2JWAA

Erbb2 transmembrane segment dimer spatial structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
44
structure length
44
Chain Sequence
GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Spatial Structure of the Dimeric Transmembrane Domain of the Growth Factor Receptor ErbB2 Presumably Corresponding to the Receptor Active State
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Receptor tyrosine-protein kinase erbB-2
total genus 13
structure length 44
sequence length 44
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2jwaA00
4RJTA 1SQBD 1P84D 2N9YB 3BCCD 3GG2A 1SQQD 2KS1A 4A7PA 2BCCD 2JWAA 3FWLA 2A06D 2YIUB 1KB9D 1SQVD 2FYUD 2IBZD 2O3JA 2QJYB 2QG4A 2Y0DA 1L0ND 1PPJD 2L91A 2Y0CA 3H1HD 2K9JB 3L70D 3PRJA 3VMAA 4D6TD 4EDFA 3TF5A 1NTZD 1ZRTD 5TJHA 2Y0EA 3ITKA 2RMZA 2Q3EA 3KHUA 1NU1D 4U3FD 3TDKA 2QJKB 1BGYD 1NTMD 3L72D 3GW6A 1PP9D 2QJPB 3L71D 5KKZB 5KLVD 3H1ID 1KYOD 3CX5D 3PLNA 5KLIB 1NTKD 3TGUD 3CXHD 1SQXD 3H1JD 3H1KD 4PD4D 3PTZA 3L73D 2FYNB 3CWBD 2RN0A 3H1LD 3PHLA 3L75D 1BE3D 1SQPD 1EZVD 3L74D 1L0LD 2KNCB 1BCCD
chains in the Genus database with same CATH superfamily
3H1JG 2FYNC 1KILA 1KORA 2KS1B 2UWJE 2GM4A 3AEEC 3B5NB 4OGQB 1FAVA 4JYBA 4UB8H 2OYIA 1GL2D 2WSEJ 2QA4P 3IF4A 4XA4A 1FZCB 2Y0CA 3HUSC 3O6QB 4TT3H 3U59A 2LKMA 2R5BA 2Q1KA 1MV8A 1BDDA 3PRJA 2P67A 3TNUA 2Q3IA 1GK4A 1X8YA 2QEXP 3AEFC 4I2LC 3T97B 3FGAD 2POHA 3G9RA 1OIPA 5BVZA 1H8AA 1J1EC 1LTAC 1LTJC 2HR3A 2NPSA 3F5HA 1NTMD 4HKZH 2I1KA 3WUTA 2O01J 3Q5RA 4H13C 1N73A 1GTWA 2WWWA 4HJGH 1URQB 2GA1A 5AW1B 2FYUJ 3B5ND 4IL6E 1Q2NA 2K9JA 1T3UA 2IZ1A 3HD7C 4K35A 4OGQD 3G3ZA 3L73D 3CWBD 4JYCA 5AVWB 3USSA 3G71P 4UB8E 3N4XA 1GU5A 1NOHA 2ZJSE 3L74D 3SFDC 3HE4B 2NRGA 3GMAA 2E76C 3GHGA 4GOFA 4XE5B 5APWA 3BCCD 1KQFB 4ASVA 1FJKA 1ZR4A 1N2DC 2I1JA 1BE3G 1L0LK 3GF3A 1L0LE 1YHQP 2C0WA 1IFJA 2N1TD 1L4AA 2HG5D 2R32A 2XNDH 3H1KE 3NMDA 3V2RA 2GUVA 3VOPA 2SPZA 1EDKA 1JY2N 2QVAA 1AFOA 2Y0EA 1VQ6P 4IL6H 1VQMP 2KLUA 3L72E 1JY2P 4DCKA 3C1LA 1L0LG 5H2FE 1X0TA 4IOIH 3D71A 2JR8A 2AXTE 1KYOD 3TDKA 1LJ2A 3L74G 5CJ4A 1SQXE 3RGUA 1RF1B 2B87A 2HODA 2C9LY 1IC2A 1ZN5A 3G4SP 1EZVD 3KQGA 4PJ0H 2FFDB 2G3AA 1NU1E 2D2CD 1HGVA 2K3RA 1FDIA 4C7RA 4RJTA 2OYHB 1H0TA 2YKPA 3L35A 5CBOA 3OJAB 2N1TB 3CI9A 1ZOYC 1YTZT 1NTZJ 2P10A 2P7JA 3RBZA 3VP9A 5AVVB 3D6ZA 1YJ9P 1N8RQ 3CCLP 1LT9A 2K9YA 4C7NA 1IFNA 1W2BO 1Q82Q 3AEDC 2FYUE 4AQRD 1IO4A 1PP9E 3S1KA 2O1KA 1PPJD 3BASA 5AVYB 5BU5A 2M5AB 1BE3E 3RK3B 5L8RJ 1G1IA 2V4HA 3IN6A 4GOEA 3PJSK 2AXTH 5GTHH 1NTKK 3OA7A 1GZLA 4NPEA 5AW4B 2YMYA 5KAFE 2XKMA 2ZAEB 1YTZI 1NKNA 2A45I 2QJKB 1R5SA 3KHUA 2B89A 3MTUE 3GW6A 3CMAP 2RKLA 2P1JA 4O9BA 1HJ0A 1URQD 2FY8A 5AW2B 3M0AA 2WT7A 2WSFJ 3CXHD 3H25A 3H1KD 1VDFA 1JNMA 1VQ4P 2JJLA 1EC5A 3AE7C 1QVFO 1S5LX 1QL1A 3JSVC 3RK2B 3HTKA 1GDTA 5CCHC 1P84E 3WUVA 2W27A 4DJGA 3GLMA 2W90A 1LWUA 1VL2A 4A7PA 3CC7P 3V2PA 1SQBJ 2A06D 2W8ZA 4H0LB 5KAFH 3CWBE 3AEGC 4I6MC 3MIWA 4NPFX 2M8RA 3C8VA 1SQPJ 1EQ7A 3B5NC 3L75J 3LW5J 1NTZD 3AECC 4OGQC 1DD3A 3CCSP 