2JWAA

Erbb2 transmembrane segment dimer spatial structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
44
structure length
44
Chain Sequence
b'GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Receptor tyrosine-protein kinase erbB-2
publication title Spatial Structure of the Dimeric Transmembrane Domain of the Growth Factor Receptor ErbB2 Presumably Corresponding to the Receptor Active State
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 13
structure length 44
sequence length 44
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2jwaA00
5TJHA 3TGUD 3BCCD 3CXHD 3PHLA 3H1LD 1NU1D 4U3FD 5KLVD 3L70D 2BCCD 1SQPD 2O3JA 3L72D 2K9JB 1L0ND 1SQQD 3TF5A 1P84D 1PP9D 1SQXD 1NTMD 1L0LD 3PTZA 3L73D 3L74D 3CWBD 2Y0EA 2FYNB 5KLIB 4EDFA 4PD4D 1EZVD 1ZRTD 3H1HD 4D6TD 3KHUA 1BE3D 3H1ID 3H1JD 3VMAA 2RMZA 3ITKA 2RN0A 1KYOD 2A06D 1NTZD 3L71D 3L75D 3FWLA 4RJTA 2QJYB 1KB9D 2N9YB 1BCCD 3TDKA 2YIUB 4A7PA 3CX5D 3PRJA 1SQVD 3GW6A 2IBZD 2L91A 1BGYD 2Y0DA 2KNCB 2KS1A 2QG4A 2Y0CA 3PLNA 1PPJD 1NTKD 2FYUD 3H1KD 2Q3EA 1SQBD 2QJPB 3GG2A 2JWAA 5KKZB 2QJKB
chains in the Genus database with same CATH superfamily
2M8RA 5BU8B 2IPPA 1VQPP 2GUVA 1ZR2A 1D7MA 3TGUJ 3BCCJ 4WB4A 1EXJA 3F89A 1NKZB 1KN7A 3V4WA 5CBOA 4C7NB 4GKGA 2ZVNB 2XDJA 2PGDA 4Y28J 3L74D 3HUSC 2E42A 2P58A 3CWBD 1JOCA 2WSEH 1NTMJ 2ZXEB 5E79E 3VP9A 3B4SA 4U3FG 3IFMA 2I1JA 2HG5D 3RK3E 1JY3O 3CMEP 2KSEA 3MP7B 3CCEP 2Z5IA 3H1IJ 3H1JJ 1QVGO 1FDMA 2Q9IA 3FWLA 2IFNA 1VQ9P 4C46A 1MFZA 5AVTB 1YITP 3H1HG 3Q5PA 1BDCA 3GHGC 1BE3G 1SQXK 2KS1A 2HODA 2XNDH 3PLNA 2E74D 1JY3N 5GTIH 5BVZA 3CLQA 3MD0A 1S5LX 3WUVA 3A0BH 3II6A 3GG2A 2JWAA 4RESB 1SVFA 2GUSA 3RBZA 4OGQB 1AA0A 2HPCA 2LKMA 3Q2YA 1GK4A 5AW8B 5TISE 1VQ7P 5AVUB 1RE4C 5APVA 3CD6P 5KLVD 1T3JA 2ZXXA 2BCCD 1KFNA 1PPJG 3EQ2A 2HPCB 2FYUG 1ZP0C 3E1IA 3M9QA 1H88A 1PP9D 1L0NE 1NKNA 4I2LC 3CCVP 4H13B 2WQYC 2K9YA 2C0WA 5AVXB 3KHUA 3JSVC 3WU2H 3CI9A 3BRVB 3TSIA 4D6TE 1NJIQ 2KLUA 5CHXA 1H8AA 3V2NA 1MUUA 2CPSA 3VYIA 1KQLA 1IFJA 3L35A 3L71E 3L75E 4EOTA 2JP3A 1R8EA 3BVHA 5DJUB 1KB9D 4JQ0D 1W2BO 5KTBA 1VQNP 3AE5C 3MUDC 4OGQC 1L0LK 2L5GB 1IJDB 2A06G 1FU1A 3PH0A 2O1JA 2NPSC 1IFDA 2N1TA 1SQBD 1S9KD 5AVRB 3H1KE 4AQRD 2OARA 1KQSO 2M3BA 3H1LD 2N1TB 1MKMA 2WTYA 1YQ3C 3AE4C 4NPEA 3L72D 2QRXA 1NO4A 1FZEA 3L70E 1FC2C 1L0NJ 3M06A 4IOIH 1LTTC 4RKUJ 4PJ0H 4UB8H 4L73A 3TGUG 2FYNB 2IX7C 3BCCG 4PD4H 4M3LA 3SWKA 2OYIA 1NHLA 3F5HA 2M5AA 1HJ0A 1X9VA 4D6TJ 1KYOH 4IL6X 4BRYA 2A45G 4AYCA 3NFQA 3U1AA 3NTNA 1NTMG 2AEMA 2M5AB 1K73Q 3L71J 1EXIA 3L75J 1MFTA 3Q5RA 1PIXA 5B66E 4N6JA 3NMDA 1EZVG 4ASWA 2YIUB 2WITA 3H1IG 1A02J 3H1JG 2IZ1A 1SQVD 1BE3E 1HWTC 3M9BA 3O6QA 1ZMEC 1LTJA 1S5LH 2N1TC 5APSA 1T2KD 2CPBA 2WSFJ 1LTIC 4I6MC 3O6QB 4QMAA 5KKZB 3H1KJ 1IC2A 2KYVA 1LTJB 3SWYA 1GMJA 1M1JB 3CXHD 1K04A 1OVRA 4NPFX 2LR2A 2IBZG 1AJYA 3M0DA 2FYNC 1GL2A 2Z4EA 4RO0A 5AW0B 2RH0A 2PP6A 3L70J 2FXOA 1FDOA 2FYZA 1FOSE 2AEFA 2K9JA 1RF0C 2QA4P 1EQ7A 2OTKE 3OJAB 3BATA 2E5YA 4W7ZA 1PV3A 4OGQD 2YIUC 1HBWA 1HUCA 4H44D 