1S3JA

X-ray crystal structure of yuso protein from bacillus subtilis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
SADQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYLSFLTEEEMLQAAHITAKLAQAAETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords YusO protein
publication title X-ray crystal structure of YusO protein from Bacillus subtilis, a member of MarR transcriptional regulator family
rcsb
source organism Bacillus subtilis
total genus 47
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s3jA02
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1s3jA03
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1s3jA01
2DTRA 2XIGA 1WRJA 2CGPA 2ISZA 1XCBA 1BM9A 5DD8A 4HA8A 4YFKF 1F9NA 1I27A 1UFMA 2XKPA 4HQEA 2R44A 1GXQA 4MTEA 5H20A 1YW7A 5E1WA 2NNNA 1WWXA 4A0XA 1SD7A 1TNTA 1O3RA 2FNAA 1IN6A 3ZMVA 2LSOA 4P96A 1R36A 4G9YA 2OQGA 2EFPA 4G94A 4CXFA 1P4WA 1MJBA 4GOFA 4G6QA 3VEPA 3MZWB 4A2UA 3I59A 3BPVA 3WU0A 1S3JA 2FE3A 1J75A 3G73A 5D5XB 4L0YB 2LR2A 1RNLA 3P9IA 4R79A 2QQAA 4ZYEA 1SAXA 2B87A 5CBOA 3E3VA 2VBXA 4QLCU 1MDMB 1BOAA 3EDPA 3TO7A 1U5TA 3MEXA 2H6BA 2FXAA 4LMYA 3TKYA 2KIMA 4EGZA 3E6CC 3VFZA 4ESJA 3NEUA 5HDGA 2CYYA 4M9ZA 1HSTA 5JFRA 4GOEA 2NYXA 3L09A 5JR3A 4CZZA 1R7JA 1EDIA 2EV0A 4CO8A 3M9AA 3ML6A 3E97A 5E8IA 3FM3A 2JPCA 1ZG3A 3BJAA 4KNYA 2O0YA 3KP5A 2QBYA 1QZYA 3ZP5A 2M1BA 1A04A 1J2XA 3HIFA 3TO6A 3EUHA 2GZWA 3HSFA 3BPXA 2WV0A 3CTAA 1UHMA 3KP2A 4HYEA 4CHUA 2VONA 4LG0A 1OR7A 4P5OA 5F64A 1I6XA 4S05A 1ZG1A 3O2PE 4LGWA 2OD5A 1HKTA 2SPZA 3WTWC 1DPUA 5LRSA 3RI4A 1S6LA 4HOBA 4CDGA 2I8DA 4IVNA 1W5SA 4GODA 2ACJA 2KZIA 3ABTA 1DDNA 4RB3C 4KN4X 1LQ1A 4HW0A 1CF7A 2CWEA 2O6GE 4HX7A 5EEGA 1IN7A 1MD0A 4ESFA 4HLYA 2VC1A 2QYOA 1XD7A 4HAMA 5IT3A 5ILUA 1KU9A 2LF7A 5FGMA 5HS9A 2R7FA 1Z6RA 4QWQA 2P7CB 2ZBKA 1TW3A 1HW5A 3DEUA 4I01A 2Z33A 4JK1X 2D2WA 3MWMA 2RC4A 4N0BA 5DDGA 1UHWA 1MJAA 3W7XA 5EEHA 4WWIA 1F1ZA 2JPBA 3P9KA 4A12A 2ZNYA 3W6JB 3O6BB 5FFXA 3RYRA 3VODA 1K7AA 4MEXF 1BIAA 3S2WA 5E17F 1AWCA 5A2QZ 4IF4A 3WE2A 2KIUA 4EMSA 4K35A 5ICEA 3ZMSA 1KYZA 3WU1B 3RGUA 4WX9A 3SHFA 3IC7A 4WK8F 1EDLA 1UB9A 1IXCA 1U3EM 2JRTA 3WGHA 2GAUA 3JW4A 2RVCA 5CVVA 5AONA 2KRFA 1BJAA 1XN7A 1BI1A 1YIOA 1ON2A 3E6BA 1U7JA 3LFKA 5FLXK 5BQTA 2K02A 1KQ8A 1YW8A 3V8KA 3CO7C 3HHGA 2LXCB 1LVAA 4S04A 3F8NA 5LEJA 5L3CA 4F7ZA 5FB2A 1FBUA 3E5XA 2QVOA 4B8XA 1C0WA 5LGTA 5E1XA 3E5QA 2QENA 3GUDA 3ECOA 4OINF 3HTUA 4LD5A 3LWFA 3D5LA 2HTJA 4A6DA 4O6JA 4RGSA 5HLIA 2K4BA 2DAOA 2YU3A 2ESHA 5DYMA 3KZZA 1H9TA 2R7DA 3WTYC 2K3RA 3W7UA 3QP6A 4NB5A 1XGNA 3PQKA 3MHVA 2RQPA 2IT0A 5H6RA 3Q9VA 1IUYA 1B4AA 1KQ0A 3S1KA 1B9MA 2BBYA 2M0BA 2RKHA 3KP3A 1NVOA 2M5AA 2FBIA 1L0OC 2PMUA 1LJ9A 1YS6A 2A6EF 2NNYA 1MJ9A 5K5GB 3CDHA 3IWZA 1FZPB 4L9TA 4MTDA 1KU7A 4WF2A 4CGZA 4DNCA 4KFCA 1ZGAA 2Y48A 3REOA 1R1UA 3K1NA 2WMMA 1MFTA 4HLXA 2M5WA 3F6VA 4BHCA 4M6XA 4P9FA 2KI7B 1OPCA 3D0SA 3DF8A 3DP7A 1EH8A 3EYYA 3GEZA 4MEYF 4ZYHA 4BNCA 5D6FA 4E70A 2HKOA 2NS0A 2K4JA 1JMBA 2H27A 4BXLA 2DI3A 2MLKA 3T5XA 2P6TA 1HXDA 1FLIA 4M73A 3ISPA 1ZARA 4AWXB 3BJOA 1U78A 3JAMK 4HF0A 1YTYA 5CVRA 1MZBA 4BXUA 3Q5FA 1H0MA 3K2ZA 4IRHA 2OA4A 3V4GA 1FBSA 1EH6A 4P55A 3DPLC 2HGCA 1R00A 4KMUX 2PN6A 3J81K 2G9WA 3K0LA 1WQ2A 3RPQA 1NHAA 5ICGA 2F5EA 4R1HA 5FD6A 5HDKA 1FOKA 2CO5A 1TQMA 3F72A 3VOEA 4I02A 5LGUA 3SQNA 2VC0A 2M45A 1TQIA 4NQWA 3ROUA 2C6YA 4ON0A 1XMAA 4HDVA 3TOAA 4A0YA 1SD4A 3EETA 2QWWA 4K2EA 2PQ8A 2ZO4A 5ERIA 1T6SA 4Z2YA 2MC3A 2RN7A 5E20A 1QNTA 5D5UB 1LEAA 1MGTA 2G7HA 2GWRA 1IN8A 2IA1A 3NQOA 3I59B 2HEOA 1GXPA 3T1BA 2FSWA 2Q1KA 1BC8C 1ZXGA 2XVCA 2ZAEB 2FBHA 3E6DA 5E8GA 1E17A 1IXSB 5GW7A 3U2RA 4RS8A 1OYWA 4KDPA 2B87B 2VN2A 2ZJ2A 2D45A 3MFKA 3OV8A 1FNNA 4NPFX 2P5KA 4EM2A 1KU3A 1L3LA 2RV8A 4OOIA 5CVUA 1ONVA 1SFEA 2BE5F 4WWCA 4HBLA 4I0BA 1R5HA 4L5JA 1XSVA 1J9IA 2W25A 3RTRA 5BPIA 5K1YA 2J5PA 1MKMA 1O57A 3QAHA 3MZHA 5DJTB 2P8TA 3GLXA 2LKPA 3N97A 3KZYA 5FLXZ 1DP7P 2QBYB 4I2OA 3D3IA 4IHTA 3CO6C 3GFMA 4PCQA 4I09A 2BEOA 4U0WA 2F5DA 2TDXA 5L3BA 2J5OA 3KEOA 1YG2A 3E35A 2OQRA 5D4SA 4ZH4F 4EYYQ 4GXOA 4G7ZF 2PJPA 1RI7A 4ASWA 4N9HA 5KK1A 4LB5A 2FRHA 2M87A 4LG0B 2BV6A 1QO0D 4Y17A 3KETA 4M9SA 3QRFF 2M8EA 1ZYRF 3ZQ7A 4ETSA 5LRRA 4UVBA 1OKRA 1Z7UA 1SD5A 5LEKA 2G7UA 1RM1C 3E6MA 3VB2A 2GQQA 3BOQA 2VOPA 3R0AA 1IXRC 1CF7B 4RB2C 