1S3JA

X-ray crystal structure of yuso protein from bacillus subtilis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
b'SADQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYLSFLTEEEMLQAAHITAKLAQAAETD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YusO protein
publication title X-ray crystal structure of YusO protein from Bacillus subtilis, a member of MarR transcriptional regulator family
rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 47
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s3jA02
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1s3jA03
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1s3jA01
3H3UA 5JFRA 3WTUC 3QPHA 1UB9A 2QLZA 3TDZC 3V4GA 3ZN0A 1IW7F 3MEXA 2R7DA 2VE8A 2Z5UA 2K27A 1CF7A 5HOOA 6PAXA 4RB2C 2KIKA 3JSPA 4L9JA 1EDJA 4JBAA 1B1BA 4UVBA 2EV5A 2JPBA 1QPMA 1YW9A 1HKSA 2MLKA 2OU2A 4UVAA 2OZUA 1MJAA 4RGXA 5CA3A 2CGPA 2KRFA 5F64A 3LA7A 5DD8A 3WODF 2Y0MA 2K4JA 2QBYA 3ULQB 4HF1A 4LG0A 4RAYA 2DK5A 1IN5A 3H92A 4YFKF 3KP3A 5CVRA 2ACJA 1I1SA 3L00A 4UNOA 3KP2A 1G3WA 1HQCA 5ILVA 2M45A 5EEGA 2GAUA 1R1TA 3DV8A 2VONA 3ZMUA 3DPTA 2XVCA 2VXZA 2COMA 2JRTA 3HIFA 4QLCU 5D5WB 1T39A 1DUXC 2FQ3A 1T0FA 3KE2A 4BYYA 1ZREA 4YG2F 3FF5A 3E6MA 2RC4A 1H0TB 1F1ZA 1SFEA 1W7PB 1B9MA 1SD6A 3F6VA 4IRIA 2VOPA 3KFWX 2L01A 3W6JB 4BNCA 5JI6A 3K9TA 1FSEA 4KUMA 1FC2C 3V7SA 1DDNA 2IPQX 4AWXB 2B87A 4HX8A 5JR3A 1PP8F 1T38A 2JTVA 4ASVA 2FNPA 1IRFA 3JAMZ 4IJAA 1LDKB 1CGPA 1R5HA 4CDGA 2KIFA 2V1XA 5D6FA 1R00A 3VB2A 4M9SA 1RUNA 4L9NA 5E1ZB 2IW5A 2DPUA 1GXPA 2OBPA 2KIMA 1P4AA 2J5PA 2IJLA 1ONVA 1VTNC 1EC5A 3EYYA 4P9UA 5CBNA 4HJGH 4ESFA 1QQIA 2PI0A 4B09A 2GIVA 4AD9A 1TBXA 4CO8A 5FFZA 2XAFA 3R61A 2Y75A 2Z9OA 2GQQA 4GCVA 4MNUA 3TOAA 3U9GA 5LHHA 5DEQA 1EH7A 2HEOA 3E6DA 4HB1A 3V8KA 5LGTA 1WQ2A 4RAZA 4BXLA 4B8XA 1OPCA 1QZZA 4ON0A 3RDIA 2JT1A 4WF2A 2XAHA 3W7SA 4EJOA 1XSVA 4HW0A 3TO9A 1ZH5A 4EVIA 2VC1A 3DP7A 3GUDA 1LP1B 3K0LA 3WTSC 1SMYF 4KT5C 3J80K 2M5AB 3T8RA 5AIQA 1ZGJA 2KKOA 4YFNF 1YIOA 2P5VA 5TJJA 1W5SA 4MHGA 5L3CA 2QQAA 4MGRA 1WKMA 4HOBA 2X0LA 2UWMA 3GX4X 3O6BB 2FRHA 3E6BA 1BI0A 4K35A 1KGSA 1O3QA 4PGGA 1K6OA 3LFKA 2HKXA 5KVRA 3F8BA 2EFPA 1ZHFA 2V1DA 4IRHA 4PGHA 2AXLA 3WU0A 1REPC 1F5TA 3I59A 5J8FA 1X0TA 1S6LA 3C7JA 3F21A 3WGGA 2HFHA 3ISPA 3HOSA 3GZ5A 1MJ9A 2ZFWA 3C3WA 3E5QA 4YFXF 1EDKA 2P5KA 2LF8A 1Y47A 4BXUA 2RNJA 4M71A 4JQFA 1LT1A 2QVAA 4OMYA 1FYKA 3TOBA 3FX3A 4LLLA 4JBZA 1D8KA 1HKTA 2QUFA 1FWZA 1FBQA 3FHZA 2WV0A 4EYYQ 1IXRC 1XB4A 1JXSA 4HV5A 1FYLA 4WK8F 2DAOA 3COAC 3CO6C 5ILUA 5FLXZ 3DXJF 3K1MA 3EYIA 5KK1A 2UWJE 2NS0A 4F7ZA 2VOOA 1AOYA 3P9KA 3K1NA 3WTYC 4HYEA 1O57A 2FA5A 3E97A 4N9IA 3LAJA 1TQIA 1MKMA 3CUQB 1I6XA 3E6CC 3HSEA 2FSWA 1HW2A 1FZPB 4RB1A 2LSOA 2A61A 4FHTA 3REOA 2KI7B 3I0TA 4HBLA 4UV8A 5HDNA 4EJVA 3HYIA 4O3MA 1Z1DA 3QPTA 2A6HF 4DNCA 1FSHA 2ZNYA 5FFXA 4IRGA 4U88A 4AIKA 4G7HF 5FO5A 2XUBA 2CYYA 4XSXF 5BQTA 2VBYA 3TKYA 2RGVA 3RGUA 3GFIA 3P9IA 5D5XB 3W7WA 2RKLA 4EM0B 2HKOA 2O3FA 3U1DA 5LLQA 2O6GE 1I5ZA 3M7GA 2BV6A 3B73A 2ZMEA 4N0BA 4EJWA 5JHUA 4ZZLA 1MDMB 2VODA 5E1XA 2ETHA 1IZ1A 1XCBA 2HYGD 3CO7C 2D1HA 1KU2A 2DK8A 5LRRA 3MAJA 3RKWA 4EGYA 2FOKA 3JW4A 2NNNA 3ABTA 2GXBA 1LDDA 2E7WA 3MHVA 1K7AA 2XV4S 4HX4A 2BE5F 1ZW0A 2P6SA 4HX7A 3LQQA 2OD5A 3DF8A 4AVPA 2VE9A 4AIJA 2OQRA 2KIUA 2NRAC 1XGNA 1SAXA 1UHWA 4IVNA 3ZMVA 5HLHA 1S29A 3M1EA 4NPDA 2W84A 5ICEA 2KJCA 3WG9A 3F8FA 1J0RA 4OINF 1O7LA 3BDDA 2DO7A 3R0AA 3GFLA 3LA2A 2A3SA 2BEOA 4I02A 2P5LC 3RI4A 4KICA 3FMQA 4UHTA 2KS1B 2CFXA 3GYHX 1G3TA 3I59B 5F1RA 4M9XA 3I71A 5IT9Z 2R44A 5DJTB 5DV5A 3IKVA 3V8JA 1FLIA 2IT0A 1K79A 2ESNA 3F22A 1L0OC 4G6QA 1XGMA 1B59A 4UV9A 5DCMA 2DQLA 2QM3A 2FF4A 3MZWB 5BS6A 2M1BA 4HZFA 4L9TA 4G7ZF 1Z6RA 4R1HA 4S04A 2LDUA 4XLPF 3M8EA 2JZYA 1IN8A 2UZKA 1XGOA 2PLYA 2STWA 5C39A 3I54A 4OMZA 5IT3A 5K1YA 1X3UA 1XCVA 4D0PA 3MWMA 2PG4A 3R0JA 4O5VA 2R7FA 3WTXC 4KIFA 4M73A 2LKPA 4RGSA 2L02A 5K5GB 1H9GA 3IC7A 1QBJA 4GXOA 2HZTA 3F6OA 2JWDA 1TLHB 2MA3A 1S3JA 5K5RA 1JGSA 5L3EA 1KA8A 4WXCA 3WGHA 2PQ8A 1BC8C 2DLLA 1AWCA 3KLNA 1S7AA 3T0YA 2JSCA 2F5DA 4NPFX 4GODA 1ZRCA 3HHHA 2HTJA 2HTSA 1R36A 1YQAA 1EDLA 1U5TC 4ENJA 1QZYA 4XLNF 1U5TA 3LA3A 2P58A 2L3DA 3WE2A 4R8HA 3TDUC 1H9TA 1OR7A 4IHSA 2M0BA 3IRRA 2O61A 4NQWA 3HRSA 2QWWA 3WE3A 4I98B 3IL2A 2DBBA 4Q5SF 1YG2A 3RIRA 1R1VA 3K1PA 4ASWA 4Z2YA 4FX4A 1HW1A 2VBZA 3FXQA 3IWFA 1WI9A 2UXNA 4ENKA 3B02A 1S8NA 4CGZA 1HXDA 3KP5A 1G3SA 4ZYHA 3ZP5A 1D5VA 3OOPA 3L09A 2MBFA 4ESJA 3BJAA 2A69F 2KZJA 3R6SA 1RUOA 4U0YA 1C0WA 1XSXA 2WC2A 2V9VA 1BIBA 1MGTA 1KQ0A 3QRFF 4KYWA 3RPUA 1LDJA 2RQPA 2A68F 5D8LB 2O0YA 1XSDA 4G6DA 2XGXA 3EDPA 3F8NA 1R23A 3G73A 1J75A 1KQ8A 1YYVA 2QYOA 3M9AA 3HRTA 5HLIA 1YTFB 3DEUA 3WTZA 3GF2A 2DU9A 1XDUA 1T6SA 3OV8A 2EFQA 5HS7A 2Z99A 2Z3YA 4H0EA 3MZHA 3E35A 2XHKA 2GZWA 1BDCA 4A5NA 5LHIA 3BPXA 5BPIA 3QU6A 4EQQA 4XRFA 1I27A 3ZMSA 1ZRFA 2ZAEB 2PMHA 2WMMA 4RGUA 1WRJA 3D3IA 1E17A 3IHUA 4HLXA 2RVCA 2EV0A 2PBIA 2RKHA 2DQRA 1K78B 1OVUA 1IN7A 5ED4A 5AIPA 4ZNCA 3KP4A 5ICFA 4L0YB 1W7PD 2CG4A 3J80Z 3KEOA 3LAPA 3J81Z 4HDUA 4A5MA 2NAZA 1J5YA 2CQKA 3FM5A 2A07F 1ODDA 5EEHA 3F3XA 4EV0A 2B88A 3P9CA 1CF7B 4OIOF 5HLGA 1FPQA 4MQVA 5FD5A 2EFOA 4YIFA 2XRNA 1BN5A 1BOAA 2Q8KA 1HKQA 3W7TA 1FBUA 3KLOA 2VBXA 4HDVA 2P7CB 1DPUA 4OU0A 3HRUA 5L3DA 3FXEA 5JVTA 2VBWA 2OTKE 5J8CA 1P4XA 1YTYA 1JHHA 3DQVC 3LWFA 2QBYB 2HWVA 1R7JA 2KUBA 2L54A 4OOIA 3E5XA 4LG0B 3C18A 1V4RA 2EA4A 1GHCA 1FT9A 3QAHA 4LLNA 3GFMA 3MZYA 5CYVA 2IA0A 2DI3A 1GVJA 4O6JA 3CTAA 3AAFA 1U7MA 2OAZA 3WGIA 2P90A 3PH0A 2ZO4A 3LQRA 2QZ8A 3VOEA 4PDKA 2P8TA 3MCZA 3NEUA 1KU7A 1P4WA 2EK5A 4RB0A 4KMFA 3L9FA 1LVAA 1TQMA 2ZBKA 4Q47A 3ERED 2E1NA 2H6BA 1B6AA 4GOEA 1TTYA 1GXQA 1TNTA 2HR3A 1UCRA 5LEKA 5D4RA 1MZBA 2EA2A 2H09A 1ZARA 2B87B 5H6QA 1BDDA 4KJMA 1OYIA 1ZXGA 2FE3A 4Q4ZF 1MFTA 2DT5A 3FXDA 5DYMA 1OKRA 2H94A 4MN4C 5A2QZ 2F5CA 5DUIA 3QP6A 4Y17A 2QENA 4U7BA 2FEZA 4LGWA 1E2XA 3K69A 1XMAA 2M5WA 2IA2A 4G9YA 1ON2A 4RS8A 3D5LA 5BPDA 2O8XA 4EMSA 1R1UA 3FXRA 4ZMDA 3GZ6A 2Q2EA 1O3TA 3VFZA 1KU3A 2LF7A 3BY6A 1J2XA 5LGUA 2H6CA 4WXHA 1IXCA 2Q1KA 1OVRA 3GLXA 1B4AA 2J5OA 1QO0D 4I09A 4TV7A 3HTSB 2BYVE 5HDKA 3KP6A 5E18F 1H0TA 1NVPB 1W7PA 2WAMA 1SD5A 5LBQA 2LR2A 1WSUA 3ZMTA 2FNAA 3W7XA 4A0YA 4M9ZA 2ZNZA 1XD7A 3ZQ7A 4I2OA 4ZYEA 4IF4A 3KCCA 4HQEA 3TQNA 2E1CA 1BIAA 1U8RA 2XKPA 4U0WA 1NH2B 4CXFA 1U7JA 5CVJA 2L4MA 3KEQA 3WU1B 4UUVA 2EWNA 1BC7C 3HHGA 1DEEG 4GYGA 2ADUA 3CLOA 5HS9A 3G3ZA 2IRFG 3BOQA 1LB2A 2EV6A 1Z05A 1YS7A 3T5XA 5ILSA 2GWRA 1D3YA 4I0BA 2KZIA 2IA1A 2PN6A 2EJRA 2LXCB 2ISYA 4P5OA 3F8MA 4CZZA 4HF2A 3JSOA 1ZG1A 4MTDA 4ZYGA 5LGNA 4ENNA 4KFCA 3KZYA 2XAJA 1J59A 2YPRA 5H6RA 1S7OA 3GEZA 4P9FA 2PMUA 1G3YA 1T98A 1OYWA 2P6TA 3QWOC 3Q9SA 1EH8A 4M6XA 1P6RA 5HVQC 4Q48A 2HQRA 3V7RA 3I4PA 1JMBA 3QU3A 1RIOH 3KETA 4L5IA 4ZH4F 2EFWA 3IRQA 3M8FA 4L5JA 2A5YB 3CJNA 2QQBA 3NQOA 4BHPA 3ZPLA 4LFUA 1R58A 4KNYA 3TO6A 5TRDA 5ICGA 5LHGA 4EGZA 1IRGA 5IT9K 2STTA 2HGCA 2X4HA 2MH9A 1ZAOA 4GO1A 4LJZF 2XIGA 2G7UA 4NPEA 1LP1A 4FT8A 1ZG3A 3IKTA 1SMTA 5BMZA 3E3VA 2M5AA 2L4AA 3ZMDA 4EJTA 3S2WA 3SZPA 4P96A 1STZA 2FMYA 4A2UA 4DQ2A 3KZZA 2DPDA 2FBIA 4IPAA 5J6XA 1KU9A 2W25A 1T2KA 1FX7A 3LSTA 4LMYA 4CICA 2JPCA 2KJBA 1IN6A 4YIIA 2MD5A 2MLGA 2R3SA 1FOKA 3TGNA 4GGGA 5H20A 4P55A 4AIHA 4OIQF 4GYIA 5D8KB 3HUGA 1O3SA 2DFIA 3T1BA 1XGSA 5AONA 1ZLKA 2FXAA 4HA8A 3W6KB 2ZJ2A 1W4MA 5DCFA 2YSRA 1XMKA 4L0ZB 5F6FA 3VODA 2IP2A 2ZKZA 1UFMA 2H27A 3SFZA 3PFIA 1U3EM 1G6NA 1LEAA 3GFJA 3ECOA 2K02A 2DTRA 4HQMA 1ZRDA 4HKZH 4G7OF 1YO5C 1TNSA 2K7LA 2FBHA 2F2EA 3FZVA 2PJPA 1YLFA 4WX9A 2YX4A 5E8IA 3FMSA 3H3ZA 4CYDA 4PZJA 1Z9CA 1ZYRF 4A6DA 1XN7A 1O3RA 4RGRA 3HTUA 4U0VA 2PEXA 3ZN1A 2AS5F 4A0ZA 2VN2A 4UXNA 2ZMEB 3VEPA 1IF1A 1BI3A 4IOIH 2ZCWA 1XDSA 3DFGA 1IN4A 4IXAA 3JAMK 3HRMA 1YFHA 3IWZA 5CLSA 3MFKA 2G9WA 3CUQC 3CUQA 4EM1A 2IVMA 2EB7A 2MH2A 2QRXA 4M72A 1I1GA 4NB5A 3O3KA 3EETA 1JM0A 3RKYA 3E5UA 1OVVA 3V7CA 1ON1A 1QNTA 5L3FA 3QOPA 1DPRA 5D5UB 4A6EA 1B9NA 4QWQA 4KN4X 1KYZA 1HBXG 1L3LA 3RTRA 1EDIA 3HOTA 2OZ6A 4ZZDA 3KP7A 3P7NA 1V3FA 3U2RA 2FMLA 1Z6TA 2QVOA 3GXOA 1LJ9A 3BP8A 3L2CA 1FBSA 4WWIA 1Z91A 4KIGA 3D0SA 4KDPA 5D6EA 1G4DA 3C1DA 3R4KA 1IUYA 1FC3A 1R5GA 1ZG5A 2LNBA 4FX0A 1PP7U 1Z7UA 4ESBA 1SD4A 1BM9A 2CWEA 1ULYA 5DUKA 1PDNC 2GXGA 1MDMA 5HS8A 5E8GA 2FBKA 1ZGAA 1H0MA 1ZN2A 3BJOA 2TDXA 1WWXA 4NHJA 3FMRA 4IHTA 4ENMA 3WTVC 4K3AA 1BI1A 3BZ6A 5DCMB 2LXBA 2BBYA 4CPGA 1DP7P 2K4BA 4HF0A 1BI2A 1NHAA 3J81K 3ABUA 5DD4A 3Q5FA 3J7AO 3O2PE 2MC3A 3GO5A 1ZLJA 4HAMA 3V8LA 4BHCA 4U7DA 3TO7A 3NRVA 5BOXA 1A04A 2K86A 1YS6A 5K5OA 2SPZA 2Z33A 5D4SA 2ZXJA 1MJBA 1SD7A 2FU4A 2P4WA 5K5QA 2RN7A 1RZ4A 2UXXA 4I0AA 3RYPA 3PQKA 2V79A 1Q1HA 2CW0F 4KMUX 1U6GA 5CBOA 1P92A 1P2FA 2ISZA 2D1VA 5DDGA 4WXDA 1R22A 4A0XA 4BH9A 3ELKA 3QP5A 1YW7A 2M87A 2GA1A 4KA4A 4UVCA 1U5TB 3MQ0A 5GW7A 2ESHA 4M6YA 2V6CA 4N9HA 4E70A 2QQ9A 3FWEA 4L9VA 2HDCA 3GVAA 4S05A 3JTHA 4LB6B 4EJUA 2YR2A 2D2WA 2P7VB 3K2ZA 3Q9VA 5HDGA 1JHFA 5FLXK 5ERIA 5DJUB 3DPLC 2VT3A 4I7HA 1RM1C 1FNNA 2CSOA 4WCGA 3BJ6A 2V1UA 1LQ1A 2CO5A 4M74A 3R60A 4BHBA 2M30A 1IAWA 3F23A 3W7UA 3RYRA 2YU3A 1KQ9A 3RPQA 2HQNA 1SS1A 1OYYA 2A6EF 2XASA 1IXSB 1EH6A 1BBYA 1LEBA 1J9IA 2G7HA 5A2QK 5EFWB 2RDPA 5CVIA 1JE8A 3FM3A 3ML6A 5D5VB 4HLYA 1MD0A 2C6YA 3SZTA 1YW8A 3WTTC 2OQGA 1HSTA 3HSFA 4LK0F 2E7XA 3PQJA 2ELHA 1TW3A 4LK1F 2HS5A 3N4MA 4LB5A 4K2EA 3WTWC 4RB3C 1UHMA 2XAQA 4BQAA 3JTGA 1PUEE 2Y48A 1RNLA 4G8XA 3SHFA 2NNYA 1D8JA 2GA2A 4Y13A 2XROA 1O7FA 3F72A 2O03A 4L18B 4BAYA 1SFXA 3EQLF 4A12A 3ZDMA 5CVVA 1FP1D 2YX7A 5ICCA 3ZMZA 4KN7X 1FY7A 4MEYF 4MEXF 1Q2NA 1RI7A 2DW4A 4Y15A 4PCQA 2XAGA 1Y0UA 3I58A 3L7WA 5E1WA 2F5EA 3GWZA 4XBFA 4ZYDA 1LNWA 5FD6A 3F8CA 1U78A 3SQNA 2W85A 4OIRF 5CJ9A 1KYWA 1J7KA 1FYMA 1U2WA 3RKXA 2K3RA 2RV8A 3RJPA 3BPVA 1OMIA 3FXUA 4GOFA 5CVUA 5E20A 3BROA 5L3BA 5FGMA 3CDHA 3I64A 2NYXA 3ROUA 4EM2A 2D45A 2EFNA 3DKWA 4MQ9F 2W24A 3T8TA 1F9NA 1F4KA 1NVOA 1USSA 1FP2A 2PFBA 3GW2A 2WTEA 3CUOA 4G94A 4OIPF 2OA4A 4ETSA 5LRSA 1TQPA 1USTA 5L3GA 4JK1X 3EUHA 2VC0A 2B89A 1HW5A 2BGCA 3I5UA 2B0LA 3SXYA 4ASNA 4WWCA 1TW2A 4I01A 2Q0OA 3BWGA 3N97A 5FB2A 2HOEA 4XSZF 5LEJA 3HSRA 1W5TA 4R79A 3S1KA 4KIBA 2F5FA 4HV6A 3ECHA 2VT2A 2HYFA 3I53A 1BJAA 2WWYA 5E17F 1K78A 4CHUA 4MTEA 1HSJA 2I8DA 4LD5A 1EV7A 2W57A 2M8EA 1SFUA 1QGPA 4LLGF 2XKOA
