2AXTE

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
82
structure length
82
Chain Sequence
GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
total genus 19
structure length 82
sequence length 82
chains with identical sequence e
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 2axtE00
5GTHE 5GTIE 3A0HE 5B66E 3WU2E 4UB8E 4IL6E 5E79E 5B5EE 5TISE 3KZIE 5KAIE 3A0BE 4PJ0E 4UB6E 3JCUE 5KAFE 1W5CE 5H2FE 2AXTE 1S5LE
chains in the Genus database with same CATH superfamily
3GMAA 3G71P 2WWWA 4EIJA 2G8YA 4PD4H 2HPCB 2WSSH 1P84I 4IFFA 3H1LD 1GL2A 1USEA 5KKZB 2E76D 1RH5B 2I1JA 2I8DA 1L0NG 1LWUC 2FYUJ 3MD0A 5BU5A 5TISE 3HUSC 2GUSA 3G3ZA 3WUUA 2V7QJ 2W6AA 1KC8Q 2H43A 3H1JE 5CHXA 1RE3C 2KSEA 4HB1A 5KLVD 3Q5SA 1SQBJ 3EWKA 4YTPC 3TYYA 3GHGC 1L4AA 2B88A 2KOGA 1MZ9A 1BSHA 3H1IJ 2P10A 3CCUP 3NXSA 1LT9B 3V4QA 1YYCA 5CBOA 1L0LE 3CX5D 2K9JB 3JCUH 2FYNC 3CCQP 1T2KC 3L70G 5B66H 3CX5I 1FZCC 5KJ7C 1NGMB 1Y8AA 2IYPA 2KLUA 3K5BA 1IFJA 1IFIA 1TU3F 2R3SA 4R4MA 3RK3D 1VQMP 1N7SA 3VP8A 1IFDA 1PPJE 2A06D 1IZNB 2KP8A 1BGYG 2G3AA 5B5EE 2C0XA 2L91A 2QJYB 2QIWA 1BCCJ 3L75E 3PLNA 4IFMA 3CWBD 1KORA 1PL5A 2AXTH 4GT1A 3H32A 2BCCD 3H1KE 3TK1A 4ASWA 1SS1A 1KQLA 1CI6B 1NU1J 5CBNA 3A5TA 3KXDA 3D70A 1AQTA 4KJMA 1K73Q 1LNQA 1LT1A 1FJKA 2OARA 1VQPP 4WY4A 1FZCA 2FBWC 4H0LD 2GUVA 5KLVJ 1XTGB 1HJ0A 2W27A 1NKNA 5KAFE 3USSA 2B87A 1JTHB 1NOHA 4L75A 4XE5B 3T97B 1PP9G 1L0NE 2M5AA 1LTTC 1S9KD 4N78D 2OTLP 4PD4E 1NTKD 1EXIA 2ZXEB 4ZKUA 3R2PA 4BWNA 3L73G 2R5DA 3KQGA 3V2NA 2FXMA 3HUSA 2KLVA 1SQPD 2NPSB 3GF7A 1S4XA 1FC2C 1HWTC 1KMIZ 1NWQA 3M0AA 1OIPA 2C9NY 3N7NA 1M90Q 3E7KA 2AXCA 2M5AB 2JEEA 1J2JB 2N9BA 3RK2C 3VP9A 1BSNA 3P7KA 3VMXA 4YPCA 3CWBG 3V4WA 1PP9E 1GW4A 4H44C 5EFWB 2J58A 5APVA 4K35A 3V2PA 3Q5RA 2GM4A 3CCJP 2XDJA 2LXCB 4RKUJ 2QM7A 2WT7B 4BRYB 1NU1D 1LTJC 1SVFA 3AE7C 3L72D 3SFDC 3I55P 5CCGD 3CMAP 1MFTA 1VQOP 1AQ5A 2XNDH 1NKZB 2QJYC 1DD4A 1RE3A 1L0LK 4LC1A 2W83C 1FZBA 3L71G 1KFMA 5APQA 3WUTA 4H0LB 2QG4A 1NTMG 1EDJA 1RE4C 3B5NC 1KYOE 2FKWB 1EZVE 1NTKJ 1FBMA 1SQVD 2ZFCA 4IL6H 1AA0A 4O9BA 3RBXA 2FFDB 1VQ9P 1LWUA 1SQPG 1FOSF 2FXPA 1FZEA 3M0DA 3A2AA 3H1KD 2YKQA 2E76B 3B5ND 3ITKA 4UB8H 3BCCG 5M1BA 1GL2C 3CCLP 4U3FJ 5AVSB 2GA1A 2CPSA 4DT0A 2Q6QA 1GW3A 1ZV8A 3IR9A 1OVRA 2YXQB 3AEFC 2FYUG 1OZHA 2M0BA 1SQXK 1JY3O 1URQC 1L0NJ 2E74B 3L71E 1S3JA 1WRGA 1OWAA 2D2CC 2N1TB 1WT6A 3H1HD 1S9KE 3F5HA 2YMYA 1MFZA 2FFDA 1RF0C 2E74D 2OQQA 1FZGA 2J5UA 2N1TD 3AE8C 3H1HG 1N7SD 4H13C 3M91A 3P8MC 1Q90D 3CCMP 2D2CB 4QMAA 1BDCA 4R4LA 5H2FE 3M9HA 3L72J 5TISH 1N73C 2WTYA 3II6A 5APYA 1M1KQ 1NAYA 3GHGB 2C0WA 1VQLP 1CI6A 4Y99C 3BCCJ 3ZDMA 2Y0DA 5AVZB 2E75C 1MV8A 4PJ0H 1GU4A 2JO1A 2NRGA 1SQQE 3P8CD 2WT7A 2V7QH 1AJYA 1H88A 5APWA 3C8VA 1SQXJ 1NTMJ 2JR8A 