3RL0B

Truncated snare complex with complexin (p1)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
59
structure length
59
Chain Sequence
ALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein/exocytosis
molecule keywords Vesicle-associated membrane protein 2
publication title Complexin cross-links prefusion SNAREs into a zigzag array.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 59
sequence length 59
chains with identical sequence F, J, N, R, V, Z, d
ec nomenclature
pdb deposition date 2011-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3rl0B00
1N7SC 3B5ND 4OH8B 1HVVA 1JTHB 1GL2B 1L4AD 1SFCA 5CCGA 5KJ7C 4WY4C 2YMYA 1N7SA 3B5NC 1L4AC 1URQB 1KILB 3KYQA 4WY4A 2N1TB 2WZ7A 5CCHA 3HD7B 1NHLA 4N78E 3RK2B 3RL0B 1URQD 2NPSC 3RK3B 1KILD 1SFCB 2M8RA 2N1TD 4LGDE 1XTGB 3HD7D 2H8PD 4W7YA 1GL2D 1N7SB 3RK2D 1T3JA 1URQC 1KILC 2NPSA 3RL0D 3RK3D 5KJ7A 4W7ZA 3TSIA 2N1TC 1SFCD 5CCGD 4WY4B 3B5NA 3HD7C 1L4AA 1GL2C 3RK2C 2XDJA 4JF7A 3RL0C 3RK3C 4W80A 2HFED 1SFCC 5CCGC 3HTKB 1JTHA 1GL2A 5CCHD 3PP5A 3P8CE 2NPSB 2KOGA 2PP6A 3M0DC 5CCHC 1N7SD 3B5NB 1URQA 2HG5D 1KILA 1L4AB 2N1TA 3VOPA 2NPSD 4WY4D 5KJ7D 3HD7A
chains in the Genus database with same CATH superfamily
3VMXA 4U3FG 1SQPD 3KDPB 5CCGA 5KJ7C 1A02J 2WSCH 2MKVA 5CBNA 1OWAA 1SQBG 3G71P 1FDIA 3B5NC 2WQYC 2M3BA 3G4SP 1L0NK 5GTHH 1LTIC 3KYQA 1NGMB 2FYUK 1DIPA 3E1RA 2Z5IA 1U57A 1KTMA 1LWUA 4H13D 5AVVB 4CPGA 1WMKA 1QL2A 2K9JB 5BU8B 4OVNF 1N73C 2Z4EA 1KILC 2W90A 1RE4C 1HF9A 4EIJA 1GK6A 2ZT9B 1RY3A 1VQ5P 1SQVK 5KLVK 2RKLA 1QGKB 3TF5A 3TK1A 5KAFH 3KHUA 3E7KA 2ZYDA 4TLFA 4UB6H 2Q7CA 1VQPP 1W5CE 2QA4P 3P7KA 1PZQA 1G1JA 2QVAA 3A0BE 1PFIA 3AE9C 3CLQA 2D2CB 2ZAEB 4N3YB 5CCHC 1FZFA 2QEXP 2WWWA 3P8MC 1NTKE 3WU2H 1L4AB 3LW5H 1NTZK 4WBAA 2CPBA 1NU1G 3RK3E 2QJYB 2WSFH 2E76B 2Q3IA 3L70J 2IFNA 3CX5H 1JB0J 2MJZA 2OGUA 2GUVA 2N1TB 1LTBC 1ZLLA 3B8EB 5APYA 3FWNA 2D2CC 2O01H 3IF4A 5CJ4A 3GMAA 1XTGB 3HD7D 2XV5A 4L75A 2J5UA 3AEGC 1MKMA 4PD4H 5C39A 2G8YA 4D6TG 2P58A 1NAFA 1JNMA 5KAIH 2E74B 3ABVC 3V4WA 2M5AA 2OTKE 1YTZT 1SQQJ 1KYOD 3A0HE 5AW1B 1NAYA 2KP8A 4NPDA 1LT1A 1X0TA 1ZOYC 4HB1A 2WPQA 4IL6E 3FGAD 1L0LG 2YIUB 4ZKUA 1KZUB 2E43A 4IL6X 2K9YA 3JCUH 3L72E 2NPSD 1LTGC 1HTLC 2FYUJ 3HD7A 3CMAP 3CCRP 4GT1A 2O1KA 1K05A 1VQMP 4C7NB 2Y0EA 2C0WA 4ASWA 1BSHA 1SQXK 4WWIA 5GTHE 4U3FD 1SQPJ 3L71G 2AXTH 2FYNC 4RESB 3G6EP 4PV1B 1OMIA 3NMDA 1SQBD 1BGYE 1YI2P 2YKOA 2JO1A 4YTPC 3L74J 3BCCE 2XNDH 2NPSA 3RL0D 1NYHA 3M0AA 4H44C 4C7NA 1CW5A 1IFMA 1DEBA 1M57D 3RK2C 3RBXA 3V2PA 4WVZA 1VPCA 5KAFE 1JY2O 5AW2B 1BE3E 1IFNA 4UB6E 5AW8B 4L74A 2B87A 1FC2C 2LR2A 1GL2A 3IN6A 1VQNP 3H1LE 3H25A 2HLOA 1H0TB 3I56P 2PP6A 3H1KE 3M0DC 1JCCA 4Y99C 2DW3A 1LP1B 3VOPA 3WU2E 1H88A 2Y0CA 5APXA 1GD2E 1FAVA 2C9LY 2YKQA 1WT6A 3AE7C 1MUUA 4DZOA 1KV4A 3Q1MA 3CWBD 1LTSC 1YBKA 3CX5E 3JC22 4XA4A 4M3LA 1H0TA 1PV3A 1LT9B 2M0BA 3CC7P 1M90Q 2LXCB 1NTME 1DEEG 2AEFA 1LP1A 1NTKD 4PD4I 1LJ2A 1VF5D 3CC2P 1SVFA 1EXIA 2W6JH 5CBOA 1RF1B 3V6IA 3RK3D 3VYIA 2Q6QA 1S1CX 1SFCD 3GHGA 3HE4B 2FY8A 4PD4E 1OFCX 5AW7B 1NTMG 1YJNP 3VP9A 3VMYA 4A7PA 4TT3H 5KAIE 2XDJA 2HPCA 1H8AA 3HUSC 1ZXGA 1LT9A 3H1HE 2A45I 1NU1K 5KKZC 2ZYAA 1KFNA 4NPEA 2KS1B 1A02F 2UWJE 1AQTA 2KUBA 3L73E 1LNQA 3L75J 2IZ0A 3H1JE 3BRTB 2ZVNB 2E5TA 3N4XA 1SQXJ 4WY4D 1GW3A 2OYHC 2AEMA 3JCUE 1VQ4P 4IFMA 3F89A 1M56D 3NXSA 3H32A 1Q7YQ 1SFCA 2H7HA 1UIIA 3H1JG 2KSJA 1URQB 1S3JA 1LGHB 3TGUJ 2R3SA 1KYOI 1IK9A 1Q90D 2AXTE 3I5CA 3A3YB 1YQ3C 4HJGH 3IAOA 3S1KA 3L72D 4JYBA 4LGDE 4U3FJ 4OGQB 5CMZA 1J1EC 4I7ZB 4JYCA 1L0LK 3TSIA 1EQ7A 2E75C 2GA1A 1SQBJ 1FE6A 3PHLA 1VQOP 4I1LA 1BDCA 3MHVA 1GDTA 1K04A 1LTJA 1ZR2A 1G1IA 2FYZA 1JEKA 3MZWB 1JY2P 3V2QA 2FFDC 1KQGB 2BEZF 3EFGA 1BGYD 1OW7A 2IYOA 4EDFA 3B5NB 3ITKA 1QVFO 1TU3F 3CL3D 3VP8A 3BCCD 1DX7A 3M9BA 5M1BA 4B86A 2C0XA 4HH2A 4YXWH 2IX7C 5AW0B 4PJ0H 1G2CB 3M9QA 1BE3D 2P2UA 5AW4B 4C46A 1AQ5A 1N73B 2IPPA 1KQLA 1KILB 3H1LD 3H6PA 1M8OB 2K1AA 3H1KD 2WVRA 1VL2A 1K8AQ 2RH0A 4LC1A 