2AXTE

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
molecule tags Electron transport
total genus 19
structure length 82
sequence length 82
chains with identical sequence e
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 2axtE00
3A0BE 5B5EE 5B66E 2AXTE 4UB6E 4UB8E 5H2FE 4IL6E 3KZIE 5E79E 5GTIE 5KAFE 5TISE 5KAIE 1W5CE 3A0HE 4PJ0E 1S5LE 3WU2E 5GTHE 3JCUE
chains in the Genus database with same CATH superfamily
1A02F 2YXQB 4UB8H 1SQBG 3L72E 2C0WA 2QM7A 3PLNA 3WU2H 1GW3A 2Q6QA 2D2CC 2WVRA 5AW1B 2PAJA 3O6QB 5APYA 3FXEA 3A3YB 2FY8A 2E75D 2H88C 3KHUA 1URQA 2FBWC 4BXLA 3IR9A 1LTTC 4GDOA 3AE6C 5APXA 1BGYG 3MHVA 2KS1A 3L70D 1L4AD 2JP3A 1JCCA 3CCUP 1H0TA 1VQ6P 2KB7P 2H7HA 5AW9B 2QVAA 1JY2O 1NTZK 2E76C 3H1HG 3B4SA 3CCVP 1ZP0C 1KZUB 2Q3IA 2BCCD 1VQ8P 3H1JG 1L0LJ 2KSEA 1YQ4C 1RE4C 1PGJA 1AQ5A 4W7ZA 1HJBA 1JM0A 3OW2O 5AVVB 1SQPD 3GHGA 4EOTA 2YKPA 2K37A 1JY2P 2KK7A 4YXDC 4Y99C 3MUDC 4D6TE 3M0DA 1USEA 2POHA 2WSEH 3K5BA 1KTMA 1OFCX 1BE3G 2W27A 1NYHA 4TLFA 2RKLA 2ZT9B 2N1TA 5KTBA 1N86A 1M90Q 4H0LD 3RGUA 3GG2A 1IZNB 1M8OB 3LIDA 2OYIA 3NXSA 1H8AA 1SQVJ 1KB9D 1JTHA 3HE5B 4GKGA 4H44D 3V2NA 2C9NY 2WT7B 2Z4EA 4U3FE 4XA4A 3AE1C 3A2AA 3H1IJ 2KLUA 2FYUE 3V4WA 1NU1G 1ZRTE 3UIAA 2QJYC 1BCCE 2ZYAA 2ZVOB 1OX3A 5KJ7A 3BATA 1SQXG 3CCQP 1MFTA 1P84H 3VMXA 5KLVG 4EI2A 1GL2A 1JY3N 1GW4A 3U1CA 3F5HA 3RK2B 1N7SC 4ZNCA 2HODB 2C0XA 4XE5B 3L75J 3BCCJ 2B89A 1TU3F 1EZVD 1KQFB 3H1KG 2IZ1A 5AVZB 4JBZA 3H32A 1RF1C 3A7OA 3SWFA 4UB6E 2H8PD 1URQD 3CMEP 4ZKPA 2W90A 1T8ZA 1JMMA 3M9BA 2Q7CA 1S1CX 3L35A 1PPJG 4PD4I 2AEJA 1T6AA 5M1BA 5APQA 2YNYA 3RL0D 3HUSB 4KJMA 1L0LD 1NTZJ 5E79E 3TGUD 1J1DC 2YO3A 1FAVA 5AW2B 1BSHA 1Q7YQ 3Q3DA 4W80A 2BASA 3V4QA 1U7JA 2K9JA 3I56P 3GF3A 1NU1K 4PV1D 3KXDA 4DZOA 1KMIZ 3CX5I 2XDJA 1A02J 1SQXK 4EYYQ 1DD3A 1RHZB 1HTLC 1SQPK 1W2BO 2KS1B 3CXHE 1LWUA 2ZJSE 1H0TB 1EDIA 4C7NB 2JWDA 2KLVA 2KZJA 1LTGC 4R4LA 1USDA 1ZLLA 1SQBJ 1HJ0A 1IK7A 3A0BH 1SFCB 3ABVC 1FDMA 4BRYB 3V5BA 3VMAA 1SQVD 5AW7B 1N73A 3SWYA 1EZVI 1KFNA 1PP9G 3G4SP 3JC22 3IFMA 2W8ZA 3LW5H 1FZFA 2Y0CA 4HKZH 3EFFK 1NTKG 3O6QA 1H88A 1VQ7P 2V4HA 2GA1A 2N1TB 3H1LE 1VQ4P 1YITP 3LW5J 3U1AA 3P7KA 5KJ7D 4IOIH 3I5CA 3FWNA 1KILE 1RF0C 2NZ2A 3L71E 2FFDB 4K35A 1K73Q 3H1HJ 1VF5C 4AUWA 2NPSC 2L5GB 5APUA 2I1JA 1S9KE 1GL2D 1P84D 3H1JJ 2V7QH 3MZWB 3NTNA 2WSSH 3L75D 1X8YA 1LJ2A 2E5TA 2I8DA 5H2FE 2W6AA 1M1JC 1CSBA 5KAIE 1YI2P 2XKMA 1LTSC 3A5TA 3T97B 3OJAB 1LTAC 3D6ZA 2KIKA 1HGZA 2XNDH 1M56D 3L74E 2Z5HA 2W6JH 2O01H 2ZYDA 2JEEA 3AEFC 1ZMEC 1NTZD 1E79H 1CZQA 3ZDMA 4B86A 3L70J 3KZIE 5AVRB 4WY4B 3AEEC 1LTBC 2Q1KA 2XNXA 4DOJA 4WB4A 3FXDA 3AEGC 2FXPA 1NU1J 2IDBA 2E74D 1FS0E 1GK6A 1IK9A 1Q81Q 1SQXJ 3L36A 1EDJA 5GTIE 1ZXGA 1SQPJ 3HE5A 2HFED 1X79B 3VTPC 