3RL0B

Truncated snare complex with complexin (p1)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
59
structure length
59
Chain Sequence
ALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 2
publication title Complexin cross-links prefusion SNAREs into a zigzag array.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/exocytosis
total genus 27
structure length 59
sequence length 59
chains with identical sequence F, J, N, R, V, Z, d
ec nomenclature
pdb deposition date 2011-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3rl0B00
1JTHB 1N7SD 1L4AA 1KILD 5KJ7A 1L4AB 5CCHA 1L4AC 2HG5D 5KJ7C 1N7SA 5CCHC 1KILA 1N7SB 1SFCD 1T3JA 1N7SC 1KILB 1KILC 3TSIA 2HFED 3PP5A 2M8RA 3HTKB 1SFCA 1URQD 2N1TD 1XTGB 1SFCB 1SFCC 1NHLA 3HD7D 1URQA 2N1TA 1URQB 4OH8B 2N1TB 1URQC 3VOPA 2N1TC 4LGDE 5CCGD 3RK2D 3HD7A 2H8PD 3HD7B 3HD7C 3B5ND 4JF7A 5CCGA 2PP6A 3RK3D 5CCGC 3RL0D 3B5NA 2NPSD 3P8CE 3B5NB 3KYQA 3B5NC 4WY4D 4W7ZA 1GL2D 3RK3B 2NPSA 3M0DC 3RK3C 3RL0B 2NPSB 3RL0C 2NPSC 4W7YA 4WY4A 1GL2A 2XDJA 4W80A 1L4AD 2KOGA 4WY4B 3RK2B 4WY4C 3RK2C 5KJ7D 1GL2B 1GL2C 2WZ7A 2YMYA 5CCHD 1JTHA 1HVVA 4N78E
chains in the Genus database with same CATH superfamily
1FE6A 1NTZK 3AE6C 1SQPJ 3IR9A 3H6PA 1LTSC 1OXZA 2WSCJ 2Z5IA 1SQQG 4H13D 1IFDA 3L72J 5H2FE 1FZGA 3B4SA 3A5TA 3CC2P 3L72E 1R5SA 1JEKA 3PLNA 1SQXK 5GTIE 2WT7B 1KB9D 3H1LD 1VQ9P 1XTCC 2YXRB 5AW8B 1P84D 5AVYB 2IBZD 3KQGA 1KQLA 3A2AA 4LGDE 5CCGD 4PV1C 1J1EC 3TGUJ 4HKZH 2RN0A 3SFEC 5AW9B 3B5ND 2L5GB 3TGUE 3CWBD 1IFIA 3SWFA 2O01J 5AW3B 1JY3P 5KKZB 1FDOA 2Z4EA 4GKGA 4IL6H 2QJYB 3M0AA 1OVUA 1FZCC 3H32B 4GT1A 4IFMA 1RF0C 2QE7H 4Z1MH 2NPSA 4H44D 2KB7P 3RL0B 3PRJA 2H88C 3A0BH 3CI9A 3AE7C 3RBZA 1RQUA 2P2UA 1RH5B 1OVRA 1K8AQ 1JTHA 1NGMB 4N78E 2J58A 1PGJA 2OYHA 4D6TG 1L0NJ 5CCHA 3AEEC 2GA1A 1IJDB 1L0NE 1EDIA 1Q86Q 1LTGC 1OW6A 3Q3DA 1KILC 1X8YA 2J59M 1OZHA 1YTZI 2Y9ZA 2I1JA 1BE3J 3NMDA 4UB8E 2UWJE 3S1KA 3B8EB 1BE3E 1QVGO 1SQPG 1R5LA 2FKWB 3H1JE 1SQQD 2QIWA 3I5CA 1M1JC 2XZRA 3L72G 4B86A 2L91A 1S9KE 3WUUA 3Q1MA 1P84H 3NFQA 1NAFA 3G6EP 1LWUB 2BEQD 4BWNA 1IZNB 3RK3D 3AE5C 1VPCA 1VQOP 3EFGA 3K5BA 2HODA 1HJ0A 4EDFA 1S5LX 4UB6H 2NRGA 1NKNA 2O01N 3TGUG 2OTKE 1NYHA 4DZOA 1ZLLA 2FXPA 3P8CD 2JKVA 2WWWA 4Y28J 1KFMA 4IOIH 1RE3C 2RKLA 2YO3A 3AE9C 1KV4A 2D2CD 1L4AA 5K5GB 1UIXA 3CD6P 1RF1B 2WSSH 3L75D 1VQ8P 1FU1A 2KUBA 5KAIH 2OYIB 2Y0EA 3IF4A 1L0LD 3AEGC 1IO4A 3BVHA 3PP5A 3R4YA 4D6TD 1ZN5A 4DJGA 1E79H 2E76C 3CLQA 4H13B 1N2DC 1ZW0A 1ZOYC 1JCCA 1L0NG 3IN6A 2Q6QA 4BXLA 1RQVA 1FAVA 1K04A 3ZDMA 3D6YA 4BRYA 3A0HH 4C46A 1VQ7P 1SQPD 2IX7C 1BE3G 3GMAA 3FWLA 3A0BE 1CI6A 3II6A 1LP1A 2Z5HA 2WTYA 3L71J 4ZMDA 1J1DB 4HB1A 3MUDC 3L71E 3B5NB 3VMYA 3KPEA 2I8DA 3HE4A 2FFDA 2FXOA 1LT1A 1QVFO 1NTZJ 5BU5A 1A02F 3D70A 3S9OA 4OWFA 1GL2A 2XDJA 1GU4A 1DD4A 3CCEP 2V7QH 4WY4C 1GW4A 4H44B 1BGYJ 3NTNA 1HUCA 1IK9A 2JWAA 1SQVD 1FOSE 1N7SD 2YMKA 5AW0B 2QRXA 1KQSO 2KNCA 2OTLP 1KB9E 1WT6A 2WSFJ 3H1LE 1NU1D 1P84E 2E75D 2HPCA 2IBZE 4HYTB 3V5BA 1JB0J 2M3BA 2BASA 2IYPA 1LGHB 1BSNA 2KP8A 5AVTB 1H0TB 3CWBE 3CCMP 2ZXXA 2K9JA 4I7ZB 4RO0A 4UB6E 5KKZC 4JBZA 2GM4A 4WVZA 5B66H 1L2PA 3TNUB 2PAJA 1NTKD 3IAOA 1S2EA 5TISE 5H2FH 1K73Q 2WSCH 3RK3B 4XFJA 3LIEA 2E74D 2NPSC 1IC2A 1Q7YQ 1RE4C 5KAIE 3FXEA 1X22A 5AVRB 5KJ7D 3L71G 1DX7A 4H0LD 2YIUB 1NWQA 1PPJG 3AE4C 2R5BA 3L35A 4JYCA 1NTZG 4U7JA 2OYHC 1YQ3C 5CCHC 1QLED 2D2CB 3A0HE 1KC8Q 2C0WA 1SQQE 1QX8A 3M06A 1BGYG 1KFNA 2O01H 4JQ0D 3L70J 4WWIA 3N7NA 2W27A 2N1TD 4DOJA 1Y8AA 3AEAC 2QM7A 2XNXA 2JDIH 2G8YA 1EZVG 1YIJP 5KAFE 3RK3E 1MUUA 3D71A 1PV3A 5M1BA 2IBZG 3PHLA 3HD7A 5KLVD 1YQ4C 1HGVA 2W8ZA 2RH0A 1AJYA 2V7QJ 1KYOD 4JF7A 1UIIA 3C1LA 1YITP 5E79H 3OJAB 2YNYA 2YO2A 3KZIE 3P8CE 1AV1A 1JY3O 3AEFC 1W2EA 4EIJA 2JO1A 3SWKA 2JEEA 1KZUB 5APUA 1QL1A 1IFMA 3OA7A 3RK2B 1T2KD 5C39A 1FJPA 2J5UA 3L75J 4OGQD 3L75E 1L0LJ 2PGDA 1OFCX 2P67A 1L0LE 3HE5B 1GK4A 2ZT9B 1L4AC 4D6TE 4AUWA 4EOTA 5B66E 1N7SB 1SFCD 3ITKA 3E1RA 2LXBA 1USEA 4HJGH 4LC1A 