1BDDA 1X9VA 1KB9H 1N8RQ 1NU1J 1N7SB 2OTLP 5B66H 1KMIZ 3W67A 3AE6C 4IOIH 1N73A 3CX5D 2ZT9D 5CCGC 1EDKA 1GZLA 3WUUA 1Q2NA 1PIXA 5AVTB 2WPVB 1X22A 5B5EH 1MFZA 1NTMD 1SQPK 2FXPA 5AVSB 2KYVA 3CCUP 3B4SA 3AEEC 4H0LC 1VQ9P 4RKUJ 1ZRTD 2QM7A 4D6TJ 4U7JA 1FS0E 2WT7B 3CWBE 2QSIA 2KIKA 3CCSP 1L2PA 4PD4D 3KQGA 5APWA 1N7SC 2Y9ZA 1JTHB 1L4AD 2W83C 2K9JA 1NKNA 2Y9YA 3RBZA 3H1HD 2RN0A 1RF0C 2O01N 3CWBG 2E76D 1L0LJ 1MV8A 1OW6A 2H88C 3A7OA 3PTZA 3L73D 3SWKA 1NOHA 3H1JD 3M06A 2WT7A 2OYIB 2N1TD 1NTKG 2AXCA 3OW2O 4DOJA 4W7YA 4H13C 1T3JA 2KSEA 1D7MA 4KJMA 1RQVA 1L4AA 1JMBA 1HBWA 3TNUB 2YXQB 1BCCE 5E79H 3L71J 2E74D 4UB8H 1M1KQ 2HYNA 2NZ2A 3WMM0 3E1IA 2WSCJ 1J2JB 1QLED 2ZYGA 3I55P 1Q82Q 3Q5PA 1CI6B 1KORA 1BCCG 1EZVE 2HODB 1KQFB 1WRGA 2OYIC 1M1JB 2N1TA 3H1IE 2W6AA 1OZHA 2FYNB 3RGUA 3SFDC 1K73Q 3AEBC 4YPCA 1FZCC 4PJ0E 5L8RJ 2IBZI 4GOEA 2A06E 1YHQP 1LTAC 3H1IG 4RO0A 2JR8A 4H44B 3KXDA 2IZ1A 1CI6A 1KB9I 3QH9A 3GW6A 3C8VA 1Q86Q 2IBZE 4N78E 3RK2B 1FZAA 2XU6A 1EDJA 2YO2A 2A06G 3L72G 2IYPA 1KB9E 1GL2D 1M1JC 4Z1MH 5H2FH 2WITA 4PV1D 1NH4A 2ZFCA 1OVRA 1XTCC 3AE8C 2IBZG 5B66E 3HD7C 4Y99B 3HE5B 4MN4C 1CSBA 3LW5J 3HTKB 4HYTB 1SQQE 1E79H 2WSFJ 3CCLP 5B5EE 1FZEA 1HJBA 3CCMP 1KILE 1BGYG 3NTNA 1YQ4C 2KZIA 3BCCG 1NTMJ 4ZMDA 1L0NE 2K37A 3AE2C 3B71A 3U1AA 5KLIC 2XNXA 2FYUE 2O01J 1SQBK 1IFJA 4ZKPA 1ZV8A 1PGPA 3PLNA 1IZNB 1BE3G 1FDOA 1H89A 4EOTA 1L0NG 3CX5I 3H1LG 4ZNCA 1HGVA 4R4LA 1KFMA 3H1KG 2Y0DA 1SQVE 2L5GB 3HUSB 5KLVE 3P32A 1BSNA 2JJLA 2P67A 3D6ZA 2CPSA 5KKZB 3MUDA 1SLQA 4K3AA 3SSUA 3CXHH 1USEA 2JKVA 3RL0g 5AW3B 3H1JJ 2R5BA 3L74E 1X79B 3V4QA 1SQVG 4BWNA 5KLVG 4JF7A 3RL0C 5AW9B 2WMMA 2B88A 3CPWO 2ZVOB 2OYHB 3II6A 1CZQA 1ZRTE 2KK7A 3D70A 4IFFA 2BCCE 3CCVP 1YTZI 4UB8E 4DJGA 3Q3DA 1NTZE 3HUSA 5BVZA 1PP9E 3VMAA 3S9OA 3KZIH 1J1DC 1VDFA 2KLVA 2QJPC 2BCCG 3UIAA 2KZJA 1DD3A 1NTZG 4IFDK 1VQ6P 1BCCD 2OYHA 1RF1A 3V2RA 3H1HG 2C9NY 1J1EB 3GF3A 3G3ZA 3R4YA 3HE4A 2QE7H 2E75B 1UIXA 1JO5A 3L73G 1URQD 1EZVD 3LIEA 4R4MA 1JMMA 1JY2N 4KT0J 3H1ID 1S9KE 4GKGA 2KS1A 2FFDB 4DT0A 4W7ZA 3BASA 1VF5C 1EDIA 1HH0A 2J59M 5H2FE 2K3RA 4WY4B 1ZP0C 3R2PA 2N9YB 1P84H 4OGQD 3Q5RA 2Z5HA 3RK3C 2QJKC 4O9BA 2A06D 4C7RA 5GTIH 1SFCC 4EI2A 3L70D 5CHXA 1AA0A 1JY3P 1S4XA 4GDOA 2IBZD 4N78D 3V2NA 1T2KD 2YNYA 1YJ9P 2E42A 1EXJA 1URQA 1Y47A 1FBMA 1KB9D 5AVUB 3L75E 5KJ7D 3O8ZA 1SS1A 3AE4C 3B5ND 1SQXE 3CCEP 2I8DA 4WY4C 4ASVA 2JDIH 4EYYQ 3IR9A 1USDA 3OAKA 5APSA 1R8EA 2M3EA 3VMZA 1SQQD 1AFOA 2JWAA 3L37A 3BATA 4I2LC 1NHLA 1FZGA 2W8ZA 3TGUE 3A0HH 1KILD 2M8RA 1RE3A 2QIWA 2H8PD 3K5BA 1L0ND 2FKWB 3T97B 5KJ7A 4GODA 2PAJA 3CXHE 1X8YA 2FYUD 4Y28J 3B5NA 4H0LB 3CWBJ 1KC8Q 1VQKP 2J58A 2YXRB 2YKPA 2V7QJ 1S5LH 4LLHA 1IJDB 3C9IA 5CCHD 3PP5A 2PFXA 3OJAB 1G2CA 1N86A 1NTKJ 2O3JA 1SQVD 5KLVD 1PGQA 1R5SA 2GUSA 1QEXA 2IFMA 1KILA 1RE4A 3T97A 2XKMA 1OVUA 1NWQA 3M91A 3CC4P 5K5GB 3KZIE 3AE3C 3GF7A 1PGJA 3L74D 1SP4A 2R3CA 2I1KA 3MP7B 1N7SA 1AV1A 4H13B 1LWUC 3CI9A 2ITAA 2XZRA 3A5TA 1NJIQ 4QMAA 2BCCD 3FXDA 1S2EA 2D2CD 1IO4A 1NTZD 2ZXXA 1IFPA 2W6BA 5CCHA 3CCQP 5BU5A 1BCCJ 2OARA 1RF0A 3VTPC 1PP9D 5AVXB 1OXZA 2BASA 3BVHA 2FBWC 1IFIA 3O6QB 2WSEJ 1RH5B 1P84I 4I6MC 1PL5A 3AE5C 1NTMK 1NU1E 2PRRA 1RHZB 3FWLA 1PPJE 3H1IJ 1P84E 1T6AA 5GTIE 3U59A 1DH3A 1GU4A 1JTHA 3PH0A 5TJHA 3V5BA 2WTYA 1RQUA 2ZT9C 2KOGA 1FZCB 3O6QA 2LKMA 3L72J 1PPJG 1QX8A 2ZXEB 4BXLA 2GM4A 2KNCB 1S9KD 2AEJA 2M5AB 3NFQA 1EZVI 1GW4A 4D6TE 4OH8B 1HVVA 2OYIA 2WSSH 2YMYA 1AVYA 1E5WA 2N9BA 1L4AC 2B89A 5TISH 3TDKA 1FZCA 2PGDA 1GK4A 1JOCA 4OWFA 1W2EA 3HD7B 2KNCA 3TNUA 1L0LE 1BGYJ 2QJYC 3EFFK 2E76C 3SWYA 3BCCJ 4H44D 1EZVG 3L75D 1OVVA 1OIPA 1K9MQ 3RK2D 2Q3EA 3L70E 3IFMA 1SQXD 3C1LA 2P10A 2N1TC 3L4FA 5APTA 2A45H 1BE3J 2HODA 3USSA 1M1JA 3U1CA 1DD4A 2VRSA 3F5HA 1L0NJ 3H1LJ 1NO4A 3L70G 1S5LE 3AEDC 3H1KJ 1N7LA 1FOSE 1YYCA 3WUVA 5KLIB 2W27A 3Q2YA 1ZR4A 1FDMA 3P8CE 3L71E 3ZDMA 3TGUD 2NPSB 5APVA 2E74C 3EQ2A 2YMKA 1S5LX 1JY3O 1QL1A 3CXHD 1HWTC 3EWKA 1SQVJ 5KLVJ 2B87B 1M7LA 1AVOA 1GL2B 3AE1C 1FU1A 5DJTB 