2JWAA

Erbb2 transmembrane segment dimer spatial structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
44
structure length
44
Chain Sequence
GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Receptor tyrosine-protein kinase erbB-2
publication title Spatial Structure of the Dimeric Transmembrane Domain of the Growth Factor Receptor ErbB2 Presumably Corresponding to the Receptor Active State
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 44
sequence length 44
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2jwaA00
1BE3D 2N9YB 1KB9D 4EDFA 3PHLA 1BCCD 3CWBD 2Y0EA 1L0ND 2IBZD 3BCCD 3TDKA 3TGUD 2FYNB 4RJTA 3H1LD 2KNCB 3L72D 2RMZA 3PTZA 1NTKD 3ITKA 2L91A 3L70D 1SQQD 3TF5A 2BCCD 3H1ID 3H1KD 5KLVD 2Q3EA 2Y0CA 1L0LD 2YIUB 1SQPD 1NTZD 1P84D 1SQXD 2O3JA 4D6TD 3L71D 5KLIB 2QJYB 4U3FD 5KKZB 2K9JB 1NTMD 1SQVD 1EZVD 1BGYD 3L75D 3VMAA 3L74D 4A7PA 2QJKB 3GW6A 2RN0A 2FYUD 1PPJD 1NU1D 3CX5D 1PP9D 5TJHA 3PLNA 3CXHD 1ZRTD 2KS1A 3GG2A 3L73D 3PRJA 1SQBD 2A06D 2JWAA 3H1HD 2Y0DA 1KYOD 2QJPB 3FWLA 3H1JD 3KHUA 2QG4A 4PD4D
chains in the Genus database with same CATH superfamily
3SSUA 1A02F 1LP1A 2Y0EA 3CPWO 1VQLP 1J1EB 5H2FE 3U1AA 2HPCA 3QWOC 1W2EA 2BCCE 1NOHA 3H6PA 3LW5H 3L70D 5CJ4A 2Y9ZA 2FYNC 5KLVD 3V5BA 3L73G 3KZIH 2E76D 1KQSO 1AVOA 4L75A 1SQQK 3L72J 3CX5H 3H1HG 4D6TE 1L0LD 4DZOA 2YIUB 3EWKA 4AQRD 1SQPD 4OWFA 2YXRB 4U3FE 5AVYB 1X79B 1OZHA 1NTME 1RF1B 3NMDA 3I55P 1S72P 2IBZG 1URQD 5EFWB 2NPSD 1BGYD 3II6A 2H88C 4OGQC 1NU1E 2FYUJ 2ZT9D 1GZLA 5KAFE 1FZCC 1SVFA 2H8PD 1PPJD 2QE7H 4H13B 1LWUC 2L5GB 3CL3D 2J5UA 3B5NC 1M57D 2QJKC 1VF5D 3L75G 5CCHC 2PP6A 1JNMA 2C0WA 1GK4A 1BCCE 5AW8B 1LJ2A 1EQ7A 4JYCA 2E75C 1K9MQ 1S2EA 1KFMA 4HYTB 1VQ7P 3CI9A 2G8YA 1EDKA 1NTZE 2ZAEB 4WVZA 3K5BA 1K73Q 1JY3N 1RH5B 1NTKD 1S9KE 1MUUA 5E79E 4HB1A 2L91A 1M90Q 3HUSA 1IC2A 2C9LY 2M5AB 4K3AA 1YQ4C 1S1CX 4H0LB 3RK2C 1NVOA 2CPSA 2A06G 2P67A 2HLOA 3OAKA 5KJ7A 4IOIH 1FU1A 4DT0A 3CCEP 4XFJA 1JY3P 2IDBA 1AJYA 3IFMA 1ZXGA 3OA7A 2KS1B 3HE5A 2AXCA 2WSSH 4PV1B 3Q2YA 2YIUC 4OGQD 1MZ9A 2KXPB 3VP8A 1IO4A 5DJTB 1JUNA 2E74B 1RF1C 4YTPC 3L73J 2KS1A 3B5ND 3H1HJ 5APQA 3HTKB 2JWAA 3H1JJ 1NKNA 4H13C 2QJPB 3FWLA 2B9BA 1Z56A 1KB9E 1A02J 5GTHE 1YJ9P 1SQBK 5KLVE 4NPEA 2ZVNB 2E75D 2ZVOB 3VMXA 3ZDMA 1VQPP 2CK3H 5AVUB 2H89C 3R2PA 5BU5A 2WWWA 4H44D 3HTKA 2E42A 1SQVG 3RL0B 2YMYA 2JKVA 2PGDA 1H0TA 3ITKA 1N7LA 3W68A 2HODB 3Q5RA 1RE4A 1KFNA 2V4HA 3A2AA 2PRRA 3RK2D 1PPJE 4GIFA 2HG5D 3TYYA 3AE6C 3SFEC 3RK3B 1SQXD 2HODA 4NPDA 2WZ7A 3OJAB 4GT1A 4H0LC 2IYPA 2IPPA 1FAVA 1H89A 3P32A 1FJPA 2FYUE 3AEGC 2KK7A 3L75D 3L74D 3NXSA 3CCMP 4CPGA 1PP9J 2OGUA 1EDLA 2FXMA 2XV5A 2P10A 4PV1C 5BU8B 2E74C 3FGAD 1KYOD 4I1LA 2RKLA 1LT9B 3AEDC 1KYOI 2N1TB 2KI7B 3Q1MA 1X0TA 2OYHB 4L73A 3AE1C 3B8EB 1Q81Q 1SQBG 2WSCJ 1VQOP 2D2CB 2QJPC 2QM7A 3CC4P 2LKMA 3H1IE 1YJNP 4R4LA 1RE4C 2OYHA 1SQQD 1BE3G 3A0HH 3V2RA 2Z4EA 3R4YA 1LTGC 3RGUA 3VMYA 1KQLA 3RL0C 1NAYA 3AE2C 4M3LA 3WU2H 1VQ9P 3G71P 3TGUG 5KJ7D 4YXDC 1SFCA 2E76B 2ZFCA 1PGJA 