5CCGC 4TT3H 1JTHB 1OXZA 1YTZT 3HTKA 3V2PA 2IYPA 2NPSD 3U1CA 2E74B 5APUA 3AE2C 4KT0J 3HE4B 1SQBK 5KKZC 1SFCD 1LTJC 3HTKB 3AEAC 1BGYD 5KAIH 3USSA 1M1JC 1NOHA 2KZJA 4DJGA 2A06E 1GU4A 1N2DC 1NTKD 4O9BA 2Q6QA 1ZXGA 1JY3P 4KJMA 3M0DC 2G8YA 1J1EC 2G3AA 3A0BE 3AE9C 1NU1D 2HR3A 1USEA 2JO1A 3V2RA 3A5TA 1LTSC 1S2EA 1SQPE 2KSJA 1SQXD 1LP1A 3G4SP 3VMYA 2KOGA 1YYCA 4LGDE 4IL6H 3HD7D 1FDIA 2E74C 2WSEJ 1LP1B 2FYUK 4L75A 1R5LA 4N3YB 1L4AC 1L0NG 1SLQA 3CC4P 3WU2E 1X22A 1NTZD 1SQVK 3W67A 5APQA 1LNQA 2J58A 1WMKA 1NYHA 1KB9H 2QJYB 4WBAA 1VL2A 1IFPA 4D6TG 3C8VA 3PRJA 4GOFA 1Y47A 2WSCJ 2AXCA 2QIWA 3S1KA 3L71G 3L75G 1JY2N 2CK3H 3FXDA 2I8DA 1VF5B 2E5TA 1SS1A 3WUUA 1URQD 3GHGA 2H7HA 1TU3F 4U7JA 1AQTA 2VRSA 1Y9BA 3Q5SA 3QH9A 3LW5H 1CI6A 2KIKA 4PD4I 3H1KG 3D70A 1SQPJ 1RH5B 1YJWP 4CPGA 1Q86Q 1L0LD 4GODA 2ITAA 4C7NA 3L73D 3V2QA 1NH4A 2ZT9D 3AE1C 1CI6B 1FZBA 1KYOI 1DEEG 2MKVA 2V7QH 2QJYC 3ZDMA 2R32A 1KC8Q 2WPSA 1KD1Q 1N7LA 4PJ0E 4UB8E 1RE4A 3L70G 4PD4E 3IN6A 2H43A 2WZ7A 1M7LA 2KLVA 1QLED 1KYOE 2O01H 2WMMA 4I7ZB 1LTGC 1NGMB 1NTKK 1VF5C 3H32B 5APXA 5APWA 1BCCE 2OGUA 2IYOA 5KLIC 1N7SD 3TNUB 1NU1K 1R5SA 1UIXA 2K88A 1VQ8P 1S5LE 1OIPA 5APYA 3W68A 5AW3B 2QM8A 3PHLA 3V6IA 1LWUB 3V5BA 3MUDA 5DJTB 3S9OA 2FXPA 1L4AD 2ZYAA 1GDTA 1BDDA 3TF5A 1SP4A 3KPEA 2NPSA 4H44B 1HJBA 1HF9A 1NTZK 1GW3A 2YKOA 2QEXP 4I7ZC 3S4RA 1SFCA 1EC5A 3CWBE 1T2KC 2NPSB 1Q2NA 3LIEA 1SQQG 1SFCB 1FBMA 5GTHH 3PP5A 3CC7P 3GF3A 1VQ4P 2M0BA 4OH8B 2YNYA 1OW6A 1A02F 4LC1A 3WMM0 2HYNA 5CCHD 3A2AA 1M56D 2P2UA 1FZAA 1S3JA 1DD4A 1Q90D 1BCCJ 1KQGB 1ZN5A 4JF7A 5AVQB 2QG4A 2E43A 3AE6C 1LWUC 1FJKA 4HYTB 2WSSH 1JMMA 1YBKA 1RE3A 1FZCC 1HVVA 3A0HH 1ZV8A 3I56P 4H44C 1LJ2A 4YPCA 3L36A 4U3FD 2W27A 1RQUA 2B9BA 3EWKA 3MZWB 2O3JA 1Q81Q 3HD7B 2IFMA 1BSNA 2H89C 5KLVE 1EDKA 2BCCE 2FFDB 2POHA 1RY3A 1G2CB 1SFCC 2WPQA 3AEGC 3PJSK 3B8EB 1PP9E 1K05A 1P84I 3L74J 3B5ND 4GT1A 3CWBJ 2DW3A 3H1HD 4GDOA 1VF5D 1BE3D 1SQPG 1YQ4C 1QL1A 3N4XA 2V4HA 1KILD 2YO2A 1KB9I 1PGPA 1KZUB 4EIJA 1G1JA 3MTUE 4R4MA 2SPZA 3JCUE 2GM4A 1P84E 3I55P 2OYHB 3CC2P 1RF0A 3A7OA 4JYBA 3IAOA 2W8ZA 2N9YB 4DCKA 1KB9E 1U7MA 1IO4A 2H88C 2P1JA 5CCGA 1X0TA 1RE3C 1IK9A 1URQB 3IF4A 5K5GB 4HH2A 1PPJD 2NZ2A 2FYUD 3HD7C 1OVVA 3CX5H 5TJHA 2FFDC 2R5BA 1SQBE 1JMBA 3FX0A 4EI2A 2ZT9B 3E1RA 1NAYA 5BU5A 1M1JA 1K8AQ 3H1LE 2KP8A 2WVRA 5KLVJ 1X8YA 1FOSF 2BCCJ 3LIDA 2GA1A 3L72E 3RL0g 2P7JA 1W2EA 1KMIZ 1PP9J 2AXTH 4R4LA 2M3EA 2OYHC 1ZRTD 3OAKA 4LLHA 1AVYA 2RN0A 2A06D 1SQQE 1J1EB 5KAFH 1JTHA 5CJ0A 1URQC 3HRNA 3RK3C 1N7SB 1RHZB 1L2PA 1DD3A 1JCDA 1AVOA 4PV1D 1VPCA 2L91A 1E79H 3GF7A 1PGQA 2ZYDA 1N73B 1L4AA 3HE4A 1SQVE 4K3AA 2ZT9C 3FGAD 3G3ZA 1JUNA 4JBZA 2YMYA 1L4AB 1BCCG 1SQBJ 3TGUD 3BCCD 1KFMA 1OVUA 1YTZI 1OMIA 2XNXA 4EYYQ 4N78D 3H1LJ 5AW6B 3RK2C 3E7KA 1JB0J 3L72J 1NTMD 3LW5J 5GTIE 2H8PD 2OYOA 4H0LB 2Y0EA 5CCHA 3KQGA 1EZVD 3T97B 1N7SC 3H1ID 3H1JD 2V7QJ 2WPVB 3BRTB 2XZRA 2XU6A 1VQ5P 1SQQJ 3C9IA 2QM7A 1N73C 3L74G 2BEZF 3CWBG 3AEFC 1KORA 3I5CA 5AVYB 1IFMA 5GTHE 2PAJA 2IDBA 4L76A 2O01J 1JY2O 1QGKB 