2E75C 5KLVJ 2R32A 3JCUE 2KSJA 2WT7A 1KILB 1SQBD 1NKZB 3V2PA 3CWBE 3KPEA 1GZLA 4PD4H 3L73G 3RK3C 3WUVA 2HPCA 3P8MC 2OYHB 1CI6A 1PIXA 1FDIA 3R4YA 2QJKB 1L4AC 5CBNA 3CC4P 2YKQA 4EIJA 1DX7A 1WMKA 5B66E 1L0NE 3HRNA 1MZ9A 5CJ0A 4H13B 2WMMA 1IFDA 5K5GB 2L91A 3CX5H 1J1EB 2JO1A 2WITA 1HBWA 2WWWA 3CCRP 1BGYD 1JOCA 4MN4C 2QSIA 1U57A 1SQQG 3N7NA 3H1HD 1VQMP 3MGNA 3RK3E 3CCMP 1IFPA 1KFMA 1Q2NA 3F89A 2K3RA 1KQLA 2KXPB 4I7ZC 4AYCA 1M1JB 3Q5SA 2KI7B 1IC2A 3HUSA 4H0LC 2BCCE 1PGPA 1GMJA 2FYZA 4OWFA 3L74G 1R5LA 1BE3D 4DJGA 2R3SA 4RJTA 1X22A 1KC8Q 2H89C 2WPQA 1SQPE 4H44C 1PL5A 1H89A 3VMZA 3FX0A 1NO4A 2ZYGA 1JB0J 1LTIC 1RE3C 1FC2C 1LTJC 4C7NA 3S4RA 1RH5B 3CCLP 3GW6A 1PP9J 2RN0A 2KUBA 2ZT9D 1M7LA 1IO4A 4WVZA 1NAFA 1NU1D 1SFCA 3TGUJ 2HG5D 2HLOA 4BRYA 3EQ2A 5AVQB 4WBAA 4IFDK 1NTKJ 1SQXD 1KB9E 1U7MA 5KAFH 1SP4A 1QVFO 2BEQD 4N78D 1MV8A 4AQRD 5KLVD 3VN0A 1QLED 3OA7A 2LXCB 3HD7B 3RK3B 2JDIH 4UB6H 2MJZA 2W83C 5DJUB 2KYVA 3WUTA 2WZ7A 1NTMG 2QJPC 4JPZB 1L0NG 1URQC 3G6EP 1NOHA 1SQBK 1JY2N 4PJ0H 2PRRA 4JYBA 2P7JA 1HUCA 2WSEJ 4OGQD 4PD4D 5KLIB 1KYOE 3H1KD 4IFMA 1N2DC 1OW8A 2B87B 2FFDA 2H43A 3RL0C 5AVSB 4YTPC 1IFIA 3RBXA 2IX7C 3G3ZA 4UB8E 3RK2D 3C8VA 4GODA 1R8EA 2WSCH 1FZGA 1JY3O 1QEXA 1S5LE 1PPJD 1VQNP 4OH8B 3CX5D 4PV1C 2MKVA 2HPCB 1HWTC 1ZR2A 1S2EA 3HE4B 3L37A 1CI6B 1RF1A 3L72G 1JEKA 3CXHH 3T97A 3TYYA 4DT0A 4KT0J 3M0DC 5APSA 2WQYC 1JY3P 5AVWB 1NVOA 1X9VA 4WWIA 4YXWH 1IFJA 2QIWA 3VP8A 2P67A 2HYNA 1VL2A 2D2CB 3EWKA 3AE9C 3WMM0 1E5WA 1L0LE 3CPWO 3WUUA 3AE8C 4NPFX 3TGUE 2J5UA 1JNMA 1ZV8A 3QH9A 4Y28J 2A45H 3M9HA 2Q5UA 4WY4A 4HH2A 1BDCA 5AW8B 1XTCC 2FKWB 1FE6A 2OYIC 3C9IA 1NTMK 3Q5PA 2AEMA 4IL6E 3MTUE 3L73J 2R44A 5TISE 3D6YA 2FYUD 3AE2C 2YIUC 2E76B 2KP8A 5KJ7C 1PP9D 4HB1A 2HR3A 3PJSK 2ZXXA 1KILA 3G71P 1EQ7A 2AXCA 4K3AA 4D6TG 1GL2C 2OYHA 1NTKD 3GMAA 1SQVE 1SFCD 1S5LX 3JSVC 3B5NC 4Y99B 3I55P 3H1IE 3E1IA 1SQQJ 2ITAA 2IYOA 3U59A 3IF4A 5KLVK 1AVYA 2WPSA 5AW0B 3W67A 1Q82Q 4N6JA 1NGMB 3NFQA 2ZAEB 4OVNF 1LT9C 1QVGO 2ZFCA 2N1TD 3QWOC 3A0HE 1Y9BA 5CBOA 4U3FG 1P84E 5B5EH 3KDPB 4LGDE 2P10A 2FYUG 2IFMA 3KZIH 2GUVA 3L75E 3BCCE 1BCCG 2IBZE 3GF7A 1OIPA 2CPSA 1M1JA 5BU8B 3BRVB 1X0TA 1YTZT 2QJYB 2FYNC 4L73A 2ZVNB 1BGYJ 5AW4B 4RKUJ 5AVXB 4XFJA 3PH0A 1FZCC 2ZXEB 5CMZA 1NAYA 1LWUC 1N7SB 1OVVA 2IFNA 2QEXP 4ZMDA 1NTZE 3AE5C 4JQ0D 1KQGB 4KHXA 2Q9IA 5CCHA 1YJNP 4NPEA 2PGDA 3CI9A 2V7QJ 2YO2A 3MIWA 3L4FA 4GT1A 5B66H 4N3YB 1RF1B 4ASVA 2O1KA 4WY4D 1KQSO 1VPCA 2YKOA 1N73C 4U7JA 3L73D 2P2UA 1BE3J 2P58A 3TDKA 1ZOYC 1NTMJ 1QL2A 1G2CA 1YHQP 1KORA 1AJYA 2C9LY 1SQBE 2FYUK 2W6BA 3HD7A 1N8RQ 1J1DB 1FJPA 1KILD 2XZRA 4W7YA 3H1IG 2O01J 2G3AA 3B5NB 2IPPA 1RY3A 5GTHE 4R4MA 3AECC 1NTKK 5CCGA 2B87A 1YJ9P 1T3JA 3PHLA 1SQQD 3VOPA 1W2EA 3L72J 3H25A 