3RL0B

Truncated snare complex with complexin (p1)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
59
structure length
59
Chain Sequence
b'ALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 2
publication title Complexin cross-links prefusion SNAREs into a zigzag array.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/exocytosis
total genus 27
structure length 59
sequence length 59
chains with identical sequence F, J, N, R, V, Z, d
ec nomenclature
pdb deposition date 2011-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3rl0B00
4WY4B 3VOPA 4WY4D 4JF7A 3B5NC 4WY4A 1GL2C 3M0DC 2KOGA 1N7SC 1SFCB 3RK3B 1SFCD 2HFED 3RK3D 3B5NB 2N1TB 1SFCC 3B5ND 2N1TD 2HG5D 1SFCA 1L4AB 3RK3C 1GL2B 1GL2D 1HVVA 2H8PD 2N1TC 5CCGD 3B5NA 2N1TA 3HTKB 1N7SB 2M8RA 1L4AC 1N7SD 1L4AA 3HD7C 1GL2A 5CCGC 3RK2C 2PP6A 5CCGA 3KYQA 1N7SA 4N78E 1T3JA 2XDJA 4OH8B 2YMYA 1L4AD 3TSIA 3HD7B 5KJ7C 1KILB 3HD7D 3RK2B 1KILD 3RK2D 1JTHB 1XTGB 1KILC 3HD7A 4W7YA 1KILA 3RL0C 1JTHA 2NPSB 3PP5A 2NPSD 4W80A 5KJ7D 4LGDE 2NPSC 5CCHD 2NPSA 4WY4C 5KJ7A 5CCHC 3P8CE 5CCHA 3RL0B 3RL0D 1NHLA 1URQB 1URQD 2WZ7A 4W7ZA 1URQC 1URQA
chains in the Genus database with same CATH superfamily
3VOPA 5AVSB 1X79B 3L74E 3H32B 1PPJG 2KYVA 2IBZD 3L74D 4K35A 5GTHE 4IL6X 3M0DA 2QJYC 2IFNA 2ZT9D 1NAFA 1R8EA 3RK3B 3B5NB 2UWJE 4GIFA 4EOTA 1RHZB 2O1JA 2J5UA 3KZIE 1S9KE 3CCJP 2YKPA 2YKQA 1AQ5A 3IF4A 1FAVA 5AW3B 1RE3C 2GUSA 2HLOA 1NTME 1J2JB 1OVVA 3MD0A 2FFDA 1W5CE 1NTMD 5AVTB 3CX5E 2FYNC 2OYHC 2XNDH 2KB7P 3CX5D 2PFXA 3H1LD 4ZMDA 1T3UA 3A0BH 2K37A 3IN6A 1IFNA 4M3LA 3L72J 3TGUG 1YJNP 4OVNF 2HYNA 1Y47A 2R5DA 1S4XA 3A2AA 4H44D 1HJ0A 3TNUB 3CPWO 4EIJA 1AJYA 1SQBG 1EZVE 1JY3P 1VQOP 3GHGA 1EZVD 1K9MQ 2KNCA 4KT0J 3U59A 4U3FE 1VQ4P 4ASVA 5KLVJ 4U3FD 4XE5B 2E75C 4R4MA 1Q86Q 4WY4A 1MZ9A 1NTZG 5CBOA 2WT7B 1CW5A 1GL2C 1SQXJ 1G1JA 1HBWA 1NU1G 3L73E 3MIWA 5APVA 1OMIA 4PJ0H 1YIJP 5E79H 5CMZA 3VTPC 5CBNA 1ZOYC 1L4AA 2QJYB 1ZLLA 2L5GB 3SWYA 5GTIH 1HUCA 2DW3A 1RQVA 3CLQA 3AE9C 3L71G 4BXLA 3H1JE 4H13D 1QVFO 5CJ0A 1QX8A 4RJTA 2W8ZA 2A06G 2MJZA 3H1IE 3L75G 5APQA 1BGYJ 1GW3A 3BCCG 3RL0C 1BE3E 2FYUE 1JTHA 2ITAA 3H1ID 2NPSD 2LXCB 1VQ7P 1K8AQ 2LKMA 4Y28J 1FS0E 2PRRA 1QLED 1KMIZ 2FKWB 1QL2A 1DX7A 1AVYA 1NTKJ 1K05A 1URQC 1SQVK 1KZUB 2M3BA 5AW0B 4WBAA 4RO0A 4JQ0D 4GDOA 3G9RA 3AE6C 1N8RQ 2R44A 1JNMA 1JY2O 1LT1A 1JY3N 2ZJSE 4YTPC 2HR3A 3RK3E 2JJLA 3HE5B 1SFCB 3A3YB 2VRSA 3RK3D 1CI6B 2IYPA 2ZT9C 2E75B 3C1LA 1USEA 4B86A 2O01N 2OYOA 3B5ND 1QGKB 5K5GB 1GL2B 1ZV8A 1QVGO 3HE4B 3C9IA 1YYCA 1IK7A 2ZVNB 2KI7B 2CPSA 4PD4H 4RKUJ 1NJIQ 1WRGA 1R5SA 3HRNA 1FZCA 1RF0C 3ITKA 5B66H 3GLMA 1GZLA 1YBKA 5B5EH 3F89A 1NTMJ 4KJMA 3Q2YA 1PP9G 3H1LJ 2FXOA 1M1JA 2OTKE 4I7ZC 3NTNA 1LP1B 1T2KD 3RL0B 1W2EA 3AE2C 2OQQA 5AVYB 3R4YA 2IYOA 2KSJA 3CCSP 1ZN5A 1LTJA 1BDCA 3D71A 3GF3A 4U3FJ 4I1LA 1L0LJ 3AE4C 1CSBA 2B87B 3G6EP 2RKLA 3TK1A 1HVVA 3LW5J 3KZIH 2JEEA 1FDIA 1YTZT 2O1KA 4C7NB 3Q5PA 2R5BA 2HPCB 1KYOI 1SQPK 3LIDA 1M8OB 3TSIA 3Q5SA 4HYTB 2KIKA 4H13C 1DH3A 3L72E 3L70J 2K3RA 1JUNA 2W83C 3W67A 1SQBK 3S4RA 4RESB 2NPSC 1FOSF 5AW2B 1FZFA 3H1KJ 2KP8A 5KJ7A 3H1IJ 1K04A 3U1CA 1RF1B 2R3CA 3AE1C 1YQ3C 2O3JA 2YNYA 2QE7H 2QJPB 4I7ZB 1HTLC 1IO4A 2M3EA 1P84E 1NO4A 1PPJE 3VP8A 2QSIA 3IFMA 1P84D 1H0TB 2IBZI 3SWFA 1PPJD 3B71A 1IFMA 1SQQK 3I5CA 1SFCD 1YQ4C 2QM7A 2E75D 3RK3C 2YMKA 1GL2D 2OYIB 2H8PD 5CCGD 1SQVG 2N1TA 3CMEP 1KTMA 1DEEG 4HH2A 5AW4B 2XKMA 3CCLP 1L0NJ 3WUTA 1N7SA 5CJ4A 2G3AA 2K9JA 2AXTE 1BCCG 3AEDC 3D6ZA 4CPGA 4L74A 4XA4A 5CHXA 4IL6E 1BGYE 1KYOE 2KLVA 2QA4P 1BGYD 1KYOD 2P1JA 1OW6A 3AEFC 1LWUB 4YXWH 1YTZI 2QJKC 3CI9A 1IFPA 3L36A 3RL0D 1GK6A 1RE4A 3WU2E 1FJPA 1T2KC 2P10A 3WUVA 2QIWA 3V4QA 1AVOA 1NTKE 1NAYA 4JF7A 3M9BA 1OVUA 3HUSC 5DJTB 1JOCA 1NTZD 2KZJA 3Q1MA 4JYBA 1LTGC 4TT3H 1M57D 3LIEA 2Y9ZA 1JO5A 4D6TJ 1N73A 2IBZE 4L75A 5H2FE 5AVVB 2I8DA 1AV1A 1FBMA 1MKMA 4GOEA 1YITP 3MP7B 1ZXGA 2NRGA 2P67A 4I6MC 1LTSC 1KILB 1U7JA 5KAIH 2HODA 3GHGC 3L71D 1SQXG 1OZHA 