3ULQB 1U8RA 5CBNA 3F3XA 4KMFA 1KU2A 3WGIA 2B88A 4AD9A 1JHFA 3I54A 1P2FA 4UVAA 1R22A 3GX4X 3BJ6A 3L7WA 4Y15A 3PQJA 1YW9A 4P9UA 2P5VA 2DU9A 4H0EA 2RDPA 1Z05A 1PUEE 3N4MA 2DPDA 1IZ1A 3IL2A 2PI0A 2D1HA 2F2EA 3NRVA 4YFXF 4UUVA 2P90A 2XKOA 1XGSA 2L01A 1BI3A 3FX3A 3WTTC 3F8MA 3KFWX 1H9GA 3HRUA 4DQ2A 4BHBA 4HJGH 2H09A 4LLLA 1FC2C 1U6GA 4XSXF 3J7AO 2CFXA 5L3EA 1JE8A 1LB2A 1BBYA 2FOKA 3JSOA 1DUXC 1ODDA 4HKZH 2JTVA 3SFZA 1IAWA 2DQLA 2W24A 3I5UA 4OIPF 5HLHA 4MGRA 5LGNA 2JWDA 5IT9K 1KYWA 5ILSA 1Q1HA 3C18A 2XGXA 2FBKA 3H92A 1FC3A 2PBIA 4RB1A 4IJAA 4HF2A 2FF4A 2VBZA 3EQLF 4OIRF 1UCRA 1BC7C 2KIFA 1QQIA 4HX8A 4ASVA 1W4MA 2VBWA 5DUKA 3SZTA 2COMA 4FHTA 2EB7A 3JTGA 2PLYA 3JAMZ 4MNUA 1J0RA 2RKLA 2GA2A 1D3YA 1AOYA 4Q4ZF 1TTYA 3E5UA 2ZKZA 3R6SA 3FMSA 1J5YA 2HKXA 3J81Z 3M8FA 1HKQA 3GXOA 5D8KB 2V1DA 5C39A 2GXBA 1BI0A 2CG4A 5DV5A 1E2XA 3FXQA 1LDKB 4PGHA 2P58A 5CA3A 1W5TA 3DXJF 4LK0F 5JVTA 2LF8A 3DPTA 4N9IA 3R4KA 2A6HF 4HQMA 3GVAA 3ECHA 4ZZDA 4IHSA 1USTA 4O5VA 1D8JA 1IW7F 2ZNZA 3OOPA 3R0JA 1XB4A 3BWGA 4EJTA 1FPQA 1F4KA 5E18F 3I4PA 1XDSA 3J80K 2KJCA 3HRMA 3LA7A 5L3FA 2UXXA 3LQRA 3I53A 3HOTA 1PDNC 4LJZF 1BI2A 4WCGA 2HFHA 2M5AB 4NPEA 5BMZA 2OU2A 3JSPA 5J6XA 3T0YA 3KP6A 4GCVA 3HOSA 2V1UA 2VE8A 4B09A 1BN5A 2P7VB 3FMRA 4M6YA 1YTFB 1P6RA 4KT5C 1EC5A 4PZJA 2IPQX 2XROA 4XLNF 1G6NA 2E7WA 1W7PD 2AXLA 2ESNA 3I0TA 3H3UA 4EQQA 3KP7A 3LSTA 1D8KA 1WI9A 5HLGA 1I1GA 2E1NA 4RB0A 2NRAC 2MH9A 4LLNA 2XRNA 2O8XA 1P4AA 1OMIA 4AIKA 2HTSA 5F1RA 1OVRA 2B89A 3FM5A 4I0AA 1XSXA 4GGGA 1B6AA 1FBQA 4YIIA 4CYDA 4UNOA 2ZMEB 2K27A 4HV6A 4I98B 3EYIA 1SMYF 3W7WA 1HW1A 2JT1A 4BHPA 1IRGA 5E1ZB 1FYLA 2ELHA 2MA3A 3RKYA 4EJVA 4KICA 5HOOA 1I1SA 2ETHA 4ENJA 1SMTA 3P9CA 1S7OA 2JSCA 4Q48A 2UWJE 1HW2A 4UXNA 4U0YA 1EH7A 5ICFA 4L9JA 2Z9OA 2EFNA 2Z99A 4MQVA 3HUGA 2FQ3A 2HR3A 5D6EA 1Z1DA 3LA2A 2L4AA 4GYIA 2ISYA 1EV7A 3DFGA 2O03A 4AVPA 4IRIA 2W57A 3V7RA 4EVIA 1T98A 1RZ4A 2PG4A 1DPRA 4ENNA 1G4DA 2ZFWA 2DK5A 4MQ9F 2XHKA 2MH2A 4KJMA 1O3QA 1R1TA 4U88A 3L2CA 3HSEA 4LLGF 2BGCA 2E1CA 1ZLKA 2IA0A 4L0ZB 1U5TC 2MLGA 3FXRA 4K3AA 3F21A 3CUQC 5DD4A 3V7SA 2DFIA 2UWMA 1K6OA 2ZMEA 5LHHA 1ZN2A 3GF2A 3RPUA 2XUBA 3F8FA 1FT9A 5L3GA 5IT9Z 2B0LA 2DK8A 2EA4A 1K78B 3C7JA 2P6SA 3KLNA 2H94A 3JTHA 1LNWA 2X4HA 1TQPA 2IA2A 5LHIA 4UV9A 3HHHA 1WSUA 3M8EA 2K86A 4HDUA 4FX0A 2KS1B 3O3KA 1RIOH 5DCMB 4A5MA 4ENKA 2DW4A 1TLHB 2EK5A 2F5CA 2WC2A 1U2WA 5HVQC 1ZRCA 1GVJA 2W84A 3LA3A 4G7HF 3RJPA 2WAMA 2QZ8A 1G3YA 3IRRA 5K5OA 2A07F 2DT5A 2V6CA 5K5QA 1DEEG 3RDIA 2VE9A 1B1BA 2KKOA 3ZMTA 4OMZA 2P4WA 4M72A 4FX4A 1XGMA 5BS6A 3GFJA 1YO5C 1FX7A 2L4MA 3BZ6A 1LP1B 3PH0A 5JI6A 3ZN0A 2FU4A 1QPMA 3J80Z 5L3DA 2DPUA 5FD5A 1G3SA 5FO5A 1QBJA 2Y0MA 2V79A 1ZGJA 3L00A 2ZCWA 1K78A 5ED4A 3U9GA 2H6CA 2A3SA 3R60A 4GYGA 2QQBA 4HB1A 2XV4S 2MBFA 2CQKA 3C3WA 3K1MA 1ZW0A 2F5FA 4AIHA 4UHTA 4U7BA 3C1DA 3FMQA 3DKWA 4A6EA 5AIQA 5BPDA 5HS7A 3FXEA 1G3TA 1ZRFA 5DCMA 4O3MA 1H0TA 1LDDA 2X0LA 4HZFA 4BQAA 1R58A 3KLOA 1YFHA 3MAJA 3ZMZA 4LB6B 2LNBA 3I64A 1TBXA 3GFIA 1R23A 3GZ6A 1Z6TA 1RUOA 1JHHA 5LBQA 4EM0B 2GA1A 4A5NA 3F8CA 4PDKA 1ON1A 4UV8A 3QU3A 1ZH5A 5D5VB 5BOXA 1O3SA 1XDUA 4GO1A 3ZN1A 4M9XA 1F5TA 2VXZA 4EJWA 3ZMDA 1D5VA 1LP1A 1CGPA 1FYMA 3GZ5A 4G7OF 2QLZA 3ELKA 4NHJA 3SZPA 2UZKA 1JGSA 2QM3A 4LK1F 3TDUC 2WTEA 2DQRA 4XBFA 2M30A 2HYGD 3L9FA 4HF1A 4R8HA 4XSZF 3HTSB 3U1DA 3KE2A 3WODF 1Y47A 4XRFA 1HSJA 3CUQA 1QGPA 2LXBA 1YS7A 5FFZA 2Y75A 2YX7A 2BYVE 1Y0UA 2MD5A 3RKXA 4BH9A 1OYYA 4ESBA 3FHZA 4KYWA 4ASNA 2EA2A 2EFWA 2EV6A 1O7LA 5DJUB 4IRGA 2XASA 5D8LB 4PGGA 3CLOA 5EFWB 1XGOA 4YG2F 2L54A 2V1XA 4D0PA 5J8CA 5LLQA 1ZREA 1T39A 1HKSA 2OZUA 1LEBA 3GFLA 1STZA 2IJLA 3GWZA 2XAFA 1FYKA 2Z3YA 1P92A 1OVVA 1JXSA 1HQCA 2IVMA 2IP2A 1ZAOA 3BY6A 3H3ZA 5K5RA 3FXDA 2O61A 5DCFA 2VT3A 2IRFG 4RGUA 1NH2B 1IN4A 3RIRA 3HRSA 2A5YB 2P5LC 2KJBA 3IWFA 4OIOF 1T0FA 2FMLA 2EFOA 2A68F 6PAXA 1YYVA 1USSA 4MHGA 5TRDA 4EJOA 2CW0F 1MDMA 5KVRA 1O7FA 4RGRA 1IF1A 4HX4A 3DV8A 3V8LA 1QZZA 2YSRA 3W7SA 1Z91A 3W7TA 1P4XA 2KZJA 3ABUA 3IHUA 1Z9CA 1XSDA 1GHCA 2HYFA 1BDDA 4KIBA 2GIVA 5F6FA 4WXCA 4AIJA 3GO5A 3COAC 4Y13A 3PFIA 2PEXA 4TV7A 4OU0A 2VODA 3T8RA 2OTKE 3FWEA 4ZZLA 1NVPB 1I5ZA 1J7KA 1T38A 4KUMA 4NPDA 4L9NA 3QPTA 4KIFA 5ILVA 1V4RA 4YIFA 1ULYA 1WKMA 1XMKA 4CICA 3I71A 1SFXA 3FXUA 3M7GA 1VTNC 1XCVA 2FMYA 