2JWAA

Erbb2 transmembrane segment dimer spatial structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
44
structure length
44
Chain Sequence
GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Spatial Structure of the Dimeric Transmembrane Domain of the Growth Factor Receptor ErbB2 Presumably Corresponding to the Receptor Active State
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Receptor tyrosine-protein kinase erbB-2
total genus 13
structure length 44
sequence length 44
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2jwaA00
3H1ID 2FYUD 2RMZA 3FWLA 4A7PA 3GW6A 3CX5D 2QG4A 1SQPD 1BGYD 1NTZD 3PLNA 2YIUB 2O3JA 3ITKA 1BE3D 3KHUA 2Y0EA 3L70D 3BCCD 4PD4D 2QJPB 1SQVD 2A06D 2Y0DA 3GG2A 2KS1A 3CWBD 3L72D 5KKZB 3PTZA 1SQQD 2QJKB 4D6TD 5KLIB 1L0ND 2N9YB 2L91A 3TF5A 3L74D 3PHLA 1SQBD 1KYOD 5TJHA 2K9JB 1PP9D 4EDFA 1ZRTD 2JWAA 3TDKA 1PPJD 2RN0A 2Y0CA 3L75D 1NTKD 2Q3EA 1NU1D 3CXHD 5KLVD 3VMAA 1SQXD 2KNCB 3H1LD 4RJTA 2FYNB 2IBZD 3L73D 1P84D 4U3FD 2QJYB 3TGUD 1L0LD 1BCCD 3L71D 3H1HD 1EZVD 3PRJA 3H1KD 2BCCD 1NTMD 3H1JD 1KB9D
chains in the Genus database with same CATH superfamily
2JP3A 4IOIH 1L0NG 3H1HJ 3QH9A 3H1KE 4W7YA 1AVOA 4AUWA 3WUVA 1L4AB 2NPSD 5GTHE 1KV4A 1OFCX 3GHGC 5GTIE 5AVUB 2GA1A 1D7MA 1KQSO 3L37A 1AV1A 3PTZA 1IK7A 1L0LK 1SQPJ 3CXHH 3RBZA 1IZNB 3CX5E 1L0ND 2G8YA 3CCEP 1JUNA 1SQBJ 2QJPC 2POHA 1HJ0A 2Q7CA 5TJHA 3H6PA 5CHXA 3IN6A 2NZ2A 1EZVE 3TK1A 1EXIA 1SQQE 2GUVA 1YBKA 2AEMA 4U3FJ 1JB0J 4UB8E 1NU1D 1NU1K 1JY3O 2PP6A 1JTHB 3VOPA 1IFPA 3N4XA 1YJNP 1S1CX 1SFCC 1BE3E 1BGYG 3KPEA 4U3FD 2HYNA 1ZV8A 3TGUG 3USSA 4R4LA 2QE7H 5CJ4A 1R8EA 3A0HE 2YMYA 5KLVD 1NTMD 2FYNB 2JDIH 1S3JA 4H0LB 1KB9D 1HGZA 2IPPA 4H13C 2QRXA 5GTIH 1YJ9P 1FDMA 1L0NJ 1N7SB 3H1HG 3Q5PA 1NTZK 1SQPD 1FZFA 2WZ7A 1JY2P 1Q86Q 1M1KQ 4BRYA 2ZYAA 3AEBC 5APWA 1N7LA 1N7SA 2N1TA 4L73A 3L75E 1PL5A 3ABVC 2A45H 5CCHC 3I56P 2LR2A 2ZVNB 5CCHA 2KIKA 2XNDH 1PP9J 1JY2N 2N1TB 2WPQA 1MKMA 3AE6C 3AEAC 1PGJA 3L74J 4KHXA 4L75A 2YNYA 4TLFA 4UB8H 4Y28J 4EI2A 2DW3A 3AEFC 3HUSC 1RF0A 3BATA 1CSBA 2CPBA 3CL3D 2W90A 4R4MA 5CCHD 1N8RQ 4OGQC 1VQ6P 1ZW0A 2W83C 2YO2A 1NKNA 4PV1C 3A0HH 1FZGA 2OTLP 1URQD 1BGYE 1BE3G 1NU1E 2KLVA 2WITA 2WSFJ 1HH0A 1SFCA 4GDOA 4XE5B 5CCGD 2P67A 1HF9A 3CI9A 2OYIA 2M3BA 3LW5J 3KYQA 4N6JA 1OVUA 1R5SA 5KLVE 1GDTA 3I5CA 3PH0A 4XFJA 3CWBE 2Z5HA 1EDJA 4WY4C 3EQ2A 3KDPB 2A06G 2Y0DA 3CMEP 4NPEA 2NPSA 4H44D 2XKMA 2JWDA 1NTKE 1OZHA 3GF7A 1HWTC 5H2FH 4EYYQ 2B87A 2L91A 2E75B 3L74D 3LIDA 5AW4B 1P84H 1PP9D 2Q9IA 2KS1B 1FZAA 2FFDC 2RN0A 4KT0J 4Z1MH 1LTJB 3L73J 3WU2E 1FU1A 3B5ND 1RF1B 1CW5A 3O6QA 3A3YB 2WSCJ 3BVHA 5AVTB 1JCCA 2HPCA 3LW5H 3GMAA 1BDCA 1L4AA 2FYUG 3TYYA 2KNCA 3Q3DA 1NTMJ 1GU4A 1RF0C 2XNXA 4NPDA 5KLVJ 1JNMA 3E1RA 1J1EB 3L71G 3L36A 1MZ9A 2H8PD 5TISE 1GTWA 1FZCB 5M1BA 2QSIA 3H32B 3L70D 1N73B 3HE5B 3CX5H 1NU1J 3F5HA 1XTGB 3CPWO 3G3ZA 3M06A 3U1CA 3AE4C 5KLIB 2MKVA 3HD7B 1H89A 2V4HA 1JY2O 1HVVA 5CBOA 1SQBD 1KYOD 1VQPP 1FAVA 1KB9E 2RH0A 1SQBE 3K5BA 2FYUK 1ZR4A 1EDKA 