2W6JH 3KPEA 1OVRA 3P8CD 1EDLA 2YXQB 1GW4A 3BASA 2FXMA 1KORA 2A06D 1FDMA 1FOSE 3C8VA 1ZMEC 3OAKA 4BRYA 2KS1B 3GMAA 4H0LB 1HGZA 1SLQA 2Y9YA 4WY4C 3H1LE 3VMAA 3WMM0 1FDOA 2Z5HA 5CCHA 1SQPG 3H6PA 4YPCA 3H1HJ 1OX3A 4W7ZA 1E79H 1N86A 1PGQA 3CCUP 2O01J 2QJKB 4HB1A 3M9QA 2RMZA 5KLIB 2FYUK 1LTIC 3CWBG 1JCCA 1YHQP 2YO3A 1VQMP 4TLFA 5APYA 3G3ZA 2WSSH 1S5LE 1RH5B 2AXCA 1GU5A 1KB9H 1L0LE 3HUSB 1SFCC 1L0LD 5TJHA 2A45I 2E42A 5CCGC 2BEZF 3RK2C 2FFDB 3HTKA 1RE3A 2E74B 4EI2A 4HKZH 1SQQG 4NPDA 2OYHA 4LC1A 2IPPA 3VYIA 2XV5A 5KKZB 1XTGB 3HD7A 4NPEA 3OJAB 2E43A 2BCCG 1EQ7A 4JPZB 3L70E 2C9LY 1YJ9P 1ZR2A 3L74G 2QG4A 3W68A 1FJKA 3L70D 3GHGB 4UB8E 2XNXA 1PP9D 1G2CA 3H1KE 1GTWA 1SP4A 3H1KD 3TGUJ 2YO2A 1TU3F 1KQLA 1S5LX 2POHA 4WY4B 3D6YA 3I56P 2D2CC 3E1RA 4PV1C 1GMJA 4I2LC 2XU6A 5APUA 4BWNA 2WSCJ 3A0HE 3WUUA 4WWIA 4IFMA 1LTTC 3SFDC 2JWDA 4DCKA 2B89A 1L4AB 2LR2A 3USSA 1NTZJ 1CZQA 2M8RA 2WWWA 4L73A 1NU1J 3KYQA 1VQLP 1KQFB 1EDIA 1L0NE 5KAFH 3BRVB 1L0ND 2ZXEB 3RL0g 3CXHD 1IFDA 1EZVG 1FC2C 2AXTH 5AW1B 1KILD 3RK2B 1JTHB 2Q7CA 2Y0EA 4C46A 2GA1A 4U3FG 1R5LA 1Q82Q 1M7LA 2WMMA 4IL6H 3L71J 2V7QJ 4H0LD 1KYOH 2L91A 2G8YA 1H8AA 1X0TA 2H89C 3L75J 3L73G 2M5AA 3BCCJ 1PGJA 3PTZA 4GT1A 2WSEJ 1RF1C 3SSUA 1URQA 3WU2H 2KK7A 1A02F 4OGQB 1MFZA 2QJPC 3P32A 1P84I 1PFIA 3AEGC 2FYZA 3S1KA 4IFDK 2D2CB 4D6TE 3QH9A 4PV1B 3MUDC 3H1JG 3MGNA 4D6TD 2P7JA 3I55P 1SQVE 1IC2A 3F5HA 3H1IG 2OYIC 3V4WA 5BU5A 1SQVD 1KFNA 1AA0A 1FZCB 1BE3G 4AYCA 2FYUG 5KLVK 3AE7C 1S3JA 2RH0A 3N7NA 3QWOC 3VMXA 1OW7A 1SVFA 3EFGA 5GTHH 1RF0A 1SQXK 3K5BA 5KJ7C 3O8ZA 1M1KQ 1LT9A 1LTBC 3V2NA 4U7JA 4W7YA 1NWQA 1PIXA 1N7LA 1DEBA 1JY2P 1M1JB 1EXIA 1YJWP 4A7PA 4JYCA 4ZNCA 4LGDE 1M56D 3L4FA 4NPFX 1OWAA 3JCUE 3V2RA 1LWUC 1D7MA 3AE8C 1JB0J 2WPRA 3MZWB 1GK4A 3CX5H 4PJ0E 2KZIA 3P8MC 3H1HE 1HF9A 1VQNP 1H0TA 5L8RJ 3L37A 1VPCA 3H1HD 2E76B 1PP9J 4WY4D 1PL5A 1LTJB 1JEKA 2A45G 1HWTC 1J1DC 1NYHA 1JCDA 2M0BA 2N9BA 1N7SC 1USDA 5AVUB 2WQYC 3KXDA 1W2BO 4K3AA 2NZ2A 3JSVC 4DZOA 1HJBA 2HG5D 2H7HA 3BATA 1KC8Q 1S5LH 1WT6A 3E7KA 2I1KA 1PGPA 4GKGA 2PP6A 1NTKK 1HGVA 4N78E 4H44B 3LW5H 2WSFJ 2ZXXA 2C0WA 4N78D 2K88A 2Z4EA 1VF5B 5AVQB 2E5TA 3RK2D 2R3SA 2YIUC 1RE4C 1KILC 3VMYA 3AEBC 3O6QA 2Z5IA 2WPVB 3GW6A 1PGOA 4W80A 3B8EB 2NPSA 1EDKA 4H0LC 3T97A 1U57A 1T6AA 2YKOA 2IZ0A 1SQPE 1NHLA 1SQPD 3TGUE 1LGHB 2Q5UA 2WPQA 1N73C 1JY2N 3TGUD 3ABVC 2SPZA 3A5TA 2IDBA 3JC22 2WVRA 4KHXA 1SQBE 2N9YB 1PV3A 5AW7B 2C9NY 1NTMK 2B9BA 3M0DC 3H32A 1SQBD 5KLIC 2OTJP 3CWBD 2Y0DA 2D2CD 1VQ6P 1J1DB 2N1TB 1X22A 5BVZA 3A0HH 4PV1D 1VQPP 1RQUA 3PRJA 2FY8A 4N3YB 1JM0A 3B5NA 1NTZE 1N7SB 4ZKUA 2Q6QA 3N4XA 1NU1E 2K9JB 3L72G 1J1EC 1NU1D 2FFDC 2E74C 1BDDA 1SQQE 2YMYA 1ZRTE 3L35A 3V2PA 1SQVJ 2WTYA 2OTLP 1SQQD 1ZRTD 2P58A 3II6A 4UB6E 5C39A 2A45H 1X9VA 2BCCE 5EFWB 5KKZC 2BEQD 2KLUA 3PP5A 2Q3IA 4Z1MH 4AQRD 4HJGH 4O9BA 2BCCD 2GUVA 5KLVG 1BCCJ 1JMMA 3V2QA 3L71E 3KQGA 2YIUB 3TNUA 4N6JA 3P8CE 1NH4A 2A06E 3L75E 1HH0A 3BCCE 1S2EA 3L75D 3MTUE 2E76D 3BCCD 2W6BA 2JDIH 3M06A 3HUSA 2W27A 1S9KD 3VN0A 3PJSK 5AW6B 2WT7A 1N73B 3R2PA 3BVHA 4GOFA 1GD2E 3U1AA 4DT0A 2GM4A 2P2UA 3OA7A 3AE5C 1UIXA 1L4AC 2J59M 3G4SP 1DIPA 1M90Q 3HD7C 2R32A 5AVXB 2QEXP 1LNQA 3Q3DA 1NOHA 1QL1A 2Q9IA 5AVRB 1BGYG 4YXDC 3S9OA 2Q1KA 1EC5A 3E1IA 2HODB 3NXSA 3SWKA 4Y99C 1VF5D 3CXHI 3Q5RA 1J1EB 2J58A 4BRYB 2LXBA 1PZQA 3EQ2A 3CCRP 1NTKG 1DD3A 3FXDA 5KJ7D 5BU8B 1L0NK 4WB4A 1LTAC 1EXJA 3BRTB 3AEAC 3IAOA 3JCUH 3V6IA 3L73D 3EWKA 1VQ8P 4JBZA 1WMKA 1E5WA 1PP9E 2IBZG 1Y9BA 1VQKP 1OFCX 4WVZA 1SQPJ 2KNCB 4OGQC 2O01H 1A02J 2XZRA 4EDFA 5TISE 1EDJA 3KHUA 2MKVA 3TDKA 1L2PA 1Q81Q 2OARA 1GDTA 3HE5A 2N1TD 1SFCA 2JKVA 1Q2NA 1CI6A 1SQBJ 3UIAA 3CWBJ 3HTKB 3H1JD 1N7SD 2Y0CA 1GL2A 1KQGB 5CCGA 3B4SA 1P84H 5M1BA 1IFJA 3HE4A 3G71P 2ZVOB 1NTMG 2FYNB 3M91A 1FZCC 2OYHB 1BE3D 2FYUD 4IOIH 2XDJA 3A7OA 3H1LG 4OH8B 5APTA 3HD7B 3PHLA 3M9HA 1MUUA 2FBWC 3GF7A 1BSNA 4DJGA 3TYYA 1KB9I 3H25A 2IX7C 4Y99B 3CXHE 1SQQJ 1G2CB 2IFMA 1M1JC 2CK3H 1BSHA 1KILE 1T8ZA 3SFEC 