4ZNCA 4DOJA 2E74C 3L71J 3MUDA 5KLVK 2KNCA 3E1RA 3TGUE 1NTME 3TYYA 3AEAC 4YXDC 1VQLP 2P58A 4W7YA 2QIWA 5KLIB 1M7LA 3HD7B 1KMIZ 1N7SC 2B88A 3B8EB 3H1IJ 2FFDA 3V2QA 4PD4I 1NAFA 1VF5D 3H32B 2YNYA 3PTZA 1SQVE 1U7JA 4JPZB 2HPCA 1SFCB 1A02J 4JF7A 5APVA 1FJPA 2ZYAA 1N73B 2OYHC 1PGOA 2YXQB 1HH0A 1X79B 4EI2A 1SQQJ 4PJ0E 1L2PA 1L0NE 3FWLA 2YIUB 1JM0A 1AVOA 1ZV8A 1N7SA 2KIKA 3HUSB 3H1LE 4KJMA 4N3YB 3SSUA 2MKVA 3E7KA 2L91A 3H1KJ 2O01H 1YBKA 4U3FE 1ZW0A 1GD2E 4EYYQ 4GDOA 3MUDC 2N9BA 3VMXA 1YJNP 1RH5B 3V2NA 1RF1C 1BGYD 1M1KQ 5GTIH 2AXCA 3H1LG 3MD0A 1T2KD 5AVUB 5GTHE 1NGMB 1URQC 2M3EA 4K3AA 1XTGB 1U7MA 3V4WA 2A06G 1Y47A 1YJWP 1PP9G 1NAYA 3AE6C 3I56P 2E76D 1RE4A 2J59M 4ASWA 1SQVG 1ZR2A 2B9BA 3CCEP 3WMM0 1NTZE 1SQQK 1KILE 1M1JC 3EFGA 1BCCJ 1EZVG 3A3YB 3H1HJ 4W7ZA 3TK1A 1UIIA 4BXLA 4YPCA 2Z4EA 1GL2B 1SQPG 3A2AA 5KLVE 4H0LC 3H1IE 1PIXA 5CJ0A 3MGNA 2JO1A 2Y0DA 1P84H 1AA0A 1S72P 1JY3O 3B71A 1BGYG 5GTIE 4GKGA 4H13B 1KQSO 3P32A 4LGDE 4MN4C 2XZRA 2IPPA 3FWNA 5AW3B 1ZXGA 4WY4A 2R5DA 4WY4C 1S9KD 1PPJG 3H1IG 3RL0g 1VF5B 2GUSA 5APXA 3A5TA 5AVZB 5AW5B 3JC22 1URQA 5APTA 2BCCE 2KYVA 4N6JA 1HTLC 1IFDA 1LGHB 3SWKA 3Q3DA 2OTLP 2M5AA 2FKWB 1LTJB 1KD1Q 3SWFA 4BWNA 4U3FJ 3PHLA 1M1JA 3HE5A 1M56D 1USEA 1XTCC 3BCCJ 1RE4C 2ZFCA 5KJ7D 1FE6A 4H44B 3FX0A 2Y9ZA 3JCUH 1EXIA 2A06E 5AVSB 3L74J 2WMMA 3MZWB 3AE5C 2WVRA 1JUNA 2OARA 1OZHA 3V5BA 2JWAA 2M0BA 4N78D 3CPWO 2WPVB 1FZAA 1DH3A 1YIJP 1LTSC 3P7KA 1QL2A 4OWFA 3CCVP 1SQPK 3VTPC 3F89A 2JDIH 1QX8A 1SQPE 1T8ZA 2LXBA 3OW2O 1VQOP 1W5CE 1Q90D 4L74A 3V4QA 5KTBA 3HRNA 3CCRP 2WSFH 2D2CC 2V7QJ 3L73G 4HB1A 3U1AA 4PD4H 2KI7B 1AVYA 1KFMA 1L4AC 5AVQB 3VP8A 3CD6P 2AEJA 1K05A 2XDJA 1ZP0C 3Q1MA 1S2EA 2VRSA 5K5GB 3JCUE 2P2UA 3P8MC 3D70A 1GK6A 1OMIA 1OVVA 3BATA 1WRGA 1BE3D 1PL5A 3QWOC 2OYHA 2E75B 2CK3H 2KNCB 3GHGC 3L72D 1KZUB 1KILD 2PAJA 2C9NY 4KT0J 5APUA 3U1CA 1EDJA 5B66H 4L73A 3Q5SA 2BCCD 2H88C 2H8PD 2YO3A 1KQGB 1LWUC 3LIEA 4I7ZC 1PFIA 2KXPB 3BRVB 3O6QA 4PD4E 3H1JE 3RL0B 2HPCB 5CCHA 1MFZA 1J1DB 1W2EA 3AE8C 3A0BE 5TISH 3CCQP 3CL3D 2E42A 4UB6E 2Q3EA 2WSEH 3L74E 2XNXA 3B5NA 3KPEA 1NTMK 2OYOA 2KSEA 1IJDB 2LR2A 3L73E 1N7SB 1N7SD 3HUSA 2G8YA 2ZT9B 5KLVD 1Y9BA 1GW3A 1NTKE 1JTHA 2I8DA 3AEBC 3TNUB 2OYIC 2A45H 3H1LD 1CI6A 4Y28J 5AVRB 1LTBC 3S9OA 2FXMA 1HBWA 2ZVNB 3HE4A 2E5YA 4PV1C 1SQBD 3QH9A 3RL0D 1Y8AA 1LP1B 3L70G 3EFFK 3VN0A 3AE2C 1MKMA 1HGZA 1FC2C 4AUWA 1JMBA 1SQVD 1IZNB 4BRYA 2WSSH 3L4FA 1K9MQ 4I1LA 2LXCB 1LNQA 2ZXXA 2L5GB 3LIDA 1FOSE 2AEMA 2R3CA 3TF5A 1OVUA 4IFDK 2J5UA 5TJHA 3H1KG 4U3FD 3B4SA 3AE9C 1RF0C 3M9BA 1G2CA 2ZXEB 1G1JA 3IFMA 1IK7A 2BCCJ 4L76A 2JKVA 5AW6B 1FZGA 2H89C 2OYIB 1NTKD 1L4AB 1NVOA 1YQ3C 1SQBG 2NPSD 1RF1A 1RE3C 1EZVI 1KYOI 3S4RA 4HYTB 1KTMA 2FYUK 2CPSA 1FU1A 1KILB 2HLOA 3CCMP 2FXPA 2NZ2A 1OW6A 3T97A 1VQ7P 1OVRA 1USDA 1P84D 1SQXG 1ZLLA 4U7JA 3BVHA 4M3LA 1FZCA 1S4XA 1SQBE 2OGUA 1TU3F 1IFPA 1QVGO 1LT9B 2M3BA 2XV5A 5AVTB 2YKOA 1AQ5A 1PGPA 4AYCA 2IX7C 2KZJA 1ZMEC 2K9JB 5KLVG 3CXHE 5KKZC 5B66E 5B5EH 1J1DC 1SQXK 2JEEA 2W6BA 1J1EB 3A7OA 