1VQ6P 5C39A 2AEJA 3L4FA 1EDJA 1DEBA 2IBZD 2N9BA 1H89A 3L37A 3P8CE 1SQVJ 2WT7B 3CL3D 2UWJE 3VN0A 2Y0CA 1BGYE 1T8ZA 3Q1MA 4UB6H 2B87B 5CMZA 2Q3EA 1GZLA 5KJ7C 1M1KQ 1NTKE 1FZGA 2QJKB 3B5NA 1HTLC 2HLOA 3B71A 1EDIA 2E76C 4HJGH 3H25A 3A0HE 4H0LC 1Y8AA 1OWAA 3B5NB 5AW4B 1NU1E 3EFFK 4NPDA 4IFFA 1NVOA 2R44A 3QWOC 2K1AA 3AEEC 5CCHC 4AUWA 1Q82Q 1KILB 5H2FH 3A3YB 3RK3D 1SQXE 5KLIB 2D2CD 5KLVG 3VP8A 2BCCG 4B86A 1LT9B 4DT0A 1XTCC 3SSUA 1PP9G 4I1LA 3BASA 1NTZE 4IFMA 3RL0D 2KNCA 1EDLA 3G71P 3KZIH 2Y9ZA 3ABVC 1K9MQ 1N8RQ 1LTAC 1U7JA 2QJKC 1RF1B 3M9HA 3CCMP 2KB7P 2LXCB 1T3UA 2KNCB 4BXLA 3CX5I 3H32A 1BGYJ 3AE3C 4BWNA 1M8OB 3RK2D 1IK7A 3B5NC 4Z1MH 2ZVOB 1PGJA 1JM0A 1NTKJ 2P67A 3TNUA 1PZQA 3JC22 1QEXA 1NTMK 1KILC 3AECC 3CX5E 4L74A 2JEEA 2Q5UA 1NU1J 1LWUA 1GTWA 1YI2P 1L0ND 4GOEA 1OX3A 3TYYA 1IFNA 2QSIA 1X79B 1LT9C 1GL2D 1SQBG 5AVSB 3D6YA 3CXHH 1FZCA 2C9NY 1YHQP 1SQXJ 3CPWO 3CCQP 1L0LE 1FE6A 3L73E 3H1LG 5AW7B 4D6TD 2WSCH 3C1LA 2YKPA 1FZCB 2AXTE 2FKWB 1CZQA 3L72G 3RGUA 3ITKA 4YXDC 1RF1C 3P7KA 2W90A 1CW5A 3L71D 3L75D 4PV1B 2MJZA 2E75D 1NTZJ 3L74E 4RJTA 3AEDC 1LGHB 3VMXA 2J59M 5KJ7D 5KAFE 2KXPB 2KS1B 4A7PA 2E76D 2HODB 4C7RA 3VTPC 1JCCA 1AQ5A 2Y0DA 4H0LD 3D6ZA 1ZOYC 2W6AA 1DX7A 3H1KD 2YXQB 1KQFB 4YXWH 1YJ9P 3D71A 1OW7A 1SQVG 1DH3A 3AEBC 1QVFO 1AV1A 2A45H 3L70D 5KAIE 1WT6A 4XE5B 3HE5A 4Y99B 1VQKP 1P84D 1PFIA 3HD7A 3MIWA 1H0TA 4GIFA 2JKVA 4PV1C 1L0LJ 3L73J 1FJPA 2FFDA 2B88A 4WY4D 3HE5B 1G2CA 4WWIA 5B5EH 4XA4A 2Z5HA 2O1KA 4DOJA 1MZ9A 2R5DA 1H0TB 1HGZA 4KHXA 3CCUP 2OQQA 1Z56A 5AW9B 1YJNP 1M57D 4K35A 2R3CA 1CSBA 2OYHA 3KXDA 2QE7H 1QL2A 4IL6E 1U57A 3GW6A 1VQOP 3G9RA 2FXMA 1WRGA 3CCJP 1NWQA 1S1CX 2OTLP 4H13C 2J5UA 2Y9YA 1URQA 1G1IA 2JDIH 3IR9A 5L8RJ 1L0NK 4Y99C 3GLMA 1VQLP 4OVNF 3V4QA 5AW2B 4UB6E 1GK6A 1NAFA 1PGOA 1BGYG 5CJ4A 2I1KA 1USDA 3RK3B 4ZNCA 3CMAP 3MHVA 2Q7CA 4U3FE 1NTKG 2D2CB 1SQQD 2YKQA 2C0XA 5E79H 3SWFA 3FWNA 3CCLP 3OA7A 3VOPA 4W7YA 1JY2P 2OYIB 2W6BA 2WWWA 1S9KE 1J1DB 2OTJP 2KZIA 1LTBC 4BRYB 2NRGA 1NU1G 4HB1A 5AVZB 3RL0B 5H2FE 3H1HE 4ZMDA 2BASA 4W80A 5EFWB 2RKLA 3O8ZA 1OW8A 1SQXG 2IZ0A 4TLFA 3CCRP 3P32A 1KILE 2XV5A 5AVVB 3GMAA 3UIAA 4DZOA 5AW1B 3K5BA 5KLVK 2FY8A 3RK2B 4OWFA 1ZW0A 3TDKA 1KV4A 1GU5A 1N86A 4HKZH 2ZAEB 1N7SA 3U59A 2XKMA 3KZIE 2KUBA 3VMZA 1NTZG 3CCSP 1S72P 1N73A 1JEKA 1PPJE 5AVWB 2D2CC 5TISH 2FYUE 4WVZA 1GL2B 4ZKUA 2OYIC 2YO3A 1J1DC 3MGNA 3CXHI 3G6EP 1BSHA 4JYCA 2KK7A 1SQPD 4U3FJ 5AW5B 2K9JB 3RL0C 1OZHA 3PTZA 3M0AA 2JWDA 3AE7C 3RBXA 5KJ7A 1VQMP 1AFOA 1XTGB 2LXBA 2JJLA 3M91A 1FZFA 3FXEA 3CXHE 1ZR4A 2E75B 2BEQD 3SFEC 1IFIA 3H1HJ 1HH0A 3VMAA 1ZRTE 2RMZA 2ZJSE 3P8CD 1T6AA 1BE3J 3T97A 2E76B 1YIJP 4H13D 4JPZB 4XFJA 4MN4C 1L0LG 3L73G 1JNMA 1KTMA 2O01N 2Q1KA 2FBWC 2JR8A 3R2PA 1ZLLA 3WUTA 2WPRA 1M90Q 2WSFH 1GL2C 1QX8A 1FS0E 2B89A 1RQVA 1UIIA 3EFGA 2C9LY 3H6PA 2Q3IA 2WT7A 1DIPA 2QJPB 2FYUJ 2R3SA 4WY4A 1SQQK 2A45I 2B87A 1Q7YQ 2P10A 5APTA 1VDFA 1J2JB 5CBNA 3TGUE 3BCCE 2E75C 2ZFCA 4WY4B 3JCUH 3Q3DA 4N78E 1W5CE 1P84H 2PFXA 1EZVI 1HGVA 1MV8A 4YTPC 2N1TD 2KI7B 3R4YA 1NTME 3P8MC 1E5WA 4EDFA 3HUSA 4PD4D 2YXRB 1KILA 1FAVA 1OFCX 1EZVE 3TK1A 3AE8C 2W6JH 1KYOD 3H1IE 3H1JE 5B5EE 1GD2E 2YMKA 5M1BA 3HUSB 5B66H 1LT9A 1GW4A 3N7NA 2IBZI 4ZKPA 4ASVA 3KYQA 3OW2O 1PL5A 1BCCD 2W83C 2QJPC 3KDPB 3CX5D 1S4XA 1LT1A 2PRRA 1RF1A 2IBZE 2K3RA 3SFDC 2QVAA 4IFDK 2K37A 4WY4C 1JO5A 5CCGD 1SQPK 3GHGB 3NXSA 2HFED 1IZNB 2ZYGA
