;  3HD7 B;  1QL2 A;  5CCH D;  3LID A;  2Q7C A;  3KYQ A;  1IFD A;  4JF7 A;  2OYI C;  4Y99 C;  1KIL A;  5APT A;  3M0A A;  3P32 A;  2NPS A;  3V2R A;  1NTZ K;  1VDF A;  2OYH A;  1AFO A;  2HOD A;  1IJD B;  5AW0 B;  5BU8 B;  3VOP A;  3RL0 C;  1M1J A;  1SLQ A;  5KJ7 D;  4XA4 A;  2C9N Y;  3SWY A;  1JY2 O;  2H43 A;  4LGD E;  1KQL A;  5CCG A;  1HH0 A;  2P7J A;  3OAK A;  3L37 A;  3U1C A;  1NHL A;  1LT9 A;  1N2D C;  1EQ7 A;  2N9B A;  2H7H A;  3MIW A;  2Q5U A;  1RF1 C;  2ZXE B;  1GU4 A;  1J1D C;  3CL3 D;  2KOG A;  3NTN A;  1LTB C;  1CW5 A;  1L4A B;  1KFM A;  4B86 A;  2WT7 B;  3GHG B;  4N78 D;  5AVU B;  1G1I A;  3BAS A;  1URQ C;  2FFD A;  3HD7 A;  5AW3 B;  3UIA A;  1IFN A;  3RK2 D;  1FAV A;  3V4W A;  3A5T A;  2YO3 A;  1FU1 A;  1YTZ I;  3KDP B;  4WY4 C;  1ZLL A;  5APQ A;  2OAR A;  2WPQ A;  5KJ7 A;  3A2A A;  1CI6 B;  2KLV A;  1T3J A;  4ZKP A;  1H8A A;  1A02 F;  2OYH C;  2O1K A;  2QM7 A;  3M06 A;  3MTU E;  1GTW A;  4C46 A;  1JY2 P;  4OH8 B;  1KFN A;  2KYV A;  5AVV B;  3NFQ A;  2R3C A;  5APV A;  2E43 A;  1LTJ A;  1URQ D;  3L35 A;  2IFN A;  5AW5 B;  5CJ4 A;  1KZU B;  5AVZ B;  2QM8 A;  1FZF A;  3T97 A;  1NAF A;  2WZ7 A;  2NPS B;  1N86 A;  1T2K C;  1FDM A;  1FZC C;  2IPP A;  5APS A;  3CI9 A;  1FOS E;  3HE4 B;  1KIL D;  1IFJ A;  1J2J B;  1RE3 C;  3O8Z A;  2NPS D;  3EFG A;  3OJA B;  3E1I A;  5CCH C;  4I2L C;  2GM4 A;  1L4A A;  2C0X A;  1GK4 A;  1DX7 A;  1J1E B;  2JJL A;  2HLO A;  4I6M C;  2YNY A;  1FZA A;  3HE5 B;  3VN0 A;  5BU5 A;  1N7S A;  4KHX A;  1LT9 B;  3IFM A;  1GZL A;  5CCG D;  1WRG A;  5KTB A;  1N73 B;  2XU6 A;  2IX7 C;  4DZO A;  1NKZ B;  1RE4 A;  5KJ7 C;  4C7N B;  3VMX A;  2HYN A;  1HWT C;  4JYC A;  2FFD B;  3HUS B;  2XZR A;  1G2C A;  1ZV8 A;  1JY3 O;  2M3B A;  3A7O A;  2PAJ A;  1JNM A;  4LLH A;  2MJZ A;  2KB7 P;  3PP5 A;  2YKQ A;  3HD7 D;  1FJK A;  4N3Y B;  2WPS A;  1T3U A;  1YTZ T;  1RF0 A;  2POH A;  1VPC A;  2C9L Y;  1SQP K;  3HE4 A;  1S9K D;  4N78 E;  3VMY A;  1LWU B;  4M3L A;  1JTH A;  1NWQ A;  4WB4 A;  1LTJ B;  1JCC A;  1LGH B;  5AW1 B;  1GL2 B;  1X8Y A;  3GHG C;  3RK2 C;  2HFE D;  4W7Y A;  1L0N K;  3HE5 A;  4W80 A;  2HPC B;  3P8M C;  3G3Z A;  4N6J A;  1A02 J;  2J58 A;  5AW8 B;  1GU5 A;  4GT1 A;  2YKO A;  1N73 A;  1HVV A;  3BAT A;  1X9V A;  2WPR A;  3B5N A;  2E42 A;  2YMY A;  1T8Z A;  3NXS A;  1JY3 P;  1SQQ K;  4C7N A;  5AVX B;  2OYI B;  4Y99 B;  1IFM A;  3HUS A;  1NTM K;  1OXZ A;  1N7S B;  1FBM A;  4GKG A;  1L4A D;  2FYU K;  3EQ2 A;  3TSI A;  1LTS C;  1OWA A;  2XKM A;  3BVH A;  2ZFC A;  2Q9I A;  5APW A;  4IFD K;  1N7S D;  1MFZ A;  1KIL C;  2N1T A;  2IFM A;  1NTK K;  2NPS C;  1RF0 C;  2YO2 A;  3NMD A;  1SQB K;  1G2C B;  4EOT A;  4O9B A;  2GUS A;  3HRN A;  1LWU A;  1W2E A;  2C0W A;  1M1J C;  2HG5 D;  5APX A;  1H89 A;  3BRT B;  1JMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...