2JWAA

Erbb2 transmembrane segment dimer spatial structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
44
structure length
44
Chain Sequence
GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Receptor tyrosine-protein kinase erbB-2
publication title Spatial Structure of the Dimeric Transmembrane Domain of the Growth Factor Receptor ErbB2 Presumably Corresponding to the Receptor Active State
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 13
structure length 44
sequence length 44
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2jwaA00
5KLIB 3L74D 3PTZA 3PHLA 1SQQD 2YIUB 3ITKA 3TDKA 5KKZB 3GW6A 3L72D 1SQVD 3CX5D 5KLVD 3L73D 1L0LD 3KHUA 2IBZD 2KNCB 2O3JA 3CXHD 3PRJA 3GG2A 1PP9D 1KYOD 3H1HD 1PPJD 2QJPB 1BCCD 3L70D 3VMAA 2L91A 2QJYB 2JWAA 2QJKB 3H1ID 3FWLA 3PLNA 2FYNB 2QG4A 2Y0CA 1SQXD 2A06D 2RN0A 1NTZD 4D6TD 4U3FD 1BGYD 1NTKD 2RMZA 1L0ND 2KS1A 3CWBD 4EDFA 2Y0EA 1ZRTD 3H1KD 3H1JD 2Q3EA 5TJHA 1P84D 2FYUD 4RJTA 3L75D 2K9JB 1EZVD 1BE3D 1SQBD 2Y0DA 4A7PA 4PD4D 3BCCD 3H1LD 3TF5A 1SQPD 3TGUD 2N9YB 1KB9D 3L71D 1NU1D 1NTMD 2BCCD
chains in the Genus database with same CATH superfamily
1N7SD 5KLVG 4PD4I 1Q90D 3QWOC 1OW6A 3CI9A 1PGJA 2E76D 1VQLP 2OQQA 3HTKA 1PV3A 3KPEA 3QH9A 1BCCD 2P1JA 2QJYB 4CPGA 2M3BA 3EWKA 2Q3IA 3KZIH 2JWDA 2ZYDA 2XV5A 1JY2O 2W27A 2KI7B 4R4LA 5APTA 4JYBA 1BGYE 2L5GB 1KN7A 2W6BA 1Q86Q 1EZVG 3NXSA 1BDDA 4OGQC 1FDIA 3KXDA 3V5BA 1VQNP 1RQVA 3L75E 4DOJA 3L70J 2ITAA 1KILB 5H2FE 3AEAC 2PRRA 5CMZA 2IFNA 2B88A 1URQA 1HWTC 1NYHA 4UB6E 5AW3B 2IBZE 4HB1A 1AVYA 2WSEH 1VQKP 2FY8A 3IFMA 1T3JA 1EXJA 1FDMA 5H2FH 5CBNA 1FE6A 1IFNA 5AW4B 1GZLA 1Y9BA 5KLVE 5AVVB 5AW2B 4UB6H 2NPSA 4YXDC 2FYUJ 1JOCA 2PGDA 1NJIQ 2KSEA 4NPEA 2WSSH 3HRNA 1SQXG 2BASA 3RK2C 5AVWB 3RBZA 2A06G 2Y9YA 1NAFA 2OGUA 1BCCG 3CMAP 1FJPA 2JKVA 1SVFA 1EDLA 2AEFA 4DT0A 1NTKD 4IFDK 5AW1B 3BATA 3H1JG 4L76A 1JM0A 1KB9E 1PGOA 1WRGA 3L71E 4IL6X 1P84E 1PZQA 1J1DC 2QJPC 1IFPA 1LTGC 1JY2P 4C7NA 3CC2P 1Q2NA 4K35A 4H44C 1RF0A 2IYPA 3HUSA 3TGUD 1ZR2A 1KTMA 3H1KJ 1KB9H 4OGQB 5KAFE 3L37A 2R3SA 2KK7A 3L73G 1P84H 4C7RA 1JCCA 1QX8A 2E42A 4H13B 1HGVA 1GL2B 3VTPC 1H88A 2GA1A 3PRJA 4YXWH 1Y47A 4TT3H 3H1IG 1G2CA 1M7LA 5KAFH 2IDBA 1FBMA 2KZIA 1DEEG 1SFCA 2H43A 2QJKB 4KT0J 5KAIE 1W2BO 1FZBA 1CW5A 5AVTB 2KIKA 1NTZG 3HE5A 1IJDB 2J58A 3MIWA 2R32A 3CPWO 2A06E 2XNXA 4D6TD 3CCLP 4OGQD 2OYOA 1S4XA 1E79H 3RK2B 1N73B 5KAIH 3USSA 1GDTA 3H1JE 4KJMA 4H13D 2P10A 4RJTA 3HD7B 1GL2D 1LTAC 3V2PA 3E7KA 4NPFX 1LP1A 3UIAA 1BSHA 1SQPK 4DZOA 4GOFA 3CCSP 3II6A 1URQC 1NU1D 1IFIA 3F89A 1YITP 3AEFC 2I1KA 1RF1B 1HF9A 1L0LG 3WU2E 1L0NJ 3V4QA 1N86A 1PP9G 3CX5E 4DJGA 2FFDA 3L73E 4I1LA 1KD1Q 1NTMK 3MTUE 2HPCB 1KYOD 3RK2D 2K3RA 2NPSC 1LT9A 3A3YB 2B9BA 4W7YA 3AEEC 3WU2H 1SQVK 2XDJA 5AVSB 2N1TB 4OVNF 1EDJA 1FC2C 3CX5H 2OYIB 2ZVNB 3MZWB 1VQ4P 3O8ZA 2OTKE 1HJ0A 2A45H 3CC4P 3HTKB 2AXCA 2Z5HA 4WBAA 3MUDA 1BGYD 1S2EA 3GF7A 3EFGA 2KNCA 3SFDC 3M91A 3A0BE 2ZYGA 1SQXJ 5AVXB 3H1KD 3H1LG 2Q3EA 4H44D 1IO4A 4O9BA 3B8EB 3L75D 