2FXPA 1DD4A 4DOJA 1SS1A 1FZGA 3MHVA 3CCVP 1LP1A 2BCCJ 2WITA 3CMAP 1L0LG 1UIIA 3L74J 1KQSO 2E76C 1IZNB 2YXRB 1LTJC 1MV8A 1KN7A 2OGUA 2PAJA 2AEFA 3ZDMA 2JWAA 1FZEA 5APSA 3VMZA 1ZP0C 3PH0A 5KAIE 1OIPA 2IZ1A 3CCEP 3KDPB 4ZKPA 2WSCH 1LT9C 1AFOA 2B87A 3VP9A 1GU4A 1OW8A 4GODA 1MFTA 5APWA 1N2DC 1S1CX 3NFQA 5DJUB 3FXEA 2C0XA 1OXZA 2QVAA 1VL2A 1IJDB 3L70G 1T3JA 3AECC 1FZBA 4C7NA 2HPCA 3A0BE 3CD6P 4H44C 3CC4P 1G1IA 1K73Q 3H1KG 1VF5C 1NKZB 5H2FH 2RN0A 1Q90D 2KUBA 1Y8AA 2E74D 4UB6H 5APXA 1VQ5P 5CCHD 1XTCC 1BCCE 1Z56A 5AVWB 2M5AB 1BCCD 1JMBA 1KB9E 2V7QH 3RGUA 2PGDA 1URQB 2WZ7A 1KB9D 1RF1A 3CCMP 3CCQP 3RBZA 3EFFK 1IFIA 1QEXA 3M0AA 1FE6A 1H88A 1FZAA 1ZR4A 2WSEH 3CC7P 3L73J 2KOGA 4ASWA 2ZT9B 3CL3D 1L0NG 4PD4I 1YI2P 5KTBA 5E79E 2E5YA 1LJ2A 2KSEA 2QM8A 3MUDA 2ZAEB 4EYYQ 4MN4C 1NKNA 2ZYAA 2N1TC 3FX0A 5GTIE 2W6AA 2OYIA 3NMDA 2QRXA 5AVZB 2K9YA 1FU1A 3L72D 3D70A 1LT9B 2AEMA 3H1JJ 4QMAA 3OW2O 1L4AD 3HD7D 3PLNA 2BASA 1BE3J 2FYUJ 3P7KA 2JO1A 4C7RA 1S72P 1NTZK 1VQ9P 5KLVE 1NU1K 5KLVD 2W90A 1LWUA 2JR8A 1SQXE 3GG2A 1SQXD 1KFMA 4D6TG 5AW5B 1ZW0A 1H89A 3B5NC 2AEJA 5KAFE 3AE3C 3FGAD 4UB8H 2ZYGA 2K1AA 1AQTA 3FWLA 2HFED 5TISH 4L76A 3IR9A 3FWNA 4OGQD 5AW8B 3CX5I 4LLHA 2WPSA 4PD4E 3CWBE 2B88A 1IK9A 2V4HA 4PD4D 2I1JA 4IFFA 5B66E 1U7MA 2CPBA 1Q7YQ 4H13B 1JY3O 5B5EE 2KXPB 4AUWA 1KD1Q 5AW9B 4OWFA 2WSFH 4R4LA 3O6QB 4XFJA 1VDFA 1EZVI 1KILA 3H1HG 3V5BA 1KV4A 2H43A 2ZYDA 2Q3EA 2JP3A 2NPSB 3CC2P 3T97B 3AEEC 1RY3A 1NTKD 1NGMB 3TF5A 2KS1A 1X8YA 3CXHH 5CCHC 2ZFCA 3RBXA 1L0LK 2H88C 1URQD 1NVOA
chains in the Genus database with same CATH topology
3VOPA 5AVSB 1E5WA 1A02F 1X79B 1HTLC 1IO4A 1NO4A 3H32B 1MFZA 2KYVA 3VP8A 3IFMA 3SWFA 3P32A 1PFIA 3M0DA 2FYZA 2O01H 1A02J 2XZRA 2IFNA 1IFMA 4IFDK 1SQQK 3I5CA 1NAFA 3RK3B 1SFCD 2OARA 2QM7A 3B5NB 1GDTA 3HE5A 4GIFA 4EOTA 2N1TD 1SFCA 3RK3C 2O1JA 3MGNA 1S9KE 1CI6A 2P7JA 1GL2D 2OYIB 3UIAA 2H8PD 5CCGD 2YKPA 2YKQA 2N1TA 1IC2A 3HTKB 1N7SD 4HH2A 1GL2A 1AQ5A 5AW4B 2OYIC 3V4WA 5BU5A 5CCGA 2XKMA 1KFNA 1FAVA 5AW3B 1FZCB 1N7SA 1RE3C 2GUSA 1IFJA 2HLOA 3HE4A 4AYCA 5CJ4A 5KLVK 1J2JB 3N7NA 3VMXA 3M91A 3MD0A 1FZCC 2OYHB 1SVFA 3EFGA 2FFDA 1RF0A 5AVTB 1SQXK 2XDJA 3A7OA 4OH8B 2OYHC 5APTA 3HD7B 3O8ZA 5KJ7C 2KB7P 1LT9A 1LTBC 3M9HA 3V2NA 1MUUA 1T3UA 1IFNA 4M3LA 4W7YA 1NWQA 4XA4A 5CHXA 1N7LA 2KLVA 1DEBA 3TYYA 1JY2P 1M1JB 2HYNA 2R5DA 2IX7C 4Y99B 3A2AA 4JYCA 3TNUB 2P1JA 1G2CB 2IFMA 1M1JC 1LWUB 4EIJA 4LGDE 1T8ZA 3L4FA 1YTZI 1OWAA 3V2RA 1LWUC 1JY3P 2WPRA 3CI9A 3GHGA 1GK4A 3L36A 3RL0D 1GK6A 1RE4A 4DOJA 1FZGA 3P8MC 1FJPA 1T2KC 3L37A 3U59A 1VPCA 3V4QA 2WITA 4WY4D 1LTJB 2A45G 4JF7A 4XE5B 3M9BA 1HWTC 1J1DC 3HUSC 4WY4A 1MZ9A 1LTJC 1JCDA 2WT7B 1CW5A 1MV8A 1GL2C 1JOCA 1G1JA 2N9BA 2PAJA 1HBWA 1N7SC 3MIWA 5APVA 5AVUB 4JYBA 1LTGC 1FZEA 5APSA 3LIEA 3VMZA 1JO5A 4DZOA 1HJBA 1N73A 3KDPB 2HG5D 2H7HA 4ZKPA 2WSCH 3BATA 1LT9C 5CMZA 1AFOA 1WT6A 3VP9A 3VTPC 1GU4A 5AVVB 2I1KA 1L4AA 5APWA 4GKGA 1ZLLA 2PP6A 1N2DC 1NTKK 3NFQA 2C0XA 2L5GB 3SWYA 1OXZA 1FBMA 1HGVA 1IJDB 4N78E 1HUCA 1T3JA 3LW5H 1FZBA 4C7NA 2HPCA 2C0WA 4N78D 2Z4EA 3CLQA 5AVQB 2P67A 4I6MC 1LTSC 1KILB 1G1IA 5CJ0A 2HODA 3GHGC 3RK2D 1RE4C 1NKZB 1KILC 3KPEA 2MJZA 3P8CD 5APQA 1GW4A 3VMYA 3BASA 1GW3A 3RL0C 2FXMA 1JTHA 2Z5IA 1FDMA 1FOSE 3OAKA 2NPSD 5APXA 4W80A 3B8EB 1HGZA 1SLQA 5CCHD 2NPSA 4WY4C 1XTCC 1Z56A 5AVWB 2LKMA 3WMM0 3T97A 2Z5HA 2YKOA 5CCHA 3H6PA 2FKWB 1QL2A 1DX7A 1NHLA 1URQB 2WZ7A 1LGHB 2Q5UA 2WPQA 4W7ZA 1N86A 1N73C 1URQC 1RF1A 1JY2N 1SQVK 1KZUB 2M3BA 3A5TA 1IFIA 3M0AA 5AW0B 3M9QA 4WBAA 1H88A 4KHXA 1FZAA 1ZR4A 2FYUK 2WSEH 5AW7B 1LTIC 2C9NY 1NTMK 1JCCA 3M0DC 1JNMA 2YO3A 3H32A 2KOGA 1JY2O 1JY3N 3CL3D 5APYA 2JJLA 3HE5B 5KTBA 3G3ZA 1SFCB 3A3YB 2VRSA 3RK3D 1GU5A 1CI6B 4B86A 1J1DB 2N1TB 3HUSB 1SFCC 3B5ND 5BVZA 2QM8A 3MUDA 1GL2B 1ZV8A 1NKNA 4N3YB 2N1TC 3B5NA 4ZKUA 1N7SB 3HE4B 2W6AA 3N4XA 3C9IA 2A45I 2E42A 5CCGC 3RK2C 1YYCA 2OYIA 2FFDB 3NMDA 3HTKA 1RE3A 5AVZB 2CPSA 1J1EC 1FU1A 2FFDC 1WRGA 3HRNA 1FZCA 1LT9B 1RF0C 2YMYA 