1PPJD 1URQD 2WT7A 1NTZD 5AW1B 1SQPE 3HUSA 1HJBA 2KSEA 3CXHD 1EXJA 3GG2A 1JUNA 1J1DC 1FBMA 3GHGB 1Y9BA 4IL6X 1BGYD 3VOPA 1R8EA 2KZIA 4R4LA 1JY2P 1EXIA 2CK3H 3L70G 1SQXD 2BCCD 1EZVD 3RGUA 1T8ZA 2E5YA 2O1JA 1ZR4A 2QJKC 3HUSB 1PGOA 2FYNB 2DW3A 3H32A 2WITA 1SQVJ 3CXHI 2WQYC 1RY3A 1SQVE 2FFDC 4YPCA 2XU6A 2B9BA 2FY8A 2OQQA 1SLQA 2FXMA 1GL2C 1NU1J 4LLHA 3H1HD 1EZVI 1KB9I 2E74B 3CC7P 1NU1E 2W83C 2ZJSE 1K9MQ 2Q5UA 3JSVC 1P84I 2IFMA 5AW7B 3Q5RA 1YJ9P 2IBZI 5GTHE 1RE4A 4H0LB 2LKMA 2W6AA 1M8OB 3FWNA 5APWA 4YXWH 1VQNP 1BCCD 1YHQP 2H7HA 3L75G 2HFED 5E79E 1L0LG 3KDPB 2KS1B 4PV1D 2ZYGA 1A02J 1NTMK 3F89A 1VF5C 1HGZA 1NTKJ 1KQFB 3SSUA 2ZXEB 2B88A 2N1TB 1NTKE 1KQGB 3CXHH 3AECC 1BDCA 3C9IA 1LWUA 2JP3A 3QWOC 1OW8A 1W5CE 4NPEA 3A7OA 2HR3A 1KB9H 4R4MA 4W7ZA 3L70D 3L74J 4Y99C 1AQ5A 2IFNA 1PGPA 2KLUA 2KXPB 2WSFH 1H8AA 4N3YB 1ZXGA 4L76A 2JJLA 3TK1A 3VMXA 1JY3N 5KLIC 3PH0A 1VF5D 2PFXA 2KSJA 1KILD 2AXTE 1SQVG 1RF1A 3P8MC 3E1IA 3L73D 1IFPA 4OGQB 2P1JA 3NXSA 2OYIA 1H88A 3GLMA 3M9BA 1NU1G 1YJNP 3G71P 5KLVJ 5KLVE 4I2LC 1SFCB 5TISH 5AVVB 1VQLP 2KZJA 1KYOE 1VDFA 2G3AA 1URQB 3SFDC 2QVAA 1MFZA 5TJHA 4ZNCA 3HD7C 4PD4D 5CCGA 2K3RA 5B5EE 4MN4C 3ABVC 3H1IJ 2B87B 2ZFCA 2Y9YA 3B5NA 2E42A 1NTKG 5APQA 2R3SA 3PTZA 1K05A 4RESB 2ZT9C 3AEDC 5BU8B 1DIPA 3I56P 1LTJB 3V6IA 5AVSB 3FXDA 2JR8A 3FX0A 1AVOA 1VL2A 3MP7B 5KAFH 1KTMA 1PPJE 2B89A 3L74G 2YKOA 3OAKA 1NTZE 5AVWB 1LTBC 2E76D 1S1CX 1PGQA 2YKPA 3CXHE 3M9HA 1KMIZ 3VTPC 2M8RA 1BGYE 3HTKB 1HBWA 1HH0A 3KZIH 1N8RQ 3WU2E 1SQXJ 2BCCJ 1U7JA 1H0TA 1OW7A 3TF5A 4K35A 2QJPB 1SQXE 2BCCE 3VP8A 1AVYA 1EZVE 3HUSC 1NVOA 2FYNC 4PV1B 2A06G 5AVQB 4C7NB 1G1IA 1J1EB 2H8PD 3TNUA 1ZV8A 4O9BA 5KLVG 1WRGA 1N73A 2C9NY 2SPZA 2R3CA 1PP9J 4RKUJ 4L74A 1HWTC 4PD4H 3C8VA 3KYQA 3H1HJ 3BCCJ 4L73A 1JOCA 1FZCB 4WY4D 2QJYC 3H1HE 4M3LA 3LW5J 3RL0C 2R32A 1N73B 3H1IG 1BCCJ 1USDA 3CC4P 1BCCE 2QG4A 1VQMP 2P10A 1EQ7A 3T97B 3O6QB 3TDKA 3VN0A 1JCDA 1SQBK 4HH2A 2M0BA 1SQBD 1MZ9A 1GZLA 1NTMJ 1KILB 4KT0J 2JWDA 3V2NA 4GDOA 1SP4A 1CZQA 2Y0DA 1G2CB 1OVVA 3L74D 4K3AA 1NHLA 1IK7A 1M1JB 3G9RA 4GOEA 1JM0A 2E43A 2R44A 1FJKA 1S5LE 1QGKB 1M57D 2AEJA 1BSHA 5AVUB 4U3FJ 3L70E 1QEXA 3CX5D 1M90Q 1LWUC 4OVNF 1MKMA 1SQXG 1VQ4P 2BCCG 3GF3A 5AW2B 2NPSD 5GTHH 2A06D 2IDBA 1CSBA 1S4XA 1X0TA 1ZRTD 2QSIA 3V2PA 2KIKA 1KILE 3L73J 4JPZB 3EQ2A 3WUTA 2YKQA 2MJZA 2H89C 3L73E 3BATA 2KOGA 3EWKA 1PP9G 2FYUK 2POHA 2YMYA 5CCHD 2FYUD 2WVRA 3EFFK 1U57A 3H1HG 3HE5A 3BRVB 4QMAA 3BCCG 1DEEG 2W6JH 3E7KA 1RF1C 1NOHA 3V4QA 1N7SA 1LT9B 2I1KA 5CHXA 2Q3IA 3H1ID 3VMZA 1KYOI 2OYIC 3TSIA 1BCCG 2LXCB 2P58A 3SWYA 3CMAP 1NKZB 3UIAA 2E76B 4AQRD 3W68A 3CCUP 4H13C 1RHZB 2ITAA 4PD4E 3GHGA 1LTAC 2IZ1A 4L75A 4OH8B 1NTMG 3M9QA 1GDTA 3V2RA 3HRNA 2M5AB 2KLVA 3TYYA 2GUVA 3H1KD 2AXTH 3MD0A 2E75B 5CCGC 1YBKA 2Q1KA 1WMKA 2P7JA 3B5NC 3WMM0 2K1AA 3W67A 3MIWA 2OYOA 1GW3A 2XNDH 2C9LY 4U3FG 2R5DA 2W90A 1L4AD 4WY4B 4JYBA 3G3ZA 4H44C 5CJ0A 2H43A 1KYOH 3CCVP 2FYZA 2WPVB 2WPRA 3O8ZA 5KJ7A 1T3UA 1PIXA 3AEBC 2QJPC 3L73G 1SS1A 3IFMA 1AFOA 2LR2A 4GOFA 3CCQP 3JC22 1PP9D 1J2JB 1Q81Q 1VQPP 5B5EH 3BCCD 2KS1A 1FZBA 3CCLP 5APVA 5BVZA 1N7LA 3V2QA 2OGUA 2N1TA 4XE5B 3D6ZA 3RL0g 4I7ZC 2O1KA 3U1AA 4GODA 3MTUE 1DH3A 4ZKUA 1KORA 4WB4A 1PFIA 1ZP0C 4C7RA 2PP6A 5CBOA 1X79B 4I6MC 1N73C 1NTMD 4YTPC 2K37A 1GL2D 1JY2N 1D7MA 1DEBA 2ZAEB 3RK3C 5APSA 3Q5PA 2NPSB 3AE3C 1SQBJ 3WU2H 3S4RA 1G1JA 2QEXP 1SQBE 2Y0CA 2WZ7A 1KN7A 2GUSA 2YIUC 1JTHB 3CCSP 3H1JJ 4U3FD 3G4SP 1SQQK 3WUVA 4KJMA 2K88A 2QM8A 2OYHB 3L74E 2D2CC 3LIDA 3U59A 1KD1Q 1OX3A 1Z56A 1SFCA 1NO4A 1NH4A 1XTGB 2WSEJ 5AW5B 3USSA 1MV8A 2OTJP 4DCKA 3P32A 3CX5E 1URQA 4XA4A 1S72P 2XKMA 3LW5H 1FZAA 3RBXA 1IFJA 4WBAA 2A06E 1CW5A 1W2BO 2YXQB 4TT3H 3P7KA 1ZRTE 4KHXA 2OARA 3L4FA 2B87A 1BDDA 5APTA 1VQKP 2A45G 3U1CA 1FDIA 3M0DA 2HODB 2FYUJ 3CMEP 1ZMEC 2FYUE 1YJWP 5AVZB 1LTJA 3JCUH 3QH9A 1VQ6P 1Q90D 2CPSA 2W6BA 1LT9C 4AYCA 5CJ4A 2NZ2A 4IFDK 1T6AA 3M91A 5AVXB 1L0LK 3RK2C 3H1IE 2MKVA 1JNMA 1EC5A 2Q3EA 3AE8C 4PJ0H 4A7PA 