1VQKP 3L71J 1L0LJ 1ZXGA 2QJKC 1WMKA 3KZIH 3M0DA 3CCVP 1SQVK 3MUDC 1GW3A 4GOFA 4UB6E 1VF5C 3S4RA 4RJTA 2W6BA 1S5LX 2KUBA 3M9HA 2WSCH 5C39A 3A0BE 2WT7B 2FYUE 2OTKE 3H1HD 4NPFX 2J59M 4O9BA 4RKUJ 4WB4A 3T97B 5KAFH 4N3YB 1L0NE 2IFMA 3M0AA 3H1KG 3L71E 1YJWP 1KD1Q 1J1DC 1KFNA 1RE3C 1KFMA 2QIWA 2XV5A 3CX5D 3FX0A 3U1AA 1T2KC 1G2CA 1DD3A 3V2PA 1CI6A 1IFMA 3V4WA 1K73Q 1L2PA 4ZKUA 1NTZJ 3L4FA 1FS0E 1E5WA 1LTTC 5L8RJ 3AE9C 3H1JG 5AW9B 1JOCA 5AW6B 2BCCG 2O01J 2E43A 5B5EE 1EZVG 3IR9A 1SQQG 3A7OA 1E79H 3TNUA 1VQNP 1VPCA 2Q3EA 2Q1KA 4OWFA 1JMMA 2E76C 2I8DA 1SQXG 3A0BH 4K35A 2M5AB 4LC1A 4W80A 1Q2NA 1EXJA 1IO4A 1PGOA 3AEEC 2HODA 1M8OB 1T6AA 2NPSC 3AE7C 4PJ0H 4DOJA 2GM4A 2YIUC 2IDBA 1PPJE 1URQB 3H1IG 2ZXXA 3H1KJ 1SQBK 3H1HE 1G1JA 3FWLA 5CCGC 1MV8A 3VMYA 1VQLP 4D6TJ 1IJDB 3JSVC 2HLOA 3PLNA 4UB6H 4D6TE 4H44C 1RY3A 1M7LA 1T3JA 2O3JA 3MUDA 3Q2YA 1GU5A 1KTMA 1KILC 3KZIE 1SQVG 2CPSA 1VL2A 2JEEA 1LWUB 5H2FE 3RK3E 1Q81Q 1HJBA 2OYOA 4RESB 5B5EH 3O8ZA 1FZCA 5AW1B 1RQVA 3OA7A 2R32A 2ZJSE 1SLQA 1S2EA 1OW7A 1K04A 1VDFA 5APXA 1Q82Q 3S9OA 2B88A 2IZ0A 2Y0CA 1FJKA 1SQXE 1W2EA 2KYVA 1LT9B 2D2CB 3P8CE 4JPZB 5CMZA 3TGUE 3OJAB 1KB9I 3H1LE 1NHLA 3NTNA 1FE6A 1KYOI 1NU1G 3EWKA 3H1LD 3P8CD 4C46A 3CCJP 1BGYJ 2ZT9B 3F89A 1SQPG 1PPJG 4IL6H 1FOSE 4MN4C 1OIPA 4BRYB 2M8RA 4ZNCA 1KQGB 2BCCD 3FGAD 2FYZA 3AE2C 2Z5IA 5KLVG 2B9BA 5EFWB 3RGUA 4D6TG 3LIEA 3GW6A 1P84E 5AW7B 4I7ZC 2QJYC 3GHGA 2A06E 4W7ZA 3RK3C 2A06D 4ZMDA 3L72J 1XTCC 4IFFA 2E42A 4HB1A 3RK2C 1KB9H 3L75J 1NTKG 1QGKB 3VYIA 1YI2P 3P32A 5BU5A 2ZYGA 2OYHC 1PGPA 3C1LA 1IFJA 3HTKB 3MGNA 2PGDA 2W6AA 3PHLA 4K3AA 5KLVK 1GL2D 3VN0A 1U57A 1OX3A 3EFFK 1NGMB 1RE3A 3RBXA 5AW5B 5B66H 1VQ9P 2E5TA 1GL2B 2AXCA 2E74B 3B71A 3H1LG 2IBZE 2KSJA 3JCUE 3PJSK 4IL6E 2W8ZA 2R5BA 2E5YA 3S1KA 3BCCG 3D71A 1BE3J 2K9JA 3E1IA 1RE4A 2WSFH 3MZWB 1BDDA 3CCSP 1LJ2A 1RE4C 1NTZE 2OYIC 1ZMEC 1CZQA 4C7RA 2VRSA 3RL0D 3V4QA 3B5NB 1LP1B 2FY8A 2YO3A 1Y47A 2R3CA 5AVRB 5AVZB 2B87B 5KTBA 1N7SD 3L72G 3B8EB 2JO1A 2M0BA 3B5NA 5AVQB 3HUSB 5AW8B 2WPRA 1NOHA 2O1KA 4OGQB 4JBZA 5AW0B 3G4SP 1TU3F 2D2CD 2XU6A 1USDA 1SQBG 3H1IJ 5KAFE 1OW6A 3RL0C 3NMDA 4B86A 3CCLP 5BU8B 1L0LE 2IBZG 3KXDA 3L73G 1IC2A 2XDJA 2ZYDA 4PD4E 1Y8AA 1ZOYC 1YTZI 3RK3D 3CD6P 1SQXK 4Y99B 2RKLA 1GK4A 1NTZG 4WVZA 4N78E 1BCCD 1PV3A 3H32A 1EZVD 1SQQK 3MD0A 3W68A 3D6ZA 1LT9A 3H1JJ 1K9MQ 3CCUP 5KJ7D 3RL0g 1M57D 2IBZI 2IYPA 5KKZB 4WY4A 3KQGA 3TGUJ 3Q1MA 1NWQA 3CC4P 1SQXJ 3CC2P 2J58A 2E75C 3AE1C 3BCCD 4H0LD 1SQVJ 4GIFA 3CWBD 2I1KA 4AYCA 1YHQP 2Y9ZA 1N86A 1PIXA 1T3UA 5K5GB 1YIJP 1LTJC 1J2JB 3H1JE 2KZIA 1PP9G 1WT6A 3TF5A 2BCCE 1LTJA 2WSSH 1RF1C 2YXQB 3TDKA 1L0LG 1PPJD 1NTKK 3L73E 1EDIA 1NTKD 1EZVI 1NH4A 3G6EP 1M90Q 2N1TC 4LLHA 1T8ZA 2K37A 3G9RA 5KAIH 1RH5B 1MUUA 3CX5I 3IFMA 4TT3H 1NTKJ 2ZT9D 1QLED 3H1IE 4M3LA 2WPVB 3GHGB 2KP8A 5GTHH 1NTMK 3CXHI 1W2BO 3FXEA 4A7PA 1A02F 1JEKA 4OH8B 4EOTA 1RQUA 1SQPK 2QG4A 1H88A 1AQTA 5KLIC 2L5GB 3HD7C 1SQVE 1G1IA 3V2QA 2QJPB 5AVWB 1SQVD 4HKZH 3I55P 2FXPA 3MTUE 2P7JA 3BCCJ 3WUUA 2PFXA 1MFTA 