1S3JA

X-ray crystal structure of yuso protein from bacillus subtilis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
SADQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYLSFLTEEEMLQAAHITAKLAQAAETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of YusO protein from Bacillus subtilis, a member of MarR transcriptional regulator family
rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords YusO protein
total genus 47
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s3jA02
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1s3jA03
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1s3jA01
3SHFA 2QM3A 2P7VB 2PBIA 4B09A 4UVAA 2XROA 2VONA 4UVBA 1FPQA 1KU9A 1SFUA 4O5VA 2WC2A 4R8HA 2D1HA 2EK5A 3SQNA 3GYHX 4ZYDA 1DUXC 2WTEA 1X3UA 1OR7A 3NEUA 3TDUC 4IVNA 5TJJA 2ADUA 4H0EA 5CLSA 3P9IA 3HUGA 4NPDA 1YLFA 5H6QA 3EETA 2K3RA 3RKWA 3SFZA 1I5ZA 3IWFA 1J5YA 4WX9A 2NRAC 4EGZA 5HS7A 1YW9A 1Z6RA 3EQLF 5JVTA 2RKHA 1ZRCA 3RTRA 3TOAA 2KIKA 3N97A 1FOKA 3W7UA 1XGOA 3ZN0A 1G4DA 3C3WA 4HW0A 1VTNC 5CBOA 4L5IA 4PGGA 2MLKA 2KJCA 5KVRA 4NPEA 1XD7A 4IRIA 3LSTA 4HYEA 4MQ9F 3F23A 1BM9A 5LGNA 3O2PE 4KMUX 4WXCA 2QBYB 1ZN2A 2STWA 3S1KA 1TW3A 3D3IA 5CBNA 4LK0F 2FQ3A 3DPLC 2P58A 3KP4A 1MZBA 2XGXA 4KNYA 5BS6A 2FBHA 3IHUA 3CUQC 2EFWA 2FE3A 1H9TA 3MQ0A 1DPRA 2XHKA 3CDHA 5E8IA 3J81Z 3GLXA 1EC5A 5LLQA 1RUOA 2RC4A 4ASNA 2MC3A 2CQKA 3I59B 1E17A 3HRUA 1KU3A 1P92A 3FF5A 1B4AA 1YTFB 5DUIA 4KN4X 1PUEE 5D4SA 1LDKB 1W4MA 2HR3A 5AONA 1B9MA 4HF1A 5LHIA 4RGXA 2MLGA 5L3FA 4Z2YA 1LVAA 5LEKA 4R79A 1R5HA 1IXRC 1OVUA 4GO1A 3FHZA 2FBIA 2CW0F 3LAPA 4HV6A 1RZ4A 3GFMA 4EV0A 4M73A 1SD7A 5ILUA 2LF7A 3WGHA 2DO7A 2Z33A 5ICCA 2DPUA 3TO7A 4K35A 3ABUA 3RKXA 2DQRA 1NHAA 3IRRA 3H3ZA 3ABTA 4L0YB 2STTA 1KA8A 1W5TA 4G6DA 2ISYA 3U1DA 3V7RA 2EFPA 5AIPA 3R0JA 1DDNA 2BEOA 5D8KB 1EDKA 2DFIA 3TOBA 1XDSA 2L01A 4RGUA 1IXSB 1O3TA 3V7SA 3JAMZ 1RIOH 2OD5A 3LFKA 3RYPA 5FGMA 4R1HA 3CLOA 4CXFA 1OYIA 1T39A 1P4WA 1I27A 2Z3YA 3W7WA 2HKXA 3FMRA 3T8RA 2HWVA 3KLOA 1XDUA 4RGSA 1QQIA 5EEGA 4MNUA 1K7AA 3GVAA 1FSEA 3V8KA 2EA2A 3PQKA 2M87A 2HQNA 3F8BA 3QPTA 2UXXA 4ESBA 2XIGA 3WU1B 3E6DA 2PMHA 5F64A 5F6FA 1F5TA 5DYMA 2V1UA 3HHGA 1K6OA 1KYWA 2KI7B 2BYVE 4EM2A 4WCGA 1BBYA 1L0OC 4GCVA 4ZYHA 3WGGA 1LEBA 4G7HF 5DCMA 3M9AA 4XRFA 2HFHA 1T6SA 2QENA 2DW4A 2F2EA 1T98A 1BI3A 1E2XA 4M72A 3R0AA 2V1DA 3SZTA 2V1XA 5D4RA 3WTXC 5D6EA 1CGPA 3KP7A 5K5OA 2ETHA 2L4AA 4I09A 4LK1F 3IC7A 2AXLA 4A2UA 3HHHA 5E8GA 1QPMA 1KU2A 1Z7UA 1GHCA 2H09A 2CSOA 3KZYA 2IVMA 2FSWA 3ERED 3Q5FA 3MZYA 1LP1A 1ZGJA 2MA3A 4EJVA 3DV8A 3SXYA 4FT8A 2QVOA 3W7XA 3EUHA 3IWZA 3N4MA 1JE8A 3B73A 1PP8F 4LG0B 2ESNA 1IAWA 3E6MA 2PG4A 4U88A 1H0TB 1XGNA 2ACJA 2ZJ2A 2OZ6A 1LQ1A 2W84A 1B1BA 4HOBA 5D5UB 1TW2A 1REPC 1UHWA 2NS0A 2Y0MA 5BQTA 3RYRA 4BAYA 4N0BA 1ZG1A 1XGMA 2MD5A 5F1RA 1S29A 2K4JA 4M71A 4MHGA 3LA3A 1J9IA 3DP7A 2E7XA 1QBJA 3I4PA 1DP7P 4K2EA 2UWJE 1I1SA 2P5VA 2JSCA 3MAJA 1ZARA 2JPCA 1S7AA 5K5QA 4LB6B 3E35A 4RB0A 4UXNA 5LHHA 4HKZH 1R1TA 1P4AA 1R23A 4I2OA 1F4KA 3CJNA 4JQFA 5FLXZ 4BHBA 3EYYA 1BDCA 1FP1D 2H94A 3F3XA 3WGIA 1NVPB 2PMUA 4U0WA 1PDNC 4OIOF 4AWXB 2LXCB 4N9HA 1TNSA 3BJAA 3BPXA 2Z9OA 1YW7A 2L54A 3SZPA 2B87A 4KT5C 1L3LA 3TGNA 3RDIA 2IPQX 5JR3A 3T8TA 4M6XA 1U6GA 2BBYA 1MDMB 5L3BA 4HX8A 2BE5F 2M45A 2ZBKA 1ZRFA 1D8JA 3TDZC 2DLLA 3K9TA 2RVCA 3ZDMA 5FD6A 1U5TB 5A2QZ 1KU7A 3ISPA 1FYLA 1KQ9A 4P9FA 2L02A 4U0VA 1ZLJA 4BHCA 2E1CA 4AVPA 1XSVA 1K78A 2D45A 2E7WA 3CUOA 4KIBA 4U7DA 2FRHA 3WU0A 1J59A 3V8LA 1U2WA 3ZMZA 2F5FA 3HIFA 5ILSA 4F7ZA 2QZ8A 1BI1A 1RNLA 3BY6A 4GXOA 5D5XB 1V4RA 1ULYA 3RPQA 3VEPA 4HX7A 4OMYA 2EB7A 5L3CA 2XASA 1R58A 1O3SA 1KYZA 4RAYA 1IXCA 2GXGA 1MFTA 5DJTB 2LNBA 3F6OA 2W85A 1T0FA 2GWRA 2W24A 1LT1A 4NHJA 1Z6TA 5E18F 2YPRA 1J7KA 4MEXF 5DDGA 1W5SA 4CICA 4MQVA 4RAZA 3ZPLA 2FU4A 2DU9A 5D5WB 4ENJA 1Y47A 3M1EA 2R3SA 4XSZF 1J0RA 4WK8F 3D5LA 3E5XA 4HX4A 3GUDA 3K1MA 3I58A 2VBWA 3DKWA 3I64A 2HGCA 4KIFA 1BC7C 4Y17A 4A5NA 1EH8A 2GZWA 2EFNA 3MHVA 4ZH4F 4ZYEA 5BPDA 2XAQA 2Y75A 1YIOA 3I59A 1I1GA 3GFJA 2KRFA 2XV4S 5IT3A 4AIJA 3H3UA 2VE9A 2LXBA 2DQLA 1RUNA 1H9GA 1S6LA 1ON1A 3CO6C 1YYVA 1UCRA 5AIQA 1IN6A 4YFXF 2A61A 2FF4A 4Y13A 1HXDA 1Z1DA 3LAJA 2NYXA 1XMKA 4ASWA 4GYGA 3LA7A 2JRTA 5ICEA 5CVRA 2K27A 3LQRA 2LR2A 4M74A 3K0LA 3F8MA 4LG0A 3KEOA 4XLPF 5J8FA 2VOPA 4P5OA 4CHUA 3WTSC 2MH9A 1JHHA 1IF1A 4L9TA 2M1BA 4GGGA 1G3YA 3HYIA 3PFIA 1ON2A 1OPCA 4PZJA 2XAGA 5LRSA 2JPBA 5FFXA 4XLNF 3Q9VA 4L0ZB 4ASVA 5H6RA 3TO9A 2FXAA 2VN2A 1A04A 3KETA 4L9JA 4AD9A 4YFKF 3U9GA 4WWIA 1YQAA 3GZ5A 2P90A 4AIHA 2XAHA 1Z05A 2P5KA 4ZZLA 4D0PA 3BP8A 3MZHA 3J81K 4FHTA 4ETSA 1R1UA 1I6XA 2RNJA 1ZRDA 3MCZA 2C6YA 1XCBA 5FFZA 5CVIA 4HDVA 3RI4A 2ISZA 2IT0A 1STZA 3VB2A 2A6EF 5DCMB 1XB4A 3HOTA 2DBBA 3QPHA 2D1VA 4M9SA 3KP6A 3VFZA 2HEOA 1IRGA 1FY7A 1LJ9A 2VC1A 2ZO4A 1O3QA 1EDLA 4IHTA 2M5AB 3KLNA 1S3JA 1FX7A 1IUYA 5CVUA 3BZ6A 3GO5A 1WKMA 1ZGAA 2ZMEA 1UB9A 4BH9A 3ZN1A 2KS1B 5DV5A 2DAOA 1X0TA 2P4WA 3JSPA 2HYFA 1MD0A 2IP2A 2RQPA 3WE3A 1TTYA 4LLLA 2COMA 1KQ8A 3GFLA 3J80K 2PEXA 3P7NA 2E1NA 1HBXG 4KYWA 1IN7A 3RKYA 1U7JA 1B6AA 