3CCJP 3N4XA 3H25A 1L4AB 1S5LH 1GMJA 5DJUB 4IL6E 5CBNA 1T3JA 1N7SC 1SQBG 4ASWA 1H89A 4PD4I 1SQPK 2WPQA 1S3JA 3HTKA 4EYYQ 2ZVOB 5L8RJ 3BASA 1FS0E 2IZ0A 4IFFA 3H1JG 2AEMA 3H1KJ 3HD7D 2E75C 2N9YB 3H1KE 3L72D 4C7NA 3GHGC 4BRYB 3V4WA 1GD2E 3RK2D 1FZEA 2KK7A 1CI6B 2ZT9D 1LP1B 2QJKB 3AE1C 1SQVK 2AXCA 1FZFA 1FZCA 1RF0A 1FC2C 3TGUD 2Q9IA 1ZR2A 3F5HA 2WMMA 3HE4B 2FFDB 2QA4P 2V4HA 2RMZA 3H1LJ 1HTLC 4W7YA 1YYCA 1NU1K 3AE2C 4ASVA 4W80A 4NPDA 1GL2B 1PP9E 1GK6A 1JMMA 2C0XA 3T97A 3O6QA 4CPGA 2E74C 2FYUG 1SVFA 3BCCE 1JMBA 2HG5D 3CWBJ 3L36A 5KJ7C 1OIPA 1Y47A 4H0LC 5EFWB 1KILA 3BRTB 2KNCB 1LTTC 4N78D 1PZQA 2N9BA 1OWAA 1G2CA 1AQTA 2A45I 2HPCB 1L0NK 3A3YB 1EDKA 3VP9A 1GTWA 1L0ND 2M3EA 1QL2A 1M1JA 2WPSA 3Q2YA 3VYIA 1LTIC 1NTKK 3GF7A 3KHUA 5APXA 1VF5B 1HF9A 1DD3A 1NJIQ 3R2PA 4I1LA 2K9JB 2N1TC 3B71A 1U7MA 1AA0A 1BE3D 5AW4B 1NTME 3JCUE 3H1JD 2FBWC 5GTIH 2HLOA 3OW2O 3H1KG 1Q2NA 3RL0D 1YI2P 1S9KD 3MHVA 2KI7B 2ZYDA 2ZYAA 4PJ0E 1OMIA 5CMZA 1FDMA 2O3JA 3CCRP 4Y99B 4EI2A 2BEZF 2IYOA 4GIFA 4RJTA 1JY2O 1E5WA 1Q82Q 4YXDC 1SQQJ 4U3FE 1RE3A 3L37A 3FGAD 5APYA 3CL3D 5KLIB 2Q7CA 2IPPA 1TU3F 2A45H 1YTZT 1LNQA 1VQ5P 3I55P 1M7LA 1LT9A 1T2KC 3GW6A 4OGQC 3MZWB 1PL5A 1GU5A 4TLFA 3H1LG 1M56D 2HYNA 3Q5SA 5KLVK 3CX5I 1NAYA 4ZKPA 1SFCC 3VMAA 3CWBG 3CPWO 1FOSF 5DJTB 1EDLA 2E5TA 4NPFX 1URQC 1M1KQ 1EDJA 2M5AA 3HD7B 1X9VA 4DT0A 4UB8H 1N86A 2AEFA 3MUDA 5AW6B 2KYVA 3KXDA 1JO5A 2ZVNB 4N6JA 2PRRA 2VRSA 3PJSK 4D6TJ 2CPBA 3M0DC 3MGNA 1LJ2A 5KTBA 4WY4A 1LTJC 3L71D 2K9YA 1MFTA 1IFNA 2WSEH 1HVVA 2XV5A 3CX5H
chains in the Genus database with same CATH topology
1NTZK 1JTHB 1NWQA 3IR9A 1SQQK 3H6PA 2QM8A 2R5BA 3L35A 4JYCA 2YKOA 2OYHB 2OYHC 3OAKA 1LTSC 1OXZA 5AVWB 5CCHC 1LTBC 2Z5IA 1IFDA 2C0WA 2YKPA 3LIDA 3M9HA 3U59A 1FZGA 3A5TA 3M06A 3VTPC 1KFNA 2O01H 1Z56A 2M8RA 3HTKB 1HBWA 1HH0A 1SQXK 1SFCA 3N7NA 2W27A 2N1TD 4DOJA 1NO4A 1NH4A 1XTGB 2QM7A 2XNXA 5AW5B 2WT7B 1MV8A 1XTCC 3P32A 5AW8B 1URQA 4XA4A 5AVYB 3VP8A 2XKMA 3HUSC 3KQGA 1MUUA 3LW5H 1KQLA 3A2AA 1FZAA 4LGDE 5AVQB 1IFJA 5CCGD 4C7NB 4WBAA 1G1IA 3HD7A 1J1EB 1CW5A 2H8PD 3TNUA 1J1EC 1HGVA 1ZV8A 5AW9B 3B5ND 2L5GB 4O9BA 1WRGA 3P7KA 4JF7A 1IFIA 4KHXA 3SWFA 1N73A 2OARA 2C9NY 3L4FA 3OJAB 2YNYA 2R3CA 5AW3B 2YO2A 5APTA 2A45G 1HWTC 3U1CA 1JY3P 3P8CE 3KYQA 2Z4EA 4GKGA 3M0DA 1JOCA 2HODB 1JY3O 3M0AA 4WY4D 1FZCB 1FZCC 3H32B 4GT1A 4IFMA 1RF0C 1W2EA 4M3LA 4EIJA 2NPSA 5AVZB 2KB7P 3RL0B 1LTJA 3RL0C 2JEEA 1KZUB 2R32A 2CPSA 2W6BA 5APUA 3CI9A 1LT9C 1QL1A 4AYCA 5CJ4A 1IFMA 3OA7A 3RK2B 1N73B 4IFDK 3M91A 5AVXB 3RK2C 1L0LK 1T2KD 1FJPA 2P2UA 1JNMA 1JTHA 4N78E 1EQ7A 2J58A 2P67A 3VN0A 2OYHA 3HE5B 1GK4A 3N4XA 1L4AB 5CCHA 1JCDA 1L4AC 1SQBK 4HH2A 4AUWA 1IJDB 1MZ9A 1GZLA 4EOTA 1LTGC 1N7SB 1SFCD 1T3JA 1N7SC 1KILB 1H89A 1KILC 1SQPK 1X8YA 2J59M 2WPQA 3HTKA 4LC1A 3V2NA 1SP4A 1YTZI 1CZQA 2I1JA 1G2CB 3BASA 3NMDA 3B8EB 1URQD 2WT7A 4IFFA 5AW1B 1NHLA 2FKWB 3HUSA 1HJBA 1M1JB 3HD7D 3I5CA 1M1JC 1JUNA 1J1DC 1FBMA 3GHGB 2XZRA 4C7NA 3GHGC 2E43A 3VOPA 3V4WA 1FJKA 4B86A 1GD2E 1S9KE 3RK2D 1JY2P 1FZEA 3NFQA 5AVUB 1NAFA 1LWUB 1CI6B 1LWUC 3RK3D 5AW2B 1T8ZA 1VPCA 2O1JA 1ZR4A 2NPSD 3HUSB 1SQVK 3EFGA 2HODA 1FZFA 1FZCA 1RF0A 1CSBA 3H32A 2WITA 2Q9IA 1RY3A 1ZR2A 1NKNA 3HE4B 2FFDB 3V2PA 2FFDC 2XU6A 4DZOA 1HTLC 1ZLLA 4W7YA 1YYCA 3EQ2A 1NU1K 2YKQA 3P8CD 4W80A 2MJZA 1SLQA 3BATA 2KOGA 2WWWA 1KFMA 2FXMA 1RE3C 1GL2B 2FYUK 1GL2C 2POHA 4LLHA 2YMYA 5CCHD 2YO3A 1GK6A 1JMMA 2C0XA 3T97A 3HE5A 3BRVB 1L4AA 2Q5UA 1SVFA 2IFMA 5AW7B 2HG5D 1RF1B 3L36A 1RE4A 1RF1C 5KJ7C 1NOHA 3V4QA 2LKMA 2W6AA 1N7SA 1LT9B 2I1KA 5CHXA 1KILA 2Q3IA 3BRTB 5APWA 1LTTC 4N78D 3VMZA 2N9BA 1OWAA 1FU1A 1G2CA 2OYIB 2H7HA 2OYIC 3TSIA 2HFED 1IO4A 3BVHA 3PP5A 2A45I 3SWYA 2HPCB 1L0NK 3A3YB 3VP9A 1GTWA 1ZN5A 3KDPB 1NKZB 3UIAA 4AQRD 3CLQA 1QL2A 1M1JA 1N2DC 2WPSA 3VYIA 1JCCA 1LTIC 1NTKK 1A02J 1NTMK 3GHGA 1FAVA 5APXA 1LTAC 1HGZA 3R2PA 2ZXEB 4OH8B 2N1TB 4I1LA 2N1TC 4C46A 3M9QA 1GDTA 5AW4B 3V2RA 3HRNA 2IX7C 3C9IA 1LWUA 2KLVA 3TYYA 1CI6A 2GUVA 