2AXTE

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
total genus 19
structure length 82
sequence length 82
chains with identical sequence e
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 2axtE00
5B66E 3JCUE 5GTHE 5KAIE 2AXTE 1S5LE 5TISE 5KAFE 5B5EE 3A0HE 4PJ0E 5E79E 3KZIE 1W5CE 4UB6E 5GTIE 4UB8E 4IL6E 5H2FE 3A0BE 3WU2E
chains in the Genus database with same CATH superfamily
3IF4A 3SSUA 2R3SA 3USSA 5APYA 1SQVD 3A3YB 1SQBD 5L8RJ 1KILC 2P67A 5GTIH 3VYIA 3RL0B 1H88A 1NTKD 1OFCX 1IFPA 3U1AA 4JF7A 3RK3E 1LT1A 2GUVA 1LTTC 2KLUA 1SQQK 2FXOA 1T3UA 5AVRB 3RK2B 3O6QA 1T2KD 4OH8B 3E1IA 2JR8A 1H8AA 1OWAA 1L0LJ 3M9BA 3H1LD 3TNUB 1IK9A 1T3JA 5KTBA 3CXHE 5AW6B 2OYHB 2FYUJ 3B5NC 1AJYA 3FXDA 2O3JA 3CCRP 1S3JA 3BCCJ 1H0TB 3H1JD 3OA7A 3N7NA 3V2QA 3WU2H 3A5TA 5CHXA 3HUSB 2QSIA 1MKMA 1RY3A 2MKVA 3WUTA 1FOSF 1VQMP 4GOFA 5AVSB 3C9IA 4DZOA 5CMZA 4PJ0E 2R32A 2B88A 3V2NA 3IN6A 4WY4D 1L0NG 1KYOI 1FOSE 3WUUA 1FAVA 1S5LX 2RN0A 4HYTB 2XDJA 3H1IJ 5BU5A 1NTZK 1MUUA 4HKZH 1OMIA 3VOPA 2HPCB 3B8EB 2K37A 2IBZI 4EIJA 2LKMA 2QE7H 5KLVD 2V4HA 1Q2NA 3V5BA 1LJ2A 4HH2A 1IFIA 2IX7C 5KAFE 1LTJB 1YI2P 2WWWA 1AA0A 1PP9G 4MN4C 2KK7A 2K88A 4PD4I 3SWFA 1L0NE 3JCUE 1YYCA 4U7JA 4QMAA 1KQFB 1IO4A 3G71P 3RBZA 3RL0g 3HD7B 1FU1A 1NTMG 1J1DC 1VQOP 2J58A 3CXHH 2OTLP 2FFDA 4IL6E 2KUBA 5TJHA 2Y0CA 4WB4A 1GL2B 3RL0D 1VL2A 1NTMD 3P8CD 1FZFA 3CX5I 1BGYD 4TLFA 1VQNP 3HE4A 1PP9E 1HUCA 4Y99B 2AEJA 3H1IG 2DW3A 2WSSH 3L71J 2HYNA 3H1KG 1L0LK 1QLED 1HTLC 2ZVNB 2KZJA 1ZLLA 3VP8A 3AE5C 1NTME 3L72G 2FYUK 5H2FE 4IFFA 3CCUP 1YJ9P 3H32B 2O1JA 5KAIE 3AE9C 1FDIA 2AEFA 1JMBA 1SQXG 3L72D 4WY4A 1JY3O 2E75C 3A7OA 3F89A 4EDFA 1QVGO 1NU1D 1KZUB 3RK3C 2WPRA 1IC2A 3NFQA 3C8VA 5KAFH 4KHXA 1KYOH 3H1IE 2KXPB 5TISE 3PHLA 1LTAC 1EDIA 1FZCB 3H1KE 2JO1A 2AEMA 2H89C 2HR3A 3L70D 4H0LB 3JCUH 2OQQA 5AVQB 4JPZB 1EQ7A 3I5CA 1GMJA 1E5WA 5K5GB 4RKUJ 4WWIA 2FFDC 3C1LA 1SQXE 4KT0J 4IL6H 1T2KC 1FZBA 1NJIQ 1J2JB 2QJPB 4UB8E 4C7NB 2O01J 1BSNA 2W90A 1FDOA 1YHQP 2FKWB 2QEXP 2H88C 5CBOA 2ZJSE 1OW8A 1JY3P 1KQGB 1ZP0C 4DJGA 1JEKA 2P1JA 1M90Q 1ZMEC 1X79B 3JSVC 2XNDH 5M1BA 3HD7D 3VTPC 4U3FD 3EFFK 1YTZI 5AVVB 2JP3A 1OW6A 2H8PD 2YKPA 4EYYQ 4YPCA 5H2FH 1LTIC 1GL2D 1M57D 1Y47A 3CX5H 1P84I 5KAIH 3TNUA 1PGOA 3RK3B 4L73A 4WY4C 2WTYA 2OYHA 2E74C 2W6AA 5EFWB 1EDKA 3SWYA 1H0TA 2WITA 1OX3A 3H1HG 1USEA 1U57A 3Q2YA 3HUSA 5TISH 1NVOA 2L91A 2Q5UA 3L35A 2FYNB 1Q82Q 1ZV8A 5APWA 4GIFA 3GF3A 2W27A 2YXQB 1VQ4P 2YO3A 1HF9A 3UIAA 4D6TJ 2P7JA 1LTSC 1Q81Q 1KB9E 1IK7A 2FBWC 2Z5HA 1VQ7P 3V4QA 5GTIE 2HPCA 1DIPA 4OWFA 1WT6A 3H1HE 4H0LD 3RL0C 2ZXEB 2C0WA 3VP9A 1LTJA 1SQVJ 2A06G 3L74D 2E42A 3F5HA 3V6IA 3O8ZA 3R2PA 1JMMA 2KSEA 1NTKJ 3AECC 1Q90D 1MV8A 5AW7B 2N9BA 4HJGH 2E74B 3Q5RA 3W67A 