2E76D 4BWNA 1QL2A 4YXWH 1Q7YQ 1LT1A 1LP1A 3CLQA 2H43A 1M1JC 1CI6B 3QWOC 1DX7A 4JYCA 3CCRP 3OW2O 2C9NY 1PGQA 1S72P 1SQQJ 4XA4A 1SFCB 1X0TA 2JR8A 2JWAA 2WQYC 3GF3A 1S5LH 4C7NA 4L74A 3UIAA 1LGHB 2FYNC 3P8MC 3NFQA 3T97A 4H13B 1DH3A 1YTZT 1VQ8P 1J1DB 1SQPE 2M3EA 2KSEA 2LXCB 3WU2H 4I6MC 2FYUJ 2G3AA 1GMJA 4EDFA 2FFDA 3CCMP 1M56D 3H1ID 1GW4A 2FYUD 1IFDA 5APYA 1BSNA 2O01H 3M91A 3U59A 3H25A 1KMIZ 2N1TD 4PD4D 5E79E 3GG2A 3SWKA 3IAOA 1J1EC 4I1LA 2IX7C 1FZCC 1L4AC 1VQOP 1SQQD 3HE5A 2YKQA 2N9YB 3AEGC 1M1JA 4I2LC 1K05A 2CK3H 4GODA 4PV1B 5AVVB 4DCKA 2BASA 4DZOA 4H13D 1SS1A 2NPSB 3SFEC 1KQFB 4IFMA 5CBNA 2PAJA 2W6JH 3VP8A 3BCCE 2OARA 2A45I 3JC22 1JY3N 3BASA 4WWIA 1BSHA 2IFNA 1X9VA 2N9BA 4GKGA 4CPGA 2ZVOB 2QEXP 5AVYB 4H44B 1ZLLA 1NKZB 1NVOA 1DEEG 4WY4B 1HBWA 1PZQA 4OVNF 2P2UA 2UWJE 3V2NA 1VF5B 1JY3P 3SWFA 3B4SA 3G71P 4DJGA 1GD2E 3M0DC 2KI7B 2QM7A 2WVRA 3M9BA 4LGDE 2H88C 2AEFA 2KK7A 1NAFA 3CXHE 3L72E 4IL6X 1QVGO 3L72D 2Q5UA 4H0LC 1OMIA 2V7QH 3HD7D 1UIXA 2OGUA 3II6A 5BVZA 1N7SC 3N7NA 3WMM0 2V7QJ 3VMZA 3VMXA 1JCDA 4QMAA 2AXTE 4YXDC 2XZRA 1Z56A 2I1JA 2BCCJ 1SVFA 2K9JB 2R3SA 3NXSA 1U7MA 3O6QB 1N2DC 4N78D 1LTGC 1USEA 2ZAEB 2WPSA 3TSIA 3R4YA 4JYBA 1AFOA 3CWBJ 3VP9A 3HD7A 3H1LJ 1IFIA 3SSUA 4KJMA 2AEJA 1SQXD 2KNCB 1MFZA 2Q6QA 3TGUD 3EFGA 2QJYB 3L70E 3PRJA 2FBWC 1GZLA 2YKPA 3H1JD 3L74G 4PJ0E 1BCCJ 1Y9BA 3BRVB 3RK2B 3Q5RA 4YPCA 1FZEA 3P7KA 2Y0EA 2H89C 2BEZF 2ZFCA 3RK2D 1JO5A 2WSEH 3HTKA 5APTA 2H7HA 1VQ7P 1AVYA 2YMKA 3CC7P 3HE4B 5AVXB 2OYHA 3TNUB 4WBAA 2LKMA 5KAIE 1KYOH 1T2KD 2WSEJ 4JF7A 1PP9E 1GL2C 2QJKB 1G2CB 2ZXEB 4D6TD 2WTYA 2A45G 1GL2A 4PD4I 4IFDK 1HUCA 1LWUC 3WUTA 3C9IA 1K8AQ 5CJ0A 5AVSB 2W27A 3MIWA 1DEBA 1PFIA 3BRTB 1URQA 1A02J 2WT7A 5AW3B 1ZN5A 1LTAC 3VMAA 2FFDB 1HTLC 2OQQA 2IBZD 1VQ5P 3C8VA 4PD4H 1EC5A 1FDIA 1LT9C 3IF4A 1NYHA 3CCQP 3D70A 2HPCB 1YYCA 3SWYA 3M9QA 1NAYA 2KOGA 5B66E 2KB7P 1H0TA 2ITAA 3D6YA 4DT0A 1EQ7A 1NTZD 2HG5D 2KLUA 3ITKA 1BE3D 4U3FE 1VQ4P 1JMBA 2BEQD 4YTPC 2HFED 2YXRB 1FC2C 1FDOA 1YQ3C 2KS1A 1IK9A 2K3RA 2IYOA 3RL0B 1U7JA 3W67A 4ASWA 5APVA 3L75G 4WY4D 3AE5C 2P58A 1FJPA 1LTBC 1OW8A 2B89A 1RF1A 2JKVA 1N73C 2P10A 2LXBA 1OVVA 1NTMG 2Y9YA 3MP7B 3SFDC 3CMAP 1AA0A 2Q3IA 5APUA 1HGVA 1OWAA 2WWWA 3V2RA 3L75D 1W5CE 2E74D 2NRGA 4GT1A 1KILD 4ZKPA 3CXHD 1RHZB 1KILE 1KC8Q 5AW2B 3E7KA 1FOSF 1FZBA 2OTJP 1IFNA 4HYTB 4L76A 1ZP0C 5KKZC 1L0LD 2IZ1A 3JCUH 1QX8A 2E74C 3L71D 1JTHA 5KJ7C 5KJ7A 2QA4P 1OXZA 1Q90D 1S5LE 2RMZA 2Z4EA 1DIPA 1P84I 1BGYD 1BCCE 1LNQA 1QL1A 3L35A 4U3FG 5APSA 1VQMP 4ASVA 3CWBG 2J5UA 2C0XA 2K88A 1JM0A 1UIIA 1X8YA 3AE3C 3L70J 1OVRA 2K1AA 4EIJA 3MHVA 4GOEA 2KXPB 3GLMA 2D2CC 2QVAA 1ZRTE 1NTME 2JJLA 1KN7A 2YKOA 1H8AA 3A2AA 2HR3A 2KZJA 1AQ5A 1X22A 2ZT9C 2C9LY 3V5BA 5E79H 1NO4A 2MJZA 2E75D 4PV1D 1VF5D 1NJIQ 1AJYA 3L73D 1R5LA 2FXMA 2PRRA 4I7ZB 3AEDC 1L0NK 2E76B 4C7NB 2SPZA 3Q5SA 3H1KD 2K9YA 2AXTH 4HJGH 3RK3B 2HODB 3AECC 3HRNA 1LTSC 3HUSA 3PP5A 2GUSA 5DJTB 1DD4A 1KORA 2P1JA 1BCCG 4Y99C 5CCGA 5TISH 3HE4A 2OYHB 2YIUB 3KHUA 1M1JB 1GK6A 1URQC 4BXLA 2FKWB 1KZUB 3A5TA 1KILA 4RO0A 1YITP 2WMMA 3ZDMA 1WRGA 1N73A 4OGQD 5APQA 1S4XA 3VTPC 1QVFO 1X79B 1SP4A 1KILB 2M5AA 2FXOA 4U7JA 1S9KE 1FBMA 1L4AD 1S9KD 4JQ0D 1ZRTD 3FXDA 1SFCD 3FWNA 2C0WA 2OYIB 2R5DA 2O01N 3V6IA 1ZR2A 1YQ4C 2R44A 3OAKA 4HH2A 4AQRD 3L70G 2O1JA 1EDLA 1KQLA 1P84D 3B5NC 5DJUB 1H0TB 3R2PA 1LTIC 1KYOE 1QEXA 3AE8C 3L74E 2QM8A 1LWUA