2AEFA 2IZ0A 2YXRB 5C39A 1CW5A 1DEEG 2E75D 2QE7H 2ZYDA 2Z5IA 2PGDA 4RESB 1Q86Q 4RO0A 3L72J 3MHVA 4D6TG 1BGYJ 3CX5D 3A0BH 3H6PA 3M06A 5TISE 3W67A 4UB6H 1VQ9P 2WITA 5DJUB 4Y99B 2K88A 1S3JA 1N73C 2K37A 2NPSC 2IBZE 2QSIA 2E75C 3IR9A 3WU2H 1A02F 1JY3P 1BCCD 3AE4C 2ZYGA 3H1HD 4PV1B 2KOGA 3RBXA 1VQ5P 2Z5HA 1R8EA 1MFTA 2QJYC 1T6AA 3Q5PA 5B5EE 2CPBA 2DW3A 1CZQA 3L72G 1LWUB 1WMKA 4L75A 4U3FG 4CPGA 4D6TJ 2IBZD 2E43A 1JO5A 4N78E 3N7NA 1NWQA 1HVVA 1KFNA 2QJPC 2YKQA 1NTKG 3P8CD 3UIAA 3MP7B 1ZRTD 3P8CE 4IFFA 1OXZA 1S1CX 1LT1A 2E74D 4GODA 1FZBA 1FZEA 3L37A 4IFMA 1FDOA 4I7ZB 4B86A 1HJBA 1RQUA 1H0TB 1L4AD 1PP9D 1K8AQ 2N1TA 3WU2E 3KZIE 1HUCA 4EOTA 1M57D 1FS0E 2WPRA 1SS1A 3II6A 4C7NB 2K1AA 4YTPC 5KAIH 3EWKA 1L0NJ 2FBWC 2PFXA 3PP5A 2RN0A 3M0DA 1SQPD 1NTMG 1L0LJ 1Q81Q 3ZDMA 1DX7A 2JWDA 1KILC 2PRRA 2Q5UA 2ZVOB 1EZVE 1YI2P 5AVXB 1KB9H 2IBZG 3BCCE 4D6TE 1KQLA 3GG2A 3PH0A 1YYCA 1DIPA 3RK3E 2KS1A 1DD4A 3CX5E 4JQ0D 5KLVJ 2WZ7A 1LT9C 1KB9D 3H32A 4H0LD 3H1ID 3Q2YA 3D6YA 1K04A 1PZQA 3L70D 4D6TD 5M1BA 1E5WA 4PV1D 1JY3N 3BCCG 4ZKPA 1NO4A 1SVFA 3I5CA 1NTMJ 3NTNA 4W80A 3R2PA 4R4MA 2RH0A 3M9HA 3CMEP 1BSHA 1L0NG 4H13D 1SP4A 2C0XA 3CXHH 2IYOA 3R4YA 3TGUJ 1MZ9A 1PP9J 1NU1K 1OW8A 5CCGD 2QM8A 3HD7D 4BRYB 5DJTB 1NYHA 2WT7B 1SQVJ 1NH4A 1QLED 2O1JA 3C9IA 2W83C 3H1JJ 1N7LA 3IAOA 1L0NK 2KP8A 4JBZA 2IDBA 2E76B 1FZFA 3CX5H 3OAKA 2KB7P 4KHXA 5KJ7C 4HH2A 1JCDA 1OFCX 2WSCH 3LW5H 4H44C 5KJ7A 3GHGB 2N9YB 4ZKUA 2KK7A 2KZIA 1SQBK 2YO2A 3FXDA 2J58A 3TGUG 5AW8B 5E79E 1EDLA 2KSJA 4OH8B 2QJYB 4LLHA 1GL2C 1GW4A 1L0ND 2IBZI 3GF7A 2OTJP 1WT6A 4OVNF 1JY2O 2E74B 3L70J 4WY4D 2IFNA 3M9QA 2D2CB 4Y99C 1KYOH 1SFCD 5CHXA 2FYUG 2QRXA 3HD7A 1VPCA 3L75G 5KKZB 2H43A 1BGYE 3CLQA 1AV1A 1VQKP 3H1JD 1OW7A 2ZT9C 1CI6B 4PD4D 3CXHI 1VQNP 2BCCG 1SFCA 1LTJA 4GT1A 1R5LA 5AW0B 3V6IA 1NKZB 1M1JB 3HE5B 3KZIH 2XU6A 1H88A 1P84I 1PGJA 1MUUA 4WB4A 3L75E 5E79H 3TGUD 1GU4A 1LP1A 5KAIE 1EDIA 3M0DC 1LTTC 1QGKB 5APYA 3TSIA 1IFIA 1OX3A 2NPSB 5CMZA 3RL0C 1PGQA 2ZT9D 4WBAA 1AJYA 3NFQA 5CCGC 2OTKE 1SQXJ 1KB9E 2JP3A 1JMMA 1K73Q 1KN7A 1E79H 4EDFA 2N1TC 4LC1A 2MJZA 2R44A 1SQQG 1VF5C 1T3JA 3K5BA 3E1IA 4IL6X 1NU1J 3L71E 3RK2D 1J2JB 3BRTB 1G2CB 3CWBG 1JEKA 2HFED 2WTYA 5AW9B 2IFMA 2IYPA 1NTZG 2O01N 5CCGA 3A0HE 1NTZK 1SQQE 3ABVC 5AW7B 4QMAA 3G6EP 2FYNB 3KDPB 3L71G 5APQA 2V7QH 1LTIC 2BASA 3RK2C 1KC8Q 4EIJA 1HWTC 3L70E 1LTGC 1SLQA 3SFEC 4Z1MH 2Q6QA 1M8OB 3CC2P 1IK9A 1SFCC 3RK3D 1HF9A 1GL2A 2FYZA 2WPSA 3L36A 3CWBJ 1PPJE 1BSNA 3I55P 1UIXA 2H7HA 2FYUD 5EFWB 3VMAA 2W6AA 4C46A 1DEBA 4DT0A 4DZOA 3AE3C 4YXWH 3VMZA 3CCJP 1FZCC 2B87B 2HODB 4WY4B 1N86A 1X9VA 2RMZA 1BCCE 3A0HH 1Z56A 1NU1D 3H1HE 1M90Q 1JCCA 2R3SA 3L71D 1IFMA 3M91A 2QM7A 1X22A 4NPDA 1KV4A 2Q9IA 1SQXD 5APSA 1U57A 2HYNA 1ZRTE 1JB0J 1KYOE 3NXSA 3WUUA 2YMKA 5BU8B 2BEQD 3VMYA 1EXJA 1BDCA 1Q7YQ 1H89A 4RKUJ 4ZMDA 3O8ZA 5CBNA 2E5TA 2Y9YA 3AE1C 1RE3A 3CX5I 3EQ2A 1SQQD 2KUBA 1S5LH 3RK3C 2YIUC 1PV3A 4XFJA 1FDMA 3H1LJ 2FFDC 1JOCA 1JTHB 1OWAA 1NHLA 2BEZF 3W68A 2O3JA 2QG4A 3VYIA 2QJKC 1NU1G 1RF0A 1KB9I 1BE3J 4H44D 5H2FH 4TLFA 1S9KE 2OQQA 2PP6A 3ITKA 1RY3A 3CCUP 4R4LA 1T2KC 4WVZA 3HTKB 2WQYC 2KLVA 2WPQA 2QJPB 3FXEA 3SWYA 1QEXA 2W6JH 1BCCG 3H1HG 5KLIC 5CCHD 1FOSF 3PLNA 2A45G 1CSBA 2WSCJ 1AQTA 1D7MA 3KXDA 1RQVA 3KYQA 3L73J 4GIFA 2Q7CA 1S5LE 1VQPP 1NJIQ 1VQ8P 1NTKJ 3L75D 2FXOA 1YQ4C 1YITP 1RHZB 1SQVK 3CC4P 1L0LD 1FBMA 2ITAA 4WWIA 1GMJA