2K7LA 3IRQA 3ZPLA 3MZYA 1X3UA 4KA4A 1IRFA 3R61A 2YR2A 3KCCA 4Q47A 4HV5A 1TW2A 1R5GA 1SD6A 3KEQA 5H6QA 4XLPF 1S8NA 1ZLJA 2ADUA 1BIBA 1TNSA 2Q2EA 4KN7X 2L02A 2IW5A 1EDKA 1X0TA 2DBBA 1JM0A 3ERED 3DQVC 5CLSA 1G3WA 2RGVA 2HZTA 1SFUA 1Q2NA 2YX4A 2VBYA 1FWZA 4IOIH 2KUBA 3QP5A 3FF5A 4JBAA 4UVCA 2PMHA 2WWYA 2KIKA 4KIGA 3Q9SA 1FP2A 3CUOA 4IPAA 1U7MA 4FT8A 4BAYA 4EM1A 1T2KA 2LDUA 2XAJA 5D4RA 4EJUA 2OZ6A 1FY7A 4L5IA 5HDNA 1EDJA 2OBPA 1YQAA 4Q5SF 2OAZA 1PP8F 1OVUA 2HQNA 2HS5A 2ZXJA 4G6DA 4G8XA 3WGGA 4ZNCA 3HSRA 3K69A 3QWOC 1S7AA 1YLFA 2CSOA 4OMYA 3F22A 1O3TA 4BYYA 4WXHA 1PP7U 1K79A 3B73A 4EV0A 3ZMUA 1KA8A 5ICCA 3MCZA 2STTA 3RKWA 2UXNA 4RGXA 2JZYA 3HYIA 3K9TA 2PFBA 4U0VA 3HRTA 1KGSA 2GXGA 1S29A 2EJRA 2FA5A 5CVIA 3QOPA 2HOEA 1ZRDA 3WTVC 4LFUA 5DEQA 1BDCA 3WG9A 1OYIA 3I58A 2EV5A 2L3DA 4ENMA 1V3FA 1KQ9A 4MN4C 3WE3A 1J59A 2VT2A 3IKTA 4RAZA 3W6KB 4EGYA 1B9NA 3GYHX 1W7PB 3WTUC 2O3FA 3KP4A 1HBXG 3F8BA 3WTZA 2A69F 3TGNA 1B59A 2STWA 5TJJA 3WTSC 5J8FA 3TO9A 2QVAA 1H0TB 2RNJA 3AAFA 2QRXA 2QUFA 3LQQA 5DUIA 5CYVA 2XAQA 3G3ZA 4ZYDA 2D1VA 3BP8A 1IN5A 4YFNF 3M1EA 3B02A 4OIQF 4M74A 2NAZA 3IKVA 3BDDA 2EFQA 2XAGA 4JQFA 2AS5F 3K1PA 2QQ9A 3F23A 1LDJA 3V8JA 3GW2A 2VOOA 1FP1D 4WXDA 2DLLA 1FSEA 2Q0OA 1R1VA 2DO7A 3BROA 1REPC 1ZG5A 2XAHA 3WTXC 3LAJA 1LT1A 2FNPA 3CJNA 2YPRA 2V9VA 3P7NA 4ZYGA 5LHGA 3ZDMA 5A2QK 4U7DA 4JBZA 5CVJA 3TQNA 4CPGA 4ZMDA 3V7CA 1FSHA 2R3SA 3T8TA 4IXAA 4A0ZA 3TOBA 2E7XA 1SS1A 5HS8A 2Q8KA 3F6OA 4L9VA 2Z5UA 5CJ9A 3LAPA 1W7PA 3RYPA 1U5TB 1RUNA 3QPHA 3QU6A 3CUQB 5D5WB 2HQRA 3SXYA 2FEZA 5AIPA 4M71A 2A61A 2HDCA 3TDZC 4L18B 3MQ0A 4I7HA 2HWVA 3FZVA 4RAYA 1ZHFA 2EWNA 2W85A 5JHUA
chains in the Genus database with same CATH superfamily
2DTRA 2ITCC 2ISZA 2IBZD 2ODMA 1XCBA 1F9NA 1COWG 2QJKC 3E1IA 1MSDA 3F7VC 2W7NA 3EXAA 2Z5HA 1I27A 1UFMA 3FB7C 2R7VA 2BVLA 2TRTA 2R44A 1GXQA 4MTEA 1OCRB 4MLOA 4H37A 4U3FH 2RCVA 2CH0A 1TNTA 2AXTZ 2FNAA 5LXTB 2LSOA 2XOKG 4G9YA 2OQGA 2UUAB 1TWHJ 4NVPA 4PSWA 1P4WA 2ZYAA 2QDOA 1TC3C 5BVZA 4BQOA 3VEPA 1KD1W 2MYSA 5IYDJ 1J75A 3G73A 5LD2C 1T8ZA 1X1PA 3P32A 3HGYA 4L5EA 1FXVA 2BCCG 3P9IA 4CC5A 4FFBB 1SVMA 2VQGA 5CBOA 2E43A 3E3VA 1MDMB 3TO7A 2FL4A 1AILA 4LMYA 4G2KA 4N6JA 5CCGC 2ZM6O 3LDDA 3F5WC 4A3MJ 2CUEA 3AG4B 5HDGA 5TISZ 1JKOC 3LDEA 4M9ZA 1HSTA 5JFRA 2GOMA 3LL7A 4CH4A 2F43G 4B3SB 3L09A 4CZZA 4LR3A 3BZKA 3M9AA 5KAFH 3FM3A 4O4HB 1ZG3A 1WA8A 2O0YA 1QZYA 4DR7B 3OYBA 3LSRA 1FFTB 4B4CA 3BAAA 3HSFA 2WV0A 3ABKB 5C44J 1GMGA 2YIUC 1OR7A 2NPSC 3OYKA 3N05A 2PF4E 2JP3A 2OD5A 2Q3EA 4EB6B 3GF7A 4NXNB 4Z2WA 1NG7A 5JJNB 3Q0WA 1DPUA 4NXMB 1USEA 4GODA 3E1RA 1XUQA 1DDNA 3L2RA 4KN4X 5EEAA 4LF4B 2OYHB 1LQ1A 3SZGA 1YQ4C 1SQBE 2QWRB 1MD0A 4ESFA 2QYOA 4HAMA 4DW0A 2KKWA 1BA5A 1L0LG 2YKQA 3HRNA 1NJIQ 2RH0A 2R7FA 4QWQA 5CMUA 2P7CB 2E75C 2ZBKA 1TW3A 4E7KA 1VI0A 5C8YA 1GN6A 4JI0B 2K88A 1SQQG 4JK1X 2RC4A 4N0BA 5B3SH 1UHWA 3RK2D 5EEHA 3DLAA 3HL2A 4ZOLB 2JPBA 1IDZA 1R3IC 1PNMA 3O6BB 1FXKB 3RL0D 1BT8A 3WB0A 1BIAA 2DQ3A 3IR9A 1ETVA 2ECBA 2ZDIA 1AWCA 1PFIA 2H1LA 1N7LA 4J7ZA 5KNLA 1GM9A 3WHBA 4Q6GA 3JCUZ 5B1BC 4K35A 3GZNB 3ZMSA 3WU1B 4U7NA 3SHFA 5E79E 1UB9A 1UZCA 1Q1VA 5LMUO 1EZVI 5AONA 1X19A 4EB6A 1YJWI 1LTJC 1JFFB 1YIOA 1ON2A 3ZQCA 2N9BA 1SVLA 2A45I 4I7ZC 3CDIA 1K5SA 1SC7A 5FLXK 2OYHA 2K02A 2IJIA 3ZJZA 1OCZH 2I5UA 3DTIA 3FKJA 2HDDA 4O2AA 1JY3P 1NU1D 5L3CA 1W2BU 2HYNA 1C0WA 5AW2B 2YC0A 1FBMA 3HTUA 2H43A 3D5LA 1QA6A 4JZ2A 1OJHA 3FWNA 5FPOA 4A6DA 1H2SB 4O6JA 4RGSA 3KIOA 1HGVA 3G6EV 2K4BA 3EHBB 2DAOA 2YU3A 2ESHA 4JI3O 4OVNF 1QVFU 1FXKA 2R5YB 2YXQB 3CC7I 4XM3A 1WRGA 3H32B 5B1NA 1K4CC 3G4SP 3CMAP 3O65A 1VL2A 4DW1A 5IP6A 3HE5B 3QP6A 4MT8A 4NB5A 1N34O 2RQPA 5H6RA 1FZFA 1IUYA 3V2PA 3DLLF 1B4AA 5KTBA 3B8MA 1MMAA 3ZHSA 2OYIB 2JJ7A 2P5OA 4W4KA 5J9PC 1QNMA 2M5AA 2BOLA 4YHHB 3A4CA 2YKOA 2A6EF 2EZIA 1GDTA 1JFFA 1M5IA 3H1HD 1P49A 4WF2A 1RQVA 1T3JA 3D36A 4I4TA 4X89A 3V2RA 2WA3A 4GDFA 2WMMA 4HLXA 1Q6HA 3F6VA 5IYCJ 3K5LA 4FTHA 3JRFA 1KFNA 2X6YA 2O1KA 4P9FA 1OPCA 1YRNB 3DP7A 3L70H 1IBLB 1M7LA 3APOA 1JT0A 1H88A 2N9YB 2HKOA 1UIIA 5AVYB 5FKLA 1KZHA 2JR8A 1IBMO 1GTOA 2H27A 2JVHA 1BSMA 2ZE6A 2DI3A 3T5XA 1FLIA 1GL2B 1SFKA 4TSFG 3BCCG 2QGNA 1ZARA 3V6IA 2R5YA 3BJOA 3BR0A 1U78A 2E2HJ 3H32A 2JVGA 1PPJD 5CVRA 4E6KG 1JMMA 2K9NA 1Y74B 4BXUA 3Q5FA 1AJQA 3RVYA 4WY4A 3TXQA 