2ZYAA 2NZ2A 1GDTA 1ZXGA 3HD7A 2JWDA 4N6JA 2OYHC 2KIKA 1M1KQ 1QX8A 4YXWH 4I7ZC 3H1LJ 1PFIA 5E79H 5APSA 4RJTA 1GL2A 2M0BA 2OYOA 2RMZA 1SQQG 1S2EA 1OW7A 3AE4C 3GW6A 2VRSA 2BCCJ 3HUSC 3L73G 5APQA 4L76A 1CSBA 3H1JJ 1SQPJ 1E79H 2A06E 3WUVA 3RBXA 1NYHA 1LT9B 5CBNA 3K5BA 1P84H 3L75J 2JJLA 1Y9BA 3TYYA 2ZT9B 1QEXA 3PH0A 4RO0A 1AV1A 1G1JA 3RK3D 2XU6A 1NGMB 3CWBJ 3G6EP 4XFJA 3IR9A 4DT0A 2LXCB 4M3LA 2K3RA 1MZ9A 3H32A 1KB9H 2AXCA 3CCQP 2HFED 2QA4P 2E76B 3CXHD 1T6AA 1SQQE 3ABVC 5KKZC 3U59A 2R5DA 1PIXA 2V7QH 3L73E 2Q3EA 2A45I 1ZOYC 1LTJC 1NTZG 1GK4A 1Z56A 3FX0A 3U1CA 2KZIA 3EFGA 1IJDB 1ZRTE 3AEBC 1FZCA 4C46A 2KSJA 4JQ0D 2Z4EA 2O01H 2QJKB 4Z1MH 1K05A 4XE5B 2OYIB 3VMZA 1AQTA 4I7ZB 2M3EA 3MTUE 3HD7C 1JTHB 1RQUA 3Q3DA 1J1EB 2O1KA 1FZAA 2OGUA 1PPJG 3II6A 3V4WA 1GW3A 1NWQA 1GL2C 2YXRB 4C7NA 1HGVA 1FE6A 1MFZA 1SLQA 1FBMA 4OGQB 1SQVK 4CPGA 1SQBK 1DX7A 1PGPA 2XV5A 1NTZE 4ZKUA 2RKLA 3CWBG 1NTKK 4Y99C 1BGYJ 4R4MA 2J5UA 3QH9A 1KYOD 2E74D 3GHGB 2IBZG 1X8YA 1Q86Q 3A2AA 3BRVB 1L0ND 2NPSB 2IBZD 4W80A 5KKZB 1LTBC 5AW3B 1PPJE 1EZVI 4ZKPA 3A0HH 2Q3IA 3V2PA 2G8YA 1FJKA 1KYOE 1L0LG 1SQPK 1DEEG 3R4YA 3FWLA 5C39A 2R3CA 2FYUG 1S1CX 2ZT9D 3CWBE 2IFMA 3E7KA 3BASA 3M0AA 3D70A 2HODB 3G9RA 1FZCC 2IBZE 3BCCG 1PP9D 3M0DA 3CCLP 1YJNP 1IFDA 4GOEA 1EXIA 3AEGC 4H0LC 2FYUD 4PV1B 2Y0DA 2WQYC 1K04A 1GD2E 4H13B 1R8EA 3BCCD 3I56P 2E76D 2IZ1A 3L70J 3NMDA 4PD4E 1WRGA 4GT1A 4XA4A 3TSIA 3CX5D 2QJPC 1PV3A 1NHLA 1L0LE 2C0XA 1KTMA 5AVTB 1XTGB 2M3BA 1IFNA 2WT7B 1VQKP 1CI6B 2FYUE 5KLVK 1KD1Q 1PZQA 1GK6A 3SFDC 4NPEA 1DD4A 2MJZA 3BCCE 3MZWB 3CCJP 3H1ID 2SPZA 3GF7A 4NPDA 3H1KD 3CX5E 1OVRA 3LW5J 2E5YA 2XNXA 2WSEJ 4U3FJ 2QIWA 2BEZF 2PAJA 1KV4A 1HJBA 4OGQD 1W2EA 1AVOA 2YNYA 4BXLA 2KOGA 3WMM0 1DD3A 1SQXD 1TU3F 4AQRD 3AE7C 3Q1MA 2ZYGA 2ZAEB 1FZGA 3CC2P 1BE3J 2W6JH 4N3YB 2POHA 1UIXA 5APTA 1U7MA 2Q6QA 3SWKA 3I55P 3M0DC 3GLMA 3MP7B 3S4RA 3P7KA 1GTWA 1IZNB 4TT3H 3AEAC 1LT9A 2FYNC 3RGUA 2NPSD 1NOHA 4GDOA 2RH0A 4K3AA 1N7SB 1JOCA 2O01N 1NH4A 2Q1KA 5CCGD 3B71A 3L71G 1S5LE 4PD4H 3TGUJ 1GU5A 5KLIB 1LWUB 3VMXA 5B5EE 2W83C 4A7PA 1D7MA 4EOTA 1GW4A 1HBWA 1N7LA 2JWAA 3IAOA 4GKGA 1NU1K 2JDIH 3L71D 4BRYB 3L4FA 2WVRA 4PV1D 3AE6C 1VF5B 3EQ2A 3GMAA 3CMEP 2JEEA 4H13D 2R44A 3FGAD 3S1KA 1KILE 2KYVA 1P84D 2LXBA 3L74J 1NKZB 3TK1A 5APVA 3L71E 3AE1C 1LNQA 2OYIA 1XTCC 2N1TB 5E79E 3PTZA 5BVZA 1JTHA 3CCEP 4WBAA 1X9VA 1G2CB 3CLQA 1KB9D 3ZDMA 1RF0C 5BU8B 2WSCJ 1P84E 1M8OB 3H1HD 2QVAA 1BCCJ 1NAYA 1RF1C 3D71A 1LT9C 2YMYA 4R4LA 2M5AB 3NTNA 3GHGA 2ZT9C 1RH5B 2Q9IA 2C9NY 2PRRA 2E5TA 3VMYA 1M1JB 4JYCA 1ZR2A 2I8DA 1S5LH 2NPSA 4YXDC 4LLHA 2QJYB 5B5EH 2PFXA 2HG5D 5AW0B 2E76C 1USDA 2IPPA 4IOIH 1OXZA 5CCGA 5APXA 2KNCB 2W6BA 5KJ7D 1SQBJ 2N9YB 2BASA 1EDLA 2CPSA 2ZXXA 2G3AA 2AXTE 