1SFCB 4U3FG 1IJDB 3H1KJ 1IK9A 5DJTB 3CMEP 4YXDC 3L72E 3AEGC 2Q5UA 2IBZI 1M57D 4U3FD 3S9OA 1HJBA 5AVQB 4ZKPA 3TSIA 5L8RJ 1NTMK 1D7MA 2KZJA 4RESB 5AW2B 4D6TJ 3D6YA 1KILC 2Q9IA 1PP9D 2RH0A 1P84D 3OJAB 1LTBC 3H1JD 4OH8B 1M1JA 2JWAA 1L4AD 2LKMA 2QM8A 2R32A 2WSCH 1SP4A 3RGUA 3RK3E 1M7LA 5KAFH 5KLVE 1KB9I 2QJPB 5AVTB 5GTIH 3U1CA 1H89A 3FXDA 4H13D 2IZ0A 2L5GB 3NTNA 3H6PA 2N1TC 3HE4B 1SQQK 2JDIH 1YQ4C 2C9LY 1LTIC 3I56P 3B8EB 3QWOC 3BCCD 1GTWA 3CD6P 1JOCA 2B87B 2OGUA 1KYOD 1RF0A 3IN6A 5KJ7D 1YTZT 2H88C 3P32A 2P67A 4EYYQ 2FYZA 4OGQD 2WMMA 1KZUB 1ZR2A 3KHUA 5KAIE 3G4SP 1T2KD 3GF3A 1QVGO 4ZNCA 1LTJA 3BCCE 2OYIC 2BASA 3CXHD 1NH4A 1ZW0A 1NTMD 2KXPB 1MKMA 1BE3J 3BASA 1HH0A 3FWNA 4UB6E 4GKGA 3RL0D 3VOPA 1BE3G 3L70E 1SQBK 3E1RA 2K9YA 2KS1B 3JCUE 3NFQA 1LGHB 1QL1A 2KZIA 4B86A 4D6TD 3E1IA 5AW9B 1CSBA 1NYHA 1PP9J 4Y28J 4JYCA 1LJ2A 1EXJA 1Z56A 3A0HE 1FDIA 3U59A 1BCCG 1RHZB 2YKPA 4XA4A 2H89C 3LIDA 4I1LA 2DW3A 3M9BA 5E79H 4NPFX 4AQRD 2O01H 3AEAC 1FZCB 2HLOA 2PGDA 2E42A 2CK3H 3EFFK 1EQ7A 2W90A 2W8ZA 1YJ9P 2IBZG 1BGYD 3RK2D 3B5NB 5CJ4A 1S1CX 1VQ5P 1IFPA 2WSFJ 3VMYA 1OFCX 1YIJP 3HD7B 1OW6A 1AV1A 4WY4C 2FY8A 2NZ2A 5AVXB 3A0BE 5KKZC 1LTAC 3AEDC 3RL0C 4H13B 1T3UA 1CW5A 1FDMA 4WWIA 2LR2A 1M56D 1SQBD 1FE6A 1SQVG 1UIIA 1UIXA 3B71A 5C39A 1HBWA 3U1AA 1NTZK 1N7LA 3AE5C 1BE3D 4I7ZB 3AECC 1VQ4P 2OYOA 4L74A 1HF9A 1QEXA 2AXTE 1KN7A 1X22A 1S5LX 1OW8A 2QRXA 1EZVI 1EDKA 3CX5H 5GTHE 5AW4B 2QEXP 3A3YB 3H1IG 3V2QA 3L74J 2M8RA 2JKVA 1JY2O 2N1TA 4N3YB 3G9RA 1SQBG 4AUWA 1H0TB 1FZAA 1KB9E 2H8PD 3C9IA 3AE1C 2XV5A 4GIFA 4JQ0D 2JWDA 1LT9A 1N86A 2KYVA 2PFXA 1JTHA 2A06G 3L71D 3CCRP 1E5WA 1HVVA 1YJWP 5AW0B 1NHLA 1LTGC 1NO4A 4EI2A 1BCCD 2Z5IA 2OYIA 3M0DC 2I1KA 2BEZF 5AVWB 1KILB 1L4AC 3IF4A 3RL0g 4EOTA 1ZN5A 3CWBE 1Y9BA 1KILD 4PD4D 1BCCE 4GOFA 2FXOA 2YXRB 2HG5D 1YHQP 3GW6A 3CI9A 3GLMA 2YMKA 3MUDA 1SQQJ 2FYUK 2W6BA 1VF5B 2SPZA 2B9BA 1ZRTE 3P8CE 3WUVA 1PFIA 3HTKB 1N8RQ 2Q3EA 2ZAEB 1KV4A 3KPEA 1PZQA 3V2RA 1JO5A 3PHLA 1SQPJ 4TLFA 2IFNA 2K37A 1M1JB 3AE2C 1S72P 5K5GB 1SQVK 2QVAA 1E79H 4KHXA 3EFGA 3H1IE 1QL2A 3KZIE 1J1EC 4NPDA 2O01J 3L71J 1HGZA 4PV1D 2P1JA 1KQGB 3GG2A 3CC4P 1VQ8P 1AVOA 2NPSA 3SSUA 3TGUJ 1URQB 2E74C 3O6QA 4OVNF 2HODA 5KJ7A 3TGUG 5KTBA 1FJPA 1LTSC 4U3FE 1URQD 2K1AA 2YO2A 3L70J 2FYUE 1PGJA 2YIUB 5CCGA 2WQYC 3MGNA 3H32B 3SWFA 1Q2NA 1QLED 2KK7A 4ZMDA 4EDFA 3HD7A 2BEQD 4LGDE 3OW2O 1SFCC 1PPJG 1SQPK 1P84H 2A45G 2RKLA 3PH0A 1DEEG 1DD3A 2AEJA 2YIUC 2MKVA 1RE4A 1KFNA 3AE6C 3L36A 1PGPA 4BRYA 5B5EH 3TF5A 1FAVA 1HUCA 5E79E 1VQ7P 1R5SA 1JY2N 1R8EA 1A02J 1U7MA 4IOIH 3H1KG 1JMBA 2Z4EA 1SQXG 4OGQC 2IFMA 2Y9ZA 4L76A 3C1LA 3PRJA 1PPJD 2A06E 2P7JA 2QJPC 1SQQG 1ZR4A 3TGUE 5CCGC 1L0ND 1GK6A 1CZQA 5KLVG 4I7ZC 1H0TA 1NTKE 3H1HJ 2Z5HA 3FGAD 