3H6PA 1SS1A 4H13D 3CXHI 2CPBA 3M0AA 1M57D 3BCCG 1OVUA 4I6MC 1IJDB 2A45G 3H1HE 1DIPA 2FXOA 4NPDA 3G9RA 1LGHB 3HE4A 3H1JE 1ZR4A 3L74D 3P8CD 3VP9A 2A06E 2QE7H 1DEBA 1MFZA 3MP7B 1GD2E 2G8YA 3H1KJ 3H1LG 3AEDC 1S4XA 2O01N 1SVFA 2ZT9C 3TK1A 2A45I 3L71G 2Y9YA 1PFIA 2Y9ZA 4L74A 4HYTB 3AE7C 3CCEP 2J58A 1FBMA 3TSIA 1NH4A 2E42A 1FZCB 1VF5B 2NPSB 3B8EB 5CHXA 3D71A 1BDDA 2E43A 3CD6P 3CMAP 2PFXA 1Z56A 5BU5A 1AV1A 4D6TJ 1YJWP 1L2PA 3L70E 1OWAA 3KQGA 5CCHD 2GM4A 1Y8AA 1KYOH 2OYOA 3SWKA 4OGQC 3E1RA 2CK3H 1WT6A 1WRGA 1HVVA 1EXIA 1NU1E 2VRSA 1LT1A 1RE4A 1NTMD 1SQXE 3VMYA 1L0ND 4EDFA 3RL0g 3RK2C 1NHLA 2KNCB 1S5LH 2AXTE 4N78E 1FOSF 2P1JA 5KLVE 2KOGA 3MUDA 2JKVA 1IFNA 2OTLP 4U3FJ 1LP1B 1R5SA 4O9BA 2FYUJ 1OW6A 1OVRA 3RBZA 3HD7D 3RK3D 1K05A 1BCCJ 2M3BA 2XU6A 3S1KA 1BSNA 1UIIA 4PD4E 3H1KE 5AVUB 4JF7A 1QGKB 2OGUA 1K9MQ 3II6A 3L72D 3CWBG 1HH0A 5CCGD 1G2CB 3HUSC 1T2KD 2E75B 2KZIA 1Y47A 1SQQK 1D7MA 3Q5RA 1OXZA 1PPJE 1JUNA 1DD4A 3CX5E 2A06G 2FXMA 2K1AA 2DW3A 4IL6H 4QMAA 4BWNA 5TISH 3TF5A 3W68A 3AEBC 1S72P 1S3JA 1L4AB 3O8ZA 1EC5A 3VYIA 1DEEG 4GIFA 3TNUB 5E79H 1N7SA 1PGOA 5KKZC 2N9YB 3M9QA 1KD1Q 2D2CD 4HJGH 4RESB 3WU2E 1SFCC 1EZVE 5L8RJ 1NWQA 3L70G 3GHGC 1JCDA 3CL3D 2WSCJ 2OARA 4D6TD 2BCCG 4I7ZB 4CPGA 2BEZF 2M3EA 1VQKP 2YMKA 3OAKA 4IFFA 4OGQB 1PP9E 4H0LB 1RQVA 4L75A 3HTKA 1SQPG 3A0HH 2SPZA 2N1TC 2JR8A 2B88A 2M5AB 2QG4A 3ITKA 2E76D 5AW5B 2WTYA 1VQ5P 1NTKE 1KYOD 2FFDC 1QX8A 4H44B 3FGAD 3N4XA 3B5NA 1Q86Q 3KYQA 2YMYA 1JO5A 2NRGA 1L0NK 2JWAA 5KAFE 2R3CA 3BASA 1AVOA 4U3FD 1LTJB 1ZRTD 1T3UA 1BCCD 2Y0DA 1G1IA 2UWJE 1LT9A 3H1LJ 1DH3A 1PV3A 1JMBA 4LC1A 1YBKA 4PJ0E 1AQTA 3L71J 5H2FH 2LKMA 3LIEA 5KAIH 1NKNA 3CCJP 1KB9I 3IN6A 2QA4P 3M91A 3V2RA 4WY4C 3AEAC 2QJPB 1ZW0A 5AVTB 1URQB 1M1KQ 3SSUA 2WSFH 1YQ3C 2RMZA 1RF0A 3PTZA 4M3LA 3RL0B 1FZCA 1W5CE 2NPSA 2WPVB 5KKZB 2QRXA 1EZVG 2WSFJ 1K8AQ 3L74J 4C46A 1KYOI 2LR2A 1N7SD 1KILC 5GTHH 2K9YA 2WPRA 3SFEC 1FU1A 4PV1B 2E5YA 2OYHC 2N9BA 1EDKA 4IL6X 1OMIA 3R2PA 3GHGB 3PRJA 3CC7P 1IFMA 2QJKC 5GTIH 3L73E 2E74C 4I2LC 1LNQA 1Q90D 1L0LG 3H1ID 3JCUH 5CJ4A 3TGUG 3P32A 4H13C 2KNCA 1KN7A 1FDOA 3CXHD 3GLMA 1FZEA 3AE4C 2B9BA 1J1EC 1FJKA 4ZKUA 1J2JB 4LLHA 2IZ0A 1VQ9P 5DJTB 3CWBJ 1LP1A 3USSA 2LXBA 2YXRB 2OYIB 3Q2YA 2O1JA 1JTHB 4GOEA 5AW6B 2PP6A 1GU5A 3BCCD 3B5ND 3FWLA 1SQQE 4L76A 2IBZD 3AE3C 1PZQA 1VDFA 1NJIQ 1K04A 1L0NJ 1UIXA 2XV5A 2YIUB 3BRTB 2OTJP 4ASWA 1YTZI 3IAOA 1SQVG 3HTKB 2QM8A 2Z5IA 1CW5A 3H1LD 1OW7A 1FZAA 2M0BA 5C39A 1GL2B 4C7RA 1FOSE 3L71D 5BVZA 3P8CE 3V6IA 4Z1MH 1S9KD 1L4AA 3A0BE 1GK4A 3CC2P 2IYPA 2K88A 3EFGA 4RO0A 5CCHC 5B5EE 1FZBA 4I1LA 2OTKE 1KV4A 3TNUA 3PP5A 4DCKA 2I1KA 1AA0A 2Y0EA 1VQLP 1L0LK 5TJHA 3H32B 2R5BA 2R5DA 1BGYE 2J59M 5AW3B 2BCCJ 3D70A 2AXTH 3C1LA 3S9OA 1EDLA 2Q3EA 