2P1JA 3UIAA 2QJYC 1ZR2A 1QEXA 1KV4A 1GD2E 1KYOH 3A0BE 2R3CA 2QA4P 3RK3C 1URQB 2NPSB 2LXBA 3AE7C 2ZT9B 3GHGA 3L73E 3VMZA 3L70G 3A3YB 4U3FJ 1N2DC 1X9VA 3H1HE 1WT6A 2BEZF 2JR8A 2E74D 1R5LA 2I1KA 1JOCA 2NPSA 2WSFH 1ZV8A 1L0LG 1VF5B 1LTIC 4DCKA 1SQPG 1EDIA 2IBZE 3MP7B 1L0NJ 4UB8E 4WWIA 1JY3O 1LNQA 1EXIA 5B66H 3V6IA 1VQ6P 3TDKA 2C9NY 1LT9C 1BGYG 4IL6E 3H1LD 2KB7P 2N1TC 1GU5A 2OYHC 3B4SA 4I7ZB 3G4SP 1NHLA 4GOEA 3D6ZA 3JCUE 2D2CC 3WU2E 5AW0B 1Q90D 4KT0J 3GF7A 3PH0A 4XE5B 3AEBC 1NTZJ 5CBNA 3G6EP 1P84D 1PFIA 1M7LA 3T97B 3L71D 3LW5J 4HJGH 1KILA 2YKOA 1EXJA 1KMIZ 2O1JA 5L8RJ 3IN6A 1PP9E 4A7PA 1CSBA 1NTKG 1RQVA 1VDFA 1OVUA 1JTHB 2A06E 1PGQA 1M1KQ 1DH3A 1SQBD 3GLMA 3H32A 4L76A 2NPSC 3B5NB 1VQ8P 2ZT9C 4PD4E 2IZ0A 1QVFO 2JP3A 1BE3D 2P7JA 1RY3A 5B5EH 3BCCD 3Q5SA 1LP1B 3SWKA 2YMKA 1ZOYC 3TGUD 5CBOA 1P84H 1VF5C 3ABVC 4DOJA 4H44B 2VRSA 2GUVA 2AEFA 1FZAA 4EI2A 1AV1A 2ZJSE 2H43A 3D71A 5KLVJ 2D2CD 1QX8A 3FXDA 1SFCD 5KAIH 1L0LJ 3AEEC 5AW1B 2Q3EA 1SQPJ 1Y47A 2Q7CA 3F5HA 1ZMEC 2K3RA 4TT3H 4I7ZC 3RK2B 4EYYQ 2E5TA 1JY2N 2R3SA 3MGNA 2O3JA 3L37A 1DX7A 2O1KA 2WSEJ 2W90A 1IFIA 1SQVE 3CC2P 5AW6B 1QVGO 2A45I 1HUCA 3WUTA 4N78D 4PJ0H 3AEFC 1IFMA 2OTLP 3BATA 3VYIA 1UIXA 3CXHD 3M9BA 4MN4C 1ZRTD 4W7ZA 1DIPA 4KHXA 4L74A 3CXHI 1T2KC 2FXOA 3C1LA 3B71A 3KDPB 2WTYA 1GTWA 5AVRB 4YPCA 3S9OA 4KJMA 1L0NE 1SQXG 1IFPA 1FS0E 2W6JH 5CJ0A 1VQNP 4UB6E 3P7KA 1OVVA 1YTZT 2I1JA 1NTKJ 3L72D 3L74G 2IFMA 1NWQA 1ZW0A 3E1IA 5AW7B 1G2CB 1NKZB 3HUSB 1JB0J 2IX7C 3L4FA 3VN0A 3FXEA 3RBXA 1T3UA 3RK3E 3M9HA 2Z5IA 4H44C 3V4QA 4GOFA 3CXHH 2P2UA 2ITAA 1G2CA 4JQ0D 1YYCA 1T6AA 3H1IJ 5CHXA 1KILD 1H8AA 4N6JA 3MHVA 3H1KG 1PIXA 2ZYGA 3E1RA 3HE5B 2IFNA 3USSA 3KZIE 4ZKPA 4TLFA 1GL2D 3CX5E 2P58A 2O01J 1G1IA 5CMZA 2W8ZA 3V4WA 1NTMK 1SQQG 3TGUE 1LTJA 2FY8A 2E43A 4XA4A 1T2KD 1N7SD 2QRXA 1NU1K 5CCGA 3V2NA 2QEXP 1YI2P 1Q7YQ 2KLVA 3KPEA 4HKZH 5AW4B 3KHUA 3Q3DA 2ZXEB 3U1CA 2JO1A 4ASWA 2FFDB 1T3JA 1HWTC 2H7HA 3M0DA 4BRYA 4C7NB 1DEBA 3WUVA 3L70E 1H0TB 1K8AQ 5AVSB 2FYZA 3E7KA 5AVZB 1Q2NA 1K04A 3MD0A 2FFDA 3CWBG 3C8VA 2QVAA 1L0LE 4C7NA 1SQPE 2XNXA 2Y0CA 1OIPA 1SQXJ 3CCRP 3HUSC 5AVXB 3O6QB 3MZWB 3SWYA 3S1KA 5GTIH 1AVYA 1BGYE 2QJYB 2WPQA 3L75J 1EZVD 1VQ5P 5KJ7C 1S4XA 1EZVI 3H1LG 2RN0A 1OX3A 3O6QA 1HF9A 1LTJC 4D6TG 2CPBA 2OYIB 4I2LC 1N8RQ 2XZRA 4HH2A 2R5DA 2IBZI 4NPFX 4OVNF 1L2PA 2WT7A 1FOSE 1T8ZA 2C0XA 1NU1G 5APUA 1IK9A 2OYIA 3A7OA 3M0DC 3BRVB 3L71G 1FE6A 1YHQP 2OYOA 1NTKE 1USDA 4JF7A 3I56P 1VQ4P 3VP9A 1NAFA 3EFGA 2MKVA 4I6MC 3OW2O 2YKPA 4EOTA 1E5WA 2OARA 2WSFJ 2FFDC 3IR9A 3TF5A 4C46A 2N9BA 3AEAC 1R8EA 3H1KD 1PZQA 1JY2O 1VQMP 1G1JA 4GDOA 2O01N 3VTPC 1SFCB 1U57A 1LTAC 1Q86Q 3CCSP 5GTIE 3NFQA 1L4AA 3N7NA 1OMIA 3SFDC 3BCCG 5APVA 1S3JA 1S5LH 2W27A 2ZYAA 4Y99B 4R4MA 1XTCC 3GHGB 1KN7A 4PD4I 2Y9YA 4Z1MH 5CCGD 3FX0A 1SQVJ 2FYUK 1FDMA 3MUDA 2KYVA 2YNYA 1EC5A 3M9QA 2OYIC 2WPVB 2KP8A 3M0AA 4WBAA 1IFDA 3CWBD 3SWFA 1U7JA 5TISH 2GA1A 2OQQA 3H1LJ 2Q3IA 1FOSF 3CCUP 2BCCD 3KXDA 2V7QH 1LGHB 1SQXE 1Q82Q 2R32A 1UIIA 2MJZA 5AW2B 1AQTA 3CMEP 