3II6A 2Z5HA 3MD0A 2HLOA 2WTYA 5CCGC 1J1DB 3RL0D 3A7OA 1S9KD 2P7JA 3B5NB 3VMYA 3B5NC 3WMM0 3KPEA 5CMZA 1FDMA 3HE4A 4Y99B 4W7ZA 2FFDA 3MIWA 4Y99C 1AQ5A 2IFNA 2WSFH 1GW3A 4GIFA 1H8AA 2C9LY 1JY2O 5BU5A 1E5WA 4N3YB 1A02F 2R5DA 1RE3A 2JJLA 3L37A 1GL2A 2XDJA 5APYA 1GU4A 1L4AD 4WY4B 3TK1A 4WY4C 4JYBA 1GW4A 3VMXA 3CL3D 3G3ZA 3NTNA 1HUCA 1JY3N 1IK9A 5CJ0A 2H43A 2Q7CA 2IPPA 1FOSE 2FYZA 2A45H 1N7SD 1YTZT 2KSJA 1KILD 2WPRA 3O8ZA 1RF1A 5KJ7A 1T3UA 1M7LA 3E1IA 3P8MC 1LT9A 1T2KC 5AW0B 2P1JA 3IFMA 3NXSA 1GU5A 1AFOA 1WT6A 2OYIA 2HYNA 1J2JB 5KLVK 1H88A 2HPCA 3M9BA 4HYTB 3V5BA 1FZBA 2M3BA 2BASA 4I2LC 1SFCB 4ZKPA 1SFCC 1LGHB 5APVA 5AVVB 5BVZA 2KP8A 1N7LA 3V2QA 5AVTB 1FOSF 1VDFA 2N1TA 4XE5B 1URQB 1URQC 2O1KA 2GM4A 3U1AA 1MFZA 3MTUE 1DH3A 4ZKUA 3HD7B 1X9VA 3HD7C 4WB4A 3TNUB 1PFIA 4C7RA 5CCGA 1N86A 2PP6A 1X79B 3MUDA 4I6MC 2PAJA 5AW6B 2KYVA 2ZFCA 1N73C 3B5NA 1JO5A 4N6JA 2E42A 5APQA 2VRSA 1GL2D 1JY2N 2CPBA 2WSCH 3M0DC 4RESB 3RK3B 1DEBA 3RK3C 5APSA 3MGNA 2NPSB 3LIEA 5KTBA 2NPSC 5BU8B 1IC2A 1LTJB 4WY4A 1LTJC 1RE4C 5AVSB 5AVRB 1G1JA 5KJ7D 1DX7A 2WZ7A 1IFNA 2WSEH 1HVVA 2XV5A 2GUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTH B;  1N7S D;  1L4A A;  1KIL D;  5KJ7 A;  1L4A B;  5CCH A;  1L4A C;  2HG5 D;  5KJ7 C;  1N7S A;  5CCH C;  1KIL A;  1N7S B;  1SFC D;  1T3J A;  1N7S C;  1KIL B;  1KIL C;  3TSI A;  2HFE D;  3PP5 A;  2M8R A;  3HTK B;  1SFC A;  1URQ D;  2N1T D;  1XTG B;  1SFC B;  1SFC C;  1NHL A;  3HD7 D;  1URQ A;  2N1T A;  1URQ B;  4OH8 B;  2N1T B;  1URQ C;  3VOP A;  2N1T C;  4LGD E;  5CCG D;  3RK2 D;  3HD7 A;  2H8P D;  3HD7 B;  3HD7 C;  3B5N D;  4JF7 A;  5CCG A;  2PP6 A;  3RK3 D;  5CCG C;  3RL0 D;  3B5N A;  2NPS D;  3P8C E;  3B5N B;  3KYQ A;  3B5N C;  4WY4 D;  4W7Z A;  1GL2 D;  3RK3 B;  2NPS A;  3M0D C;  3RK3 C;  3RL0 B;  2NPS B;  3RL0 C;  2NPS C;  4W7Y A;  4WY4 A;  1GL2 A;  2XDJ A;  4W80 A;  1L4A D;  2KOG A;  4WY4 B;  3RK2 B;  4WY4 C;  3RK2 C;  5KJ7 D;  1GL2 B;  1GL2 C;  2WZ7 A;  2YMY A;  5CCH D;  1JTH A;  1HVV A;  4N78 E; 
#chains in the Genus database with same CATH topology
 1FE6 A;  1NTZ K;  3AE6 C;  1SQP J;  3IR9 A;  3H6P A;  1LTS C;  1OXZ A;  2WSC J;  2Z5I A;  1SQQ G;  4H13 D;  1IFD A;  3L72 J;  5H2F E;  1FZG A;  3B4S A;  3A5T A;  3CC2 P;  3L72 E;  1R5S A;  1JEK A;  3PLN A;  1SQX K;  5GTI E;  2WT7 B;  1KB9 D;  3H1L D;  1VQ9 P;  1XTC C;  2YXR B;  5AW8 B;  1P84 D;  5AVY B;  2IBZ D;  3KQG A;  1KQL A;  3A2A A;  4LGD E;  5CCG D;  4PV1 C;  1J1E C;  3TGU J;  4HKZ H;  2RN0 A;  3SFE C;  5AW9 B;  3B5N D;  2L5G B;  3TGU E;  3CWB D;  1IFI A;  3SWF A;  2O01 J;  5AW3 B;  1JY3 P;  5KKZ B;  1FDO A;  2Z4E A;  4GKG A;  4IL6 H;  2QJY B;  3M0A A;  1OVU A;  1FZC C;  3H32 B;  4GT1 A;  4IFM A;  1RF0 C;  2QE7 H;  4Z1M H;  2NPS A;  4H44 D;  2KB7 P;  3RL0 B;  3PRJ A;  2H88 C;  3A0B H;  3CI9 A;  3AE7 C;  3RBZ A;  1RQU A;  2P2U A;  1RH5 B;  1OVR A;  1K8A Q;  1JTH A;  1NGM B;  4N78 E;  2J58 A;  1PGJ A;  2OYH A;  4D6T G;  1L0N J;  5CCH A;  3AEE C;  2GA1 A;  1IJD B;  1L0N E;  1EDI A;  1Q86 Q;  1LTG C;  1OW6 A;  3Q3D A;  1KIL C;  1X8Y A;  2J59 M;  1OZH A;  1YTZ I;  2Y9Z A;  2I1J A;  1BE3 J;  3NMD A;  4UB8 E;  2UWJ E;  3S1K A;  3B8E B;  1BE3 E;  1QVG O;  1SQP G;  1R5L A;  2FKW B;  3H1J E;  1SQQ D;  2QIW A;  3I5C A;  1M1J C;  2XZR A;  3L72 G;  4B86 A;  2L91 A;  1S9K E;  3WUU A;  3Q1M A;  1P84 H;  3NFQ A;  1NAF A;  3G6E P;  1LWU B;  2BEQ D;  4BWN A;  1IZN B;  3RK3 D;  3AE5 C;  1VPC A;  1VQO P;  3EFG A;  3K5B A;  2HOD A;  1HJ0 A;  4EDF A;  1S5L X;  4UB6 H;  2NRG A;  1NKN A;  2O01 N;  3TGU G;  2OTK E;  1NYH A;  4DZO A;  1ZLL A;  2FXP A;  3P8C D;  2JKV A;  2WWW A;  4Y28 J;  1KFM A;  4IOI H;  1RE3 C;  2RKL A;  2YO3 A;  3AE9 C;  1KV4 A;  2D2C D;  1L4A A;  5K5G B;  1UIX A;  3CD6 P;  1RF1 B;  2WSS H;  3L75 D;  1VQ8 P;  1FU1 A;  2KUB A;  5KAI H;  2OYI B;  2Y0E A;  3IF4 A;  1L0L D;  3AEG C;  1IO4 A;  3BVH A;  3PP5 A;  3R4Y A;  4D6T D;  1ZN5 A;  4DJG A;  1E79 H;  2E76 C;  