3L35A 3V2PA 2OYHA 1L4AD 4LC1A 1GZLA 2WTYA 2IPPA 3HD7D 3VYIA 2XV5A 1XTGB 2BASA 3HD7A 3II6A 2A45H 1X9VA 3OJAB 2E43A 3P7KA 1EQ7A 4C7RA 3PP5A 2Q3IA 4AQRD 1NTZK 4O9BA 2C9LY 2GUVA 1ZR2A 1M1JA 1JMMA 3V2QA 1FJKA 1NU1K 3GHGB 3KQGA 2XNXA 3NTNA 3TNUA 1G2CA 1GTWA 4N6JA 1LWUA 3P8CE 1T2KD 1NH4A 3RL0B 1SP4A 1W2EA 2YO2A 1HH0A 1KFMA 1KQLA 5AW5B 3MTUE 2POHA 5AVYB 1H89A 4WY4B 2W6BA 3M06A 2KSJA 3B5NC 3HUSA 1ZN5A 2W27A 1LTJA 4I2LC 1S9KD 3VN0A 2XU6A 5AW6B 5APUA 2WT7A 1N73B 3R2PA 3BVHA 1GD2E 4I1LA 3U1AA 2HFED 4IFMA 1CSBA 1LTTC 2GM4A 1L4AB 2P2UA 3OA7A 3IR9A 3TK1A 5AW8B 1HVVA 1CZQA 2M8RA 1L4AC 2J59M 2WPSA 2WWWA 4LLHA 3HD7C 2R32A 5AVXB 1IK9A 2JEEA 1NOHA 1QL1A 3KYQA 1YTZT 2O1KA 4C7NB 2Q9IA 5AVRB 2I1JA 2R5BA 2HPCB 4IFFA 3BRVB 2CPBA 3E1IA 2HODB 1SQPK 2ZXEB 3NXSA 4Y99C 3LIDA 1JY3O 1IFDA 3TSIA 4AUWA 5AW1B 1KILD 5AW9B 3RK2B 2WSFH 4HYTB 1DH3A 1VDFA 1JTHB 2Q7CA 4C46A 1J1EB 1KILA 3V5BA 2J58A 2H43A 1M7LA 1JUNA 2NPSB 3EQ2A 1SQBK 1RY3A 5KJ7D 4RESB 2NPSC 1FOSF 5AW2B 1FZFA 5BU8B 1H8AA 2KP8A 1X8YA 1L0NK 5KJ7A 5CCHC 4WB4A 2ZFCA 1LTAC 3BRTB 3U1CA 1L0LK 1RF1B 2R3CA 1URQD 4GT1A 1RF1C 2YNYA 1URQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WY4 B;  3VOP A;  4WY4 D;  4JF7 A;  3B5N C;  4WY4 A;  1GL2 C;  3M0D C;  2KOG A;  1N7S C;  1SFC B;  3RK3 B;  1SFC D;  2HFE D;  3RK3 D;  3B5N B;  2N1T B;  1SFC C;  3B5N D;  2N1T D;  2HG5 D;  1SFC A;  1L4A B;  3RK3 C;  1GL2 B;  1GL2 D;  1HVV A;  2H8P D;  2N1T C;  5CCG D;  3B5N A;  2N1T A;  3HTK B;  1N7S B;  2M8R A;  1L4A C;  1N7S D;  1L4A A;  3HD7 C;  1GL2 A;  5CCG C;  3RK2 C;  2PP6 A;  5CCG A;  3KYQ A;  1N7S A;  4N78 E;  1T3J A;  2XDJ A;  4OH8 B;  2YMY A;  1L4A D;  3TSI A;  3HD7 B;  5KJ7 C;  1KIL B;  3HD7 D;  3RK2 B;  1KIL D;  3RK2 D;  1JTH B;  1XTG B;  1KIL C;  3HD7 A;  4W7Y A;  1KIL A;  3RL0 C;  1JTH A;  2NPS B;  3PP5 A;  2NPS D;  4W80 A;  5KJ7 D;  4LGD E;  2NPS C;  5CCH D;  2NPS A;  4WY4 C;  5KJ7 A;  5CCH C;  3P8C E;  5CCH A;  3RL0 B;  3RL0 D;  1NHL A;  1URQ B;  1URQ D;  2WZ7 A;  4W7Z A;  1URQ C;  1URQ A; 
#chains in the Genus database with same CATH topology
 3VOP A;  5AVS B;  1X79 B;  3L74 E;  3H32 B;  1PPJ G;  2KYV A;  2IBZ D;  3L74 D;  4K35 A;  5GTH E;  4IL6 X;  3M0D A;  2QJY C;  2IFN A;  2ZT9 D;  1NAF A;  1R8E A;  3RK3 B;  3B5N B;  2UWJ E;  4GIF A;  4EOT A;  1RHZ B;  2O1J A;  2J5U A;  3KZI E;  1S9K E;  3CCJ P;  2YKP A;  2YKQ A;  1AQ5 A;  3IF4 A;  1FAV A;  5AW3 B;  1RE3 C;  2GUS A;  2HLO A;  1NTM E;  1J2J B;  1OVV A;  3MD0 A;  2FFD A;  1W5C E;  1NTM D;  5AVT B;  3CX5 E;  2FYN C;  2OYH C;  2XND H;  2KB7 P;  3CX5 D;  2PFX A;  3H1L D;  4ZMD A;  1T3U A;  3A0B H;  2K37 A;  3IN6 A;  1IFN A;  4M3L A;  3L72 J;  3TGU G;  1YJN P;  4OVN F;  2HYN A;  1Y47 A;  2R5D A;  1S4X A;  3A2A A;  4H44 D;  1HJ0 A;  3TNU B;  3CPW O;  4EIJ A;  1AJY A;  1SQB G;  1EZV E;  1JY3 P;  1VQO P;  3GHG A;  1EZV D;  1K9M Q;  2KNC A;  4KT0 J;  3U59 A;  4U3F E;  1VQ4 P;  4ASV A;  5KLV J;  4U3F D;  4XE5 B;  2E75 C;  4R4M A;  1Q86 Q;  4WY4 A;  1MZ9 A;  1NTZ G;  5CBO A;  2WT7 B;  1CW5 A;  1GL2 C;  1SQX J;  1G1J A;  1HBW A;  1NU1 G;  3L73 E;  3MIW A;  5APV A;  1OMI A;  4PJ0 H;  1YIJ P;  5E79 H;  5CMZ A;  3VTP C;  5CBN A;  1ZOY C;  1L4A A;  2QJY B;  1ZLL A;  2L5G B;  3SWY A;  5GTI H;  1HUC A;  2DW3 A;  1RQV A;  3CLQ A;  3AE9 C;  3L71 G;  4BXL A;  3H1J E;  4H13 D;  1QVF O;  5CJ0 A;  1QX8 A;  4RJT A;  2W8Z A;  2A06 G;  2MJZ A;  3H1I E;  3L75 G;  5APQ A;  1BGY J;  1GW3 A;  3BCC G;  3RL0 C;  1BE3 E;  2FYU E;  1JTH A;  2ITA A;  3H1I D;  2NPS D;  2LXC B;  1VQ7 P;  1K8A Q;  2LKM A;  4Y28 J;  1FS0 E;  2PRR A;  1QLE D;  1KMI Z;  2FKW B;  1QL2 A;  1DX7 A;  1AVY A;  1NTK J;  1K05 A;  1URQ C;  1SQV K;  1KZU B;  2M3B A;  5AW0 B;  4WBA A;  4RO0 A;  4JQ0 D;  4GDO A;  3G9R A;  3AE6 C;  1N8R Q;  2R44 A;  1JNM A;  1JY2 O;  1LT1 A;  1JY3 N;  2ZJS E;  4YTP C;  2HR3 A;  3RK3 E;  2JJL A;  3HE5 B;  1SFC B;  3A3Y B;  2VRS A;  3RK3 D;  1CI6 B;  2IYP A;  2ZT9 C;  2E75 B;  3C1L