3WUTA 5AW6B 3S4RA 2YIUC 3QWOC 1KYOH 5AW5B 3TYYA 1JUNA 5AVRB 2WPRA 1MZ9A 2IDBA 4WB4A 2P7JA 5AVQB 1SQQG 2WZ7A 1GTWA 3M0DA 2I1JA 2NRGA 3PJSK 3HE5A 2R32A 2P1JA 1R5LA 4KHXA 3RL0B 2NPSC 5APUA 5APQA 3GLMA 3HTKA 3GG2A 1FJKA 1NVOA 2BCCJ 1NTZJ 1HUCA 2Q1KA 1Z56A 4GOFA 1W2BO 3AECC 1VQLP 1PP9J 3M9HA 1IC2A 2FYUG 3H1HJ 2QM8A 1GL2C 3CD6P 1SQPE 1QVGO 4PV1C 4W80A 4DCKA 1J1DB 1N2DC 3KPEA 2QJPB 3L73J 3L36A 4L76A 1ZMEC 2H43A 1LTTC 3GHGB 1SQPG 4N6JA 3MD0A 2HG5D 1VQ7P 3SWFA 2HPCB 2O1JA 1OX3A 1NU1D 4AUWA 5E79E 3MTUE 3MUDC 4L73A 4NPFX 3L74G 1PPJD 2H89C 2CK3H 1P84D 1HJ0A 2G3AA 1MFTA 5DJUB 4JPZB 2Q9IA 1KN7A 1VF5B 2BEQD 4XFJA 1IFDA 1GU5A 2KB7P 5TISE 2HR3A 3AEFC 2FXMA 3OA7A 1HGZA 4BRYB 3G9RA 3H32B 1NTKK 5AVWB 3RK3B 3L35A 2QJKB 1PP9G 1SFCB 3GHGC 1PGOA 2E5YA 1EDLA 2E75D 1JY3N 4JQ0D 4D6TD 1VQ8P 2ZJSE 3BRVB 1OW8A 1LT9C 2YO3A 1Q81Q 2JEEA 1JCDA 2HFED 2JP3A 4K35A 4AQRD 2QRXA 3A0BH 1AJYA 2V7QH 1RF1C 4BRYA 1T3UA 4YXDC 1L0LD 3PRJA 1NKZB 3N7NA 3D71A 1S72P 2A45G 1KQSO 2KLUA 3FXEA 2Q5UA 3FX0A 1U7MA 1YITP 1Y8AA 1ZW0A 4AYCA 1T8ZA 1LTJB 2WPSA 3HRNA 3VN0A 4RJTA 3Q5SA 1JM0A 1U7JA 2L91A 2OTJP 2V4HA 2R5DA 2FFDA 3CMEP 1KYOE 4WY4A 1FZBA 3P8CD 3L71D 1KD1Q 1FJPA 1YIJP 3CCJP 4XE5B 3AEAC 2SPZA 2B9BA 1Y9BA 1GMJA 1EC5A 3L75G 2WSEH 2OQQA 1URQC 5CJ0A 5KTBA 1SQXG 1LTJC 5CCGD 3JSVC 3CXHI 3SFEC 3MGNA 1YJWP 3MIWA 2KXPB 3LIDA 2FXOA 3D6YA 5EFWB 2LXBA 1ZN5A 4IL6H 5AVZB 4OGQC 4H0LD 2POHA 2OYOA 2KI7B 4I7ZC 2R44A 4U3FE 3W68A 2RMZA 3TGUG 1FOSF 4GIFA 1N7SD 1IK7A 3A2AA 1LWUB 1SQQK 1SQBE 1T2KC 4JBZA 2QG4A 4HKZH 5AVYB 2JWDA 1RE3C 2K88A
chains in the Genus database with same CATH topology
3NXSA 3VMXA 3H32A 4OH8B 1HVVA 3U1AA 1SFCA 2OYIA 2XNXA 3KDPB 5CCGA 5KJ7C 1A02J 2WSCH 1SQBK 1IFJA 2H7HA 4ZKPA 1ZV8A 2YMYA 1OWAA 1E5WA 2N9BA 3B5NC 2M3BA 2KSJA 1L4AC 1H89A 1L0NK 1URQB 1LTIC 3KYQA 4EOTA 1LGHB 1FZCA 2FYUK 1GK4A 1JOCA 1HGVA 1IK9A 1W2EA 2Z5IA 3HD7B 3TNUA 1LWUA 1KFMA 5AVVB 3I5CA 3SWYA 2L5GB 1QL2A 3A3YB 3HUSB 3P32A 4JYBA 4LGDE 2JJLA 2P67A 5BU8B 2CPSA 3MUDA 1SLQA 5CMZA 1J1EC 1N73C 3RK2D 2Z4EA 3IFMA 4JYCA 1KILC 1RE4C 1L0LK 3TSIA 4EIJA 1GK6A 1EQ7A 2N1TC 3L4FA 1RY3A 1SQVK 5AW3B 5KLVK 5APTA 2R5BA 2A45H 1X79B 3V4QA 2HODA 3TK1A 1M1JA 3U1CA 4JF7A 4I1LA 2VRSA 3RL0C 5AW9B 2Q7CA 1GDTA 3P7KA 1LTJA 1ZR2A 1G1IA 2OYHB 3II6A 1CZQA 1NO4A 1G1JA 2FYZA 4IFFA 1JY2P 3V2QA 1N7LA 2FFDC 1YYCA 1YTZI 1FOSE 2W27A 1ZR4A 1FDMA 3P8CE 3HUSA 1PFIA 2NPSB 5BVZA 5APVA 3CLQA 3EQ2A 4N3YB 3EFGA 5CCHC 1FZFA 3B5NB 2WWWA 3P8MC 3CL3D 1L4AB 1JY3O 3VP8A 1QL1A 1J1DC 1VDFA 1DX7A 3M9BA 3LW5H 2KLVA 2C0XA 4B86A 1NTZK 4HH2A 4WBAA 1HWTC 3UIAA 2CPBA 2IX7C 1M7LA 5AW0B 1GL2B 2WSFH 4IFDK 1FU1A 5AW6B 2OYHA 1G2CB 3M9QA 2Q3IA 2IFNA 2P2UA 1RF1A 5AW4B 5AW5B 3TYYA 4C46A 3V2RA 1AQ5A 1JUNA 2C9NY 1J1EB 5AVRB 2WPRA 1MZ9A 1N73B 2MJZA 2IPPA 3G3ZA 2GUVA 1KQLA 1KILB 3HE4A 4WB4A 2P7JA 5AVQB 2N1TB 2WZ7A 3H6PA 1LTBC 1ZLLA 1GTWA 3M0DA 2I1JA 1JO5A 3B8EB 5APYA 3HE5A 2R32A 2P1JA 4KHXA 3RL0B 1URQD 2NPSC 5APUA 5APQA 3HTKA 3LIEA 2O01H 1FJKA 4LC1A 1X9VA 5CJ4A 1JMMA 1JY2N 1HUCA 1XTGB 3HD7D 1Z56A 1S9KE 4GKGA 2XV5A 1N7SB 2FFDB 4W7ZA 3BASA 3M9HA 1HH0A 1NAFA 2J59M 1JNMA 4WY4B 3R2PA 1IC2A 2QM8A 3V4WA 1GL2C 1N73A 2Z5HA 3RK3C 4W80A 1YTZT 4O9BA 1J1DB 4C7RA 1SFCC 5AW1B 1N2DC 3KPEA 5CCGC 2KP8A 5CHXA 1GZLA 1JY3P 5AVTB 2WPQA 3L36A 4N78D 2H43A 1MFZA 1SQPK 3V2NA 5AVSB 1LTTC 2YNYA 1T2KD 2KYVA 3GHGB 4ZKUA 1KZUB 2E42A 4N6JA 2E43A 1URQA 3MD0A 2HG5D 1FBMA 2QM7A 3SWFA 2HPCB 5AVUB 2WT7B 2NPSD 1LTGC 2O1JA 5KJ7D 1HTLC 3HD7A 3O8ZA 4AUWA 5APWA 3MTUE 3KQGA 1N7SC 3B5ND 4GT1A 1JTHB 1L4AD 2O1KA 1NKNA 4WY4C 3IR9A 4C7NB 2C0WA 3OAKA 1RF0C 5APSA 2Q9IA 3VMZA 1AFOA 3L37A 1SQXK 1MV8A 3A7OA 1IFDA 1GU5A 2KB7P 3BATA 2FXMA 3OA7A 4I2LC 1NHLA 1FZGA 1HGZA 4RESB 3H32B 1NOHA 1NTKK 5AVWB 3RK3B 3L35A 1KILD 3M06A 2WT7A 3NMDA 1SFCB 2OYIB 3GHGC 2M8RA 2N1TD 1RE3A 1JY3N 2YKOA 4DOJA 2H8PD 4W7YA 1T3JA 2FKWB 2NPSA 3RL0D 5KJ7A 3BRVB 2PAJA 1LT9C 1X8YA 3M0AA 2YO3A 4C7NA 1CW5A 1IFMA 1DEBA 3B5NA 2JEEA 1JCDA 1L4AA 3RK2C 1HBWA 3TNUB 