2V4HA 1ZRTD 1JMMA 1FZFA 2ZJSE 3TGUD 1FU1A 2WSCJ 2NPSC 3V5BA 3MUDC 1PIXA 1NU1K 1KYOH 1MUUA 3L70D 1L0LG 2LXBA 2WSFH 3AEBC 3QH9A 5CCHA 5GTHH 2IX7C 1NTZJ 2OTKE 2E43A 4C7RA 4I2LC 2A45H 2M3EA 1SQXE 2WSEJ 1YQ3C 2XNXA 4IL6X 2KI7B 1DEBA 3SWKA 3CPWO 1J1DC 1GZLA 4NPEA 2WPRA 1VQNP 1S5LH 1JY3N 5CMZA 1OW7A 1FS0E 4JBZA 1K8AQ 1L2PA 1SQXD 2WSEH 1NU1E 2AEFA 3LW5J 1RF1B 4DZOA 1EDLA 1JCDA 1W2EA 2CPBA 2E75B 2O1KA 5APXA 1H8AA 1GDTA 4H0LC 1T8ZA 2KUBA 3H1ID 2OYHC 2E75D 4HJGH 3ABVC 1KB9H 2R3CA 3H25A 1IFNA 3CXHI 4W7YA 4C46A 1YBKA 1EZVD 1VDFA 3CCVP 1VQ6P 5CCHC 1VQKP 4LLHA 1SQBE 5KAIH 3CCSP 1LTJB 1P84E 1N7SC 2Q1KA 4HYTB 1USDA 1VF5D 1OX3A 1A02F 2K88A 2AEMA 3FXEA 3BATA 4UB6H 2ZYAA 3HD7C 4WY4B 1YTZI 4UB8E 2QJKB 2D2CD 4IL6E 2ZYDA 4RO0A 5APTA 3V6IA 2RN0A 1J1EB 1NTZD 1VF5C 2E5TA 3CWBJ 1Q81Q 3SFEC 1QVFO 2M3BA 1SQVE 4JF7A 2ZYGA 1KILE 2BCCJ 3UIAA 2Y0EA 2WVRA 3JC22 4MN4C 1GL2D 1U7JA 2PAJA 3GHGA 1KQFB 1GU5A 1RQVA 5TJHA 1JM0A 3KDPB 1GL2B 2B89A 5AW3B 2PP6A 1S2EA 3HE4A 3R4YA 2KB7P 1QGKB 3L73J 2ZVOB 1AVYA 3G6EP 3BRTB 3WMM0 3W68A 3CLQA 1VPCA 1ZXGA 5AW5B 4C7NB 1IFMA 3EQ2A 3F89A 4AYCA 2OYIB 1SLQA 2WPQA 3O8ZA 2YKOA 1W2BO 1Q7YQ 1XTCC 3LW5H 5B66E 2QE7H 1LT9C 4N78E 4CPGA 1K9MQ 2O01N 1L4AB 4HH2A 3Q3DA 1Q82Q 3FX0A 1AFOA 2YO3A 1JCCA 4H44D 2E5YA 1OMIA 3I5CA 3T97A 2K9JA 1GD2E 2BCCG 2XU6A 4GODA 5AVYB 1ZMEC 2HR3A 3HE5B 1JY3P 3H1LG 1BGYJ 2IPPA 2NPSD 4K3AA 5AW6B 3W67A 5KLIB 1BE3E 2K3RA 1L0LD 1Y47A 3TNUA 2Q7CA 3PJSK 5APSA 1X9VA 1BGYE 1PGQA 2XKMA 1NTKK 3A0BH 3IAOA 1RQUA 2WPVB 3L73E 3L74G 4JYBA 2HYNA 4OWFA 5AVRB 2QJKC 3M9QA 3MZWB 1NAFA 1WMKA 4U7JA 2Q3IA 4D6TG 4RJTA 1JY2P 1U57A 2QSIA 1EC5A 1OVUA 2ZXXA 2WPSA 3JSVC 3L73D 3HE5A 1KB9D 1M1JC 2PRRA 5H2FH 1EDIA 5GTIE 5APUA 1KILA 1SQVJ 4KT0J 2P58A 3CX5E 2MJZA 3L74D 4DCKA 1G2CB 2O1JA 3A7OA 3FWLA 4PD4I 1FOSE 3CXHH 2ZVNB 1RF1C 2KS1A 3IFMA 1SFCD 3CXHE 2IBZD 1PV3A 1DX7A 3MHVA 4C7NA 2YNYA 4YXWH 1JNMA 3CC2P 5CJ0A 2ZT9C 2UWJE 2IDBA 3HTKA 5AVUB 2FYNB 3AE3C 2Y9YA 3HUSB 3VTPC 4D6TE 5BVZA 3OAKA 4W7ZA 3HD7D 4IFDK 1J1DB 3AEEC 5AVVB 3RBZA 4DJGA 3RK3C 1Q86Q 1EZVG 2BCCE 2KNCB 3AE4C 1L0LJ 4Z1MH 3BVHA 1JUNA 1IC2A 1N73A 1NTME 2RMZA 3H1LE 2VRSA 4PV1C 4DOJA 4L73A 1OVVA 1R5LA 2POHA 3L75J 3B5NA 1S5LE 1SQQD 4H44B 5CCHD 3RK3B 1T6AA 1KYOI 3OA7A 4OGQB 1T3JA 4HKZH 3SWYA 3TNUB 2IYOA 3VMAA 3A0HH 2OTJP 1RY3A 4PV1B 5AW1B 1KD1Q 1URQA 3O6QB 5BU8B 4WVZA 1NTKG 2OYHA 3RL0B 1SQPE 1LP1B 1X79B 3MP7B 1PGOA 1JEKA 4BXLA 1KTMA 3M06A 2ITAA 2HPCA 1IO4A 1N2DC 3Q1MA 3B4SA 1ZOYC 3MTUE 3D6ZA 2O3JA 2IZ1A 3AE9C 1GK4A 3L37A 1HGVA 3S1KA 1JB0J 1G2CA 2E76C 2HFED 2XZRA 4PJ0E 1LWUB 1IK7A 3H1JG 3H1JJ 3PTZA 4I6MC 4JPZB 1KQSO 4XFJA 1DH3A 3D71A 5AW8B 4WB4A 2H7HA 4GOEA 2KIKA 3L4FA 1L0NK 2J59M 3LIEA 4GDOA 2ZT9D 3L74E 4TT3H 3H1LJ 3Q2YA 1GMJA 3KYQA 1K05A 1NVOA 