chains in the Genus database with same CATH superfamily
3QPHA 1UB9A 1U97A 3TDZC 2QEXP 2X9DA 1HDPA 3V4GA 3ZN0A 5TISZ 1H89C 1FFTB 1WB8A 4ANJA 2W6IG 2R7DA 2Z5UA 2K27A 1VQNV 1CF7A 1YHQI 1JT6A 1JCCA 3T4DA 2M2EA 3G1LA 1NH2D 3KX2A 1EDJA 1S7EA 2R7TA 1B1BA 1N8RQ 2YXHA 1HKSA 4PD4F 4UVAA 1AP6A 3M7MX 5CA3A 1JKPC 2CGPA 1LE8B 5F64A 1YJNP 5DD8A 2CPSA 2AXTZ 3CWBE 3DU5A 1E3HA 3ABMH 1K9MQ 3RK3D 2Z0AA 1NTKD 3STZC 2HXOA 1IN5A 2QWQB 4YFKF 3LW5J 2ACJA 2OPTA 1NR1A 2ZE5A 3HB9A 2ZT9B 4BIUA 4DV5B 1GW4A 1TWCJ 3AECC 1PUFA 2H7HA 4PK4A 2L0KA 2VXZA 2FD5A 4DR2B 4D6TJ 4QLCU 1HNXO 1K73Q 2RQ6A 2IZ1A 2UV1A 2FQ3A 3OYCA 4BYYA 3K06A 4I76A 1F1ZA 3OUSA 3RYFB 1LFBA 1DU6A 2EIMH 4P9OA 3GTOJ 4EATA 4E7KA 4DZOA 1KKDA 4M3LA 2KFDA 2IPQX 4HX8A 2QM4A 1DQUA 1N0JA 4DYCA 3JAWB 1ETYA 1IRFA 2FNPA 1Q6IA 1IFDA 4JOMA 2KXPB 3ONQA 5CBFA 1Y66A 4PJ0C 5AW7B 2DMNA 5CA0A 2VPRA 3OIQA 2OTLV 4NXNB 1W0UA 2CUGA 1ZR4A 2IW5A 4E7ZA 4UB6Z 1L4AB 1I0HA 4DUZB 4TV8B 3NWTA 4JPRA 2IJLA 1TC3C 1ONVA 2FX0A 3KKYA 1NTZE 3Q5RA 3CXCU 4P9UA 2IS1A 3G71I 3CC4I 4DV0B 4ESFA 1PGQA 2MD0A 3DXRA 3A0BH 4CO8A 2XAFA 1OLTA 3FB6C 2Y75A 3JC22 1XBLA 4GCVA 3X2QB 1KQSU 3OYKA 5KLVG 1OCRC 1IK7A 3BAAA 2ZVOB 1EH7A 3E6DA 4RM3A 2X51A 2QEXI 1PIXA 1WQ2A 4PFPA 1ZRTE 1NU1H 1OPCA 3PM1A 5F0CA 2ZFCA 4ON0A 2W90A 3HB3B 1ZH5A 3MKYB 4EVIA 1VQ7V 4AI8A 4A3GJ 2Y0IA 2BCCH 2B5UA 2KRHA 2M5AB 1SFCD 1L0LH 3T8RA 5AIQA 1ZGJA 4YFNF 5AVTB 3K4CA 1IBLB 5BU5A 3GTJJ 2CUZA 5AW6B 2HQ5A 1WKMA 1YJNI 1IK9A 2KSEA 1E5WA 2JP3A 3RZDJ 1LTTC 1H2GA 2K9LA 3BA9A 2OCHA 1BI0A 3I55V 3FBIB 1O3QA 1YE9A 1P84E 2XPWA 2E75D 3LFKA 4IQ4A 1W2BU 2E19A 3F8BA 2EFPA 2ICWG 1JGGA 3N4XA 4IRHA 4D7MA 1L0NK 2JA8J 2AXLA 1XPXA 4DV6B 3L71G 5KAIC 3I59A 4GYCB 3M0DC 4WF9V 2LY9A 2HFHA 1LTJA 1DX7A 3HOSA 4AQYO 1MJ9A 1SETA 4LP8A 2K9JB 4YFXF 1EDKA 4ZI7B 1KILC 2VKHA 1Y47A 3B5NC 4BBRJ 2RNJA 2QVAA 3TW7A 4WFAV 4RQEA 2XPUA 1IDYA 5IYBO 2Q67A 3CCSV 2L9NA 1W0TA 5B1AB 3FX3A 3NFQA 3HOVJ 3HOWJ 3L72G 1Z21A 1FWZA 3K79A 1FBQA 4LNUA 1QGKB 1HUCA 1JXSA 1QEXA 1Y67A 4HV5A 2CH7A 3BCCE 3SEQA 3GF7A 3BVOA 2YIUB 5FLXZ 2YMYA 2XZRA 1S5LC 4C3HJ 3FYIB 3CX5E 4JV5B 5LOVA 3F7VC 3O8ZA 1NTMG 1O57A 5M5XJ 3K03A 2EILC 4N9IA 2N1TD 3LAJA 3UT5A 2YS9A 3SDBA 4XLFA 1PKXA 1VARA 2M4GA 1I6XA 5B3SC 2R7SA 2EQRA 4RMNA 3E1RA 2KDZA 1ETOA 1DF4A 1AA0A 3W68A 1MUUA 4KITB 1YCIA 2IJJA 4UCRA 2A61A 4FHTA 4HBLA 4UV8A 5LMNB 4EJVA 2CV2A 1TAEA 3QPTA 5JWPA 2L5GB 2LKSA 3M3YJ 4G7HF 2CJJA 1WLEA 5FO5A 2OIEA 4XSXF 1SKVA 3GFIA 3W7WA 3OEHG 3U59A 4EM0B 3QPLA 4CYCA 3EHBB 1BE3J 4A3LJ 1I5ZA 3M7GA 4U3FJ 4IL6C 2ODMA 2LYCA 1FDIA 2ZMEA 4EJWA 3ZHVA 4F6RB 2D2CD 2HVRA 1WP7A 5KCMA 2IU0A 1J1EC 5B66H 2VS0A 3RL0g 2ZD9A 1YRNA 3RKWA 1JY3O 1SQXG 1NWQA 2GXBA 1KB9D 3J81N 5FRMA 4DW1A 2ZE6A 1XMXA 1QA6A 1YITV 3LDDA 3BATA 1NI8A 2BE5F 2CE4A 4HX7A 3S3WA 3GTGJ 2A06H 5JLWA 2OD5A 2YSUB 3DF8A 4AVPA 4B47A 1Q86Q 2OQRA 3STLC 4H0LC 3T1CA 3HE4B 3ZMVA 3E86A 1DH3A 3WG9A 3F8FA 4KJZA 2P1JA 2G3AA 1QHGA 2OC6A 4XQFA 2NVYJ 2VQCA 2CTWA 3LA2A 2A3SA 2WT7A 2P5LC 2ELJA 4FZ1A 1GM7A 3AG3B 1LFPA 1OX3A 3K7AJ 1VQPP 4MTOA 2UXBO 1A5JA 1VPCA 4KICA 3K57A 1THZA 3RPUD 1SC7A 4J00A 5F1RA 3VMXA 4KHPB 5CA1A 2KOGA 5IT9Z 4MVSA 1UMQA 2DOAA 2DA3A 2ATKC 2IT0A 5AVZB 2KZGA 2GUZA 2DQLA 1QLEB 2FKWB 1LWUC 4LF5B 2FF4A 3A0BE 1N7SA 1M8OB 4F93B 1G8MA 3HPLC 2XGCA 3A0RA 5BS6A 5FLXN 2M1BA 2ECCA 4G7ZF 1Z6RA 1JTXA 4MLOA 2Q9IA 2Y2ZA 2DQ0A 1QU7A 1AJPA 2STWA 1NU1E 4MVZA 4OPHA 4D6TD 3SWFA 5IT3A 3MKWB 2VB6A 4B7EA 1X3UA 3R0JA 2R7FA 1ZUQA 1GU5A 2DYSB 2V4DA 2BCCE 4QPJA 2HI3A 5LL6Y 2B9ZA 1V5GA 1L0LE 3IC7A 5B1OA 3I56P 2LLKA 1XI1A 3F6OA 1TA8A 4BW9A 5KNLA 2JA2A 3ZX6A 2ZNIA 1RY3A 1JGSA 3OE7G 2QKSA 3CC2I 1V5FA 1HBWA 2X7RB 4BE2A 3S9OA 1RP3B 1BC8C 1KB9F 3ABLH 3A2AA 2HHHO 3HUSC 2R5DA 4O4JB 1NTZJ 3THOA 1U5TA 4LIUA 2JS3A 2P58A 1IFJA 4DR6O 1QRYA 1H9TA 1OR7A 2M0BA 2O61A 1QVFO 3VQVA 3U0ZA 3HRSA 3BQYA 3KPHA 3B40A 4I98B 1NTZK 3Q0UA 3RIRA 4Z2YA 3FXKA 2ZB9A 3JRHA 1YVWA 4Y33A 4JAUA 1ZKGA 3MKLA 4IX7A 4PA6A 4QE7A 2XDJA 4IOCF 1JUPA 3O9OA 3FWLA 1S4XA 4A69C 1KECA 2ELKA 1G3SA 1NK3P 2PJRA 1HNWO 2JA7J 1MMGA 4PUSA 4DR5B 2MW2B 2HOTA 1ZK8A 3OMAB 2M7BA 1H88C 4U0YA 1C0WA 3G9RA 3QYBA 1MGTA 1YQ3C 3QRFF 2J59M 4J41A 4RAIA 2L5QA 1SANA 1VQPI 2A68F 5D8LB 1NKZB 2O0YA 2XGXA 3DWLE 4HZ3A 3S3OA 1NGMB 3H5RA 1URQA 1M57B 1OXZA 3HRTA 2C2AA 5GTHH 2Q6QA 1FE6A 3OV8A 2EFQA 2Z99A 1CXZB 1VQ9V 3RYIB 1KQGB 3I5CA 4B86A 2GXAA 2ZT9D 3OEEG 2WMMA 2QE7H 1TUEB 1AB3A 3AEFC 5H2FH 1WRJA 2L7FP 4YIOA 2OWOA 2PP6A 4RLQA 1I08A 3LSIA 1YXBA 3M1CA 4ZNCA 4PDVA 4L0YB 1X1DA 2VJ5A 4A5MA 1LUWA 1J5YA 1ODDA 4GDOA 2RQQA 2YXYA 4RAFA 4EV0A 2WZ7A 5J4VA 1Z7LA 2A45I 3P9CA 3I56I 3T1YB 1FPQA 3IF4A 3VYRB 1K34A 5B66E 5FD5A 2HPCA 3MN2A 3EXAA 4O2AB 3K58A 3MD0A 3PL8A 1BN5A 3A0HC 5AW0B 3TNUA 3C2HA 4UB6C 1B72A 1FBUA 1JVMA 3HKDB 2P7CB 1SVFA 2CK3H 1DPUA 4OU0A 5L3DA 4DR4O 1P4XA 1JHHA 2A06E 2DFFA 4P30A 2QBYB 5B1BH 1W2BO 5DM6F 1FS0G 3E5XA 3C18A 1IXBA 2NXNB 1FT9A 3CRCA 2Q4PA 3GFMA 1K4DC 1YOVB 4RM2A 1GVJA 3HGYA 1L4AD 2ADPA 2Y4TA 2DN9A 2UU9O 2F4MB 4XNFA 2VKVA 3VOEA 5E3MA 2P8TA 3NEUA 3S3XA 4KMFA 4H33A 2YI9A 1TQMA 1R6KA 