5AVXB 1U7JA 3ITKA 4N78E 2YO2A 1N7SD 2HODA 5CCHD 3H6PA 1QL1A 2A06D 3G3ZA 3IFMA 2QJKC 4BWNA 2IFNA 1W2BO 1YQ3C 2OYIC 5CJ0A 5B66E 4Y28J 1FZEA 3D6YA 4OVNF 3LIDA 4DCKA 1J1EC 4DOJA 1BCCG 1RE3A 3A0BH 1YBKA 3CL3D 1VF5D 1CZQA 4D6TG 1RF1B 2WT7A 1NO4A 1SQQD 4OGQC 2WSEH 3PJSK 2IYPA 3KYQA 1CI6A 3CC4P 3L73D 2B87B 1RE4C 2Z5IA 4IL6X 4ASVA 3GHGC 1KN7A 1S4XA 5DJUB 2N1TD 2BEQD 2PP6A 2KS1B 1ZRTD 1N8RQ 2J59M 3PP5A 1RQVA 3A0HE 2Y9YA 3AEFC 4JBZA 3M9HA 1JCDA 2A45G 1SQVG 2NPSC 1M56D 1SQBG 5AW1B 3AE2C 3B4SA 1JB0J 1LTGC 1BCCE 5DJTB 1GZLA 3PLNA 4K35A 1PL5A 4AYCA 1VDFA 2Y9ZA 1NTKG 1SP4A 1K73Q 5CJ4A 3MIWA 5CCGC 4D6TE 3L36A 3MD0A 1OZHA 3CXHI 3HTKB 3CPWO 1SFCC 3OW2O 5KLVJ 4KJMA 2ITAA 3AEEC 4I6MC 4L74A 2AXTH 2B89A 1KFMA 3H1LG 1NTZD 3BATA 4AUWA 2FY8A 5KJ7A 2E43A 1RHZB 4I2LC 2XKMA 4PV1C 1H89A 3E1RA 4I1LA 2BCCG 3CCVP 4H13C 1PP9J 1LP1B 1SQVE 3H1JG 1SQPG 1URQB 1SQBE 5B66H 2CPBA 1N7SA 5CCHA 1S72P 1N73B 3FXEA 3T97B 2NRGA 3L75G 1VQ5P 1X22A 1NTKE 2IDBA 1RE3C 2BCCD 1KORA 1SQPD 1L4AC 1LWUA 2IZ0A 2QRXA 1PPJD 1NTMJ 2K1AA 3L75D 2FYZA 4BRYA 2GA1A 3OAKA 3H1LE 4H44D 1N86A 2OTJP 5AVZB 2K9JB 1EZVG 3CWBD 2R5BA 2UWJE 2BCCE 3HE5B 2QM7A 3H1JE 1SQPE 2WSCH 1R5LA 1EZVD 2KP8A 3L75E 3H1KJ 5KLVG 1N2DC 3V2RA 1KILB 1SFCB 2W8ZA 1GU4A 4IFMA 4HB1A 2N1TA 5AVUB 2QG4A 1KC8Q 3L72J 1QVFO 4PD4D 3KQGA 1JY2N 2ZFCA 1OVVA 1G2CA 1VQ9P 1NU1J 1QL2A 2Y0EA 2GM4A 5AW8B 4GODA 4RESB 1L0LD 2FXPA 1CW5A 2I1JA 3Q5PA 1SQXJ 2H43A 2LR2A 2OTKE 4EI2A 3TDKA 1EZVE 3M06A 2HLOA 1X0TA 4W7YA 5KJ7C 2JKVA 3B5NB 1VQPP 2M5AA 1M7LA 1JO5A 2B9BA 1JM0A 2A45H 1N7SC 5KLVE 3CC7P 1L4AB 1L0NK 5CCHC 3L37A 1MFTA 3BVHA 1BGYG 1Q7YQ 1M1JA 2YIUC 1AQ5A 5KLIC 1LWUC 3N4XA 1IFJA 1IFMA 1ZR4A 1ZN5A 1LGHB 3MGNA 1YJWP 2KNCA 3RK2D 2D2CC 2KB7P 2P10A 5AW4B 1VF5C 4B86A 4PJ0H 1BDDA 1URQD 4JYBA 3P8CE 3W68A 1HH0A 2L5GB 2WSFJ 4LGDE 1NU1G 2H7HA 1BGYE 5GTHE 3CD6P 3Q5SA 2N1TC 1NTMK 4YTPC 3G4SP 1RF0A 2M8RA 3KZIE 1YIJP 3QWOC 2WPVB 2FXMA 3L70G 1AVYA 3O6QB 1RF1A 4UB6E 3KPEA 3GG2A 4WVZA 1EDJA 2B87A 3CCSP 1PGQA 1J1DB 1A02J 3VN0A 3L72E 1NAFA 2V7QJ 3H1HJ 2PGDA 1NU1E 1KILD 4LC1A 1SFCD 2YIUB 3H25A 2KS1A 3CCMP 4ZNCA 2QM8A 1OVUA 5AW2B 2YMKA 2WPQA 1M1JC 1HGZA 1YTZT 2CK3H 1HWTC 2QJYC 1T8ZA 2P58A 2D2CB 3L70E 1SQXK 1JNMA 1L2PA 4O9BA 5APUA 4C7RA 4U3FG 3HTKA 1KMIZ 4NPFX 3EWKA 1HJ0A 1DEBA 3B5ND 1OIPA 2GUSA 3P8MC 2P2UA 2OARA 1L4AD 3AE8C 3AEDC 3OJAB 1BE3G 4ASWA 4H44C 5AVYB 5AW5B 5AVWB 3NXSA 2Q7CA 2C9LY 1KQLA 2ZVOB 2E75B 1VPCA 1PGJA 5GTHH 1LP1A 3A0BE 3JC22 3MHVA 1URQA 1FS0E 1YQ4C 1BE3D 1YITP 1N73A 3T97A 1VQLP 3KZIH 1SS1A 3TF5A 3MUDA 1EXJA 4U3FE 1NKNA 3HRNA 1KB9I 3PRJA 1RE4A 3S9OA 3TGUG 1K9MQ 3FWNA 4UB6H 1QGKB 1SQQJ 1BE3E 2FFDB 2K9JA 1G1IA 2YKOA 3TGUD 1FJPA 4N78D 3L73J 2K9YA 1A02F 3HE5A 1JCCA 1DH3A 3CI9A 1EC5A 2I1KA 