A;  1USE A;  4B86 A;  2O01 N;  2OYO A;  3B5N D;  1QGK B;  5K5G B;  1GL2 B;  1ZV8 A;  1QVG O;  3HE4 B;  3C9I A;  1YYC A;  1IK7 A;  2ZVN B;  2KI7 B;  2CPS A;  4PD4 H;  4RKU J;  1NJI Q;  1WRG A;  1R5S A;  3HRN A;  1FZC A;  1RF0 C;  3ITK A;  5B66 H;  3GLM A;  1GZL A;  1YBK A;  5B5E H;  3F89 A;  1NTM J;  4KJM A;  3Q2Y A;  1PP9 G;  3H1L J;  2FXO A;  1M1J A;  2OTK E;  4I7Z C;  3NTN A;  1LP1 B;  1T2K D;  3RL0 B;  1W2E A;  3AE2 C;  2OQQ A;  5AVY B;  3R4Y A;  2IYO A;  2KSJ A;  3CCS P;  1ZN5 A;  1LTJ A;  1BDC A;  3D71 A;  3GF3 A;  4U3F J;  4I1L A;  1L0L J;  3AE4 C;  1CSB A;  2B87 B;  3G6E P;  2RKL A;  3TK1 A;  1HVV A;  3LW5 J;  3KZI H;  2JEE A;  1FDI A;  1YTZ T;  2O1K A;  4C7N B;  3Q5P A;  2R5B A;  2HPC B;  1KYO I;  1SQP K;  3LID A;  1M8O B;  3TSI A;  3Q5S A;  4HYT B;  2KIK A;  4H13 C;  1DH3 A;  3L72 E;  3L70 J;  2K3R A;  1JUN A;  2W83 C;  3W67 A;  1SQB K;  3S4R A;  4RES B;  2NPS C;  1FOS F;  5AW2 B;  1FZF A;  3H1K J;  2KP8 A;  5KJ7 A;  3H1I J;  1K04 A;  3U1C A;  1RF1 B;  2R3C A;  3AE1 C;  1YQ3 C;  2O3J A;  2YNY A;  2QE7 H;  2QJP B;  4I7Z B;  1HTL C;  1IO4 A;  2M3E A;  1P84 E;  1NO4 A;  1PPJ E;  3VP8 A;  2QSI A;  3IFM A;  1P84 D;  1H0T B;  2IBZ I;  3SWF A;  1PPJ D;  3B71 A;  1IFM A;  1SQQ K;  3I5C A;  1SFC D;  1YQ4 C;  2QM7 A;  2E75 D;  3RK3 C;  2YMK A;  1GL2 D;  2OYI B;  2H8P D;  5CCG D;  1SQV G;  2N1T A;  3CME P;  1KTM A;  1DEE G;  4HH2 A;  5AW4 B;  2XKM A;  3CCL P;  1L0N J;  3WUT A;  1N7S A;  5CJ4 A;  2G3A A;  2K9J A;  2AXT E;  1BCC G;  3AED C;  3D6Z A;  4CPG A;  4L74 A;  4XA4 A;  5CHX A;  4IL6 E;  1BGY E;  1KYO E;  2KLV A;  2QA4 P;  1BGY D;  1KYO D;  2P1J A;  1OW6 A;  3AEF C;  1LWU B;  4YXW H;  1YTZ I;  2QJK C;  3CI9 A;  1IFP A;  3L36 A;  3RL0 D;  1GK6 A;  1RE4 A;  3WU2 E;  1FJP A;  1T2K C;  2P10 A;  3WUV A;  2QIW A;  3V4Q A;  1AVO A;  1NTK E;  1NAY A;  4JF7 A;  3M9B A;  1OVU A;  3HUS C;  5DJT B;  1JOC A;  1NTZ D;  2KZJ A;  3Q1M A;  4JYB A;  1LTG C;  4TT3 H;  1M57 D;  3LIE A;  2Y9Z A;  1JO5 A;  4D6T J;  1N73 A;  2IBZ E;  4L75 A;  5H2F E;  5AVV B;  2I8D A;  1AV1 A;  1FBM A;  1MKM A;  4GOE A;  1YIT P;  3MP7 B;  1ZXG A;  2NRG A;  2P67 A;  4I6M C;  1LTS C;  1KIL B;  1U7J A;  5KAI H;  2HOD A;  3GHG C;  3L71 D;  1SQX G;  1OZH A;  2W6J H;  3KPE A;  1OVR A;  3P8C D;  1EDL A;  2YXQ B;  1GW4 A;  3BAS A;  2FXM A;  1KOR A;  2A06 D;  1FDM A;  1FOS E;  3C8V A;  1ZME C;  3OAK A;  4BRY A;  2KS1 B;  3GMA A;  4H0L B;  1HGZ A;  1SLQ A;  2Y9Y A;  4WY4 C;  3H1L E;  3VMA A;  3WMM 0;  1FDO A;  2Z5H A;  5CCH A;  1SQP G;  3H6P A;  4YPC A;  3H1H J;  1OX3 A;  4W7Z A;  1E79 H;  1N86 A;  1PGQ A;  3CCU P;  2O01 J;  2QJK B;  4HB1 A;  3M9Q A;  2RMZ A;  5KLI B;  2FYU K;  1LTI C;  3CWB G;  1JCC A;  1YHQ P;  2YO3 A;  1VQM P;  4TLF A;  5APY A;  3G3Z A;  2WSS H;  1S5L E;  1RH5 B;  2AXC A;  1GU5 A;  1KB9 H;  1L0L E;  3HUS B;  1SFC C;  1L0L D;  5TJH A;  2A45 I;  2E42 A;  5CCG C;  2BEZ F;  3RK2 C;  2FFD B;  3HTK A;  1RE3 A;  2E74 B;  4EI2 A;  4HKZ H;  1SQQ G;  4NPD A;  2OYH A;  4LC1 A;  2IPP A;  3VYI A;  2XV5 A;  5KKZ B;  1XTG B;  3HD7 A;  4NPE A;  3OJA B;  2E43 A;  2BCC G;  1EQ7 A;  4JPZ B;  3L70 E;  2C9L Y;  1YJ9 P;  1ZR2 A;  3L74 G;  2QG4 A;  3W68 A;  1FJK A;  3L70 D;  3GHG B;  4UB8 E;  2XNX A;  1PP9 D;  1G2C A;  3H1K E;  1GTW A;  1SP4 A;  3H1K D;  3TGU J;  2YO2 A;  1TU3 F;  1KQL A;  1S5L X;  2POH A;  4WY4 B;  3D6Y A;  3I56 P;  2D2C C;  3E1R A;  4PV1 C;  1GMJ A;  4I2L C;  2XU6 A;  5APU A;  4BWN A;  2WSC J;  3A0H E;  3WUU A;  4WWI A;  4IFM A;  1LTT C;  3SFD C;  2JWD A;  4DCK A;  2B89 A;  1L4A B;  2LR2 A;  3USS A;  1NTZ J;  1CZQ A;  2M8R A;  2WWW A;  4L73 A;  1NU1 J;  3KYQ A;  1VQL P;  1KQF B;  1EDI A;  1L0N E;  5KAF H;  3BRV B;  1L0N D;  2ZXE B;  3RL0 g;  3CXH D;  1IFD A;  1EZV G;  1FC2 C;  2AXT H;  5AW1 B;  1KIL D;  3RK2 B;  1JTH B;  2Q7C A;  2Y0E A;  4C46 A;  2GA1 A;  4U3F G;  1R5L A;  1Q82 Q;  1M7L A;  2WMM A;  4IL6 H;  3L71 J;  2V7Q J;  4H0L D;  1KYO