3V2PA 2HFED 1VPCA 2J58A 1JY2O 5AW2B 4AQRD 2YKPA 1IFNA 5AW8B 4LLHA 2HYNA 1GL2A 1IJDB 3C9IA 5CCHD 1RF1C 3PP5A 1T3UA 3WMM0 3OJAB 3E1IA 2HLOA 1J2JB 1G2CA 1NKZB 1N86A 3N7NA 2PP6A 1CI6B 2A45G 3M0DC 1JCCA 2GUSA 4Y99C 2IFMA 1KILA 1RE4A 2HODB 2Q5UA 1WRGA 2XKMA 1M1JB 2N1TA 3T97A 3M91A 1NWQA 2OYIC 3VOPA 1H88A 4AYCA 5APXA 1T8ZA 1FAVA 1GD2E 2W6AA 1LTJB 2C9LY 2YKQA 1WT6A 2WPSA 1MUUA 3HRNA 1SP4A 4DZOA 3VN0A 1FZCC 2R3CA 2I1KA 2R5DA 1N7SA 1LTSC 2FFDA 1LWUC 3CI9A 3A5TA 2XZRA 1LTAC 4M3LA 4XA4A 1LT9B 1FZBA 4WY4A 3P8CD 1IO4A 1FJPA 1CI6A 2W6BA 5CCHA 4XE5B 5BU5A 2OARA 1RF0A 3VTPC 4N78E 5AVXB 3RK2B 1FZAA 2XU6A 1OXZA 2BASA 3BVHA 1IFIA 2YO2A 1SVFA 2WSEH 4I6MC 1RF1B 1GL2D 1M1JC 1URQC 2WITA 3RK3D 3VYIA 1NH4A 2ZFCA 1NTMK 5CJ0A 1SFCD 3GHGA 3HE4B 5KTBA 5CCGD 1LTJC 1XTCC 5AW7B 3HD7C 3VP9A 3VMYA 4Y99B 2XDJA 3MGNA 2HPCA 3HE5B 3MIWA 1H8AA 1CSBA 3HUSC 1LT9A 3LIDA 3HTKB 1ZN5A 2A45I 1NU1K 5AVZB 3U59A 4HYTB 1DH3A 1GU4A 2POHA 1JTHA 1KFNA 3V5BA 2WTYA 1A02F 2KOGA 1FZCB 1FZEA 1HJBA 2LKMA 1FOSF 4GIFA 2ZXEB 1N7SD 2GM4A 3A2AA 3BRTB 1LWUB 1S9KD 1SQQK 1T2KC 3N4XA 3NFQA 3NTNA 4WY4D 1GW3A 5AVYB 2OYHC 1GW4A 1RE3C 4IFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7S C;  3B5N D;  4OH8 B;  1HVV A;  1JTH B;  1GL2 B;  1L4A D;  1SFC A;  5CCG A;  5KJ7 C;  4WY4 C;  2YMY A;  1N7S A;  3B5N C;  1L4A C;  1URQ B;  1KIL B;  3KYQ A;  4WY4 A;  2N1T B;  2WZ7 A;  5CCH A;  3HD7 B;  1NHL A;  4N78 E;  3RK2 B;  3RL0 B;  1URQ D;  2NPS C;  3RK3 B;  1KIL D;  1SFC B;  2M8R A;  2N1T D;  4LGD E;  1XTG B;  3HD7 D;  2H8P D;  4W7Y A;  1GL2 D;  1N7S B;  3RK2 D;  1T3J A;  1URQ C;  1KIL C;  2NPS A;  3RL0 D;  3RK3 D;  5KJ7 A;  4W7Z A;  3TSI A;  2N1T C;  1SFC D;  5CCG D;  4WY4 B;  3B5N A;  3HD7 C;  1L4A A;  1GL2 C;  3RK2 C;  2XDJ A;  4JF7 A;  3RL0 C;  3RK3 C;  4W80 A;  2HFE D;  1SFC C;  5CCG C;  3HTK B;  1JTH A;  1GL2 A;  5CCH D;  3PP5 A;  3P8C E;  2NPS B;  2KOG A;  2PP6 A;  3M0D C;  5CCH C;  1N7S D;  3B5N B;  1URQ A;  2HG5 D;  1KIL A;  1L4A B;  2N1T A;  3VOP A;  2NPS D;  4WY4 D;  5KJ7 D;  3HD7 A; 
#chains in the Genus database with same CATH topology
 3VMX A;  4U3F G;  1SQP D;  3KDP B;  5CCG A;  5KJ7 C;  1A02 J;  2WSC H;  2MKV A;  5CBN A;  1OWA A;  1SQB G;  3G71 P;  1FDI A;  3B5N C;  2WQY C;  2M3B A;  3G4S P;  1L0N K;  5GTH H;  1LTI C;  3KYQ A;  1NGM B;  2FYU K;  1DIP A;  3E1R A;  2Z5I A;  1U57 A;  1KTM A;  1LWU A;  4H13 D;  5AVV B;  4CPG A;  1WMK A;  1QL2 A;  2K9J B;  5BU8 B;  4OVN F;  1N73 C;  2Z4E A;  1KIL C;  2W90 A;  1RE4 C;  1HF9 A;  4EIJ A;  1GK6 A;  2ZT9 B;  1RY3 A;  1VQ5 P;  1SQV K;  5KLV K;  2RKL A;  1QGK B;  3TF5 A;  3TK1 A;  5KAF H;  3KHU A;  3E7K A;  2ZYD A;  4TLF A;  4UB6 H;  2Q7C A;  1VQP P;  1W5C E;  2QA4 P;  3P7K A;  1PZQ A;  1G1J A;  2QVA A;  3A0B E;  1PFI A;  3AE9 C;  3CLQ A;  2D2C B;  2ZAE B;  4N3Y B;  5CCH C;  1FZF A;  2QEX P;  2WWW A;  3P8M C;  1NTK E;  3WU2 H;  1L4A B;  3LW5 H;  1NTZ K;  4WBA A;  2CPB A;  1NU1 G;  3RK3 E;  2QJY B;  2WSF H;  2E76 B;  2Q3I A;  3L70 J;  2IFN A;  3CX5 H;  1JB0 J;  2MJZ A;  2OGU A;  2GUV A;  2N1T B;  1LTB C;  1ZLL A;  3B8E B;  5APY A;  3FWN A;  2D2C C;  2O01 H;  3IF4 A;  5CJ4 A;  3GMA A;  1XTG B;  3HD7 D;  2XV5 A;  4L75 A;  2J5U A;  3AEG C;  1MKM A;  4PD4 H;  5C39 A;  2G8Y A;  4D6T G;  2P58 A;  1NAF A;  1JNM A;  5KAI H;  2E74 B;  3ABV C;  3V4W A;  2M5A A;  2OTK E;  1YTZ T;  1SQQ J;  1KYO D;  3A0H E;  5AW1 B;  1NAY A;  2KP8 A;  4NPD A;  1LT1 A;  1X0T A;  1ZOY C;  4HB1 A;  2WPQ A;  4IL6 E;  3FGA D;  1L0L G;  2YIU B;  4ZKU A;  1KZU B;  2E43 A;  4IL6 X;  2K9Y A;  3JCU H;  3L72 E;  2NPS D;  1LTG C;  1HTL C;  2FYU J;  3HD7 A;  3CMA P;  3CCR P;  4GT1 A;  2O1K A;  1K05 A;  1VQM P;  4C7N B;  2Y0E A;  2C0W A;  4ASW A;  1BSH A;  1SQX K;  4WWI A;  5GTH E;  4U3F D;  1SQP J;  3L71 G;  2AXT H;  2FYN C;  4RES B;  3G6E P;  4PV1 B;  1OMI A;  3NMD A;  1SQB D;  1BGY E;  1YI2 P;  2YKO A;  2JO1 A;  4YTP C;  3L74 J;  3BCC E;  2XND H;  2NPS A;  3RL0 D;  1NYH A;  3M0A