1L4AC 4D6TD 2B89A 3A0HE 4WY4A 1FZFA 2SPZA 4U3FD 3L75E 3CD6P 3GF3A 3L74E 5AVWB 1KILB 1NTMD 1SFCC 3BVHA 4RESB 5APWA 3G9RA 1D7MA 3CCJP 3L72G 1NU1D 2WQYC 1GL2B 2KSJA 2K1AA 1SQBJ 1NJIQ 2JWDA 1KYOE 3PRJA 5H2FH 4Y99C 3H32B 2BASA 1N7SB 5DJUB 2WMMA 1IFNA 1SP4A 3GHGC 1BE3J 3H1KE 1GL2A 3LIDA 1HVVA 4U7JA 3BCCJ 3PHLA 1BCCD 1GW4A 3Q5PA 1FJKA 1KORA 3TGUJ 3CMAP 3D6YA 4RJTA 1N7SA 4JYBA 1SQQE 2RMZA 3BASA 1HBWA 1LT1A 1S9KD 1YITP 5B66E 2W83C 5AVQB 1NO4A 1KQFB 2ZXXA 5KAFH 2W6BA 3L70J 1JM0A 1L4AD 1FZCA 3JC22 3EFFK 3CX5I 2LR2A 3HE4B 2YO3A 4GODA 2PFXA 2K9JB 5APYA 1IJDB 1CZQA 2B88A 1WMKA 3CCVP 3CWBE 5CCHA 1YBKA 2W6AA 2B87A 3AE5C 3AE9C 1FBMA 2XKMA 3PLNA 3HE4A 1OVRA 1AQ5A 1J1DB 1KILC 1DD3A 4ZNCA 4AUWA 4EIJA 2IYOA 1BGYJ 2K9JA 1M8OB 2AEJA 1RE3A 3JSVC 1IFJA 3AE4C 1GL2C 1W5CE 1QLED 5E79H 1JEKA 1NYHA 2QG4A 4IFMA 1PGOA 2RH0A 1KB9D 4EDFA 1PGPA 1KB9I 2HFED 3H1LE 1AFOA 4W7YA 1NH4A 1JY2P 1N7SC 4LLHA 2JJLA 1M1JB 1EZVG 1OW6A 3H1JG 3KYQA 3EQ2A 2M3EA 3P8CD 5B5EE 1OFCX 2AXTH 1M1JA 2JDIH 1IK7A 1P84E 2K37A 1PL5A 4ASVA 3L71E 2FBWC 5APXA 2Q5UA 2WPSA 1Y8AA 1H88A 2A45H 4WY4D 3N4XA 2GUSA 4C7RA 1RF1A 1ZR4A 5KLIB 5KKZB 1QL1A 2KLUA 5KAIE 1RHZB 4WB4A 3VMAA 2BEQD 2FYUD 1KB9H 2XDJA 1WRGA 4QMAA 2NZ2A 4RO0A 5GTHH 1SQVK 5AW9B 1SQBE 4W80A 3WUUA 3WMM0 3M91A 1LTJB 2KZJA 1RE3C 3A5TA 1HGVA 2FXPA 1KQGB 4PJ0E 3HD7B 4BXLA 2HR3A 1BE3E 2WSEH 1J1DC 3BCCE 1PP9G 4DJGA 3CLQA 1J1EC 2K88A 3RL0g 1N73B 3G3ZA 1FZGA 4BRYB 3HD7A 4O9BA 1JO5A 3L36A 1R5SA 1VL2A 1X8YA 1L0NK 2HYNA 4LGDE 1GW3A 3H1ID 2M5AA 1MFTA 1N73A 5APTA 1M1JC 2AXTE 1VQKP 1YQ3C 1KD1Q 2KIKA 1FDIA 2M3BA 1TU3F 2R5BA 3HRNA 1GU4A 4N78E 2M8RA 4JBZA 4LC1A 1KC8Q 1FC2C 1NTZK 2QSIA 3M06A 1YTZI 5CCHD 1S5LX 4IL6X 2YO2A 3CXHE 1ZRTE 1JMBA 3MTUE 5KLIC 1X22A 5KKZC 2BCCG 2Q9IA 3GG2A 1LTSC 1HJBA 3L73D 1SLQA 4N3YB 5AVVB 1EDJA 4JPZB 5BVZA 3L74J 3H1HD 2POHA 2WT7B 2AEMA 3V2PA 3H1JD 3P8CE 2Q1KA 1MFZA 3I5CA 1OW7A 3P8MC 5AVTB 2IBZD 5CCGC 1ZN5A 4U3FG 3HD7C 1ZP0C 3L72E 1NTMG 4IFFA 2O01H 1FZEA 1BSHA 3PTZA 1NGMB 1CI6B 4ZMDA 1PV3A 1N73C 3H1KJ 3AECC 5K5GB 1L0NG 1OW8A 2K9YA 3A0BH 2QM8A 3PP5A 3FWNA 2KUBA 1KILE 1CI6A 3RBZA 5KTBA 1SQQJ 5KLVK 1L4AB 3D70A 1BCCG 4RKUJ 1L0LK 3C9IA 3IF4A 1SQPK 2KSEA 2V7QJ 2DW3A 2G3AA 1HTLC 4ZKUA 4H13D 5C39A 3AE8C 1W2BO 2IZ1A 1NTZG 3CCQP 1PP9D 1M56D 4UB8H 1HJ0A 1XTGB 3TNUB 3AE3C 2A06D 2YXQB 3NTNA 4IL6H 3U59A 2FKWB 1LT9A 2N1TA 1GMJA 1K05A 2Y0DA 4PD4D 3CWBJ 2XNDH 4OH8B 2OTJP 1AA0A 3JCUH 3TNUA 3PJSK 3HD7D 3TK1A 5M1BA 5AW5B 2BCCJ 2QIWA 3VOPA 4H0LD 1N86A 4AYCA 1OWAA 3CC7P 1NTKK 2R44A 2A45G 4YXWH 3CCLP 2OTKE 1BSNA 1DEEG 1IZNB 2JEEA 4D6TJ 1MKMA 1RF0A 2WITA 1YJWP 4PV1D 1QGKB 1EZVE 1JMMA 1NTMJ 4WY4B 3V2QA 1Y9BA 4Y28J 5KLVG 2M0BA 3H1JE 1SQVD 2KZIA 1URQA 2ZYDA 1DD4A 1QL2A 4PD4H 1JCCA 3MIWA 1ZLLA 1NU1J 3GW6A 3O8ZA 1E79H 2J59M 4BWNA 3L71J 4K35A 2WSCH 2WPRA 1GK6A 1LTBC 1CW5A 3S4RA 1USEA 2PAJA 1S5LE 1KTMA 2UWJE 1LTTC 3IAOA 3L35A 1PPJG 2XU6A 3H25A 1BCCJ 2N9YB 1U7MA 2LXCB 1GDTA 1L0ND 1MV8A 3RL0D 3F89A 3MUDC 2KOGA 2I8DA 2FYNB 1JCDA 2KNCB 1SS1A 2FYUG 2WVRA 2NRGA 1P84I 2Q6QA 3QH9A 5TISE 2E76C 3LIEA 1YIJP 1HGZA 3RK3D 1OXZA 2KNCA 1RF0C 4OGQB 1FZBA 2J58A 3W67A 1NTZD 1FZCB 3T97A 4B86A 4GKGA 1LWUB 5AW3B 1RQUA 1URQC 1BDCA 1SQXK 4IFDK 1VPCA 5APSA 2QJKB 2Z5HA 3BRTB 2E5YA 1KZUB 3CX5D 2YKQA 5TJHA 4WY4C 3TSIA 2B87B 1JTHA 1LWUA 3H1IG 4UB6H 2GM4A 1HH0A 1BDDA 2E75B 3B5NA 3GMAA 2N1TD 2HPCB 3KQGA 1J2JB 1FDOA