2VE8A 4EJTA 5ICFA 3WTWC 4UVCA 5DJUB 4CYDA 2ZCWA 1YW8A 5JHUA 1NVOA 5C39A 2Y48A 2M5AA 3E97A 2RV8A 3ZMVA 2FOKA 1OYWA 4HBLA 4I0AA 2YU3A 3F6VA 2VOOA 3GWZA 4PCQA 2X0LA 1QZYA 5H20A 3JAMK 1DPUA 3T0YA 2HZTA 3J7AO 3ZMTA 2DK5A 1SFXA 4ON0A 5HS8A 3G73A 5CA3A 2H6BA 2TDXA 5HLGA 1ZH5A 2QVAA 2KUBA 1JMBA 3KP3A 4FX4A 3E6CC 1FLIA 3COAC 4L9VA 1C0WA 4XBFA 1G3WA 4HLXA 3R61A 2O3FA 4RB3C 5HS9A 4Q47A 5E17F 1ZG5A 3GXOA 5FB2A 2VC0A 3HTUA 2ESHA 1FP2A 5DCFA 2HTSA 1K79A 2KIUA 3REOA 2JT1A 4GOFA 2GA2A 2YR2A 5LRRA 1EDJA 1SMTA 1FZPB 3IKTA 1GXQA 3LA2A 4BXLA 1PP7U 4I0BA 4JK1X 2Q8KA 3ZMUA 3LQQA 3EYIA 6PAXA 1HW5A 2H27A 2HS5A 4CPGA 5HLHA 1SS1A 3KE2A 2O0YA 1BI0A 3E5QA 2YX7A 5ILVA 2A69F 3B02A 2IRFG 4HQEA 1ZREA 2OQRA 4O3MA 1BJAA 1ZAOA 1HKTA 2Z99A 2PI0A 3FZVA 4KJMA 4OU0A 2FA5A 1QZZA 1ONVA 2HYGD 4LMYA 4LGWA 2V79A 2CFXA 2MH2A 3HSRA 5EEHA 5L3GA 4KFCA 1S8NA 2YSRA 3FX3A 2PJPA 1HW2A 1O3RA 5LBQA 1TLHB 3RJPA 1LB2A 4HB1A 1USSA 3F8FA 3RGUA 5DEQA 2FBKA 2FNAA 4HZFA 4YIIA 3JW4A 2ZXJA 1WWXA 3OOPA 1TNTA 5K1YA 4M6YA 4G7OF 3FXQA 5LHGA 3DQVC 1EH6A 4NPFX 3U2RA 2NNNA 1WI9A 2CG4A 1MJBA 4BYYA 3W6KB 1XN7A 2O61A 4EQQA 3D0SA 3BWGA 1FC3A 1QO0D 3BJ6A 2ZAEB 2QLZA 4P96A 2EWNA 5CYVA 1U3EM 1TQPA 3WTUC 3IL2A 1LEAA 4OINF 2GA1A 2J5PA 5D6FA 2B89A 4UUVA 4G94A 5HOOA 3WODF 2Q2EA 2ZKZA 1TQIA 3QAHA 2KJBA 4EGYA 5FO5A 1U5TA 2B88A 1BC8C 1YG2A 4MN4C 1XSXA 2V9VA 3R6SA 1V3FA 1U5TC 2W25A 2A3SA 3P9KA 3JSOA 3K1PA 5J8CA 5DUKA 1HQCA 3FXEA 1LDDA 4OIRF 3CTAA 3DXJF 1OVRA 4EM1A 1FC2C 4BHPA 1USTA 2M30A 4IJAA 3E5UA 4UV9A 4RS8A 3M7GA 2VT2A 2Z5UA 4ENNA 3HRMA 1R5GA 3CUQA 4M9ZA 2FMYA 2W57A 3K69A 5HDKA 2ZMEB 2A07F 2HQRA 2LF8A 2GQQA 1Q1HA 4EM0B 1W7PD 3NQOA 4UHTA 4A6DA 4P9UA 2VT3A 3HTSB 1F1ZA 2CYYA 3IRQA 2EV5A 2J5OA 3HSFA 2R7DA 1H0MA 4KA4A 4HJGH 3WTVC 4IOIH 3ZMSA 2GAUA 5E1ZB 4QLCU 4L5JA 5ED4A 4GOEA 4OMZA 1G6NA 1BI2A 2OU2A 3QRFF 1OVVA 2XKOA 3QWOC 3H92A 2K86A 1HKSA 2ZFWA 3MWMA 4ENKA 1YFHA 3TO6A 4HF2A 4TV7A 4EJOA 3EDPA 2VXZA 1WSUA 1FT9A 1W7PB 4MGRA 3GFIA 4L18B 2DPDA 3L9FA 1J2XA 1CF7B 2O8XA 3CUQB 3P9CA 4HLYA 3GEZA 4OIQF 1SFEA 1XSDA 2QBYA 1H0TA 2P6TA 2R7FA 4KDPA 4ENMA 4ESJA 2O03A 5JI6A 3KFWX 2PN6A 1NH2B 2XVCA 3GW2A 1SD6A 1XGSA 3C18A 4CGZA 4KICA 1P2FA 2CWEA 1IW7F 2QWWA 2OBPA 1SD4A 3E3VA 3ELKA 4WWCA 2A5YB 1R7JA 1FWZA 4HQMA 4M9XA 2KIFA 5BOXA 2UWMA 4ESFA 1BOAA 1G3SA 3BROA 1LDJA 2QQAA 4WXHA 4YG2F 1UFMA 3DEUA 1T2KA 4JBAA 5DD4A 4DNCA 1D5VA 2ELHA 2F5DA 3LWFA 1R00A 1RI7A 1O7FA 3WE2A 1ZLKA 5IT9K 3PQJA 1P6RA 1JHFA 4N9IA 4YFNF 2VBXA 4DQ2A 2K4BA 5L3DA 2OTKE 2IJLA 5HVQC 1G3TA 3V4GA 4HDUA 4IXAA 1U7MA 4BXUA 2SPZA 1ODDA 4I7HA 5CJ9A 1HKQA 4A0XA 3I53A 2QRXA 2EA4A 3L00A 2IA2A 3TQNA 4A0ZA 2O6GE 2VBYA 5E20A 3DF8A 2KKOA 1T38A 4MTDA 3BDDA 3T5XA 4U7BA 2M5WA 1SAXA 5FLXK 3K1NA 2RKLA 3KZZA 1J75A 1K78B 4HAMA 2Q1KA 4A5MA 2H6CA 2G9WA 3K2ZA 5E1WA 3L09A 1WQ2A 2MBFA 2QQ9A 3KEQA 4I01A 3ULQB 1ZG3A 4Q5SF 1Z9CA 4GODA 4WXDA 2OQGA 1QNTA 4IRHA 5JFRA 3MFKA 1BDDA 1D3YA 4LJZF 1MDMA 4MTEA 3MEXA 2EJRA 3MZWB 5IT9Z 4B8XA 3BJOA 3F72A 4CO8A 3FMSA 1MKMA 3HSEA 3ML6A 2XKPA 2RN7A 2B87B 5GW7A 2EV6A 4PGHA 3BOQA 2KZIA 3QP6A 2OAZA 1YO5C 4I98B 1FYKA 1CF7A 2LSOA 3HRTA 3I71A 3FWEA 4S04A 1R22A 3FXDA 2CO5A 2FNPA 2OA4A 1W7PA 5L3EA 4OIPF 1O7LA 2LKPA 2G7HA 2HDCA 2OZUA 4G8XA 4WF2A 1JGSA 3I5UA 5LGTA 1XMAA 1EV7A 2Q0OA 4KIGA 2GIVA 3VODA 5KK1A 1IRFA 4A0YA 4HV5A 4G9YA 2X4HA 3E6BA 3ZQ7A 3DFGA 2QQBA 4KN7X 4RGRA 2A68F 4RB2C 2KZJA 1D8KA 4RB1A 3V8JA 2VBZA 2HTJA 2DT5A 2K7LA 1YS6A 1FBUA 4O6JA 2HOEA 2CGPA 1HSTA 4MEYF 1KGSA 2ZNZA 2A6HF 2ZNYA 1EDIA 1FBQA 5ERIA 4ZYGA 1BN5A 2DTRA 3BPVA 3RIRA 1YTYA 3J80Z 4EVIA 5A2QK 2I8DA 2R44A 3S2WA 5LEJA 4LD5A 5E1XA 5ICGA 3TKYA 4E70A 1FBSA 5TRDA 1GVJA 2K02A 3QU3A 4PDKA 1AOYA 1R36A 2WAMA 5HLIA 5D5VB 1TQMA 3VOEA 2VODA 1OKRA 2RGVA 1ZW0A 4LFUA 2D2WA 1Z91A 4CZZA 1HW1A 4UNOA 4Q4ZF 1LP1B 1BIAA 3PH0A 2UXNA 4EJUA 4U0YA 2JWDA 3HRSA 1AWCA 4EYYQ 1P4XA 5J6XA 1BIBA 4XSXF 2P5LC 5CVJA 3WG9A 1S7OA 4IRGA 1Y0UA 2NNYA 1JM0A 2EFQA 3I54A 3ZP5A 1EH7A 4LB5A 2IA0A 4QWQA 3ROUA 4OOIA 3AAFA 2M0BA 4Y15A 5CVVA 1U78A 1IN4A 3I0TA 3W6JB 2BGCA 2DK8A 2JTVA 1SD5A 3F21A 3FM5A 3QU6A 5HDGA 1SMYF 5BMZA 1F9NA 2V6CA 3GZ6A 3F8NA 3T1BA 1IZ1A 2QUFA 3R4KA 4BNCA 4CDGA 4K3AA 2WMMA 3C1DA 4P55A 5D8LB 2F5EA 1Q2NA 5DD8A 4G6QA 4HF0A 4YIFA 2EFOA 3CO7C 4IHSA 3KP2A 3FXRA 3FM3A 3G3ZA 1ZYRF 3GX4X 2YX4A 4NB5A 4ZZDA 3O3KA 4G7ZF 4Q48A 2P6SA 4A6EA 3FMQA 3IKVA 1YS7A 5K5RA 3L7WA 1RM1C 1FNNA 2F5CA 4LLGF 4BQAA 3QP5A 4A12A 4L9NA 3W7SA 3M8EA 1U8RA 2L4MA 1IN5A 4KUMA 2XAJA 5K5GB 3KCCA 1OYYA 1TBXA 2PFBA 4JBZA 1LNWA 2G7UA 3GF2A 3W7TA 2DI3A 3ECOA 5LGUA 1XCVA 1IN8A 2QYOA 1QGPA 4IPAA 2WV0A 3KP5A 2GXBA 1WRJA 3F22A 2WWYA 3FXUA 1B59A 2IW5A 2XUBA 3L2CA 3WTYC 3ECHA 3JTGA 3HOSA 1DEEG 3F8CA 2EV0A 4EJWA 4FX0A 3O6BB 5BPIA 2HKOA 2XAFA 1FYMA 4GYIA 2BV6A 2IA1A 1MJ9A 5HDNA 4AIKA 3RPUA 2RDPA 2FEZA 1HSJA 1ZHFA 2XRNA 1OMIA 4KMFA 3WTZA 2AS5F 3DPTA 4LLNA 1O57A 2M8EA 1ZXGA 2KIMA 1FSHA 3M8FA 1GXPA 4UV8A 2LDUA 1KQ0A 2L3DA 2P8TA 1B9NA 2PQ8A 3R60A 5EFWB 3C7JA 4NQWA 3WTTC 4I02A 2PLYA 4HA8A 2FMLA 2UZKA 4ZNCA 1MJAA 4IF4A 3JTHA 5FD5A 1UHMA 3ZMDA 3QOPA 4ZMDA 2JZYA 3NRVA 2B0LA 2NAZA 1R1VA 4EMSA 3Q9SA 2P7CB 3V7CA 1MGTA 1JXSA 4S05A 3OV8A