chains in the Genus database with same CATH topology
4RJTA 1SQBD 1P84D 2N9YB 3BCCD 3GG2A 1SQQD 2KS1A 4A7PA 2BCCD 2JWAA 3FWLA 2A06D 2YIUB 1KB9D 1SQVD 2FYUD 2IBZD 2O3JA 2QJYB 2QG4A 2Y0DA 1L0ND 1PPJD 2L91A 2Y0CA 3H1HD 2K9JB 3L70D 3PRJA 3VMAA 4D6TD 4EDFA 3TF5A 1NTZD 1ZRTD 5TJHA 2Y0EA 3ITKA 2RMZA 2Q3EA 3KHUA 1NU1D 4U3FD 3TDKA 2QJKB 1BGYD 1NTMD 3L72D 3GW6A 1PP9D 2QJPB 3L71D 5KKZB 5KLVD 3H1ID 1KYOD 3CX5D 3PLNA 5KLIB 1NTKD 3TGUD 3CXHD 1SQXD 3H1JD 3H1KD 4PD4D 3PTZA 3L73D 2FYNB 3CWBD 2RN0A 3H1LD 3PHLA 3L75D 1BE3D 1SQPD 1EZVD 3L74D 1L0LD 2KNCB 1BCCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RJT A;  1SQB D;  1P84 D;  2N9Y B;  3BCC D;  3GG2 A;  1SQQ D;  2KS1 A;  4A7P A;  2BCC D;  2JWA A;  3FWL A;  2A06 D;  2YIU B;  1KB9 D;  1SQV D;  2FYU D;  2IBZ D;  2O3J A;  2QJY B;  2QG4 A;  2Y0D A;  1L0N D;  1PPJ D;  2L91 A;  2Y0C A;  3H1H D;  2K9J B;  3L70 D;  3PRJ A;  3VMA A;  4D6T D;  4EDF A;  3TF5 A;  1NTZ D;  1ZRT D;  5TJH A;  2Y0E A;  3ITK A;  2RMZ A;  2Q3E A;  3KHU A;  1NU1 D;  4U3F D;  3TDK A;  2QJK B;  1BGY D;  1NTM D;  3L72 D;  3GW6 A;  1PP9 D;  2QJP B;  3L71 D;  5KKZ B;  5KLV D;  3H1I D;  1KYO D;  3CX5 D;  3PLN A;  5KLI B;  1NTK D;  3TGU D;  3CXH D;  1SQX D;  3H1J D;  3H1K D;  4PD4 D;  3PTZ A;  3L73 D;  2FYN B;  3CWB D;  2RN0 A;  3H1L D;  3PHL A;  3L75 D;  1BE3 D;  1SQP D;  1EZV D;  3L74 D;  1L0L D;  2KNC B;  1BCC D; 
#chains in the Genus database with same CATH topology
 3H1J G;  2FYN C;  1KIL A;  1KOR A;  2KS1 B;  2UWJ E;  2GM4 A;  3AEE C;  3B5N B;  4OGQ B;  1FAV A;  4JYB A;  4UB8 H;  2OYI A;  1GL2 D;  2WSE J;  2QA4 P;  3IF4 A;  4XA4 A;  1FZC B;  2Y0C A;  3HUS C;  3O6Q B;  4TT3 H;  3U59 A;  2LKM A;  2R5B A;  2Q1K A;  1MV8 A;  1BDD A;  3PRJ A;  2P67 A;  3TNU A;  2Q3I A;  1GK4 A;  1X8Y A;  2QEX P;  3AEF C;  4I2L C;  3T97 B;  3FGA D;  2POH A;  3G9R A;  1OIP A;  5BVZ A;  1H8A A;  1J1E C;  1LTA C;  1LTJ C;  2HR3 A;  2NPS A;  3F5H A;  1NTM D;  4HKZ H;  2I1K A;  3WUT A;  2O01 J;  3Q5R A;  4H13 C;  1N73 A;  1GTW A;  2WWW A;  4HJG H;  1URQ B;  2GA1 A;  5AW1 B;  2FYU J;  3B5N D;  4IL6 E;  1Q2N A;  2K9J A;  1T3U A;  2IZ1 A;  3HD7 C;  4K35 A;  4OGQ D;  3G3Z A;  3L73 D;  3CWB D;  4JYC A;  5AVW B;  3USS A;  3G71 P;  4UB8 E;  3N4X A;  1GU5 A;  1NOH A;  2ZJS E;  3L74 D;  3SFD C;  3HE4 B;  2NRG A;  3GMA A;  2E76 C;  3GHG A;  4GOF A;  4XE5 B;  5APW A;  3BCC D;  1KQF B;  4ASV A;  1FJK A;  1ZR4 A;  1N2D C;  2I1J A;  1BE3 G;  1L0L K;  3GF3 A;  1L0L E;  1YHQ P;  2C0W A;  1IFJ A;  2N1T D;  1L4A A;  2HG5 D;  2R32 A;  2XND H;  3H1K E;  3NMD A;  3V2R A;  2GUV A;  3VOP A;  2SPZ A;  1EDK A;  1JY2 N;  2QVA A;  1AFO A;  2Y0E