3CLQ A;  4H13 B;  1N2D C;  1ZW0 A;  1ZOY C;  1JCC A;  1L0N G;  3IN6 A;  2Q6Q A;  4BXL A;  1RQV A;  1FAV A;  1K04 A;  3ZDM A;  3D6Y A;  4BRY A;  3A0H H;  4C46 A;  1VQ7 P;  1SQP D;  2IX7 C;  1BE3 G;  3GMA A;  3FWL A;  3A0B E;  1CI6 A;  3II6 A;  1LP1 A;  2Z5H A;  2WTY A;  3L71 J;  4ZMD A;  1J1D B;  4HB1 A;  3MUD C;  3L71 E;  3B5N B;  3VMY A;  3KPE A;  2I8D A;  3HE4 A;  2FFD A;  2FXO A;  1LT1 A;  1QVF O;  1NTZ J;  5BU5 A;  1A02 F;  3D70 A;  3S9O A;  4OWF A;  1GL2 A;  2XDJ A;  1GU4 A;  1DD4 A;  3CCE P;  2V7Q H;  4WY4 C;  1GW4 A;  4H44 B;  1BGY J;  3NTN A;  1HUC A;  1IK9 A;  2JWA A;  1SQV D;  1FOS E;  1N7S D;  2YMK A;  5AW0 B;  2QRX A;  1KQS O;  2KNC A;  2OTL P;  1KB9 E;  1WT6 A;  2WSF J;  3H1L E;  1NU1 D;  1P84 E;  2E75 D;  2HPC A;  2IBZ E;  4HYT B;  3V5B A;  1JB0 J;  2M3B A;  2BAS A;  2IYP A;  1LGH B;  1BSN A;  2KP8 A;  5AVT B;  1H0T B;  3CWB E;  3CCM P;  2ZXX A;  2K9J A;  4I7Z B;  4RO0 A;  4UB6 E;  5KKZ C;  4JBZ A;  2GM4 A;  4WVZ A;  5B66 H;  1L2P A;  3TNU B;  2PAJ A;  1NTK D;  3IAO A;  1S2E A;  5TIS E;  5H2F H;  1K73 Q;  2WSC H;  3RK3 B;  4XFJ A;  3LIE A;  2E74 D;  2NPS C;  1IC2 A;  1Q7Y Q;  1RE4 C;  5KAI E;  3FXE A;  1X22 A;  5AVR B;  5KJ7 D;  3L71 G;  1DX7 A;  4H0L D;  2YIU B;  1NWQ A;  1PPJ G;  3AE4 C;  2R5B A;  3L35 A;  4JYC A;  1NTZ G;  4U7J A;  2OYH C;  1YQ3 C;  5CCH C;  1QLE D;  2D2C B;  3A0H E;  1KC8 Q;  2C0W A;  1SQQ E;  1QX8 A;  3M06 A;  1BGY G;  1KFN A;  2O01 H;  4JQ0 D;  3L70 J;  4WWI A;  3N7N A;  2W27 A;  2N1T D;  4DOJ A;  1Y8A A;  3AEA C;  2QM7 A;  2XNX A;  2JDI H;  2G8Y A;  1EZV G;  1YIJ P;  5KAF E;  3RK3 E;  1MUU A;  3D71 A;  1PV3 A;  5M1B A;  2IBZ G;  3PHL A;  3HD7 A;  5KLV D;  1YQ4 C;  1HGV A;  2W8Z A;  2RH0 A;  1AJY A;  2V7Q J;  1KYO D;  4JF7 A;  1UII A;  3C1L A;  1YIT P;  5E79 H;  3OJA B;  2YNY A;  2YO2 A;  3KZI E;  3P8C E;  1AV1 A;  1JY3 O;  3AEF C;  1W2E A;  4EIJ A;  2JO1 A;  3SWK A;  2JEE A;  1KZU B;  5APU A;  1QL1 A;  1IFM A;  3OA7 A;  3RK2 B;  1T2K D;  5C39 A;  1FJP A;  2J5U A;  3L75 J;  4OGQ D;  3L75 E;  1L0L J;  2PGD A;  1OFC X;  2P67 A;  1L0L E;  3HE5 B;  1GK4 A;  2ZT9 B;  1L4A C;  4D6T E;  4AUW A;  4EOT A;  5B66 E;  1N7S B;  1SFC D;  3ITK A;  3E1R A;  2LXB A;  1USE A;  4HJG H;  4LC1 A;  1PPJ D;  1URQ D;  2WT7 A;  1NTZ D;  5AW1 B;  1SQP E;  3HUS A;  1HJB A;  2KSE A;  3CXH D;  1EXJ A;  3GG2 A;  1JUN A;  1J1D C;  1FBM A;  3GHG B;  1Y9B A;  4IL6 X;  1BGY D;  3VOP A;  1R8E A;  2KZI A;  4R4L A;  1JY2 P;  1EXI A;  2CK3 H;  3L70 G;  1SQX D;  2BCC D;  1EZV D;  3RGU A;  1T8Z A;  2E5Y A;  2O1J A;  1ZR4 A;  2QJK C;  3HUS B;  1PGO A;  2FYN B;  2DW3 A;  3H32 A;  2WIT A;  1SQV J;  3CXH I;  2WQY C;  1RY3 A;  1SQV E;  2FFD C;  4YPC A;  2XU6 A;  2B9B A;  2FY8 A;  2OQQ A;  1SLQ A;  2FXM A;  1GL2 C;  1NU1 J;  4LLH A;  3H1H D;  1EZV I;  1KB9 I;  2E74 B;  3CC7 P;  1NU1 E;  2W83 C;  2ZJS E;  1K9M Q;  2Q5U A;  3JSV C;  1P84 I;  2IFM A;  5AW7 B;  3Q5R A;  1YJ9 P;  2IBZ I;  5GTH E;  1RE4 A;  4H0L B;  2LKM A;  2W6A A;  1M8O B;  3FWN A;  5APW A;  4YXW H;  1VQN P;  1BCC D;  1YHQ P;  2H7H A;  3L75 G;  2HFE D;  5E79 E;  1L0L G;  3KDP B;  2KS1 B;  4PV1 D;  2ZYG A;  1A02 J;  1NTM K;  3F89 A;  1VF5 C;  1HGZ A;  1NTK J;  1KQF B;  3SSU A;  2ZXE B;  2B88 A;  2N1T B;  1NTK E;  1KQG B;  3CXH H;  3AEC C;  1BDC A;  3C9I A;  1LWU A;  2JP3 A;  3QWO C;  1OW8 A;  1W5C E;  4NPE A;  3A7O A;  2HR3 A;  1KB9 H;  4R4M A;  4W7Z A;  3L70 D;  3L74 J;  4Y99 C;  1AQ5 A;  2IFN A;  1PGP A;  2KLU A;  2KXP B;  2WSF H;  1H8A A;  4N3Y B;  1ZXG A;  4L76 A;  2JJL A;  3TK1 A;  3VMX A;  1JY3 N;  5KLI C;  3PH0 A;  1VF5 D;  2PFX A;  2KSJ A;  1KIL D;  2AXT E;  1SQV G;  1RF1 A;  3P8M C;  3E1I A;  3L73 D;  1IFP A;  4OGQ B;  2P1J A;  3NXS A;  2OYI A;  1H88 A;  3GLM A;  3M9B A;  1NU1 G;  1YJN P;  3G71 P;  5KLV J;  5KLV E;  4I2L C;  1SFC B;  5TIS H;  5AVV B;  1VQL P;  2KZJ A;  1KYO E;  1VDF A;  2G3A A;  1URQ B;  3SFD C;  2QVA A;  1MFZ A;  5TJH A;  4ZNC A;  