chains in the Genus database with same CATH superfamily
2O1KA 3HOWJ 4YHHO 2O7OA 1AROP 2ZSHB 2BY0A 2PBIA 3K9SA 4DYLA 3H36A 1KU9A 2QM4A 4JI0O 5FRMA 3TW7A 2QEXV 1H88C 2ZT9B 2R5YA 4OPHA 4PA3A 1Y56A 1TUEB 1YRNB 3NXSA 4ZYDA 1DUXC 3MHHC 1PPJG 3TYYA 2K9SA 3NEUA 3K5MA 5C93A 4DO2A 4PDVA 5TJJA 5EZHA 2ADUA 5CLSA 4NPDA 5B5EH 3L70H 1TUBA 2KYVA 3OSGA 1RY3A 5GAEJ 4JF7A 5HS7A 1Z21A 3EQLF 2RKHA 3CMAV 4B3RO 2DYRB 3DTKA 3N97A 2ZT9D 2ZYGA 2GUSA 4DIQA 2IH1C 4A3GJ 4PGGA 2KJCA 1N34O 1SQPD 2Z5IA 2N8GA 3OE7G 4IRIA 3LSTA 2IEKA 4HYEA 2Y69C 2K1EA 3I55I 4DZPA 3EFGA 2HJDA 3RBXA 2H88C 4KMUX 4WXCA 2PGGA 2QBYB 2STWA 2X48A 2FQ3A 1NI8A 5LA6A 2P58A 4KNYA 2FBHA 3KZIH 2DQ0A 2LBFA 1P49A 3O6QA 1U0JA 1AVYA 1NU1E 4UUJC 2EFWA 5KLVJ 1OCOB 1H9TA 1DPRA 2HG5D 2XHKA 1GK4A 3B5NB 2I5UA 1N2DC 4P9OA 2V7QJ 1HWTC 1VQ6I 1RUOA 1NKZB 3LSKA 5JQGB 5C44J 4U3JB 2E2HJ 1DK1A 2TRTA 3II6A 1OJLA 1P92A 2MGQA 3HOZJ 4BE0A 1PUEE 3KX2A 1B9MA 3MD2A 2CQ7A 1N36O 1QRYA 4AYCA 2VL8A 1VQ8V 2HU9A 1LTSC 3S32A 2HI3A 4RGXA 4I0XA 4DUZO 2H1KA 1YITP 2KRHA 5L3FA 2LTPA 4JI8B 2AHYA 4Z2YA 1LVAA 5KHGA 3QF7A 2W7NA 1D0ZA 4ZIBA 4MTOA 3GTOJ 2LFRA 3JAKB 3FHZA 2A05A 2FBIA 1KFMA 3ABMC 5HNFA 2W90A 2E3CA 3CWBH 3GFMA 5ILUA 3TL4X 2DPUA 3TO7A 4GKKB 1SAUA 1NHAA 1MNMC 3QPLA 2AXTZ 3CEIA 3H3ZA 3B5NC 1MW7A 3VMZA 1KA8A 2DJNA 4G6DA 3Q4HB 3OYKA 5AIPA 1DDNA 3S17J 5D8KB 4JI5O 2DFIA 1VQ7P 4RGUA 2L7MP 3CPWU 1N77A 2WAFA 3D36A 3OSFA 3RQIA 3CP1A 3HJEA 1RIOH 1JNMA 2OD5A 2JUCA 1LT9B 3TGUJ 3CLOA 2WA3A 1CP9A 1VQLP 5E3MA 3U1CA 4ZJZA 1XDUA 1S7EA 1FAVA 3IH4A 3L72J 2DMQA 1NAYA 2EA2A 3PQKA 2ZSIB 2E5LO 3F8BA 3QPTA 2UXXA 2DA4A 4ESBA 3L74H 3A0HZ 3E6DA 5F6FA 4ZBMA 1BCCH 1DQUA 2V1UA 2K37A 4KXRA 3CRAA 1OISA 3H1KJ 3L75E 1VFCA 5TISZ 4WCGA 2HDDA 1SQVH 2RAEA 4ZYHA 5KLIC 2XGCA 2ZD9A 1BE3D 3B77A 3M9AA 2HFHA 1T6SA 2ZXEB 2FYZA 2JA2A 1E2XA 3FKJA 3IFXA 4DV0B 5HODA 4WBAA 3L2WA 3OYLA 3WTXC 4H13B 5JCOA 3C2GA 2LYCA 1OW7A 1H8AC 2DOFA 4BY1J 5K5OA 1YSCA 2DFHA 2O8KA 1YXBA 5J3LA 4HNAB 9ANTA 3HHHA 1POGA 1QPMA 2H3OA 1KU2A 2E35A 1QVUA 3HM5A 4M3LA 5AW3B 4JI2B 3PLNA 2IYOA 3ERED 3CC4I 4EJVA 3DEWA 1SFCB 3ETEA 3U0ZA 1L8DA 3VYSB 2BXZA 2CQNA 1K4SA 4LG0B 2P67A 2FFDA 3CWBD 1WNSA 1IAWA 3E6MA 1FZCC 1FJLA 1H0TB 1WFXA 1VQNI 2OZ6A 3VBBA 2B9ZA 1SZTA 1LQ1A 4HOBA 2XV5A 5D5UB 3OTFA 4RAFA 1RE4C 3BCCE 3HE4B 3UO3A 1O4XA 3RGBA 4N0BA 3ASOC 2JO1A 5F1RA 4HRIA 2E34A 3CXCU 1WP7A 3DP7A 1URQD 1M90Q 1R3IC 5B66C 3L75G 1I1SA 4PSXA 3GTLJ 2Q9LA 5H2FC 3CMEI 3E35A 4UXNA 2DWDC 2IU3A 4HKZH 2E76C 2B7EA 1IX9A 2YU9J 3M9BA 3A8TA 3AE4C 1E1QG 1WP8A 4U3JA 3HKZN 5H2FZ 2QF7A 3HXLA 4JQFA 5FLXZ 4FJCC 1FP1D 2DA1A 3NR7A 3F3XA 2M9HA 4M3BA 1BCCG 2I10A 4OIOF 4CSWA 4AWXB 4OX9B 1E1RG 1W36C 5TISH 1RKWA 2RH0A 3HEFA 4WY4D 2YO2A 3TGNA 4LF8B 4IL6C 3T8TA 4LGDE 2BBYA 1JR9A 3ML0A 4DJGA 4HX8A 2BE5F 2M45A 4PJLA 3IC9A 5IP7J 5AVXB 1FXHA 1Y9BA 3TDZC 2DLLA 2VQLA 1N86A 3J7YJ 1SQPJ 2D5VA 1ENVA 3K5NA 1FYLA 5JVDA 4P9FA 1X19A 3S15J 1GLNA 2IZ0A 3CI9A 2E1CA 2W27A 4AM3A 1XSVA 3O8ZA 1JJOA 2E7WA 4FLZA 3CWBE 1ZX3A 1M1JA 3VPRA 5B1AB 3V8LA 1U2WA 5E1AC 3MKZA 3ZX6A 1OX3A 4KT6A 3OYMA 1ULYA 3RPQA 3VEPA 4XLEA 4HX7A 1OCCB 2LRDA 2IGMA 1S5LX 3ITKA 2A45H 1GN2A 4KJZA 3DEEA 2BOBC 4KP4A 1MFTA 1V54C 2LNBA 3F6OA 1A31A 1AA0A 1YRNA 3H0DA 3JC22 2IXSA 4C2UA 2YPRA 3ZEDA 4Y7NJ 1R5ID 2XNDH 2G3AA 1S4XA 4CICA 4RAZA 2ZJSE 2ZVNB 1Y6XA 1OIPA 2DYRC 2VRSA 2K9LA 4R4LA 4J19A 3M4OJ 1FIPA 2NXNB 3DKWA 2OYOA 1ZRTE 3ZQLA 2VS0A 2WLMA 4Y17A 4A5NA 2GZWA 1PM9A 1S77D 3MHVA 4ZH4F 3W6VA 3R66A 4XQFA 3ZRWB 2XAQA 3KZIE 1EJ9A 5KUMA 3GFJA 3B4SA 1H89C 1VP7A 4BWAA 2KRFA 5E79H 2PI5A 4AIJA 4E6KG 2VE9A 5CA0B 2DQLA 1RUNA 1ZLZA 1PL4A 1KQLA 1SQVE 1B72B 2A61A 2BY2A 2DFEA 5FKNA 1FDOA 3T97B 1P9QC 4ASWA 1O9GA 1EN6A 2QDOA 3ABVC 4FLVA 1SQBK 1Z56A 3LQRA 4ABMA 3P32A 3K0LA 3KEOA 5GTIH 5J8FA 2OUMA 2VOPA 3KYLA 4GT1A 4MVOA 4Z6YA 4L9TA 1G3YA 3PFIA 2BHYA 3FYIB 5FFXA 4H0LD 5H6RA 3RWRD 2VN2A 1A04A 3KETA 3B6AA 1Y76B 4CYCB 1OCPA 4AIHA 2XAHA 2JP3A 3BP8A 3MZHA 3L72E 3OIQA 4D6TG 2EQRA 3DC6A 4JI2O 4J41A 1ZRDA 3AG4C 5CVIA 4HDVA 3CCEP 4YJ3A 1NU1K 2CK3G 1ERDA 1STZA 5B1OA 2XKMA 2GDSA 2J58A 1XB4A 3RQ4A 1EZVH 3VFZA 2HEOA 4A3FJ 1VQ5V 4MVZA 4DV5B 4NXMO 1FY7A 4OGQC 1KQSU 4RO0A 1EDLA 3BT9A 1PL0A 4C3IJ 1H2NA 3OTOO 2M5AB 5KAIC 4DR3O 2LVSA 1S3JA 1WPXA 5JJJB 2LH9A 4CUGA 1K9MQ 4RUFA 4B43A 2WADA 5JH7B 3H1LD 2MFZA 3KXDA 3BABA 2GV9A 4BH9A 5DV5A 2DAOA 2HODA 4EEQA 2Q3IA 2PY5A 1AV1A 5KJ7A 2MJZA 1WZ2A 4IQJA 4EI2A 4K0KO 4LIUA 2G38A 4KYWA 1IN7A 4G2KA 3IAM2 1HF9A 4UVCA 4CYDA 1Y66A 2DYSB 2R93J 1VDFA 1E5WA 1NVOA 4XIDA 2L91A 3R2PA 3ZMVA 1TT5B 3SWYA 4XN0A 4U7OA 1Y0NA 4D5FA 2Z4EA 1MNDA 5CJ0A 5AW7B 3GWZA 1PGOA 1QZYA 2EPFA 3OUSA 2KISA 3CCQP 2WSEH 3D5SC 3OTOB 2HZTA 3DC5A 1Y8RB 2FQ4A 5J4VA 1G59A 5LD2C 5A9GA 2QJPC 3RL0D 4LNUB 5HLGA 1F7YA 5B1BH 3AG2B 4EKWA 4L9VA 2WVRA 4XBFA 4KHPO 2IBZI 1XMQO 3AKZA 4X65B 5HS9A 5E17F 5APYA 1Z3XA 1NK2P 1SP4A 3DLAA 1Y74B 3WUUA 4UB6Z 4YIPA 1I94O 4YTPC 4JZ2A 1QR9A 3TCUA 3ZHTA 4PDMA 2YR2A 5LRRA 3L9DA 3LA2A 1PP7U 1ZQ3P 3AK2A 2EILB 2Y2ZA 4NTWA 1VI0A 4IL6H 2M7BA 3W3CA 2H27A 1IV8A 2JK3A 2HS5A 3WMM0 1DGSA 5APSA 1NU1J 