3HE4B 4UB8H 3SFEC 1VQ6P 3LIEA 1BDCA 3KHUA 1KILA 1SFCA 2ZYDA 3L74G 3AE3C 3TGUE 1JY3N 4L75A 1FC2C 1VQ8P 1W5CE 1FDMA 4H44B 1HVVA 2IYOA 1AFOA 3KXDA 1S9KD 3CMAP 1JY2O 3RK2C 3VMAA 1ZW0A 4WY4B 3P32A 1R5SA 3B5NA 1NTZJ 3M9QA 1URQC 1Y8AA 2D2CD 1L4AA 1N73C 2WZ7A 3WU2E 1KQSO 3LW5H 3MUDC 2WPSA 4W7ZA 2WMMA 2YKQA 3L74E 1BSHA 2KI7B 1BCCD 1S9KE 3D6ZA 1SVFA 3KDPB 1JUNA 2XZRA 5AW9B 2WSFH 4D6TD 1K8AQ 1WMKA 3M91A 1UIIA 2E75D 4IFDK 3BRTB 2KLVA 1KFNA 4ZMDA 1JY2P 1L0NJ
chains in the Genus database with same CATH topology
5B66E 3JCUE 5GTHE 5KAIE 2AXTE 1S5LE 5TISE 5KAFE 5B5EE 3A0HE 4PJ0E 5E79E 3KZIE 1W5CE 4UB6E 5GTIE 4UB8E 4IL6E 5H2FE 3A0BE 3WU2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B66 E;  3JCU E;  5GTH E;  5KAI E;  2AXT E;  1S5L E;  5TIS E;  5KAF E;  5B5E E;  3A0H E;  4PJ0 E;  5E79 E;  3KZI E;  1W5C E;  4UB6 E;  5GTI E;  4UB8 E;  4IL6 E;  5H2F E;  3A0B E;  3WU2 E; 
#chains in the Genus database with same CATH topology
 3IF4 A;  3SSU A;  2R3S A;  3USS A;  5APY A;  1SQV D;  3A3Y B;  1SQB D;  5L8R J;  1KIL C;  2P67 A;  5GTI H;  3VYI A;  3RL0 B;  1H88 A;  1NTK D;  1OFC X;  1IFP A;  3U1A A;  4JF7 A;  3RK3 E;  1LT1 A;  2GUV A;  1LTT C;  2KLU A;  1SQQ K;  2FXO A;  1T3U A;  5AVR B;  3RK2 B;  3O6Q A;  1T2K D;  4OH8 B;  3E1I A;  2JR8 A;  1H8A A;  1OWA A;  1L0L J;  3M9B A;  3H1L D;  3TNU B;  1IK9 A;  1T3J A;  5KTB A;  3CXH E;  5AW6 B;  2OYH B;  2FYU J;  3B5N C;  1AJY A;  3FXD A;  2O3J A;  3CCR P;  1S3J A;  3BCC J;  1H0T B;  3H1J D;  3OA7 A;  3N7N A;  3V2Q A;  3WU2 H;  3A5T A;  5CHX A;  3HUS B;  2QSI A;  1MKM A;  1RY3 A;  2MKV A;  3WUT A;  1FOS F;  1VQM P;  4GOF A;  5AVS B;  3C9I A;  4DZO A;  5CMZ A;  4PJ0 E;  2R32 A;  2B88 A;  3V2N A;  3IN6 A;  4WY4 D;  1L0N G;  1KYO I;  1FOS E;  3WUU A;  1FAV A;  1S5L X;  2RN0 A;  4HYT B;  2XDJ A;  3H1I J;  5BU5 A;  1NTZ K;  1MUU A;  4HKZ H;  1OMI A;  3VOP A;  2HPC B;  3B8E B;  2K37 A;  2IBZ I;  4EIJ A;  2LKM A;  2QE7 H;  5KLV D;  2V4H A;  1Q2N A;  3V5B A;  1LJ2 A;  4HH2 A;  1IFI A;  2IX7 C;  5KAF E;  1LTJ B;  1YI2 P;  2WWW A;  1AA0 A;  1PP9 G;  4MN4 C;  2KK7 A;  2K88 A;  4PD4 I;  3SWF A;  1L0N E;  3JCU E;  1YYC A;  4U7J A;  4QMA A;  1KQF B;  1IO4 A;  3G71 P;  3RBZ A;  3RL0 g;  3HD7 B;  1FU1 A;  1NTM G;  1J1D C;  1VQO P;  2J58 A;  3CXH H;  2OTL P;  2FFD A;  4IL6 E;  2KUB A;  5TJH A;  2Y0C A;  4WB4 A;  1GL2 B;  3RL0 D;  1VL2 A;  1NTM D;  3P8C D;  1FZF A;  3CX5 I;  1BGY D;  4TLF A;  1VQN P;  3HE4 A;  1PP9 E;  1HUC A;  4Y99 B;  2AEJ A;  3H1I G;  2DW3 A;  2WSS H;  3L71 J;  2HYN A;  3H1K G;  1L0L K;  1QLE D;  1HTL C;  2ZVN B;  2KZJ A;  1ZLL A;  3VP8 A;  3AE5 C;  1NTM E;  3L72 G;  2FYU K;  5H2F E;  4IFF A;  3CCU P;  1YJ9 P;  3H32 B;  2O1J A;  5KAI E;  