chains in the Genus database with same CATH topology
3H1ID 2FYUD 2RMZA 3FWLA 4A7PA 3GW6A 3CX5D 2QG4A 1SQPD 1BGYD 1NTZD 3PLNA 2YIUB 2O3JA 3ITKA 1BE3D 3KHUA 2Y0EA 3L70D 3BCCD 4PD4D 2QJPB 1SQVD 2A06D 2Y0DA 3GG2A 2KS1A 3CWBD 3L72D 5KKZB 3PTZA 1SQQD 2QJKB 4D6TD 5KLIB 1L0ND 2N9YB 2L91A 3TF5A 3L74D 3PHLA 1SQBD 1KYOD 5TJHA 2K9JB 1PP9D 4EDFA 1ZRTD 2JWAA 3TDKA 1PPJD 2RN0A 2Y0CA 3L75D 1NTKD 2Q3EA 1NU1D 3CXHD 5KLVD 3VMAA 1SQXD 2KNCB 3H1LD 4RJTA 2FYNB 2IBZD 3L73D 1P84D 4U3FD 2QJYB 3TGUD 1L0LD 1BCCD 3L71D 3H1HD 1EZVD 3PRJA 3H1KD 2BCCD 1NTMD 3H1JD 1KB9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1I D;  2FYU D;  2RMZ A;  3FWL A;  4A7P A;  3GW6 A;  3CX5 D;  2QG4 A;  1SQP D;  1BGY D;  1NTZ D;  3PLN A;  2YIU B;  2O3J A;  3ITK A;  1BE3 D;  3KHU A;  2Y0E A;  3L70 D;  3BCC D;  4PD4 D;  2QJP B;  1SQV D;  2A06 D;  2Y0D A;  3GG2 A;  2KS1 A;  3CWB D;  3L72 D;  5KKZ B;  3PTZ A;  1SQQ D;  2QJK B;  4D6T D;  5KLI B;  1L0N D;  2N9Y B;  2L91 A;  3TF5 A;  3L74 D;  3PHL A;  1SQB D;  1KYO D;  5TJH A;  2K9J B;  1PP9 D;  4EDF A;  1ZRT D;  2JWA A;  3TDK A;  1PPJ D;  2RN0 A;  2Y0C A;  3L75 D;  1NTK D;  2Q3E A;  1NU1 D;  3CXH D;  5KLV D;  3VMA A;  1SQX D;  2KNC B;  3H1L D;  4RJT A;  2FYN B;  2IBZ D;  3L73 D;  1P84 D;  4U3F D;  2QJY B;  3TGU D;  1L0L D;  1BCC D;  3L71 D;  3H1H D;  1EZV D;  3PRJ A;  3H1K D;  2BCC D;  1NTM D;  3H1J D;  1KB9 D; 
#chains in the Genus database with same CATH topology
 2JP3 A;  4IOI H;  1L0N G;  3H1H J;  3QH9 A;  3H1K E;  4W7Y A;  1AVO A;  4AUW A;  3WUV A;  1L4A B;  2NPS D;  5GTH E;  1KV4 A;  1OFC X;  3GHG C;  5GTI E;  5AVU B;  2GA1 A;  1D7M A;  1KQS O;  3L37 A;  1AV1 A;  3PTZ A;  1IK7 A;  1L0L K;  1SQP J;  3CXH H;  3RBZ A;  1IZN B;  3CX5 E;  1L0N D;  2G8Y A;  3CCE P;  1JUN A;  1SQB J;  2QJP C;  2POH A;  1HJ0 A;  2Q7C A;  5TJH A;  3H6P A;  5CHX A;  3IN6 A;  2NZ2 A;  1EZV E;  3TK1 A;  1EXI A;  1SQQ E;  2GUV A;  1YBK A;  2AEM A;  4U3F J;  1JB0 J;  4UB8 E;  1NU1 D;  1NU1 K;  1JY3 O;  2PP6 A;  1JTH B;  3VOP A;  1IFP A;  3N4X A;  1YJN P;  1S1C X;  1SFC C;  1BE3 E;  1BGY G;  3KPE A;  4U3F D;  2HYN A;  1ZV8 A;  3TGU G;  3USS A;  4R4L A;  2QE7 H;  5CJ4 A;  1R8E A;  3A0H E;  2YMY A;  5KLV D;  1NTM D;  2FYN B;  2JDI H;  1S3J A;  4H0L B;  1KB9 D;  1HGZ A;  2IPP A;  4H13 C;  2QRX A;  5GTI H;  1YJ9 P;  1FDM A;  1L0N J;  1N7S B;  3H1H G;  3Q5P A;  1NTZ K;  1SQP D;  1FZF A;  2WZ7 A;  1JY2 P;  1Q86 Q;  1M1K Q;  4BRY A;  2ZYA A;  3AEB C;  5APW A;  1N7L A;  1N7S A;  2N1T A;  4L73 A;  3L75 E;  1PL5 A;  3ABV C;  2A45 H;  5CCH C;  3I56 P;  2LR2 A;  2ZVN B;  5CCH A;  2KIK A;  2XND H;  1PP9 J;  1JY2 N;  2N1T B;  2WPQ A;  1MKM A;  3AE6 C;  3AEA C;  1PGJ A;  3L74 J;  4KHX A;  4L75 A;  2YNY A;  4TLF A;  4UB8 H;  4Y28 J;  4EI2 A;  2DW3 A;  3AEF C;  3HUS C;  1RF0 A;  3BAT A;  1CSB A;  2CPB A;  3CL3 D;  2W90 A;  4R4M A;  5CCH D;  1N8R Q;  4OGQ C;  1VQ6 P;  1ZW0 A;  2W83 C;  2YO2 A;  1NKN A;  4PV1 C;  3A0H H;  1FZG A;  2OTL P;  1URQ D;  1BGY E;  1BE3 G;  1NU1 E;  2KLV A;  2WIT A;  2WSF J;  1HH0 A;  1SFC A;  4GDO A;  4XE5 B;  5CCG D;  2P67 A;  1HF9 A;  3CI9 A;  2OYI A;  2M3B A;  3LW5 J;  3KYQ A;  4N6J A;  1OVU A;  1R5S A;  5KLV E;  1GDT A;  3I5C A;  3PH0 A;  4XFJ A;  3CWB E;  2Z5H A;  1EDJ A;  4WY4 C;  3EQ2 A;  3KDP B;  2A06 G;  2Y0D A;  3CME P;  4NPE A;  2NPS A;  4H44 D;  2XKM A;  2JWD A;  1NTK E;  1OZH A;  3GF7 A;  1HWT C;  5H2F H;  4EYY Q;  2B87 A;  2L91 A;  2E75 B;  3L74 D;  3LID A;  5AW4 B;  1P84 H;  1PP9 D;  2Q9I A;  2KS1 B;  1FZA A;  2FFD C;  2RN0 A;  4KT0 J;  4Z1M H;  1LTJ B;  3L73 J;  3WU2 E;  1FU1 A;  3B5N D;  1RF1 B;  1CW5 A;  3O6Q A;  3A3Y B;  2WSC J;  3BVH A;  5AVT B;  1JCC A;  2HPC A;  3LW5 H;  3GMA A;  1BDC A;  1L4A A;  2FYU G;  3TYY A;  2KNC A;  3Q3D A;  1NTM J;  1GU4 A;  1RF0 C;  2XNX A;  4NPD A;  5KLV J;  1JNM A;  3E1R A;  1J1E B;  3L71 G;  3L36 A;  1MZ9 A;  2H8P D;  5TIS E;  1GTW A;  1FZC B;  5M1B A;  2QSI A;  3H32 B;  3L70 D;  1N73 B;  3HE5 B;  3CX5 H;  1NU1 J;  3F5H A;  1XTG B;  3CPW O;  3G3Z A;  3M06 A;  3U1C A;  3AE4 C;  5KLI B;  2MKV A;  3HD7 B;  1H89 A;  2V4H A;  1JY2 O;  1HVV A;  5CBO A;  1SQB D;  1KYO D;  1VQP P;  1FAV A;  1KB9 E;  2RH0 A;  1SQB E;  3K5B A;  2FYU K;  1ZR4 A;  1EDK A;  1VQK P;  3L71 J;  1L0L J;  1ZXG A;  2QJK C;  1WMK A;  3KZI H;  3M0D A;  3CCV P;  1SQV K;  3MUD C;  1GW3 A;  4GOF A;  4UB6 E;  1VF5 C;  3S4R A;  4RJT A;  2W6B A;  1S5L X;  2KUB A;  3M9H A;  2WSC H;  5C39 A;  3A0B E;  2WT7 B;  2FYU E;  2OTK E;  3H1H D;  4NPF X;  2J59 M;  4O9B A;  4RKU J;  4WB4 A;  3T97 B;  5KAF H;  4N3Y B;  1L0N E;  2IFM A;  3M0A A;  3H1K G;  3L71 E;  1YJW P;  1KD1 Q;  1J1D C;  1KFN A;  1RE3 C;  1KFM A;  2QIW A;  2XV5 A;  3CX5 D;  3FX0 A;  3U1A A;  1T2K C;  1G2C A;  1DD3 A;  3V2P A;  1CI6 A;  1IFM A;  3V4W A;  1K73 Q;  1L2P A;  4ZKU A;  1NTZ J;  3L4F A;  1FS0 E;  1E5W A;  1LTT C;  5L8R J;  3AE9 C;  3H1J G;  5AW9 B;  1JOC A;  5AW6 B;  2BCC G;  2O01 J;  2E43 A;  5B5E E;  1EZV G;  3IR9 A;  1SQQ G;  3A7O A;  1E79 H;  3TNU A;  1VQN P;  1VPC A;  2Q3E A;  2Q1K A;  4OWF A;  1JMM A;  2E76 C;  2I8D A;  1SQX G;  3A0B H;  4K35 A;  2M5A B;  4LC1 A;  4W80 A;  1Q2N A;  1EXJ A;  1IO4 A;  1PGO A;  3AEE C;  2HOD A;  1M8O B;  1T6A A;  2NPS C;  3AE7 C;  4PJ0 H;  4DOJ A;  2GM4 A;  2YIU C;  2IDB A;  1PPJ E;  1URQ B;  3H1I G;  2ZXX A;  3H1K J;  1SQB K;  3H1H E;  1G1J A;  3FWL A;  5CCG C;  1MV8 A;  3VMY A;  1VQL P;  4D6T J;  1IJD B;  3JSV C;  2HLO A;  3PLN A;  4UB6 H;  4D6T E;  4H44 C;  1RY3 A;  1M7L A;  1T3J A;  2O3J A;  3MUD A;  3Q2Y A;  1GU5 A;  1KTM A;  1KIL C;  3KZI E;  1SQV G;  2CPS A;  1VL2 A;  2JEE A;  1LWU B;  5H2F E;  3RK3 E;  1Q81 Q;  1HJB