2HG5D 2OTLP 2AGAA 4JYCA 3CCJP 2I10A 2E1NA 3A01A 2H6BA 4J7KA 1K4TA 1OW6A 2K5CA 2JUGA 2RCVA 4XL9A 1ENHA 2E34A 4JZ2A 1JA8A 1ZARA 1ZSPA 1TUBA 2M3BA 4KJMA 1BE3D 3CZ6A 1VQMV 5EYRA 1X2MA 2GV9A 2EIJC 3FXDA 5DYMA 2H94A 4U3FD 4Y17A 2B7EA 4YELA 1E2XA 1W5CC 5EJCA 4YJ3B 1EN4A 1XMAA 2M5WA 1OIPA 1ON2A 4I55B 3D5LA 1GTWA 5BPDA 4X20A 5KJ7D 4DRXA 4A3BJ 3FXRA 2Q2EA 3I9V2 1TWAJ 1T2KD 1M1EB 1YQ4C 1KU3A 3JATB 4X1YB 5J40A 1VQ7P 3ZHRA 5LGUA 3OGIB 2H6CA 1Q81W 2KB1A 2CQ7A 2A3QA 1S0VA 1NYHA 3IJ4A 2Q1KA 4GFBA 1Z5VA 1BA5A 3GLXA 3CI9A 1B4AA 1OCOH 2ITDC 1IURA 1FAVA 2BYVE 3KP6A 1H0TA 3JARA 3SFEC 2ZJSE 3PIPF 4ZTJA 4GZRB 2NPSA 2E76C 1WA8A 3RYHA 4QPQA 1SA0A 3I55P 3HG9A 4M9ZA 2JS5A 3JR9A 4H44D 4HQEA 2E1CA 3G1OA 1OCRB 4U0WA 4O9BA 4IKFA 5CVJA 2L4MA 2EWNA 4EDFA 3DKYA 4DOZA 3HHGA 5BY1A 3JSLA 1HNXB 2IX7C 4PA3A 2DA1A 3T5XA 2K37A 1XG1A 2M7WA 4K8ZA 4QGPA 4UB8C 1FZAA 1FZFA 2QJ1A 1H2KA 5F1JA 3BTCA 3F8MA 1VQKV 3B6AA 1XEQA 4W80A 4BS9A 1S72V 2YPRA 2BCCJ 3H1LH 3CCSP 2KK7A 1S7OA 4WY4C 5J1RA 1WVRA 5JH7B 2W6JG 3H32A 1NU1K 1KKCA 1T98A 2EIKC 3ZQFA 4L8JA 2PI4A 4M6XA 1NJIQ 2ZDIC 1Y39A 4JQ0D 2HQRA 1UIIA 4C7RA 2XF6A 4LIVA 1X3ZB 4O2BA 1YSCA 1JTHB 4L5JA 3IUOA 4FLWA 3ZXSA 2QQBA 4KNYA 3CLQA 2OTLI 3CCJI 3CSXA 3DCFA 5LHGA 5CCGA 4EGZA 1KILB 1ZAOA 3B5NB 5FKLA 5EYPB 1FMVA 2G7UA 4BR6A 4MFEA 4FIPC 4PA4A 3HXLA 2ZJQF 2Y69C 5JCOA 5GTHE 4CA0A 5BMZA 1JO5A 2ZSIB 4BUPA 3PUBA 3SZPA 3H1CA 4A2UA 1RF0A 3BTLA 3KZZA 5DS9A 1X8YA 5J6XA 2OYOA 1H8AC 3K5MA 3H01A 5H2FE 2YKPA 3B8NA 2JPCA 2EPFA 4YIIA 1M1KW 2HVKC 1FOKA 4NYKA 2FFDC 2R5YB 4LWSA 5H20A 4CCLA 4BACA 3HUGA 3FK6A 4BE0A 1VQ7I 2EILB 1ZRTD 1WT6A 4XLHA 4FZ0A 4MIMA 1ZLKA 2F1MA 1GL2C 2ZJ2A 5B3SB 2DMPA 2KLVA 2C9NY 4YXWH 2ZIOA 2YSRA 4GDFA 1Z56A 2JJ2G 2NR5A 4QPKA 2ZKZA 1UFMA 4F91B 3ETQA 1U3EM 2OQQA 3OM3B 1G6NA 3FXOA 2DXIA 2KPMA 3ECOA 3HTKA 1H38A 3K5BA 4FFKA 1IC2A 3L73H 5LXTB 1ZRDA 3I55I 1SQBJ 1YITP 2JUCA 3N27A 4WBAA 4E7HA 3ABKH 2H8RA 1DF5A 1HJBA 1JY3P 3S3MA 4PZJA 4CCNA 4AQYB 3M9BA 3KZIZ 1O3RA 2JWTA 1N78A 3HTUA 2D5VA 2PEXA 5BMVA 1TWGJ 2HZDA 4UXNA 3N2KA 2XC7A 2CW8A 4RESB 4MVMA 2ZCWA 3H1HH 1H2LA 4B44A 1Q7YW 4AHCA 2DYRC 1RQVA 1IN4A 3I5DA 1J1EB 5JJJB 1I94O 2E42A 2PI5A 4GIFA 1XC5A 3MFKA 4XIDA 2Y31A 1QVGU 1F36A 3CUQA 1KD1Q 2MH2A 2QRXA 3CCSI 1OWAA 2NZ2A 2DCEA 1CPYA 1OVVA 1QNTA 1A02J 1POGA 3SJAC 4DK0A 1B9NA 2EINC 1U0JA 2MC4A 1Y4MA 1KYZA 2MG4A 3TP0A 1SQQH 1MZEA 4L74A 4ZZDA 5IY5C 3QF7A 5FL7G 2F48A 4G6TB 1M5IA 5IP9J 4H0LB 3D36C 1WJFA 3V2RA 4KIGA 5DEDA 4QE9A 1PP9H 1TVKB 1D0ZA 2HPIA 2QGUA 4KDPA 2V7QG 2JJLA 3IFXA 1OZ0A 4C46A 1FC3A 4DV4B 1FAFA 1IFNA 3F7YC 2A05A 3QVNA 1N8RW 1Y9BA 1E3PA 1Z7UA 3TCUA 4ESBA 3MIWA 4FE4A 2ADQB 1ULYA 2OCCH 1MDMA 1M56C 5HS8A 3L2UA 2FBKA 4BEHB 4QSHA 3G2BA 5JVDA 3J7AU 4OXSA 4ENMA 1BCCH 1KBHA 4U3JA 4K3AA 3C9IA 1ETKA 3ICXA 4AVZA 5DCMB 4D7NA 1DP7P 2K4BA 1PFIA 4MVUA 3DEWA 4N21A 1WB7A 1LWUB 2NLJC 2QWNB 3E2EA 1IFPA 4HF0A 3RBZA 1BI2A 5E3LA 4ABZA 3MTUE 4HG2A 5DD4A 5E1AC 1MNEA 3OR6C 3JRDA 4C3JJ 4DBQA 1MG1A 3GWOA 4J11A 2HYNA 3OUFA 2SPZA 2Z33A 5IP6A 3MKZA 2RN7A 4LF7O 2FXOA 2BTQB 4HPQA 3KHUA 3RYPA 3L70J 3PSFA 4JYYA 1X19A 1RKWA 2QM8A 1SP4A 2BEZF 1YITI 2ZR2A 3ASOC 2Z5IA 5LP6C 2Q68A 1PGJA 3H1LE 3U1CA 3GF3A 4ZHQA 4WXDA 1NO4A 1P7JA 3LDCA 1SQVD 1YW7A 2M87A 3HUSB 2GA1A 1A6QA 3S2DJ 3M4OJ 3KEYA 1M57D 1FXKC 4M6YA 3BCCG 1IUFA 5FPOA 1FZCB 2BY3A 5BNGA 2R7XA 4E70A 2UXBB 2HDCA 3GVAA 5FPRA 2D2WA 4A3IJ 3K2ZA 4DGWB 4JI3B 2WA3A 5IJ9A 1FNNA 2CSOA 2V1UA 4IYIA 4BHBA 3HKEB 2M30A 5JQGB 2JGDB 3ZCOA 2YU3A 3RPQA 1X58A 2MGQA 2EZPA 2ZSHB 3BABA 1Z3XA 1SS1A 2A6EF 4NUBA 1USEA 2QA4P 1IXSB 1BBYA 1J9IA 3RCOA 3JASB 2G7HA 5CVIA 5IYDO 2R7ZJ 2Y4UA 2BVLA 2W82A 3K4KA 4W7ZA 2R5ZA 1M1JC 1YW8A 5APXA 1BR4A 2QSGX 3N2GA 3VPRA 3WTWC 3MMYB 3ZRVA 3VDXA 2XAQA 4X65O 5EIBC 3FXMA 1MA1A 3MVPA 3UNGC 2JO1A 1JCHA 4BQAA 3JTGA 1PUEE 4HNVA 5K7FA 1O7FA 3QG5A 4WBNA 4L18B 3EQ2A 5AW1B 3BPZA 5EBWC 3EQLF 5C8YB 1L8DA 5CVVA 2IJIA 5KLVH 1FP1D 3AG2C 2BCCD 5ICCA 2BSKA 2IH1C 2W27A 2JQ7A 4MEYF 4MEXF 2HHHB 2O01J 2DW4A 2LC2A 4PCQA 4Y15A 3L73E 1LT9C 3L7WA 4U7NA 1RF1A 1OCCC 5HFMA 1LNWA 3LSQA 1T6AA 2W85A 1U2WA 2K3RA 4CS3A 4GOFA 2KYVA 2KIQA 3BROA 5FGMA 3HE5B 4DUYO 4MQ9F 2DOSA 2Z5HA 3D3QA 2PFBA 3TMOA 2WLIA 2FY8A 5KAFH 3H1HE 3CUOA 3HKCB 1OHHG 2DWEC 2A79B 3CB2A 1W2EA 2Q6AA 3ZRWB 4HSTA 1K92A 2VQHA 1KV4A 2KSDA 1RR7A 1TQPA 4LFAO 2VC0A 3RT3C 3L71H 1HNWB 2OYIA 1X59A 2WPRA 2RH0A 3I5UA 5J2UB 3B8EB 2B0LA 3SXYA 4ASNA 1XL6A 2RMZA 1TW2A 1D7MA 4CC6A 1AJYA 3BWGA 1SQQE 5FB2A 1JY2O 1K8AW 2QJKC 1AA7A 2GOXB 3S14J 1K97A 1RE3A 3HSRA 1VQMP 4LCUC 2E5TA 4KIBA 3VN0A 1PP9E 2VT2A 3L72H 2HYFA 3I53A 5LYJA 1XDCA 3IFMA 5IWAB 1HSJA 2CS3A 3Q2YA 2DJNA 2M0CA 2M8EA 1QGPA 4LLGF 3H3UA 5JFRA 1Z3YA 2E43A 1PZQA 1GZLA 5GTIZ 1IW7F 1G1XB 2HODB 3MEXA 1UHSA 3VTPC 2LBFB 2QA4I 3WU2C 4XFJA 1OCZH 2WQYC 2ME6A 3OYIA 1SQBD 1NTMH 4L9JA 1L0LG 2KP8A 1QL2A 1DLBA 5IYZA 3A7OA 1XTGB 1BCCE 2MLKA 2I5UA 2L6LA 2R7WA 5M1BA 1MJAA 1YJWV 1QX8A 2AEJA 3LA7A 2EIJB 2WSFH 2P10A 3H0DA 2K4JA 2JJ7A 2FXPA 3RVZA 1URFA 1A35A 4HF1A 4LG0A 3EFGA 4RAYA 2DK5A 1IRZA 5CVRA 2QG4A 3L00A 3KP2A 2N8GA 1G3WA 3BRCA 1NH4A 4OVNF 2DDAA 3U1AA 3ZRXA 4IZZA 