3AE9 C;  1FDI A;  2AEF A;  1JMB A;  1SQX G;  3L72 D;  4WY4 A;  1JY3 O;  2E75 C;  3A7O A;  3F89 A;  4EDF A;  1QVG O;  1NU1 D;  1KZU B;  3RK3 C;  2WPR A;  1IC2 A;  3NFQ A;  3C8V A;  5KAF H;  4KHX A;  1KYO H;  3H1I E;  2KXP B;  5TIS E;  3PHL A;  1LTA C;  1EDI A;  1FZC B;  3H1K E;  2JO1 A;  2AEM A;  2H89 C;  2HR3 A;  3L70 D;  4H0L B;  3JCU H;  2OQQ A;  5AVQ B;  4JPZ B;  1EQ7 A;  3I5C A;  1GMJ A;  1E5W A;  5K5G B;  4RKU J;  4WWI A;  2FFD C;  3C1L A;  1SQX E;  4KT0 J;  4IL6 H;  1T2K C;  1FZB A;  1NJI Q;  1J2J B;  2QJP B;  4UB8 E;  4C7N B;  2O01 J;  1BSN A;  2W90 A;  1FDO A;  1YHQ P;  2FKW B;  2QEX P;  2H88 C;  5CBO A;  2ZJS E;  1OW8 A;  1JY3 P;  1KQG B;  1ZP0 C;  4DJG A;  1JEK A;  2P1J A;  1M90 Q;  1ZME C;  1X79 B;  3JSV C;  2XND H;  5M1B A;  3HD7 D;  3VTP C;  4U3F D;  3EFF K;  1YTZ I;  5AVV B;  2JP3 A;  1OW6 A;  2H8P D;  2YKP A;  4EYY Q;  4YPC A;  5H2F H;  1LTI C;  1GL2 D;  1M57 D;  1Y47 A;  3CX5 H;  1P84 I;  5KAI H;  3TNU A;  1PGO A;  3RK3 B;  4L73 A;  4WY4 C;  2WTY A;  2OYH A;  2E74 C;  2W6A A;  5EFW B;  1EDK A;  3SWY A;  1H0T A;  2WIT A;  1OX3 A;  3H1H G;  1USE A;  1U57 A;  3Q2Y A;  3HUS A;  5TIS H;  1NVO A;  2L91 A;  2Q5U A;  3L35 A;  2FYN B;  1Q82 Q;  1ZV8 A;  5APW A;  4GIF A;  3GF3 A;  2W27 A;  2YXQ B;  1VQ4 P;  2YO3 A;  1HF9 A;  3UIA A;  4D6T J;  2P7J A;  1LTS C;  1Q81 Q;  1KB9 E;  1IK7 A;  2FBW C;  2Z5H A;  1VQ7 P;  3V4Q A;  5GTI E;  2HPC A;  1DIP A;  4OWF A;  1WT6 A;  3H1H E;  4H0L D;  3RL0 C;  2ZXE B;  2C0W A;  3VP9 A;  1LTJ A;  1SQV J;  2A06 G;  3L74 D;  2E42 A;  3F5H A;  3V6I A;  3O8Z A;  3R2P A;  1JMM A;  2KSE A;  1NTK J;  3AEC C;  1Q90 D;  1MV8 A;  5AW7 B;  2N9B A;  4HJG H;  2E74 B;  3Q5R A;  3W67 A;  2ZYA A;  2NZ2 A;  1GDT A;  1ZXG A;  3HD7 A;  2JWD A;  4N6J A;  2OYH C;  2KIK A;  1M1K Q;  1QX8 A;  4YXW H;  4I7Z C;  3H1L J;  1PFI A;  5E79 H;  5APS A;  4RJT A;  1GL2 A;  2M0B A;  2OYO A;  2RMZ A;  1SQQ G;  1S2E A;  1OW7 A;  3AE4 C;  3GW6 A;  2VRS A;  2BCC J;  3HUS C;  3L73 G;  5APQ A;  4L76 A;  1CSB A;  3H1J J;  1SQP J;  1E79 H;  2A06 E;  3WUV A;  3RBX A;  1NYH A;  1LT9 B;  5CBN A;  3K5B A;  1P84 H;  3L75 J;  2JJL A;  1Y9B A;  3TYY A;  2ZT9 B;  1QEX A;  3PH0 A;  4RO0 A;  1AV1 A;  1G1J A;  3RK3 D;  2XU6 A;  1NGM B;  3CWB J;  3G6E P;  4XFJ A;  3IR9 A;  4DT0 A;  2LXC B;  4M3L A;  2K3R A;  1MZ9 A;  3H32 A;  1KB9 H;  2AXC A;  3CCQ P;  2HFE D;  2QA4 P;  2E76 B;  3CXH D;  1T6A A;  1SQQ E;  3ABV C;  5KKZ C;  3U59 A;  2R5D A;  1PIX A;  2V7Q H;  3L73 E;  2Q3E A;  2A45 I;  1ZOY C;  1LTJ C;  1NTZ G;  1GK4 A;  1Z56 A;  3FX0 A;  3U1C A;  2KZI A;  3EFG A;  1IJD B;  1ZRT E;  3AEB C;  1FZC A;  4C46 A;  2KSJ A;  4JQ0 D;  2Z4E A;  2O01 H;  2QJK B;  4Z1M H;  1K05 A;  4XE5 B;  