2ITAA 1BI0A 3E5QA 2A69F 1N4CA 3DGEA 4V2GA 3K4LA 4HQEA 1P84E 1YHQP 2OQRA 3OJAB 1HKTA 2Z99A 4LF5O 4HYTB 4GX5A 3AL0C 2R7QA 4LGWA 3GLMA 4XE5B 1SC7A 5APQA 1VQPV 1KONA 4J11A 1S8NA 5B1AH 1HW2A 5KAIE 3HPGA 1NH2D 3RJPA 4HB1A 1ETWA 2FBKA 2FNAA 2HVJC 4HZFA 3OOPA 3HB9A 2FYUK 1YCIA 1KV4A 3CMEV 2EZPA 4XA4A 1FZFA 2MW8A 3DQVC 5LHGA 3TXSA 3MN2A 3WU2Z 3BG3A 3D71A 1PP9G 4PA9A 3H1IE 3BAAA 2FKWB 4PI2A 1SQQK 4BJ6C 5KHJA 2ZAEB 2QLZA 4E7KA 2YKOA 2EWNA 5CYVA 1XS9A 4D9JA 4XICA 4UB6E 2V4JC 2J5PA 3L74E 4RQFA 5D6FA 5D5QA 2YIBA 2F4VB 2B89A 2Q5ZA 3P8CD 2ZKZA 1TQIA 1ETOA 4CS2A 1AI4A 2HVSA 2BOCC 2AEFA 2E36A 2V9VA 2HG5C 4Z1VA 4EDFA 3LW5J 3DPUA 1U5TC 2VKDA 4XRMA 3H1CA 3K1PA 4RUEA 3H32B 4IIJB 3CTAA 1NOHA 3DXJF 1OVRA 3I5CA 3BR2A 5IYBJ 4XOPA 4BHPA 1USTA 2CW7A 2M30A 2NZ2A 2UU9B 2VT2A 1KILE 3P3NA 2LKMA 3CMYA 3HRMA 1SFOJ 1R5GA 4DUYO 4M9ZA 3NTNA 3JAWB 3G71P 2V7QH 5FLMJ 4N3YB 2LF8A 2WBMA 1LTBC 3KCYA 4I4TA 4UHTA 4A6DA 3HTSB 1F1ZA 2Y4TA 4MVUA 4DXWA 2R7DA 4GDFA 1VQ4V 3H1JE 4HJGH 2EIMH 3KZIZ 3WTVC 3VP8A 3TJTA 2CFOA 5E1ZB 2ETNA 4L5JA 4JAVA 4UFZA 1K8AQ 4GOEA 2OU2A 4X1IB 2E1OA 2XKOA 1X9VA 1AJNA 3CS5A 1SFKA 4RAGA 3FWLA 4GZRB 3N2GB 1HKSA 3FB8C 3E22B 3AK1A 2FYNB 4CBCA 4EJOA 1WSUA 3PN1A 1FT9A 5EYPA 4F92B 3GFIA 4GCZA 4FLWA 4LF9O 3M0AA 4G6TB 4QNHB 1KILA 3L9FA 3HB3B 1CF7B 3DCFA 3D8CA 1NTZG 3CUQB 4LF4O 3P9CA 2CV1A 3GEZA 1YYCA 1KILD 5CQEA 1SFEA 3L70J 1XSDA 4H33A 1KZUB 2L7ZA 5GTIC 4KDPA 4ENMA 4DW1A 1VF5D 3CCRP 1P4RA 1SD6A 3GHGC 1Q90D 1DP3A 5IPAA 1P2FA 1IW7F 2MC4A 1WMKA 3H1LJ 3L1PA 4WWCA 2EIMB 1Y6IA 5C4JJ 2RDCA 4IO9F 1SA0B 3MP7B 4RO2A 4M9XA 5BOXA 4V19K 1CSBA 3ABMB 5B1BC 4MFDA 1LDJA 2QQAA 4WXHA 4Y3OA 4LF6O 5TISE 1WRGA 3JD4A 4EB6B 2R7WA 3RYFB 1D5VA 4GKJO 4F4LA 2WLLA 1VQ9I 3CLQA 3LWFA 2AW9A 2WA4A 1O7FA 2LLKA 2LO1A 3O8HA 1I39A 3CC2V 1LUJB 1ZLKA 3S14J 4I55B 4IL6E 2DJIA 1K4DC 5JHFA 2VWJA 1VQ6V 2VQFO 1M7LA 4OH8B 4YFNF 4DQ2A 2K4BA 4NVPA 5CCGC 5E79C 1G1XB 1ROPA 1JT0A 2PX9A 1RESA 3OIOA 4RESB 4HDUA 4I76A 2XB0X 4RAIA 2IBZD 3H1ID 1S9KD 2L35A 1HKQA 3C90A 3I53A 1VQ9V 1J09A 1VQ5I 3BDDA 3EUAA 4LFCB 3AL0B 3KYDB 3OMIB 2G0EA 5KJ7C 2AZ0A 1Q6HA 4UCVA 1KD1W 1K78B 4II2A 3B8NA 1AQTA 4R50A 4C30A 2FKXA 2A06D 5E1WA 1WQ2A 4GYCB 3SGIA 1K7DA 3ULQB 2XF7A 1ZG3A 3FK6A 3MZ8A 1HDDC 5LMUO 3H1KD 4Q5SF 2B5UA 4WXDA 3OY9A 5GTHC 5CPRB 2OCCB 3CHXA 1JUPA 1BDDA 1D3YA 4MTEA 1LE8A 3MEXA 3MZWB 2HFED 5IT9Z 2WSCJ 1SQQH 4W4LA 4JOMA 4E7HA 1BE3J 3OW2O 2V1NA 2ZXHA 1SFCA 4PGHA 3UKMA 2KZIA 3QP6A 2KT0A 2ZR3A 2OAZA 1YO5C 1CF7A 1TC3C 3CXHE 1XOUA 1EBOA 3CCMP 2FNPA 5EYPB 2G7HA 4F91B 2OZUA 1W36D 4G8XA 3I5UA 5CA1B 1NYHA 4AVZA 5KHIA 3VODA 1HNZO 3E7LA 2HVRA 4H0LB 1H8HG 2RJZA 4AQRD 4KN7X 2QJPB 1YX3A 4RGRA 2A68F 5AW0B 5KAFE 4RB1A 3V8JA 2E71A 2HTJA 1D2DA 4ABZA 2K7LA 2JR8A 1FBUA 4O6JA 2WQYC 4WBNB 1PPJD 3A0BZ 2W83C 3VTPC 5CB4B 2DT7B 5M3MJ 1D7MA 2Y30A 1N78A 1NTZJ 1JKPC 2G8YA 2WAEA 3B6CA 1JY2O 5ERIA 1RSOA 1BN5A 2DTRA 3I55P 4EVIA 2R44A 2AHQA 1LTJB 3S2WA 3AG2H 1FOWA 1ZAUA 5F0HA 4XKVA 3TKYA 1HUCA 4DUZB 4E70A 5TRDA 4ZYAA 3QU3A 4IL6Z 1AOYA 3DU5A 5HLIA 3OR2C 4AUXA 1LT9C 3BR3A 2K9QA 3VOEA 4DV4B 2CUJA 3R4YA 1HC8A 1BE3G 2OCCH 2WB1N 1K6YA 2QA4P 3CC4V 4ITVA 4UNOA 1PP9D 4X64O 1TP4A 3DU6A 2BASA 5HLTA 4U0YA 2JWDA 4MVSA 1LTTC 1W59A 3AEGC 3D36C 2QG4A 2KDOA 4YIRX 1VQPI 5CVJA 2IH3C 3BTJA 3I54A 1T2KC 4OOIA 4PD4H 3HL2A 1LKXA 5CQGA 2EIJB 1VQ8P 2R9RB 1L1FA 2F93B 2JTVA 2PAJA 1SD5A 3F21A 3FM5A 3L2UA 3QU6A 2TCTA 5BMZA 3UNGC 4MFEA 3T1BA 1WGXA 4P1WA 1ZGWA 1V54H 4BJTA 1IZ1A 3S3OA 2Z16A 3P30A 4BNCA 3BQYA 2ZVOB 1PVEA 4NTYA 3SJMA 1FTZA 1VQ4P 2F5EA 2WLLB 3P8MC 2Q69A 1RP3B 4EB6A 4DBQA 3BASA 1WJ5A 3KP2A 3FM3A 1QU3A 3ZRXA 1I08A 4O4LB 1RSOB 1US6A 4JGSA 2Y69B 1NQTA 3H9JA 2IBZH 3M3YJ 1URQA 1IXMA 3CQZJ 4RLQA 3A01A 4QPJA 4UCOA 3O65A 4U7JA 2R3CA 1OCZH 1YJWP 3IKVA 4AC0A 3BG6A 1VQLI 1GK6A 5EEAA 4UCTA 2KG7B 3L7WA 3H0GJ 1FNNA 4LLGF 1BHBA 2Q3EA 4L9NA 5CCHC 2OQQA 3JAMN 1U8RA 5C3EJ 1IN5A 4KUMA 5EJCA 1PGJA 3UR3C 1OJHA 1TBXA 5KKZC 5LMUB 1LNWA 3EVKA 3RYIB 4D1QA 3N4XA 3OMAB 2E5TA 2E75D 5CN0A 1Y74A 4GUNA 1PNLA 3T1YB 2WWYA 4E7LA 2F43G 1VF6C 5KLVD 5JCOC 3CC4P 3PHLA 1OHHG 1GD2E 4EJWA 1JOCA 2YICA 2JEUA 2XAFA 1FYMA 1QHTA 4QE9A 2KLOA 2MABA 5AW6B 3VYTB 3CMAI 5M5YJ 1W1WE 3GTGJ 4MTGA 1NS1A 3BC8A 2O1JA 2LY1A 2ZNIA 2RDPA 3LSMA 2FEZA 1HSJA 2XRNA 2XUMA 2KIMA 4R6ZA 4FQGA 2R5YB 1KQ0A 4F6RB 2PFXA 3JRIA 2L0KA 4DR2B 2H8PC 4IYIA 4W4KA 2XNDG 2X85A 2FYUG 2OYHC 2UZKA 2ZXWH 3T4DA 4RMNA 5FD5A 3TDKA 4DV6O 3QOPA 2JZYA 3JCUZ 5K1XA 3L73D 1JJ2U 2GUVA 2BHZA 2B0LA 2NN4A 3V2RA 2LGQA 3ZOBA 2P7CB 1MGTA 1JXSA 2R4GA 4B08A 3OV8A 3NWTA 1JB0J 3SHFA 4NXMB 2P7VB 4H37A 1S72P 3HKBA 4PJ0Z 4UVAA 3LFUA 2XROA 2VONA 4UVBA 4UB6H 1MSFC 1SFUA 4GX0A 4O5VA 1M57B 4R8HA 2D1HA 3MHSC 3HBLA 3VMYA 3GTPJ 1SQBJ 5IWAB 1BSNA 4EOTA 2QJKC 1X3UA 3B71A 4O2BB 2IU0A 1AVMA 2NR5A 4H0EA 4DOJA 1JA8A 4JV5B 3U21A 3P9IA 5ITZB 1BCCJ 1RHZB 3RYFA 4DV2O 2K3RA 3B40A 4YJ3B 2KHMA 3CRMA 3IWFA 1GDTA 3K5LA 1J5YA 2NRAC 2Y69H 5FRNA 3BQZA 4ZI7B 2LY2A 3JRBA 1MMSA 2K9MA 1ZRCA 4YXWG 3W67A 1R8EA 1BA5A 3RTRA 3TOAA 2EZHA 5AW9B 4A3EJ 5TGTA 2JVHA 3C3WA 5CBOA 4L5IA 1FDMA 2MLKA 3K70D 3FISA 4FM1A 3PFYA 4P2ZA 2LREA 