H;  2L91 A;  2G8Y A;  1H8A A;  1X0T A;  2H89 C;  3L75 J;  3L73 G;  2M5A A;  3BCC J;  1PGJ A;  3PTZ A;  4GT1 A;  2WSE J;  1RF1 C;  3SSU A;  1URQ A;  3WU2 H;  2KK7 A;  1A02 F;  4OGQ B;  1MFZ A;  2QJP C;  3P32 A;  1P84 I;  1PFI A;  3AEG C;  2FYZ A;  3S1K A;  4IFD K;  2D2C B;  4D6T E;  3QH9 A;  4PV1 B;  3MUD C;  3H1J G;  3MGN A;  4D6T D;  2P7J A;  3I55 P;  1SQV E;  1IC2 A;  3F5H A;  3H1I G;  2OYI C;  3V4W A;  5BU5 A;  1SQV D;  1KFN A;  1AA0 A;  1FZC B;  1BE3 G;  4AYC A;  2FYU G;  5KLV K;  3AE7 C;  1S3J A;  2RH0 A;  3N7N A;  3QWO C;  3VMX A;  1OW7 A;  1SVF A;  3EFG A;  5GTH H;  1RF0 A;  1SQX K;  3K5B A;  5KJ7 C;  3O8Z A;  1M1K Q;  1LT9 A;  1LTB C;  3V2N A;  4U7J A;  4W7Y A;  1NWQ A;  1PIX A;  1N7L A;  1DEB A;  1JY2 P;  1M1J B;  1EXI A;  1YJW P;  4A7P A;  4JYC A;  4ZNC A;  4LGD E;  1M56 D;  3L4F A;  4NPF X;  1OWA A;  3JCU E;  3V2R A;  1LWU C;  1D7M A;  3AE8 C;  1JB0 J;  2WPR A;  3MZW B;  1GK4 A;  3CX5 H;  4PJ0 E;  2KZI A;  3P8M C;  3H1H E;  1HF9 A;  1VQN P;  1H0T A;  5L8R J;  3L37 A;  1VPC A;  3H1H D;  2E76 B;  1PP9 J;  4WY4 D;  1PL5 A;  1LTJ B;  1JEK A;  2A45 G;  1HWT C;  1J1D C;  1NYH A;  1JCD A;  2M0B A;  2N9B A;  1N7S C;  1USD A;  5AVU B;  2WQY C;  3KXD A;  1W2B O;  4K3A A;  2NZ2 A;  3JSV C;  4DZO A;  1HJB A;  2HG5 D;  2H7H A;  3BAT A;  1KC8 Q;  1S5L H;  1WT6 A;  3E7K A;  2I1K A;  1PGP A;  4GKG A;  2PP6 A;  1NTK K;  1HGV A;  4N78 E;  4H44 B;  3LW5 H;  2WSF J;  2ZXX A;  2C0W A;  4N78 D;  2K88 A;  2Z4E A;  1VF5 B;  5AVQ B;  2E5T A;  3RK2 D;  2R3S A;  2YIU C;  1RE4 C;  1KIL C;  3VMY A;  3AEB C;  3O6Q A;  2Z5I A;  2WPV B;  3GW6 A;  1PGO A;  4W80 A;  3B8E B;  2NPS A;  1EDK A;  4H0L C;  3T97 A;  1U57 A;  1T6A A;  2YKO A;  2IZ0 A;  1SQP E;  1NHL A;  1SQP D;  3TGU E;  1LGH B;  2Q5U A;  2WPQ A;  1N73 C;  1JY2 N;  3TGU D;  3ABV C;  2SPZ A;  3A5T A;  2IDB A;  3JC2 2;  2WVR A;  4KHX A;  1SQB E;  2N9Y B;  1PV3 A;  5AW7 B;  2C9N Y;  1NTM K;  2B9B A;  3M0D C;  3H32 A;  1SQB D;  5KLI C;  2OTJ P;  3CWB D;  2Y0D A;  2D2C D;  1VQ6 P;  1J1D B;  2N1T B;  1X22 A;  5BVZ A;  3A0H H;  4PV1 D;  1VQP P;  1RQU A;  3PRJ A;  2FY8 A;  4N3Y B;  1JM0 A;  3B5N A;  1NTZ E;  1N7S B;  4ZKU A;  2Q6Q A;  3N4X A;  1NU1 E;  2K9J B;  3L72 G;  1J1E C;  1NU1 D;  2FFD C;  2E74 C;  1BDD A;  1SQQ E;  2YMY A;  1ZRT E;  3L35 A;  3V2P A;  1SQV J;  2WTY A;  2OTL P;  1SQQ D;  1ZRT D;  2P58 A;  3II6 A;  4UB6 E;  5C39 A;  2A45 H;  1X9V A;  2BCC E;  5EFW B;  5KKZ C;  2BEQ D;  2KLU A;  3PP5 A;  2Q3I A;  4Z1M H;  4AQR D;  4HJG H;  4O9B A;  2BCC D;  2GUV A;  5KLV G;  1BCC J;  1JMM A;  3V2Q A;  3L71 E;  3KQG A;  2YIU B;  3TNU A;  4N6J A;  3P8C E;  1NH4 A;  2A06 E;  3L75 E;  1HH0 A;  3BCC E;  1S2E A;  3L75 D;  3MTU E;  2E76 D;  3BCC D;  2W6B A;  2JDI H;  3M06 A;  3HUS A;  2W27 A;  1S9K D;  3VN0 A;  3PJS K;  5AW6 B;  2WT7 A;  1N73 B;  3R2P A;  3BVH A;  4GOF A;  1GD2 E;  3U1A A;  4DT0 A;  2GM4 A;  2P2U A;  3OA7 A;  3AE5 C;  1UIX A;  1L4A C;  2J59 M;  3G4S P;  1DIP A;  1M90 Q;  3HD7 C;  2R32 A;  5AVX B;  2QEX P;  1LNQ A;  3Q3D A;  1NOH A;  1QL1 A;  2Q9I A;  5AVR B;  1BGY G;  4YXD C;  3S9O A;  2Q1K A;  1EC5 A;  3E1I A;  2HOD B;  3NXS A;  3SWK A;  4Y99 C;  1VF5 D;  3CXH I;  3Q5R A;  1J1E B;  2J58 A;  4BRY B;  2LXB A;  1PZQ A;  3EQ2 A;  3CCR P;  1NTK G;  1DD3 A;  3FXD A;  5KJ7 D;  5BU8 B;  1L0N K;  4WB4 A;  1LTA C;  1EXJ A;  3BRT B;  3AEA C;  3IAO A;  3JCU H;  3V6I A;  3L73 D;  3EWK A;  1VQ8 P;  4JBZ A;  1WMK A;  1E5W A;  1PP9 E;  2IBZ G;  1Y9B A;  1VQK P;  1OFC X;  4WVZ A;  1SQP J;  2KNC B;  4OGQ C;  2O01 H;  1A02 J;  2XZR A;  4EDF A;  5TIS E;  1EDJ A;  3KHU A;  2MKV A;  3TDK A;  1L2P A;  1Q81 Q;  2OAR A;  1GDT A;  3HE5 A;  2N1T D;  1SFC A;  2JKV A;  1Q2N A;  1CI6 A;  1SQB J;  3UIA A;  3CWB J;  3HTK B;  3H1J D;  1N7S D;  2Y0C A;  1GL2 A;  1KQG B;  5CCG A;  3B4S A;  1P84 H;  5M1B A;  1IFJ A;  3HE4 A;  3G71 P;  2ZVO B;  1NTM G;  2FYN B;  3M91 A;  1FZC C;  2OYH B;  1BE3 D;  2FYU