chains in the Genus database with same CATH topology
5TJHA 3TGUD 3BCCD 3CXHD 3PHLA 3H1LD 1NU1D 4U3FD 5KLVD 3L70D 2BCCD 1SQPD 2O3JA 3L72D 2K9JB 1L0ND 1SQQD 3TF5A 1P84D 1PP9D 1SQXD 1NTMD 1L0LD 3PTZA 3L73D 3L74D 3CWBD 2Y0EA 2FYNB 5KLIB 4EDFA 4PD4D 1EZVD 1ZRTD 3H1HD 4D6TD 3KHUA 1BE3D 3H1ID 3H1JD 3VMAA 2RMZA 3ITKA 2RN0A 1KYOD 2A06D 1NTZD 3L71D 3L75D 3FWLA 4RJTA 2QJYB 1KB9D 2N9YB 1BCCD 3TDKA 2YIUB 4A7PA 3CX5D 3PRJA 1SQVD 3GW6A 2IBZD 2L91A 1BGYD 2Y0DA 2KNCB 2KS1A 2QG4A 2Y0CA 3PLNA 1PPJD 1NTKD 2FYUD 3H1KD 2Q3EA 1SQBD 2QJPB 3GG2A 2JWAA 5KKZB 2QJKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TJH A;  3TGU D;  3BCC D;  3CXH D;  3PHL A;  3H1L D;  1NU1 D;  4U3F D;  5KLV D;  3L70 D;  2BCC D;  1SQP D;  2O3J A;  3L72 D;  2K9J B;  1L0N D;  1SQQ D;  3TF5 A;  1P84 D;  1PP9 D;  1SQX D;  1NTM D;  1L0L D;  3PTZ A;  3L73 D;  3L74 D;  3CWB D;  2Y0E A;  2FYN B;  5KLI B;  4EDF A;  4PD4 D;  1EZV D;  1ZRT D;  3H1H D;  4D6T D;  3KHU A;  1BE3 D;  3H1I D;  3H1J D;  3VMA A;  2RMZ A;  3ITK A;  2RN0 A;  1KYO D;  2A06 D;  1NTZ D;  3L71 D;  3L75 D;  3FWL A;  4RJT A;  2QJY B;  1KB9 D;  2N9Y B;  1BCC D;  3TDK A;  2YIU B;  4A7P A;  3CX5 D;  3PRJ A;  1SQV D;  3GW6 A;  2IBZ D;  2L91 A;  1BGY D;  2Y0D A;  2KNC B;  2KS1 A;  2QG4 A;  2Y0C A;  3PLN A;  1PPJ D;  1NTK D;  2FYU D;  3H1K D;  2Q3E A;  1SQB D;  2QJP B;  3GG2 A;  2JWA A;  5KKZ B;  2QJK B; 
#chains in the Genus database with same CATH topology
 2M8R A;  5BU8 B;  2IPP A;  1VQP P;  2GUV A;  1ZR2 A;  1D7M A;  3TGU J;  3BCC J;  4WB4 A;  1EXJ A;  3F89 A;  1NKZ B;  1KN7 A;  3V4W A;  5CBO A;  4C7N B;  4GKG A;  2ZVN B;  2XDJ A;  2PGD A;  4Y28 J;  3L74 D;  3HUS C;  2E42 A;  2P58 A;  3CWB D;  1JOC A;  2WSE H;  1NTM J;  2ZXE B;  5E79 E;  3VP9 A;  3B4S A;  4U3F G;  3IFM A;  2I1J A;  2HG5 D;  3RK3 E;  1JY3 O;  3CME P;  2KSE A;  3MP7 B;  3CCE P;  2Z5I A;  3H1I J;  3H1J J;  1QVG O;  1FDM A;  2Q9I A;  3FWL A;  2IFN A;  1VQ9 P;  4C46 A;  1MFZ A;  5AVT B;  1YIT P;  3H1H G;  3Q5P A;  1BDC A;  3GHG C;  1BE3 G;  1SQX K;  2KS1 A;  2HOD A;  2XND H;  3PLN A;  2E74 D;  1JY3 N;  5GTI H;  5BVZ A;  3CLQ A;  3MD0 A;  1S5L X;  3WUV A;  3A0B H;  3II6 A;  3GG2 A;  2JWA A;  4RES B;  1SVF A;  2GUS A;  3RBZ A;  4OGQ B;  1AA0 A;  2HPC A;  2LKM A;  3Q2Y A;  1GK4 A;  5AW8 B;  5TIS E;  1VQ7 P;  5AVU B;  1RE4 C;  5APV A;  3CD6 P;  5KLV D;  1T3J A;  2ZXX A;  2BCC D;  1KFN A;  1PPJ G;  3EQ2 A;  2HPC B;  2FYU G;  1ZP0 C;  3E1I A;  3M9Q A;  1H88 A;  1PP9 D;  1L0N E;  1NKN A;  4I2L C;  3CCV P;  4H13 B;  2WQY C;  2K9Y A;  2C0W A;  5AVX B;  3KHU A;  3JSV C;  3WU2 H;  3CI9 A;  3BRV B;  3TSI A;  4D6T E;  1NJI Q;  