3HD7 C;  4PD4 D;  5CCG A;  2K3R A;  5B5E E;  4MN4 C;  3ABV C;  3H1I J;  2B87 B;  2ZFC A;  2Y9Y A;  3B5N A;  2E42 A;  1NTK G;  5APQ A;  2R3S A;  3PTZ A;  1K05 A;  4RES B;  2ZT9 C;  3AED C;  5BU8 B;  1DIP A;  3I56 P;  1LTJ B;  3V6I A;  5AVS B;  3FXD A;  2JR8 A;  3FX0 A;  1AVO A;  1VL2 A;  3MP7 B;  5KAF H;  1KTM A;  1PPJ E;  2B89 A;  3L74 G;  2YKO A;  3OAK A;  1NTZ E;  5AVW B;  1LTB C;  2E76 D;  1S1C X;  1PGQ A;  2YKP A;  3CXH E;  3M9H A;  1KMI Z;  3VTP C;  2M8R A;  1BGY E;  3HTK B;  1HBW A;  1HH0 A;  3KZI H;  1N8R Q;  3WU2 E;  1SQX J;  2BCC J;  1U7J A;  1H0T A;  1OW7 A;  3TF5 A;  4K35 A;  2QJP B;  1SQX E;  2BCC E;  3VP8 A;  1AVY A;  1EZV E;  3HUS C;  1NVO A;  2FYN C;  4PV1 B;  2A06 G;  5AVQ B;  4C7N B;  1G1I A;  1J1E B;  2H8P D;  3TNU A;  1ZV8 A;  4O9B A;  5KLV G;  1WRG A;  1N73 A;  2C9N Y;  2SPZ A;  2R3C A;  1PP9 J;  4RKU J;  4L74 A;  1HWT C;  4PD4 H;  3C8V A;  3KYQ A;  3H1H J;  3BCC J;  4L73 A;  1JOC A;  1FZC B;  4WY4 D;  2QJY C;  3H1H E;  4M3L A;  3LW5 J;  3RL0 C;  2R32 A;  1N73 B;  3H1I G;  1BCC J;  1USD A;  3CC4 P;  1BCC E;  2QG4 A;  1VQM P;  2P10 A;  1EQ7 A;  3T97 B;  3O6Q B;  3TDK A;  3VN0 A;  1JCD A;  1SQB K;  4HH2 A;  2M0B A;  1SQB D;  1MZ9 A;  1GZL A;  1NTM J;  1KIL B;  4KT0 J;  2JWD A;  3V2N A;  4GDO A;  1SP4 A;  1CZQ A;  2Y0D A;  1G2C B;  1OVV A;  3L74 D;  4K3A A;  1NHL A;  1IK7 A;  1M1J B;  3G9R A;  4GOE A;  1JM0 A;  2E43 A;  2R44 A;  1FJK A;  1S5L E;  1QGK B;  1M57 D;  2AEJ A;  1BSH A;  5AVU B;  4U3F J;  3L70 E;  1QEX A;  3CX5 D;  1M90 Q;  1LWU C;  4OVN F;  1MKM A;  1SQX G;  1VQ4 P;  2BCC G;  3GF3 A;  5AW2 B;  2NPS D;  5GTH H;  2A06 D;  2IDB A;  1CSB A;  1S4X A;  1X0T A;  1ZRT D;  2QSI A;  3V2P A;  2KIK A;  1KIL E;  3L73 J;  4JPZ B;  3EQ2 A;  3WUT A;  2YKQ A;  2MJZ A;  2H89 C;  3L73 E;  3BAT A;  2KOG A;  3EWK A;  1PP9 G;  2FYU K;  2POH A;  2YMY A;  5CCH D;  2FYU D;  2WVR A;  3EFF K;  1U57 A;  3H1H G;  3HE5 A;  3BRV B;  4QMA A;  3BCC G;  1DEE G;  2W6J H;  3E7K A;  1RF1 C;  1NOH A;  3V4Q A;  1N7S A;  1LT9 B;  2I1K A;  5CHX A;  2Q3I A;  3H1I D;  3VMZ A;  1KYO I;  2OYI C;  3TSI A;  1BCC G;  2LXC B;  2P58 A;  3SWY A;  3CMA P;  1NKZ B;  3UIA A;  2E76 B;  4AQR D;  3W68 A;  3CCU P;  4H13 C;  1RHZ B;  2ITA A;  4PD4 E;  3GHG A;  1LTA C;  2IZ1 A;  4L75 A;  4OH8 B;  1NTM G;  3M9Q A;  1GDT A;  3V2R A;  3HRN A;  2M5A B;  2KLV A;  3TYY A;  2GUV A;  3H1K D;  2AXT H;  3MD0 A;  2E75 B;  5CCG C;  1YBK A;  2Q1K A;  1WMK A;  2P7J A;  3B5N C;  3WMM 0;  2K1A A;  3W67 A;  3MIW A;  2OYO A;  1GW3 A;  2XND H;  2C9L Y;  4U3F G;  2R5D A;  2W90 A;  1L4A D;  4WY4 B;  4JYB A;  3G3Z A;  4H44 C;  5CJ0 A;  2H43 A;  1KYO H;  3CCV P;  2FYZ A;  2WPV B;  2WPR A;  3O8Z A;  5KJ7 A;  1T3U A;  1PIX A;  3AEB C;  2QJP C;  3L73 G;  1SS1 A;  3IFM A;  1AFO A;  2LR2 A;  4GOF A;  3CCQ P;  3JC2 2;  1PP9 D;  1J2J B;  1Q81 Q;  1VQP P;  5B5E H;  3BCC D;  2KS1 A;  1FZB A;  3CCL P;  5APV A;  5BVZ A;  1N7L A;  3V2Q A;  2OGU A;  2N1T A;  4XE5 B;  3D6Z A;  3RL0 g;  4I7Z C;  2O1K A;  3U1A A;  4GOD A;  3MTU E;  1DH3 A;  4ZKU A;  1KOR A;  4WB4 A;  1PFI A;  1ZP0 C;  4C7R A;  2PP6 A;  5CBO A;  1X79 B;  4I6M C;  1N73 C;  1NTM D;  4YTP C;  2K37 A;  1GL2 D;  1JY2 N;  1D7M A;  1DEB A;  2ZAE B;  3RK3 C;  5APS A;  3Q5P A;  2NPS B;  3AE3 C;  1SQB J;  3WU2 H;  3S4R A;  1G1J A;  2QEX P;  1SQB E;  2Y0C A;  2WZ7 A;  1KN7 A;  2GUS A;  2YIU C;  1JTH B;  3CCS P;  3H1J J;  4U3F D;  3G4S P;  1SQQ K;  3WUV A;  4KJM A;  2K88 A;  2QM8 A;  2OYH B;  3L74 E;  2D2C C;  3LID A;  3U59 A;  1KD1 Q;  1OX3 A;  1Z56 A;  1SFC A;  1NO4 A;  1NH4 A;  1XTG B;  2WSE J;  5AW5 B;  3USS A;  1MV8 A;  2OTJ P;  4DCK A;  3P32 A;  3CX5 E;  1URQ A;  4XA4 A;  1S72 P;  2XKM A;  3LW5 H;  1FZA A;  3RBX A;  1IFJ A;  4WBA A;  2A06 E;  1CW5 A;  1W2B O;  2YXQ B;  4TT3 H;  3P7K A;  1ZRT E;  4KHX A;  2OAR A;  3L4F A;  2B87 A;  1BDD A;  5APT A;  1VQK P;  2A45 G;  3U1C A;  1FDI A;  3M0D A;  2HOD B;  2FYU J;  3CME