chains in the Genus database with same CATH topology
1BE3D 2N9YB 1KB9D 4EDFA 3PHLA 1BCCD 3CWBD 2Y0EA 1L0ND 2IBZD 3BCCD 3TDKA 3TGUD 2FYNB 4RJTA 3H1LD 2KNCB 3L72D 2RMZA 3PTZA 1NTKD 3ITKA 2L91A 3L70D 1SQQD 3TF5A 2BCCD 3H1ID 3H1KD 5KLVD 2Q3EA 2Y0CA 1L0LD 2YIUB 1SQPD 1NTZD 1P84D 1SQXD 2O3JA 4D6TD 3L71D 5KLIB 2QJYB 4U3FD 5KKZB 2K9JB 1NTMD 1SQVD 1EZVD 1BGYD 3L75D 3VMAA 3L74D 4A7PA 2QJKB 3GW6A 2RN0A 2FYUD 1PPJD 1NU1D 3CX5D 1PP9D 5TJHA 3PLNA 3CXHD 1ZRTD 2KS1A 3GG2A 3L73D 3PRJA 1SQBD 2A06D 2JWAA 3H1HD 2Y0DA 1KYOD 2QJPB 3FWLA 3H1JD 3KHUA 2QG4A 4PD4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE3 D;  2N9Y B;  1KB9 D;  4EDF A;  3PHL A;  1BCC D;  3CWB D;  2Y0E A;  1L0N D;  2IBZ D;  3BCC D;  3TDK A;  3TGU D;  2FYN B;  4RJT A;  3H1L D;  2KNC B;  3L72 D;  2RMZ A;  3PTZ A;  1NTK D;  3ITK A;  2L91 A;  3L70 D;  1SQQ D;  3TF5 A;  2BCC D;  3H1I D;  3H1K D;  5KLV D;  2Q3E A;  2Y0C A;  1L0L D;  2YIU B;  1SQP D;  1NTZ D;  1P84 D;  1SQX D;  2O3J A;  4D6T D;  3L71 D;  5KLI B;  2QJY B;  4U3F D;  5KKZ B;  2K9J B;  1NTM D;  1SQV D;  1EZV D;  1BGY D;  3L75 D;  3VMA A;  3L74 D;  4A7P A;  2QJK B;  3GW6 A;  2RN0 A;  2FYU D;  1PPJ D;  1NU1 D;  3CX5 D;  1PP9 D;  5TJH A;  3PLN A;  3CXH D;  1ZRT D;  2KS1 A;  3GG2 A;  3L73 D;  3PRJ A;  1SQB D;  2A06 D;  2JWA A;  3H1H D;  2Y0D A;  1KYO D;  2QJP B;  3FWL A;  3H1J D;  3KHU A;  2QG4 A;  4PD4 D; 
#chains in the Genus database with same CATH topology
 3SSU A;  1A02 F;  1LP1 A;  2Y0E A;  3CPW O;  1VQL P;  1J1E B;  5H2F E;  3U1A A;  2HPC A;  3QWO C;  1W2E A;  2BCC E;  1NOH A;  3H6P A;  3LW5 H;  3L70 D;  5CJ4 A;  2Y9Z A;  2FYN C;  5KLV D;  3V5B A;  3L73 G;  3KZI H;  2E76 D;  1KQS O;  1AVO A;  4L75 A;  1SQQ K;  3L72 J;  3CX5 H;  3H1H G;  4D6T E;  1L0L D;  4DZO A;  2YIU B;  3EWK A;  4AQR D;  1SQP D;  4OWF A;  2YXR B;  4U3F E;  5AVY B;  1X79 B;  1OZH A;  1NTM E;  1RF1 B;  3NMD A;  3I55 P;  1S72 P;  2IBZ G;  1URQ D;  5EFW B;  2NPS D;  1BGY D;  3II6 A;  2H88 C;  4OGQ C;  1NU1 E;  2FYU J;  2ZT9 D;  1GZL A;  5KAF E;  1FZC C;  1SVF A;  2H8P D;  1PPJ D;  2QE7 H;  4H13 B;  1LWU C;  2L5G B;  3CL3 D;  2J5U A;  3B5N C;  1M57 D;  2QJK C;  1VF5 D;  3L75 G;  5CCH C;  2PP6 A;  1JNM A;  2C0W A;  1GK4 A;  1BCC E;  5AW8 B;  1LJ2 A;  1EQ7 A;  4JYC A;  2E75 C;  1K9M Q;  1S2E A;  1KFM A;  4HYT B;  1VQ7 P;  3CI9 A;  2G8Y A;  1EDK A;  1NTZ E;  2ZAE B;  4WVZ A;  3K5B A;  1K73 Q;  1JY3 N;  1RH5 B;  1NTK D;  1S9K E;  1MUU A;  5E79 E;  4HB1 A;  2L91 A;  1M90 Q;  3HUS A;  1IC2 A;  2C9L Y;  2M5A B;  4K3A A;  1YQ4 C;  1S1C X;  4H0L B;  3RK2 C;  1NVO A;  2CPS A;  2A06 G;  2P67 A;  2HLO A;  3OAK A;  5KJ7 A;  4IOI H;  