A;  4H44 C;  4C7N A;  1CW5 A;  1IFM A;  1DEB A;  1M57 D;  3RK2 C;  3RBX A;  3V2P A;  4WVZ A;  1VPC A;  5KAF E;  1JY2 O;  5AW2 B;  1BE3 E;  1IFN A;  4UB6 E;  5AW8 B;  4L74 A;  2B87 A;  1FC2 C;  2LR2 A;  1GL2 A;  3IN6 A;  1VQN P;  3H1L E;  3H25 A;  2HLO A;  1H0T B;  3I56 P;  2PP6 A;  3H1K E;  3M0D C;  1JCC A;  4Y99 C;  2DW3 A;  1LP1 B;  3VOP A;  3WU2 E;  1H88 A;  2Y0C A;  5APX A;  1GD2 E;  1FAV A;  2C9L Y;  2YKQ A;  1WT6 A;  3AE7 C;  1MUU A;  4DZO A;  1KV4 A;  3Q1M A;  3CWB D;  1LTS C;  1YBK A;  3CX5 E;  3JC2 2;  4XA4 A;  4M3L A;  1H0T A;  1PV3 A;  1LT9 B;  2M0B A;  3CC7 P;  1M90 Q;  2LXC B;  1NTM E;  1DEE G;  2AEF A;  1LP1 A;  1NTK D;  4PD4 I;  1LJ2 A;  1VF5 D;  3CC2 P;  1SVF A;  1EXI A;  2W6J H;  5CBO A;  1RF1 B;  3V6I A;  3RK3 D;  3VYI A;  2Q6Q A;  1S1C X;  1SFC D;  3GHG A;  3HE4 B;  2FY8 A;  4PD4 E;  1OFC X;  5AW7 B;  1NTM G;  1YJN P;  3VP9 A;  3VMY A;  4A7P A;  4TT3 H;  5KAI E;  2XDJ A;  2HPC A;  1H8A A;  3HUS C;  1ZXG A;  1LT9 A;  3H1H E;  2A45 I;  1NU1 K;  5KKZ C;  2ZYA A;  1KFN A;  4NPE A;  2KS1 B;  1A02 F;  2UWJ E;  1AQT A;  2KUB A;  3L73 E;  1LNQ A;  3L75 J;  2IZ0 A;  3H1J E;  3BRT B;  2ZVN B;  2E5T A;  3N4X A;  1SQX J;  4WY4 D;  1GW3 A;  2OYH C;  2AEM A;  3JCU E;  1VQ4 P;  4IFM A;  3F89 A;  1M56 D;  3NXS A;  3H32 A;  1Q7Y Q;  1SFC A;  2H7H A;  1UII A;  3H1J G;  2KSJ A;  1URQ B;  1S3J A;  1LGH B;  3TGU J;  2R3S A;  1KYO I;  1IK9 A;  1Q90 D;  2AXT E;  3I5C A;  3A3Y B;  1YQ3 C;  4HJG H;  3IAO A;  3S1K A;  3L72 D;  4JYB A;  4LGD E;  4U3F J;  4OGQ B;  5CMZ A;  1J1E C;  4I7Z B;  4JYC A;  1L0L K;  3TSI A;  1EQ7 A;  2E75 C;  2GA1 A;  1SQB J;  1FE6 A;  3PHL A;  1VQO P;  4I1L A;  1BDC A;  3MHV A;  1GDT A;  1K04 A;  1LTJ A;  1ZR2 A;  1G1I A;  2FYZ A;  1JEK A;  3MZW B;  1JY2 P;  3V2Q A;  2FFD C;  1KQG B;  2BEZ F;  3EFG A;  1BGY D;  1OW7 A;  2IYO A;  4EDF A;  3B5N B;  3ITK A;  1QVF O;  1TU3 F;  3CL3 D;  3VP8 A;  3BCC D;  1DX7 A;  3M9B A;  5M1B A;  4B86 A;  2C0X A;  4HH2 A;  4YXW H;  2IX7 C;  5AW0 B;  4PJ0 H;  1G2C B;  3M9Q A;  1BE3 D;  2P2U A;  5AW4 B;  4C46 A;  1AQ5 A;  1N73 B;  2IPP A;  1KQL A;  1KIL B;  3H1L D;  3H6P A;  1M8O B;  2K1A A;  3H1K D;  2WVR A;  1VL2 A;  1K8A Q;  2RH0 A;  4LC1 A;  1BDD A;  1X9V A;  1KB9 H;  1N8R Q;  1NU1 J;  1N7S B;  2OTL P;  5B66 H;  1KMI Z;  3W67 A;  3AE6 C;  4IOI H;  1N73 A;  3CX5 D;  2ZT9 D;  5CCG C;  1EDK A;  1GZL A;  3WUU A;  1Q2N A;  1PIX A;  5AVT B;  2WPV B;  1X22 A;  5B5E H;  1MFZ A;  1NTM D;  1SQP K;  2FXP A;  5AVS B;  2KYV A;  3CCU P;  3B4S A;  3AEE C;  4H0L C;  1VQ9 P;  4RKU J;  1ZRT D;  2QM7 A;  4D6T J;  4U7J A;  1FS0 E;  2WT7 B;  3CWB E;  2QSI A;  2KIK A;  3CCS P;  1L2P A;  4PD4 D;  3KQG A;  5APW A;  1N7S C;  2Y9Z A;  1JTH B;  1L4A D;  2W83 C;  2K9J A;  1NKN A;  2Y9Y A;  3RBZ A;  3H1H D;  2RN0 A;  1RF0 C;  2O01 N;  3CWB G;  2E76 D;  1L0L J;  1MV8 A;  1OW6 A;  2H88 C;  3A7O A;  3PTZ A;  3L73 D;  3SWK A;  1NOH A;  3H1J D;  3M06 A;  2WT7 A;  2OYI B;  2N1T D;  1NTK G;  2AXC A;  3OW2 O;  4DOJ A;  4W7Y A;  4H13 C;  1T3J A;  2KSE A;  1D7M A;  4KJM A;  1RQV A;  1L4A A;  1JMB A;  1HBW A;  3TNU B;  2YXQ B;  1BCC E;  5E79 H;  3L71 J;  2E74 D;  4UB8 H;  1M1K Q;  2HYN A;  2NZ2 A;  3WMM 0;  3E1I A;  2WSC J;  1J2J B;  1QLE D;  2ZYG A;  3I55 P;  1Q82 Q;  3Q5P A;  1CI6 B;  1KOR A;  1BCC G;  1EZV E;  2HOD B;  1KQF B;  1WRG A;  2OYI C;  1M1J B;  2N1T A;  3H1I E;  2W6A A;  1OZH A;  2FYN B;  3RGU A;  3SFD C;  1K73 Q;  3AEB C;  4YPC A;  1FZC C;  4PJ0 E;  5L8R J;  2IBZ I;  4GOE A;  2A06 E;  1YHQ P;  1LTA C;  3H1I G;  4RO0 A;  2JR8 A;  4H44 B;  3KXD A;  2IZ1 A;  1CI6 A;  1KB9 I;  3QH9 A;  3GW6 A;  3C8V A;  1Q86 Q;  2IBZ E;  4N78 E;  3RK2 B;  1FZA A;  2XU6 A;  1EDJ A;  2YO2 A;  2A06 G;  3L72 G;  2IYP A;  1KB9 E;  1GL2 D;  1M1J C;  4Z1M H;  5H2F H;  2WIT A;  4PV1 D;  1NH4 A;  2ZFC A;  1OVR A;  1XTC C;  3AE8 C;  2IBZ G;  5B66 E;  3HD7 C;  4Y99 B;  3HE5 B;  4MN4 C;  1CSB A;  3LW5 J;  3HTK B;  4HYT B;  