3K2ZA 2JO1A 1OCOH 1OIPA 1EH6A 2LP0A 1R00A 2P2UA 4MFEA 3H1JH 2G9WA 2OYIA 1NHAA 3B8EB 4R1HA 1B3QA 1FOKA 2CO5A 4I76A 3K9AA 5LGUA 3BPZA 4IYIA 1A02J 3PTZA 4I0XB 1XMAA 5KAFC 2P67A 4HDVA 3L73G 2XHBA 2WB1N 2DFHA 2ZO4A 5KLIB 1S5LH 3HKBB 2MC3A 1U57A 2RN7A 4BE0A 1LEAA 1URQC 3TNUB 1NU1J 3NQOA 5CA1B 3ZCOA 5M3FJ 1VQLP 3H1ID 3KPHA 2HEOA 1GXPA 2FSWA 3PNTA 2XVCA 4X88A 3LOCA 1VQKP 1MOFA 1YRNA 5E8GA 1E17A 4YXWG 2K9YA 3TYYA 2VJIA 3U2RA 2Q0AA 1NTKD 2RN0A 2L7KA 4KDPA 2Y4TA 2LG4A 2B87B 3CI9A 1I94O 3OV8A 3ZR8X 4EM2A 1KU3A 1JOYA 1WMKA 2RV8A 1GL2A 5CVUA 2YO3A 2DFFA 2BE5F 4WWCA 4HBLA 3H1KH 2WADA 3I4NJ 1Y74A 2OT5A 2ZVOB 3F5HA 1YQ3C 4UB8H 1O57A 3QAHA 5DJTB 3GLXA 3N97A 5B3SC 3EWKA 1DP7P 1X59A 1TWAJ 2A06D 4IHTA 3H1HJ 3GF3A 2BEOA 2F5DA 2TDXA 3J7AU 2Q5UA 3KEOA 4I0XA 3E35A 3CYOA 2O1JA 2QSIA 1KQFB 2IDBA 1RPRA 4ASWA 2KLUA 2WPSA 3CJHB 2BV6A 3DTUB 1QO0D 2HEPA 3CC4I 4G6TB 4M9SA 1AP6A 4U87A 1R3LC 3BVOA 3TNUA 3JAWB 5CA1A 1GTWA 1ENVA 2R0QC 5GAHJ 2FBWC 1S76D 3JCZA 2EJ7A 1SD5A 2G7UA 2HHHB 1MNDA 3VB2A 3G4SV 1W36D 3CMAV 3S1QJ 2GQQA 1ORQC 3DC6A 4B7EA 1EA3A 2VOPA 3R0AA 1IXRC 5KMGA 4EIJA 1CF7B 2ELJA 1JI8A 2GBOA 3BATA 4U7JA 2QR4A 1KU2A 3K10A 2R5ZB 3SFDC 4KFMA 3L2UA 2M3AA 4MVZA 5L8RJ 1JHFA 3AG2B 2BE3A 1R22A 3K4KA 3MIWA 2I1KA 3QVNA 2DU9A 2RDPA 1L0NE 1AI6A 3ZHQA 1WI3A 1R73A 3N4MA 1WCMJ 3N7NA 2F2EA 2P90A 3VYRB 2XKOA 2R4GA 2AHZA 1HDPA 4B3MO 4HJGH 4DR7O 4XSXF 5L3EA 1VQPI 1BBYA 3FB8C 4D9JA 3M9HA 1VEWA 3RYHB 4HEA2 1RPOA 1IAWA 2W24A 2LFRA 4OIPF 2QJKB 2JWDA 1XOUA 3CJHA 1KYWA 1IV6A 4DYQA 4JX4A 1OX3A 5ILSA 1YDXA 3H1IJ 3H92A 2PBIA 3KKYA 4NXMO 1VDFA 4JOMA 4HNVA 2E1MB 1N33O 2KIFA 4HX8A 3L4FA 1L4AA 3A0BZ 4ASVA 1XG1A 2P6JA 5TISH 2COMA 4FHTA 1NTZD 4LF4O 2X85A 3M0DC 3JAMZ 2EPFA 1S5LX 3KYLA 2V26A 5AVXB 3E5UA 2ZKZA 3HB9A 3J81Z 3M8FA 3CX5I 1ETOA 2IBZG 1OV9A 3ESWB 5DV5A 1EN4A 3FXQA 4PA4A 3KZIH 1MNMC 5HFLA 4PGHA 2P58A 3DWLE 1NKDA 1W5TA 4JYAB 5GAGJ 2LF8A 4M6VA 3GVAA 3IAM2 3IFMA 4RQEA 4DR4B 2JA2A 1RHZB 4IHSA 4OGQC 2ZIMA 1D8JA 1SQVK 3R0JA 5JVGF 4LF5B 2FX0A 1ZR4A 2IX7C 3BABA 1VQKV 3I4PA 2J59M 2WPDG 3RYHA 4DT0A 2GTAA 1LE8B 2VL8A 2Q6AA 1S5HC 3J7AY 3OS1A 2WLIA 3HOTA 3IGAC 4LJZF 3MD0A 1BI2A 1PGJA 3CHXA 1N32O 4PV1C 1EBOA 1EZVE 2EIJC 3KP6A 3L72E 1PD3A 1UJ8A 2VQEB 3RFRA 2X9DA 3KDPB 1BN5A 2P7VB 1W5CC 1V55H 1Z0XA 4KT5C 4C7NB 1EC5A 3LNNA 3QO8A 2YIUB 2XROA 1HF0A 4JTCB 2XPUA 2E71A 4AQRD 2NPSB 1B06A 2XU6A 3G71P 3KP7A 3GTPJ 2KB7P 3GTQJ 4KHPO 1X2NA 5IYBJ 3BT9A 3D5SC 3CCMV 1BGYE 1S1CX 2HYJA 2QA4V 2VPLA 4IL6Z 2E34A 3H6PA 1OMIA 4Z1VA 4PJ0E 2E1OA 4I0AA 2LYCA 4A3CJ 4QJFB 4CYDA 1NR1A 2BHYA 3L71E 4MVUA 5HNFA 3HG9A 4F55A 5AVQB 2E75B 3BR6A 1E1RG 4ZDOA 2YDEA 2X6BA 1N73B 1ZQ3P 2J58A 1H8AA 1YHQP 2MA3A 5HOOA 1I1SA 1LE8A 1SMTA 1IFNA 3EFGA 4Q48A 1EH7A 1AVMA 4UB8C 2ECCA 1MZ9A 4J19A 4YHHO 2Z2SB 3HUGA 2FQ3A 1DLBA 4CUGA 1K9MW 1M1JC 2QM4A 1NTZJ 5B1BB 2RMZA 2CTQA 2O03A 4AVPA 2M9HA 4CH6A 4LF7O 1RZ4A 4LFBB 4BDZA 4MVOA 5HFMA 1Y6XA 2PG4A 3SR2C 4OAYA 4A3JJ 1LTJB 2ZFWA 3SDGA 2JEEA 2QEXV 4I7ZB 2MH2A 2HXOA 2FJ1A 2UU9O 1N78A 1KKDA 1HF9A 1IBLO 3T1CA 1XMQO 4LGDE 4DO2A 1R1TA 3FXKA 1JVMA 2PRRA 3L2CA 2E1CA 3IP4B 4M3GA 2IA0A 1U5TC 3FXRA 2LGQA 2CQQA 3F21A 2ITDC 2DCEA 1R5SA 5AW4B 3DXRA 3F8FA 2JIZG 3FYIB 2XGEA 3HZJA 2B0LA 4X1KB 2DK8A 2EA4A 2X6XA 2RDCA 3GLMA 2XUMA 4OWFA 1JO5A 4ZKIA 2H94A 1N73A 4FPPA 4JI5B 3VOPA 1LNWA 1JUNA 2Y4UA 1X1AA 4RUEA 2Y0DA 1EJ9A 1B04A 1RQUA 3O3KA 3CXHH 1UFIA 2W6JG 4ENKA 2DW4A 4FM1A 2WC2A 2W84A 1QZEA 4DK0A 3JRDA 2ETNA 1N7SC 2L5QA 2QZ8A 2WAFA 3ZHUA 1AI5A 5JQGB 3W2AA 3C2BA 1R8EA 1SQXG 2OCHA 1IRZA 3DCFA 1WB7A 4OMZA 3OUFA 2P4WA 2YXYA 1FOSF 4FX4A 3ZEDA 3CXHF 5B1AH 1IJDB 4B3TB 2JQ7A 4F3QA 5JI6A 4XDKA 5TISC 3ZN0A 3F7YC 4XN0A 2Y0MA 2X48A 1Q81W 1ZOYC 1CI6B 3L00A 3AE2C 3O6QB 1MA1A 2KT0A 1RSOB 2Y0PA 2JGUA 3LSSA 5EK0A 4JF3A 3S17J 5BMVB 1FOWA 4YJ3A 3A0HH 1ZW0A 1DU0A 3SSUA 3WMM0 4AIHA 5EBWC 3FMQA 3M91A 4HRIA 2WPQA 3FXEA 4IOAF 1G3TA 3WUTA 1TA8A 1LDDA 1AROP 1F43A 1R58A 5JH7B 4LB6B 1E79H 3I64A 3LSJA 1SQBD 3S1RJ 2LR8A 3GFIA 2BY2A 5C93A 2QM8A 2CW7A 1SQVH 4PDLA 3JRBA 4FM2A 4I50A 1D7MA 1FZCC 5JQGA 2R7QA 3PNYA 2OTJI 3OY9A 3ABMC 1ON1A 2AXTE 2D2CC 2HODB 4J9YB 2JRMA 4UV8A 4PDMA 3QG5A 5EYPB 2E35A 3VQXA 5D5VB 1O3SA 4HNAB 1XDUA 4XFJA 2BCCE 4XN3A 3MD2A 1D5VA 4L75A 1PVEA 3WU2Z 1V55C 3FBNB 2LREA 2LP7A 1URQB 1FYMA 4FZ0A 1KFMA 3GZ5A 