P;  1ZME C;  2FYU E;  1YJW P;  5AVZ B;  1LTJ A;  3JCU H;  3QH9 A;  1VQ6 P;  1Q90 D;  2CPS A;  2W6B A;  1LT9 C;  4AYC A;  5CJ4 A;  2NZ2 A;  4IFD K;  1T6A A;  3M91 A;  5AVX B;  1L0L K;  3RK2 C;  3H1I E;  2MKV A;  1JNM A;  1EC5 A;  2Q3E A;  3AE8 C;  4PJ0 H;  4A7P A;  3CCJ P;  3N4X A;  3H25 A;  1L4A B;  1S5L H;  1GMJ A;  5DJU B;  4IL6 E;  5CBN A;  1T3J A;  1N7S C;  1SQB G;  4ASW A;  1H89 A;  4PD4 I;  1SQP K;  2WPQ A;  1S3J A;  3HTK A;  4EYY Q;  2ZVO B;  5L8R J;  3BAS A;  1FS0 E;  2IZ0 A;  4IFF A;  3H1J G;  2AEM A;  3H1K J;  3HD7 D;  2E75 C;  2N9Y B;  3H1K E;  3L72 D;  4C7N A;  3GHG C;  4BRY B;  3V4W A;  1GD2 E;  3RK2 D;  1FZE A;  2KK7 A;  1CI6 B;  2ZT9 D;  1LP1 B;  2QJK B;  3AE1 C;  1SQV K;  2AXC A;  1FZF A;  1FZC A;  1RF0 A;  1FC2 C;  3TGU D;  2Q9I A;  1ZR2 A;  3F5H A;  2WMM A;  3HE4 B;  2FFD B;  2QA4 P;  2V4H A;  2RMZ A;  3H1L J;  1HTL C;  4W7Y A;  1YYC A;  1NU1 K;  3AE2 C;  4ASV A;  4W80 A;  4NPD A;  1GL2 B;  1PP9 E;  1GK6 A;  1JMM A;  2C0X A;  3T97 A;  3O6Q A;  4CPG A;  2E74 C;  2FYU G;  1SVF A;  3BCC E;  1JMB A;  2HG5 D;  3CWB J;  3L36 A;  5KJ7 C;  1OIP A;  1Y47 A;  4H0L C;  5EFW B;  1KIL A;  3BRT B;  2KNC B;  1LTT C;  4N78 D;  1PZQ A;  2N9B A;  1OWA A;  1G2C A;  1AQT A;  2A45 I;  2HPC B;  1L0N K;  3A3Y B;  1EDK A;  3VP9 A;  1GTW A;  1L0N D;  2M3E A;  1QL2 A;  1M1J A;  2WPS A;  3Q2Y A;  3VYI A;  1LTI C;  1NTK K;  3GF7 A;  3KHU A;  5APX A;  1VF5 B;  1HF9 A;  1DD3 A;  1NJI Q;  3R2P A;  4I1L A;  2K9J B;  2N1T C;  3B71 A;  1U7M A;  1AA0 A;  1BE3 D;  5AW4 B;  1NTM E;  3JCU E;  3H1J D;  2FBW C;  5GTI H;  2HLO A;  3OW2 O;  3H1K G;  1Q2N A;  3RL0 D;  1YI2 P;  1S9K D;  3MHV A;  2KI7 B;  2ZYD A;  2ZYA A;  4PJ0 E;  1OMI A;  5CMZ A;  1FDM A;  2O3J A;  3CCR P;  4Y99 B;  4EI2 A;  2BEZ F;  2IYO A;  4GIF A;  4RJT A;  1JY2 O;  1E5W A;  1Q82 Q;  4YXD C;  1SQQ J;  4U3F E;  1RE3 A;  3L37 A;  3FGA D;  5APY A;  3CL3 D;  5KLI B;  2Q7C A;  2IPP A;  1TU3 F;  2A45 H;  1YTZ T;  1LNQ A;  1VQ5 P;  3I55 P;  1M7L A;  1LT9 A;  1T2K C;  3GW6 A;  4OGQ C;  3MZW B;  1PL5 A;  1GU5 A;  4TLF A;  3H1L G;  1M56 D;  2HYN A;  3Q5S A;  5KLV K;  3CX5 I;  1NAY A;  4ZKP A;  1SFC C;  3VMA A;  3CWB G;  3CPW O;  1FOS F;  5DJT B;  1EDL A;  2E5T A;  4NPF X;  1URQ C;  1M1K Q;  1EDJ A;  2M5A A;  3HD7 B;  1X9V A;  4DT0 A;  4UB8 H;  1N86 A;  2AEF A;  3MUD A;  5AW6 B;  2KYV A;  3KXD A;  1JO5 A;  2ZVN B;  4N6J A;  2PRR A;  2VRS A;  3PJS K;  4D6T J;  2CPB A;  3M0D C;  3MGN A;  1LJ2 A;  5KTB A;  4WY4 A;  1LTJ C;  3L71 D;  2K9Y A;  1MFT A;  1IFN A;  2WSE H;  1HVV A;  2XV5 A;  3CX5 H; 
#chains in the Genus database with same CATH homology
 1NTZ K;  1JTH B;  1NWQ A;  3IR9 A;  1SQQ K;  3H6P A;  2QM8 A;  2R5B A;  3L35 A;  4JYC A;  2YKO A;  2OYH B;  2OYH C;  3OAK A;  1LTS C;  1OXZ A;  5AVW B;  5CCH C;  1LTB C;  2Z5I A;  1IFD A;  2C0W A;  2YKP A;  3LID A;  3M9H A;  3U59 A;  1FZG A;  3A5T A;  3M06 A;  3VTP C;  1KFN A;  2O01 H;  1Z56 A;  2M8R A;  3HTK B;  1HBW A;  1HH0 A;  1SQX K;  1SFC A;  3N7N A;  2W27 A;  2N1T D;  4DOJ A;  1NO4 A;  1NH4 A;  1XTG B;  2QM7 A;  2XNX A;  5AW5 B;  2WT7 B;  1MV8 A;  1XTC C;  3P32 A;  5AW8 B;  1URQ A;  4XA4 A;  5AVY B;  3VP8 A;  2XKM A;  3HUS C;  3KQG A;  1MUU A;  3LW5 H;  1KQL A;  3A2A A;  1FZA A;  4LGD E;  5AVQ B;  1IFJ A;  5CCG D;  4C7N B;  4WBA A;  1G1I A;  3HD7 A;  1J1E B;  1CW5 A;  2H8P D;  3TNU A;  1J1E C;  1HGV A;  1ZV8 A;  5AW9 B;  3B5N D;  2L5G B;  4O9B A;  1WRG A;  3P7K A;  4JF7 A;  1IFI A;  4KHX A;  3SWF A;  1N73 A;  2OAR A;  2C9N Y;  3L4F A;  3OJA B;  2YNY A;  2R3C A;  5AW3 B;  2YO2 A;  5APT A;  2A45 G;  1HWT C;  3U1C A;  1JY3 P;  3P8C E;  3KYQ A;  2Z4E A;  4GKG A;  3M0D A;  1JOC A;  2HOD B;  1JY3 O;  3M0A A;  4WY4 D;  1FZC B;  1FZC C;  3H32 B;  4GT1 A;  4IFM A;  1RF0 C;  1W2E A;  4M3L A;  4EIJ A;  2NPS A;  5AVZ B;  2KB7 P;  3RL0 B;  1LTJ A;  3RL0 C;  2JEE A;  1KZU B;  2R32 A;  2CPS A;  2W6B A;  5APU A;  3CI9 A;  1LT9 C;  1QL1 A;  4AYC