1BCCJ 3VN0A 1J1EB 4NPDA 1K05A 2Y0DA 4I7ZC 1X9VA 4AUWA 1NWQA 4AQRD 1NO4A 3SWKA 1DIPA 1LTJA 1RF0C 1IFJA 1HVVA 2IZ1A 1SQQG 1EDIA 2YO2A 3A0BH 3HUSC 5CCGA 2R5DA 1JMBA 1MZ9A 3T97B 1YIJP 2CPSA 1ZV8A 1SQBK 3PHLA 1LWUB 1N2DC 3FXEA 1GK6A 1NU1G 2E74B 2JR8A 1KC8Q 3H1HG 4EYYQ 4RO0A 1M90Q 5KLVD 2HG5D 1L0LE 3D70A 2KOGA 3U1CA 3CXHE 1PP9E 3WUTA 1TU3F 2N9BA 3V2RA 1DD4A 1YHQP 2LKMA 1GK4A 2J5UA 4AYCA 4WY4B 2O01J 3GLMA 1SFCC 5APQA 1DX7A 1JUNA 4BXLA 4EOTA 2R44A 3AE8C 2WT7A 2YMYA 3CXHH 1W2EA 3KYQA 3BASA 4PD4E 2J59M 3H1IJ 1M56D 2POHA 2M8RA 2YXQB 5M1BA 1N7SB 1LT1A 1YTZI 2MJZA 1S5LH 2E74D 2E76B 1HGZA 1IFDA 1S1CX 1P84D 3CL3D 1NTZJ 2AEMA 5APYA 1EZVD 4IL6E 1K73Q 4GDOA 2ZXEB 1URQD 1K9MQ 3H1LE 4PD4H 1NGMB 2H8PD 3L75G 1H0TB 1FJKA 2OTLP 3C9IA 1HUCA 2B87B 1VQ7P 3SWFA 5BU5A 1FU1A 2VRSA 1NTKJ 4ZMDA 2IBZG 2PFXA 3M0DA 4B86A 2KUBA 1XTCC 4GIFA 3SFEC 2K9JA 1YJWP 1QGKB 2W6AA 2FFDC 2PP6A 2OYHB 4BRYB 3AE1C 1VL2A 3B5NA 4HKZH 1QEXA 2L91A 1YI2P 2FBWC 2WZ7A 1LT9C 1BDCA 3TGUJ 2FYNB 4QMAA 1M1JB 3AEDC 1ZRTE 1RE4A 1YQ4C 3BRTB 3SWYA 1SQXD 2E43A 3D71A 5CJ4A 2OARA 1VQ8P 3BVHA 3CCQP 2A06D 1Q82Q 1BE3E 1U7MA 1RHZB 2P2UA 5KKZC 2KS1A 3V2NA 3V6IA 3MUDC 5CHXA 4MN4C 4EDFA 2Q1KA 1M8OB 1OVVA 2H88C 2KB7P 3H1JD 4GT1A 3O6QA 3L4FA 3PH0A 3E1IA 3L71G 3TNUA 2M5AA 3P7KA 1VQMP 3L72E 1G1JA 4RKUJ 3GHGB 3GMAA 5KTBA 3CMEP 1ZN5A 1USEA 4OH8B 1LTJC 1ZR4A 2FYUK 4Y99C 1Y8AA 4D6TJ 5CCGC 4OWFA 2C0WA 2YIUB 1OZHA 4IFFA 4L74A 1AV1A 1QVGO 1HTLC 3OA7A 3CX5D 3L73D 1ZLLA 2IYOA 1OFCX 2H89C 3AE3C 2WPQA 3RK3E 4U3FE 3VMAA 2HLOA 3MGNA 1SQQJ 3K5BA 2ZT9C 2WPSA 3H1ID 3PLNA 2M0BA 1NU1J 1KYOI 2Y0CA 2QEXP 3FGAD 4PV1B 3H1HJ 3L36A 5KLIC 2W90A 2C9NY 3CWBG 4Y28J 1NTZD 4LGDE 4Z1MH 1CZQA 2IFMA 1IZNB 1YTZT 2W8ZA 1JTHB 3CD6P 3WMM0 3AE4C 2FXMA 1LT9B 3RGUA 2ZVOB 4W80A 4ZKPA 1Q7YQ 5AW9B 5APXA 1YJ9P 3U1AA 1HH0A 2B89A 3CLQA 3BCCE 1VDFA 1JB0J 1NTMG 1EXIA 3N4XA 3G4SP 2YKOA 3B71A 2RH0A 1SQVG 5KJ7A 1GW4A 1GU4A 1BGYJ 1JY2N 4PV1D 3EFFK 2ZFCA 3M0DC 2NZ2A 1L0LD 2WSEJ 1NKNA 4HH2A 3CXHD 1GW3A 1S9KE 1R5LA 3GG2A 1PP9D 1LTJB 3L75J 3VP8A 2Q5UA 4Y99B 1MKMA 3LIDA 2YKQA 2A45G 3RK3C 2D2CC 3LIEA 3A7OA 3LW5H 2JDIH 2AXTE 1JY3O 3VOPA 2HFED 1A02J 3CWBE 1UIXA 1SQPE 1QL1A 5KLVJ 2XZRA 3IN6A 2WSCH 5AW6B 3OJAB 2E75C 4PJ0E 1ZW0A 1CI6B 2LR2A 1L0NK 2AXTH 2BCCG 1KQSO 2E5YA 3H1LD 4EI2A 1QL2A 3IF4A 2QSIA 1L2PA 3L74G 5CCGD 2MKVA 1X22A 1P84I 1NTME 1IK7A 1EZVI 2XNDH 2YKPA 2Z5IA 5GTIE 3AE7C 3PTZA 1RQUA 3RL0C 1SQQD 1VF5C 2K1AA 2KYVA 4TLFA 1YQ3C 1SQVE 2C0XA 1PPJG 3L71J 1E5WA 1T3UA 1KILA 1X79B 1R5SA 4H0LC 1FOSF 3H1HD 1H8AA 1BSNA 1J1DB 4YPCA 2QJPB 2WVRA 2R5BA 5GTIH 1OWAA 1KQFB 2YNYA 2HODA 3MHVA 2ZYAA 2JO1A 4H44B 1LNQA 2DW3A 5GTHE 1SQXK 1QLED 2RMZA 3AE5C 2P7JA 1WMKA 4C46A 2ZXXA 3FX0A 5C39A 3NMDA 2YXRB 1FZAA 5APWA 1SQBE 1EC5A 2BEQD 4L75A 3I55P 2O1KA 1JY3P 1ZMEC 2BCCE 3OW2O 3I56P 1R8EA 3JC22 2IPPA 4RESB 3NTNA 1NVOA 3L74E 2WPVB 2XU6A 5KJ7C 1KILE 2IZ0A 2FKWB 1S3JA 3R4YA 4LLHA 1HBWA 3L70G 1X0TA 2IBZD 2WSFH 3H1JJ 3P8CE 3RK3D 1PPJE 1FAVA 3M9QA 3CCJP 1AJYA 1RH5B 3RL0B 1OXZA 4ZNCA 3CX5I 1K8AQ 