5EEGA 2GAUA 4OH8B 4C7NA 3ZMUA 3DPTA 2QR4A 1KYOD 3EUKL 2E2JJ 2COMA 2JRTA 4RUFA 3O8HA 1G1JA 4O4IB 4XRMA 2QKAA 1Q86W 1T0FA 3OTOB 1ZREA 3FF5A 4DR4B 2RC4A 3JREA 4OWFA 2HVSA 4IRIA 1IBKB 3KFWX 2AQEA 2ZYDA 1EJ9A 2L01A 2VXDA 1KMIZ 5JI6A 3QOEA 2E76B 2UUBO 1FC2C 3V7SA 2R3CA 1KILD 2UU9B 1DDNA 1WFXA 5KX5A 4FFBA 3B5ND 1SQXH 2JTVA 4ASVA 4JPZB 2NRGA 3G1MA 2FXMA 2Q1ZB 4RA2A 3L37A 1APLC 1PPJD 1R00A 1QHTA 4D6TG 1RUNA 2XB0X 4L9NA 1YTZT 1NS1A 2DPUA 3CJHB 4XICA 4R7CA 1IX9A 2OBPA 2J5PA 4DV1B 3HGGA 1FBMA 2E5LO 4WY4B 4PV1C 1EC5A 2BY2A 3JRCA 1VQMI 4XRSA 2EIKB 2ZNJA 5CBNA 1MMDA 2PI0A 3JAKA 5APTA 4B09A 4YRVA 1PVEA 5FFZA 5J47A 5IJ0B 5KHGA 1FEXA 4RO2A 3A03A 4MSWC 4WFHA 1DD4A 2E1OA 2LG4A 2E3CA 4RAZA 3KZIC 4B8XA 2A7WA 3RDIA 4EJOA 5DM6V 5APQA 3TO9A 3L70D 3DP7A 4RQFA 3GUDA 2ID6A 3BVHA 3VWBA 3WTSC 2LJ2A 5KLVE 1JJ6C 2Y69B 2WPQA 4KT5C 4GKGA 3BR3A 2Y0PA 3P3NA 2KKOA 4FM0A 1YIOA 1SQPJ 2COBA 4JP0A 1W5SA 4MHGA 1KYOF 1A02F 3WMM0 1YIJP 5E79Z 3MP7B 1V55H 2X0LA 1WHUA 3W2WA 3GX4X 1GV5A 2BHZA 3E6BA 1JJ2U 1YJ9V 3GMAA 4E6KG 4IIJA 2GBOA 2M4KA 1SQPK 4PGGA 3L2VA 1R3KC 5TISH 2HKXA 2FFDB 4Q6GA 3E22B 3EUAA 1K3EA 2V1DA 4W97A 2Z2SB 1USDA 1REPC 2RREA 1X1CA 1X0TA 1GW3A 3C7JA 1LTJC 1HWYA 3K0GA 3WHBA 5KAFE 1GL2B 2AHQA 2HU9A 3E5QA 3E8HA 4XR6A 2JGUA 2BASA 4H0LD 2I1KA 4LF9B 1D5AA 1S72I 4GLXA 1S5JA 1GUUA 4M71A 2EBIA 1LT1A 3L71E 2AXTH 1I5YA 4MFDA 4TV9B 3C2BA 4LLLA 2VPLA 4JBZA 5B5EH 4BQNA 2VASA 2XT9A 2QUFA 2P6JA 2M8RA 3JRBA 4XONA 1FYLA 1AI4A 2AHZA 5K7ZA 4DW6A 4PD4I 4WK8F 2DAOA 1EQ7A 3L73J 3COAC 3JALA 4X1IB 5FRNA 4FLTA 3T1HO 3L72E 3H35A 1ZGWA 1JT0A 5KK1A 2CTRA 4A5UB 1BHAA 3K1NA 1NKNA 3WTYC 1QCEA 4JTCB 2DYRB 1BR2A 1VDFA 1MBEA 2QWOB 3E8FA 4TT3H 3CC4V 2B9BA 5C4XJ 3AE4C 2W0XA 4DV0O 1FZPB 3GB7C 4ASUG 2KI7B 1NTME 2EINB 3PSIA 4O4HA 2ZKOA 1R73A 1PJRA 2A6HF 5IY5B 2ZNYA 2OF7A 4G2KA 1MSEC 4IRGA 3HZJA 1FTTA 2XUBA 4AU7A 4PDRA 1SZXA 3TKYA 3RGUA 3P9IA 5D5XB 1N75A 4LF8B 5GAHJ 3FISA 1OV9A 2DMXA 4MVQA 1OW7A 3EPZA 1R49A 2JIZG 4OWRB 4E7SA 4DOJA 3H1KJ 3AG1C 4UB6H 1N73A 2CGOA 1YJNV 2ZMEC 4TSFG 2YKQA 1IBLO 2Z1DA 2XF5A 3HEFA 2VODA 5E1XA 1DGWY 1IZ1A 1M56B 1EZJA 1SQQK 2D1HA 4BJTA 5AW4B 5D5PA 1YIJI 4PA9A 1QLNA 5FKOA 1G8XA 3U10A 3ZHTA 2GTAA 3JW4A 2NNNA 3LSJA 1Q43A 1LDDA 2E7WA 2RNGA 1FFXB 2VL8A 4A3EJ 5AG2A 2AW9A 1WRGA 1AR1B 3CMAV 2K9SA 4DV6O 2EULA 3ABVC 1RKTA 2VE9A 2NNUA 3CXHI 1SQXE 4PHZA 2KIUA 1R4MB 2OYHA 1XGNA 1SAXA 4IVNA 1S29A 2XF7A 3GHGA 4DV3O 1BE3G 5IOZA 5C93A 4U3FG 1ETWA 4PA7A 4OINF 2D3OW 1FOWA 3BDDA 4FMTA 4JI6O 1GAXA 2VQLA 2HVQA 3AE7C 3V2NA 3KG2A 1Y74A 2LY1A 3RI4A 1WJZA 2QQ8A 1Y8QB 4DR1O 4RO0A 1DEBA 1PNLA 1VQ4V 4RLFA 1J5EO 3GYHX 4KISA 1I50J 3BT9A 3ASOB 3I71A 2R44A 1IV8A 3UQ8A 5DV5A 3IKVA 5LP6B 3V8JA 1YTZI 5CB4B 4IHJA 1XGMA 5CBGA 3BFRA 2KG7A 2P06A 5HFLA 1N34O 4JV5O 1D1AA 3S17J 3HKBB 1AILA 2QE7G 1BR1A 1N7SC 3MZWB 5EDNA 3OYDA 1ORKA 1FXKB 1K61A 3C90A 4HZFA 2EZOA 2WLHA 2IGMA 2X6CA 1NOHA 2LGWA 1IN8A 2DA4A 3SZGA 4ZDOA 2UZKA 5C39A 4OMZA 3AG4C 1XCVA 1JQ0A 4O5VA 5LMNO 5A2QN 3WTXC 4M73A 3HOZJ 1PGOA 1IV6A 2L02A 2HQAA 2M0MA 3P8CE 4PJ0Z 2P7JA 3ASNC 2HZTA 1EXIA 1TT0A 3HC7A 2BY0A 2GLOA 5K5RA 4PDMA 3CRAA 5L3EA 2HFEC 2Y0SA 2ITAA 2VJIA 3JSNA 1M1JB 3WGHA 2PQ8A 1YX5A 4IOAF 3ESWB 4BIOA 2JSCA 3GTKJ 4NPFX 5J2TB 4GODA 4H44C 2HTJA 4A3MJ 5TISE 1R36A 2IS2A 1U5TC 3L4FA 4FE7A 2QKLB 1QZYA 4XLNF 1R6NA 4LF7B 2W8ZA 1W59A 1DTOA 3PO2J 1OR7C 4R8HA 1PV0A 2GIZA 4IHSA 3IRRA 4PI2A 4NQWA 4DR7O 5EBMC 3K4LA 3PHLA 3IL2A 2DBBA 2L9RA 3OIPA 4Q5SF 3AG2B 3K5LA 3AKZA 5GTIC 4HYOA 1P9QC 2VBZA 2AXTE 3KIOA 1WI9A 4ENKA 1ZLZA 2YIBA 4HNUA 5KLVJ 4CGZA 1LT9B 1OCCB 1IO2A 5B5EE 4HNAA 3OOPA 3L09A 2MBFA 4P1WA 1VF6A 4CBCA 1CI6B 5M3FJ 1UJWB 4LBEC 3CCQV 1RUOA 2WLJA 1BMFG 1ROPA 3JYCA 2CFOA 4BQOA 2V9VA 1BIBA 3L35A 5KLVK 4U7OA 2QTSA 3MHHC 2KMUA 1XOUA 2W6JH 2HLDG 4I9QA 3JCZA 4I0XB 2PX9A 2E71A 4DV7B 1N36O 1JY2P 3F8NA 1SQPD 3G73A 1J95A 3CC7V 1URQC 3BR2A 3IN6A 1FZEA 4J9YB 2DQ3A 3M9AA 1P4RA 2MKVA 3SWYA 3JD4A 3WTZA 5KAIZ 1VQ8V 2OV7A 1UELB 3CD6V 4X8AA 3NTNA 3MZHA 2NVTJ 1IDZA 2GZWA 1B3QA 5GONA 5BPIA 3E8GA 3PNYA 1ZRFA 2QJKB 1IFIA 3L71J 3H1JH 4X65B 3W2AA 3SWKA 3B4SA 2RVCA 2EV0A 2PBIA 2XAUA 4PD4H 3W67A 2WV1A 1OVUA 1IN7A 2JSPA 4GX2A 5ICFA 3SPIA 3PIOF 2N74A 3J80Z 3KEOA 1SS3A 4HDUA 4UB6E 3HBLA 2IJHA 3FM5A 3D5SC 2A07F 1R4NB 2DE0X 3RVYA 2E76D 1TU3F 2IBDA 1CF7B 5HLGA 1BT8A 1TGOA 2ZYGA 3BR5A 2Y0CA 3KCYA 4ZJZA 2EFOA 9ANTA 2XRNA 1BOAA 4MTXA 4OAZA 2HOSA 1V54C 2VBXA 3K4BA 4HDVA 1G2HA 1A31A 3L73D 4YJ2A 3FXEA 2WSCJ 5J8CA 3BA8A 1YTYA 2E36A 4DUYB 3DQVC 3L74J 2KUBA 2K88A 2G0EA 1F7YA 1JI8A 1Q6UA 3RBXA 2EA4A 1GHCA 2ZXWH 1E0EA 1AFOA 3E83A 2ZJRF 3HRNA 3V2QA 4FPPA 1U7MA 2VWJA 4BE1A 3H1ID 2P90A 3PH0A 2ZO4A 1MNMC 2QZ8A 1NTMK 1FMWA 1X9VA 4LFAB 2VJJA 1PUFB 3MCZA 4C9YA 1P4WA 1FS0E 5J4YA 1L2PA 1LVAA 2ZXXA 4B3MO 3K3WA 1FXHA 1B6AA 4IL6Z 1CSBA 1GRJA 2WLNA 1W5CE 2HR3A 1UCRA 4XDLA 1HGVA 2PAJA 2H09A 3B2EE 3CRMA 1PD3A 1S9HA 2NVQJ 5H6QA 2BW3A 2FE3A 2P22C 4MN4C 1OKRA 2HDDA 5DUIA 3QP6A 3H1KD 2QENA 2H3OA 1BZKA 4U7BA 5FKMA 3F5TA 3UKGA 1KB9I 2X6XA 2WAFA 2Z16A 3L1PA 5C4JJ 5CA0B 3H5NA 4M3FA 3FB8C 2O8XA 3GZ6A 3FKIJ 3BY6A 3UO3A 1J2XA 1LUJB 1IXCA 2V7QH 