1SQQ E;  1E79 H;  2WSF J;  3CCL P;  5B5E E;  1FZE A;  1HJB A;  3CCM P;  1KIL E;  1BGY G;  3NTN A;  1YQ4 C;  2KZI A;  3BCC G;  1NTM J;  4ZMD A;  1L0N E;  2K37 A;  3AE2 C;  3B71 A;  3U1A A;  5KLI C;  2XNX A;  2FYU E;  2O01 J;  1SQB K;  1IFJ A;  4ZKP A;  1ZV8 A;  1PGP A;  3PLN A;  1IZN B;  1BE3 G;  1FDO A;  1H89 A;  4EOT A;  1L0N G;  3CX5 I;  3H1L G;  4ZNC A;  1HGV A;  4R4L A;  1KFM A;  3H1K G;  2Y0D A;  1SQV E;  2L5G B;  3HUS B;  5KLV E;  3P32 A;  1BSN A;  2JJL A;  2P67 A;  3D6Z A;  2CPS A;  5KKZ B;  3MUD A;  1SLQ A;  4K3A A;  3SSU A;  3CXH H;  1USE A;  2JKV A;  3RL0 g;  5AW3 B;  3H1J J;  2R5B A;  3L74 E;  1X79 B;  3V4Q A;  1SQV G;  4BWN A;  5KLV G;  4JF7 A;  3RL0 C;  5AW9 B;  2WMM A;  2B88 A;  3CPW O;  2ZVO B;  2OYH B;  3II6 A;  1CZQ A;  1ZRT E;  2KK7 A;  3D70 A;  4IFF A;  2BCC E;  3CCV P;  1YTZ I;  4UB8 E;  4DJG A;  3Q3D A;  1NTZ E;  3HUS A;  5BVZ A;  1PP9 E;  3VMA A;  3S9O A;  3KZI H;  1J1D C;  1VDF A;  2KLV A;  2QJP C;  2BCC G;  3UIA A;  2KZJ A;  1DD3 A;  1NTZ G;  4IFD K;  1VQ6 P;  1BCC D;  2OYH A;  1RF1 A;  3V2R A;  3H1H G;  2C9N Y;  1J1E B;  3GF3 A;  3G3Z A;  3R4Y A;  3HE4 A;  2QE7 H;  2E75 B;  1UIX A;  1JO5 A;  3L73 G;  1URQ D;  1EZV D;  3LIE A;  4R4M A;  1JMM A;  1JY2 N;  4KT0 J;  3H1I D;  1S9K E;  4GKG A;  2KS1 A;  2FFD B;  4DT0 A;  4W7Z A;  3BAS A;  1VF5 C;  1EDI A;  1HH0 A;  2J59 M;  5H2F E;  2K3R A;  4WY4 B;  1ZP0 C;  3R2P A;  2N9Y B;  1P84 H;  4OGQ D;  3Q5R A;  2Z5H A;  3RK3 C;  2QJK C;  4O9B A;  2A06 D;  4C7R A;  5GTI H;  1SFC C;  4EI2 A;  3L70 D;  5CHX A;  1AA0 A;  1JY3 P;  1S4X A;  4GDO A;  2IBZ D;  4N78 D;  3V2N A;  1T2K D;  2YNY A;  1YJ9 P;  2E42 A;  1EXJ A;  1URQ A;  1Y47 A;  1FBM A;  1KB9 D;  5AVU B;  3L75 E;  5KJ7 D;  3O8Z A;  1SS1 A;  3AE4 C;  3B5N D;  1SQX E;  3CCE P;  2I8D A;  4WY4 C;  4ASV A;  2JDI H;  4EYY Q;  3IR9 A;  1USD A;  3OAK A;  5APS A;  1R8E A;  2M3E A;  3VMZ A;  1SQQ D;  1AFO A;  2JWA A;  3L37 A;  3BAT A;  4I2L C;  1NHL A;  1FZG A;  2W8Z A;  3TGU E;  3A0H H;  1KIL D;  2M8R A;  1RE3 A;  2QIW A;  2H8P D;  3K5B A;  1L0N D;  2FKW B;  3T97 B;  5KJ7 A;  4GOD A;  2PAJ A;  3CXH E;  1X8Y A;  2FYU D;  4Y28 J;  3B5N A;  4H0L B;  3CWB J;  1KC8 Q;  1VQK P;  2J58 A;  2YXR B;  2YKP A;  2V7Q J;  1S5L H;  4LLH A;  1IJD B;  3C9I A;  5CCH D;  3PP5 A;  2PFX A;  3OJA B;  1G2C A;  1N86 A;  1NTK J;  2O3J A;  1SQV D;  5KLV D;  1PGQ A;  1R5S A;  2GUS A;  1QEX A;  2IFM A;  1KIL A;  1RE4 A;  3T97 A;  2XKM A;  1OVU A;  1NWQ A;  3M91 A;  3CC4 P;  5K5G B;  3KZI E;  3AE3 C;  3GF7 A;  1PGJ A;  3L74 D;  1SP4 A;  2R3C A;  2I1K A;  3MP7 B;  1N7S A;  1AV1 A;  4H13 B;  1LWU C;  3CI9 A;  2ITA A;  2XZR A;  3A5T A;  1NJI Q;  4QMA A;  2BCC D;  3FXD A;  1S2E A;  2D2C D;  1IO4 A;  1NTZ D;  2ZXX A;  1IFP A;  2W6B A;  5CCH A;  3CCQ P;  5BU5 A;  1BCC J;  2OAR A;  1RF0 A;  3VTP C;  1PP9 D;  5AVX B;  1OXZ A;  2BAS A;  3BVH A;  2FBW C;  1IFI A;  3O6Q B;  2WSE J;  1RH5 B;  1P84 I;  4I6M C;  1PL5 A;  3AE5 C;  1NTM K;  1NU1 E;  2PRR A;  1RHZ B;  3FWL A;  1PPJ E;  3H1I J;  1P84 E;  1T6A A;  5GTI E;  3U59 A;  1DH3 A;  1GU4 A;  1JTH A;  3PH0 A;  5TJH A;  3V5B A;  2WTY A;  1RQU A;  2ZT9 C;  2KOG A;  1FZC B;  3O6Q A;  2LKM A;  3L72 J;  1PPJ G;  1QX8 A;  2ZXE B;  4BXL A;  2GM4 A;  2KNC B;  1S9K D;  2AEJ A;  2M5A B;  3NFQ A;  1EZV I;  1GW4 A;  4D6T E;  4OH8 B;  1HVV A;  2OYI A;  2WSS H;  2YMY A;  1AVY A;  1E5W A;  2N9B A;  1L4A C;  2B89 A;  5TIS H;  3TDK A;  1FZC A;  2PGD A;  1GK4 A;  1JOC A;  4OWF A;  1W2E A;  3HD7 B;  2KNC A;  3TNU A;  1L0L E;  1BGY J;  2QJY C;  3EFF K;  2E76 C;  3SWY A;  3BCC J;  4H44 D;  1EZV G;  3L75 D;  1OVV A;  1OIP A;  1K9M Q;  3RK2 D;  2Q3E A;  3L70 E;  3IFM A;  1SQX D;  3C1L A;  2P10 A;  2N1T C;  3L4F A;  5APT A;  2A45 H;  1BE3 J;  2HOD A;  3USS A;  1M1J A;  3U1C A;  1DD4 A;  2VRS A;  3F5H A;  1L0N J;  3H1L J;  1NO4 A;  3L70 G;  1S5L E;  3AED C;  3H1K J;  1N7L A;  1FOS E;  1YYC A;  3WUV A;  5KLI B;  2W27 A;  