3DTEA 1Z5WA 4HSRA 5LP6C 4C2TA 2LFBA 5F0CA 3BZKA 1BM9A 2EIJC 3FB6C 1BGYG 1ZN2A 1W5CE 1R5SA 3ICXA 3PRJA 1YIJV 3D3IA 3SJCC 4PD4I 3RT3C 2AHZA 1MZBA 5J47A 1KUQA 5IYZA 1B72A 2ELJA 3CUQC 4ZTJA 1KILB 1RF0C 3MQ0A 1KKDA 2F66C 2V4DA 4F93B 5EBLC 3APOA 3OM3B 2NVQJ 5LLQA 1ZL8A 4HNAA 1NTMG 2P5OA 3HPLC 4PUSA 3UO2A 1BR1A 3I59B 1HJBA 3ZRWA 1E17A 1H2LA 3HRUA 1KU3A 1SVMA 2HHHO 4UB6C 4RA2A 4FZ0A 2PZSA 1YJNI 1FE6A 1LWUA 4JI1B 4D7TA 3SYPA 1URFA 4XN3A 1AJPA 3FKSG 1WT6A 4II3A 2MLGA 3HE5B 3G71I 3A2FA 3ZCOA 4X62O 3FXLA 2H1LA 2L9SA 1OVUA 1IFJA 4GO1A 2KDZA 2IPPA 2CW0F 3G9RA 1X8YA 1S72V 3IAS2 3VOUA 4RM3A 1N0JA 3RYIA 2UXDB 2DO7A 5ICCA 4K35A 2Q5UA 3NARA 1BHAA 2P7JA 3CC7V 4H0LC 1HR0O 1HF0A 2DFFA 3OW2U 3CCSP 1S5LZ 5IJ9B 3V7RA 3U1DA 3E8BA 3TOBA 4JTDB 1FXKB 1IXSB 3PSFA 3CSXA 1O3TA 2KFDA 2DQ3A 3PNVA 1KQFB 2PRRA 4R1HA 4CXFA 4IFDK 3HTKA 2Z3YA 3ZHVA 2DXIA 1T95A 3Q4HA 2KIQA 4JP0A 3TGUG 2HWVA 1QQIA 4CCKA 2QEXP 1J95A 1RKTA 1K7AA 4JAAA 3PUBA 3V8KA 3OGCC 2HQNA 3FDYA 1Y4MA 1B06A 1Q3EA 5DYMA 1AKHB 5JH7A 2Q68A 2M7WA 3HHGA 5EYRA 5B3SC 3SJAC 2FOWA 1BL8A 1L4AD 3JARA 2BYVE 4CH4A 1FXVA 2CE4A 1VF5B 3KPHA 2OF7A 4GCVA 4XRSA 2E76B 3WGGA 3MAQA 2F95B 4HG2A 4G7HF 2VQGA 2C2AA 5KX5A 1LR1A 3CCMI 1T98A 1MBJA 2UU9O 3K04A 3SZTA 2V1XA 3PSIA 1AI5A 3RZDJ 4M3DA 5CCGA 5D6EA 5KHDA 1BSMA 2QKAA 1CGPA 3VMAA 1ETKA 5JQGA 1VNDA 5E8GA 1GHCA 2A06E 2K9JB 1EXIA 5BY1A 2FSWA 2VASA 3MZYA 1LP1A 4AIDA 3DV8A 2DYSH 3SXYA 4YEJA 5AW4B 4FT8A 1VQKV 3EUHA 4RDUA 3K6GA 3V42A 1PP8F 1ZV8A 5IJ9A 1KC8W 2M7AA 2FTKA 2NS7A 1L0NK 4PDRA 4FM2A 2ZJQF 5AVUB 1T33A 1NJIQ 1TW2A 1REPC 1JTXA 2NS0A 4U3FH 4H44C 4PD4F 4BAYA 3WU2E 4R8CA 2YIDA 1ZG1A 2F4OB 2MD5A 2MD0A 1S29A 4M71A 2JS3A 4MHGA 3L72G 1J9IA 3H1HJ 5EG0B 5BMVA 1QBJA 2LP0A 2EZLA 1NU1G 4K2EA 4M3FA 1IJDB 1ZARA 1UHSA 4LB6B 4RB0A 1HH0A 5LHHA 4H44D 1AR1B 1VF7A 1KB9F 3V4QA 4I2OA 1J5EB 3FBIB 3CJNA 4WFHA 3H5NA 1MBHA 2LOOA 2QWNB 3E83A 3VQXA 1M5IA 2PMUA 1QVGO 1PDNC 3LMMA 2ZT9C 1VQ4I 3F89A 1V9PA 3DBHB 1NTZH 3BPXA 2F23A 2FUG2 1YW7A 3M99B 1N73A 5BR8B 4DZJA 4Z1MH 3AG3H 3AFHA 4BIZA 1CZQA 1N34B 1QBZA 1QGKB 1S2EA 1E0EA 3S4RA 2IPQX 1GK9A 3LL7A 1U6GA 5IYCJ 2V9KA 3TEDA 3M1CA 2QJYC 5J1YA 4HH2A 2CTPA 3H1IJ 2OCEA 3ZDMA 4NR1A 5FD6A 1U5TB 1KU7A 1PPJE 1TWCJ 1ZLJA 5GTHE 3BG5A 2JDIH 1RF1C 2QR4A 3OYHA 1YQ4C 1J59A 4LBEC 1IBLO 2F5FA 3HIFA 5ILSA 3UCSC 2OC6A 1RNLA 3LNQA 2V7QG 1JX9A 3ZHRA 3HZJA 3LNNA 1RE3A 5LMNO 2HQ5A 1L0LE 5L3CA 1SQPG 4L75A 1GM7A 4RAYA 3ASOB 2QJYB 1IXCA 3G4SI 1NTZD 3A03A 4BW5A 3OL4A 4B3MO 2QIWA 3KDPB 3LSQA 2W24A 2FD5A 4NHJA 1Z6TA 5J2UA 1GKFA 4FTHA 3L73E 2OTLI 3AG4B 5DDGA 2L2OA 2JJ1G 2KB1A 1JI8A 5D5WB 4ENJA 1RRJA 3N05A 1J0RA 4W7ZA 4A93J 3BR6A 3E5XA 1I3AA 4HX4A 3K1MA 2VBWA 2CH7B 2JGDA 3SYTA 1SQXJ 3FYEB 4KIFA 1EQ7A 1SS3A 3B8EB 3DWLE 4ZYEA 1IJWC 5BPDA 1YIOA 1K3EA 3PO3J 2W48A 2OTLV 1TWFJ 3G6EV 2P10A 1UELB 5AVWB 5KJ7D 1Y8AA 2HLOA 1N7LA 5CA0A 5LP6A 1H9GA 4BQNA 2ARHA 2CMPA 3CO6C 2R7VA 2BCCD 2XU6A 3HE4A 1IN6A 4LF7O 1HXDA 2ELKA 3Q5PA 3VQVA 1WJZA 2Q6AA 2NYXA 4GYGA 3LA7A 5M5XJ 3FGAD 2Q0AA 2QQ8A 5AVZB 2K27A 1LFUP 2LR2A 2HNHA 1VZ0A 4A3CJ 3S3XA 3WTSC 1I5XA 2AQFA 2WWWA 1UZCA 2K88A 1OPCA 4H13C 4PZJA 4FLTA 4XLNF 2R5BA 2FXAA 3CYOA 4C7UA 3IV5A 4YFKF 3QH9A 1D1BA 3GZ5A 2P90A 2M4KA 1A02J 2P5KA 3ASNH 3OYCA 4LNUA 2QGNA 1PYVA 4ETSA 1R1UA 1I6XA 1ZUQA 3IF4A 3MCZA 3K70C 1N33O 1FS0G 2IT0A 1M57D 4IL6X 4UB8E 3CXHI 3HOTA 2W82A 4LF7B 2ME0A 3LUTB 4PJ0C 1GMGA 2LY9A 3I9V2 4IT5A 4KHXA 4GKGA 2DN0A 2O01H 2ZO4A 4AU7A 4IHTA 3KLNA 1QHHD 4BR6A 1MBEA 1GU4A 4JX4A 2Q1ZB 4NXNB 3BZ6A 1URQB 3GO5A 1EN4A 1ZGAA 1L0NG 2QCOA 1ZR4A 3ZN1A 1PZQA 1HW7A 4TWKA 2WA0A 2VQEO 2RQPA 3WE3A 1KFNA 1TTYA 1Z5VA 3SJQC 2PMZN 2COMA 1KQ8A 3J80K 1ORQC 2KS1A 3C3TA 1UG2A 3JRAA 3CD6P 1MIJA 1JPXA 1U7JA 3CMAP 1MMGA 4YY3O 5ICFA 2QSIA 2NNUA 3ABLC 4DOZA 1YW8A 5BXZA 1QCEA 4M3EA 2L6LA 2RV8A 2CQQA 2BW3B 2QWOB 4BY7J 1S76D 2N1TA 2FOKA 1GMJA 4AHCA 4DR2O 1OYWA 1MZ9A 4I0AA 2YU3A 1PP9J 1GL2B 2VOOA 4PCQA 1RQUA 3JAMK 5H20A 4TLFA 1DPUA 2BZTA 2A7WA 1R73A 1NTKE 3ZMTA 3HD7A 1L0NE 3G73A 5CA3A 2E5NA 2R0QC 2VLAA 4C3JJ 1ZH5A 1A02F 1IFPA 2CDYA 4CYCA 1FLIA 1G3WA 1OFCX 1LJ2A 1OW6A 1MSEC 4PJ0E 2JKVA 4RB3C 3KEYA 4U7NA 1PPJH 2VC0A 3HTUA 1R4NB 2HTSA 1K79A 2JVDA 2EIKB 3LSSA 1JY3P 2RNBA 2H8PD 2UXCO 3FXMA 1KB9E 2YIBD 3CDIA 5B66Z 1OR7C 2WZ7A 1VQ5P 4LP8A 1FZPB 2NS8A 3TSIA 1NK3P 2R7UA 4I0BA 4BGDA 4JK1X 2XSDC 1IXBA 3F7VC 6PAXA 2CUEA 2UUZA 1K8AW 3L75D 2R70A 4I6MC 1SS1A 2BW3A 3KE2A 3Q3DA 2VJIA 2YX7A 4RM2A 3BVOA 1N32B 3B02A 2IRFG 3ASNC 3M9HA 4O3MA 1BJAA 2IJIA 3S3WA 2PI0A 2QEXI 3JRHA 2VRZA 4KJMA 1Z2GA 1WPKA 1QZZA 2F4VO 4LMYA 3LNMB 3HSRA 1IDZA 1FZGA 3BFRA 1QX8A 4KFCA 4O2AA 2YSRA 1OXZA 1VQ7V 1O3RA 5LBQA 1QPIA 1TLHB 3ZRVA 1VEWA 3BR1A 1LB2A 2UXBB 4G28B 3RGUA 5DEQA 4A69C 2QSHX 2ZXJA 3PJRA 3RYCA 1WWXA 4Q6GA 2M3EA 5K1YA 2UUCO 4G7OF 3FXQA 1YITV 2IAIA 2EILH 1YI2P 5FPRA 4NPFX 2KNCA 3E2EA 1GN6A 4NTXA 3HKDB 1ZK8A 1WA8A 3W6KB 5IYDO 4DYRA 3D0SA 3BWGA 1LFPA 1QO0D 3BJ6A 1LE8B 2F48A 2CGOA 1FJGO 1X22A 1TQPA 1IGNA 3IL2A 2DOAA 2HPMA 3CXHF 4G94A 5HOOA 2KSJA 3WODF 2Q2EA 3QAHA 2KJBA 1N73C 4IHJA 3JSNA 3JATB 1BC8C 5CKTA 3AE3C 2Z0AA 3ETDA 2ZQMA 4J42A 