A;  1VQ6 P;  4IL6 H;  1VQM P;  2KLU A;  3L72 E;  1JY2 P;  4DCK A;  3C1L A;  1L0L G;  5H2F E;  1X0T A;  4IOI H;  3D71 A;  2JR8 A;  2AXT E;  1KYO D;  3TDK A;  1LJ2 A;  3L74 G;  5CJ4 A;  1SQX E;  3RGU A;  1RF1 B;  2B87 A;  2HOD A;  2C9L Y;  1IC2 A;  1ZN5 A;  3G4S P;  1EZV D;  3KQG A;  4PJ0 H;  2FFD B;  2G3A A;  1NU1 E;  2D2C D;  1HGV A;  2K3R A;  1FDI A;  4C7R A;  4RJT A;  2OYH B;  1H0T A;  2YKP A;  3L35 A;  5CBO A;  3OJA B;  2N1T B;  3CI9 A;  1ZOY C;  1YTZ T;  1NTZ J;  2P10 A;  2P7J A;  3RBZ A;  3VP9 A;  5AVV B;  3D6Z A;  1YJ9 P;  1N8R Q;  3CCL P;  1LT9 A;  2K9Y A;  4C7N A;  1IFN A;  1W2B O;  1Q82 Q;  3AED C;  2FYU E;  4AQR D;  1IO4 A;  1PP9 E;  3S1K A;  2O1K A;  1PPJ D;  3BAS A;  5AVY B;  5BU5 A;  2M5A B;  1BE3 E;  3RK3 B;  5L8R J;  1G1I A;  2V4H A;  3IN6 A;  4GOE A;  3PJS K;  2AXT H;  5GTH H;  1NTK K;  3OA7 A;  1GZL A;  4NPE A;  5AW4 B;  2YMY A;  5KAF E;  2XKM A;  2ZAE B;  1YTZ I;  1NKN A;  2A45 I;  2QJK B;  1R5S A;  3KHU A;  2B89 A;  3MTU E;  3GW6 A;  3CMA P;  2RKL A;  2P1J A;  4O9B A;  1HJ0 A;  1URQ D;  2FY8 A;  5AW2 B;  3M0A A;  2WT7 A;  2WSF J;  3CXH D;  3H25 A;  3H1K D;  1VDF A;  1JNM A;  1VQ4 P;  2JJL A;  1EC5 A;  3AE7 C;  1QVF O;  1S5L X;  1QL1 A;  3JSV C;  3RK2 B;  3HTK A;  1GDT A;  5CCH C;  1P84 E;  3WUV A;  2W27 A;  4DJG A;  3GLM A;  2W90 A;  1LWU A;  1VL2 A;  4A7P A;  3CC7 P;  3V2P A;  1SQB J;  2A06 D;  2W8Z A;  4H0L B;  5KAF H;  3CWB E;  3AEG C;  4I6M C;  3MIW A;  4NPF X;  2M8R A;  3C8V A;  1SQP J;  1EQ7 A;  3B5N C;  3L75 J;  3LW5 J;  1NTZ D;  3AEC C;  4OGQ C;  1DD3 A;  3CCS P;  4ZNC A;  4DOJ A;  2E74 C;  3L71 J;  3MUD A;  5KLV K;  2KNC A;  3E1R A;  3TGU E;  1NTM E;  3TYY A;  3AEA C;  4YXD C;  1VQL P;  2P58 A;  4W7Y A;  2QIW A;  5KLI B;  1M7L A;  3HD7 B;  1KMI Z;  1N7S C;  2B88 A;  3B8E B;  3H1I J;  2FFD A;  3V2Q A;  4PD4 I;  1NAF A;  1VF5 D;  3H32 B;  2YNY A;  3PTZ A;  1SQV E;  1U7J A;  4JPZ B;  2HPC A;  1SFC B;  1A02 J;  4JF7 A;  5APV A;  1FJP A;  2ZYA A;  1N73 B;  2OYH C;  1PGO A;  2YXQ B;  1HH0 A;  1X79 B;  4EI2 A;  1SQQ J;  4PJ0 E;  1L2P A;  1L0N E;  3FWL A;  2YIU B;  1JM0 A;  1AVO A;  1ZV8 A;  1N7S A;  2KIK A;  3HUS B;  3H1L E;  4KJM A;  4N3Y B;  3SSU A;  2MKV A;  3E7K A;  2L91 A;  3H1K J;  2O01 H;  1YBK A;  4U3F E;  1ZW0 A;  1GD2 E;  4EYY Q;  4GDO A;  3MUD C;  2N9B A;  3VMX A;  1YJN P;  1RH5 B;  3V2N A;  1RF1 C;  1BGY D;  1M1K Q;  5GTI H;  2AXC A;  3H1L G;  3MD0 A;  1T2K D;  5AVU B;  5GTH E;  1NGM B;  1URQ C;  2M3E A;  4K3A A;  1XTG B;  1U7M A;  3V4W A;  2A06 G;  1Y47 A;  1YJW P;  1PP9 G;  1NAY A;  3AE6 C;  3I56 P;  2E76 D;  1RE4 A;  2J59 M;  4ASW A;  1SQV G;  1ZR2 A;  2B9B A;  3CCE P;  3WMM 0;  1NTZ E;  1SQQ K;  1KIL E;  1M1J C;  3EFG A;  1BCC J;  1EZV G;  3A3Y B;  3H1H J;  4W7Z A;  3TK1 A;  1UII A;  4BXL A;  4YPC A;  2Z4E A;  1GL2 B;  1SQP G;  3A2A A;  5KLV E;  4H0L C;  3H1I E;  1PIX A;  5CJ0 A;  3MGN A;  2JO1 A;  2Y0D A;  1P84 H;  1AA0 A;  1S72 P;  1JY3 O;  3B71 A;  1BGY G;  5GTI E;  4GKG A;  4H13 B;  