3GF3A 4IFMA 1YBKA 2QG4A 3NFQA 4XA4A 3MP7B 1URQB 4GKGA 4N3YB 1A02F 1PGPA 2OTJP 2RN0A 5B5EE 3TK1A 1GL2A 1FZFA 2Q7CA 2FYUG 2E75D 2K88A 1J2JB 3L73J 1BE3G 1LTIC 2WQYC 2WITA 3Q2YA 1NH4A 1LGHB 4LC1A 2YMKA 2QA4P 2YO3A 1LTSC 1NTKK 1VQPP 3AE2C 2NPSB 3BCCD 3VYIA 3P8MC 3TYYA 2LXCB 5EFWB 4R4MA 1JCDA 2AEJA 1KB9D 3L71D 3RL0D 1VF5D 1JEKA 1L4AA 1GMJA 3L72G 1Q81Q 5APSA 1N73A 3ITKA 3WUVA 3M0AA 3D6ZA 3HD7A 1PL5A 5APVA 2FXPA 2IX7C 1KILC 3L70E 3U59A 1MUUA 4JQ0D 3AEGC 3HE4A 4W7ZA 4I7ZB 4IL6H 3Q5PA 3FWLA 4C7NB 1QVFO 4U3FG 2NPSD 1RF1A 2HYNA 3P32A 3N7NA 2KP8A 1VQ9P 3HUSB 1T2KC 4HJGH 1W5CE 1FZCA 5TISE 1K04A 5CCHA 3Q1MA 1KQGB 1VQ6P 3CWBD 2HPCA 1T6AA 1L0LJ 1PP9J 2FYUE 2G8YA 1KV4A 3G71P 3KZIE 1MFTA 2N1TA 2UWJE 4A7PA 1JNMA 1G2CB 2OYIA 5TISH 1ZP0C 1SFCB 1FS0E 3BRVB 1NTMD 1KYOE 3PJSK 5KJ7D 3BCCG 1AVOA 4XE5B 2O1JA 3HE5B 1KORA 1SQQK 3VMXA 3KQGA 4DCKA 3RBXA 1SQVD 1N7LA 4ZKUA 1FZGA 1NU1K 2O3JA 4BWNA 3CC7P 1KYOH 1EQ7A 3PP5A 1IK9A 2H7HA 3H1LJ 3CCRP 2QE7H 1RY3A 5AVUB 5AVRB 3T97A 3CCUP 2FXOA 5CBOA 1T8ZA 1LP1B 2Q9IA 3H1KE 1L0NG 1XTGB 3IR9A 4JYCA 1LWUA 4M3LA 1M57D 1AFOA 1SFCD 2O01N 2CK3H 3S1KA 3G6EP 4H13C 1YJNP 4ASVA 1GL2C 5BVZA 1MFZA 5BU8B 2HODB 1VQ5P 2I8DA 4WVZA 1NHLA 2FFDB 1FZEA 1VQOP 2XKMA 3L35A 4WY4A 1PIXA 1SQPG 4L73A 5AW0B 2QJKC 1SQBD 4GOEA 1G1IA 2QM8A 1D7MA 3M06A 2Y9ZA 3G9RA 1PFIA 2BCCD 2WWWA 2ZJSE 1N7SA 1BE3J 3L74D 1L4AC 2KLVA 1IFMA 1S5LX 2G3AA 5KKZB 1NKZB 1N73C 1KILD 1ZOYC 2KNCB 3VP9A 1AA0A 4N78E 3HD7C 3P8CD 1PPJD 1WT6A 2R3CA 1H0TA 2JWAA 2K37A 2CPBA 2KXPB 3L72J 1OW8A 2IBZI 2W83C 2B87A 5KLVK 1AQTA 1VPCA 1T2KD 2RKLA 1Z56A 2Q6QA 2E5TA 3Q5RA 1EZVE 1SLQA 1SP4A 1RF1C 1L0NE 3ABVC 3B5NC 2W6JH 4U7JA 4BRYA 2OYHA 2FYZA 2GM4A 2KSJA 3H32A 1FZCC 5CCHC 1FDOA 3AE9C 3D6YA 1RE4C 4U3FJ 1M1JA 4PD4D 2ZT9B 3E1RA 1U7JA 3M9HA 3A0HE 2N1TC 1USDA 2N9YB 2OYIC 2V7QH 1KQLA 1SQBG 4I2LC 1EDKA 4XFJA 5KLIB 3VMZA 2WT7B 1KFNA 3W67A 1KB9I 2Z4EA 4JF7A 1RE3A 3Q3DA 1YYCA 3A0HH 1UIIA 1SQXE 2WTYA 1DH3A 1OW7A 1BCCE 1J1EC 2SPZA 5AW8B 3L70D 4JPZB 3GHGA 3M9BA 1GD2E 4PJ0H 1L4AB 3BCCJ 2NRGA 3KDPB 3R2PA 3H25A 1NTKG 3AE6C 2ZT9D 2KLUA 3CCVP 1JO5A 1LWUC 1AQ5A 2E74C 3HE4B 3LW5J 2QM7A 1JMMA 1KFMA 1LTBC 1ZRTD 2KZJA 1DEBA 1CSBA 3JSVC 5TJHA 3WUUA 2FYUD 1LTTC 2K9JB 3TSIA 3TGUG 5B66E 1BE3D 1M1KQ 4WY4C 3AEBC 2PAJA 3B5NB 2V7QJ 5AVQB 3TF5A 4I6MC 3RK3B 2D2CB 4EIJA 4K3AA 1GTWA 1FZCB 2WSCJ 1L4AD 5K5GB 1JTHA 3G3ZA 5GTHH 1OMIA 3JCUE 3H1IE 1N7SC 3TDKA 5E79E 5B66H 1HJBA 3L72D 3CWBJ 3HD7D 1SQPJ 3FXDA 1JY3N 2O01H 3VMYA 4UB8E 3KHUA 2E76C 2KS1B 5AW5B 1NTZE 2E75B 3SSUA 4HYTB 3O6QB 3RL0g 1H89A 3JCUH 3TNUB 4D6TG 5E79H 2M5AB 4WWIA 1NTMJ 1PGQA 1S72P 4UB8H 3A5TA 3B5ND 2D2CD 4U3FD 1NTKE 5CCHD 5AW7B 3CCEP 1VF5B 2QIWA 4ASWA 2HR3A 1SQVJ 5AVYB 3Q5SA 3EQ2A 3S4RA 2A45I 2OYHC 3IAOA 2Y0EA 1OX3A 3B4SA 1SS1A 4H0LB 1OVRA 2N1TD 1NTZK 2JJLA 1NOHA 3F5HA 4YTPC 5AVZB 5DJUB 5CJ0A 4N6JA 2FYNC 1M1JC 3TGUE 2K9YA 2JEEA 4KHXA 4WB4A 2QRXA 2QJYC 2V4HA 1IC2A 1OVUA 5B5EH 3GW6A 1S5LE 2JP3A 2C9LY 3OAKA 1CI6A 2BEZF 2QVAA 3CCMP 1RE3C 1X8YA 4N78D 1DD3A 5DJTB 5APUA 2WPRA 2WMMA 2LXBA 3AECC 1SQBJ 4IOIH 1KZUB 2P58A 1U57A 3GHGC 4H0LD 3ZDMA 2WSFJ 1L0LK 1BGYG 2BCCJ 3V4WA 1ZXGA 3S9OA 3W68A 1S9KD 1MV8A 4D6TE 3L74J 2YIUC 3H6PA 2GUVA 1OIPA 1L0ND 3A2AA 3H1KG 3FWNA 3C1LA 3I5CA 2ZAEB 2P67A 1GU5A 3CXHI 5L8RJ 2M3EA 3C8VA 4WY4D 1KMIZ 1SQQE 3V2QA 4JBZA 4GODA 1FOSE 1N8RQ 2I1JA 3MD0A 1SQPD 4PV1C 1NU1E 1NAYA 2GUSA 3H1HE 1LJ2A 3H32B