2OYQA 4LFAO 2QLZA 1LKXA 2FKXA 4OPHA 1JGSA 2QM3A 3TDUC 1Q86Q 1ZLZA 4Y4RA 3W2WA 5CJ0A 1CI6A 5KAIH 3O6QA 1K33A 4R8HA 1RSOA 2E2IJ 3HEFA 4XSZF 3HDDA 2AHYA 3KE2A 5BMVA 3PLNA 3GB7C 1W0TA 1LWUA 1MBHA 4MVSA 4XRFA 4WCEV 2LXBA 3ZOBA 1YS7A 3HTKA 2UUCB 2BYVE 1Y0UA 2MD5A 1QVTA 1X1BA 4CBCA 1P4RA 3JCUC 1WLEA 4D7NA 4NC7A 4ASNA 1X8YA 1O7LA 2CJJA 5EIBC 5LMNB 1XMXA 2F4VB 3E8FA 4IRGA 5H2FH 5D8LB 1IDYA 2N8GA 1SQPK 4RESB 3T97B 3GTGJ 2Q9IA 2L54A 2WLJA 5J8CA 2EZKA 2Q7CA 1NTCA 3UT5A 2OPTA 1UAAA 5B3SB 2CUFA 3GFLA 2JA7J 2IJLA 4C7RA 2P10A 3VMAA 1SESA 4BL0B 1GN2A 5EYPA 2IVMA 5CCHD 1H8HG 4HNAA 3QF7A 1FU1A 1JX9A 1WJDA 3OMAB 3J80N 2VQLA 4HPQA 2OC6A 2JRIA 3GMEA 3UCSC 1URQA 1EXIA 1NU1K 3T1HB 3CCLP 3F5TA 1KYOI 4OIOF 1BHAA 2A68F 2KPMA 6PAXA 5HLTA 2IBZI 2R9IA 2Q2EB 4EJOA 4GKJB 1IC8A 2OTLP 1YHQI 1SQQE 2P4VA 3L75H 3ZGKA 3OE7G 5KVRA 1O7FA 4RGRA 4JYAO 2JJ1G 1M56B 2JJ2G 3OA7A 3DV8A 4TV8A 1QZZA 2YSRA 1Z91A 5E3OA 2V6EA 3THOA 2KZJA 3H1LH 4HNUA 4IKFA 3I3LA 2I1JA 1H38A 1ETQA 2HYFA 2B1IA 1SQBJ 2H7HA 4KIBA 3RZOJ 2JKVA 1RFYA 3GO5A 3T97A 1F7YA 4TV7A 4X62B 4B3RO 3LIEA 1YX3A 3OIPA 5AVSB 5APVA 2OTKE 1FZGA 1VQ4P 2KB1A 1T38A 5D5QA 3AE8C 4KUMA 4DV1B 3UQ8A 1Y1WJ 3JRCA 2VQEO 4BR6A 2F4MB 1IK7A 1YJNV 3W6VA 1Y1VJ 1WKMA 3OW2U 4RAFA 3VSKA 2D5VA 3RK3E 1VTNC 2G8YA 2FMYA 1NTMJ 1IRFA 3R61A 3AEAC 3OS2A 3S2HJ 4Q47A 1K8AQ 1IX9A 1JJOA 1IV8A 1SD6A 3KEQA 4XLPF 3SWFA 2ADUA 2Q2EA 1K73Q 4YY3B 2GHYA 1JM0A 2ZE7A 3V4QA 1ZK8A 3IAYA 3G9RA 2HZTA 5B1AC 1LTGC 3AG1H 1SAUA 5CQGA 2YX4A 4IOIH 4KT0J 3ZRGA 2KIKA 2AQEA 3Q9SA 1T95A 1T6AA 4EATA 1D0XA 2LDUA 3ZQLA 5JCOC 4OGQB 1E0EA 3QTCA 3QPSA 5D4RA 3A0HC 1KQSU 4EJUA 5HDNA 1RR7A 1DGRM 2IGKA 2OBPA 3LSUA 1OVUA 3CCQV 2HS5A 5GTHH 1Q6IA 4JAUA 4UCRA 2WV1A 4LFBO 5BU8B 5J40A 4PV1B 2CSOA 5IPAA 3UO3A 4WBAA 3F22A 4EEQA 2EIJB 3CPWU 3CEIA 1QR9A 4Q20A 4WXHA 1EN6A 3SJBC 1NTKK 3K9TA 3M0DA 2HVJC 2QKSA 4R6ZA 3AE9C 2YXRB 2GXGA 2HOEA 4JI6B 4JX6A 2EV5A 4L76A 1RF0A 2KFDA 3BCCE 2L6LA 1V3FA 4MN4C 3OYCA 4RAZA 2JDIH 4EGYA 3OR2C 1W7PB 4JI5O 2O3FA 2BXZA 1FMWA 2XF6A 4RKUJ 2ZE5A 3F8BA 3WTZA 1YCIA 5KAIC 4DV4B 3TEDA 5A2QN 2QF7A 2STWA 1MMNA 1X4TA 1KP2A 2IPPA 2W83C 1MBJA 4IHJA 2QVAA 2N1TD 1H0TB 5GADJ 2QRXA 4JYBA 4IHYA 1ZLLA 1PV3A 3Q1MA 2XAQA 3U1AA 3CCRI 1RKTA 4YFNF 3L73E 2X6CA 4OIQF 1Y39A 4KHXA 2XF5A 2Z4EA 4N3YB 3VMYA 1YITV 3EUKL 3BDDA 3D1NI 1MUUA 5H2FC 4JQFA 2AS5F 1MZEA 3K1PA 3F23A 1SQPH 1LDJA 1MBKA 2Q4PA 4D6TG 4BWAA 2CTRA 4MTFA 2DO7A 1L0ND 3BROA 3CESA 1REPC 5B66H 1ZG5A 1M1JB 1JCDA 3VYUB 4JQ0D 1LT1A 2FNPA 4LF8B 3CJNA 4IO9F 2YPRA 1D5NA 1G2HA 1LTBC 5LHGA 4U7DA 3TQNA 4CPGA 2UUBO 2DMPA 3ETGA 1SS1A 5HS8A 2OCEA 1NU1H 3HUSC 2B7EA 2DA6A 4JI1O 1W7PA 3RYPA 1U5TB 1RUNA 4QPOA 4E7IA 4CCMA 3K79A 2HQRA 1OCTC 3SXYA 5LA6B 5AIPA 3TDZC 2W8ZA 1CW5A 4I7HA 2GUZA 1W59A 2X6OA 2NVXJ 2EWNA 2W85A 1FJPA 1WRJA 2CGPA 2QSAA 1BM9A 4HA8A 3GW6A 4BUPA 4IQJA 1V5GA 5M3MJ 1UJWB 3JR9A 1X22A 1FE6A 1S9KE 1YW7A 5E1WA 1WWXA 4A0XA 1SD7A 5EC1C 4BXXJ 1IN6A 3ZMVA 1R36A 1N7SB 4CXFA 3HM5A 3H1HH 2LBFA 1P7GA 1MJBA 5J3LA 3MZWB 1LFBA 2FE3A 3GLLA 2V4DA 2UXDB 4L0YB 3FK7A 2LR2A 1Q5OA 1TUBB 2KIQA 2QQAA 4CCNA 4JAAA 1SAXA 1MW7A 2A3QA 4XRMA 2VBXA 3CMMA 4A3DJ 1Z3XA 2KXPB 1U5TA 3MEXA 4MVRA 3STLC 1SC5B 1JY2O 1EZVD 2UUCO 2QG4A 1LT9C 4EGZA 2QCOA 5LA6A 3L72D 4RBOA 3E6CC 3VFZA 2CV2A 2E36A 3Q5SA 1R1BA 2ADPA 1FS0E 5LMNO 1NAFA 3AG1C 1D1CA 5JR3A 1VQOP 1VQ8P 2EV0A 4PA7A 5GONB 2JPCA 3CWBJ 4TUYA 1JQ0A 1BGYD 2MW8A 2M1BA 5APTA 1A04A 3HIFA 3CJQB 2AGAA 5IY5H 3CMYA 3FBIB 3KP2A 3UNGC 1FZCB 3HD7D 5F64A 3CCEP 1I6XA 3L71D 1ZG1A 3ABMB 5KKZC 2D2CB 2SPZA 5GTHC 2I8DA 3T1HO 1I0HA 4IVNA 3RPUD 3A0BE 2ACJA 4MTXA 1FJKA 3D5RC 1VQ5V 1JKQC 3ABTA 1GMJA 4XMYA 2B9BA 1TUBA 2KSJA 2BW3A 3H1IH 4GKJO 3MGNA 2CWEA 3SYQA 4WY4D 4BQQA 1VQ7P 2AHQA 5EDNA 1ETKA 4ZIBA 4HX7A 3AG4H 5EEGA 1V55B 2VC1A 3LUTB 1NTKH 4DW6A 1R5LA 3DBRB 5FGMA 4X20B 3S3MA 2AEJA 1HW5A 1VIBA 1ZRTE 1QRYA 2IFMA 1RE4A 2D2WA 4W1UA 2Q7EA 1MJAA 1I5YA 2AQFA 4M3FA 1FXHA 4X62O 5AVWB 3ICXA 1KZUB 3E8BA 2ZNYA 2C0XA 5GONA 4BRYB 3AG7A 1NJIW 2M8GX 1ZR2A 4ITVA 4ASUG 5E17F 3VMZA 1YIJI 2Q6QA 3P3PA 4IF4A 2R5BA 4D7MA 3RK2C 2HG5D 2WY7Q 4DR5B 2A06H 2W0XA 1KYZA 3IC7A 5F2VO 1EDLA 4YELA 2PGGA 1FZCA 3RL0C 1NTMG 2VXDA 3N2GB 2V7QG 1AA7A 5CVVA 2IAIA 2W27A 1BJAA 1XN7A 1FEXA 1RRJA 3TF5A 2JN6A 1SFCA 3HPHA 4NC6A 1AI7A 4WFGA 3U11A 1DGWY 4XK4A 