2JP3A 1X0TA 1RF1A 4N6JA 2ZT9B 1NTZE 1FDOA 3RK2B 3L75D 4W80A 4WBAA 2FYUD 2Y0CA 3WU2E 3TDKA 1YI2P 1QX8A 1VL2A 2W6JH 2HODB 2KNCA 3PP5A 3WU2H 3CC7P 3HRNA 1DIPA 2R44A 1X8YA 1N73B 5AW7B 3H1HE 2A45I 3L35A 2JJLA 5KLIC 1K04A 3CCEP 1G1IA 4Y99B 1M8OB 4ASVA 1OXZA 3L75G 3N4XA 1BDDA 1ZLLA 5KLVK 1YITP 1G1JA 2IBZE 3MIWA 3NMDA 3BRVB 2P2UA 2WITA 4M3LA 2KSJA 1NJIQ 4A7PA 1N7SB 1NTZG 3Q5PA 5DJUB 3CL3D 3S4RA 2R5BA 3VYIA 1HTLC 1ZP0C 1YJNP 2FFDC 4WY4D 1W5CE 2WZ7A 2OYHB 1NU1G 3VMZA 3L72G 3VN0A 2QA4P 1LP1A 3KZIH 2N9YB 1SFCA
chains in the Genus database with same CATH topology
5GTHE 5GTIE 3A0HE 5B66E 3WU2E 4UB8E 4IL6E 5E79E 5B5EE 5TISE 3KZIE 5KAIE 3A0BE 4PJ0E 4UB6E 3JCUE 5KAFE 1W5CE 5H2FE 2AXTE 1S5LE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTH E;  5GTI E;  3A0H E;  5B66 E;  3WU2 E;  4UB8 E;  4IL6 E;  5E79 E;  5B5E E;  5TIS E;  3KZI E;  5KAI E;  3A0B E;  4PJ0 E;  4UB6 E;  3JCU E;  5KAF E;  1W5C E;  5H2F E;  2AXT E;  1S5L E; 
#chains in the Genus database with same CATH topology
 3GMA A;  3G71 P;  2WWW A;  4EIJ A;  2G8Y A;  4PD4 H;  2HPC B;  2WSS H;  1P84 I;  4IFF A;  3H1L D;  1GL2 A;  1USE A;  5KKZ B;  2E76 D;  1RH5 B;  2I1J A;  2I8D A;  1L0N G;  1LWU C;  2FYU J;  3MD0 A;  5BU5 A;  5TIS E;  3HUS C;  2GUS A;  3G3Z A;  3WUU A;  2V7Q J;  2W6A A;  1KC8 Q;  2H43 A;  3H1J E;  5CHX A;  1RE3 C;  2KSE A;  4HB1 A;  5KLV D;  3Q5S A;  1SQB J;  3EWK A;  4YTP C;  3TYY A;  3GHG C;  1L4A A;  2B88 A;  2KOG A;  1MZ9 A;  1BSH A;  3H1I J;  2P10 A;  3CCU P;  3NXS A;  1LT9 B;  3V4Q A;  1YYC A;  5CBO A;  1L0L E;  3CX5 D;  2K9J B;  3JCU H;  2FYN C;  3CCQ P;  1T2K C;  3L70 G;  5B66 H;  3CX5 I;  1FZC C;  5KJ7 C;  1NGM B;  1Y8A A;  2IYP A;  2KLU A;  3K5B A;  1IFJ A;  1IFI A;  1TU3 F;  2R3S A;  4R4M A;  3RK3 D;  1VQM P;  1N7S A;  3VP8 A;  1IFD A;  1PPJ E;  2A06 D;  1IZN B;  2KP8 A;  1BGY G;  2G3A A;  5B5E E;  2C0X A;  2L91 A;  2QJY B;  2QIW A;  1BCC J;  3L75 E;  3PLN A;  4IFM A;  3CWB D;  1KOR A;  1PL5 A;  2AXT H;  4GT1 A;  3H32 A;  2BCC D;  3H1K E;  3TK1 A;  4ASW A;  1SS1 A;  1KQL A;  1CI6 B;  1NU1 J;  5CBN A;  3A5T A;  3KXD A;  3D70 A;  1AQT A;  4KJM A;  1K73 Q;  1LNQ A;  1LT1 A;  1FJK A;  2OAR A;  1VQP P;  4WY4 A;  1FZC A;  2FBW C;  4H0L D;  2GUV A;  5KLV J;  1XTG B;  1HJ0 A;  2W27 A;  1NKN A;  5KAF E;  3USS A;  2B87 A;  1JTH B;  1NOH A;  4L75 A;  4XE5 B;  3T97 B;  1PP9 G;  1L0N E;  2M5A A;  1LTT C;  1S9K D;  4N78 D;  2OTL P;  4PD4 E;  1NTK D;  1EXI A;  2ZXE B;  4ZKU A;  3R2P A;  4BWN A;  3L73 G;  2R5D A;  3KQG A;  3V2N A;  2FXM A;  3HUS A;  2KLV A;  1SQP D;  2NPS B;  3GF7 A;  1S4X A;  1FC2 C;  1HWT C;  1KMI Z;  1NWQ A;  3M0A A;  1OIP A;  2C9N Y;  3N7N A;  1M90 Q;  3E7K A;  2AXC A;  2M5A B;  2JEE A;  1J2J B;  