2FFDC 2VQHA 1SQXD 1JKQC 4WY4A 3CX5I 4OX9O 4WF9V 3JSOA 1N8RQ 3CX5E 4EM1A 3L74D 5KLVK 3E5UA 1UFIA 2YXRB 5KAFH 3QODA 4I50A 3CCSI 2QTSA 2ZIMA 5HDKA 1X1BA 1QA6A 2A07F 3PUFA 3AEEC 1Q1HA 2I1KA 4EM0B 1W7PD 3L2QA 2B63J 3CP8A 4HEA2 2NOJB 1TWGJ 3IRQA 2EV5A 4B7EA 1AA7A 2J5OA 1H0MA 1NHLA 1BW6A 1F4NA 4XDLA 3K79A 2O01N 2GAUA 3LSHA 4FISA 4QLCU 4BDYA 1RQVA 1NTMD 4OMZA 1JJ8C 2EINC 2OTJI 3TBIA 1YJWV 3AE8C 4KISA 2YIUC 1M57C 4QPOA 5F0FA 3L71D 3MWMA 2MG4A 3TO6A 3H1IG 1FZCA 1APLC 3EDPA 2VXZA 4XKWA 3P8CE 1W7PB 5IWAO 4D7NA 5CBGA 2F1MA 1J2XA 2YNYA 1GM9A 3RK3E 4PI0A 3ABKB 3GF7A 4P9PA 5EZYA 4OWRB 4O4IB 2WSEJ 2QBYA 1FAFA 1H0TA 2N9YB 3A0BC 2O03A 2PN6A 3GW2A 1XGSA 3C18A 4CGZA 5GTIE 3A0HC 2ZFUA 3A7OA 3BRCA 5LXTB 2E42A 3EUKL 4LFAB 2CWEA 2WAQA 2OBPA 4DYQA 3H01A 1SD4A 2VI6A 3ELKA 1HOMA 4HQMA 1RPWA 1S5JA 2UWMA 3ETGA 2CPSA 1PV3A 4DV6B 1G3SA 1IK7A 1K5SA 3L72H 1ZTEA 3BCAA 4YG2F 3AG2C 1VARA 4AYBN 2YO3A 1JOYA 3DEUA 1VQMV 2N04A 1UIIA 3HGYA 4U3FG 1EKEA 1K73Q 2ELHA 1SC5B 2YUAA 1P7IA 2ZE7A 4PDLA 2BCCE 3AG4H 1WVRA 1B8IA 2OTLP 4LH6A 2P06A 2JJLA 1EA3A 2WLIB 3K2AA 4N9IA 5L3DA 3WHCA 2IJLA 5HVQC 3I4MJ 1G3TA 1TGOA 1MZFA 2DTZA 2JEEA 4BXUA 2SPZA 4YRVA 5CJ9A 2QRXA 2IA2A 2VBYA 3DF8A 4A3IJ 1FZEA 2DW3A 1T38A 4MTDA 2BVLA 4TUYA 3T5XA 5CJ4A 1WAZA 1D5YA 4WY4C 2M5WA 1SAXA 2ZCEA 1VQNV 3S2HJ 1OCOH 2AQEA 3KZZA 1R3LC 3ABKC 1ORKA 2WY7Q 3QWLA 3I56V 2H6CA 2G9WA 1G1JA 3OMYA 5CHXA 2QQ9A 2CRGA 1NTKG 3WHBA 2WLKA 2OQGA 1YVWA 4IRHA 4BEHB 3CC7I 2DWEC 2KOGA 4LJZF 3BA8A 4B3TO 2EJRA 4X6AJ 4B8XA 2YS9A 2WSSH 2Q7GA 3F72A 3FMSA 1LWUC 3QOEA 2W4SA 3ML6A 3H1HD 2AEMA 1MBFA 5F1JA 5GW7A 3RL0g 2EV6A 1N25A 4A7PA 3IH3A 5EIBD 1FYKA 2LSOA 4CC6A 5KKZB 3S3MA 1PNMA 3I71A 2CO5A 3T1CA 1W7PA 4BS9A 2LKPA 2CPBA 1GN3A 4I0XB 5GAHJ 2PUSA 5EBMC 4EFEA 1RF0A 3L75J 1XMAA 1XEQA 3GVMA 4AILC 2CJJA 2WLHA 1IRFA 3KCXA 2GUZA 4TV9A 4A0YA 4G9YA 3IAYA 3E6BA 3DFGA 2LGWA 3KG2A 5AVSB 4RB2C 2H8RA 3BCCH 2KZJA 1VF5C 3CCVV 4PA6A 1WJCA 1BSHA 2HOEA 3FD9A 3FX7A 4IX7A 4I6ZA 3KPEA 3HG9A 1KGSA 2ZNZA 1KQGB 2NPSA 1Q6IA 1WB7A 4QTRA 4ZYGA 1SQVK 1PP9H 1XG1A 3BATA 3AEBC 1FS0E 1IC2A 2I8DA 2CGNA 5BU5A 5LEJA 2KPMA 5M3FJ 5ICGA 5LYJB 2GTSA 4PSWA 1FBSA 3LIDA 2L7FP 1YF2A 1R36A 1J5EO 4TOIA 5GTHZ 4FPPA 1TQMA 4PA4A 2RGVA 1ZW0A 1N7SD 5B3SB 4LFUA 5DM6V 2D2WA 1Z91A 4FZ1A 1J2JB 5EC2C 1SETA 2D3OW 4Q4ZF 2WT7A 2CUZA 4EJUA 3CD6I 1S1CX 4LFAO 3CCUI 1LVKA 4B3SO 2DT6A 3S1RJ 1S7OA 1JTHB 1TUBB 3FB5C 3RYHB 2WSCH 2IA0A 1I0HA 1Q82Q 2LK2A 3AAFA 3MKWB 5CVVA 1U78A 2O01J 2HZDA 4L73A 1IN4A 3I0TA 2WV1A 5KNLA 1R4MB 4CCOA 3GCMA 2DK8A 3JD3A 1P7BA 3UKGA 1GL2D 4X66O 5HDGA 1F9NA 3DBRB 3L71E 2YSUB 2CV0A 2M4GA 3SDGA 3R4KA 4S0HB 3SEQA 4K3AA 2WMMA 1YJ9I 2DA7A 4RBOA 2K1AA 4W7YA 5GP9A 1IVSA 1U57A 1IDSA 1M56D 4LF8O 1JY2P 5EC1C 4G6QA 1KYOD 2DYRH 1HCRA 2WB1A 3L72D 1JCHA 3CO7C 3F5TA 4IHSA 2UUAB 1UJ8A 4U3FD 3A1YA 3WB2A 1KORA 2XDVA 2YX4A 1YBKA 3E1RA 4ZZDA 1X3ZB 4UUSA 1ZL8B 3CJQB 3OIPA 3O3KA 2P6SA 1GTWA 1MG1A 1VQ8I 4A6EA 3FMQA 2IBZG 2OV7A 1YS7A 3BG9A 4H13D 5K5RA 3E7KA 4BQAA 5LXTA 1W2EA 3PIPF 1HDJA 2RMZA 2X6AA 2FYUE 1NTKJ 2GIZA 1OCRB 1BW5A 2P4VA 3VQYA 1CXZB 1AP5A 1QVFU 4JBZA 4YJ2A 3W7TA 2DI3A 1PJRA 3ECOA 1UG0A 5LGUA 1WPBA 4Y28J 1QGPA 2WV0A 4JI7O 4KITB 3JAKA 3ZIAG 2FXMA 3FXUA 5F27A 3MVPA 1QLEB 3CMMA 2H7HA 4X1KA 3HOSA 4BRYB 4J00A 1FPOA 3F8CA 1EN5A 3A2AA 1RPOA 1H2MA 1MMMA 5APUA 2HKOA 4GYIA 3A0RA 2LR8A 1R6RA 1DGWY 1OCRC 3AG3C 2K40A 3HDDA 1NR1A 2E60A 1Q43A 3FFQA 2NPSC 1Q5OA 4LLNA 1O57A 1XREA 1FSHA 3STLC 3GB7C 3HKCB 2LDUA 4HZ3A 2L3DA 1NG6A 2DN9A 5EFWB 1V5EA 3C7JA 1GUUA 1YE9A 3L70G 4I02A 1IG7A 2LBFB 3O6QB 1MJAA 4IF4A 3JTHA 3HKBB 4LF5B 2VKHA 5B1BB 2M2EA 1NBMG 3CCJI 4ZMDA 3BPZA 3B2EE 2LJ2A 1BZKA 1L0NH 1IUFA 2Q0OC 3Q9SA 4S05A 3AG1C 1R6TA 3IFMA 2C9NY 4B09A 4WY4B 5GADJ 1FPQA 1K9MW 1YOVB 1K73W 2HXIA 4F6RA 3DLLF 2HJFC 4Y33A 2EK5A 3BCCD 3GYHX 1IV6A 2WTEA 2R72A 3MKYB 2DMNA 1KB9H 4LWSB 3HOUJ 2V26A 1T5EA 4ZOLA 3A2KA 3QNEA 4N78E 2DA2A 3MUDC 3Q5RA 3CCLI 5IYDJ 4KT0J 3HUGA 1YLFA 5FKOA 5H6QA 3SFZA 1I5ZA 1TWAJ 3DXRA 4A5UB 1JKRC 2PGDA 3HUGB 1YTZI 3TXQA 4WX9A 3D1NI 4EGZA 3IR9A 4GKJB 1JKOC 1K33A 1X1AA 5AW8B 4ZOLB 1YW9A 1T8ZA 1Z6RA 1MMNA 2DYSC 2HOSA 3ZCCA 5APTA 2XTAA 1XGOA 1VTNC 3RYCB 2UUBB 5KVRA 3K4NA 4PFPA 4QE7A 1S5HC 3OS1A 2CTQA 3E1IA 4B3RB 4MQ9F 4B3AA 3ZHQA 3N27A 1DF4A 1OCRH 1XMXA 3O2PE 3CCRV 2OCCC 5CBNA 4LK0F 5EZYB 1IRXA 3HGGA 4PD4E 3DPLC 3AE2C 4YPCA 3K9AA 5BS6A 1I3QJ 1LTGC 2VIXA 2CS3A 3BR0A 1BE3E 1SQXH 2FE3A 3GBGA 1NH3A 3CDHA 5E8IA 1S5LC 2DMTA 3J81Z 3P7KA 2R5DA 1EC5A 1JTYA 3RK2C 4ASNA 3OA7A 2MC3A 3CCRI 3ZS8C 3FF5A 5GONB 4BIUA 1YQ3C 2BCCG 4BWNA 4KN4X 5D4SA 1LDKB 5J2TA 2HR3A 2JMWA 4IQ4A 3CXHD 2B1GA 2CK3H 4JI3O 4HF1A 5LHIA 2QKSA 2OARA 2M3AA 3JRDA 4X20A 3SPJA 4LFBB 3D6YA 5A2QN 3HRNA 5LEKA 4R79A 4X1YB 4L5EA 4JYCA 3TGUD 3OAKA 1DTOA 4MW3A 1AKHA 2P6JA 2FXPA 4TT3G 1N33B 1BR4A 4M73A 3H1JH 3WGHA 2Z33A 3ABUA 1XBLA 4BL0B 3RKXA 2DQRA 2QKMB 4HSTA 1A5JA 3IRRA 5D5PA 2QSAA 3ABTA 1CEZA 2OWOA 1GU5A 4UCSA 1VQOI 2EFPA 4D7SA 1EDKA 1W5CC 1GL2A 2L01A 4LG3A 2L5QA 3V7SA 3JAMZ 2E75B 5IY5H 4WVZA 1JMKC 3LFKA 2Q2EB 1KQSO 4X66B 5FGMA 1OYIA 1T39A 1AJQA 4B4CA 1P4WA 5CMZA 3W7WA 