3M0AA 4FLVA 5BQTA 1YW8A 3M8JA 2VPRA 3HHGA 3CO7C 1D2DA 5B66C 4JI8B 4ZC3A 2LXCB 3CCUI 4S04A 5LEJA 3E8GA 2R5DA 2JVDA 4IL6E 2EULA 3SPHA 3HGGA 5E1XA 1TL8A 1DK1A 1VQNV 2QENA 1UHSA 3BLYA 4K8ZA 4A3BJ 1GUUA 4DOZA 1XI1A 5KLVK 3AG3C 3JATB 2HTJA 2YXHA 3D70A 4QGPA 3BCBA 1WJCA 3OR6C 3HOVJ 3CCSP 3DTEA 1JY3N 4BRYA 1WVRA 3SPGA 3RYFB 4GT1A 4TT3G 2K3RA 4UCUA 2L9NA 3P7KA 2W1OA 1XGNA 2IT0A 4RO2A 1BCCJ 3FKIJ 3S1KA 1B9MA 1FDMA 2BBYA 4CZCA 2M0BA 4OAZA 3PFYA 3QPLA 3L71J 4V19K 2RKHA 3KP3A 1BR2A 3N2GA 2FBIA 2C9NY 1NHLA 1YS6A 3CDHA 5B5EZ 2Q1ZB 4DNCA 2XNDH 1FKAO 4B86A 1ZGAA 4TOIA 2FY8A 3REOA 1R1UA 2E2JJ 1VQOV 3AKZA 5AW3B 1FTTA 1VQMP 4PUSA 1VZ0A 4RO0A 1TVKA 1X1CA 9ANTA 2KI7B 3D0SA 1OJLA 1G8MA 1FDIA 1J1EC 3GEZA 5EGOB 1F23A 3OYNA 2AO9A 1S5LE 3CCMI 5D6FA 2QA4I 3AFHA 4DV4O 3JATA 2JWAA 1WJAA 2C2AA 4M73A 2L9VA 3GHGC 3CCEV 5D5PA 2KP6A 2PMZA 1KTMA 5B1AB 1QPIA 2W6AA 4NNJA 4PJLA 4HF0A 1YTYA 3ZXSA 3RYFA 2BCCD 1H0MA 4H13D 1SQBK 4IRHA 3V4GA 5KCMA 4DZOA 3JALA 1L4AD 4P55A 2JGDA 2PN6A 3RPQA 1VQ7V 1GV2A 1U9NA 1SEUA 4DUZO 4XRSA 1QL2A 3FGAD 5HDKA 1OW7A 4I02A 5H9CA 2ZINA 4DV7B 1NR7A 5BY1A 2WLLB 1SQXE 2M45A 1AHDP 2LKMA 3ROUA 2C6YA 4IHWA 3U10A 1N75A 2WAQN 3HKZN 2QIWA 2FYUK 3CS5A 1MNGA 1Y8AA 1WPBA 5IY5C 4LF8O 2LLKA 1VF9A 5E20A 5D5UB 4HSTA 4ZTFA 2GWRA 2H8WA 2B9SA 1ZWIC 3I59B 2PI5A 3T1YB 5EZYB 3RBZA 3T1BA 3S3NA 2VQHA 3E6DA 3C9IA 2BY3A 5GW7A 2QEXI 1LPQA 1E3OC 2FKWB 1IG7A 2VKDA 1AVYA 1FNNA 4NPFX 2P5KA 5J4YA 1ZP0C 4O4JA 4OOIA 1FOYA 2QKCA 1SFEA 1NH3A 3RW0A 1W0KG 5AG2A 1HWYA 5K1YA 2J5PA 3DPUA 2RMKB 4GLXA 1R71A 1J2JB 3CC2P 2LKPA 5AW1B 3K5NA 2MSYA 3HB3B 1G1XB 3ZRXA 2QBYB 5E1AC 3CO6C 3GFMA 1PIXA 2WLLA 3CD6P 4XONA 1YG2A 5D4SA 1SQQD 2PJPA 3GTJJ 1NQTA 5KK1A 4LB5A 2M87A 4LG0B 2UXCO 3ABLH 3KETA 1BW5A 5FROA 4B3XA 2CPBA 5KHHA 3NXSA 1VQ6P 2M8EA 2HOAA 1ZYRF 4LCUC 3OGCC 3CB2A 5EZYA 3D6ZA 2ZXWH 4XLEA 4E7SA 4AQYB 4UB6H 3KXDA 3WU2E 4RB2C 5IOYA 1F51A 5J47A 2Y9ZA 1U8RA 1L1FA 2YNYA 5CBNA 4TQDA 1AJNA 5DEDA 3H9JA 3J7YJ 1MSFC 4YIOA 3SYAA 4HNTA 3I54A 2HVKC 2M8RA 1W36C 2BCCJ 4Y15A 4LP8A 3PQJA 4P9UA 2YO2A 3I55P 3G67A 1SLQA 2Y0SN 3HUSB 1G2CB 1PUEE 3RK3D 3U1CA 4QPJA 2BEQD 3NRVA 1B72A 2PY5A 1R6NA 4UUVA 2L2OA 3A2KA 2R7RA 3FX3A 3CWBG 1H9GA 3HRUA 4DQ2A 1YI2P 3AE7C 1JY3O 5KLVH 2TCTA 1D5AA 1J5EB 2ZIOA 4LLLA 1U6GA 2CFXA 3S16J 1JE8A 2ZJRF 1WPXA 3BVHA 4A5UB 3OFNG 1U8BA 2CE4A 3KZIE 1IFPA 1OWAA 2JTVA 3SFZA 5J2TA 1R9TJ 2DQLA 2L7FP 2FFDC 5HLHA 1K3EA 5LGNA 3MZ8A 3QODA 2IH3C 1A6QA 1UG2A 2YMYA 4X64B 1FC3A 4RB1A 4IJAA 2IS4A 4II3A 4HF2A 3WG7H 1EKEA 2FF4A 2VBZA 3EQLF 3Q0VA 4HYTB 1UCRA 1BC7C 5EG0B 2QE7G 1QQIA 1T56A 5IP9J 1NZ6A 1J09A 1I3AA 1J0RA 3TSIA 2GA2A 2Q69A 5M5YJ 4CS2A 1NK3P 5E3NA 2WPVB 3FMSA 1J5YA 3CCSI 2CRGA 4I5SA 3GXOA 2MW2B 2O57A 2IJKA 5C39A 3DEEA 2CG4A 4ABMA 1WGXA 3BR5A 1E2XA 3HUSA 3IAS2 1YJ9V 4LG3A 1IFIA 1G2CA 4JI2B 3ETEA 4WFEA 4N9IA 3K6GA 1T08B 2JWTA 3JD1A 3K5BA 4R50A 3OOPA 1OQYA 2PUSA 2K37A 1XB4A 3BWGA 5K7ZA 1Q7YQ 1JA8A 3AG1B 3J80K 2KJCA 3TGUD 3C90A 3LA7A 1YOVB 3LQRA 2CUGA 3I53A 3TJTA 3JC22 3IH4A 1SQBH 4WCGA 1Z3YA 1DEBA 3BCCD 1SKVA 5J6XA 4AYBA 4GCVA 3HOSA 2CK3H 2V1UA 1Y76B 4QMAA 4EFBA 4M6YA 5EG0A 1S2EA 5E3LA 2NRGA 2E7WA 4JI8O 2NS8A 2JA8J 3I0TA 5KKZB 2LKXA 3BTIA 1WI9A 2FYUH 3N4XA 2B63J 1I1GA 3CSXA 2XRNA 2X1DA 2O8XA 3KCXA 3L73D 3NARA 4DUYB 3FM5A 4PJ0Z 4YIIA 3TL4X 2VQFO 5KX5A 1H2NA 3MTUE 2R7ZJ 5E79H 5KJ7D 1WP7A 2JJLA 2YS8A 4CCLA 1MABG 2HXIA 1QHGA 2HI3A 4JTAB 3STZC 1K83J 5E1ZB 2ZYGA 1BCCG 3ZQIA 5FNVA 3MVPA 4EJVA 2ETHA 1S7OA 2LRDA 3OR7C 2JSCA 1GAXA 1Y0NA 4ZI7B 3H0GJ 2Z9OA 2EFNA 3QH9A 1U97A 2DA4A 1HDDC 3JAMN 1POGA 4NQWB 1FIPA 2XF7A 1L0NK 1XREA 1Y76A 1H8EG 4XOPA 2L4AA 1VPCA 1FZEA 1EV7A 3RK2B 1R6KA 4LIVA 2W57A 4JYKA 3IF4A 3PRJA 3J81N 3RL0B 1W0JG 2VJJA 4J11A 3H35A 1H89C 1DPRA 2XGCA 1AV1A 3ABLC 3A7OA 1K4SA 3UM7A 2MFZA 1MNEA 4KJMA 4PD4I 2LY2A 1WJEA 2AEMA 1LJ2A 3JARA 4LH6A 4CYCB 3C3TA 3SJCC 4IHVA 3HBLA 2ZXWC 4PI2A 3RL0g 2ZSIB 1XNQB 3H0DA 3CUQC 1KILE 1YJWP 3CC2I 4ZTJA 2DFIA 1Z56A 2GLOA 1L8DA 3RYIA 1JUSA 1QVFO 2FUG2 2RQ6A 1PP9J 2DYRH 5IT9Z 1XDCA 4H0LD 3A2FA 4R8CA 4J80A 2P6SA 3N2KA 3WFVA 2DA7A 1QBZA 5CBHA 3TGUJ 3JASB 1TQPA 3AG3B 4MS2A 5LHIA 4YJ2B 4W80A 2YEVB 3HHHA 3S1MJ 4HDUA 4FX0A 1RIOH 4ZI7A 5DCMB 2M0CA 3BCCJ 4RLFA 2M7WA 5LOVB 2K9SA 4DV7O 1TLHB 1NO4A 2EK5A 4QNHB 1U2WA 1ZRCA 4D6TE 2OCCH 1GVJA 2HPCB 