chains in the Genus database with same CATH topology
5KLIB 3L74D 3PTZA 3PHLA 1SQQD 2YIUB 3ITKA 3TDKA 5KKZB 3GW6A 3L72D 1SQVD 3CX5D 5KLVD 3L73D 1L0LD 3KHUA 2IBZD 2KNCB 2O3JA 3CXHD 3PRJA 3GG2A 1PP9D 1KYOD 3H1HD 1PPJD 2QJPB 1BCCD 3L70D 3VMAA 2L91A 2QJYB 2JWAA 2QJKB 3H1ID 3FWLA 3PLNA 2FYNB 2QG4A 2Y0CA 1SQXD 2A06D 2RN0A 1NTZD 4D6TD 4U3FD 1BGYD 1NTKD 2RMZA 1L0ND 2KS1A 3CWBD 4EDFA 2Y0EA 1ZRTD 3H1KD 3H1JD 2Q3EA 5TJHA 1P84D 2FYUD 4RJTA 3L75D 2K9JB 1EZVD 1BE3D 1SQBD 2Y0DA 4A7PA 4PD4D 3BCCD 3H1LD 3TF5A 1SQPD 3TGUD 2N9YB 1KB9D 3L71D 1NU1D 1NTMD 2BCCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLI B;  3L74 D;  3PTZ A;  3PHL A;  1SQQ D;  2YIU B;  3ITK A;  3TDK A;  5KKZ B;  3GW6 A;  3L72 D;  1SQV D;  3CX5 D;  5KLV D;  3L73 D;  1L0L D;  3KHU A;  2IBZ D;  2KNC B;  2O3J A;  3CXH D;  3PRJ A;  3GG2 A;  1PP9 D;  1KYO D;  3H1H D;  1PPJ D;  2QJP B;  1BCC D;  3L70 D;  3VMA A;  2L91 A;  2QJY B;  2JWA A;  2QJK B;  3H1I D;  3FWL A;  3PLN A;  2FYN B;  2QG4 A;  2Y0C A;  1SQX D;  2A06 D;  2RN0 A;  1NTZ D;  4D6T D;  4U3F D;  1BGY D;  1NTK D;  2RMZ A;  1L0N D;  2KS1 A;  3CWB D;  4EDF A;  2Y0E A;  1ZRT D;  3H1K D;  3H1J D;  2Q3E A;  5TJH A;  1P84 D;  2FYU D;  4RJT A;  3L75 D;  2K9J B;  1EZV D;  1BE3 D;  1SQB D;  2Y0D A;  4A7P A;  4PD4 D;  3BCC D;  3H1L D;  3TF5 A;  1SQP D;  3TGU D;  2N9Y B;  1KB9 D;  3L71 D;  1NU1 D;  1NTM D;  2BCC D; 
#chains in the Genus database with same CATH topology
 1N7S D;  5KLV G;  4PD4 I;  1Q90 D;  3QWO C;  1OW6 A;  3CI9 A;  1PGJ A;  2E76 D;  1VQL P;  2OQQ A;  3HTK A;  1PV3 A;  3KPE A;  3QH9 A;  1BCC D;  2P1J A;  2QJY B;  4CPG A;  2M3B A;  3EWK A;  2Q3I A;  3KZI H;  2JWD A;  2ZYD A;  2XV5 A;  1JY2 O;  2W27 A;  2KI7 B;  4R4L A;  5APT A;  4JYB A;  1BGY E;  2L5G B;  1KN7 A;  2W6B A;  1Q86 Q;  1EZV G;  3NXS A;  1BDD A;  4OGQ C;  1FDI A;  3KXD A;  3V5B A;  1VQN P;  1RQV A;  3L75 E;  4DOJ A;  3L70 J;  2ITA A;  1KIL B;  5H2F E;  3AEA C;  2PRR A;  5CMZ A;  2IFN A;  2B88 A;  1URQ A;  1HWT C;  1NYH A;  4UB6 E;  5AW3 B;  2IBZ E;  4HB1 A;  1AVY A;  2WSE H;  1VQK P;  2FY8 A;  3IFM A;  1T3J A;  1EXJ A;  1FDM A;  5H2F H;  5CBN A;  1FE6 A;  1IFN A;  5AW4 B;  1GZL A;  1Y9B A;  5KLV E;  5AVV B;  5AW2 B;  4UB6 H;  2NPS A;  4YXD C;  2FYU J;  1JOC A;  2PGD A;  1NJI Q;  2KSE A;  4NPE A;  2WSS H;  3HRN A;  1SQX G;  2BAS A;  3RK2 C;  5AVW B;  3RBZ A;  2A06 G;  2Y9Y A;  1NAF A;  2OGU A;  1BCC G;  3CMA P;  1FJP A;  2JKV A;  1SVF A;  1EDL A;  2AEF A;  4DT0 A;  1NTK D;  4IFD K;  5AW1 B;  3BAT A;  3H1J G;  4L76 A;  1JM0 A;  1KB9 E;  1PGO A;  1WRG A;  3L71 E;  4IL6 X;  1P84 E;  1PZQ A;  1J1D C;  2QJP C;  1IFP A;  