1KQS O;  3P32 A;  4LGD E;  4MN4 C;  2XZR A;  2IPP A;  3FWN A;  5AW3 B;  1ZXG A;  4WY4 A;  2R5D A;  4WY4 C;  1S9K D;  1PPJ G;  3H1I G;  3RL0 g;  1VF5 B;  2GUS A;  5APX A;  3A5T A;  5AVZ B;  5AW5 B;  3JC2 2;  1URQ A;  5APT A;  2BCC E;  2KYV A;  4N6J A;  1HTL C;  1IFD A;  1LGH B;  3SWK A;  3Q3D A;  2OTL P;  2M5A A;  2FKW B;  1LTJ B;  1KD1 Q;  3SWF A;  4BWN A;  4U3F J;  3PHL A;  1M1J A;  3HE5 A;  1M56 D;  1USE A;  1XTC C;  3BCC J;  1RE4 C;  2ZFC A;  5KJ7 D;  1FE6 A;  4H44 B;  3FX0 A;  2Y9Z A;  3JCU H;  1EXI A;  2A06 E;  5AVS B;  3L74 J;  2WMM A;  3MZW B;  3AE5 C;  2WVR A;  1JUN A;  2OAR A;  1OZH A;  3V5B A;  2JWA A;  2M0B A;  4N78 D;  3CPW O;  2WPV B;  1FZA A;  1DH3 A;  1YIJ P;  1LTS C;  3P7K A;  1QL2 A;  4OWF A;  3CCV P;  1SQP K;  3VTP C;  3F89 A;  2JDI H;  1QX8 A;  1SQP E;  1T8Z A;  2LXB A;  3OW2 O;  1VQO P;  1W5C E;  1Q90 D;  4L74 A;  3V4Q A;  5KTB A;  3HRN A;  3CCR P;  2WSF H;  2D2C C;  2V7Q J;  3L73 G;  4HB1 A;  3U1A A;  4PD4 H;  2KI7 B;  1AVY A;  1KFM A;  1L4A C;  5AVQ B;  3VP8 A;  3CD6 P;  2AEJ A;  1K05 A;  2XDJ A;  1ZP0 C;  3Q1M A;  1S2E A;  2VRS A;  5K5G B;  3JCU E;  2P2U A;  3P8M C;  3D70 A;  1GK6 A;  1OMI A;  1OVV A;  3BAT A;  1WRG A;  1BE3 D;  1PL5 A;  3QWO C;  2OYH A;  2E75 B;  2CK3 H;  2KNC B;  3GHG C;  3L72 D;  1KZU B;  1KIL D;  2PAJ A;  2C9N Y;  4KT0 J;  5APU A;  3U1C A;  1EDJ A;  5B66 H;  4L73 A;  3Q5S A;  2BCC D;  2H88 C;  2H8P D;  2YO3 A;  1KQG B;  1LWU C;  3LIE A;  4I7Z C;  1PFI A;  2KXP B;  3BRV B;  3O6Q A;  4PD4 E;  3H1J E;  3RL0 B;  2HPC B;  5CCH A;  1MFZ A;  1J1D B;  1W2E A;  3AE8 C;  3A0B E;  5TIS H;  3CCQ P;  3CL3 D;  2E42 A;  4UB6 E;  2Q3E A;  2WSE H;  3L74 E;  2XNX A;  3B5N A;  3KPE A;  1NTM K;  2OYO A;  2KSE A;  1IJD B;  2LR2 A;  3L73 E;  1N7S B;  1N7S D;  3HUS A;  2G8Y A;  2ZT9 B;  5KLV D;  1Y9B A;  1GW3 A;  1NTK E;  1JTH A;  2I8D A;  3AEB C;  3TNU B;  2OYI C;  2A45 H;  3H1L D;  1CI6 A;  4Y28 J;  5AVR B;  1LTB C;  3S9O A;  2FXM A;  1HBW A;  2ZVN B;  3HE4 A;  2E5Y A;  4PV1 C;  1SQB D;  3QH9 A;  3RL0 D;  1Y8A A;  1LP1 B;  3L70 G;  3EFF K;  3VN0 A;  3AE2 C;  1MKM A;  1HGZ A;  1FC2 C;  4AUW A;  1JMB A;  1SQV D;  1IZN B;  4BRY A;  2WSS H;  3L4F A;  1K9M Q;  4I1L A;  2LXC B;  1LNQ A;  2ZXX A;  2L5G B;  3LID A;  1FOS E;  2AEM A;  2R3C A;  3TF5 A;  1OVU A;  4IFD K;  2J5U A;  5TJH A;  3H1K G;  4U3F D;  3B4S A;  3AE9 C;  1RF0 C;  3M9B A;  1G2C A;  2ZXE B;  1G1J A;  3IFM A;  1IK7 A;  2BCC J;  4L76 A;  2JKV A;  5AW6 B;  1FZG A;  2H89 C;  2OYI B;  1NTK D;  1L4A B;  1NVO A;  1YQ3 C;  1SQB G;  2NPS D;  1RF1 A;  1RE3 C;  1EZV I;  1KYO I;  3S4R A;  4HYT B;  1KTM A;  2FYU K;  2CPS A;  1FU1 A;  1KIL B;  2HLO A;  3CCM P;  2FXP A;  2NZ2 A;  1OW6 A;  3T97 A;  1VQ7 P;  1OVR A;  1USD A;  1P84 D;  1SQX G;  1ZLL A;  4U7J A;  3BVH A;  4M3L A;  1FZC A;  1S4X A;  1SQB E;  2OGU A;  1TU3 F;  1IFP A;  1QVG O;  1LT9 B;  2M3B A;  2XV5 A;  5AVT B;  2YKO A;  1AQ5 A;  1PGP A;  4AYC A;  2IX7 C;  2KZJ A;  1ZME C;  2K9J B;  5KLV G;  3CXH E;  