5FKKA 3FMRA 3T8RA 1JUSA 2M8RA 3IN6A 3CWBJ 1FXKC 4F55A 2RN9A 2KKWA 2ZIOA 3GVAA 3BTCA 2PI4A 3AEFC 3V2PA 2M87A 1H89A 2VXDA 3TNUB 3WU1B 1X4PA 1F5TA 3H6PA 4FE7A 1SQVJ 4CC5A 5EGOB 3UM7A 3VOPA 3KYQA 1K6OA 2KI7B 1CPYA 4EM2A 1IBKO 3U11A 2UV1A 2WLIA 1XPXA 3PTZA 3GZNB 5DTDA 4IHXA 1GM8A 1BMFG 3SFIA 3L71J 1WJAA 4I1LA 3TNUA 5IJ0A 5DCMA 2E74C 3BEHA 3S1NJ 3E8GA 2M34A 3K4JA 4F3QA 4I9QA 2JQ7A 2V1DA 5KAFC 3RYHA 3ZQIA 2KSDA 3KP7A 2ETHA 2L4AA 2UXDO 2IGKA 3IC7A 4QIWN 1Z7UA 2VWKA 2H09A 1RR8C 1PKXA 1SQBD 3THOA 3M07A 1AU7A 3KZYA 2JA7J 2X6WA 3Q5FA 2Y0SA 2MA3A 5IT9N 2QVOA 4XR6A 3IWZA 3H1JJ 2ODMA 3GF3A 1L2PA 1JE8A 3SDBA 3OYIA 2PG4A 3H9GA 2XGEA 5F2VO 5CCHA 1MH4A 1FJGB 3NFQA 5B5EE 2ACJA 2DMPA 2QM8A 3S1MJ 4DR6B 3HKEA 1P84F 2KZVA 3BCCJ 2IM9A 2Y0MA 5BQTA 3A0BH 3RYRA 2JA8J 1X4TA 2JGUA 1XHXA 5JJEB 4E7SA 1XGMA 3SSUA 4JYAB 2K4JA 1AB3A 2W6BA 2E5LB 3VYRB 1ZRTD 1P84H 3LA3A 4BU2A 2K9JA 2E7XA 3U59A 4C7NA 3I4PA 3PNYA 2P5VA 5C4XJ 1IZ3A 2JSCA 3JREA 3MAJA 1HNXB 2BOLA 2JPCA 1S7AA 1RE3C 3AE9C 5J1RA 3K4BA 3N7NA 2YUSA 1AHDP 4TV9B 1P4AA 5GONA 4FM0A 2W0XA 1R23A 2D2CB 3V2QA 3T2MA 4N23A 2UUCB 2JEXA 3C2HA 3TW6A 4DV1O 2K3FA 2GSMB 2BTOA 3EYYA 2H94A 3WGIA 4B1RA 1JT6A 3W2AA 2V7FA 4U0WA 1YTFD 2JN6A 3JARB 4DT0A 4JTCB 3WU2C 1TNSA 1JMMA 4XFJA 4AI8A 3CX5D 2Z9OA 3BZCA 3E86A 2L54A 3SZPA 2HYNA 4KT5C 5LA6B 3L35A 2IDBA 4NYKA 5K7HA 3H1JG 4F52A 1K05A 1DH3A 5EZGA 3LSRA 1COWG 1SFCC 1MDMB 5L3BA 3G6EI 3IAOA 3H5AA 1IK9A 2D2CD 1ZRFA 1B04A 2RCVA 1NO4A 3K9TA 2CV2A 2RVCA 3CJRB 4FE4A 4LF9B 1WHUA 1KYOH 5M5WJ 3ISPA 4IHJB 1KQ9A 3JD0A 2P2UA 2L02A 2BEZF 4U0VA 4BHCA 1WCMJ 4AVPA 2QJKB 1IZNB 4NC6A 2X1EA 3SFEC 5AW2B 4KIBA 2FRHA 3WU0A 2A06G 3ZMZA 2Q8VA 4F7ZA 2QZ8A 1F43A 1BI1A 3MIWA 4I5SA 1NTMH 5D5XB 3KHUA 2EB7A 3HKDA 1SANA 2XASA 1R58A 1O3SA 1KYZA 1SERA 3CMEP 1Y67A 2EIKH 5DJTB 2W85A 2ZR2A 4JI4O 2GWRA 3PL8A 1IBMO 1E79H 1LT1A 2P4KA 3NMDA 5E18F 1Z77A 1W5SA 2XNXA 4MQVA 3ZPLA 2DU9A 3N2KA 1B8IB 5IYBO 3OD4A 1PP9E 4XSZF 3AEAC 3OMNB 3TGUE 2P0WA 3A0HH 4OPAA 3I64A 5KAIH 2HGCA 1WH5A 1Q7YW 4PFOA 4HNVA 3L70D 2YXYA 1VF9A 2R7TA 1M4UA 1VQKP 3I59A 1I1GA 2IFNA 1IRZA 2XV4S 4ICGA 2AXTE 5JLXA 4IOAF 1HWYA 1QHGA 2CU7A 2YXLA 2LXBA 5C8YB 3JSLA 5H2FH 2EIJH 3LIEA 2YEVB 4JF3A 4WB4A 2P81A 1RM1B 4CCLA 4YFXF 2ZM6O 4Y13A 2WLJA 3GMEA 1D5NA 1DIPA 5E3OA 1Z1DA 2W6JH 1XMKA 3AE1C 2XPUA 2JRTA 1AJYA 4XLFA 1T2KD 3MKLA 1N75A 5ICEA 4IIJA 1OQYA 3F8MA 4XLPF 4CHUA 1OWAA 3ZJZA 3GLLA 3I56I 2MH9A 4XLCA 4YHHB 4X89A 1BGYJ 2KSEA 2M1BA 3HYIA 2W0FC 4MLOA 3K5OA 1NVPD 2YXQB 2FXOA 1RH5B 5LRSA 4X64B 4L0ZB 3L71H 3TO9A 4ASVA 1K04A 1YTZT 1JJ6C 2EX3A 4LF6B 2N1TC 4CH6A 4WWIA 1XQ8A 3LW5H 1Z05A 4ZZLA 4D0PA 3J81K 4PHZA 3W2WA 1TVKB 4JYAO 2XDJA 3H35A 2M8GX 4KHPB 2J5UA 4BW9A 4R7CA 1ZP0C 2DBBA 3QPHA 2D1VA 4JPRA 3Q3SA 1EZVI 3KP6A 1IRGA 1Q81W 4DV0O 1LJ9A 3DSQA 4O4HA 4U3FE 3AG7A 4DR6O 3RK3B 1QLEC 3QVNA 4V2FA 1XNRO 1FX7A 2ZXIA 5IY5B 4IHWA 4DV1B 1BT8A 3ZXSA 1UJWB 2KS1B 1WI3A 1HP8A 2EZKA 2P4WA 2BE3A 3JSPA 4L76A 4LLLA 1LTJA 3Q0VA 2PEXA 2FJ1A 3L70E 3P7NA 1EZJA 4W80A 4MSWC 2OYHB 5KMGB 1QLED 2ZE5A 4PJNA 1N73B 2VE8A 3WTWC 3EXAA 4DK0A 2HQAA 2ZCWA 3UIAA 5JHUA 2BY3A 4BKXA 3KIOA 1IO2A 2HDWA 3L73G 1V5GA 2OPTA 4HBLA 2K9NA 3K06A 3F6VA 3RW0A 4CH5A 1SLQA 2X0LA 2IS2A 4TQFA 1SQPK 2NOGA 1KB9I 1VQMP 4QJFB 1XMQB 4GX2A 2HHHB 2FY8A 1F51A 2UUAO 2DK5A 4DV7O 2MW2B 1KYOI 4XORA 1HVVA 2H6BA 1BQ0A 4PV1D 2XHBA 2QVAA 1QU7A 3KP3A 3E6CC 2R7ZJ 3COAC 2NPSD 1E79G 1C0WA 4HLXA 2NVYJ 3CD6V 4D6TH 1M1KQ 3R61A 4RQEA 2WTYA 1ZG5A 3OR7C 1Z7LA 5FB2A 1QR8A 1BL0A 4X62B 2Q9IA 2ESHA 1FP2A 5DCFA 1XTCC 2KIUA 2A45G 2RN0A 3REOA 2H89C 3L71G 2JT1A 2W6AA 4UUTA 3SPHA 3G1LA 1GXQA 4O2AB 1TZLA 5CCGD 2Q8KA 2AZ2A 3JASB 2DOSA 2Q73A 4UCUA 2QWQB 1SQPE 3IGAC 3LQQA 4DV3O 1JCCA 2PP6A 3HOXJ 2A45I 1HW5A 2NPSB 4CPGA 1QNMA 2N9BA 2ZINA 2O0YA 1RPRA 2GXAA 5ILVA 4O9BA 2N74A 1AFOA 1D1CA 1SQBH 1SESA 3EWKA 1FZBA 1IFDA 3JD2A 4OU0A 2FA5A 4O4LA 5KMGA 3L37A 2HYGD 4FLUA 5FLVA 2XRLA 2V79A 2CFXA 1E3HA 4FETA 3CCSV 2MH2A 5EEHA 2GUZB 3H1KE 3L36A 1OLTA 5HFLA 1RF1B 4IHVA 2ZXXA 2J59M 4MO7A 2DMUA 1FD9A 2A79B 3OUFA 1XTGB 4YIIA 3JW4A 1IC8A 1SQXE 4FLYA 4TQDA 4BE2A 4Q20A 1TNTA 5APXA 4M6YA 5AVRB 2CUFA 1RE4A 3JALB 3CCYA 3U2RA 2NNNA 1WI9A 3K08A 4ZI7A 1NTCA 2CG4A 3CL3D 2E2JJ 2ZE6A 4BYYA 2GOMA 4K8XA 4J9YB 2PYJA 1NTKD 1R6NA 5ITZA 3I5DA 4P96A 1J1DC 1U3EM 5KLVG 3WTUC 5H5NA 4UUVA 1FYJA 1TAEA 1YIJI 4EGYA 5FO5A 4B3SB 1U5TA 2B88A 1LNQA 4RJTA 2KL4A 2W25A 2A3SA 1Q82W 3GHGB 4G27B 1HQCA 1H2SB 3FXEA 4OIRF 2QSGX 3CCUP 2HPCA 3A4CA 2QA4V 1IFIA 1LUWA 4UV9A 5DS9A 2F4IA 4ENNA 3H1LH 2R92J 4UB8H 5IYCO 5EF6A 3CUQA 2FMYA 2W57A 3K69A 3IJ4A 1S5LE 2ZMEB 3JCUE 4EATA 4J7JA 2A06H 3NQOA 3MUDA 5CB4A 2VT3A 4GIFA 3OT7A 2VKVA 1SQQG 4C9YA 4CCJA 3E22A 3RVYA 1L0LD 3I4NJ 4J80A 4N6JA 2YMKA 4IOIH 3VYIA 3V6IA 3H1HG 1FMVA 5ED4A 3WG7H 1G6NA 1BI2A 1OVVA 3FXKA 3H92A 1SEUA 5KLIB 2ZFWA 4ENKA 4JI6O 1EM1A 5BMVB 3AEDC 4HF2A 4U87A 1BCCE 3M9QA 3LOCA 3HUSA 3SDLA 1H8EG 4LLHA 3L75H 2IJJA 4DR1O 3DTUB 2X51A 5TISC 2DPDA 3L74G 3IH2A 3DTIA 2VB6A 4HLYA 2K9YA 4OIQF 2EJ7A 3AE7C 5BR8O 1WB8A 2ZJRF 4YIOA 5IP6A 1M90W 2E1MB 2VJ5A 3VSLA 5AVVB 2R7FA 4WFEA 4ESJA 5JI6A 