D;  4IOI H;  2XDJ A;  3A7O A;  3H1L G;  4OH8 B;  5APT A;  3HD7 B;  3PHL A;  3M9H A;  1MUU A;  2FBW C;  3GF7 A;  1BSN A;  4DJG A;  3TYY A;  1KB9 I;  3H25 A;  2IX7 C;  4Y99 B;  3CXH E;  1SQQ J;  1G2C B;  2IFM A;  1M1J C;  2CK3 H;  1BSH A;  1KIL E;  1T8Z A;  3SFE C;  2FXP A;  1DD4 A;  4DOJ A;  1SS1 A;  1FZG A;  3MHV A;  3CCV P;  1LP1 A;  2BCC J;  2WIT A;  3CMA P;  1L0L G;  1UII A;  3L74 J;  1KQS O;  2E76 C;  1IZN B;  2YXR B;  1LTJ C;  1MV8 A;  1KN7 A;  2OGU A;  2PAJ A;  2AEF A;  3ZDM A;  2JWA A;  1FZE A;  5APS A;  3VMZ A;  1ZP0 C;  3PH0 A;  5KAI E;  1OIP A;  2IZ1 A;  3CCE P;  3KDP B;  4ZKP A;  2WSC H;  1LT9 C;  1AFO A;  2B87 A;  3VP9 A;  1GU4 A;  1OW8 A;  4GOD A;  1MFT A;  5APW A;  1N2D C;  1S1C X;  3NFQ A;  5DJU B;  3FXE A;  2C0X A;  1OXZ A;  2QVA A;  1VL2 A;  1IJD B;  3L70 G;  1T3J A;  3AEC C;  1FZB A;  4C7N A;  2HPC A;  3A0B E;  3CD6 P;  4H44 C;  3CC4 P;  1G1I A;  1K73 Q;  3H1K G;  1VF5 C;  1NKZ B;  5H2F H;  2RN0 A;  1Q90 D;  2KUB A;  1Y8A A;  2E74 D;  4UB6 H;  5APX A;  1VQ5 P;  5CCH D;  1XTC C;  1BCC E;  1Z56 A;  5AVW B;  2M5A B;  1BCC D;  1JMB A;  1KB9 E;  2V7Q H;  3RGU A;  2PGD A;  1URQ B;  2WZ7 A;  1KB9 D;  1RF1 A;  3CCM P;  3CCQ P;  3RBZ A;  3EFF K;  1IFI A;  1QEX A;  3M0A A;  1FE6 A;  1H88 A;  1FZA A;  1ZR4 A;  2WSE H;  3CC7 P;  3L73 J;  2KOG A;  4ASW A;  2ZT9 B;  3CL3 D;  1L0N G;  4PD4 I;  1YI2 P;  5KTB A;  5E79 E;  2E5Y A;  1LJ2 A;  2KSE A;  2QM8 A;  3MUD A;  2ZAE B;  4EYY Q;  4MN4 C;  1NKN A;  2ZYA A;  2N1T C;  3FX0 A;  5GTI E;  2W6A A;  2OYI A;  3NMD A;  2QRX A;  5AVZ B;  2K9Y A;  1FU1 A;  3L72 D;  3D70 A;  1LT9 B;  2AEM A;  3H1J J;  4QMA A;  3OW2 O;  1L4A D;  3HD7 D;  3PLN A;  2BAS A;  1BE3 J;  2FYU J;  3P7K A;  2JO1 A;  4C7R A;  1S72 P;  1NTZ K;  1VQ9 P;  5KLV E;  1NU1 K;  5KLV D;  2W90 A;  1LWU A;  2JR8 A;  1SQX E;  3GG2 A;  1SQX D;  1KFM A;  4D6T G;  5AW5 B;  1ZW0 A;  1H89 A;  3B5N C;  2AEJ A;  5KAF E;  3AE3 C;  3FGA D;  4UB8 H;  2ZYG A;  2K1A A;  1AQT A;  3FWL A;  2HFE D;  5TIS H;  4L76 A;  3IR9 A;  3FWN A;  4OGQ D;  5AW8 B;  3CX5 I;  4LLH A;  2WPS A;  4PD4 E;  3CWB E;  2B88 A;  1IK9 A;  2V4H A;  4PD4 D;  2I1J A;  4IFF A;  5B66 E;  1U7M A;  2CPB A;  1Q7Y Q;  4H13 B;  1JY3 O;  5B5E E;  2KXP B;  4AUW A;  1KD1 Q;  5AW9 B;  4OWF A;  2WSF H;  4R4L A;  3O6Q B;  4XFJ A;  1VDF A;  1EZV I;  1KIL A;  3H1H G;  3V5B A;  1KV4 A;  2H43 A;  2ZYD A;  2Q3E A;  2JP3 A;  2NPS B;  3CC2 P;  3T97 B;  3AEE C;  1RY3 A;  1NTK D;  1NGM B;  3TF5 A;  2KS1 A;  1X8Y A;  3CXH H;  5CCH C;  2ZFC A;  3RBX A;  1L0L K;  2H88 C;  1URQ D;  1NVO A; 
#chains in the Genus database with same CATH homology
 3VOP A;  5AVS B;  1E5W A;  1A02 F;  1X79 B;  1HTL C;  1IO4 A;  1NO4 A;  3H32 B;  1MFZ A;  2KYV A;  3VP8 A;  3IFM A;  3SWF A;  3P32 A;  1PFI A;  3M0D A;  2FYZ A;  2O01 H;  1A02 J;  2XZR A;  2IFN A;  1IFM A;  4IFD K;  1SQQ K;  3I5C A;  1NAF A;  3RK3 B;  1SFC D;  2OAR A;  2QM7 A;  3B5N B;  1GDT A;  3HE5 A;  4GIF A;  4EOT A;  2N1T D;  1SFC A;  3RK3 C;  2O1J A;  3MGN A;  1S9K E;  1CI6 A;  2P7J A;  1GL2 D;  2OYI B;  3UIA A;  2H8P D;  5CCG D;  2YKP A;  2YKQ A;  2N1T A;  1IC2 A;  3HTK B;  1N7S D;  4HH2 A;  1GL2 A;  1AQ5 A;  5AW4 B;  2OYI C;  3V4W A;  5BU5 A;  5CCG A;  2XKM A;  1KFN A;  1FAV A;  5AW3 B;  1FZC B;  1N7S A;  1RE3 C;  2GUS A;  1IFJ A;  2HLO A;  3HE4 A;  4AYC A;  5CJ4 A;  5KLV K;  1J2J B;  3N7N A;  3VMX A;  3M91 A;  3MD0 A;  1FZC C;  2OYH B;  1SVF A;  3EFG A;  2FFD A;  1RF0 A;  5AVT B;  1SQX K;  2XDJ A;  3A7O A;  4OH8 B;  2OYH C;  5APT A;  3HD7 B;  3O8Z A;  5KJ7 C;  2KB7 P;  1LT9 A;  1LTB C;  3M9H A;  3V2N A;  1MUU A;  1T3U A;  1IFN A;  4M3L A;  4W7Y A;  1NWQ A;  4XA4 A;  5CHX A;  1N7L A;  2KLV A;  1DEB A;  3TYY A;  1JY2 P;  1M1J B;  2HYN A;  2R5D A;  2IX7 C;  4Y99 B;  3A2A A;  4JYC A;  3TNU B;  2P1J A;  1G2C B;  2IFM A;  1M1J C;  1LWU B;  4EIJ A;  4LGD E;  1T8Z A;  3L4F A;  1YTZ I;  1OWA A;  3V2R A;  1LWU C;  1JY3 P;  2WPR A;  3CI9 