2N9B A;  3RK2 C;  3VP9 A;  1BSN A;  3P7K A;  3VMX A;  4YPC A;  3CWB G;  3V4W A;  1PP9 E;  1GW4 A;  4H44 C;  5EFW B;  2J58 A;  5APV A;  4K35 A;  3V2P A;  3Q5R A;  2GM4 A;  3CCJ P;  2XDJ A;  2LXC B;  4RKU J;  2QM7 A;  2WT7 B;  4BRY B;  1NU1 D;  1LTJ C;  1SVF A;  3AE7 C;  3L72 D;  3SFD C;  3I55 P;  5CCG D;  3CMA P;  1MFT A;  1VQO P;  1AQ5 A;  2XND H;  1NKZ B;  2QJY C;  1DD4 A;  1RE3 A;  1L0L K;  4LC1 A;  2W83 C;  1FZB A;  3L71 G;  1KFM A;  5APQ A;  3WUT A;  4H0L B;  2QG4 A;  1NTM G;  1EDJ A;  1RE4 C;  3B5N C;  1KYO E;  2FKW B;  1EZV E;  1NTK J;  1FBM A;  1SQV D;  2ZFC A;  4IL6 H;  1AA0 A;  4O9B A;  3RBX A;  2FFD B;  1VQ9 P;  1LWU A;  1SQP G;  1FOS F;  2FXP A;  1FZE A;  3M0D A;  3A2A A;  3H1K D;  2YKQ A;  2E76 B;  3B5N D;  3ITK A;  4UB8 H;  3BCC G;  5M1B A;  1GL2 C;  3CCL P;  4U3F J;  5AVS B;  2GA1 A;  2CPS A;  4DT0 A;  2Q6Q A;  1GW3 A;  1ZV8 A;  3IR9 A;  1OVR A;  2YXQ B;  3AEF C;  2FYU G;  1OZH A;  2M0B A;  1SQX K;  1JY3 O;  1URQ C;  1L0N J;  2E74 B;  3L71 E;  1S3J A;  1WRG A;  1OWA A;  2D2C C;  2N1T B;  1WT6 A;  3H1H D;  1S9K E;  3F5H A;  2YMY A;  1MFZ A;  2FFD A;  1RF0 C;  2E74 D;  2OQQ A;  1FZG A;  2J5U A;  2N1T D;  3AE8 C;  3H1H G;  1N7S D;  4H13 C;  3M91 A;  3P8M C;  1Q90 D;  3CCM P;  2D2C B;  4QMA A;  1BDC A;  4R4L A;  5H2F E;  3M9H A;  3L72 J;  5TIS H;  1N73 C;  2WTY A;  3II6 A;  5APY A;  1M1K Q;  1NAY A;  3GHG B;  2C0W A;  1VQL P;  1CI6 A;  4Y99 C;  3BCC J;  3ZDM A;  2Y0D A;  5AVZ B;  2E75 C;  1MV8 A;  4PJ0 H;  1GU4 A;  2JO1 A;  2NRG A;  1SQQ E;  3P8C D;  2WT7 A;  2V7Q H;  1AJY A;  1H88 A;  5APW A;  3C8V A;  1SQX J;  1NTM J;  2JR8 A;  1SFC B;  4U3F G;  1IJD B;  3H1K J;  1IK9 A;  5DJT B;  3CME P;  4YXD C;  3L72 E;  3AEG C;  2Q5U A;  2IBZ I;  1M57 D;  4U3F D;  3S9O A;  1HJB A;  5AVQ B;  4ZKP A;  3TSI A;  5L8R J;  1NTM K;  1D7M A;  2KZJ A;  4RES B;  5AW2 B;  4D6T J;  3D6Y A;  1KIL C;  2Q9I A;  1PP9 D;  2RH0 A;  1P84 D;  3OJA B;  1LTB C;  3H1J D;  4OH8 B;  1M1J A;  2JWA A;  1L4A D;  2LKM A;  2QM8 A;  2R32 A;  2WSC H;  1SP4 A;  3RGU A;  3RK3 E;  1M7L A;  5KAF H;  5KLV E;  1KB9 I;  2QJP B;  5AVT B;  5GTI H;  3U1C A;  1H89 A;  3FXD A;  4H13 D;  2IZ0 A;  2L5G B;  3NTN A;  3H6P A;  2N1T C;  3HE4 B;  1SQQ K;  2JDI H;  1YQ4 C;  2C9L Y;  1LTI C;  3I56 P;  3B8E B;  3QWO C;  3BCC D;  1GTW A;  3CD6 P;  1JOC A;  2B87 B;  2OGU A;  1KYO D;  1RF0 A;  3IN6 A;  5KJ7 D;  1YTZ T;  2H88 C;  3P32 A;  2P67 A;  4EYY Q;  2FYZ A;  4OGQ D;  2WMM A;  1KZU B;  1ZR2 A;  3KHU A;  5KAI E;  3G4S P;  1T2K D;  3GF3 A;  1QVG O;  4ZNC A;  1LTJ A;  3BCC E;  2OYI C;  2BAS A;  3CXH D;  1NH4 A;  1ZW0 A;  1NTM D;  2KXP B;  1MKM A;  1BE3 J;  3BAS A;  1HH0 A;  3FWN A;  4UB6 E;  4GKG A;  3RL0 D;  3VOP A;  1BE3 G;  