3Q2Y A;  1ZR4 A;  1FDM A;  3P8C E;  3L71 E;  3ZDM A;  3TGU D;  2NPS B;  5APV A;  2E74 C;  3EQ2 A;  2YMK A;  1S5L X;  1JY3 O;  1QL1 A;  3CXH D;  1HWT C;  3EWK A;  1SQV J;  5KLV J;  2B87 B;  1M7L A;  1AVO A;  1GL2 B;  3AE1 C;  1FU1 A;  5DJT B;  3WUT A;  5AW6 B;  3S4R A;  2YIU C;  3QWO C;  1KYO H;  5AW5 B;  3TYY A;  1JUN A;  5AVR B;  2WPR A;  1MZ9 A;  2IDB A;  4WB4 A;  2P7J A;  5AVQ B;  1SQQ G;  2WZ7 A;  1GTW A;  3M0D A;  2I1J A;  2NRG A;  3PJS K;  3HE5 A;  2R32 A;  2P1J A;  1R5L A;  4KHX A;  3RL0 B;  2NPS C;  5APU A;  5APQ A;  3GLM A;  3HTK A;  3GG2 A;  1FJK A;  1NVO A;  2BCC J;  1NTZ J;  1HUC A;  2Q1K A;  1Z56 A;  4GOF A;  1W2B O;  3AEC C;  1VQL P;  1PP9 J;  3M9H A;  1IC2 A;  2FYU G;  3H1H J;  2QM8 A;  1GL2 C;  3CD6 P;  1SQP E;  1QVG O;  4PV1 C;  4W80 A;  4DCK A;  1J1D B;  1N2D C;  3KPE A;  2QJP B;  3L73 J;  3L36 A;  4L76 A;  1ZME C;  2H43 A;  1LTT C;  3GHG B;  1SQP G;  4N6J A;  3MD0 A;  2HG5 D;  1VQ7 P;  3SWF A;  2HPC B;  2O1J A;  1OX3 A;  1NU1 D;  4AUW A;  5E79 E;  3MTU E;  3MUD C;  4L73 A;  4NPF X;  3L74 G;  1PPJ D;  2H89 C;  2CK3 H;  1P84 D;  1HJ0 A;  2G3A A;  1MFT A;  5DJU B;  4JPZ B;  2Q9I A;  1KN7 A;  1VF5 B;  2BEQ D;  4XFJ A;  1IFD A;  1GU5 A;  2KB7 P;  5TIS E;  2HR3 A;  3AEF C;  2FXM A;  3OA7 A;  1HGZ A;  4BRY B;  3G9R A;  3H32 B;  1NTK K;  5AVW B;  3RK3 B;  3L35 A;  2QJK B;  1PP9 G;  1SFC B;  3GHG C;  1PGO A;  2E5Y A;  1EDL A;  2E75 D;  1JY3 N;  4JQ0 D;  4D6T D;  1VQ8 P;  2ZJS E;  3BRV B;  1OW8 A;  1LT9 C;  2YO3 A;  1Q81 Q;  2JEE A;  1JCD A;  2HFE D;  2JP3 A;  4K35 A;  4AQR D;  2QRX A;  3A0B H;  1AJY A;  2V7Q H;  1RF1 C;  4BRY A;  1T3U A;  4YXD C;  1L0L D;  3PRJ A;  1NKZ B;  3N7N A;  3D71 A;  1S72 P;  2A45 G;  1KQS O;  2KLU A;  3FXE A;  2Q5U A;  3FX0 A;  1U7M A;  1YIT P;  1Y8A A;  1ZW0 A;  4AYC A;  1T8Z A;  1LTJ B;  2WPS A;  3HRN A;  3VN0 A;  4RJT A;  3Q5S A;  1JM0 A;  1U7J A;  2L91 A;  2OTJ P;  2V4H A;  2R5D A;  2FFD A;  3CME P;  1KYO E;  4WY4 A;  1FZB A;  3P8C D;  3L71 D;  1KD1 Q;  1FJP A;  1YIJ P;  3CCJ P;  4XE5 B;  3AEA C;  2SPZ A;  2B9B A;  1Y9B A;  1GMJ A;  1EC5 A;  3L75 G;  2WSE H;  2OQQ A;  1URQ C;  5CJ0 A;  5KTB A;  1SQX G;  1LTJ C;  5CCG D;  3JSV C;  3CXH I;  3SFE C;  3MGN A;  1YJW P;  3MIW A;  2KXP B;  3LID A;  2FXO A;  3D6Y A;  5EFW B;  2LXB A;  1ZN5 A;  4IL6 H;  5AVZ B;  4OGQ C;  4H0L D;  2POH A;  2OYO A;  2KI7 B;  4I7Z C;  2R44 A;  4U3F E;  3W68 A;  2RMZ A;  3TGU G;  1FOS F;  4GIF A;  1N7S D;  1IK7 A;  3A2A A;  1LWU B;  1SQQ K;  1SQB E;  1T2K C;  4JBZ A;  2QG4 A;  4HKZ H;  5AVY B;  2JWD A;  1RE3 C;  2K88 A; 
#chains in the Genus database with same CATH homology
 3NXS A;  3VMX A;  3H32 A;  4OH8 B;  1HVV A;  3U1A A;  1SFC A;  2OYI A;  2XNX A;  3KDP B;  5CCG A;  5KJ7 C;  1A02 J;  2WSC H;  1SQB K;  1IFJ A;  2H7H A;  4ZKP A;  1ZV8 A;  2YMY A;  1OWA A;  1E5W A;  2N9B A;  3B5N C;  2M3B A;  2KSJ A;  1L4A C;  1H89 A;  1L0N K;  1URQ B;  1LTI C;  3KYQ A;  4EOT A;  1LGH B;  1FZC A;  2FYU K;  1GK4 A;  1JOC A;  1HGV A;  1IK9 A;  1W2E A;  2Z5I A;  3HD7 B;  3TNU A;  1LWU A;  1KFM A;  5AVV B;  3I5C A;  3SWY A;  2L5G B;  1QL2 A;  3A3Y B;  3HUS B;  3P32 A;  4JYB A;  4LGD E;  2JJL A;  2P67 A;  5BU8 B;  2CPS A;  3MUD A;  1SLQ A;  5CMZ A;  1J1E C;  1N73 C;  3RK2 D;  2Z4E A;  3IFM A;  4JYC A;  1KIL C;  1RE4 C;  1L0L K;  3TSI A;  4EIJ A;  1GK6 A;  1EQ7 A;  2N1T C;  3L4F A;  1RY3 A;  1SQV K;  5AW3 B;  5KLV K;  5APT A;  2R5B A;  2A45 H;  1X79 B;  3V4Q A;  2HOD A;  3TK1 A;  1M1J A;  3U1C A;  4JF7 A;  4I1L A;  2VRS A;  3RL0 C;  5AW9 B;  2Q7C A;  1GDT A;  3P7K A;  1LTJ A;  1ZR2 A;  1G1I A;  2OYH B;  3II6 A;  1CZQ A;  1NO4 A;  1G1J A;  2FYZ A;  4IFF A;  1JY2 P;  3V2Q A;  1N7L A;  2FFD C;  1YYC A;  1YTZ I;  1FOS E;  2W27 A;  1ZR4 A;  1FDM A;  3P8C E;  3HUS A;  1PFI A;  2NPS B;  5BVZ A;  5APV A;  3CLQ A;  3EQ2 A;  4N3Y B;  3EFG A;  5CCH C;  1FZF A;  3B5N B;  2WWW A;  3P8M C;  3CL3 D;  1L4A B;  1JY3 O;  3VP8 A;  1QL1 A;  