3BR0A 4X6AJ 1HJ0A 2KNCA 2J5OA 1NTKH 1SQXK 1QO0D 2ZE7A 3RFRA 3QYFA 4I09A 4TV7A 2BOLA 1I39A 4NC7A 5HDKA 1AP5A 2EZKA 4PV1B 2F43G 3DEEA 1KFMA 1GLNA 4AILC 1NVPB 1W7PA 1JMMA 1I5XA 3DXRB 2NPSC 1GL2D 3C3TA 1YJ9P 1BGYD 2MK3A 4PJJA 1XD7A 3ZQ7A 4NVPA 4X64O 3I56V 3BR6A 4IF4A 1SQVG 3TQNA 1F51A 3ABMC 4Z2WA 1BIAA 1U8RA 4GT1A 3KEQA 4UUVA 1S2EA 3T1YO 1MMNA 3CYOA 1DEEG 5EGOA 1WZ2A 3J80N 3BOQA 1LB2A 2EV6A 4ZDLA 2AZ2A 2GWRA 3H1HG 2V9PA 1D3YA 3M91A 1SFOJ 4I0BA 5GTHZ 2E74C 3LNMB 2A45G 4P5OA 2WA0A 2I1JA 4LOCA 2Y9ZA 2UUBB 5LGNA 2XAJA 1J59A 1FJGO 5H6RA 4X62O 1TP4A 4P9FA 4BXFA 1OYWA 2O7OA 2P6TA 5D5QA 3QWOC 3Q9SA 4D5CA 2BOBC 5AVUB 3I4PA 1JMBA 2E5ZA 3KETA 4L5IA 4ZH4F 1HR0O 3M8FA 1LTJB 3VP8A 1XNQO 4BHPA 3ZPLA 4LFUA 4IFFA 1T08B 3IAS2 3OS1A 1N7LA 3TO6A 5CCGC 5ICGA 1KFNA 2MJZA 1PNMA 1IRGA 2Y30A 2MH9A 1WJAA 3WG7H 3CDLA 3H25A 1US6A 4BWAA 4NPEA 5JCOC 3PFYA 1LP1A 1HDJA 4FT8A 1SMTA 3E3VA 3L2QA 4A7PA 3S1MJ 4MW3A 4EJTA 3S2WA 1LUVA 4JYAO 1RF0C 5APUA 4XKWA 4LNUB 1AU7A 1BCCG 1KONA 1SF9A 2WY8Q 3PLNA 2CH7B 2W25A 2LD5A 3H1JE 3RQ4A 4DCKA 1D0XA 2PY5A 2DMQA 5FNVA 1M56D 3CXHD 3GVMA 4J42A 3A0BC 5J1YA 2W83C 4MT8A 4PD4E 1KQLA 5E3NA 2BTQA 3D6YA 3GMEA 5LOVB 1T5EA 1XS9A 4AIHA 5D8KB 4QIWF 3VP9A 3UT5B 2M7AA 1I3AA 4N78E 2ZC2A 2FXAA 3BCBA 2FYUJ 4EFEA 1ETQA 4RKUJ 2IP2A 2Q9LA 1V5EA 1BOBA 1NZ6A 2K1EA 1PL0A 1YJ9I 2DTRA 4C2MJ 1FZCA 2UXCO 1X1PA 1YBKA 4HQMA 5KUKA 1T95A 2FYUK 5GAEJ 3HPGA 1RH5B 3CMAP 4PELA 4XMYA 1MBHA 2K7LA 4BGDA 3OYEA 1YLFA 1GM8A 2YX4A 4CYCB 2Q5UA 4J10A 5E8IA 3H3ZA 1AKHA 4UFZA 1QNMA 2HVJC 4RGRA 4CSWA 4YY3O 4Y99C 2ZMEB 1IF1A 3CJQB 2CTQA 3VBBA 1XDSA 2LY2A 4Z1MG 4IXAA 2CUFA 5BXZA 3HRMA 1YRNB 2ETNA 3HD7A 5AW5B 2JN6A 2R7QA 3CUQC 1WPXA 2IVMA 1Z0XA 1AJQA 1VQ4P 4NB5A 3O3KA 3RKYA 3OW2U 4JAAA 5L3FA 2R72A 3UIAA 3QOPA 1JY3N 1DPRA 3APQA 4A6EA 1SQBG 3NWSA 1HBXG 3S32A 5KMGA 1BQ0A 3FD9A 3T1HB 3CCJV 3WFVA 3KP7A 3A0HZ 3U2RA 1MBKA 2QVOA 1LJ9A 1FBSA 3CJTB 2QJYC 4FM2A 3D0SA 1YZBA 5D6EA 2R9RB 4Y3OA 3CXHF 2CDYA 4H4KC 2K40A 4AUWA 1R9TJ 2EZIA 4XKCA 3V2PA 1JFFA 1BM9A 1MMAA 4PJLA 2XSDC 1TT5B 2CWEA 5CA1B 3UCSC 3RK3E 5EIBD 1NTKE 4C30A 3LSMA 1WWXA 2GTSA 3L75J 3K08A 5K1XA 3L74D 2NOJB 1P7IA 1BI1A 1FD9A 2GUZB 3RQIA 2LXBA 3LUTB 1N7SB 2JVHA 2JRMA 2QWRB 2ITCC 4ZKIA 2K3PA 1VQ6P 1NHAA 4BDZA 2KZVA 3ETEA 3J81K 3ABUA 1VQ5P 2VKEA 3ZIAG 1N2DC 2MC3A 3S8PA 4AM3A 3V8LA 4BHCA 3TO7A 3NRVA 1KB9H 2C9LY 1YYCA 1X3WB 1NH3A 1L0NJ 3GTLJ 1E1RG 2W6BA 3AG4B 1H8EG 1Q3EA 2ZXJA 1MFZA 5K5QA 4MVRA 4DK1A 2WITA 1R5LA 3PQKA 4YHHO 5B66C 1PPJG 1Q1HA 4KMUX 4YIPA 3ASNB 1N33O 1XHZA 2KS1A 1P2FA 1BSMA 4LH6A 1KTMA 2H8WA 1Y1VJ 2QCOA 3CMAI 2KRCA 2ISZA 4DV3B 1ZR2A 3UR3C 3G4SV 4BH9A 2LO1A 4KA4A 4H44B 3AE2C 3CMEP 4MS2A 3CCQP 1U5TB 2ESHA 1FZGA 1S1CX 4JI6B 1SESA 1MZ9A 3TK1A 4DR1B 4JX4A 3JTHA 1JTYA 1J5EB 1V9PA 1H8HG 2WPDG 5FLXK 1VQ4I 5DJUB 3DPLC 2VT3A 1RM1C 1E79H 1AVMA 1LQ1A 1AV1A 3CC7P 1XQ8A 3LW5H 3L70G 3W7UA 4BRYB 3RYRA 2PYLA 1KQ9A 4ZDPA 4B3SO 2HQNA 1G4YB 3S2HJ 1ERDA 3QYEA 1N34B 1VQ8P 5BVZA 1LR1A 5IPAA 2XASA 3CS5A 3CD6P 1LEBA 1K8AQ 2PJRB 4UB8Z 4RWUA 4D6TH 3KDPB 4DV4O 5D5VB 2C6YA 1AI5A 3DC5A 2OQGA 4Y4RA 4LK0F 2E7XA 3PQJA 2ELHA 4LK1F 1ZL8A 1JEKA 3HDDA 3AK2A 1IDSA 4CH7A 2O5RA 4XOPA 4JI5O 2NNYA 4B08A 3F72A 4JAVA 1MV8A 1URQB 1QL1A 1B8IA 4LGDE 4FM1A 1EBOA 4Y28J 3ZMZA 4NKGB 2KISA 1DU0A 1I3QJ 3OS0A 5IDJA 2J5UA 2XHBA 1YI2V 5BZBA 3U21A 2MYSA 3B77A 1VQ6I 2XAGA 1YDXA 4FK5C 1RF1C 1VQ5I 4XBFA 3CCEP 5FD6A 3F8CA 4OIRF 3RL0C 5CJ9A 3ABLC 3OR7C 1FYMA 3ZRGA 3RJPA 5E20A 3CDHA 4DR7B 5JVGF 4X1EA 2VUMJ 3A8TA 2O9LA 1F4KA 1F9NA 1HOMA 3OD4A 4GX5A 5AVRB 1FOSF 2YEVA 4N4OB 4LLHA 4OIPF 1S9KD 2HPCB 1S5LX 2WSEH 4PJNA 3LOCA 4QPOA 5L3GA 3TNUB 2OYIC 2B89A 1B72B 2N05A 4XDKA 1V54B 3PTZA 3CWBJ 4R4MA 4WWCA 3BRTB 3CCQI 4XSZF 1RE3C 5EZHA 2F4IA 4JI3O 2Q3EA 2H1LA 2BVMA 2YS8A 1N36B 1UPGA 2WWYA 5E17F 1K78A 4CHUA 4JI4B 5F0HA 4B3XA 1TL8A 2NOGA 2FYUD 4PV1D 1EV7A 2TRTA 3IP4B 3CC7I 1Y1WJ 2XKOA 5B1NA 3WTUC 1NVPD 2QLZA 3DLLF 1QR9A 1RE4A 1OW8A 1VQ8I 2VE8A 1P84I 3A01B 3CD6I 2IBZD 3FAVA 2Q0AA 4ZIBA 5HOOA 5GTHC 6PAXA 2Q7HA 3FXJA 1MOFA 4ITVA 4JBAA 1D5NA 4UVBA 2XSJC 2JPBA 3A2FA 3ZQCA 3GTQJ 1XNRB 1TUBB 3KXDA 4RGXA 2WPSA 2KRFA 2ME0A 5H2FC 1DD3A 4DYQA 2O1JA 2L7KA 4YEJA 4AYBN 3SJMA 4XDJA 3ULQB 1KB9E 4X20B 3FDYA 1GO3F 5IP7J 2Q2EB 5JJNB 2OGUA 2ZR3A 3VQWA 1HQCA 2M45A 4L5EA 1S76D 3Q5SA 1XUQA 5E3OA 3MD2A 2OUMA 2XVCA 3TETA 3SYCA 1XHXA 1VZ0A 5HNHA 3OAAG 1Y76A 5D5WB 4U7JA 1Q90D 3E0JB 4I4TA 1XMOO 1DUXC 1T0FC 3APOA 3T4ZA 2X6WA 1HDDC 1IVSA 3E6MA 1R6TA 3CCEI 1H0TB 3JARB 1B9MA 3F6VA 3CX5I 2NPSB 1WA8B 3RYHB 1SA0B 3K9TA 1Q5OA 2VQGA 4O4LA 1RSOA 3CCVV 1EFRG 4D7SA 3BEHA 4AWXB 2B87A 1HC8A 4JX5A 3ABMB 5B1BC 5LA6A 3V4WA 1PP8F 3VSKA 3OMYA 3FX7A 3JAMZ 1Y8RB 3X2QH 4BDYA 3Q4HB 1CGPA 1R5HA 2BE3A 4B3MB 1K83J 2LR8A 4M3EA 4CDGA 2KIFA 2V1XA 2E74B 1BE3H 3K4JA 2O3JA 4DYRA 4TT3G 3S3NA 3L75D 3RYCA 5E1ZB 4U3FH 3WHCA 2P2UA 2KIMA 1P4AA 4JI2O 3TDKA 3VMZA 1VTNC 4OX9O 3H32B 1WJEA 4D6TE 5IWAO 3IAYA 4HJGH 4K8XA 3IH2A 1Q82Q 3M99B 1MBJA 1XX5A 2JDIG 1L0ND 3R61A 4O2BB 2QA4V 5IT9N 4MNUA 3U9GA 1VF7A 2WAEA 3CF5F 1PL5A 1SVOA 2HEOA 4HB1A 3V8KA 3ASNH 2IGOA 5LGTA 4A3CJ 2QKCA 2CPBA 