3FIWA 2YC0A 2XVCA 2JVGA 2ITDC 4O4IA 4JI5B 4KICA 1WJEA 2QWWA 2OTJP 2QE7G 5AW1B 3K7AJ 3E3VA 4UY8I 1IFNA 1R7JA 2YI8A 1LFBA 4IKFA 2ILMA 2KIFA 5LP6B 1KKCA 2IJKA 5J9PC 2NLJC 1MH3A 3X2QC 1A6QA 1D1AA 5IY5C 1UFMA 3PP5A 2L7KA 1T2KA 4JBAA 2JDIG 4DNCA 1Z3YA 3SR2C 3QTCA 1IBLB 3FX0A 4ZTFA 2F5DA 4WFBV 1NKDA 3WE2A 1HGVA 1PFIA 3CCMV 4I7ZC 3CJHA 3W68A 5F08A 4IFMA 3A0BE 3M0DA 3GTQJ 3OFNG 4DR4O 1N7SB 1P6RA 3SPIA 2K3PA 5IP9J 2VBXA 4DRXA 2OTKE 2XZRA 4IXAA 1DEBA 3O8GA 4HPQA 4I50B 1Y1VJ 3B8MA 2WSFH 1ODDA 4XRSG 1ZR2A 1VQLV 2EA4A 3TQNA 3UQ8A 3VQWA 2IBDA 3JCUC 5E20A 2KKOA 2WPDG 1QVTA 2LFSA 1X1DA 1NTME 5DM7F 3JSVC 4U7BA 2R32A 1NGMB 1I5YA 1V54B 5FLXK 3CJTB 2M0MA 3H1JD 1GRJA 3B09A 1AR5A 2RKLA 4QMAA 3K3WA 1HDPA 2Q1KA 1PNKA 2B9SA 1U9OA 4CA0A 4H4KC 3L09A 4AYBA 2MBFA 4N78D 4LFCO 4JI6B 2Q7HA 1FXKA 1SRYA 1SVLA 1O9HA 4GODA 4NXNO 4I7ZB 5JFRA 3MFKA 2GM4A 3X2QH 1MMAA 1U97A 3OOUA 4I99C 1P7GA 4OAZA 3H1KG 1NTKK 2E74B 2ICWG 2XKPA 3G6EP 5DEDA 2RN7A 2B87B 1CW5A 1BJZA 2COBA 4XKCA 2E2IJ 2M0CA 1FJKA 5B66H 3BOQA 1HA8A 3G67A 3AE5C 2A3QA 2IS6A 2R7SA 2MYSA 4I98B 4YXWH 1MMDA 3O9OA 1EXJA 3HRTA 3WFVA 1R22A 4A3MJ 5L3EA 4OIPF 1DF5A 4AUWA 2PMZA 1YJNP 4NC8A 2HDCA 4QSHA 4WF2A 2RQ6A 3ZGKA 1M1KW 3H1HH 1I94B 2Q0OA 2GIVA 5IE9A 3CCLP 3EQ2A 2JWAA 4XKBA 1YZBA 3ZQ7A 5LMNB 3ERMA 4HYOA 5CBFA 4K0KB 1D8KA 2NVTJ 3SWFA 2LD5A 2Q4PA 3RN4A 4B3MB 5EG0A 3HR0A 2FBWC 1MSWD 1X79B 1MV8A 2FL4A 2ZXWC 2X6CA 1OCTC 4MEYF 3T1HO 3LSIA 1X1PA 1Z0XA 2AGAA 1EDIA 3CC7P 2AO9A 3RIRA 1NWQA 1YTYA 1R9TJ 2I1JA 5A2QK 3MD0A 3HKZA 5E1XA 3C3SA 1L4AA 1SQVG 4JPZB 2V6EA 1VIBA 1GVJA 2K02A 4PDKA 3ZRSA 2JRMA 2WAMA 3H32A 1ZELA 2LMDA 4HNUA 2JIZG 1S0VA 4CZZA 1LT9A 4UB8C 2YIUB 2D2CC 1ETQA 1SZXA 1Q86Q 1LP1B 1BIAA 3G2BA 3PH0A 1R6KA 4C46A 4O4HB 1FIAA 3HRSA 4EYYQ 1USEA 2CUGA 1P4XA 1X2NA 4XL9A 2E5ZA 3V5BA 1T0FC 2P5LC 3TGUH 2E19A 3ONQA 4IRGA 1Y0UA 2Q7CA 3H1IH 1JM0A 2EFQA 3ZP5A 1Q86W 1EH7A 4LB5A 2WPQA 3SYQA 4QWQA 2M0BA 2JJ7A 4Y15A 3A02A 2DA3A 3SJBC 3Q1MA 1G2HA 2Z5HA 2BGCA 3OYNA 2NVUB 1GVDA 2N1TB 2AXTH 1SMYF 4E7IA 2UXBO 2OYQA 3GZ6A 4IOCF 1YDXA 4DRXB 3F8NA 1PD3A 4B47A 4I9WA 1SVFA 2ECBA 2QUFA 2FYUD 1XTAA 3CRRA 4P55A 4D5CA 5EDNA 3LSPA 1RETA 2EZIA 3FHNA 1L4AB 5DD8A 1ZOYC 4HF0A 2OIGA 2EFOA 1XHZA 2JRIA 3T97A 2JK5C 5AW5B 3FXRA 3Q5SA 4OGQD 3H1LE 3J81N 3OYJA 1ZYRF 3GX4X 1ZSPA 4EFBA 1MUUA 4NB5A 1DGRM 2W00A 3HTKB 1MNEA 3FXJA 4G7ZF 4Q48A 1MNGA 5JWPA 3MTUE 1PV0A 1SA0A 3HUSC 1TA8A 3TMOA 4WFFA 4M6VA 1XNRB 1OZHA 2YKQA 4RWUA 3G71V 5KHKA 4L87A 2X1DA 2MKVA 3OS2A 3ASOH 2QA4I 4DR4B 4FLXA 3ZHSA 1RM1C 2F5CA 5E3NA 4U3FJ 4ZDPA 1LUVA 4JI0B 2RQQA 3JASA 3QYEA 1QL2A 3FKIJ 2XAJA 5KLVH 3KCCA 1OYYA 2PFBA 1EZVE 4YY3B 4E7ZA 4IYHA 2A5WA 1XCVA 1IN8A 2GBOA 4IPAA 3JR9A 1JY3O 5M1BA 3H3VK 4J9ZB 1PUFB 1Q7YQ 1ZLLA 5FL7G 2R7XA 4YELA 3JRGA 2VPLA 1WRJA 4PV1C 5EK0A 3HUSB 3E8HA 2IW5A 5GPAA 1A36A 1S9HA 2PTMA 4ZDLA 4JI7B 4Y99C 2EV0A 1W0TA 4NUBA 5GPCA 4FX0A 5BPIA 3RL0C 3E0JB 5CCHD 1GZLA 1AILA 1JFFB 1MJ9A 3OYEA 5HDNA 4AIKA 5IDJA 3GW6A 3RFRA 1ZHFA 2X6OA 2AS5F 1ZTRA 2M8EA 3OWTA 1L0ND 1ZXGA 3M8FA 1WLEA 4UV8A 1ENHA 3TK1A 4RKUJ 5JVDB 3A01B 2P8TA 4XDJA 2PQ8A 2VJJA 2KK7A 4DR1B 1P7JA 3WTTC 3K0DA 3JAWA 2FMLA 5IYZB 1M8OB 3TP3A 2BVMA 1KECA 3SYAA 3I3LA 1N0NA 1BCCD 1OCZC 2JGDB 4OAYA 1FFTB 3OYDA 1MSDA 1LGHB 1R1VA 4XLAA 1EF4A 3V7CA 5BZBA 1NTZK 1SQPH 2KQXA 2QM3A 1T3UA 1GO3F 1J1DB 1T8IA 1SKVA 4PJ0H 2WC2A 5KHHA 3IUOA 4GFBA 3OGIB 3G1OA 2FB5A 4I2LC 1SQBE 3SQNA 2C9LY 1AP6A 1OR7A 2R5ZA 4I55A 1WJBA 4M3GA 3TDUC 4IVNA 2CAZC 4DBRA 2W6JG 4B86A 1VQKI 3AECC 3EETA 3RKWA 3RK2B 1Y1WJ 2ZYDA 2JWTA 1LTAC 5APWA 3QYBA 5AVYB 3KQGA 3ABLB 3OYGA 1IURA 3J7ZI 5JVTA 4ANJA 4JZGA 2RREA 2Z1DA 2R5ZB 1OCCH 4BQOA 2KIKA 1FOKA 3W7UA 4NKGB 3ZN0A 3E1SA 3JYCA 1G4DA 3WG7B 2IJHA 4HW0A 4UB8Z 3L73H 1V5FA 2HEPA 2JA5J 4LC1A 1NU1D 2EIMC 1BGYE 4NPEA 1XD7A 5GAGJ 2A6TA 1W2BO 2XPWA 2ZC2A 5JLWA 2O57A 1FJPA 1GN4A 3F23A 2ME6A 5LGNA 3HOVJ 4N4NB 3RK2D 3VP9A 1JO5A 3BVHA 3S1KA 4FIPC 1MBKA 1TW3A 2EBOA 4P30A 3V4WA 5DN6G 3KP4A 2WPRA 2FX0A 1SQFA 2XGXA 1VMGA 3IHUA 3ZQHA 4Z2WA 5J1UA 2E43A 3CXHH 4WBNA 4QPKA 4FVMA 1GW4A 5C8YA 3GLXA 4W97A 3VMXA 2E76D 2RC4A 3EUHC 4DZOA 4LCUC 4PK4A 2CQKA 2QWPB 2ZNJA 3NAUA 4PD4D 1M56B 1B4AA 1YTFB 2OT5A 1JFFA 5DUIA 3PJSK 1W4MA 3GWKC 5AONA 2Z2SB 2X9DA 1SQGA 2WY8Q 3QPSA 1R49A 4GDOA 1R5HA 2LW1A 1I7FA 1IXRC 4HBNA 4CH3A 3K5BA 4I4TB 4JYKA 3FB7C 3J80N 1G4YB 2WAQN 2DDBA 3JCZA 1PGQA 3G4SP 1G8XA 3LAPA 4HV6A 1RZ4A 1VF6A 4EV0A 1OCCC 1SD7A 2LF7A 5E79Z 3PO2J 4DR7B 1RR7A 3CF5F 1HTLC 3K4CA 4L0YB 4C3HJ 2Q7EA 2STTA 1W5TA 4MVMA 1JTHA 2ISYA 2QM7A 3R0JA 2BEOA 1H88A 1XDSA 2W6IG 4DCKA 3OEEG 3JCUH 1H38A 3QO8A 3CC2I 1W2BU 3P3PA 4J7KA 3RYPA 3ESWB 3CPWO 1WH7A 3PM1A 3HD7D 1I27A 2L9RA 5J40A 2HKXA 3PIOF 3STZC 2DA5A 3KLOA 4RGSA 4H44B 2ZDIA 2X7RB 1DU6A 2KLUA 5LYJA 5EEGA 2KMUA 4MNUA 1Q81Q 5KX5B 1VQPP 2C0WA 1FSEA 2YMYA 1VQNP 4PJMA 4BIOA 1QVGU 1NG7A 3ZQCA 1MFZA 3LDDA 2XIGA 2WSSG 2PMHA 5F64A 1FKAO 3JALA 4R4MA 1L0LJ 4A3KJ 4E4HA 1KYWA 1R5LA 1VQOP 3GMAA 3RVZA 3X2QB 1BBYA 1L0OC 4ZKPA 1SQXK 4X20B 1N8RW 2EH3A 3CJHB 2AEJA 2ZJPF 2XF6A 1XMOB 4JX5A 1LEBA 3WUTA 1M9NA 1KP2A 1RF1A 4XRFA 2QENA 2DW4A 2F2EA