2KLU A;  5CHX A;  1H8A A;  3V2N A;  1MUU A;  2CPS A;  3VYI A;  1KQL A;  1IFJ A;  3L35 A;  3L71 E;  3L75 E;  4EOT A;  2JP3 A;  1R8E A;  3BVH A;  5DJU B;  1KB9 D;  4JQ0 D;  1W2B O;  5KTB A;  1VQN P;  3AE5 C;  3MUD C;  4OGQ C;  1L0L K;  2L5G B;  1IJD B;  2A06 G;  1FU1 A;  3PH0 A;  2O1J A;  2NPS C;  1IFD A;  2N1T A;  1SQB D;  1S9K D;  5AVR B;  3H1K E;  4AQR D;  2OAR A;  1KQS O;  2M3B A;  3H1L D;  2N1T B;  1MKM A;  2WTY A;  1YQ3 C;  3AE4 C;  4NPE A;  3L72 D;  2QRX A;  1NO4 A;  1FZE A;  3L70 E;  1FC2 C;  1L0N J;  3M06 A;  4IOI H;  1LTT C;  4RKU J;  4PJ0 H;  4UB8 H;  4L73 A;  3TGU G;  2FYN B;  2IX7 C;  3BCC G;  4PD4 H;  4M3L A;  3SWK A;  2OYI A;  1NHL A;  3F5H A;  2M5A A;  1HJ0 A;  1X9V A;  4D6T J;  1KYO H;  4IL6 X;  4BRY A;  2A45 G;  4AYC A;  3NFQ A;  3U1A A;  3NTN A;  1NTM G;  2AEM A;  2M5A B;  1K73 Q;  3L71 J;  1EXI A;  3L75 J;  1MFT A;  3Q5R A;  1PIX A;  5B66 E;  4N6J A;  3NMD A;  1EZV G;  4ASW A;  2YIU B;  2WIT A;  3H1I G;  1A02 J;  3H1J G;  2IZ1 A;  1SQV D;  1BE3 E;  1HWT C;  3M9B A;  3O6Q A;  1ZME C;  1LTJ A;  1S5L H;  2N1T C;  5APS A;  1T2K D;  2CPB A;  2WSF J;  1LTI C;  4I6M C;  3O6Q B;  4QMA A;  5KKZ B;  3H1K J;  1IC2 A;  2KYV A;  1LTJ B;  3SWY A;  1GMJ A;  1M1J B;  3CXH D;  1K04 A;  1OVR A;  4NPF X;  2LR2 A;  2IBZ G;  1AJY A;  3M0D A;  2FYN C;  1GL2 A;  2Z4E A;  4RO0 A;  5AW0 B;  2RH0 A;  2PP6 A;  3L70 J;  2FXO A;  1FDO A;  2FYZ A;  1FOS E;  2AEF A;  2K9J A;  1RF0 C;  2QA4 P;  1EQ7 A;  2OTK E;  3OJA B;  3BAT A;  2E5Y A;  4W7Z A;  1PV3 A;  4OGQ D;  2YIU C;  1HBW A;  1HUC A;  4H44 D;  5CCG C;  4TT3 H;  1JTH B;  1OXZ A;  1YTZ T;  3HTK A;  3V2P A;  2IYP A;  2NPS D;  3U1C A;  2E74 B;  5APU A;  3AE2 C;  4KT0 J;  3HE4 B;  1SQB K;  5KKZ C;  1SFC D;  1LTJ C;  3HTK B;  3AEA C;  1BGY D;  5KAI H;  3USS A;  1M1J C;  1NOH A;  2KZJ A;  4DJG A;  2A06 E;  1GU4 A;  1N2D C;  1NTK D;  4O9B A;  2Q6Q A;  1ZXG A;  1JY3 P;  4KJM A;  3M0D C;  2G8Y A;  1J1E C;  2G3A A;  3A0B E;  3AE9 C;  1NU1 D;  2HR3 A;  1USE A;  2JO1 A;  3V2R A;  3A5T A;  1LTS C;  1S2E A;  1SQP E;  2KSJ A;  1SQX D;  1LP1 A;  3G4S P;  3VMY A;  2KOG A;  1YYC A;  4LGD E;  4IL6 H;  3HD7 D;  1FDI A;  2E74 C;  2WSE J;  1LP1 B;  2FYU K;  4L75 A;  1R5L A;  4N3Y B;  1L4A C;  1L0N G;  1SLQ A;  3CC4 P;  3WU2 E;  1X22 A;  1NTZ D;  1SQV K;  3W67 A;  5APQ A;  1LNQ A;  2J58 A;  1WMK A;  1NYH A;  1KB9 H;  2QJY B;  4WBA A;  1VL2 A;  1IFP A;  4D6T G;  3C8V A;  3PRJ A;  4GOF A;  1Y47 A;  2WSC J;  2AXC A;  2QIW A;  3S1K A;  3L71 G;  3L75 G;  1JY2 N;  2CK3 H;  3FXD A;  2I8D A;  1VF5 B;  2E5T A;  1SS1 A;  3WUU A;  1URQ D;  3GHG A;  2H7H A;  1TU3 F;  4U7J A;  1AQT A;  2VRS A;  1Y9B A;  3Q5S A;  3QH9 A;  3LW5 H;  1CI6 A;  2KIK A;  4PD4 I;  3H1K G;  3D70 A;  1SQP J;  1RH5 B;  1YJW P;  4CPG A;  1Q86 Q;  1L0L D;  4GOD A;  2ITA A;  4C7N A;  3L73 D;  3V2Q A;  1NH4 A;  2ZT9 D;  3AE1 C;  1CI6 B;  1FZB A;  1KYO I;  1DEE G;  2MKV A;  2V7Q H;  2QJY C;  3ZDM A;  2R32 A;  1KC8 Q;  2WPS A;  1KD1 Q;  1N7L A;  4PJ0 E;  