4NTYA 5BU8B 1QZZA 5EG0A 2JT1A 4F92B 2XAHA 3AL0C 1EZVD 2VC1A 1FYJA 3CRQA 4J19A 2MFZA 3K0LA 3TJTA 1KQSO 3U1KA 1U57A 3K4NA 4R6ZA 2CW7A 2EJ7A 2UUCB 2P5VA 1GN2A 1XTAA 5TJJA 3RGBA 1OCOC 2LOOA 3BCCJ 2PFXA 5L3CA 2QWPB 4HOBA 2Y9YA 4X64B 2UWMA 5B1AH 4IFDK 4K35A 4II3A 1KQFB 1IO4A 2CAZC 3ZHUA 2Q69A 1D1CA 1SC5B 1K6OA 4BY7J 1UIXA 4X1KA 3BC8A 4LWSB 3JRIA 5GTIH 2ZJPF 4CZCA 3CCUV 3HUGB 4XKBA 3DTUB 4JF3A 1H2SB 2KQRA 3H9VA 4EB6A 1FJLA 2P7TC 3OR2C 3OYJA 4GKKO 3WU0A 1F5TA 5J8FA 3OTOO 2HNHA 3KCXA 4V2FA 3ISPA 3E89A 3GZ5A 1IBKO 4B43A 2P5KA 3BHPA 1FPOA 1P49A 3V6IA 1FJGB 1SQPG 2A9HA 4X62B 4LFBO 3DC6A 3HTKB 3FWNA 3QWLA 1X22A 1FOYA 3TOBA 3OYHA 1MNGA 4ZTFA 1KP3A 2ZE8A 2GHYA 1AHDP 1D8KA 3FHZA 2YC0A 2WV0A 4EYYQ 3BLYA 3OMNB 2KLUA 1VQOP 1HR0B 4YXDC 1I6HJ 4UCVA 1XNQB 3CO6C 3JAMN 5BMVB 1N86A 3T97A 1GKFA 3DXJF 3N2KB 3CCMV 4Y99B 1QBZA 3DPUA 2UWJE 2NS0A 4F7ZA 1AOYA 3P9KA 2V6EA 1BL8A 4HYEA 4DV1O 3E97A 2R92J 1TQIA 4K0KO 3RZOJ 1N7SD 3CUQB 2IFMA 3E6CC 3HSEA 4E7IA 4JYAB 5TJHA 2ARHA 2M9HA 3TL4X 3LMMA 3I3LA 3W3CA 2WTYA 2M8GX 3REOA 3OMIB 5HDNA 4P9PA 2W00A 3HYIA 4O3MA 2FL4A 4DNCA 2NS7A 5FFXA 2OJED 3P7KA 1E1QG 4ZOLA 3QO5A 2QJYB 2CYYA 2N9BA 2LMDA 2GOMA 2RKLA 1NHLA 3B6CA 1SFCA 3L36A 2O3FA 3U1DA 5LLQA 3OYFA 2HFED 1N73C 3DTIA 2HDWA 3OAKA 3V5BA 5F04A 4N0BA 5JHUA 3CF2A 4ZZLA 1GN6A 1MDMB 4I50A 5GPCA 3H1IG 4DO2A 2ETHA 3UM7A 2DFEA 3AG3H 1X4TA 3CWBD 2HYGD 3H0GJ 3CO7C 2AQFA 1KU2A 1MIJA 2UXCB 3MAJA 5JVDB 4XM3A 4EGYA 4BJ6C 4U3JB 2BHYA 1O9GA 1KN7A 1AR5A 5EF6A 4C2TA 1T3JA 1BW6A 5AVQB 2JVGA 1GK6A 4OPAA 1K7AA 2E5NA 4NR1A 3WU2Z 4HX4A 5CBHA 3LQQA 4II2A 1NU1J 3ABKC 5DN6G 4YY3B 3G4SP 2OYHC 4PSXA 3GHGC 1UHWA 3M1EA 3AEGC 2W84A 2KJCA 1WPBA 3TGUG 2FJ1A 5IE9A 3H1KG 3CE2A 4LF9O 1GK4A 1RC9A 1XMQB 3AEIA 1O7LA 1L0LJ 3R0AA 3GFLA 3O6QA 4I02A 1JOYA 5E79H 2IH3C 3HPHA 2HJFC 1BE3E 2AXCA 2XNXA 2DYSH 2IFNA 4U3FE 1G3TA 4KHXA 2PMZN 4M9XA 3JCUH 2DDBA 2YU9J 3F0CA 1L0LK 5DJTB 3CP2A 4L76A 4ZHQB 1FLIA 2YUSA 2KKWA 1VQOI 1S77D 2F4VO 2ESNA 1UG0A 3F5HA 2VRZA 3ZRSA 1B59A 4UV9A 1KYOI 1URQD 2N1TA 2F95B 5CPRB 3PP5A 3H1JG 2QGNA 3UKMA 2WAQA 4OGQC 1BGYG 1KZUB 3D1NI 4NXMO 1SERA 4S04A 1ZP0C 3KYCB 3OOUA 2M3EA 1XGOA 1D0YA 5HNFA 1NTZD 1UAAA 4V19K 2BXYA 1SFKA 5IJ9B 1RM1B 5K1YA 4D0PA 4G12A 1GDTA 4RDUA 3C2GA 2JJ1G 4E7LA 2DWDC 2H88C 4KIFA 2OCCC 1J09A 3AK1A 5K5GB 4C7UA 1COWG 1Y6IA 4CUGA 5M5WJ 4JYKA 2JWDA 1TLHB 2MA3A 2RNBA 3LDEA 4J7ZA 5B5EZ 1S3JA 1YI2P 1K04A 4LF8O 1FZBA 3RK2C 2FQ4A 1MH3A 2VQEO 2R5ZB 2DLLA 3N2GB 1QVFU 3FYEB 2OCEA 3KYDB 2F5DA 4IHVA 1VFCA 1ZRCA 2IS6A 1YIJV 4WFFA 5GTIE 4ENJA 1EDLA 2W6AA 2H1KA 3LA3A 3PNTA 1AI6A 2L3DA 4HNTA 1SQGA 3TDUC 4WBNB 4YHHB 2JR8A 3ZEDA 1N33B 1J1DC 2QWWA 2JMWA 1SQVH 3BRVB 2FB5A 4XN3A 1P84D 3VYSB 2BSKB 3J7ZI 2RAEA 4A3DJ 4DV2O 2DOEA 3ZQHA 4ASWA 5DECA 3P30A 1HW1A 3IWFA 2WAQN 2E1MC 1G2CA 1S8NA 1RF1B 4J7JA 1M90W 3G4SI 3KP5A 4ZYHA 1D5VA 1VF6C 2QTOA 4ESJA 3BJAA 3RL0B 4TOIA 2A69F 3ABLB 4CS4A 4B3TO 2A45H 2DT7B 1ZN5A 2KZJA 3R6SA 2G8YA 3OYAA 1CEZA 2TCTA 2LTPA 2IPPA 1KQ0A 4KYWA 3RPUA 3G6EV 2WLIB 1EF4A 2FKXA 2X85A 1XSDA 2XKMA 1JX9A 4B3SB 2F93B 1J75A 3SYAA 1YYVA 3BCCD 1GN4A 1LPQA 4DR3O 1YTFB 2OYIB 2WWWA 2ZYAA 1ZELA 3QQAA 1XDUA 3DGEA 1T6SA 4CS2A 4H0EA 3E35A 1NTKG 3CX5D 2XHKA 3O65A 4JTAB 5CHXA 4A5NA 5LHIA 3II6A 3MGNA 3QU6A 4EQQA 2B9SA 2FYNC 4XRFA 2WSEJ 1JMKC 1I27A 3H5AA 3ZMSA 2ZAEB 2PMHA 3HM5A 3LSSA 4CCMA 3FKJA 3QPSA 3D3IA 3IHUA 1JY2N 4JI5B 5H9CA 4ICGA 1AQ5A 1ZTRA 4I9WA 3A02A 5LYJB 2DQRA 4D5FA 2HPMA 5AIPA 2YXRB 1PYVA 2K1AA 2VKDA 3BCAA 5KLIC 3J81Z 3LAPA 1EN6A 4KL1A 2NAZA 2NPSD 4KFMA 2W4SA 5EEHA 3VYUB 5LMUB 2B88A 1WJDA 4DT0A 4EKWA 2YKOA 3IAOA 4XOTA 1YI2I 4YIFA 5IYZB 3H9GA 2Q8KA 1HKQA 1P84F 3W7TA 3KLOA 3OSFA 3AEBC 4EOTA 3F9KA 5EZYA 3HRUA 2VBWA 2OTKE 1RPRA 3LWFA 4TUYA 2LFBA 2E74D 4CCKA 3CCVP 1P7GA 4LG0B 2H8PD 1V4RA 4LLNA 2IA0A 2DI3A 3PJRA 4O6JA 4XORA 3CTAA 5ITZA 4X0GA 1T3UA 2OAZA 4PJ0H 2KT0A 1CP9A 4NC6A 4PDKA 4C7NB 5KAFC 2EK5A 4RB0A 3HOXJ 5E79E 3L9FA 5FLVA 2ZBKA 3DKXA 3FGAD 1LJ2A 3ERED 2LP7A 3JCUE 3PJSK 1GXQA 2LH9A 3ZQIA 5AW3B 4Z1MH 5LEKA 5D4RA 3RN4A 4AQRD 2OARA 2KQXA 5CCGD 2UXDO 4JI7B 4B3RO 3ITKA 5KX5B 4FFBB 2LFRA 3L74G 3BG6A 1OYIA 5B1BB 3CX5F 3MDSA 1LE8A 4DV7O 3HKZA 2HYJA 1AQTA 2F5CA 1OCRH 3JRAA 4BIZA 3QH9A 4PDLA 1SQBH 3D71A 3U11A 3S1RJ 2R93J 3N7NA 4G9YA 4RS8A 2R9IA 1VF5C 4U87A 1ORQC 3FIWA 4ZMDA 3RWRD 1O3TA 3VFZA 1KC8W 2LF7A 3A4CA 3CC2P 3BG5A 1WAZA 1OVRA 1OCZC 5JHFA 3LSUA 4HEA2 2RN0A 2MW8A 3HTSB 1RETA 1NU1D 2LGQA 3CMMA 4BL0B 5E18F 4JI8B 3JAKB 1GH6A 5LBQA 1WSUA 1Z5WA 3KYLA 3RYFA 5IOYA 3JD0A 1KYOH 1IZNB 3BR1A 2ZNZA 2L7ZA 4I2OA 1VMGA 3IH4A 4ZYEA 3DTKA 1L0LD 4CXFA 1U7JA 3WU1B 5TGTA 3JAWA 3RSNA 3G80A 1BC7C 3CCUP 2ADUA 5KAIH 4EI2A 3G3ZA 3J7AY 3AL0B 4A3JJ 1XMOB 3N05A 1YS7A 4LITA 1OISA 5H5NA 2CQNA 3PNVA 1BL0A 4AUXA 2IS4A 4N23A 2ZIMA 5KKZC 1SQVE 5AW9B 2ZM6B 5JJEB 2IA1A 3DTEA 1KZHA 3TXSA 2EJRA 2LXCB 3MUDA 4HF2A 3JSOA 1OCOB 3FB5C 4MTDA 4ZYGA 4KFCA 3KZYA 3HKZN 1L4AA 3BQZA 3P8MC 4TV8A 4RAGA 2AEFA 4IIJB 3CCVI 2NVXJ 2PMUA 3OYBA 1G3YA 1AJNA 1PPJH 1EH8A 2QSIA 2QSFX 1W36C 3KPEA 4Q48A 4XA4A 1R6RA 3VYTB 3K5NA 2DN0A 3V7RA 3QU3A 2BTOA 4CH5A 3AFHA 1LFUP 