1FU1 A;  4DT0 A;  3CCE P;  4XFJ A;  1JY3 P;  2IDB A;  1AJY A;  3IFM A;  1ZXG A;  3OA7 A;  2KS1 B;  3HE5 A;  2AXC A;  2WSS H;  4PV1 B;  3Q2Y A;  2YIU C;  4OGQ D;  1MZ9 A;  2KXP B;  3VP8 A;  1IO4 A;  5DJT B;  1JUN A;  2E74 B;  1RF1 C;  4YTP C;  3L73 J;  2KS1 A;  3B5N D;  3H1H J;  5APQ A;  3HTK B;  2JWA A;  3H1J J;  1NKN A;  4H13 C;  2QJP B;  3FWL A;  2B9B A;  1Z56 A;  1KB9 E;  1A02 J;  5GTH E;  1YJ9 P;  1SQB K;  5KLV E;  4NPE A;  2ZVN B;  2E75 D;  2ZVO B;  3VMX A;  3ZDM A;  1VQP P;  2CK3 H;  5AVU B;  2H89 C;  3R2P A;  5BU5 A;  2WWW A;  4H44 D;  3HTK A;  2E42 A;  1SQV G;  3RL0 B;  2YMY A;  2JKV A;  2PGD A;  1H0T A;  3ITK A;  1N7L A;  3W68 A;  2HOD B;  3Q5R A;  1RE4 A;  1KFN A;  2V4H A;  3A2A A;  2PRR A;  3RK2 D;  1PPJ E;  4GIF A;  2HG5 D;  3TYY A;  3AE6 C;  3SFE C;  3RK3 B;  1SQX D;  2HOD A;  4NPD A;  2WZ7 A;  3OJA B;  4GT1 A;  4H0L C;  2IYP A;  2IPP A;  1FAV A;  1H89 A;  3P32 A;  1FJP A;  2FYU E;  3AEG C;  2KK7 A;  3L75 D;  3L74 D;  3NXS A;  3CCM P;  4CPG A;  1PP9 J;  2OGU A;  1EDL A;  2FXM A;  2XV5 A;  2P10 A;  4PV1 C;  5BU8 B;  2E74 C;  3FGA D;  1KYO D;  4I1L A;  2RKL A;  1LT9 B;  3AED C;  1KYO I;  2N1T B;  2KI7 B;  3Q1M A;  1X0T A;  2OYH B;  4L73 A;  3AE1 C;  3B8E B;  1Q81 Q;  1SQB G;  2WSC J;  1VQO P;  2D2C B;  2QJP C;  2QM7 A;  3CC4 P;  2LKM A;  3H1I E;  1YJN P;  4R4L A;  1RE4 C;  2OYH A;  1SQQ D;  1BE3 G;  3A0H H;  3V2R A;  2Z4E A;  3R4Y A;  1LTG C;  3RGU A;  3VMY A;  1KQL A;  3RL0 C;  1NAY A;  3AE2 C;  4M3L A;  3WU2 H;  1VQ9 P;  3G71 P;  3TGU G;  5KJ7 D;  4YXD C;  1SFC A;  2E76 B;  2ZFC A;  1PGJ A;  2P1J A;  3UIA A;  2QJY C;  1ZR2 A;  1QEX A;  1KV4 A;  1GD2 E;  1KYO H;  3A0B E;  2R3C A;  2QA4 P;  3RK3 C;  1URQ B;  2NPS B;  2LXB A;  3AE7 C;  2ZT9 B;  3GHG A;  3L73 E;  3VMZ A;  3L70 G;  3A3Y B;  4U3F J;  1N2D C;  1X9V A;  3H1H E;  1WT6 A;  2BEZ F;  2JR8 A;  2E74 D;  1R5L A;  2I1K A;  1JOC A;  2NPS A;  2WSF H;  1ZV8 A;  1L0L G;  1VF5 B;  1LTI C;  4DCK A;  1SQP G;  1EDI A;  2IBZ E;  3MP7 B;  1L0N J;  4UB8 E;  4WWI A;  1JY3 O;  1LNQ A;  1EXI A;  5B66 H;  3V6I A;  1VQ6 P;  3TDK A;  2C9N Y;  1LT9 C;  1BGY G;  4IL6 E;  3H1L D;  2KB7 P;  2N1T C;  1GU5 A;  2OYH C;  3B4S A;  4I7Z B;  3G4S P;  1NHL A;  4GOE A;  3D6Z A;  3JCU E;  2D2C C;  3WU2 E;  5AW0 B;  1Q90 D;  4KT0 J;  3GF7 A;  3PH0 A;  4XE5 B;  3AEB C;  1NTZ J;  5CBN A;  3G6E P;  1P84 D;  1PFI A;  1M7L A;  3T97 B;  3L71 D;  3LW5 J;  4HJG H;  1KIL A;  2YKO A;  1EXJ A;  1KMI Z;  2O1J A;  5L8R J;  3IN6 A;  1PP9 E;  4A7P A;  1CSB A;  1NTK G;  1RQV A;  1VDF A;  1OVU A;  1JTH B;  2A06 E;  1PGQ A;  1M1K Q;  1DH3 A;  1SQB D;  3GLM A;  3H32 A;  4L76 A;  2NPS C;  3B5N B;  1VQ8 P;  2ZT9 C;  4PD4 E;  2IZ0 A;  1QVF O;  2JP3 A;  1BE3 D;  2P7J A;  1RY3 A;  5B5E H;  3BCC D;  3Q5S A;  1LP1 B;  3SWK A;  2YMK A;  1ZOY C;  3TGU D;  5CBO A;  1P84 H;  1VF5 C;  3ABV C;  4DOJ A;  4H44 B;  2VRS A;  2GUV A;  2AEF A;  1FZA A;  4EI2 A;  1AV1 A;  2ZJS E;  2H43 A;  3D71 A;  5KLV J;  2D2C D;  1QX8 A;  3FXD A;  