A;  2OYO A;  4RES B;  5B5E H;  3O8Z A;  1FZC A;  5AW1 B;  1RQV A;  3OA7 A;  2R32 A;  2ZJS E;  1SLQ A;  1S2E A;  1OW7 A;  1K04 A;  1VDF A;  5APX A;  1Q82 Q;  3S9O A;  2B88 A;  2IZ0 A;  2Y0C A;  1FJK A;  1SQX E;  1W2E A;  2KYV A;  1LT9 B;  2D2C B;  3P8C E;  4JPZ B;  5CMZ A;  3TGU E;  3OJA B;  1KB9 I;  3H1L E;  1NHL A;  3NTN A;  1FE6 A;  1KYO I;  1NU1 G;  3EWK A;  3H1L D;  3P8C D;  4C46 A;  3CCJ P;  1BGY J;  2ZT9 B;  3F89 A;  1SQP G;  1PPJ G;  4IL6 H;  1FOS E;  4MN4 C;  1OIP A;  4BRY B;  2M8R A;  4ZNC A;  1KQG B;  2BCC D;  3FGA D;  2FYZ A;  3AE2 C;  2Z5I A;  5KLV G;  2B9B A;  5EFW B;  3RGU A;  4D6T G;  3LIE A;  3GW6 A;  1P84 E;  5AW7 B;  4I7Z C;  2QJY C;  3GHG A;  2A06 E;  4W7Z A;  3RK3 C;  2A06 D;  4ZMD A;  3L72 J;  1XTC C;  4IFF A;  2E42 A;  4HB1 A;  3RK2 C;  1KB9 H;  3L75 J;  1NTK G;  1QGK B;  3VYI A;  1YI2 P;  3P32 A;  5BU5 A;  2ZYG A;  2OYH C;  1PGP A;  3C1L A;  1IFJ A;  3HTK B;  3MGN A;  2PGD A;  2W6A A;  3PHL A;  4K3A A;  5KLV K;  1GL2 D;  3VN0 A;  1U57 A;  1OX3 A;  3EFF K;  1NGM B;  1RE3 A;  3RBX A;  5AW5 B;  5B66 H;  1VQ9 P;  2E5T A;  1GL2 B;  2AXC A;  2E74 B;  3B71 A;  3H1L G;  2IBZ E;  2KSJ A;  3JCU E;  3PJS K;  4IL6 E;  2W8Z A;  2R5B A;  2E5Y A;  3S1K A;  3BCC G;  3D71 A;  1BE3 J;  2K9J A;  3E1I A;  1RE4 A;  2WSF H;  3MZW B;  1BDD A;  3CCS P;  1LJ2 A;  1RE4 C;  1NTZ E;  2OYI C;  1ZME C;  1CZQ A;  4C7R A;  2VRS A;  3RL0 D;  3V4Q A;  3B5N B;  1LP1 B;  2FY8 A;  2YO3 A;  1Y47 A;  2R3C A;  5AVR B;  5AVZ B;  2B87 B;  5KTB A;  1N7S D;  3L72 G;  3B8E B;  2JO1 A;  2M0B A;  3B5N A;  5AVQ B;  3HUS B;  5AW8 B;  2WPR A;  1NOH A;  2O1K A;  4OGQ B;  4JBZ A;  5AW0 B;  3G4S P;  1TU3 F;  2D2C D;  2XU6 A;  1USD A;  1SQB G;  3H1I J;  5KAF E;  1OW6 A;  3RL0 C;  3NMD A;  4B86 A;  3CCL P;  5BU8 B;  1L0L E;  2IBZ G;  3KXD A;  3L73 G;  1IC2 A;  2XDJ A;  2ZYD A;  4PD4 E;  1Y8A A;  1ZOY C;  1YTZ I;  3RK3 D;  3CD6 P;  1SQX K;  4Y99 B;  2RKL A;  1GK4 A;  1NTZ G;  4WVZ A;  4N78 E;  1BCC D;  1PV3 A;  3H32 A;  1EZV D;  1SQQ K;  3MD0 A;  3W68 A;  3D6Z A;  1LT9 A;  3H1J J;  1K9M Q;  3CCU P;  5KJ7 D;  3RL0 g;  1M57 D;  2IBZ I;  2IYP A;  5KKZ B;  4WY4 A;  3KQG A;  3TGU J;  3Q1M A;  1NWQ A;  3CC4 P;  1SQX J;  3CC2 P;  2J58 A;  2E75 C;  3AE1 C;  3BCC D;  4H0L D;  1SQV J;  4GIF A;  3CWB D;  2I1K A;  4AYC A;  1YHQ P;  2Y9Z A;  1N86 A;  1PIX A;  1T3U A;  5K5G B;  1YIJ P;  1LTJ C;  1J2J B;  3H1J E;  2KZI A;  1PP9 G;  1WT6 A;  3TF5 A;  2BCC E;  1LTJ A;  2WSS H;  1RF1 C;  2YXQ B;  3TDK A;  1L0L G;  1PPJ D;  1NTK K;  3L73 E;  1EDI A;  1NTK D;  1EZV I;  1NH4 A;  3G6E P;  1M90 Q;  2N1T C;  4LLH A;  1T8Z A;  2K37 A;  3G9R A;  5KAI H;  1RH5 B;  1MUU A;  3CX5 I;  3IFM A;  4TT3 H;  1NTK J;  2ZT9 D;  1QLE D;  3H1I E;  4M3L A;  2WPV B;  3GHG B;  2KP8 A;  5GTH H;  1NTM K;  3CXH I;  1W2B O;  3FXE A;  4A7P A;  1A02 F;  1JEK A;  4OH8 B;  4EOT A;  1RQU A;  1SQP K;  2QG4 A;  1H88 A;  1AQT A;  5KLI C;  2L5G B;  3HD7 C;  1SQV E;  1G1I A;  3V2Q A;  2QJP B;  5AVW B;  1SQV D;  