5KKZ C;  5B66 E;  5B5E H;  1J1D C;  1SQX K;  2JEE A;  2W6B A;  1J1E B;  3A7O A;  2AEF A;  2IZ0 A;  2YXR B;  5C39 A;  1CW5 A;  1DEE G;  2E75 D;  2QE7 H;  2ZYD A;  2Z5I A;  2PGD A;  4RES B;  1Q86 Q;  4RO0 A;  3L72 J;  3MHV A;  4D6T G;  1BGY J;  3CX5 D;  3A0B H;  3H6P A;  3M06 A;  5TIS E;  3W67 A;  4UB6 H;  1VQ9 P;  2WIT A;  5DJU B;  4Y99 B;  2K88 A;  1S3J A;  1N73 C;  2K37 A;  2NPS C;  2IBZ E;  2QSI A;  2E75 C;  3IR9 A;  3WU2 H;  1A02 F;  1JY3 P;  1BCC D;  3AE4 C;  2ZYG A;  3H1H D;  4PV1 B;  2KOG A;  3RBX A;  1VQ5 P;  2Z5H A;  1R8E A;  1MFT A;  2QJY C;  1T6A A;  3Q5P A;  5B5E E;  2CPB A;  2DW3 A;  1CZQ A;  3L72 G;  1LWU B;  1WMK A;  4L75 A;  4U3F G;  4CPG A;  4D6T J;  2IBZ D;  2E43 A;  1JO5 A;  4N78 E;  3N7N A;  1NWQ A;  1HVV A;  1KFN A;  2QJP C;  2YKQ A;  1NTK G;  3P8C D;  3UIA A;  3MP7 B;  1ZRT D;  3P8C E;  4IFF A;  1OXZ A;  1S1C X;  1LT1 A;  2E74 D;  4GOD A;  1FZB A;  1FZE A;  3L37 A;  4IFM A;  1FDO A;  4I7Z B;  4B86 A;  1HJB A;  1RQU A;  1H0T B;  1L4A D;  1PP9 D;  1K8A Q;  2N1T A;  3WU2 E;  3KZI E;  1HUC A;  4EOT A;  1M57 D;  1FS0 E;  2WPR A;  1SS1 A;  3II6 A;  4C7N B;  2K1A A;  4YTP C;  5KAI H;  3EWK A;  1L0N J;  2FBW C;  2PFX A;  3PP5 A;  2RN0 A;  3M0D A;  1SQP D;  1NTM G;  1L0L J;  1Q81 Q;  3ZDM A;  1DX7 A;  2JWD A;  1KIL C;  2PRR A;  2Q5U A;  2ZVO B;  1EZV E;  1YI2 P;  5AVX B;  1KB9 H;  2IBZ G;  3BCC E;  4D6T E;  1KQL A;  3GG2 A;  3PH0 A;  1YYC A;  1DIP A;  3RK3 E;  2KS1 A;  1DD4 A;  3CX5 E;  4JQ0 D;  5KLV J;  2WZ7 A;  1LT9 C;  1KB9 D;  3H32 A;  4H0L D;  3H1I D;  3Q2Y A;  3D6Y A;  1K04 A;  1PZQ A;  3L70 D;  4D6T D;  5M1B A;  1E5W A;  4PV1 D;  1JY3 N;  3BCC G;  4ZKP A;  1NO4 A;  1SVF A;  3I5C A;  1NTM J;  3NTN A;  4W80 A;  3R2P A;  4R4M A;  2RH0 A;  3M9H A;  3CME P;  1BSH A;  1L0N G;  4H13 D;  1SP4 A;  2C0X A;  3CXH H;  2IYO A;  3R4Y A;  3TGU J;  1MZ9 A;  1PP9 J;  1NU1 K;  1OW8 A;  5CCG D;  2QM8 A;  3HD7 D;  4BRY B;  5DJT B;  1NYH A;  2WT7 B;  1SQV J;  1NH4 A;  1QLE D;  2O1J A;  3C9I A;  2W83 C;  3H1J J;  1N7L A;  3IAO A;  1L0N K;  2KP8 A;  4JBZ A;  2IDB A;  2E76 B;  1FZF A;  3CX5 H;  3OAK A;  2KB7 P;  4KHX A;  5KJ7 C;  4HH2 A;  1JCD A;  1OFC X;  2WSC H;  3LW5 H;  4H44 C;  5KJ7 A;  3GHG B;  2N9Y B;  4ZKU A;  2KK7 A;  2KZI A;  1SQB K;  2YO2 A;  3FXD A;  2J58 A;  3TGU G;  5AW8 B;  5E79 E;  1EDL A;  2KSJ A;  4OH8 B;  2QJY B;  4LLH A;  1GL2 C;  1GW4 A;  1L0N D;  2IBZ I;  3GF7 A;  2OTJ P;  1WT6 A;  4OVN F;  1JY2 O;  2E74 B;  3L70 J;  4WY4 D;  2IFN A;  3M9Q A;  2D2C B;  4Y99 C;  1KYO H;  1SFC D;  5CHX A;  2FYU G;  2QRX A;  3HD7 A;  1VPC A;  3L75 G;  5KKZ B;  2H43 A;  1BGY E;  3CLQ A;  1AV1 A;  1VQK P;  3H1J D;  1OW7 A;  2ZT9 C;  1CI6 B;  4PD4 D;  3CXH I;  1VQN P;  2BCC G;  1SFC A;  1LTJ A;  4GT1 A;  1R5L A;  5AW0 B;  3V6I A;  1NKZ B;  1M1J B;  3HE5 B;  3KZI H;  2XU6 A;  1H88 A;  1P84 I;  1PGJ A;  1MUU A;  4WB4 A;  3L75 E;  5E79 H;  3TGU D;  1GU4 A;  1LP1 A;  5KAI E;  1EDI A;  3M0D C;  1LTT C;  1QGK B;  5APY A;  3TSI A;  1IFI A;  