3KX2A 5FKKA 2K1EA 3LA3A 1I3QJ 2WAMA 2RNGA 1ZL8B 4J01A 3CCQI 4O2BB 3H3VK 3RYCB 3CC7P 5KA6A 5KUKA 2A07F 2XPWA 1SP4A 2DA5A 3V5BA 1B1BA 3ZMTA 2F95B 2Y31A 4M72A 3B5NA 4A3IJ 1KB9H 4JASA 2ZYDA 3I55I 3OUSA 3WG7C 1FX7A 4CYCA 2ZKOA 2LD5A 3PH0A 4DRXA 4BIUA 1QPMA 2YIDA 1ETXA 3ABVC 1SERA 5L3DA 2DPUA 2VLAA 1MSEC 5FO5A 1KBHA 2NVUB 1ZGJA 2KZVA 3K08A 2H6CA 1BHBA 2XV4S 2MBFA 3C3WA 3JASA 5AVVB 3K4CA 3K1MA 4U3FJ 4YJ2A 2F5FA 4U7BA 1GN4A 4AC0A 3GHGB 5BPDA 5HS7A 3OSGA 3CRRA 1ZRFA 2ZFUA 5DCMA 1IUFA 1SVFA 4HSRA 4BACA 1KB9F 2R3CA 3AEDC 5AW0B 4BQAA 3KLOA 1YFHA 3BG5A 3MAJA 2WLMA 3ZMZA 1KC8Q 2HPCA 3GTKJ 3SJQC 2VIXA 2MJZA 2WAEA 1RUOA 5CQEA 5LBQA 4EM0B 1KONA 5LL6Y 2EBIA 4A5NA 3RYCA 1GV5A 1YITI 1M56D 2HFED 2ARHA 1WJ5A 2R9AA 4DR3B 1ZRTD 3L2QA 1ZH5A 2K3FA 4GO1A 2K9QA 3ZN1A 4AQYO 3SGIA 2LTPA 1RESA 1TT0A 4EJWA 3ZQFA 3ZMDA 5IY5B 2DDAA 5KLVG 3PM1A 4B47A 3EQ2A 4NUBA 5DM7F 3CL3D 1Y67A 4G7OF 3SZPA 4LK1F 1ZN5A 2HYGD 1QU7A 3L9FA 3ASNC 4HF1A 4BU2A 2R93J 4LC1A 4X65B 1GK6A 5FRNA 3U1DA 1NAYA 3I56V 3WODF 3R65A 3G80A 3ONQA 5K1PA 3VYIA 2IFNA 1FJGB 2LY1A 3BTCA 1HJ0A 1J5EO 3L74G 1Q86W 1SQFA 3FAVB 2EFWA 2EA2A 2EV6A 2WPRA 4DOJA 4C7UA 2G0EA 2Y0CA 5E79C 3BRCA 4PGGA 2ZT9D 2LW7A 5EFWB 4YG2F 2V1XA 3DKXA 1SETA 5GTIZ 4LFCB 1ZX3A 1T39A 3TDKA 1STZA 1WZ2A 1FYKA 4LF6B 5F08A 1H2GA 2A6TA 4Z1MH 3JRAA 4QPQA 3E89A 5LXTA 4GFBA 2IP2A 4JP0A 1ZAOA 3BY6A 3O8GA 1YF2A 2IBDA 2O61A 1L0NH 2IRFG 3HRSA 2KJBA 4IT5A 3BR1A 2FMLA 5CCHC 2L91A 1Z77A 2HVQA 4FFBA 3B77A 2ITAA 1USSA 5TRDA 4MTOA 3H25A 5DTDA 3CC4P 2CW0F 1MDMA 1UPGA 2CK3G 4V2GA 3VQYA 3W7SA 2IU0A 1TUEB 3OEEG 2EILH 4U3JB 3ZRWB 1P4XA 2QKAA 1JT6A 3UIAA 3CC7V 1HVVA 3IHUA 2WSSG 2Z1DA 1GHCA 3KYDB 3FAVA 4GKGA 2ICWG 2KP8A 1DQUA 2GIVA 4O4LB 1KN7A 2DYRC 4H44D 4AIJA 3COAC 2PEXA 1S72I 2WLHA 1EF4A 3BG3A 3HOYJ 4O4HA 3OD4A 3FWEA 4ZZLA 1TU3F 1HNWB 5FL7G 1J7KA 1NTME 4X1YB 4NPDA 1GU4A 2DOSA 5F04A 2ADQB 4YIFA 1WB8A 2FFDB 4B43A 1XMKA 1SFXA 1KKCA 2IS1A 2OCCC 1QHHD 2KNCB 4DJAA 4DZPA 3OR1C 3ZPLA 4KA4A 1VQPP 2WLKA 1USDA 4J7JA 1DGSA 1LVKA 5FKOA 4ZKUA 5GPAA 4DV5B 1ZLJA 1TNSA 2L02A 2IW5A 4RQFA 4LITA 4DUYO 1X0TA 3JYCA 2DBBA 5CLSA 4C2TA 1SQXD 1HCRA 2CV0A 1IRXA 3DSQA 1FWZA 3TBIA 3DBHB 1K8AW 3FF5A 2YSUB 2PP6A 1EZVH 4HBNA 2E76D 2WWYA 3SWKA 4KIGA 3L72H 3LSQA 1PL5A 2LFBA 1K73W 3CUOA 4IPAA 4BW5A 2DODA 2C9LY 1KORA 4ZOLA 4C3JJ 1T2KA 4EM1A 2A45H 4DV6B 3WUVA 4OX9B 1JTYA 1WH7A 1PYVA 1T5EA 4E4HA 1CZQA 4X1YA 2OZ6A 4L5IA 2DOEA 1KUQA 4FFKA 1O9GA 1Q82Q 5AVTB 3PO2J 3CRQA 2ME6A 2OAZA 1PP8F 3AEBC 3MUDC 1BGYH 2HQNA 2ZXJA 2GV9A 5LYJB 4G6DA 4CS3A 1KQGB 3DEWA 2EIMH 2KNCA 4C9YA 1YTZT 3HSRA 1G1IA 2MG4A 4PJ0H 5B5EE 1S7AA 2UXBB 3M9QA 2PGDA 1WT6A 1M93A 1ZUQA 3LDCA 1X9VA 3JSVC 1PP7U 2WB1A 2HU9A 5ICCA 3MCZA 4PD4E 3USSA 4RGXA 2HJFC 1VF6C 1IBKB 3ML0A 2PFBA 1GK9A 1XNQO 1S29A 2FA5A 1K97A 2WSCH 2M6YA 2Z0AA 1PP9G 1BE3H 3B40A 1OYIA 2E3CA 3I58A 2L3DA 2JA6J 3K4NA 1KQ9A 3H1JJ 2Q67A 1J59A 3TGUG 1CP9A 1HBXG 3TGNA 1XHXA 1LTIC 1PGPA 5TJJA 4IX7A 3TW7A 2H3OA 4B48A 3TO9A 5HODA 1L0LK 3AAFA 2EZOA 2QUFA 3LQQA 3HE5A 4XKWA 5CYVA 2WTYA 4AI8A 3AEIA 2Q3IA 1SQQK 2E74C 3M1EA 1Z2GA 1MFZA 3B02A 2EIJH 3P8MC 1Y4MA 2NAZA 1OR7C 3IKVA 2EFQA 2IJJA 4RLQA 1M57D 2N1TC 4B3AA 4WXDA 2DYSH 1SZXA 1FFXB 2CQNA 3K9SA 1R1VA 1AJYA 4JYYA 4D1QA 3AK1A 2RNBA 1XTCC 1N0JA 2IGOA 4O4IB 3CCJI 4KITB 3P7NA 3M7MX 4ZYGA 3ZDMA 3A8TA 1JKRC 1DD4A 5CVJA 1SQXJ 4TLFA 3PUBA 1FSHA 1Y8RB 2R3SA 4IXAA 3ABLB 1RH5B 1V5FA 3HOZJ 4I1LA 1NK2P 4BBRJ 5CB4B 4L9VA 2Z5UA 2L35A 4U3FG 2ZXWB 4XNFA 3I5CA 1KECA 3MHHC 3CUQB 1PUFB 1IXMA 2DN9A 1FAVA 1K5QA 3I4MJ 3E2EA 4FVMA 1ETWA 1D0YA 3WUUA 1GU5A 2EILC 2XIGA 3OEHG 1SFCD 5DD8A 4YFKF 2ZNIA 2WITA 1P84I 4N4NB 1SZTA 3IH3A 2B9ZA 3PO3J 3VP9A 3HKCB 2A9HA 4DR3O 3VQWA 3AE3C 3VWBA 2YIBA 4JI7B 1JUPA 3WHCA 2UUAO 4O4IA 3HKBA 2EFPA 3BA9A 1KQLA 1JGGA 2F1MA 5KAFZ 4G6QA 1J1DC 1RF1C 1QEXA 2HZDA 3BZCA 4A2UA 1NH4A 1S7EA 1S3JA 1QHTA 3KQGA 3BTLA 5D5XB 3ASOC 3MKLA 1RNLA 3DU6A 2EBOA 1S4XA 1I5XA 1AQ5A 1P7BA 3WG7B 2B87A 3BFRA 4PK4A 5CB4A 4GX5A 3R66A 1BOAA 1ERDA 2ME0A 3K0GA 1N86A 1M1KQ 3TKYA 1F4NA 1PUFA 2KIMA 1FJGO 2P06A 4AHCA 3CWBE 2Q9LA 2EINH 4ESJA 3EFFK 3NEUA 2AXTH 5AVRB 3VMXA 3NAUA 4B3SO 2CS3A 2KMUA 4BS9A 1IZNB 1EDIA 4CO8A 4LFCO 2DA1A 3E97A 5E8IA 1BSHA 2XNXA 3KP5A 4LF6O 3ZP5A 1FS0G 1XNRB 4FLTA 1J2XA 5JHFA 3K03A 4A3GJ 3OTOB 3HKCA 3SPIA 2O7OA 