4UB8 E;  1RE4 A;  3L70 G;  4PD4 E;  3IN6 A;  2H43 A;  2WZ7 A;  1M7L A;  2KLV A;  1QLE D;  1KYO E;  2O01 H;  2WMM A;  4I7Z B;  1LTG C;  1NGM B;  1NTK K;  1VF5 C;  3H32 B;  5APX A;  5APW A;  1BCC E;  2OGU A;  2IYO A;  5KLI C;  1N7S D;  3TNU B;  1NU1 K;  1R5S A;  1UIX A;  2K88 A;  1VQ8 P;  1S5L E;  1OIP A;  5APY A;  3W68 A;  5AW3 B;  2QM8 A;  3PHL A;  3V6I A;  1LWU B;  3V5B A;  3MUD A;  5DJT B;  3S9O A;  2FXP A;  1L4A D;  2ZYA A;  1GDT A;  1BDD A;  3TF5 A;  1SP4 A;  3KPE A;  2NPS A;  4H44 B;  1HJB A;  1HF9 A;  1NTZ K;  1GW3 A;  2YKO A;  2QEX P;  4I7Z C;  3S4R A;  1SFC A;  1EC5 A;  3CWB E;  1T2K C;  2NPS B;  1Q2N A;  3LIE A;  1SQQ G;  1SFC B;  1FBM A;  5GTH H;  3PP5 A;  3CC7 P;  3GF3 A;  1VQ4 P;  2M0B A;  4OH8 B;  2YNY A;  1OW6 A;  1A02 F;  4LC1 A;  3WMM 0;  2HYN A;  5CCH D;  3A2A A;  1M56 D;  2P2U A;  1FZA A;  1S3J A;  1DD4 A;  1Q90 D;  1BCC J;  1KQG B;  1ZN5 A;  4JF7 A;  5AVQ B;  2QG4 A;  2E43 A;  3AE6 C;  1LWU C;  1FJK A;  4HYT B;  2WSS H;  1JMM A;  1YBK A;  1RE3 A;  1FZC C;  1HVV A;  3A0H H;  1ZV8 A;  3I56 P;  4H44 C;  1LJ2 A;  4YPC A;  3L36 A;  4U3F D;  2W27 A;  1RQU A;  2B9B A;  3EWK A;  3MZW B;  2O3J A;  1Q81 Q;  3HD7 B;  2IFM A;  1BSN A;  2H89 C;  5KLV E;  1EDK A;  2BCC E;  2FFD B;  2POH A;  1RY3 A;  1G2C B;  1SFC C;  2WPQ A;  3AEG C;  3PJS K;  3B8E B;  1PP9 E;  1K05 A;  1P84 I;  3L74 J;  3B5N D;  4GT1 A;  3CWB J;  2DW3 A;  3H1H D;  4GDO A;  1VF5 D;  1BE3 D;  1SQP G;  1YQ4 C;  1QL1 A;  3N4X A;  2V4H A;  1KIL D;  2YO2 A;  1KB9 I;  1PGP A;  1KZU B;  4EIJ A;  1G1J A;  3MTU E;  4R4M A;  2SPZ A;  3JCU E;  2GM4 A;  1P84 E;  3I55 P;  2OYH B;  3CC2 P;  1RF0 A;  3A7O A;  4JYB A;  3IAO A;  2W8Z A;  2N9Y B;  4DCK A;  1KB9 E;  1U7M A;  1IO4 A;  2H88 C;  2P1J A;  5CCG A;  1X0T A;  1RE3 C;  1IK9 A;  1URQ B;  3IF4 A;  5K5G B;  4HH2 A;  1PPJ D;  2NZ2 A;  2FYU D;  3HD7 C;  1OVV A;  3CX5 H;  5TJH A;  2FFD C;  2R5B A;  1SQB E;  1JMB A;  3FX0 A;  4EI2 A;  2ZT9 B;  3E1R A;  1NAY A;  5BU5 A;  1M1J A;  1K8A Q;  3H1L E;  2KP8 A;  2WVR A;  5KLV J;  1X8Y A;  1FOS F;  2BCC J;  3LID A;  2GA1 A;  3L72 E;  3RL0 g;  2P7J A;  1W2E A;  1KMI Z;  1PP9 J;  2AXT H;  4R4L A;  2M3E A;  2OYH C;  1ZRT D;  3OAK A;  4LLH A;  1AVY A;  2RN0 A;  2A06 D;  1SQQ E;  1J1E B;  5KAF H;  1JTH A;  5CJ0 A;  1URQ C;  3HRN A;  3RK3 C;  1N7S B;  1RHZ B;  1L2P A;  1DD3 A;  1JCD A;  1AVO A;  4PV1 D;  1VPC A;  2L91 A;  1E79 H;  3GF7 A;  1PGQ A;  2ZYD A;  1N73 B;  1L4A A;  3HE4 A;  1SQV E;  4K3A A;  2ZT9 C;  3FGA D;  3G3Z A;  1JUN A;  4JBZ A;  2YMY A;  1L4A B;  1BCC G;  1SQB J;  3TGU D;  3BCC D;  1KFM A;  1OVU A;  1YTZ I;  1OMI A;  2XNX A;  4EYY Q;  4N78 D;  3H1L J;  5AW6 B;  3RK2 C;  3E7K A;  1JB0 J;  3L72 J;  1NTM D;  3LW5 J;  5GTI E;  2H8P D;  2OYO A;  4H0L B;  2Y0E A;  5CCH A;  3KQG A;  1EZV D;  3T97 B;  1N7S C;  3H1I D;  3H1J D;  2V7Q J;  2WPV B;  3BRT B;  2XZR A;  2XU6 A;  1VQ5 P;  1SQQ J;  3C9I A;  2QM7 A;  1N73 C;  3L74 G;  2BEZ F;  3CWB G;  3AEF C;  1KOR A;  3I5C A;  5AVY B;  