1S5LH 4WB4A 2EFWA 3IRQA 2FYZA 3CCMP 2A5YB 2K3FA 2EILH 2V9KA 2IZ0A 2YNYA 2STTA 4JI2B 5B3SH 2XIGA 3P5JA 3I4MJ 2PYJA 4OX9B 2FUG2 3SYTA 3Q1MA 2EH3A 2CTPA 3CHXA 3IKTA 2YIAA 3ZS8C 2P4KA 2M5AA 2L4AA 1IG7A 3ZMDA 1JNMA 4P96A 2VWKA 1STZA 2FMYA 1IFMA 1D2DA 4WCEV 2FBIA 5KHHA 3L70H 5KJ7A 1G59A 4R4LA 4D9JA 1Y8AA 1G6UA 2K9NA 1T2KA 2YDEA 3LSTA 3BG9A 3JALB 2XNDG 4XN0A 2KLOA 4LMYA 4CICA 1F43A 1IN6A 2YUAA 3R65A 2MD5A 2MLGA 2R3SA 4RBOA 1OJLA 3TGNA 1JR9A 4OIQF 4GYIA 3LL7A 2ZXEB 1GN3A 4IYHA 1LTBC 3C1LA 1IBMO 2IGNA 4IL6H 2AHYA 5AONA 1NQTA 5AVXB 5F27A 1ETVA 4HA8A 4UY8I 1W0JG 3W6KB 1T33A 4JGSA 5DCFA 2PGDA 1X4OA 1XMKA 2K9JA 5F6FA 4ZI7A 1AR4A 3M9HA 5CJ0A 4O4HB 2H27A 1SVLA 1LEAA 5M3MJ 4CH6A 1N32O 2K02A 1FZCC 1HGZA 3L2WA 1V55C 4NDLA 4DIQA 3S4RA 1YO5C 3M07A 3ZGKA 1UZCA 3SPCA 4GKKB 3CCUI 2FBHA 2F2EA 3FZVA 2PJPA 4WX9A 3OR1C 5TISC 3FMSA 1Z9CA 1ZYRF 1R3JC 1L1FA 1XN7A 1N73B 3ZN1A 3A2KA 4BRYA 3QTCA 3WUUA 1QR8A 4PJ0E 4DZPA 4IOIH 4LFBB 3AEAC 4BKXA 2FYUG 3DFGA 2A06D 4H13C 2GBYA 1YFHA 3HD7C 3IWZA 5CLSA 2G9WA 3OYLA 1E79G 2EB7A 4RUEA 4M72A 3ZHQA 1I1GA 5JLXA 2AXTC 1BHBA 1DIPA 2R7UA 2IBZG 2AEMA 2VIXA 3USSA 5D5UB 4QWQA 4KN4X 3CDIA 4XLAA 4IHWA 1FIPA 2H43A 3FFQA 1L3LA 5B5EC 1EDIA 3F89A 3HOTA 2O1KA 3ABKB 5FKNA 1QVGO 3P7NA 2OYHB 4BU2A 3W2VA 2FMLA 3GXOA 3GHGB 5APYA 3BP8A 3L2CA 2H89C 2O01H 4WWIA 3CCMI 5EK0A 4EIJA 3HOUJ 1SQBE 1VQNP 4K0KB 3R4KA 1VL2A 1R5GA 2PTMA 3IAM2 2X48A 1MW7A 2RN9A 4PJMA 3ZJZA 1PP7U 1Y74B 1EA3A 1JJOA 1SD4A 3P3PA 3VOUA 2CGNA 3AEDC 1QZEA 5DUKA 3H1LJ 2GXGA 4F6RA 5APVA 2JA6J 3BJOA 2NS8A 2TDXA 4IHJB 5KA5A 3K4MA 4NHJA 4MW8A 4IHTA 1M93A 2O8KA 2KG7B 1CW5A 2Q7CA 3EWKA 1B6QA 2BBYA 4S0HB 2L2OA 3HOYJ 1BJZA 3EFFK 2VLAA 5M5YJ 1OFCX 3S1NJ 1KYOE 4OGQB 3Q5FA 3J7AO 1HTLC 3GBGA 1ZLJA 4HAMA 4N3YB 4U7DA 3OSGA 3HE4A 3AE3C 2Q8VA 5KAIE 5K5OA 3WB1A 2DMTA 5D4SA 1HP8A 2FU4A 3OFNG 2Q5ZA 4DJAA 3D8CA 3RL0D 3SSUA 2OCCB 4LFCB 1KILE 4X88A 3ZQGA 4I0AA 4B4CA 1FDOA 2JEEA 1KUQA 3WB0A 2VRSA 1U6GA 3Q3SA 2YIDA 4XKVA 5KHDA 3L75G 2WLLB 3VQYA 4LF6O 4IHYA 3RK2B 1WCMJ 2M6YA 5BR8O 3LNQA 2DMUA 1LTIC 1R22A 3QP5A 1FDMA 1PPJE 4D1QA 4UUSB 1YTFD 2V6CA 5LD2C 4XLCA 4N9HA 1L0NG 1S5LE 2QQ9A 4JI1O 4L9VA 4NQWB 4W1UA 3G6EP 3B71A 1ZX3A 4LB6B 4EJUA 2F23A 1J1DB 2YR2A 2P7VB 2VQFO 2DA6A 5ERIA 4I7HA 2HEPA 3TEDA 3BJ6A 4UUTA 3E1IA 4M74A 2GM4A 1RQUA 3R60A 1EZVG 1Q82W 4M3BA 2F4VB 1K05A 4NC8A 1Y6XA 2E1MB 3CEIA 1SQVJ 1EH6A 4HNAB 5A2QK 5EFWB 2RDPA 2B1GA 2R4GA 1JE8A 1U9OA 3AE1C 3FM3A 4NXMB 3ML6A 3L70E 4HLYA 1NAYA 4HYTB 3OIOA 3SZTA 1VQNI 1X79B 3WTTC 3HSFA 1ZAUA 3H1HJ 1TW3A 1SQVK 4IO9F 1HH0A 4K2EA 3RKQA 4RB3C 4O4JA 5CCHA 4QNHB 2IM9A 1F23A 2XPVA 2P4VA 1HCRA 1NG7A 4G8XA 3MAQA 1IGNA 4IL6E 4AIDA 2E2HJ 3NAUA 1FTZA 1D8JA 2GA2A 4ZKUA 2XROA 2JDIH 4CH4A 4JI0O 4BAYA 1SFXA 5FKKA 3ZDMA 4IHXA 4B7KA 1SQQJ 2K9QA 2VQEB 3E7KA 4R50A 3A0HH 1EN5A 3JD1A 4MTGA 5GONB 1QU3A 1RI7A 2FYNB 2CUEA 3M9QA 2F66C 1PP9J 4D7TA 2F5EA 3GWZA 4ZYDA 4CH3A 3OS2A 1U78A 3SQNA 3Q4HA 3A1YA 1J7KA 2WPVB 3K70C 2R5BA 3BPVA 1OMIA 3FXUA 5CVUA 1VF9A 3LSRA 3I64A 4LF4O 2NYXA 4KXRA 2BZTA 3ROUA 2D45A 2EFNA 5KLIB 1N77A 2W24A 3K04A 2VI6A 1USSA 1FP2A 4DV2B 3Q0VA 2LQTA 2DTZA 3A0BZ 3K6GA 2WTEA 1I7FA 4G94A 1BCCJ 2OA4A 4ETSA 4FLZA 4BXXJ 5CKTA 4Y52J 1USTA 3EUHA 4H37A 2LKXA 2PUSA 4B3TB 3V4QA 4YJ2B 2R7VA 4Q20A 2ZVNB 3RYIA 4I01A 2Q0OA 1RESA 4LG3A 3N97A 1SQPH 2GSMB 2EIJH 1W5TA 1KORA 4R79A 3S1KA 2F5FA 3G6EI 3ECHA 4BW5A 3A3YB 2MABA 1GV2A 3TP3A 4PSWA 2JA5J 2LRDA 3B09A 2CUJA 1R71A 2I8DA 4LD5A 4M3DA 4DR3B 2YO3A 1SFUA 3KYQA 2JK5C 2KSJA 2X1DA 1RE4C 1H89A 1O9HA 3A5TA 4I7ZC 4RB2C 3CWBG 2KIKA 3JSPA 1NAFA 4CC5A 4O2AA 4E7JA 2EV5A 5CJ4A 1J2JB 1QPMA 1YW9A 2OU2A 3NMDA 1W0KG 2OZUA 2BW3B 4EFBA 2EBOA 3HKDA 3HR0A 2ILMA 3WODF 3SPHA 2Y0MA 2QBYA 4YTPC 5EZGA 2ZINA 1VF5B 3H92A 5IYCO 5A9GA 3KP3A 3ZQQA 1Q6HA 1I1SA 4UNOA 5ILVA 1VQ6V 1E3OC 1BSNA 1R1TA 4QMAA 1VQ5V 1VQLV 3DV8A 3K5OA 2VONA 4UB8H 1FIAA 2A0LA 2KNCB 3HIFA 1OCZB 1NTCA 1T39A 2JEXA 1PGPA 2W48A 1MBFA 4FQGA 2YI8A 3KE2A 4YG2F 3DU6A 5HLTA 1SFEA 1W7PB 2DA7A 1XREA 1X4PA 1SD6A 1LVKA 2VOPA 3H1IH 3S1QJ 1SQBK 3W6JB 3G67A 4BNCA 5GP9A 1DP3A 1R3IC 1FSEA 2EIKH 3FK7A 1NR7A 4KUMA 2WVRA 2BXZA 2R9AA 5JR3A 4I1LA 1QLED 4TLFA 1T38A 1A6IA 3ZHSA 2ZXWC 5EGOB 2OTJV 3CJRB 4IJAA 1JPXA 2IYOA 1LDKB 2YXQB 2P81A 1A32A 4YJ3A 3H1LD 5J1UA 3G6BA 4I55A 2BOCC 1B06A 3CMEV 5KKZB 5D6FA 2DT6A 1NTZG 3J7YJ 1AVOA 3VB2A 4M9SA 3L9DA 3B8MA 3F5WC 2R7RA 3JATA 1OQYA 4X1YA 3TGUH 2P5OA 2Y69H 1GXPA 3H1KH 2UXDB 4B3RB 2QF7A 2IU3A 1GK9A 3RW0A 5C3EJ 4J80A 2WB1A 1Q8IA 3CCRV 4PI0A 3VYIA 1QVTA 3EYYA 3LSGA 5B66Z 4JI4O 1HW7A 1U8BA 3ZCCA 3IV5A 1QQIA 2GIVA 4AD9A 2ID3A 5FJ8J 1ZLLA 1TBXA 1U9NA 2WSSG 4UCTA 3CPWU 5F0FA 2Z9OA 2LFSA 2GQQA 3Q3DA 3TOAA 5LHHA 5DEQA 5CCHD 1JKQC 3SJCC 1UG2A 2MSYA 1K9MW 2CH0A 4BXLA 2OYQA 1WGXA 4WF2A 3W7SA 1XSVA 4HW0A 4F55A 4B48A 4FCYA 1BGYH 1RR8C 3DBRB 4I99C 5FLMJ 2CRGA 2K9YA 1LP1B 1XNRO 1SMYF 3J80K 5KUMA 4OAYA 3RK3C 3A0HE 2E5YA 4E2LA 4NBQA 4N6JA 1K73W 2QQAA 4MGRA 3R2PA 1VEWA 4I6MC 2FBWC 3O6BB 2FRHA 3L72J 5FNVB 1KGSA 1RRJA 1VP7A 5JH7A 2NVUB 4I6ZA 3D6ZA 3HJEA 5KVRA 2XUMA 2CQQA 1ZHFA 2E60A 4PGHA 4WFGA 3CCEV 3O8GA 3CESA 1JTHA