A;  5CJ4 A;  1IFM A;  3OA7 A;  3RK2 B;  1N73 B;  4IFD K;  3M91 A;  5AVX B;  3RK2 C;  1L0L K;  1T2K D;  1FJP A;  2P2U A;  1JNM A;  1JTH A;  4N78 E;  1EQ7 A;  2J58 A;  2P67 A;  3VN0 A;  2OYH A;  3HE5 B;  1GK4 A;  3N4X A;  1L4A B;  5CCH A;  1JCD A;  1L4A C;  1SQB K;  4HH2 A;  4AUW A;  1IJD B;  1MZ9 A;  1GZL A;  4EOT A;  1LTG C;  1N7S B;  1SFC D;  1T3J A;  1N7S C;  1KIL B;  1H89 A;  1KIL C;  1SQP K;  1X8Y A;  2J59 M;  2WPQ A;  3HTK A;  4LC1 A;  3V2N A;  1SP4 A;  1YTZ I;  1CZQ A;  2I1J A;  1G2C B;  3BAS A;  3NMD A;  3B8E B;  1URQ D;  2WT7 A;  4IFF A;  5AW1 B;  1NHL A;  2FKW B;  3HUS A;  1HJB A;  1M1J B;  3HD7 D;  3I5C A;  1M1J C;  1JUN A;  1J1D C;  1FBM A;  3GHG B;  2XZR A;  4C7N A;  3GHG C;  2E43 A;  3VOP A;  3V4W A;  1FJK A;  4B86 A;  1GD2 E;  1S9K E;  3RK2 D;  1JY2 P;  1FZE A;  3NFQ A;  5AVU B;  1NAF A;  1LWU B;  1CI6 B;  1LWU C;  3RK3 D;  5AW2 B;  1T8Z A;  1VPC A;  2O1J A;  1ZR4 A;  2NPS D;  3HUS B;  1SQV K;  3EFG A;  2HOD A;  1FZF A;  1FZC A;  1RF0 A;  1CSB A;  3H32 A;  2WIT A;  2Q9I A;  1RY3 A;  1ZR2 A;  1NKN A;  3HE4 B;  2FFD B;  3V2P A;  2FFD C;  2XU6 A;  4DZO A;  1HTL C;  1ZLL A;  4W7Y A;  1YYC A;  3EQ2 A;  1NU1 K;  2YKQ A;  3P8C D;  4W80 A;  2MJZ A;  1SLQ A;  3BAT A;  2KOG A;  2WWW A;  1KFM A;  2FXM A;  1RE3 C;  1GL2 B;  2FYU K;  1GL2 C;  2POH A;  4LLH A;  2YMY A;  5CCH D;  2YO3 A;  1GK6 A;  1JMM A;  2C0X A;  3T97 A;  3HE5 A;  3BRV B;  1L4A A;  2Q5U A;  1SVF A;  2IFM A;  5AW7 B;  2HG5 D;  1RF1 B;  3L36 A;  1RE4 A;  1RF1 C;  5KJ7 C;  1NOH A;  3V4Q A;  2LKM A;  2W6A A;  1N7S A;  1LT9 B;  2I1K A;  5CHX A;  1KIL A;  2Q3I A;  3BRT B;  5APW A;  1LTT C;  4N78 D;  3VMZ A;  2N9B A;  1OWA A;  1FU1 A;  1G2C A;  2OYI B;  2H7H A;  2OYI C;  3TSI A;  2HFE D;  1IO4 A;  3BVH A;  3PP5 A;  2A45 I;  3SWY A;  2HPC B;  1L0N K;  3A3Y B;  3VP9 A;  1GTW A;  1ZN5 A;  3KDP B;  1NKZ B;  3UIA A;  4AQR D;  3CLQ A;  1QL2 A;  1M1J A;  1N2D C;  2WPS A;  3VYI A;  1JCC A;  1LTI C;  1NTK K;  1A02 J;  1NTM K;  3GHG A;  1FAV A;  5APX A;  1LTA C;  1HGZ A;  3R2P A;  2ZXE B;  4OH8 B;  2N1T B;  4I1L A;  2N1T C;  4C46 A;  3M9Q A;  1GDT A;  5AW4 B;  3V2R A;  3HRN A;  2IX7 C;  3C9I A;  1LWU A;  2KLV A;  3TYY A;  1CI6 A;  2GUV A;  3II6 A;  2Z5H A;  3MD0 A;  2HLO A;  2WTY A;  5CCG C;  1J1D B;  3RL0 D;  3A7O A;  1S9K D;  2P7J A;  3B5N B;  3VMY A;  3B5N C;  3WMM 0;  3KPE A;  5CMZ A;  1FDM A;  3HE4 A;  4Y99 B;  4W7Z A;  2FFD A;  3MIW A;  4Y99 C;  1AQ5 A;  2IFN A;  2WSF H;  1GW3 A;  4GIF A;  1H8A A;  2C9L Y;  1JY2 O;  5BU5 A;  1E5W A;  4N3Y B;  1A02 F;  2R5D A;  1RE3 A;  2JJL A;  3L37 A;  1GL2 A;  2XDJ A;  5APY A;  1GU4 A;  1L4A D;  4WY4 B;  3TK1 A;  4WY4 C;  4JYB A;  1GW4 A;  3VMX A;  3CL3 D;  3G3Z A;  3NTN A;  1HUC A;  1JY3 N;  1IK9 A;  5CJ0 A;  2H43 A;  2Q7C A;  2IPP A;  1FOS E;  2FYZ A;  2A45 H;  1N7S D;  1YTZ T;  2KSJ A;  1KIL D;  2WPR A;  3O8Z A;  1RF1 A;  5KJ7 A;  1T3U A;  1M7L A;  3E1I A;  3P8M C;  1LT9 A;  1T2K C;  5AW0 B;  2P1J A;  3IFM A;  3NXS A;  1GU5 A;  1AFO A;  1WT6 A;  2OYI A;  2HYN A;  1J2J B;  5KLV K;  1H88 A;  2HPC A;  3M9B A;  4HYT B;  3V5B A;  1FZB A;  2M3B A;  2BAS A;  4I2L C;  1SFC B;  4ZKP A;  1SFC C;  1LGH B;  5APV A;  5AVV B;  5BVZ A;  2KP8 A;  1N7L A;  3V2Q A;  5AVT B;  1FOS F;  1VDF A;  2N1T A;  4XE5 B;  1URQ B;  1URQ C;  2O1K A;  2GM4 A;  3U1A A;  1MFZ A;  3MTU E;  1DH3 A;  4ZKU A;  3HD7 B;  1X9V A;  3HD7 C;  4WB4 A;  3TNU B;  1PFI A;  4C7R A;  5CCG A;  1N86 A;  2PP6 A;  1X79 B;  3MUD A;  4I6M C;  2PAJ A;  5AW6 B;  2KYV A;  2ZFC A;  1N73 C;  3B5N A;  1JO5 A;  4N6J A;  2E42 A;  5APQ A;  2VRS A;  1GL2 D;  1JY2 N;  2CPB A;  2WSC H;  3M0D C;  4RES B;  3RK3 B;  1DEB A;  3RK3 C;  5APS A;  3MGN A;  2NPS B;  3LIE A;  5KTB A;  2NPS C;  5BU8 B;  1IC2 A;  1LTJ B;  4WY4 A;  1LTJ C;  1RE4 C;  5AVS B;  5AVR B;  1G1J A;  5KJ7 D;  1DX7 A;  2WZ7 A;  1IFN A;  2WSE H;  1HVV A;  2XV5 A;  2GUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...