2OYI B;  3VMZ A;  1AQT A;  4I7Z B;  2M3E A;  3MTU E;  3HD7 C;  1JTH B;  1RQU A;  3Q3D A;  1J1E B;  2O1K A;  1FZA A;  2OGU A;  1PPJ G;  3II6 A;  3V4W A;  1GW3 A;  1NWQ A;  1GL2 C;  2YXR B;  4C7N A;  1HGV A;  1FE6 A;  1MFZ A;  1SLQ A;  1FBM A;  4OGQ B;  1SQV K;  4CPG A;  1SQB K;  1DX7 A;  1PGP A;  2XV5 A;  1NTZ E;  4ZKU A;  2RKL A;  3CWB G;  1NTK K;  4Y99 C;  1BGY J;  4R4M A;  2J5U A;  3QH9 A;  1KYO D;  2E74 D;  3GHG B;  2IBZ G;  1X8Y A;  1Q86 Q;  3A2A A;  3BRV B;  1L0N D;  2NPS B;  2IBZ D;  4W80 A;  5KKZ B;  1LTB C;  5AW3 B;  1PPJ E;  1EZV I;  4ZKP A;  3A0H H;  2Q3I A;  3V2P A;  2G8Y A;  1FJK A;  1KYO E;  1L0L G;  1SQP K;  1DEE G;  3R4Y A;  3FWL A;  5C39 A;  2R3C A;  2FYU G;  1S1C X;  2ZT9 D;  3CWB E;  2IFM A;  3E7K A;  3BAS A;  3M0A A;  3D70 A;  2HOD B;  3G9R A;  1FZC C;  2IBZ E;  3BCC G;  1PP9 D;  3M0D A;  3CCL P;  1YJN P;  1IFD A;  4GOE A;  1EXI A;  3AEG C;  4H0L C;  2FYU D;  4PV1 B;  2Y0D A;  2WQY C;  1K04 A;  1GD2 E;  4H13 B;  1R8E A;  3BCC D;  3I56 P;  2E76 D;  2IZ1 A;  3L70 J;  3NMD A;  4PD4 E;  1WRG A;  4GT1 A;  4XA4 A;  3TSI A;  3CX5 D;  2QJP C;  1PV3 A;  1NHL A;  1L0L E;  2C0X A;  1KTM A;  5AVT B;  1XTG B;  2M3B A;  1IFN A;  2WT7 B;  1VQK P;  1CI6 B;  2FYU E;  5KLV K;  1KD1 Q;  1PZQ A;  1GK6 A;  3SFD C;  4NPE A;  1DD4 A;  2MJZ A;  3BCC E;  3MZW B;  3CCJ P;  3H1I D;  2SPZ A;  3GF7 A;  4NPD A;  3H1K D;  3CX5 E;  1OVR A;  3LW5 J;  2E5Y A;  2XNX A;  2WSE J;  4U3F J;  2QIW A;  2BEZ F;  2PAJ A;  1KV4 A;  1HJB A;  4OGQ D;  1W2E A;  1AVO A;  2YNY A;  4BXL A;  2KOG A;  3WMM 0;  1DD3 A;  1SQX D;  1TU3 F;  4AQR D;  3AE7 C;  3Q1M A;  2ZYG A;  2ZAE B;  1FZG A;  3CC2 P;  1BE3 J;  2W6J H;  4N3Y B;  2POH A;  1UIX A;  5APT A;  1U7M A;  2Q6Q A;  3SWK A;  3I55 P;  3M0D C;  3GLM A;  3MP7 B;  3S4R A;  3P7K A;  1GTW A;  1IZN B;  4TT3 H;  3AEA C;  1LT9 A;  2FYN C;  3RGU A;  2NPS D;  1NOH A;  4GDO A;  2RH0 A;  4K3A A;  1N7S B;  1JOC A;  2O01 N;  1NH4 A;  2Q1K A;  5CCG D;  3B71 A;  3L71 G;  1S5L E;  4PD4 H;  3TGU J;  1GU5 A;  5KLI B;  1LWU B;  3VMX A;  5B5E E;  2W83 C;  4A7P A;  1D7M A;  4EOT A;  1GW4 A;  1HBW A;  1N7L A;  2JWA A;  3IAO A;  4GKG A;  1NU1 K;  2JDI H;  3L71 D;  4BRY B;  3L4F A;  2WVR A;  4PV1 D;  3AE6 C;  1VF5 B;  3EQ2 A;  3GMA A;  3CME P;  2JEE A;  4H13 D;  2R44 A;  3FGA D;  3S1K A;  1KIL E;  2KYV A;  1P84 D;  2LXB A;  3L74 J;  1NKZ B;  3TK1 A;  5APV A;  3L71 E;  3AE1 C;  1LNQ A;  2OYI A;  1XTC C;  2N1T B;  5E79 E;  3PTZ A;  5BVZ A;  1JTH A;  3CCE P;  4WBA A;  1X9V A;  1G2C B;  3CLQ A;  1KB9 D;  3ZDM A;  1RF0 C;  5BU8 B;  2WSC J;  1P84 E;  1M8O B;  3H1H D;  2QVA A;  1BCC J;  1NAY A;  1RF1 C;  3D71 A;  1LT9 C;  2YMY A;  4R4L A;  2M5A B;  3NTN A;  3GHG A;  2ZT9 