1IFM A;  5GTH E;  2PAJ A;  2IDB A;  4L76 A;  2O01 J;  1JY2 O;  1QGK B;  1VQ6 P;  5C39 A;  2AEJ A;  3L4F A;  1EDJ A;  1DEB A;  2IBZ D;  2N9B A;  1H89 A;  3L37 A;  3P8C E;  1SQV J;  2WT7 B;  3CL3 D;  2UWJ E;  3VN0 A;  2Y0C A;  1BGY E;  1T8Z A;  3Q1M A;  4UB6 H;  2B87 B;  5CMZ A;  2Q3E A;  1GZL A;  5KJ7 C;  1M1K Q;  1NTK E;  1FZG A;  2QJK B;  3B5N A;  1HTL C;  2HLO A;  3B71 A;  1EDI A;  2E76 C;  4HJG H;  3H25 A;  3A0H E;  4H0L C;  1Y8A A;  1OWA A;  3B5N B;  5AW4 B;  1NU1 E;  3EFF K;  4NPD A;  4IFF A;  1NVO A;  2R44 A;  3QWO C;  2K1A A;  3AEE C;  5CCH C;  4AUW A;  1Q82 Q;  1KIL B;  5H2F H;  3A3Y B;  3RK3 D;  1SQX E;  5KLI B;  2D2C D;  5KLV G;  3VP8 A;  2BCC G;  4B86 A;  1LT9 B;  4DT0 A;  1XTC C;  3SSU A;  1PP9 G;  4I1L A;  3BAS A;  1NTZ E;  4IFM A;  3RL0 D;  2KNC A;  1EDL A;  3G71 P;  3KZI H;  2Y9Z A;  3ABV C;  1K9M Q;  1N8R Q;  1LTA C;  1U7J A;  2QJK C;  1RF1 B;  3M9H A;  3CCM P;  2KB7 P;  2LXC B;  1T3U A;  2KNC B;  4BXL A;  3CX5 I;  3H32 A;  1BGY J;  3AE3 C;  4BWN A;  1M8O B;  3RK2 D;  1IK7 A;  3B5N C;  4Z1M H;  2ZVO B;  1PGJ A;  1JM0 A;  1NTK J;  2P67 A;  3TNU A;  1PZQ A;  3JC2 2;  1QEX A;  1NTM K;  1KIL C;  3AEC C;  3CX5 E;  4L74 A;  2JEE A;  2Q5U A;  1NU1 J;  1LWU A;  1GTW A;  1YI2 P;  1L0N D;  4GOE A;  1OX3 A;  3TYY A;  1IFN A;  2QSI A;  1X79 B;  1LT9 C;  1GL2 D;  1SQB G;  5AVS B;  3D6Y A;  3CXH H;  1FZC A;  2C9N Y;  1YHQ P;  1SQX J;  3CPW O;  3CCQ P;  1L0L E;  1FE6 A;  3L73 E;  3H1L G;  5AW7 B;  4D6T D;  2WSC H;  3C1L A;  2YKP A;  1FZC B;  2AXT E;  2FKW B;  1CZQ A;  3L72 G;  3RGU A;  3ITK A;  4YXD C;  1RF1 C;  3P7K A;  2W90 A;  1CW5 A;  3L71 D;  3L75 D;  4PV1 B;  2MJZ A;  2E75 D;  1NTZ J;  3L74 E;  4RJT A;  3AED C;  1LGH B;  3VMX A;  2J59 M;  5KJ7 D;  5KAF E;  2KXP B;  2KS1 B;  4A7P A;  2E76 D;  2HOD B;  4C7R A;  3VTP C;  1JCC A;  1AQ5 A;  2Y0D A;  4H0L D;  3D6Z A;  1ZOY C;  2W6A A;  1DX7 A;  3H1K D;  2YXQ B;  1KQF B;  4YXW H;  1YJ9 P;  3D71 A;  1OW7 A;  1SQV G;  1DH3 A;  3AEB C;  1QVF O;  1AV1 A;  2A45 H;  3L70 D;  5KAI E;  1WT6 A;  4XE5 B;  3HE5 A;  4Y99 B;  1VQK P;  1P84 D;  1PFI A;  3HD7 A;  3MIW A;  1H0T A;  4GIF A;  2JKV A;  4PV1 C;  1L0L J;  3L73 J;  1FJP A;  2FFD A;  2B88 A;  4WY4 D;  3HE5 B;  1G2C A;  4WWI A;  5B5E H;  4XA4 A;  2Z5H A;  2O1K A;  4DOJ A;  1MZ9 A;  2R5D A;  1H0T B;  1HGZ A;  4KHX A;  3CCU P;  2OQQ A;  1Z56 A;  5AW9 B;  1YJN P;  1M57 D;  4K35 A;  2R3C A;  1CSB A;  2OYH A;  3KXD A;  2QE7 H;  1QL2 A;  4IL6 E;  1U57 A;  3GW6 A;  1VQO P;  3G9R A;  2FXM A;  1WRG A;  3CCJ P;  1NWQ A;  1S1C X;  2OTL P;  4H13 C;  2J5U A;  2Y9Y A;  1URQ A;  1G1I A;  2JDI H;  3IR9 A;  5L8R J;  1L0N K;  4Y99 C;  3GLM A;  1VQL P;  4OVN F;  3V4Q A;  5AW2 B;  4UB6 E;  1GK6 A;  1NAF A;  1PGO A;  1BGY G;  5CJ4 A;  2I1K A;  1USD A;  3RK3 B;  4ZNC A;  3CMA P;  3MHV A;  2Q7C A;  4U3F E;  1NTK G;  2D2C B;  1SQQ D;  2YKQ A;  2C0X A;  5E79 H;  3SWF A;  3FWN A;  3CCL P;  3OA7 A;  3VOP A;  4W7Y A;  1JY2 P;  2OYI B;  2W6B A;  2WWW A;  1S9K E;  