2OQQA 5EFWB 1LT9B 3L75G 5APVA 2IBZG 1G1JA 1ZN5A 4YPCA 3CLQA 3MD0A 4A7PA 1VF5D 2NPSD 1GU4A 3CCSP 1VQPP 1OZHA 3HD7C 2AEFA 1P84I 5AVYB 1AFOA 1HF9A 2JJLA 1RQUA 5APWA 2FYNB 1MKMA 4GOFA 2K9JB 2IBZI 2M5AA 2GUSA 1KB9H 2E74B 1BE3E 2RH0A 1GTWA 1NTME 3M06A 5KLIC 4TT3H 1NTZG 5CCGC 1SQVK 1HGVA 1VQOP 3NMDA 1T2KC 3B71A 1XTGB 3Q1MA 3SFDC 1LWUB 1QL1A 1PGQA 2HODA 1YYCA 1RE3A 5APTA 3CWBD 1LTJA 3E7KA 1N7LA 2M8RA 3V2QA 3BVHA 2O3JA 3H1JD 1MUUA 1SLQA 1EXJA 1YIJP 1GDTA 4JYCA 1N73B 2A06D
chains in the Genus database with same CATH topology
3A0BE 5B5EE 5B66E 2AXTE 4UB6E 4UB8E 5H2FE 4IL6E 3KZIE 5E79E 5GTIE 5KAFE 5TISE 5KAIE 1W5CE 3A0HE 4PJ0E 1S5LE 3WU2E 5GTHE 3JCUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0B E;  5B5E E;  5B66 E;  2AXT E;  4UB6 E;  4UB8 E;  5H2F E;  4IL6 E;  3KZI E;  5E79 E;  5GTI E;  5KAF E;  5TIS E;  5KAI E;  1W5C E;  3A0H E;  4PJ0 E;  1S5L E;  3WU2 E;  5GTH E;  3JCU E; 
#chains in the Genus database with same CATH topology
 1A02 F;  2YXQ B;  4UB8 H;  1SQB G;  3L72 E;  2C0W A;  2QM7 A;  3PLN A;  3WU2 H;  1GW3 A;  2Q6Q A;  2D2C C;  2WVR A;  5AW1 B;  2PAJ A;  3O6Q B;  5APY A;  3FXE A;  3A3Y B;  2FY8 A;  2E75 D;  2H88 C;  3KHU A;  1URQ A;  2FBW C;  4BXL A;  3IR9 A;  1LTT C;  4GDO A;  3AE6 C;  5APX A;  1BGY G;  3MHV A;  2KS1 A;  3L70 D;  1L4A D;  2JP3 A;  1JCC A;  3CCU P;  1H0T A;  1VQ6 P;  2KB7 P;  2H7H A;  5AW9 B;  2QVA A;  1JY2 O;  1NTZ K;  2E76 C;  3H1H G;  3B4S A;  3CCV P;  1ZP0 C;  1KZU B;  2Q3I A;  2BCC D;  1VQ8 P;  3H1J G;  1L0L J;  2KSE A;  1YQ4 C;  1RE4 C;  1PGJ A;  1AQ5 A;  4W7Z A;  1HJB A;  1JM0 A;  3OW2 O;  5AVV B;  1SQP D;  3GHG A;  4EOT A;  2YKP A;  2K37 A;  1JY2 P;  2KK7 A;  4YXD C;  4Y99 C;  3MUD C;  4D6T E;  3M0D A;  1USE A;  2POH A;  2WSE H;  3K5B A;  1KTM A;  1OFC X;  1BE3 G;  2W27 A;  1NYH A;  4TLF A;  2RKL A;  2ZT9 B;  2N1T A;  5KTB A;  1N86 A;  1M90 Q;  4H0L D;  3RGU A;  3GG2 A;  1IZN B;  1M8O B;  3LID A;  2OYI A;  3NXS A;  1H8A A;  1SQV J;  1KB9 D;  1JTH A;  3HE5 B;  4GKG A;  4H44 D;  3V2N A;  2C9N Y;  2WT7 B;  2Z4E A;  4U3F E;  4XA4 A;  3AE1 C;  3A2A A;  3H1I J;  2KLU A;  2FYU E;  3V4W A;  1NU1 G;  1ZRT E;  3UIA A;  2QJY C;  1BCC E;  2ZYA A;  2ZVO B;  1OX3 A;  5KJ7 A;  3BAT A;  1SQX G;  3CCQ P;  1MFT A;  1P84 H;  3VMX A;  5KLV G;  4EI2 A;  1GL2 A;  1JY3 N;  1GW4 A;  3U1C A;  3F5H A;  3RK2 B;  1N7S C;  4ZNC A;  2HOD B;  2C0X A;  4XE5 B;  3L75 J;  3BCC J;  2B89 A;  1TU3 F;  1EZV D;  1KQF B;  3H1K G;  2IZ1 A;  5AVZ B;  4JBZ A;  3H32 A;  1RF1 C;  3A7O A;  3SWF A;  4UB6 E;  2H8P D;  1URQ D;  3CME P;  4ZKP A;  2W90 A;  1T8Z A;  1JMM A;  3M9B A;  2Q7C A;  1S1C X;  3L35 A;  1PPJ G;  4PD4 I;  2AEJ A;  1T6A A;  5M1B A;  5APQ A;  2YNY A;  3RL0 D;  3HUS