C;  1RH5 B;  2Q9I A;  2C9N Y;  2PRR A;  2E5T A;  3VMY A;  1M1J B;  4JYC A;  1ZR2 A;  2I8D A;  1S5L H;  2NPS A;  4YXD C;  4LLH A;  2QJY B;  5B5E H;  2PFX A;  2HG5 D;  5AW0 B;  2E76 C;  1USD A;  2IPP A;  4IOI H;  1OXZ A;  5CCG A;  5APX A;  2KNC B;  2W6B A;  5KJ7 D;  1SQB J;  2N9Y B;  2BAS A;  1EDL A;  2CPS A;  2ZXX A;  2G3A A;  2AXT E;  5AVX B;  1U7J A;  3ITK A;  4N78 E;  2YO2 A;  1N7S D;  2HOD A;  5CCH D;  3H6P A;  1QL1 A;  2A06 D;  3G3Z A;  3IFM A;  2QJK C;  4BWN A;  2IFN A;  1W2B O;  1YQ3 C;  2OYI C;  5CJ0 A;  5B66 E;  4Y28 J;  1FZE A;  3D6Y A;  4OVN F;  3LID A;  4DCK A;  1J1E C;  4DOJ A;  1BCC G;  1RE3 A;  3A0B H;  1YBK A;  3CL3 D;  1VF5 D;  1CZQ A;  4D6T G;  1RF1 B;  2WT7 A;  1NO4 A;  1SQQ D;  4OGQ C;  2WSE H;  3PJS K;  2IYP A;  3KYQ A;  1CI6 A;  3CC4 P;  3L73 D;  2B87 B;  1RE4 C;  2Z5I A;  4IL6 X;  4ASV A;  3GHG C;  1KN7 A;  1S4X A;  5DJU B;  2N1T D;  2BEQ D;  2PP6 A;  2KS1 B;  1ZRT D;  1N8R Q;  2J59 M;  3PP5 A;  1RQV A;  3A0H E;  2Y9Y A;  3AEF C;  4JBZ A;  3M9H A;  1JCD A;  2A45 G;  1SQV G;  2NPS C;  1M56 D;  1SQB G;  5AW1 B;  3AE2 C;  3B4S A;  1JB0 J;  1LTG C;  1BCC E;  5DJT B;  1GZL A;  3PLN A;  4K35 A;  1PL5 A;  4AYC A;  1VDF A;  2Y9Z A;  1NTK G;  1SP4 A;  1K73 Q;  5CJ4 A;  3MIW A;  5CCG C;  4D6T E;  3L36 A;  3MD0 A;  1OZH A;  3CXH I;  3HTK B;  3CPW O;  1SFC C;  3OW2 O;  5KLV J;  4KJM A;  2ITA A;  3AEE C;  4I6M C;  4L74 A;  2AXT H;  2B89 A;  1KFM A;  3H1L G;  1NTZ D;  3BAT A;  4AUW A;  2FY8 A;  5KJ7 A;  2E43 A;  1RHZ B;  4I2L C;  2XKM A;  4PV1 C;  1H89 A;  3E1R A;  4I1L A;  2BCC G;  3CCV P;  4H13 C;  1PP9 J;  1LP1 B;  1SQV E;  3H1J G;  1SQP G;  1URQ B;  1SQB E;  5B66 H;  2CPB A;  1N7S A;  5CCH A;  1S72 P;  1N73 B;  3FXE A;  3T97 B;  2NRG A;  3L75 G;  1VQ5 P;  1X22 A;  1NTK E;  2IDB A;  1RE3 C;  2BCC D;  1KOR A;  1SQP D;  1L4A C;  1LWU A;  2IZ0 A;  2QRX A;  1PPJ D;  1NTM J;  2K1A A;  3L75 D;  2FYZ A;  4BRY A;  2GA1 A;  3OAK A;  3H1L E;  4H44 D;  1N86 A;  2OTJ P;  5AVZ B;  2K9J B;  1EZV G;  3CWB D;  2R5B A;  2UWJ E;  2BCC E;  3HE5 B;  2QM7 A;  3H1J E;  1SQP E;  2WSC H;  1R5L A;  1EZV D;  2KP8 A;  3L75 E;  3H1K J;  5KLV G;  1N2D C;  3V2R A;  1KIL B;  1SFC B;  2W8Z A;  1GU4 A;  4IFM A;  4HB1 A;  2N1T A;  5AVU B;  2QG4 A;  1KC8 Q;  3L72 J;  1QVF O;  4PD4 D;  3KQG A;  1JY2 N;  2ZFC A;  1OVV A;  1G2C A;  1VQ9 P;  1NU1 J;  1QL2 A;  2Y0E A;  2GM4 A;  5AW8 B;  4GOD A;  4RES B;  1L0L D;  2FXP A;  1CW5 A;  2I1J A;  3Q5P A;  1SQX J;  2H43 A;  2LR2 A;  2OTK E;  4EI2 A;  3TDK A;  1EZV E;  3M06 A;  2HLO A;  1X0T A;  4W7Y A;  5KJ7 C;  2JKV A;  3B5N B;  1VQP P;  2M5A A;  1M7L A;  1JO5 A;  2B9B A;  1JM0 A;  2A45 H;  1N7S C;  5KLV E;  3CC7 P;  1L4A B;  1L0N K;  5CCH C;  