1J1D C;  1VDF A;  1DX7 A;  3M9B A;  3LW5 H;  2KLV A;  2C0X A;  4B86 A;  1NTZ K;  4HH2 A;  4WBA A;  1HWT C;  3UIA A;  2CPB A;  2IX7 C;  1M7L A;  5AW0 B;  1GL2 B;  2WSF H;  4IFD K;  1FU1 A;  5AW6 B;  2OYH A;  1G2C B;  3M9Q A;  2Q3I A;  2IFN A;  2P2U A;  1RF1 A;  5AW4 B;  5AW5 B;  3TYY A;  4C46 A;  3V2R A;  1AQ5 A;  1JUN A;  2C9N Y;  1J1E B;  5AVR B;  2WPR A;  1MZ9 A;  1N73 B;  2MJZ A;  2IPP A;  3G3Z A;  2GUV A;  1KQL A;  1KIL B;  3HE4 A;  4WB4 A;  2P7J A;  5AVQ B;  2N1T B;  2WZ7 A;  3H6P A;  1LTB C;  1ZLL A;  1GTW A;  3M0D A;  2I1J A;  1JO5 A;  3B8E B;  5APY A;  3HE5 A;  2R32 A;  2P1J A;  4KHX A;  3RL0 B;  1URQ D;  2NPS C;  5APU A;  5APQ A;  3HTK A;  3LIE A;  2O01 H;  1FJK A;  4LC1 A;  1X9V A;  5CJ4 A;  1JMM A;  1JY2 N;  1HUC A;  1XTG B;  3HD7 D;  1Z56 A;  1S9K E;  4GKG A;  2XV5 A;  1N7S B;  2FFD B;  4W7Z A;  3BAS A;  3M9H A;  1HH0 A;  1NAF A;  2J59 M;  1JNM A;  4WY4 B;  3R2P A;  1IC2 A;  2QM8 A;  3V4W A;  1GL2 C;  1N73 A;  2Z5H A;  3RK3 C;  4W80 A;  1YTZ T;  4O9B A;  1J1D B;  4C7R A;  1SFC C;  5AW1 B;  1N2D C;  3KPE A;  5CCG C;  2KP8 A;  5CHX A;  1GZL A;  1JY3 P;  5AVT B;  2WPQ A;  3L36 A;  4N78 D;  2H43 A;  1MFZ A;  1SQP K;  3V2N A;  5AVS B;  1LTT C;  2YNY A;  1T2K D;  2KYV A;  3GHG B;  4ZKU A;  1KZU B;  2E42 A;  4N6J A;  2E43 A;  1URQ A;  3MD0 A;  2HG5 D;  1FBM A;  2QM7 A;  3SWF A;  2HPC B;  5AVU B;  2WT7 B;  2NPS D;  1LTG C;  2O1J A;  5KJ7 D;  1HTL C;  3HD7 A;  3O8Z A;  4AUW A;  5APW A;  3MTU E;  3KQG A;  1N7S C;  3B5N D;  4GT1 A;  1JTH B;  1L4A D;  2O1K A;  1NKN A;  4WY4 C;  3IR9 A;  4C7N B;  2C0W A;  3OAK A;  1RF0 C;  5APS A;  2Q9I A;  3VMZ A;  1AFO A;  3L37 A;  1SQX K;  1MV8 A;  3A7O A;  1IFD A;  1GU5 A;  2KB7 P;  3BAT A;  2FXM A;  3OA7 A;  4I2L C;  1NHL A;  1FZG A;  1HGZ A;  4RES B;  3H32 B;  1NOH A;  1NTK K;  5AVW B;  3RK3 B;  3L35 A;  1KIL D;  3M06 A;  2WT7 A;  3NMD A;  1SFC B;  2OYI B;  3GHG C;  2M8R A;  2N1T D;  1RE3 A;  1JY3 N;  2YKO A;  4DOJ A;  2H8P D;  4W7Y A;  1T3J A;  2FKW B;  2NPS A;  3RL0 D;  5KJ7 A;  3BRV B;  2PAJ A;  1LT9 C;  1X8Y A;  3M0A A;  2YO3 A;  4C7N A;  1CW5 A;  1IFM A;  1DEB A;  3B5N A;  2JEE A;  1JCD A;  1L4A A;  3RK2 C;  1HBW A;  3TNU B;  3V2P A;  2HFE D;  1VPC A;  2J58 A;  1JY2 O;  5AW2 B;  4AQR D;  2YKP A;  1IFN A;  5AW8 B;  4LLH A;  2HYN A;  1GL2 A;  1IJD B;  3C9I A;  5CCH D;  1RF1 C;  3PP5 A;  1T3U A;  3WMM 0;  3OJA B;  3E1I A;  2HLO A;  1J2J B;  1G2C A;  1NKZ B;  1N86 A;  3N7N A;  2PP6 A;  1CI6 B;  2A45 G;  3M0D C;  1JCC A;  2GUS A;  4Y99 C;  2IFM A;  1KIL A;  1RE4 A;  2HOD B;  2Q5U A;  1WRG A;  2XKM A;  1M1J B;  2N1T A;  3T97 A;  3M91 A;  1NWQ A;  2OYI C;  3VOP A;  1H88 A;  4AYC A;  5APX A;  1T8Z A;  1FAV A;  1GD2 E;  2W6A A;  1LTJ B;  2C9L Y;  2YKQ A;  1WT6 A;  2WPS A;  1MUU A;  3HRN A;  1SP4 A;  4DZO A;  3VN0 A;  1FZC C;  2R3C A;  2I1K A;  2R5D A;  1N7S A;  1LTS C;  2FFD A;  1LWU C;  3CI9 A;  3A5T A;  2XZR A;  1LTA C;  4M3L A;  4XA4 A;  1LT9 B;  1FZB A;  4WY4 A;  3P8C D;  1IO4 A;  1FJP A;  1CI6 A;  2W6B A;  5CCH A;  4XE5 B;  5BU5 A;  2OAR A;  1RF0 A;  3VTP C;  4N78 E;  5AVX B;  3RK2 B;  1FZA A;  2XU6 A;  1OXZ A;  2BAS A;  3BVH A;  1IFI A;  2YO2 A;  1SVF A;  2WSE H;  4I6M C;  1RF1 B;  1GL2 D;  1M1J C;  1URQ C;  2WIT A;  3RK3 D;  3VYI A;  1NH4 A;  2ZFC A;  1NTM K;  5CJ0 A;  1SFC D;  3GHG A;  3HE4 B;  5KTB A;  5CCG D;  1LTJ C;  1XTC C;  5AW7 B;  3HD7 C;  3VP9 A;  3VMY A;  4Y99 B;  2XDJ A;  3MGN A;  2HPC A;  3HE5 B;  3MIW A;  1H8A A;  1CSB A;  3HUS C;  1LT9 A;  3LID A;  3HTK B;  1ZN5 A;  2A45 I;  1NU1 K;  5AVZ B;  3U59 A;  4HYT B;  1DH3 A;  1GU4 A;  2POH A;  1JTH A;  1KFN A;  3V5B A;  2WTY A;  1A02 F;  2KOG A;  1FZC B;  1FZE A;  1HJB A;  2LKM A;  1FOS F;  4GIF A;  2ZXE B;  1N7S D;  2GM4 A;  3A2A A;  3BRT B;  1LWU B;  1S9K D;  1SQQ K;  1T2K C;  3N4X A;  3NFQ A;  3NTN A;  4WY4 D;  1GW3 A;  5AVY B;  2OYH C;  1GW4 A;  1RE3 C;  4IFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...