1LTG C;  1JY2 P;  4C7N A;  3CC2 P;  1Q2N A;  4K35 A;  4H44 C;  1RF0 A;  2IYP A;  3HUS A;  3TGU D;  1ZR2 A;  1KTM A;  3H1K J;  1KB9 H;  4OGQ B;  5KAF E;  3L37 A;  2R3S A;  2KK7 A;  3L73 G;  1P84 H;  4C7R A;  1JCC A;  1QX8 A;  2E42 A;  4H13 B;  1HGV A;  1GL2 B;  3VTP C;  1H88 A;  2GA1 A;  3PRJ A;  4YXW H;  1Y47 A;  4TT3 H;  3H1I G;  1G2C A;  1M7L A;  5KAF H;  2IDB A;  1FBM A;  2KZI A;  1DEE G;  1SFC A;  2H43 A;  2QJK B;  4KT0 J;  5KAI E;  1W2B O;  1FZB A;  1CW5 A;  5AVT B;  2KIK A;  1NTZ G;  3HE5 A;  1IJD B;  2J58 A;  3MIW A;  2R32 A;  3CPW O;  2A06 E;  2XNX A;  4D6T D;  3CCL P;  4OGQ D;  2OYO A;  1S4X A;  1E79 H;  3RK2 B;  1N73 B;  5KAI H;  3USS A;  1GDT A;  3H1J E;  4KJM A;  4H13 D;  2P10 A;  4RJT A;  3HD7 B;  1GL2 D;  1LTA C;  3V2P A;  3E7K A;  4NPF X;  1LP1 A;  3UIA A;  1BSH A;  1SQP K;  4DZO A;  4GOF A;  3CCS P;  3II6 A;  1URQ C;  1NU1 D;  1IFI A;  3F89 A;  1YIT P;  3AEF C;  2I1K A;  1RF1 B;  1HF9 A;  1L0L G;  3WU2 E;  1L0N J;  3V4Q A;  1N86 A;  1PP9 G;  3CX5 E;  4DJG A;  2FFD A;  3L73 E;  4I1L A;  1KD1 Q;  1NTM K;  3MTU E;  2HPC B;  1KYO D;  3RK2 D;  2K3R A;  2NPS C;  1LT9 A;  3A3Y B;  2B9B A;  4W7Y A;  3AEE C;  3WU2 H;  1SQV K;  2XDJ A;  5AVS B;  2N1T B;  4OVN F;  1EDJ A;  1FC2 C;  3CX5 H;  2OYI B;  2ZVN B;  3MZW B;  1VQ4 P;  3O8Z A;  2OTK E;  1HJ0 A;  2A45 H;  3CC4 P;  3HTK B;  2AXC A;  2Z5H A;  4WBA A;  3MUD A;  1BGY D;  1S2E A;  3GF7 A;  3EFG A;  2KNC A;  3SFD C;  3M91 A;  3A0B E;  2ZYG A;  1SQX J;  5AVX B;  3H1K D;  3H1L G;  2Q3E A;  4H44 D;  1IO4 A;  4O9B A;  3B8E B;  3L75 D;  1BCC J;  3VN0 A;  1J1E B;  4NPD A;  1K05 A;  2Y0D A;  4I7Z C;  1X9V A;  4AUW A;  1NWQ A;  4AQR D;  1NO4 A;  3SWK A;  1DIP A;  1LTJ A;  1RF0 C;  1IFJ A;  1HVV A;  2IZ1 A;  1SQQ G;  1EDI A;  2YO2 A;  3A0B H;  3HUS C;  5CCG A;  2R5D A;  1JMB A;  1MZ9 A;  3T97 B;  1YIJ P;  2CPS A;  1ZV8 A;  1SQB K;  3PHL A;  1LWU B;  1N2D C;  3FXE A;  1GK6 A;  1NU1 G;  2E74 B;  2JR8 A;  1KC8 Q;  3H1H G;  4EYY Q;  4RO0 A;  1M90 Q;  5KLV D;  2HG5 D;  1L0L E;  3D70 A;  2KOG A;  3U1C A;  3CXH E;  1PP9 E;  3WUT A;  1TU3 F;  2N9B A;  3V2R A;  1DD4 A;  1YHQ P;  2LKM A;  1GK4 A;  2J5U A;  4AYC A;  4WY4 B;  2O01 J;  3GLM A;  1SFC C;  5APQ A;  1DX7 A;  1JUN A;  4BXL A;  4EOT A;  2R44 A;  3AE8 C;  2WT7 A;  2YMY A;  3CXH H;  1W2E A;  3KYQ A;  3BAS A;  4PD4 E;  2J59 M;  3H1I J;  1M56 D;  2POH A;  2M8R A;  2YXQ B;  5M1B A;  1N7S B;  1LT1 A;  1YTZ I;  2MJZ A;  1S5L H;  2E74 D;  2E76 B;  1HGZ A;  1IFD A;  1S1C X;  1P84 D;  3CL3 D;  1NTZ J;  2AEM A;  5APY A;  1EZV D;  4IL6 E;  1K73 Q;  4GDO A;  2ZXE B;  1URQ D;  1K9M Q;  3H1L E;  4PD4 H;  1NGM B;  2H8P D;  3L75 G;  1H0T B;  1FJK A;  2OTL P;  3C9I A;  1HUC A;  2B87 B;  1VQ7 P;  3SWF A;  5BU5 A;  1FU1 A;  2VRS A;  1NTK J;  4ZMD A;  2IBZ G;  2PFX A;  3M0D A;  4B86 A;  2KUB A;  1XTC C;  4GIF A;  3SFE C;  2K9J A;  1YJW P;  1QGK B;  2W6A A;  2FFD C;  2PP6 A;  2OYH B;  4BRY B;  3AE1 C;  1VL2 A;  3B5N A;  4HKZ H;  1QEX A;  2L91 A;  1YI2 P;  