3L37 A;  1MFT A;  3BVH A;  1BGY G;  1Q7Y Q;  1M1J A;  2YIU C;  1AQ5 A;  5KLI C;  1LWU C;  3N4X A;  1IFJ A;  1IFM A;  1ZR4 A;  1ZN5 A;  1LGH B;  3MGN A;  1YJW P;  2KNC A;  3RK2 D;  2D2C C;  2KB7 P;  2P10 A;  5AW4 B;  1VF5 C;  4B86 A;  4PJ0 H;  1BDD A;  1URQ D;  4JYB A;  3P8C E;  3W68 A;  1HH0 A;  2L5G B;  2WSF J;  4LGD E;  1NU1 G;  2H7H A;  1BGY E;  5GTH E;  3CD6 P;  3Q5S A;  2N1T C;  1NTM K;  4YTP C;  3G4S P;  1RF0 A;  2M8R A;  3KZI E;  1YIJ P;  3QWO C;  2WPV B;  2FXM A;  3L70 G;  1AVY A;  3O6Q B;  1RF1 A;  4UB6 E;  3KPE A;  3GG2 A;  4WVZ A;  1EDJ A;  2B87 A;  3CCS P;  1PGQ A;  1J1D B;  1A02 J;  3VN0 A;  3L72 E;  1NAF A;  2V7Q J;  3H1H J;  2PGD A;  1NU1 E;  1KIL D;  4LC1 A;  1SFC D;  2YIU B;  3H25 A;  2KS1 A;  3CCM P;  4ZNC A;  2QM8 A;  1OVU A;  5AW2 B;  2YMK A;  2WPQ A;  1M1J C;  1HGZ A;  1YTZ T;  2CK3 H;  1HWT C;  2QJY C;  1T8Z A;  2P58 A;  2D2C B;  3L70 E;  1SQX K;  1JNM A;  1L2P A;  4O9B A;  5APU A;  4C7R A;  4U3F G;  3HTK A;  1KMI Z;  4NPF X;  3EWK A;  1HJ0 A;  1DEB A;  3B5N D;  1OIP A;  2GUS A;  3P8M C;  2P2U A;  2OAR A;  1L4A D;  3AE8 C;  3AED C;  3OJA B;  1BE3 G;  4ASW A;  4H44 C;  5AVY B;  5AW5 B;  5AVW B;  3NXS A;  2Q7C A;  2C9L Y;  1KQL A;  2ZVO B;  2E75 B;  1VPC A;  1PGJ A;  5GTH H;  1LP1 A;  3A0B E;  3JC2 2;  3MHV A;  1URQ A;  1FS0 E;  1YQ4 C;  1BE3 D;  1YIT P;  1N73 A;  3T97 A;  1VQL P;  3KZI H;  1SS1 A;  3TF5 A;  3MUD A;  1EXJ A;  4U3F E;  1NKN A;  3HRN A;  1KB9 I;  3PRJ A;  1RE4 A;  3S9O A;  3TGU G;  1K9M Q;  3FWN A;  4UB6 H;  1QGK B;  1SQQ J;  1BE3 E;  2FFD B;  2K9J A;  1G1I A;  2YKO A;  3TGU D;  1FJP A;  4N78 D;  3L73 J;  2K9Y A;  1A02 F;  3HE5 A;  1JCC A;  1DH3 A;  3CI9 A;  1EC5 A;  2I1K A;  3HE4 B;  4UB8 H;  3SFE C;  1VQ6 P;  3LIE A;  1BDC A;  3KHU A;  1KIL A;  1SFC A;  2ZYD A;  3L74 G;  3AE3 C;  3TGU E;  1JY3 N;  4L75 A;  1FC2 C;  1VQ8 P;  1W5C E;  1FDM A;  4H44 B;  1HVV A;  2IYO A;  1AFO A;  3KXD A;  1S9K D;  3CMA P;  1JY2 O;  3RK2 C;  3VMA A;  1ZW0 A;  4WY4 B;  3P32 A;  1R5S A;  3B5N A;  1NTZ J;  3M9Q A;  1URQ C;  1Y8A A;  2D2C D;  1L4A A;  1N73 C;  2WZ7 A;  3WU2 E;  1KQS O;  3LW5 H;  3MUD C;  2WPS A;  4W7Z A;  2WMM A;  2YKQ A;  3L74 E;  1BSH A;  2KI7 B;  1BCC D;  1S9K E;  3D6Z A;  1SVF A;  3KDP B;  1JUN A;  2XZR A;  5AW9 B;  2WSF H;  4D6T D;  1K8A Q;  1WMK A;  3M91 A;  1UII A;  2E75 D;  4IFD K;  3BRT B;  2KLV A;  1KFN A;  4ZMD A;  1JY2 P;  1L0N J; 
#chains in the Genus database with same CATH homology
 5B66 E;  3JCU E;  5GTH E;  5KAI E;  2AXT E;  1S5L E;  5TIS E;  5KAF E;  5B5E E;  3A0H E;  4PJ0 E;  5E79 E;  3KZI E;  1W5C E;  4UB6 E;  5GTI E;  4UB8 E;  4IL6 E;  5H2F E;  3A0B E;  3WU2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...