B;  4KJM A;  1L0L D;  1NTZ J;  5E79 E;  3TGU D;  1J1D C;  2YO3 A;  1FAV A;  5AW2 B;  1BSH A;  1Q7Y Q;  3Q3D A;  4W80 A;  2BAS A;  3V4Q A;  1U7J A;  2K9J A;  3I56 P;  3GF3 A;  1NU1 K;  4PV1 D;  3KXD A;  4DZO A;  1KMI Z;  3CX5 I;  2XDJ A;  1A02 J;  1SQX K;  4EYY Q;  1DD3 A;  1RHZ B;  1HTL C;  1SQP K;  1W2B O;  2KS1 B;  3CXH E;  1LWU A;  2ZJS E;  1H0T B;  1EDI A;  4C7N B;  2JWD A;  2KLV A;  2KZJ A;  1LTG C;  4R4L A;  1USD A;  1ZLL A;  1SQB J;  1HJ0 A;  1IK7 A;  3A0B H;  1SFC B;  3ABV C;  1FDM A;  4BRY B;  3V5B A;  3VMA A;  1SQV D;  5AW7 B;  1N73 A;  3SWY A;  1EZV I;  1KFN A;  1PP9 G;  3G4S P;  3JC2 2;  3IFM A;  2W8Z A;  3LW5 H;  1FZF A;  2Y0C A;  4HKZ H;  3EFF K;  1NTK G;  3O6Q A;  1H88 A;  1VQ7 P;  2V4H A;  2GA1 A;  2N1T B;  3H1L E;  1VQ4 P;  1YIT P;  3LW5 J;  3U1A A;  3P7K A;  5KJ7 D;  4IOI H;  3I5C A;  3FWN A;  1KIL E;  1RF0 C;  2NZ2 A;  3L71 E;  2FFD B;  4K35 A;  1K73 Q;  3H1H J;  1VF5 C;  4AUW A;  2NPS C;  2L5G B;  5APU A;  2I1J A;  1S9K E;  1GL2 D;  1P84 D;  3H1J J;  2V7Q H;  3MZW B;  3NTN A;  2WSS H;  3L75 D;  1X8Y A;  1LJ2 A;  2E5T A;  2I8D A;  5H2F E;  2W6A A;  1M1J C;  1CSB A;  5KAI E;  1YI2 P;  2XKM A;  1LTS C;  3A5T A;  3T97 B;  3OJA B;  1LTA C;  3D6Z A;  2KIK A;  1HGZ A;  2XND H;  1M56 D;  3L74 E;  2Z5H A;  2W6J H;  2O01 H;  2ZYD A;  2JEE A;  3AEF C;  1ZME C;  1NTZ D;  1E79 H;  1CZQ A;  3ZDM A;  4B86 A;  3L70 J;  3KZI E;  5AVR B;  4WY4 B;  3AEE C;  1LTB C;  2Q1K A;  2XNX A;  4DOJ A;  4WB4 A;  3FXD A;  3AEG C;  2FXP A;  1NU1 J;  2IDB A;  2E74 D;  1FS0 E;  1GK6 A;  1IK9 A;  1Q81 Q;  1SQX J;  3L36 A;  1EDJ A;  5GTI E;  1ZXG A;  1SQP J;  3HE5 A;  2HFE D;  1X79 B;  3VTP C;  2E75 C;  5KLV J;  2R32 A;  3JCU E;  2KSJ A;  2WT7 A;  1KIL B;  1SQB D;  1NKZ B;  3V2P A;  3CWB E;  3KPE A;  1GZL A;  4PD4 H;  3L73 G;  3RK3 C;  3WUV A;  2HPC A;  3P8M C;  2OYH B;  1CI6 A;  1PIX A;  1FDI A;  3R4Y A;  2QJK B;  1L4A C;  5CBN A;  3CC4 P;  2YKQ A;  4EIJ A;  1DX7 A;  1WMK A;  5B66 E;  1L0N E;  3HRN A;  1MZ9 A;  5CJ0 A;  4H13 B;  2WMM A;  1IFD A;  5K5G B;  2L91 A;  3CX5 H;  1J1E B;  2JO1 A;  2WIT A;  1HBW A;  2WWW A;  3CCR P;  1BGY D;  1JOC A;  4MN4 C;  2QSI A;  1U57 A;  1SQQ G;  3N7N A;  3H1H D;  1VQM P;  3MGN A;  3RK3 E;  3CCM P;  1IFP A;  1KFM A;  1Q2N A;  3F89 A;  2K3R A;  1KQL A;  2KXP B;  4I7Z C;  4AYC A;  1M1J B;  3Q5S A;  2KI7 B;  1IC2 A;  3HUS A;  4H0L C;  2BCC E;  1PGP A;  1GMJ A;  2FYZ A;  4OWF A;  3L74 G;  1R5L A;  1BE3 D;  4DJG A;  2R3S A;  4RJT A;  1X22 A;  1KC8 Q;  2H89 C;  2WPQ A;  1SQP E;  4H44 C;  1PL5 A;  1H89 A;  3VMZ A;  3FX0 A;  1NO4 A;  2ZYG A;  1JB0 J;  1LTI C;  1RE3 C;  1FC2 C;  1LTJ C;  4C7N A;  3S4R A;  1RH5 B;  3CCL P;  3GW6 A;  1PP9 J;  2RN0 A;  2KUB