1SFC D;  5KAI H;  1L0L J;  3AEE C;  5AW1 B;  2Q3E A;  1SQP J;  1Y47 A;  2Q7C A;  3F5H A;  1ZME C;  2K3R A;  4TT3 H;  4I7Z C;  3RK2 B;  4EYY Q;  2E5T A;  1JY2 N;  2R3S A;  3MGN A;  2O3J A;  3L37 A;  1DX7 A;  2O1K A;  2WSE J;  2W90 A;  1IFI A;  1SQV E;  3CC2 P;  5AW6 B;  1QVG O;  2A45 I;  1HUC A;  3WUT A;  4N78 D;  4PJ0 H;  3AEF C;  1IFM A;  2OTL P;  3BAT A;  3VYI A;  1UIX A;  3CXH D;  3M9B A;  4MN4 C;  1ZRT D;  4W7Z A;  1DIP A;  4KHX A;  4L74 A;  3CXH I;  1T2K C;  2FXO A;  3C1L A;  3B71 A;  3KDP B;  2WTY A;  1GTW A;  5AVR B;  4YPC A;  3S9O A;  4KJM A;  1L0N E;  1SQX G;  1IFP A;  1FS0 E;  2W6J H;  5CJ0 A;  1VQN P;  4UB6 E;  3P7K A;  1OVV A;  1YTZ T;  2I1J A;  1NTK J;  3L72 D;  3L74 G;  2IFM A;  1NWQ A;  1ZW0 A;  3E1I A;  5AW7 B;  1G2C B;  1NKZ B;  3HUS B;  1JB0 J;  2IX7 C;  3L4F A;  3VN0 A;  3FXE A;  3RBX A;  1T3U A;  3RK3 E;  3M9H A;  2Z5I A;  4H44 C;  3V4Q A;  4GOF A;  3CXH H;  2P2U A;  2ITA A;  1G2C A;  4JQ0 D;  1YYC A;  1T6A A;  3H1I J;  5CHX A;  1KIL D;  1H8A A;  4N6J A;  3MHV A;  3H1K G;  1PIX A;  2ZYG A;  3E1R A;  3HE5 B;  2IFN A;  3USS A;  3KZI E;  4ZKP A;  4TLF A;  1GL2 D;  3CX5 E;  2P58 A;  2O01 J;  1G1I A;  5CMZ A;  2W8Z A;  3V4W A;  1NTM K;  1SQQ G;  3TGU E;  1LTJ A;  2FY8 A;  2E43 A;  4XA4 A;  1T2K D;  1N7S D;  2QRX A;  1NU1 K;  5CCG A;  3V2N A;  2QEX P;  1YI2 P;  1Q7Y Q;  2KLV A;  3KPE A;  4HKZ H;  5AW4 B;  3KHU A;  3Q3D A;  2ZXE B;  3U1C A;  2JO1 A;  4ASW A;  2FFD B;  1T3J A;  1HWT C;  2H7H A;  3M0D A;  4BRY A;  4C7N B;  1DEB A;  3WUV A;  3L70 E;  1H0T B;  1K8A Q;  5AVS B;  2FYZ A;  3E7K A;  5AVZ B;  1Q2N A;  1K04 A;  3MD0 A;  2FFD A;  3CWB G;  3C8V A;  2QVA A;  1L0L E;  4C7N A;  1SQP E;  2XNX A;  2Y0C A;  1OIP A;  1SQX J;  3CCR P;  3HUS C;  5AVX B;  3O6Q B;  3MZW B;  3SWY A;  3S1K A;  5GTI H;  1AVY A;  1BGY E;  2QJY B;  2WPQ A;  3L75 J;  1EZV D;  1VQ5 P;  5KJ7 C;  1S4X A;  1EZV I;  3H1L G;  2RN0 A;  1OX3 A;  3O6Q A;  1HF9 A;  1LTJ C;  4D6T G;  2CPB A;  2OYI B;  4I2L C;  1N8R Q;  2XZR A;  4HH2 A;  2R5D A;  2IBZ I;  4NPF X;  4OVN F;  1L2P A;  2WT7 A;  1FOS E;  1T8Z A;  2C0X A;  1NU1 G;  5APU A;  1IK9 A;  2OYI A;  3A7O A;  3M0D C;  3BRV B;  3L71 G;  1FE6 A;  1YHQ P;  2OYO A;  1NTK E;  1USD A;  4JF7 A;  3I56 P;  1VQ4 P;  3VP9 A;  1NAF A;  3EFG A;  2MKV A;  4I6M C;  3OW2 O;  2YKP A;  4EOT A;  1E5W A;  2OAR A;  2WSF J;  2FFD C;  3IR9 A;  3TF5 A;  4C46 A;  2N9B A;  3AEA C;  1R8E A;  3H1K D;  1PZQ A;  1JY2 O;  1VQM P;  1G1J A;  4GDO A;  2O01 N;  3VTP C;  1SFC B;  1U57 A;  1LTA C;  1Q86 Q;  3CCS P;  5GTI E;  3NFQ A;  1L4A A;  3N7N A;  1OMI A;  3SFD C;  3BCC G;  5APV A;  1S3J A;  1S5L H;  2W27 A;  2ZYA A;  4Y99 B;  4R4M A;  1XTC C;  3GHG B;  1KN7 A;  4PD4 I;  2Y9Y A;  4Z1M H;  5CCG D;  3FX0 A;  1SQV J;  2FYU K;  1FDM A;  3MUD A;  2KYV A;  2YNY A;  1EC5 A;  3M9Q A;  2OYI C;  2WPV B;  2KP8 A;  3M0A A;  4WBA A;  1IFD A;  3CWB D;  3SWF A;  1U7J A;  5TIS H;  2GA1 A;  2OQQ A;  3H1L J;  2Q3I A;  1FOS F;  3CCU P;  2BCC D;  3KXD