3L70 E;  1SQB K;  3E1R A;  2K9Y A;  2KS1 B;  3JCU E;  3NFQ A;  1LGH B;  1QL1 A;  2KZI A;  4B86 A;  4D6T D;  3E1I A;  5AW9 B;  1CSB A;  1NYH A;  1PP9 J;  4Y28 J;  4JYC A;  1LJ2 A;  1EXJ A;  1Z56 A;  3A0H E;  1FDI A;  3U59 A;  1BCC G;  1RHZ B;  2YKP A;  4XA4 A;  2H89 C;  3LID A;  4I1L A;  2DW3 A;  3M9B A;  5E79 H;  4NPF X;  4AQR D;  2O01 H;  3AEA C;  1FZC B;  2HLO A;  2PGD A;  2E42 A;  2CK3 H;  3EFF K;  1EQ7 A;  2W90 A;  2W8Z A;  1YJ9 P;  2IBZ G;  1BGY D;  3RK2 D;  3B5N B;  5CJ4 A;  1S1C X;  1VQ5 P;  1IFP A;  2WSF J;  3VMY A;  1OFC X;  1YIJ P;  3HD7 B;  1OW6 A;  1AV1 A;  4WY4 C;  2FY8 A;  2NZ2 A;  5AVX B;  3A0B E;  5KKZ C;  1LTA C;  3AED C;  3RL0 C;  4H13 B;  1T3U A;  1CW5 A;  1FDM A;  4WWI A;  2LR2 A;  1M56 D;  1SQB D;  1FE6 A;  1SQV G;  1UII A;  1UIX A;  3B71 A;  5C39 A;  1HBW A;  3U1A A;  1NTZ K;  1N7L A;  3AE5 C;  1BE3 D;  4I7Z B;  3AEC C;  1VQ4 P;  2OYO A;  4L74 A;  1HF9 A;  1QEX A;  2AXT E;  1KN7 A;  1X22 A;  1S5L X;  1OW8 A;  2QRX A;  1EZV I;  1EDK A;  3CX5 H;  5GTH E;  5AW4 B;  2QEX P;  3A3Y B;  3H1I G;  3V2Q A;  3L74 J;  2M8R A;  2JKV A;  1JY2 O;  2N1T A;  4N3Y B;  3G9R A;  1SQB G;  4AUW A;  1H0T B;  1FZA A;  1KB9 E;  2H8P D;  3C9I A;  3AE1 C;  2XV5 A;  4GIF A;  4JQ0 D;  2JWD A;  1LT9 A;  1N86 A;  2KYV A;  2PFX A;  1JTH A;  2A06 G;  3L71 D;  3CCR P;  1E5W A;  1HVV A;  1YJW P;  5AW0 B;  1NHL A;  1LTG C;  1NO4 A;  4EI2 A;  1BCC D;  2Z5I A;  2OYI A;  3M0D C;  2I1K A;  2BEZ F;  5AVW B;  1KIL B;  1L4A C;  3IF4 A;  3RL0 g;  4EOT A;  1ZN5 A;  3CWB E;  1Y9B A;  1KIL D;  4PD4 D;  1BCC E;  4GOF A;  2FXO A;  2YXR B;  2HG5 D;  1YHQ P;  3GW6 A;  3CI9 A;  3GLM A;  2YMK A;  3MUD A;  1SQQ J;  2FYU K;  2W6B A;  1VF5 B;  2SPZ A;  2B9B A;  1ZRT E;  3P8C E;  3WUV A;  1PFI A;  3HTK B;  1N8R Q;  2Q3E A;  2ZAE B;  1KV4 A;  3KPE A;  1PZQ A;  3V2R A;  1JO5 A;  3PHL A;  1SQP J;  4TLF A;  2IFN A;  2K37 A;  1M1J B;  3AE2 C;  1S72 P;  5K5G B;  1SQV K;  2QVA A;  1E79 H;  4KHX A;  3EFG A;  3H1I E;  1QL2 A;  3KZI E;  1J1E C;  4NPD A;  2O01 J;  3L71 J;  1HGZ A;  4PV1 D;  2P1J A;  1KQG B;  3GG2 A;  3CC4 P;  1VQ8 P;  1AVO A;  2NPS A;  3SSU A;  3TGU J;  1URQ B;  2E74 C;  3O6Q A;  4OVN F;  2HOD A;  5KJ7 A;  3TGU G;  5KTB A;  1FJP A;  1LTS C;  4U3F E;  1URQ D;  2K1A A;  2YO2 A;  3L70 J;  2FYU E;  1PGJ A;  2YIU B;  5CCG A;  2WQY C;  3MGN A;  3H32 B;  3SWF A;  1Q2N A;  1QLE D;  2KK7 A;  4ZMD A;  4EDF A;  3HD7 A;  2BEQ D;  4LGD E;  3OW2 O;  1SFC C;  1PPJ G;  1SQP K;  1P84 H;  2A45 G;  2RKL A;  3PH0 A;  1DEE G;  1DD3 A;  2AEJ A;  2YIU C;  2MKV A;  1RE4 A;  1KFN A;  3AE6 C;  3L36 A;  1PGP A;  4BRY A;  5B5E H;  3TF5 A;  1FAV A;  1HUC A;  5E79 E;  1VQ7 P;  1R5S A;  1JY2 N;  1R8E A;  1A02 J;  1U7M A;  4IOI H;  