A;  2ZT9 D;  1M7L A;  1IO4 A;  4WVZ A;  1NAF A;  1NU1 D;  1SFC A;  3TGU J;  2HG5 D;  2HLO A;  4BRY A;  3EQ2 A;  5AVQ B;  4WBA A;  4IFD K;  1NTK J;  1SQX D;  1KB9 E;  1U7M A;  5KAF H;  1SP4 A;  1QVF O;  2BEQ D;  4N78 D;  1MV8 A;  4AQR D;  5KLV D;  3VN0 A;  1QLE D;  3OA7 A;  2LXC B;  3HD7 B;  3RK3 B;  2JDI H;  4UB6 H;  2MJZ A;  2W83 C;  5DJU B;  2KYV A;  3WUT A;  2WZ7 A;  1NTM G;  2QJP C;  4JPZ B;  1L0N G;  1URQ C;  3G6E P;  1NOH A;  1SQB K;  1JY2 N;  4PJ0 H;  2PRR A;  4JYB A;  2P7J A;  1HUC A;  2WSE J;  4OGQ D;  4PD4 D;  5KLI B;  1KYO E;  3H1K D;  4IFM A;  1N2D C;  1OW8 A;  2B87 B;  2FFD A;  2H43 A;  3RL0 C;  5AVS B;  4YTP C;  1IFI A;  3RBX A;  2IX7 C;  3G3Z A;  4UB8 E;  3RK2 D;  3C8V A;  4GOD A;  1R8E A;  2WSC H;  1FZG A;  1JY3 O;  1QEX A;  1S5L E;  1PPJ D;  1VQN P;  4OH8 B;  3CX5 D;  4PV1 C;  2MKV A;  2HPC B;  1HWT C;  1ZR2 A;  1S2E A;  3HE4 B;  3L37 A;  1CI6 B;  1RF1 A;  3L72 G;  1JEK A;  3CXH H;  3T97 A;  3TYY A;  4DT0 A;  4KT0 J;  3M0D C;  5APS A;  2WQY C;  1JY3 P;  5AVW B;  1NVO A;  1X9V A;  4WWI A;  4YXW H;  1IFJ A;  2QIW A;  3VP8 A;  2P67 A;  2HYN A;  1VL2 A;  2D2C B;  3EWK A;  3AE9 C;  3WMM 0;  1E5W A;  1L0L E;  3CPW O;  3WUU A;  3AE8 C;  4NPF X;  3TGU E;  2J5U A;  1JNM A;  1ZV8 A;  3QH9 A;  4Y28 J;  2A45 H;  3M9H A;  2Q5U A;  4WY4 A;  4HH2 A;  1BDC A;  5AW8 B;  1XTC C;  2FKW B;  1FE6 A;  2OYI C;  3C9I A;  1NTM K;  3Q5P A;  2AEM A;  4IL6 E;  3MTU E;  3L73 J;  2R44 A;  5TIS E;  3D6Y A;  2FYU D;  3AE2 C;  2YIU C;  2E76 B;  2KP8 A;  5KJ7 C;  1PP9 D;  4HB1 A;  2HR3 A;  3PJS K;  2ZXX A;  1KIL A;  3G71 P;  1EQ7 A;  2AXC A;  4K3A A;  4D6T G;  1GL2 C;  2OYH A;  1NTK D;  3GMA A;  1SQV E;  1SFC D;  1S5L X;  3JSV C;  3B5N C;  4Y99 B;  3I55 P;  3H1I E;  3E1I A;  1SQQ J;  2ITA A;  2IYO A;  3U59 A;  3IF4 A;  5KLV K;  1AVY A;  2WPS A;  5AW0 B;  3W67 A;  1Q82 Q;  4N6J A;  1NGM B;  3NFQ A;  2ZAE B;  4OVN F;  1LT9 C;  1QVG O;  2ZFC A;  2N1T D;  3QWO C;  3A0H E;  1Y9B A;  5CBO A;  4U3F G;  1P84 E;  5B5E H;  3KDP B;  4LGD E;  2P10 A;  2FYU G;  2IFM A;  3KZI H;  2GUV A;  3L75 E;  3BCC E;  1BCC G;  2IBZ E;  3GF7 A;  1OIP A;  2CPS A;  1M1J A;  5BU8 B;  3BRV B;  1X0T A;  1YTZ T;  2QJY B;  2FYN C;  4L73 A;  2ZVN B;  1BGY J;  5AW4 B;  4RKU J;  5AVX B;  4XFJ A;  3PH0 A;  1FZC C;  2ZXE B;  5CMZ A;  1NAY A;  1LWU C;  1N7S B;  1OVV A;  2IFN A;  2QEX P;  4ZMD A;  1NTZ E;  3AE5 C;  4JQ0 D;  1KQG B;  4KHX A;  2Q9I A;  5CCH A;  1YJN P;  4NPE A;  2PGD A;  3CI9 A;  2V7Q J;  2YO2 A;  3MIW A;  3L4F A;  4GT1 A;  5B66 H;  4N3Y B;  1RF1 B;  4ASV A;  2O1K A;  4WY4 D;  1KQS O;  1VPC A;  2YKO A;  1N73 C;  4U7J A;  3L73 D;  2P2U A;  1BE3 J;  2P58 A;  3TDK A;  1ZOY C;  1NTM J;  1QL2 A;  1G2C A;  1YHQ P;  1KOR A;  1AJY A;  2C9L Y;  1SQB E;  2FYU K;  2W6B A;  3HD7 A;  1N8R Q;  1J1D B;  1FJP A;  1KIL D;  2XZR A;  4W7Y A;  3H1I G;  2O01 J;  2G3A A;  3B5N B;  2IPP A;  1RY3 A;  5GTH E;  4R4M A;  3AEC C;  1NTK K;  5CCG A;  2B87 A;  1YJ9 P;  1T3J A;  3PHL A;  1SQQ D;  3VOP A;  1W2E A;  3L72 J;  3H25 A;  3H6P A;  1SS1 A;  4H13 D;  3CXH I;  2CPB A;  3M0A A;  1M57 D;  3BCC G;  1OVU A;  4I6M C;  1IJD B;  2A45 G;  3H1H E;  1DIP A;  2FXO A;  4NPD A;  3G9R A;  1LGH B;  3HE4 A;  3H1J E;  1ZR4 A;  3L74 D;  3P8C D;  3VP9 A;  2A06 E;  2QE7 H;  1DEB A;  1MFZ A;  3MP7 B;  1GD2 E;  2G8Y A;  3H1K J;  3H1L G;  3AED C;  1S4X A;  2O01 N;  1SVF A;  2ZT9 C;  3TK1 A;  2A45 I;  3L71 G;  2Y9Y A;  1PFI A;  2Y9Z A;  4L74 A;  4HYT B;  3AE7 C;  3CCE P;  2J58 A;  1FBM A;  3TSI A;  1NH4 A;  2E42 A;  1FZC B;  1VF5 B;  2NPS B;  3B8E B;  5CHX A;  3D71 A;  1BDD A;  2E43 A;  3CD6 P;  3CMA P;  2PFX A;  1Z56 A;  5BU5 A;  1AV1 A;  4D6T J;  1YJW P;  1L2P A;  3L70 E;  1OWA A;  3KQG A;  5CCH D;  2GM4 A;  1Y8A A;  1KYO H;  2OYO A;  3SWK A;  4OGQ C;  3E1R A;  2CK3 H;  1WT6 A;  1WRG A;  1HVV A;  1EXI A;  1NU1 E;  2VRS A;  1LT1 A;  1RE4 A;  1NTM D;  1SQX E;  3VMY A;  1L0N D;  4EDF A;  3RL0 g;  3RK2 C;  1NHL A;  2KNC B;  1S5L H;  2AXT E;  4N78 E;  1FOS F;  2P1J A;  5KLV E;  2KOG A;  3MUD A;  2JKV A;  1IFN A;  2OTL P;  4U3F J;  1LP1 B;  1R5S A;  4O9B A;  2FYU J;  1OW6 A;  1OVR A;  3RBZ A;  3HD7 D;  3RK3 D;  1K05 A;  1BCC J;  2M3B A;  2XU6 A;  3S1K A;  1BSN A;  1UII A;  4PD4 E;  3H1K E;  5AVU B;  4JF7 A;  1QGK B;  2OGU A;  1K9M Q;  3II6 A;  3L72 D;  3CWB G;  1HH0 A;  5CCG D;  1G2C B;  3HUS C;  1T2K D;  2E75 B;  2KZI A;  1Y47 A;  1SQQ K;  1D7M A;  3Q5R A;  1OXZ A;  1PPJ E;  1JUN A;  1DD4 A;  3CX5 E;  2A06 G;  2FXM A;  2K1A A;  2DW3 A;  4IL6 H;  4QMA A;  4BWN A;  5TIS H;  3TF5 A;  3W68 A;  3AEB C;  1S72 P;  1S3J A;  1L4A B;  3O8Z A;  1EC5 A;  3VYI A;  1DEE G;  4GIF A;  3TNU B;  5E79 H;  1N7S A;  1PGO A;  5KKZ C;  2N9Y B;  3M9Q A;  1KD1 Q;  2D2C D;  4HJG H;  4RES B;  3WU2 E;  1SFC C;  1EZV E;  5L8R J;  1NWQ A;  3L70 G;  3GHG C;  1JCD A;  3CL3 D;  2WSC J;  2OAR A;  4D6T D;  2BCC G;  4I7Z B;  4CPG A;  2BEZ F;  2M3E A;  1VQK P;  2YMK A;  3OAK A;  4IFF A;  4OGQ B;  1PP9 E;  4H0L B;  1RQV A;  4L75 A;  3HTK A;  1SQP G;  3A0H H;  2SPZ A;  2N1T C;  2JR8 A;  2B88 A;  2M5A B;  2QG4 A;  3ITK A;  2E76 D;  5AW5 B;  2WTY A;  1VQ5 P;  1NTK E;  1KYO D;  2FFD C;  1QX8 A;  4H44 B;  3FGA D;  3N4X A;  3B5N A;  1Q86 Q;  3KYQ A;  2YMY A;  1JO5 A;  2NRG A;  1L0N K;  2JWA A;  5KAF E;  2R3C A;  3BAS A;  1AVO A;  4U3F D;  1LTJ B;  1ZRT D;  1T3U A;  1BCC D;  2Y0D A;  1G1I A;  2UWJ E;  1LT9 A;  3H1L J;  1DH3 A;  1PV3 A;  1JMB A;  4LC1 A;  1YBK