1OX3 A;  2NPS B;  5CMZ A;  3RL0 C;  1PGQ A;  2ZT9 D;  4WBA A;  1AJY A;  3NFQ A;  5CCG C;  2OTK E;  1SQX J;  1KB9 E;  2JP3 A;  1JMM A;  1K73 Q;  1KN7 A;  1E79 H;  4EDF A;  2N1T C;  4LC1 A;  2MJZ A;  2R44 A;  1SQQ G;  1VF5 C;  1T3J A;  3K5B A;  3E1I A;  4IL6 X;  1NU1 J;  3L71 E;  3RK2 D;  1J2J B;  3BRT B;  1G2C B;  3CWB G;  1JEK A;  2HFE D;  2WTY A;  5AW9 B;  2IFM A;  2IYP A;  1NTZ G;  2O01 N;  5CCG A;  3A0H E;  1NTZ K;  1SQQ E;  3ABV C;  5AW7 B;  4QMA A;  3G6E P;  2FYN B;  3KDP B;  3L71 G;  5APQ A;  2V7Q H;  1LTI C;  2BAS A;  3RK2 C;  1KC8 Q;  4EIJ A;  1HWT C;  3L70 E;  1LTG C;  1SLQ A;  3SFE C;  4Z1M H;  2Q6Q A;  1M8O B;  3CC2 P;  1IK9 A;  1SFC C;  3RK3 D;  1HF9 A;  1GL2 A;  2FYZ A;  2WPS A;  3L36 A;  3CWB J;  1PPJ E;  1BSN A;  3I55 P;  1UIX A;  2H7H A;  2FYU D;  5EFW B;  3VMA A;  2W6A A;  4C46 A;  1DEB A;  4DT0 A;  4DZO A;  3AE3 C;  4YXW H;  3VMZ A;  3CCJ P;  1FZC C;  2B87 B;  2HOD B;  4WY4 B;  1N86 A;  1X9V A;  2RMZ A;  1BCC E;  3A0H H;  1Z56 A;  1NU1 D;  3H1H E;  1M90 Q;  1JCC A;  2R3S A;  3L71 D;  1IFM A;  3M91 A;  2QM7 A;  1X22 A;  4NPD A;  1KV4 A;  2Q9I A;  1SQX D;  5APS A;  1U57 A;  2HYN A;  1ZRT E;  1JB0 J;  1KYO E;  3NXS A;  3WUU A;  2YMK A;  5BU8 B;  2BEQ D;  3VMY A;  1EXJ A;  1BDC A;  1Q7Y Q;  1H89 A;  4RKU J;  4ZMD A;  3O8Z A;  5CBN A;  2E5T A;  2Y9Y A;  3AE1 C;  1RE3 A;  3CX5 I;  3EQ2 A;  1SQQ D;  2KUB A;  1S5L H;  3RK3 C;  2YIU C;  1PV3 A;  4XFJ A;  1FDM A;  3H1L J;  2FFD C;  1JOC A;  1JTH B;  1OWA A;  1NHL A;  2BEZ F;  3W68 A;  2O3J A;  2QG4 A;  3VYI A;  2QJK C;  1NU1 G;  1RF0 A;  1KB9 I;  1BE3 J;  4H44 D;  5H2F H;  4TLF A;  1S9K E;  2OQQ A;  2PP6 A;  3ITK A;  1RY3 A;  3CCU P;  4R4L A;  1T2K C;  4WVZ A;  3HTK B;  2WQY C;  2KLV A;  2WPQ A;  2QJP B;  3FXE A;  3SWY A;  1QEX A;  2W6J H;  1BCC G;  3H1H G;  5KLI C;  5CCH D;  1FOS F;  3PLN A;  2A45 G;  1CSB A;  2WSC J;  1AQT A;  1D7M A;  3KXD A;  1RQV A;  3KYQ A;  3L73 J;  4GIF A;  2Q7C A;  1S5L E;  1VQP P;  1NJI Q;  1VQ8 P;  1NTK J;  3L75 D;  2FXO A;  1YQ4 C;  1YIT P;  1RHZ B;  1SQV K;  3CC4 P;  1L0L D;  1FBM A;  2ITA A;  4WWI A;  1GMJ A; 
#chains in the Genus database with same CATH homology
 4RJT A;  1SQB D;  1P84 D;  2N9Y B;  3BCC D;  3GG2 A;  1SQQ D;  2KS1 A;  4A7P A;  2BCC D;  2JWA A;  3FWL A;  2A06 D;  2YIU B;  1KB9 D;  1SQV D;  2FYU D;  2IBZ D;  2O3J A;  2QJY B;  2QG4 A;  2Y0D A;  1L0N D;  1PPJ D;  2L91 A;  2Y0C A;  3H1H D;  2K9J B;  3L70 D;  3PRJ A;  3VMA A;  4D6T D;  4EDF A;  3TF5 A;  1NTZ D;  1ZRT D;  5TJH A;  2Y0E A;  3ITK A;  2RMZ A;  2Q3E A;  3KHU A;  1NU1 D;  4U3F D;  3TDK A;  2QJK B;  1BGY D;  1NTM D;  3L72 D;  3GW6 A;  1PP9 D;  2QJP B;  3L71 D;  5KKZ B;  5KLV D;  3H1I D;  1KYO D;  3CX5 D;  3PLN A;  5KLI B;  1NTK D;  3TGU D;  3CXH D;  1SQX D;  3H1J D;  3H1K D;  4PD4 D;  3PTZ A;  3L73 D;  2FYN B;  3CWB D;  2RN0 A;  3H1L D;  3PHL A;  3L75 D;  1BE3 D;  1SQP D;  1EZV D;  3L74 D;  1L0L D;  2KNC B;  1BCC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...