3H1K G;  1JMB A;  2Z4E A;  1SQX G;  4OGQ C;  2IFM A;  2Y9Z A;  4L76 A;  3C1L A;  3PRJ A;  1PPJ D;  2A06 E;  2P7J A;  2QJP C;  1SQQ G;  1ZR4 A;  3TGU E;  5CCG C;  1L0N D;  1GK6 A;  1CZQ A;  5KLV G;  4I7Z C;  1H0T A;  1NTK E;  3H1H J;  2Z5H A;  3FGA D;  2V4H A;  1ZRT D;  1JMM A;  1FZF A;  2ZJS E;  3TGU D;  1FU1 A;  2WSC J;  2NPS C;  3V5B A;  3MUD C;  1PIX A;  1NU1 K;  1KYO H;  1MUU A;  3L70 D;  1L0L G;  2LXB A;  2WSF H;  3AEB C;  3QH9 A;  5CCH A;  5GTH H;  2IX7 C;  1NTZ J;  2OTK E;  2E43 A;  4C7R A;  4I2L C;  2A45 H;  2M3E A;  1SQX E;  2WSE J;  1YQ3 C;  2XNX A;  4IL6 X;  2KI7 B;  1DEB A;  3SWK A;  3CPW O;  1J1D C;  1GZL A;  4NPE A;  2WPR A;  1VQN P;  1S5L H;  1JY3 N;  5CMZ A;  1OW7 A;  1FS0 E;  4JBZ A;  1K8A Q;  1L2P A;  1SQX D;  2WSE H;  1NU1 E;  2AEF A;  3LW5 J;  1RF1 B;  4DZO A;  1EDL A;  1JCD A;  1W2E A;  2CPB A;  2E75 B;  2O1K A;  5APX A;  1H8A A;  1GDT A;  4H0L C;  1T8Z A;  2KUB A;  3H1I D;  2OYH C;  2E75 D;  4HJG H;  3ABV C;  1KB9 H;  2R3C A;  3H25 A;  1IFN A;  3CXH I;  4W7Y A;  4C46 A;  1YBK A;  1EZV D;  1VDF A;  3CCV P;  1VQ6 P;  5CCH C;  1VQK P;  4LLH A;  1SQB E;  5KAI H;  3CCS P;  1LTJ B;  1P84 E;  1N7S C;  2Q1K A;  4HYT B;  1USD A;  1VF5 D;  1OX3 A;  1A02 F;  2K88 A;  2AEM A;  3FXE A;  3BAT A;  4UB6 H;  2ZYA A;  3HD7 C;  4WY4 B;  1YTZ I;  4UB8 E;  2QJK B;  2D2C D;  4IL6 E;  2ZYD A;  4RO0 A;  5APT A;  3V6I A;  2RN0 A;  1J1E B;  1NTZ D;  1VF5 C;  2E5T A;  3CWB J;  1Q81 Q;  3SFE C;  1QVF O;  2M3B A;  1SQV E;  4JF7 A;  2ZYG A;  1KIL E;  2BCC J;  3UIA A;  2Y0E A;  2WVR A;  3JC2 2;  4MN4 C;  1GL2 D;  1U7J A;  2PAJ A;  3GHG A;  1KQF B;  1GU5 A;  1RQV A;  5TJH A;  1JM0 A;  3KDP B;  1GL2 B;  2B89 A;  5AW3 B;  2PP6 A;  1S2E A;  3HE4 A;  3R4Y A;  2KB7 P;  1QGK B;  3L73 J;  2ZVO B;  1AVY A;  3G6E P;  3BRT B;  3WMM 0;  3W68 A;  3CLQ A;  1VPC A;  1ZXG A;  5AW5 B;  4C7N B;  1IFM A;  3EQ2 A;  3F89 A;  4AYC A;  2OYI B;  1SLQ A;  2WPQ A;  3O8Z A;  2YKO A;  1W2B O;  1Q7Y Q;  1XTC C;  3LW5 H;  5B66 E;  2QE7 H;  1LT9 C;  4N78 E;  4CPG A;  1K9M Q;  2O01 N;  1L4A B;  4HH2 A;  3Q3D A;  1Q82 Q;  3FX0 A;  1AFO A;  2YO3 A;  1JCC A;  4H44 D;  2E5Y A;  1OMI A;  3I5C A;  3T97 A;  2K9J A;  1GD2 E;  2BCC G;  2XU6 A;  4GOD A;  5AVY B;  1ZME C;  2HR3 A;  3HE5 B;  1JY3 P;  3H1L G;  1BGY J;  2IPP A;  2NPS D;  4K3A A;  5AW6 B;  3W67 A;  5KLI B;  1BE3 E;  2K3R A;  1L0L D;  1Y47 A;  3TNU A;  2Q7C A;  3PJS K;  5APS A;  1X9V A;  1BGY E;  1PGQ A;  2XKM A;  1NTK K;  3A0B H;  3IAO A;  1RQU A;  2WPV B;  3L73 E;  3L74 G;  4JYB A;  2HYN A;  4OWF A;  5AVR B;  2QJK C;  3M9Q A;  3MZW B;  1NAF A;  1WMK A;  4U7J A;  2Q3I A;  4D6T G;  4RJT A;  1JY2 P;  1U57 A;  2QSI A;  1EC5 A;  1OVU A;  2ZXX A;  2WPS A;  3JSV C;  