2FBW C;  2WZ7 A;  1LT9 C;  1BDC A;  3TGU J;  2FYN B;  4QMA A;  1M1J B;  3AED C;  1ZRT E;  1RE4 A;  1YQ4 C;  3BRT B;  3SWY A;  1SQX D;  2E43 A;  3D71 A;  5CJ4 A;  2OAR A;  1VQ8 P;  3BVH A;  3CCQ P;  2A06 D;  1Q82 Q;  1BE3 E;  1U7M A;  1RHZ B;  2P2U A;  5KKZ C;  2KS1 A;  3V2N A;  3V6I A;  3MUD C;  5CHX A;  4MN4 C;  4EDF A;  2Q1K A;  1M8O B;  1OVV A;  2H88 C;  2KB7 P;  3H1J D;  4GT1 A;  3O6Q A;  3L4F A;  3PH0 A;  3E1I A;  3L71 G;  3TNU A;  2M5A A;  3P7K A;  1VQM P;  3L72 E;  1G1J A;  4RKU J;  3GHG B;  3GMA A;  5KTB A;  3CME P;  1ZN5 A;  1USE A;  4OH8 B;  1LTJ C;  1ZR4 A;  2FYU K;  4Y99 C;  1Y8A A;  4D6T J;  5CCG C;  4OWF A;  2C0W A;  2YIU B;  1OZH A;  4IFF A;  4L74 A;  1AV1 A;  1QVG O;  1HTL C;  3OA7 A;  3CX5 D;  3L73 D;  1ZLL A;  2IYO A;  1OFC X;  2H89 C;  3AE3 C;  2WPQ A;  3RK3 E;  4U3F E;  3VMA A;  2HLO A;  3MGN A;  1SQQ J;  3K5B A;  2ZT9 C;  2WPS A;  3H1I D;  3PLN A;  2M0B A;  1NU1 J;  1KYO I;  2Y0C A;  2QEX P;  3FGA D;  4PV1 B;  3H1H J;  3L36 A;  5KLI C;  2W90 A;  2C9N Y;  3CWB G;  4Y28 J;  1NTZ D;  4LGD E;  4Z1M H;  1CZQ A;  2IFM A;  1IZN B;  1YTZ T;  2W8Z A;  1JTH B;  3CD6 P;  3WMM 0;  3AE4 C;  2FXM A;  1LT9 B;  3RGU A;  2ZVO B;  4W80 A;  4ZKP A;  1Q7Y Q;  5AW9 B;  5APX A;  1YJ9 P;  3U1A A;  1HH0 A;  2B89 A;  3CLQ A;  3BCC E;  1VDF A;  1JB0 J;  1NTM G;  1EXI A;  3N4X A;  3G4S P;  2YKO A;  3B71 A;  2RH0 A;  1SQV G;  5KJ7 A;  1GW4 A;  1GU4 A;  1BGY J;  1JY2 N;  4PV1 D;  3EFF K;  2ZFC A;  3M0D C;  2NZ2 A;  1L0L D;  2WSE J;  1NKN A;  4HH2 A;  3CXH D;  1GW3 A;  1S9K E;  1R5L A;  3GG2 A;  1PP9 D;  1LTJ B;  3L75 J;  3VP8 A;  2Q5U A;  4Y99 B;  1MKM A;  3LID A;  2YKQ A;  2A45 G;  3RK3 C;  2D2C C;  3LIE A;  3A7O A;  3LW5 H;  2JDI H;  2AXT E;  1JY3 O;  3VOP A;  2HFE D;  1A02 J;  3CWB E;  1UIX A;  1SQP E;  1QL1 A;  5KLV J;  2XZR A;  3IN6 A;  2WSC H;  5AW6 B;  3OJA B;  2E75 C;  4PJ0 E;  1ZW0 A;  1CI6 B;  2LR2 A;  1L0N K;  2AXT H;  2BCC G;  1KQS O;  2E5Y A;  3H1L D;  4EI2 A;  1QL2 A;  3IF4 A;  2QSI A;  1L2P A;  3L74 G;  5CCG D;  2MKV A;  1X22 A;  1P84 I;  1NTM E;  1IK7 A;  1EZV I;  2XND H;  2YKP A;  2Z5I A;  5GTI E;  3AE7 C;  3PTZ A;  1RQU A;  3RL0 C;  1SQQ D;  1VF5 C;  2K1A A;  2KYV A;  4TLF A;  1YQ3 C;  1SQV E;  2C0X A;  1PPJ G;  3L71 J;  1E5W A;  1T3U A;  1KIL A;  1X79 B;  1R5S A;  4H0L C;  1FOS F;  3H1H D;  1H8A A;  1BSN A;  1J1D B;  4YPC A;  2QJP B;  2WVR A;  2R5B A;  5GTI H;  1OWA A;  1KQF B;  2YNY A;  2HOD A;  3MHV A;  2ZYA A;  2JO1 A;  4H44 B;  1LNQ A;  2DW3 A;  5GTH E;  1SQX K;  1QLE D;  2RMZ A;  3AE5 C;  2P7J A;  1WMK A;  4C46 A;  2ZXX A;  3FX0 A;  5C39 A;  3NMD A;  2YXR B;  1FZA A;  5APW A;  1SQB E;  1EC5 A;  2BEQ D;  4L75 A;  3I55 P;  2O1K A;  1JY3 P;  1ZME C;  2BCC E;  3OW2 O;  3I56 P;  1R8E A;  3JC2 2;  2IPP A;  4RES B;  3NTN A;  1NVO A;  3L74 E;  2WPV B;  2XU6 A;  5KJ7 C;  1KIL E;  2IZ0 A;  2FKW B;  1S3J A;  3R4Y A;  4LLH A;  1HBW A;  3L70 G;  1X0T A;  2IBZ D;  2WSF H;  3H1J J;  3P8C E;  3RK3 D;  1PPJ E;  1FAV A;  3M9Q A;  