1J1D B;  2OTJ P;  2KZI A;  1LTB C;  4BRY B;  2NRG A;  1NU1 G;  4HB1 A;  5AVZ B;  3RL0 B;  5H2F E;  3H1H E;  4ZMD A;  2BAS A;  4W80 A;  5EFW B;  2RKL A;  3O8Z A;  1OW8 A;  1SQX G;  2IZ0 A;  4TLF A;  3CCR P;  3P32 A;  1KIL E;  2XV5 A;  5AVV B;  3GMA A;  3UIA A;  4DZO A;  5AW1 B;  3K5B A;  5KLV K;  2FY8 A;  3RK2 B;  4OWF A;  1ZW0 A;  3TDK A;  1KV4 A;  1GU5 A;  1N86 A;  4HKZ H;  2ZAE B;  1N7S A;  3U59 A;  2XKM A;  3KZI E;  2KUB A;  3VMZ A;  1NTZ G;  3CCS P;  1S72 P;  1N73 A;  1JEK A;  1PPJ E;  5AVW B;  2D2C C;  5TIS H;  2FYU E;  4WVZ A;  1GL2 B;  4ZKU A;  2OYI C;  2YO3 A;  1J1D C;  3MGN A;  3CXH I;  3G6E P;  1BSH A;  4JYC A;  2KK7 A;  1SQP D;  4U3F J;  5AW5 B;  2K9J B;  3RL0 C;  1OZH A;  3PTZ A;  3M0A A;  2JWD A;  3AE7 C;  3RBX A;  5KJ7 A;  1VQM P;  1AFO A;  1XTG B;  2LXB A;  2JJL A;  3M91 A;  1FZF A;  3FXE A;  3CXH E;  1ZR4 A;  2E75 B;  2BEQ D;  3SFE C;  1IFI A;  3H1H J;  1HH0 A;  3VMA A;  1ZRT E;  2RMZ A;  2ZJS E;  3P8C D;  1T6A A;  1BE3 J;  3T97 A;  2E76 B;  1YIJ P;  4H13 D;  4JPZ B;  4XFJ A;  4MN4 C;  1L0L G;  3L73 G;  1JNM A;  1KTM A;  2O01 N;  2Q1K A;  2FBW C;  2JR8 A;  3R2P A;  1ZLL A;  3WUT A;  2WPR A;  1M90 Q;  2WSF H;  1GL2 C;  1QX8 A;  1FS0 E;  2B89 A;  1RQV A;  1UII A;  3EFG A;  2C9L Y;  3H6P A;  2Q3I A;  2WT7 A;  1DIP A;  2QJP B;  2FYU J;  2R3S A;  4WY4 A;  1SQQ K;  2A45 I;  2B87 A;  1Q7Y Q;  2P10 A;  5APT A;  1VDF A;  1J2J B;  5CBN A;  3TGU E;  3BCC E;  2E75 C;  2ZFC A;  4WY4 B;  3JCU H;  3Q3D A;  4N78 E;  1W5C E;  1P84 H;  2PFX A;  1EZV I;  1HGV A;  1MV8 A;  4YTP C;  2N1T D;  2KI7 B;  3R4Y A;  1NTM E;  3P8M C;  1E5W A;  4EDF A;  3HUS A;  4PD4 D;  2YXR B;  1KIL A;  1FAV A;  1OFC X;  1EZV E;  3TK1 A;  3AE8 C;  2W6J H;  1KYO D;  3H1I E;  3H1J E;  5B5E E;  1GD2 E;  2YMK A;  5M1B A;  3HUS B;  5B66 H;  1LT9 A;  1GW4 A;  3N7N A;  2IBZ I;  4ZKP A;  4ASV A;  3KYQ A;  3OW2 O;  1PL5 A;  1BCC D;  2W83 C;  2QJP C;  3KDP B;  3CX5 D;  1S4X A;  1LT1 A;  2PRR A;  1RF1 A;  2IBZ E;  2K3R A;  3SFD C;  2QVA A;  4IFD K;  2K37 A;  4WY4 C;  1JO5 A;  5CCG D;  1SQP K;  3GHG B;  3NXS A;  2HFE D;  1IZN B;  2ZYG A; 
#chains in the Genus database with same CATH homology
 5TJH A;  3TGU D;  3BCC D;  3CXH D;  3PHL A;  3H1L D;  1NU1 D;  4U3F D;  5KLV D;  3L70 D;  2BCC D;  1SQP D;  2O3J A;  3L72 D;  2K9J B;  1L0N D;  1SQQ D;  3TF5 A;  1P84 D;  1PP9 D;  1SQX D;  1NTM D;  1L0L D;  3PTZ A;  3L73 D;  3L74 D;  3CWB D;  2Y0E A;  2FYN B;  5KLI B;  4EDF A;  4PD4 D;  1EZV D;  1ZRT D;  3H1H D;  4D6T D;  3KHU A;  1BE3 D;  3H1I D;  3H1J D;  3VMA A;  2RMZ A;  3ITK A;  2RN0 A;  1KYO D;  2A06 D;  1NTZ D;  3L71 D;  3L75 D;  3FWL A;  4RJT A;  2QJY B;  1KB9 D;  2N9Y B;  1BCC D;  3TDK A;  2YIU B;  4A7P A;  3CX5 D;  3PRJ A;  1SQV D;  3GW6 A;  2IBZ D;  2L91 A;  1BGY D;  2Y0D A;  2KNC B;  2KS1 A;  2QG4 A;  2Y0C A;  3PLN A;  1PPJ D;  1NTK D;  2FYU D;  3H1K D;  2Q3E A;  1SQB D;  2QJP B;  3GG2 A;  2JWA A;  5KKZ B;  2QJK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...