A;  4PJ0 E;  1AQT A;  3L71 J;  5H2F H;  2LKM A;  3LIE A;  5KAI H;  1NKN A;  3CCJ P;  1KB9 I;  3IN6 A;  2QA4 P;  3M91 A;  3V2R A;  4WY4 C;  3AEA C;  2QJP B;  1ZW0 A;  5AVT B;  1URQ B;  1M1K Q;  3SSU A;  2WSF H;  1YQ3 C;  2RMZ A;  1RF0 A;  3PTZ A;  4M3L A;  3RL0 B;  1FZC A;  1W5C E;  2NPS A;  2WPV B;  5KKZ B;  2QRX A;  1EZV G;  2WSF J;  1K8A Q;  3L74 J;  4C46 A;  1KYO I;  2LR2 A;  1N7S D;  1KIL C;  5GTH H;  2K9Y A;  2WPR A;  3SFE C;  1FU1 A;  4PV1 B;  2E5Y A;  2OYH C;  2N9B A;  1EDK A;  4IL6 X;  1OMI A;  3R2P A;  3GHG B;  3PRJ A;  3CC7 P;  1IFM A;  2QJK C;  5GTI H;  3L73 E;  2E74 C;  4I2L C;  1LNQ A;  1Q90 D;  1L0L G;  3H1I D;  3JCU H;  5CJ4 A;  3TGU G;  3P32 A;  4H13 C;  2KNC A;  1KN7 A;  1FDO A;  3CXH D;  3GLM A;  1FZE A;  3AE4 C;  2B9B A;  1J1E C;  1FJK A;  4ZKU A;  1J2J B;  4LLH A;  2IZ0 A;  1VQ9 P;  5DJT B;  3CWB J;  1LP1 A;  3USS A;  2LXB A;  2YXR B;  2OYI B;  3Q2Y A;  2O1J A;  1JTH B;  4GOE A;  5AW6 B;  2PP6 A;  1GU5 A;  3BCC D;  3B5N D;  3FWL A;  1SQQ E;  4L76 A;  2IBZ D;  3AE3 C;  1PZQ A;  1VDF A;  1NJI Q;  1K04 A;  1L0N J;  1UIX A;  2XV5 A;  2YIU B;  3BRT B;  2OTJ P;  4ASW A;  1YTZ I;  3IAO A;  1SQV G;  3HTK B;  2QM8 A;  2Z5I A;  1CW5 A;  3H1L D;  1OW7 A;  1FZA A;  2M0B A;  5C39 A;  1GL2 B;  4C7R A;  1FOS E;  3L71 D;  5BVZ A;  3P8C E;  3V6I A;  4Z1M H;  1S9K D;  1L4A A;  3A0B E;  1GK4 A;  3CC2 P;  2IYP A;  2K88 A;  3EFG A;  4RO0 A;  5CCH C;  5B5E E;  1FZB A;  4I1L A;  2OTK E;  1KV4 A;  3TNU A;  3PP5 A;  4DCK A;  2I1K A;  1AA0 A;  2Y0E A;  1VQL P;  1L0L K;  5TJH A;  3H32 B;  2R5B A;  2R5D A;  1BGY E;  2J59 M;  5AW3 B;  2BCC J;  3D70 A;  2AXT H;  3C1L A;  3S9O A;  1EDL A;  2Q3E A;  2OQQ A;  5EFW B;  1LT9 B;  3L75 G;  5APV A;  2IBZ G;  1G1J A;  1ZN5 A;  4YPC A;  3CLQ A;  3MD0 A;  4A7P A;  1VF5 D;  2NPS D;  1GU4 A;  3CCS P;  1VQP P;  1OZH A;  3HD7 C;  2AEF A;  1P84 I;  5AVY B;  1AFO A;  1HF9 A;  2JJL A;  1RQU A;  5APW A;  2FYN B;  1MKM A;  4GOF A;  2K9J B;  2IBZ I;  2M5A A;  2GUS A;  1KB9 H;  2E74 B;  1BE3 E;  2RH0 A;  1GTW A;  1NTM E;  3M06 A;  5KLI C;  4TT3 H;  1NTZ G;  5CCG C;  1SQV K;  1HGV A;  1VQO P;  3NMD A;  1T2K C;  3B71 A;  1XTG B;  3Q1M A;  3SFD C;  1LWU B;  1QL1 A;  1PGQ A;  2HOD A;  1YYC A;  1RE3 A;  5APT A;  3CWB D;  1LTJ A;  3E7K A;  1N7L A;  2M8R A;  3V2Q A;  3BVH A;  2O3J A;  3H1J D;  1MUU A;  1SLQ A;  1EXJ A;  1YIJ P;  1GDT A;  4JYC A;  1N73 B;  2A06 D; 
#chains in the Genus database with same CATH homology
 3A0B E;  5B5E E;  5B66 E;  2AXT E;  4UB6 E;  4UB8 E;  5H2F E;  4IL6 E;  3KZI E;  5E79 E;  5GTI E;  5KAF E;  5TIS E;  5KAI E;  1W5C E;  3A0H E;  4PJ0 E;  1S5L E;  3WU2 E;  5GTH E;  3JCU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...