3CCJ P;  1AJY A;  1RH5 B;  3RL0 B;  1OXZ A;  4ZNC A;  3CX5 I;  1K8A Q;  3GF3 A;  4IFM A;  1YBK A;  2QG4 A;  3NFQ A;  4XA4 A;  3MP7 B;  1URQ B;  4GKG A;  4N3Y B;  1A02 F;  1PGP A;  2OTJ P;  2RN0 A;  5B5E E;  3TK1 A;  1GL2 A;  1FZF A;  2Q7C A;  2FYU G;  2E75 D;  2K88 A;  1J2J B;  3L73 J;  1BE3 G;  1LTI C;  2WQY C;  2WIT A;  3Q2Y A;  1NH4 A;  1LGH B;  4LC1 A;  2YMK A;  2QA4 P;  2YO3 A;  1LTS C;  1NTK K;  1VQP P;  3AE2 C;  2NPS B;  3BCC D;  3VYI A;  3P8M C;  3TYY A;  2LXC B;  5EFW B;  4R4M A;  1JCD A;  2AEJ A;  1KB9 D;  3L71 D;  3RL0 D;  1VF5 D;  1JEK A;  1L4A A;  1GMJ A;  3L72 G;  1Q81 Q;  5APS A;  1N73 A;  3ITK A;  3WUV A;  3M0A A;  3D6Z A;  3HD7 A;  1PL5 A;  5APV A;  2FXP A;  2IX7 C;  1KIL C;  3L70 E;  3U59 A;  1MUU A;  4JQ0 D;  3AEG C;  3HE4 A;  4W7Z A;  4I7Z B;  4IL6 H;  3Q5P A;  3FWL A;  4C7N B;  1QVF O;  4U3F G;  2NPS D;  1RF1 A;  2HYN A;  3P32 A;  3N7N A;  2KP8 A;  1VQ9 P;  3HUS B;  1T2K C;  4HJG H;  1W5C E;  1FZC A;  5TIS E;  1K04 A;  5CCH A;  3Q1M A;  1KQG B;  1VQ6 P;  3CWB D;  2HPC A;  1T6A A;  1L0L J;  1PP9 J;  2FYU E;  2G8Y A;  1KV4 A;  3G71 P;  3KZI E;  1MFT A;  2N1T A;  2UWJ E;  4A7P A;  1JNM A;  1G2C B;  2OYI A;  5TIS H;  1ZP0 C;  1SFC B;  1FS0 E;  3BRV B;  1NTM D;  1KYO E;  3PJS K;  5KJ7 D;  3BCC G;  1AVO A;  4XE5 B;  2O1J A;  3HE5 B;  1KOR A;  1SQQ K;  3VMX A;  3KQG A;  4DCK A;  3RBX A;  1SQV D;  1N7L A;  4ZKU A;  1FZG A;  1NU1 K;  2O3J A;  4BWN A;  3CC7 P;  1KYO H;  1EQ7 A;  3PP5 A;  1IK9 A;  2H7H A;  3H1L J;  3CCR P;  2QE7 H;  1RY3 A;  5AVU B;  5AVR B;  3T97 A;  3CCU P;  2FXO A;  5CBO A;  1T8Z A;  1LP1 B;  2Q9I A;  3H1K E;  1L0N G;  1XTG B;  3IR9 A;  4JYC A;  1LWU A;  4M3L A;  1M57 D;  1AFO A;  1SFC D;  2O01 N;  2CK3 H;  3S1K A;  3G6E P;  4H13 C;  1YJN P;  4ASV A;  1GL2 C;  5BVZ A;  1MFZ A;  5BU8 B;  2HOD B;  1VQ5 P;  2I8D A;  4WVZ A;  1NHL A;  2FFD B;  1FZE A;  1VQO P;  2XKM A;  3L35 A;  4WY4 A;  1PIX A;  1SQP G;  4L73 A;  5AW0 B;  2QJK C;  1SQB D;  4GOE A;  1G1I A;  2QM8 A;  1D7M A;  3M06 A;  2Y9Z A;  3G9R A;  1PFI A;  2BCC D;  2WWW A;  2ZJS E;  1N7S A;  1BE3 J;  3L74 D;  1L4A C;  2KLV A;  1IFM A;  1S5L X;  2G3A A;  5KKZ B;  1NKZ B;  1N73 C;  1KIL D;  1ZOY C;  2KNC B;  3VP9 A;  1AA0 A;  4N78 E;  3HD7 C;  3P8C D;  1PPJ D;  1WT6 A;  2R3C A;  1H0T A;  2JWA A;  2K37 A;  2CPB A;  2KXP B;  3L72 J;  1OW8 A;  2IBZ I;  2W83 C;  2B87 A;  5KLV K;  1AQT A;  1VPC A;  1T2K D;  2RKL A;  1Z56 A;  2Q6Q A;  2E5T A;  3Q5R A;  1EZV E;  1SLQ A;  1SP4 A;  1RF1 C;  1L0N E;  3ABV C;  3B5N C;  2W6J H;  4U7J A;  4BRY A;  2OYH A;  2FYZ A;  2GM4 A;  2KSJ A;  3H32 A;  1FZC C;  5CCH C;  1FDO A;  3AE9 C;  3D6Y A;  1RE4 C;  4U3F J;  1M1J A;  4PD4 D;  2ZT9 B;  3E1R A;  1U7J A;  3M9H A;  3A0H E;  2N1T C;  1USD A;  2N9Y B;  2OYI C;  2V7Q H;  1KQL A;  1SQB G;  4I2L C;  1EDK A;  4XFJ A;  5KLI B;  3VMZ A;  2WT7 B;  1KFN A;  3W67 A;  1KB9 I;  2Z4E A;  4JF7 A;  1RE3 A;  3Q3D A;  1YYC A;  3A0H H;  1UII A;  1SQX E;  2WTY A;  1DH3 A;  1OW7 A;  1BCC E;  