A;  3GHG A;  1GK4 A;  3L36 A;  3RL0 D;  1GK6 A;  1RE4 A;  4DOJ A;  1FZG A;  3P8M C;  1FJP A;  1T2K C;  3L37 A;  3U59 A;  1VPC A;  3V4Q A;  2WIT A;  4WY4 D;  1LTJ B;  2A45 G;  4JF7 A;  4XE5 B;  3M9B A;  1HWT C;  1J1D C;  3HUS C;  4WY4 A;  1MZ9 A;  1LTJ C;  1JCD A;  2WT7 B;  1CW5 A;  1MV8 A;  1GL2 C;  1JOC A;  1G1J A;  2N9B A;  2PAJ A;  1HBW A;  1N7S C;  3MIW A;  5APV A;  5AVU B;  4JYB A;  1LTG C;  1FZE A;  5APS A;  3LIE A;  3VMZ A;  1JO5 A;  4DZO A;  1HJB A;  1N73 A;  3KDP B;  2HG5 D;  2H7H A;  4ZKP A;  2WSC H;  3BAT A;  1LT9 C;  5CMZ A;  1AFO A;  1WT6 A;  3VP9 A;  3VTP C;  1GU4 A;  5AVV B;  2I1K A;  1L4A A;  5APW A;  4GKG A;  1ZLL A;  2PP6 A;  1N2D C;  1NTK K;  3NFQ A;  2C0X A;  2L5G B;  3SWY A;  1OXZ A;  1FBM A;  1HGV A;  1IJD B;  4N78 E;  1HUC A;  1T3J A;  3LW5 H;  1FZB A;  4C7N A;  2HPC A;  2C0W A;  4N78 D;  2Z4E A;  3CLQ A;  5AVQ B;  2P67 A;  4I6M C;  1LTS C;  1KIL B;  1G1I A;  5CJ0 A;  2HOD A;  3GHG C;  3RK2 D;  1RE4 C;  1NKZ B;  1KIL C;  3KPE A;  2MJZ A;  3P8C D;  5APQ A;  1GW4 A;  3VMY A;  3BAS A;  1GW3 A;  3RL0 C;  2FXM A;  1JTH A;  2Z5I A;  1FDM A;  1FOS E;  3OAK A;  2NPS D;  5APX A;  4W80 A;  3B8E B;  1HGZ A;  1SLQ A;  5CCH D;  2NPS A;  4WY4 C;  1XTC C;  1Z56 A;  5AVW B;  2LKM A;  3WMM 0;  3T97 A;  2Z5H A;  2YKO A;  5CCH A;  3H6P A;  2FKW B;  1QL2 A;  1DX7 A;  1NHL A;  1URQ B;  2WZ7 A;  1LGH B;  2Q5U A;  2WPQ A;  4W7Z A;  1N86 A;  1N73 C;  1URQ C;  1RF1 A;  1JY2 N;  1SQV K;  1KZU B;  2M3B A;  3A5T A;  1IFI A;  3M0A A;  5AW0 B;  3M9Q A;  4WBA A;  1H88 A;  4KHX A;  1FZA A;  1ZR4 A;  2FYU K;  2WSE H;  5AW7 B;  1LTI C;  2C9N Y;  1NTM K;  1JCC A;  3M0D C;  1JNM A;  2YO3 A;  3H32 A;  2KOG A;  1JY2 O;  1JY3 N;  3CL3 D;  5APY A;  2JJL A;  3HE5 B;  5KTB A;  3G3Z A;  1SFC B;  3A3Y B;  2VRS A;  3RK3 D;  1GU5 A;  1CI6 B;  4B86 A;  1J1D B;  2N1T B;  3HUS B;  1SFC C;  3B5N D;  5BVZ A;  2QM8 A;  3MUD A;  1GL2 B;  1ZV8 A;  1NKN A;  4N3Y B;  2N1T C;  3B5N A;  4ZKU A;  1N7S B;  3HE4 B;  2W6A A;  3N4X A;  3C9I A;  2A45 I;  2E42 A;  5CCG C;  3RK2 C;  1YYC A;  2OYI A;  2FFD B;  3NMD A;  3HTK A;  1RE3 A;  5AVZ B;  2CPS A;  1J1E C;  1FU1 A;  2FFD C;  1WRG A;  3HRN A;  1FZC A;  1LT9 B;  1RF0 C;  2YMY A;  3L35 A;  3V2P A;  2OYH A;  1L4A D;  4LC1 A;  1GZL A;  2WTY A;  2IPP A;  3HD7 D;  3VYI A;  2XV5 A;  1XTG B;  2BAS A;  3HD7 A;  3II6 A;  2A45 H;  1X9V A;  3OJA B;  2E43 A;  3P7K A;  1EQ7 A;  4C7R A;  3PP5 A;  2Q3I A;  4AQR D;  1NTZ K;  4O9B A;  2C9L Y;  2GUV A;  1ZR2 A;  1M1J A;  1JMM A;  3V2Q A;  1FJK A;  1NU1 K;  3GHG B;  3KQG A;  2XNX A;  3NTN A;  3TNU A;  1G2C A;  1GTW A;  4N6J A;  1LWU A;  3P8C E;  1T2K D;  1NH4 A;  3RL0 B;  1SP4 A;  1W2E A;  2YO2 A;  1HH0 A;  1KFM A;  1KQL A;  5AW5 B;  3MTU E;  2POH A;  5AVY B;  1H89 A;  4WY4 B;  2W6B A;  3M06 A;  2KSJ A;  3B5N C;  3HUS A;  1ZN5 A;  2W27 A;  1LTJ A;  4I2L C;  1S9K D;  3VN0 A;  2XU6 A;  5AW6 B;  5APU A;  2WT7 A;  1N73 B;  3R2P A;  3BVH A;  1GD2 E;  4I1L A;  3U1A A;  2HFE D;  4IFM A;  1CSB A;  1LTT C;  2GM4 A;  1L4A B;  2P2U A;  3OA7 A;  3IR9 A;  3TK1 A;  5AW8 B;  1HVV A;  1CZQ A;  2M8R A;  1L4A C;  2J59 M;  2WPS A;  2WWW A;  4LLH A;  3HD7 C;  2R32 A;  5AVX B;  1IK9 A;  2JEE A;  1NOH A;  1QL1 A;  3KYQ A;  1YTZ T;  2O1K A;  4C7N B;  2Q9I A;  5AVR B;  2I1J A;  2R5B A;  2HPC B;  4IFF A;  3BRV B;  2CPB A;  3E1I A;  2HOD B;  1SQP K;  2ZXE B;  3NXS A;  4Y99 C;  3LID A;  1JY3 O;  1IFD A;  3TSI A;  4AUW A;  5AW1 B;  1KIL D;  5AW9 B;  3RK2 B;  2WSF H;  4HYT B;  1DH3 A;  1VDF A;  1JTH B;  2Q7C A;  4C46 A;  1J1E B;  1KIL A;  3V5B A;  2J58 A;  2H43 A;  1M7L A;  1JUN A;  2NPS B;  3EQ2 A;  1SQB K;  1RY3 A;  5KJ7 D;  4RES B;  2NPS C;  1FOS F;  5AW2 B;  1FZF A;  5BU8 B;  1H8A A;  2KP8 A;  1X8Y A;  1L0N K;  5KJ7 A;  5CCH C;  4WB4 A;  2ZFC A;  1LTA C;  3BRT B;  3U1C A;  1L0L K;  1RF1 B;  2R3C A;  1URQ D;  4GT1 A;  1RF1 C;  2YNY A;  1URQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...