A;  2V7Q H;  1LGH B;  1SQX E;  1Q82 Q;  2R32 A;  1UII A;  2MJZ A;  5AW2 B;  1AQT A;  3CME P;  1L4A C;  4D6T D;  2B89 A;  3A0H E;  4WY4 A;  1FZF A;  2SPZ A;  4U3F D;  3L75 E;  3CD6 P;  3GF3 A;  3L74 E;  5AVW B;  1KIL B;  1NTM D;  1SFC C;  3BVH A;  4RES B;  5APW A;  3G9R A;  1D7M A;  3CCJ P;  3L72 G;  1NU1 D;  2WQY C;  1GL2 B;  2KSJ A;  2K1A A;  1SQB J;  1NJI Q;  2JWD A;  1KYO E;  3PRJ A;  5H2F H;  4Y99 C;  3H32 B;  2BAS A;  1N7S B;  5DJU B;  2WMM A;  1IFN A;  1SP4 A;  3GHG C;  1BE3 J;  3H1K E;  1GL2 A;  3LID A;  1HVV A;  4U7J A;  3BCC J;  3PHL A;  1BCC D;  1GW4 A;  3Q5P A;  1FJK A;  1KOR A;  3TGU J;  3CMA P;  3D6Y A;  4RJT A;  1N7S A;  4JYB A;  1SQQ E;  2RMZ A;  3BAS A;  1HBW A;  1LT1 A;  1S9K D;  1YIT P;  5B66 E;  2W83 C;  5AVQ B;  1NO4 A;  1KQF B;  2ZXX A;  5KAF H;  2W6B A;  3L70 J;  1JM0 A;  1L4A D;  1FZC A;  3JC2 2;  3EFF K;  3CX5 I;  2LR2 A;  3HE4 B;  2YO3 A;  4GOD A;  2PFX A;  2K9J B;  5APY A;  1IJD B;  1CZQ A;  2B88 A;  1WMK A;  3CCV P;  3CWB E;  5CCH A;  1YBK A;  2W6A A;  2B87 A;  3AE5 C;  3AE9 C;  1FBM A;  2XKM A;  3PLN A;  3HE4 A;  1OVR A;  1AQ5 A;  1J1D B;  1KIL C;  1DD3 A;  4ZNC A;  4AUW A;  4EIJ A;  2IYO A;  1BGY J;  2K9J A;  1M8O B;  2AEJ A;  1RE3 A;  3JSV C;  1IFJ A;  3AE4 C;  1GL2 C;  1W5C E;  1QLE D;  5E79 H;  1JEK A;  1NYH A;  2QG4 A;  4IFM A;  1PGO A;  2RH0 A;  1KB9 D;  4EDF A;  1PGP A;  1KB9 I;  2HFE D;  3H1L E;  1AFO A;  4W7Y A;  1NH4 A;  1JY2 P;  1N7S C;  4LLH A;  2JJL A;  1M1J B;  1EZV G;  1OW6 A;  3H1J G;  3KYQ A;  3EQ2 A;  2M3E A;  3P8C D;  5B5E E;  1OFC X;  2AXT H;  1M1J A;  2JDI H;  1IK7 A;  1P84 E;  2K37 A;  1PL5 A;  4ASV A;  3L71 E;  2FBW C;  5APX A;  2Q5U A;  2WPS A;  1Y8A A;  1H88 A;  2A45 H;  4WY4 D;  3N4X A;  2GUS A;  4C7R A;  1RF1 A;  1ZR4 A;  5KLI B;  5KKZ B;  1QL1 A;  2KLU A;  5KAI E;  1RHZ B;  4WB4 A;  3VMA A;  2BEQ D;  2FYU D;  1KB9 H;  2XDJ A;  1WRG A;  4QMA A;  2NZ2 A;  4RO0 A;  5GTH H;  1SQV K;  5AW9 B;  1SQB E;  4W80 A;  3WUU A;  3WMM 0;  3M91 A;  1LTJ B;  2KZJ A;  1RE3 C;  3A5T A;  1HGV A;  2FXP A;  1KQG B;  4PJ0 E;  3HD7 B;  4BXL A;  2HR3 A;  1BE3 E;  2WSE H;  1J1D C;  3BCC E;  1PP9 G;  4DJG A;  3CLQ A;  1J1E C;  2K88 A;  3RL0 g;  1N73 B;  3G3Z A;  1FZG A;  4BRY B;  3HD7 A;  4O9B A;  1JO5 A;  3L36 A;  1R5S A;  1VL2 A;  1X8Y A;  1L0N K;  2HYN A;  4LGD E;  1GW3 A;  3H1I D;  2M5A A;  1MFT A;  1N73 A;  5APT A;  1M1J C;  2AXT E;  1VQK P;  1YQ3 C;  1KD1 Q;  2KIK A;  1FDI A;  2M3B A;  1TU3 F;  2R5B A;  3HRN A;  1GU4 A;  4N78 E;  2M8R A;  4JBZ A;  4LC1 A;  1KC8 Q;  1FC2 C;  1NTZ K;  2QSI A;  3M06 A;  1YTZ I;  5CCH D;  1S5L X;  4IL6 X;  2YO2 A;  3CXH E;  1ZRT E;  1JMB A;  3MTU E;  5KLI C;  1X22 A;  5KKZ C;  2BCC G;  2Q9I A;  3GG2 A;  1LTS C;  1HJB A;  3L73 D;  1SLQ A;  4N3Y B;  5AVV B;  1EDJ A;  4JPZ B;  5BVZ A;  3L74 J;  3H1H D;  2POH A;  2WT7 B;  2AEM A;  3V2P A;  3H1J D;  3P8C E;  2Q1K A;  1MFZ A;  3I5C A;  1OW7 A;  3P8M C;  5AVT B;  2IBZ D;  5CCG C;  1ZN5 A;  4U3F G;  3HD7 C;  1ZP0 C;  