1J1E C;  2SPZ A;  5AW8 B;  3L70 D;  4JPZ B;  3GHG A;  3M9B A;  1GD2 E;  4PJ0 H;  1L4A B;  3BCC J;  2NRG A;  3KDP B;  3R2P A;  3H25 A;  1NTK G;  3AE6 C;  2ZT9 D;  2KLU A;  3CCV P;  1JO5 A;  1LWU C;  1AQ5 A;  2E74 C;  3HE4 B;  3LW5 J;  2QM7 A;  1JMM A;  1KFM A;  1LTB C;  1ZRT D;  2KZJ A;  1DEB A;  1CSB A;  3JSV C;  5TJH A;  3WUU A;  2FYU D;  1LTT C;  2K9J B;  3TSI A;  3TGU G;  5B66 E;  1BE3 D;  1M1K Q;  4WY4 C;  3AEB C;  2PAJ A;  3B5N B;  2V7Q J;  5AVQ B;  3TF5 A;  4I6M C;  3RK3 B;  2D2C B;  4EIJ A;  4K3A A;  1GTW A;  1FZC B;  2WSC J;  1L4A D;  5K5G B;  1JTH A;  3G3Z A;  5GTH H;  1OMI A;  3JCU E;  3H1I E;  1N7S C;  3TDK A;  5E79 E;  5B66 H;  1HJB A;  3L72 D;  3CWB J;  3HD7 D;  1SQP J;  3FXD A;  1JY3 N;  2O01 H;  3VMY A;  4UB8 E;  3KHU A;  2E76 C;  2KS1 B;  5AW5 B;  1NTZ E;  2E75 B;  3SSU A;  4HYT B;  3O6Q B;  3RL0 g;  1H89 A;  3JCU H;  3TNU B;  4D6T G;  5E79 H;  2M5A B;  4WWI A;  1NTM J;  1PGQ A;  1S72 P;  4UB8 H;  3A5T A;  3B5N D;  2D2C D;  4U3F D;  1NTK E;  5CCH D;  5AW7 B;  3CCE P;  1VF5 B;  2QIW A;  4ASW A;  2HR3 A;  1SQV J;  5AVY B;  3Q5S A;  3EQ2 A;  3S4R A;  2A45 I;  2OYH C;  3IAO A;  2Y0E A;  1OX3 A;  3B4S A;  1SS1 A;  4H0L B;  1OVR A;  2N1T D;  1NTZ K;  2JJL A;  1NOH A;  3F5H A;  4YTP C;  5AVZ B;  5DJU B;  5CJ0 A;  4N6J A;  2FYN C;  1M1J C;  3TGU E;  2K9Y A;  2JEE A;  4KHX A;  4WB4 A;  2QRX A;  2QJY C;  2V4H A;  1IC2 A;  1OVU A;  5B5E H;  3GW6 A;  1S5L E;  2JP3 A;  2C9L Y;  3OAK A;  1CI6 A;  2BEZ F;  2QVA A;  3CCM P;  1RE3 C;  1X8Y A;  4N78 D;  1DD3 A;  5DJT B;  5APU A;  2WPR A;  2WMM A;  2LXB A;  3AEC C;  1SQB J;  4IOI H;  1KZU B;  2P58 A;  1U57 A;  3GHG C;  4H0L D;  3ZDM A;  2WSF J;  1L0L K;  1BGY G;  2BCC J;  3V4W A;  1ZXG A;  3S9O A;  3W68 A;  1S9K D;  1MV8 A;  4D6T E;  3L74 J;  2YIU C;  3H6P A;  2GUV A;  1OIP A;  1L0N D;  3A2A A;  3H1K G;  3FWN A;  3C1L A;  3I5C A;  2ZAE B;  2P67 A;  1GU5 A;  3CXH I;  5L8R J;  2M3E A;  3C8V A;  4WY4 D;  1KMI Z;  1SQQ E;  3V2Q A;  4JBZ A;  4GOD A;  1FOS E;  1N8R Q;  2I1J A;  3MD0 A;  1SQP D;  4PV1 C;  1NU1 E;  1NAY A;  2GUS A;  3H1H E;  1LJ2 A;  3H32 B; 
#chains in the Genus database with same CATH homology
 5KLI B;  3L74 D;  3PTZ A;  3PHL A;  1SQQ D;  2YIU B;  3ITK A;  3TDK A;  5KKZ B;  3GW6 A;  3L72 D;  1SQV D;  3CX5 D;  5KLV D;  3L73 D;  1L0L D;  3KHU A;  2IBZ D;  2KNC B;  2O3J A;  3CXH D;  3PRJ A;  3GG2 A;  1PP9 D;  1KYO D;  3H1H D;  1PPJ D;  2QJP B;  1BCC D;  3L70 D;  3VMA A;  2L91 A;  2QJY B;  2JWA A;  2QJK B;  3H1I D;  3FWL A;  3PLN A;  2FYN B;  2QG4 A;  2Y0C A;  1SQX D;  2A06 D;  2RN0 A;  1NTZ D;  4D6T D;  4U3F D;  1BGY D;  1NTK D;  2RMZ A;  1L0N D;  2KS1 A;  3CWB D;  4EDF A;  2Y0E A;  1ZRT D;  3H1K D;  3H1J D;  2Q3E A;  5TJH A;  1P84 D;  2FYU D;  4RJT A;  3L75 D;  2K9J B;  1EZV D;  1BE3 D;  1SQB D;  2Y0D A;  4A7P A;  4PD4 D;  3BCC D;  3H1L D;  3TF5 A;  1SQP D;  3TGU D;  2N9Y B;  1KB9 D;  3L71 D;  1NU1 D;  1NTM D;  2BCC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...