4HKZ H;  3I55 P;  2FXP A;  3MTU E;  2P7J A;  3BCC J;  3WUU A;  2PFX A;  1MFT A;  2E76 D;  4BWN A;  1QL2 A;  4YXW H;  1Q7Y Q;  1LT1 A;  1LP1 A;  3CLQ A;  2H43 A;  1M1J C;  1CI6 B;  3QWO C;  1DX7 A;  4JYC A;  3CCR P;  3OW2 O;  2C9N Y;  1PGQ A;  1S72 P;  1SQQ J;  4XA4 A;  1SFC B;  1X0T A;  2JR8 A;  2JWA A;  2WQY C;  3GF3 A;  1S5L H;  4C7N A;  4L74 A;  3UIA A;  1LGH B;  2FYN C;  3P8M C;  3NFQ A;  3T97 A;  4H13 B;  1DH3 A;  1YTZ T;  1VQ8 P;  1J1D B;  1SQP E;  2M3E A;  2KSE A;  2LXC B;  3WU2 H;  4I6M C;  2FYU J;  2G3A A;  1GMJ A;  4EDF A;  2FFD A;  3CCM P;  1M56 D;  3H1I D;  1GW4 A;  2FYU D;  1IFD A;  5APY A;  1BSN A;  2O01 H;  3M91 A;  3U59 A;  3H25 A;  1KMI Z;  2N1T D;  4PD4 D;  5E79 E;  3GG2 A;  3SWK A;  3IAO A;  1J1E C;  4I1L A;  2IX7 C;  1FZC C;  1L4A C;  1VQO P;  1SQQ D;  3HE5 A;  2YKQ A;  2N9Y B;  3AEG C;  1M1J A;  4I2L C;  1K05 A;  2CK3 H;  4GOD A;  4PV1 B;  5AVV B;  4DCK A;  2BAS A;  4DZO A;  4H13 D;  1SS1 A;  2NPS B;  3SFE C;  1KQF B;  4IFM A;  5CBN A;  2PAJ A;  2W6J H;  3VP8 A;  3BCC E;  2OAR A;  2A45 I;  3JC2 2;  1JY3 N;  3BAS A;  4WWI A;  1BSH A;  2IFN A;  1X9V A;  2N9B A;  4GKG A;  4CPG A;  2ZVO B;  2QEX P;  5AVY B;  4H44 B;  1ZLL A;  1NKZ B;  1NVO A;  1DEE G;  4WY4 B;  1HBW A;  1PZQ A;  4OVN F;  2P2U A;  2UWJ E;  3V2N A;  1VF5 B;  1JY3 P;  3SWF A;  3B4S A;  3G71 P;  4DJG A;  1GD2 E;  3M0D C;  2KI7 B;  2QM7 A;  2WVR A;  3M9B A;  4LGD E;  2H88 C;  2AEF A;  2KK7 A;  1NAF A;  3CXH E;  3L72 E;  4IL6 X;  1QVG O;  3L72 D;  2Q5U A;  4H0L C;  1OMI A;  2V7Q H;  3HD7 D;  1UIX A;  2OGU A;  3II6 A;  5BVZ A;  1N7S C;  3N7N A;  3WMM 0;  2V7Q J;  3VMZ A;  3VMX A;  1JCD A;  4QMA A;  2AXT E;  4YXD C;  2XZR A;  1Z56 A;  2I1J A;  2BCC J;  1SVF A;  2K9J B;  2R3S A;  3NXS A;  1U7M A;  3O6Q B;  1N2D C;  4N78 D;  1LTG C;  1USE A;  2ZAE B;  2WPS A;  3TSI A;  3R4Y A;  4JYB A;  1AFO A;  3CWB J;  3VP9 A;  3HD7 A;  3H1L J;  1IFI A;  3SSU A;  4KJM A;  2AEJ A;  1SQX D;  2KNC B;  1MFZ A;  2Q6Q A;  3TGU D;  3EFG A;  2QJY B;  3L70 E;  3PRJ A;  2FBW C;  1GZL A;  2YKP A;  3H1J D;  3L74 G;  4PJ0 E;  1BCC J;  1Y9B A;  3BRV B;  3RK2 B;  3Q5R A;  4YPC A;  1FZE A;  3P7K A;  2Y0E A;  2H89 C;  2BEZ F;  2ZFC A;  3RK2 D;  1JO5 A;  2WSE H;  3HTK A;  5APT A;  2H7H A;  1VQ7 P;  1AVY A;  2YMK A;  3CC7 P;  3HE4 B;  5AVX B;  2OYH A;  3TNU B;  4WBA A;  2LKM A;  5KAI E;  1KYO H;  1T2K D;  2WSE J;  4JF7 A;  1PP9 E;  1GL2 C;  2QJK B;  1G2C B;  2ZXE B;  4D6T D;  2WTY A;  2A45 G;  1GL2 A;  4PD4 I;  4IFD K;  1HUC A;  1LWU C;  3WUT A;  3C9I A;  1K8A Q;  5CJ0 A;  5AVS B;  2W27 A;  3MIW A;  1DEB A;  1PFI A;  3BRT B;  1URQ A;  1A02 J;  2WT7 A;  5AW3 B;  1ZN5 A;  1LTA C;  3VMA A;  2FFD B;  1HTL C;  2OQQ A;  2IBZ D;  1VQ5 P;  3C8V A;  4PD4 H;  1EC5 A;  1FDI A;  1LT9 C;  3IF4 A;  1NYH A;  3CCQ P;  3D70 A;  2HPC B;  1YYC A;  3SWY A;  3M9Q A;  1NAY A;  2KOG A;  5B66 E;  2KB7 P;  1H0T A;  2ITA A;  3D6Y A;  4DT0 A;  1EQ7 A;  1NTZ D;  2HG5 D;  2KLU A;  3ITK A;  1BE3 D;  4U3F E;  1VQ4 P;  1JMB A;  2BEQ D;  4YTP C;  2HFE D;  2YXR B;  1FC2 C;  1FDO A;  1YQ3 C;  2KS1 A;  1IK9 A;  2K3R A;  2IYO A;  3RL0 B;  1U7J A;  3W67 A;  4ASW A;  5APV A;  3L75 G;  4WY4 D;  3AE5 C;  2P58 A;  1FJP A;  1LTB C;  1OW8 A;  2B89 A;  1RF1 A;  2JKV A;  1N73 C;  2P10 A;  2LXB A;  1OVV A;  1NTM G;  2Y9Y A;  3MP7 B;  3SFD C;  3CMA P;  1AA0 A;  2Q3I A;  5APU A;  1HGV A;  1OWA A;  2WWW A;  3V2R A;  3L75 D;  1W5C E;  2E74 D;  2NRG A;  4GT1 A;  1KIL D;  4ZKP A;  3CXH D;  1RHZ B;  1KIL E;  1KC8 Q;  5AW2 B;  3E7K A;  1FOS F;  1FZB A;  2OTJ P;  1IFN A;  4HYT B;  4L76 A;  1ZP0 C;  5KKZ C;  1L0L D;  2IZ1 A;  3JCU H;  1QX8 A;  2E74 C;  3L71 D;  1JTH A;  5KJ7 C;  5KJ7 A;  2QA4 P;  1OXZ A;  1Q90 D;  1S5L E;  2RMZ A;  2Z4E A;  1DIP A;  1P84 I;  1BGY D;  1BCC E;  1LNQ A;  1QL1 A;  3L35 A;  4U3F G;  5APS A;  1VQM P;  4ASV A;  3CWB G;  2J5U A;  2C0X A;  2K88 A;  1JM0 A;  1UII A;  1X8Y A;  3AE3 C;  3L70 J;  1OVR A;  2K1A A;  4EIJ A;  3MHV A;  4GOE A;  2KXP B;  3GLM A;  2D2C C;  2QVA A;  1ZRT E;  1NTM E;  2JJL A;  1KN7 A;  2YKO A;  1H8A A;  3A2A A;  2HR3 A;  2KZJ A;  1AQ5 A;  1X22 A;  2ZT9 C;  2C9L Y;  3V5B A;  5E79 H;  1NO4 A;  2MJZ A;  2E75 D;  4PV1 D;  1VF5 D;  1NJI Q;  1AJY A;  3L73 D;  1R5L A;  2FXM A;  2PRR A;  4I7Z B;  3AED C;  1L0N K;  2E76 B;  4C7N B;  2SPZ A;  3Q5S A;  3H1K D;  2K9Y A;  2AXT H;  4HJG H;  3RK3 B;  2HOD B;  3AEC C;  3HRN A;  1LTS C;  3HUS A;  3PP5 A;  2GUS A;  5DJT B;  1DD4 A;  1KOR A;  2P1J A;  1BCC G;  4Y99 C;  5CCG A;  5TIS H;  3HE4 A;  2OYH B;  2YIU B;  3KHU A;  1M1J B;  1GK6 A;  1URQ C;  4BXL A;  2FKW B;  1KZU B;  3A5T A;  1KIL A;  4RO0 A;  1YIT P;  2WMM A;  3ZDM A;  1WRG A;  1N73 A;  4OGQ D;  5APQ A;  1S4X A;  3VTP C;  1QVF O;  1X79 B;  1SP4 A;  1KIL B;  2M5A A;  2FXO A;  4U7J A;  1S9K E;  1FBM A;  1L4A D;  1S9K D;  4JQ0 D;  1ZRT D;  3FXD A;  1SFC D;  3FWN A;  2C0W A;  2OYI B;  2R5D A;  2O01 N;  3V6I A;  1ZR2 A;  1YQ4 C;  2R44 A;  3OAK A;  4HH2 A;  4AQR D;  3L70 G;  2O1J A;  1EDL A;  1KQL A;  1P84 D;  3B5N C;  5DJU B;  1H0T B;  3R2P A;  1LTI C;  1KYO E;  1QEX A;  3AE8 C;  3L74 E;  2QM8 A;  1LWU A; 
#chains in the Genus database with same CATH homology
 3H1I D;  2FYU D;  2RMZ A;  3FWL A;  4A7P A;  3GW6 A;  3CX5 D;  2QG4 A;  1SQP D;  1BGY D;  1NTZ D;  3PLN A;  2YIU B;  2O3J A;  3ITK A;  1BE3 D;  3KHU A;  2Y0E A;  3L70 D;  3BCC D;  4PD4 D;  2QJP B;  1SQV D;  2A06 D;  2Y0D A;  3GG2 A;  2KS1 A;  3CWB D;  3L72 D;  5KKZ B;  3PTZ A;  1SQQ D;  2QJK B;  4D6T D;  5KLI B;  1L0N D;  2N9Y B;  2L91 A;  3TF5 A;  3L74 D;  3PHL A;  1SQB D;  1KYO D;  5TJH A;  2K9J B;  1PP9 D;  4EDF A;  1ZRT D;  2JWA A;  3TDK A;  1PPJ D;  2RN0 A;  2Y0C A;  3L75 D;  1NTK D;  2Q3E A;  1NU1 D;  3CXH D;  5KLV D;  3VMA A;  1SQX D;  2KNC B;  3H1L D;  4RJT A;  2FYN B;  2IBZ D;  3L73 D;  1P84 D;  4U3F D;  2QJY B;  3TGU D;  1L0L D;  1BCC D;  3L71 D;  3H1H D;  1EZV D;  3PRJ A;  3H1K D;  2BCC D;  1NTM D;  3H1J D;  1KB9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...