3L73 D;  3HE5 A;  1KB9 D;  1M1J C;  2PRR A;  5H2F H;  1EDI A;  5GTI E;  5APU A;  1KIL A;  1SQV J;  4KT0 J;  2P58 A;  3CX5 E;  2MJZ A;  3L74 D;  4DCK A;  1G2C B;  2O1J A;  3A7O A;  3FWL A;  4PD4 I;  1FOS E;  3CXH H;  2ZVN B;  1RF1 C;  2KS1 A;  3IFM A;  1SFC D;  3CXH E;  2IBZ D;  1PV3 A;  1DX7 A;  3MHV A;  4C7N A;  2YNY A;  4YXW H;  1JNM A;  3CC2 P;  5CJ0 A;  2ZT9 C;  2UWJ E;  2IDB A;  3HTK A;  5AVU B;  2FYN B;  3AE3 C;  2Y9Y A;  3HUS B;  3VTP C;  4D6T E;  5BVZ A;  3OAK A;  4W7Z A;  3HD7 D;  4IFD K;  1J1D B;  3AEE C;  5AVV B;  3RBZ A;  4DJG A;  3RK3 C;  1Q86 Q;  1EZV G;  2BCC E;  2KNC B;  3AE4 C;  1L0L J;  4Z1M H;  3BVH A;  1JUN A;  1IC2 A;  1N73 A;  1NTM E;  2RMZ A;  3H1L E;  2VRS A;  4PV1 C;  4DOJ A;  4L73 A;  1OVV A;  1R5L A;  2POH A;  3L75 J;  3B5N A;  1S5L E;  1SQQ D;  4H44 B;  5CCH D;  3RK3 B;  1T6A A;  1KYO I;  3OA7 A;  4OGQ B;  1T3J A;  4HKZ H;  3SWY A;  3TNU B;  2IYO A;  3VMA A;  3A0H H;  2OTJ P;  1RY3 A;  4PV1 B;  5AW1 B;  1KD1 Q;  1URQ A;  3O6Q B;  5BU8 B;  4WVZ A;  1NTK G;  2OYH A;  3RL0 B;  1SQP E;  1LP1 B;  1X79 B;  3MP7 B;  1PGO A;  1JEK A;  4BXL A;  1KTM A;  3M06 A;  2ITA A;  2HPC A;  1IO4 A;  1N2D C;  3Q1M A;  3B4S A;  1ZOY C;  3MTU E;  3D6Z A;  2O3J A;  2IZ1 A;  3AE9 C;  1GK4 A;  3L37 A;  1HGV A;  3S1K A;  1JB0 J;  1G2C A;  2E76 C;  2HFE D;  2XZR A;  4PJ0 E;  1LWU B;  1IK7 A;  3H1J G;  3H1J J;  3PTZ A;  4I6M C;  4JPZ B;  1KQS O;  4XFJ A;  1DH3 A;  3D71 A;  5AW8 B;  4WB4 A;  2H7H A;  4GOE A;  2KIK A;  3L4F A;  1L0N K;  2J59 M;  3LIE A;  4GDO A;  2ZT9 D;  3L74 E;  4TT3 H;  3H1L J;  3Q2Y A;  1GMJ A;  3KYQ A;  1K05 A;  1NVO A;  2JP3 A;  1X0T A;  1RF1 A;  4N6J A;  2ZT9 B;  1NTZ E;  1FDO A;  3RK2 B;  3L75 D;  4W80 A;  4WBA A;  2FYU D;  2Y0C A;  3WU2 E;  3TDK A;  1YI2 P;  1QX8 A;  1VL2 A;  2W6J H;  2HOD B;  2KNC A;  3PP5 A;  3WU2 H;  3CC7 P;  3HRN A;  1DIP A;  2R44 A;  1X8Y A;  1N73 B;  5AW7 B;  3H1H E;  2A45 I;  3L35 A;  2JJL A;  5KLI C;  1K04 A;  3CCE P;  1G1I A;  4Y99 B;  1M8O B;  4ASV A;  1OXZ A;  3L75 G;  3N4X A;  1BDD A;  1ZLL A;  5KLV K;  1YIT P;  1G1J A;  2IBZ E;  3MIW A;  3NMD A;  3BRV B;  2P2U A;  2WIT A;  4M3L A;  2KSJ A;  1NJI Q;  4A7P A;  1N7S B;  1NTZ G;  3Q5P A;  5DJU B;  3CL3 D;  3S4R A;  2R5B A;  3VYI A;  1HTL C;  1ZP0 C;  1YJN P;  2FFD C;  4WY4 D;  1W5C E;  2WZ7 A;  2OYH B;  1NU1 G;  3VMZ A;  3L72 G;  3VN0 A;  2QA4 P;  1LP1 A;  3KZI H;  2N9Y B;  1SFC A; 
#chains in the Genus database with same CATH homology
 5GTH E;  5GTI E;  3A0H E;  5B66 E;  3WU2 E;  4UB8 E;  4IL6 E;  5E79 E;  5B5E E;  5TIS E;  3KZI E;  5KAI E;  3A0B E;  4PJ0 E;  4UB6 E;  3JCU E;  5KAF E;  1W5C E;  5H2F E;  2AXT E;  1S5L E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...