3L72 E;  1NTM G;  4IFF A;  2O01 H;  1FZE A;  1BSH A;  3PTZ A;  1NGM B;  1CI6 B;  4ZMD A;  1PV3 A;  1N73 C;  3H1K J;  3AEC C;  5K5G B;  1L0N G;  1OW8 A;  2K9Y A;  3A0B H;  2QM8 A;  3PP5 A;  3FWN A;  2KUB A;  1KIL E;  1CI6 A;  3RBZ A;  5KTB A;  1SQQ J;  5KLV K;  1L4A B;  3D70 A;  1BCC G;  4RKU J;  1L0L K;  3C9I A;  3IF4 A;  1SQP K;  2KSE A;  2V7Q J;  2DW3 A;  2G3A A;  1HTL C;  4ZKU A;  4H13 D;  5C39 A;  3AE8 C;  1W2B O;  2IZ1 A;  1NTZ G;  3CCQ P;  1PP9 D;  1M56 D;  4UB8 H;  1HJ0 A;  1XTG B;  3TNU B;  3AE3 C;  2A06 D;  2YXQ B;  3NTN A;  4IL6 H;  3U59 A;  2FKW B;  1LT9 A;  2N1T A;  1GMJ A;  1K05 A;  2Y0D A;  4PD4 D;  3CWB J;  2XND H;  4OH8 B;  2OTJ P;  1AA0 A;  3JCU H;  3TNU A;  3PJS K;  3HD7 D;  3TK1 A;  5M1B A;  5AW5 B;  2BCC J;  2QIW A;  3VOP A;  4H0L D;  1N86 A;  4AYC A;  1OWA A;  3CC7 P;  1NTK K;  2R44 A;  2A45 G;  4YXW H;  3CCL P;  2OTK E;  1BSN A;  1DEE G;  1IZN B;  2JEE A;  4D6T J;  1MKM A;  1RF0 A;  2WIT A;  1YJW P;  4PV1 D;  1QGK B;  1EZV E;  1JMM A;  1NTM J;  4WY4 B;  3V2Q A;  1Y9B A;  4Y28 J;  5KLV G;  2M0B A;  3H1J E;  1SQV D;  2KZI A;  1URQ A;  2ZYD A;  1DD4 A;  1QL2 A;  4PD4 H;  1JCC A;  3MIW A;  1ZLL A;  1NU1 J;  3GW6 A;  3O8Z A;  1E79 H;  2J59 M;  4BWN A;  3L71 J;  4K35 A;  2WSC H;  2WPR A;  1GK6 A;  1LTB C;  1CW5 A;  3S4R A;  1USE A;  2PAJ A;  1S5L E;  1KTM A;  2UWJ E;  1LTT C;  3IAO A;  3L35 A;  1PPJ G;  2XU6 A;  3H25 A;  1BCC J;  2N9Y B;  1U7M A;  2LXC B;  1GDT A;  1L0N D;  1MV8 A;  3RL0 D;  3F89 A;  3MUD C;  2KOG A;  2I8D A;  2FYN B;  1JCD A;  2KNC B;  1SS1 A;  2FYU G;  2WVR A;  2NRG A;  1P84 I;  2Q6Q A;  3QH9 A;  5TIS E;  2E76 C;  3LIE A;  1YIJ P;  1HGZ A;  3RK3 D;  1OXZ A;  2KNC A;  1RF0 C;  4OGQ B;  1FZB A;  2J58 A;  3W67 A;  1NTZ D;  1FZC B;  3T97 A;  4B86 A;  4GKG A;  1LWU B;  5AW3 B;  1RQU A;  1URQ C;  1BDC A;  1SQX K;  4IFD K;  1VPC A;  5APS A;  2QJK B;  2Z5H A;  3BRT B;  2E5Y A;  1KZU B;  3CX5 D;  2YKQ A;  5TJH A;  4WY4 C;  3TSI A;  2B87 B;  1JTH A;  1LWU A;  3H1I G;  4UB6 H;  2GM4 A;  1HH0 A;  1BDD A;  2E75 B;  3B5N A;  3GMA A;  2N1T D;  2HPC B;  3KQG A;  1J2J B;  1FDO A; 
#chains in the Genus database with same CATH homology
 1BE3 D;  2N9Y B;  1KB9 D;  4EDF A;  3PHL A;  1BCC D;  3CWB D;  2Y0E A;  1L0N D;  2IBZ D;  3BCC D;  3TDK A;  3TGU D;  2FYN B;  4RJT A;  3H1L D;  2KNC B;  3L72 D;  2RMZ A;  3PTZ A;  1NTK D;  3ITK A;  2L91 A;  3L70 D;  1SQQ D;  3TF5 A;  2BCC D;  3H1I D;  3H1K D;  5KLV D;  2Q3E A;  2Y0C A;  1L0L D;  2YIU B;  1SQP D;  1NTZ D;  1P84 D;  1SQX D;  2O3J A;  4D6T D;  3L71 D;  5KLI B;  2QJY B;  4U3F D;  5KKZ B;  2K9J B;  1NTM D;  1SQV D;  1EZV D;  1BGY D;  3L75 D;  3VMA A;  3L74 D;  4A7P A;  2QJK B;  3GW6 A;  2RN0 A;  2FYU D;  1PPJ D;  1NU1 D;  3CX5 D;  1PP9 D;  5TJH A;  3PLN A;  3CXH D;  1ZRT D;  2KS1 A;  3GG2 A;  3L73 D;  3PRJ A;  1SQB D;  2A06 D;  2JWA A;  3H1H D;  2Y0D A;  1KYO D;  2QJP B;  3FWL A;  3H1J D;  3KHU A;  2QG4 A;  4PD4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...