3EUHA 2GZWA 3BPXA 3CXCU 4CHUA 5F0HA 1BS3A 4IOCF 4S05A 1Q8IA 3IV5A 4NXNO 3O2PE 4LGWA 1NYHA 1HKTA 3JAWA 4JGSA 3WTWC 4BQNA 5LRSA 3RI4A 1S6LA 4HOBA 4CDGA 1K61A 3BASA 3Q4HB 1W5SA 2EIMC 1IDSA 4WF9V 3MKZA 5J1UA 4PJ0C 1TT5B 1H88C 2XGDA 4HW0A 4GCZA 1CF7A 2O6GE 5DM6V 3HD7C 2OTJP 2VKVA 1IN7A 4IHXA 4HLYA 2R5ZA 1OCCH 4EDFA 5IT3A 2DW3A 2VWKA 5ILUA 2LF7A 2RREA 5HS9A 2V4JC 5AW5B 1Z6RA 4UUTA 2W48A 3ASNB 4F93B 1LTTC 3CJTB 4JI0O 3GTMJ 4I01A 1IO4A 3CRCA 2Z33A 3MWMA 4WY4C 4J42A 4C46A 5DDGA 2L0KA 2O01H 3M99B 1HR0B 3W7XA 3P9KA 4A12A 3W6JB 1NS1A 3RYRA 3VODA 1HNWO 1VQLV 4MEXF 3S2WA 1TAEA 3RVZA 5A2QZ 2WSFH 3ABMH 2Y2ZA 1JJ2U 4EMSA 1L0LH 5ICEA 5DECA 1QQCA 3RGUA 1KILD 1GH6A 3CX5H 3OYMA 4WK8F 1IXCA 1U3EM 2JRTA 1JY2P 3WGHA 5A9GA 2GAUA 3JW4A 1SQQH 2P4KA 2KRFA 1BI1A 1AQTA 4LIUA 3Q4HA 1AKHB 2A5WA 1HUCA 1M90Q 1U7JA 3LFKA 4W7YA 2YXLA 4DV5O 2YU9J 2DYSC 2HG5C 1MH3A 1GK4A 5F0CA 3VPRA 1WJZA 3V8KA 3U1KA 4AUXA 4I6ZA 2DTZA 1U0JA 1YTZI 4UUSB 2JK3A 4F7ZA 5EZGA 3E5XA 3I9V2 3ZHRA 2E42A 4D6TD 3CRMA 2RJZA 5LGTA 5IJ0B 2XDJA 5GP9A 1IURA 1ZSPA 3GUDA 3ECOA 2LKSA 3CX5F 3LWFA 3JCUH 2JK5C 1BCCE 3SFIA 3ETQA 4R4MA 3HKDB 2JS3A 1QLED 4OX9O 2Z16A 3A01B 3KCYA 3IC9A 1AI4A 5CCGA 5DYMA 3KZZA 2BY0A 4ZDLA 2XDVA 3KYCB 3WTYC 3W3CA 3W7UA 5BXZA 1YXBA 1M8OB 3PQKA 1X1DA 3BG7A 3ZBHA 2W6BA 1N34B 3Q9VA 2DYRB 3M9BA 1I6HJ 1DD3A 5LFAA 1KQ0A 1BE3G 1MBFA 4UCOA 3L70G 3K06A 4JPRA 1NVOA 2KZGA 3AEEC 4XLAA 3E7LA 4WB4A 3OYHA 2Y30A 2PMUA 1LJ9A 3QYEA 2NNYA 1MJ9A 1DF5A 2UXBO 1LTSC 3IWZA 3CZ6A 3MAQA 1KU7A 4CGZA 5FJ8J 1DU6A 4C7NA 1Q3EA 1VF5D 2NPSA 2OCCB 2M5WA 4MW3A 1U96A 4BHCA 2OQQA 3WB2A 3BA8A 4M6XA 2BTQB 3KEYA 3DF8A 3H1JG 3EYYA 1AFOA 4ZYHA 2WSEH 4BNCA 1Y56A 2OGUA 3C3SA 4E70A 1ETYA 2K4JA 1S5LZ 4GDOA 4BXLA 3HKDA 2P6TA 1VQ9I 3E83A 5DM6F 3LNQA 3A01A 3ISPA 1AP5A 1QLNA 1R5ID 3H36A 3JAMK 4TV9B 1LFUP 1US6A 4PDRA 1MZBA 2OV7A 1FIAA 1JJ8C 2BVMA 2CPSA 2OA4A 1FBSA 1ZELA 2EINC 3TW6A 3M1CA 3DPLC 2AXTC 4KMUX 3J81K 3K0LA 4U7OA 4HH2A 1ZKGA 1K04A 5ICGA 5M1BA 5FD6A 1TQMA 1JCHA 3F72A 1UG0A 1TQIA 4ON0A 2F4OB 5IP7J 1FOXA 2PTMA 3TOAA 4H13C 1BSNA 4A0YA 4FJCC 3EETA 2QWWA 5AW7B 5ERIA 4AIDA 1L4AC 4UB8Z 2GBYA 3BCCH 1T6SA 4ICGA 3JD3A 4Z2YA 3H1KG 2QWQB 2VB6A 1HJBA 1IN8A 2IA1A 3UKMA 1LTJA 2M3EA 1WNSA 4D6TJ 1GW4A 1T0FC 2Q1KA 1BC8C 1ZXGA 3RQIA 2HNHA 2BTQA 1IXSB 2K85A 4MTGA 1SFOJ 2VN2A 2BZTA 3O8ZA 3MFKA 2LJ2A 5ITZB 3SYTA 2XV5A 1L3LA 4BW9A 4FLUA 4B1RA 4BXFA 2HDWA 2JEXA 3L73H 1QX8A 1XMOB 4RM2A 4DZJA 5C3EJ 3PSIA 1ONVA 4X1KA 1SQVJ 4UB6E 4I0BA 1OCCC 4GX2A 4TV9A 1R5HA 2QWPB 1J9IA 1WJFA 2W25A 3RTRA 2DJIA 5BPIA 3FX0A 3IUOA 1MKMA 4A69C 2V9KA 3BG9A 3W2VA 2P8TA 4KL1A 4YXWH 1XHZA 5FLXZ 3CE2A 1P84E 5AVZB 3G71V 1NH2D 1WA8B 3ZQHA 4EFEA 3HOXJ 4PSXA 2D3OW 3OWTA 2J5OA 1LFPA 2OQRA 4JI7O 2E74B 4G7ZF 2E1MC 3RBXA 3BC8A 1RI7A 3EUAA 3MUDA 2V9PA 2NNUA 2FRHA 3S32A 2E5NA 4Y17A 3ZHTA 2N04A 3G6EP 1QVUA 2DOAA 1MBEA 5KLVE 3NFQA 3CMEI 1FPOA 2N1TB 3ZQ7A 4ETSA 1X4OA 3ZIAG 2HHHO 1OKRA 3CCRP 3CCVI 1RM1C 3E6MA 4LOCA 1N77A 4XL9A 5AW8B 5IE9A 1YHQV 1GO3F 4GUNA 1VF6A 5ITZA 4A3KJ 2R32A 3F3XA 3SJMA 1NTMD 4JI4B 1I50J 1ZTEA 2B88A 1P2FA 3JD4A 1NVPD 1YW9A 2P5VA 5C8YB 3T4ZA 3L74E 3A5TA 1Z05A 1H8AC 2DPDA 2JA5J 1IZ1A 2PI0A 4FLZA 1XBLA 2D1HA 2KOGA 4ZBMA 2OJED 4BHBA 2VKHA 4IZZA 1XNRO 4B3MB 4K0KB 3OTOO 5JH7A 1ORKA 2EILB 4PA9A 2FOKA 1DUXC 3RK3C 5GTIE 3KZIZ 4M3LA 1FYJA 2POHA 2HODA 1Q1HA 4LLHA 1G59A 2N1TA 2FOWA 4Z6YA 3AE4C 3L75J 3SDBA 1BQZA 2IJHA 1BOBA 2E5LB 1N33B 1A35A 2JS5A 5DUKA 3H1LJ 2Z5IA 3V2QA 4MNUA 3M07A 3L2VA 3HKEB 2G38A 1J1DB 1RF1B 3OYEA 1AOYA 1HH0A 1E3PA 4MVQA 4O2AB 1X58A 1TTYA 1SQXK 3ASOB 4L74A 4IGGA 3R6SA 1QGKB 1N25A 5D8KB 4S0HB 4HG2A 4J10A 2GXBA 3H5NA 1XL4A 1BI0A 4PFPA 4JTDB 1JUMA 1IXBA 1N73C 1LDKB 1HR0O 1SVOA 3MKWB 2BOCC 4C2UA 2FYNC 4LK0F 1NGMB 5JVTA 3DPTA 4F91B 2FYUE 1A31A 4DR4O 3I56I 2F93B 1OHHG 4ZZDA 4A3EJ 3SPJA 4LF5O 2PZSA 1TWGJ 4EEFG 2A0LA 4EJTA 2F4IA 1FPQA 4PD4D 5E18F 3A0BH 4Y33A 3B5ND 1XDSA 1SQPD 2IS2A 1KYOH 3PUFA 5L3FA 5EZHA 2UXXA 3FFQA 2IBZH 1LUVA 1LTAC 1LGHB 2HFHA 2M5AB 4NPEA 1N32B 2OU2A 3JSPA 2Q0OC 4PA6A 4F6RB 1V54H 2VE8A 2W82A 4B09A 4XOTA 3FMRA 1QVGU 1YTFB 1P6RA 1Q7YW 3HJEA 1LR1A 4GZRB 3T2MA 4XLNF 1T3UA 4I4TB 2AXLA 2ESNA 4BIZA 3TK1A 3S1NJ 3HKEA 3E86A 3K2AA 3CP8A 2V7QJ 1RF1A 4CH7A 2LK2A 1PNKA 2E1NA 4XIDA 2EIMB 2O3JA 1Y66A 4KHPB 3AECC 5TJHA 3OYLA 2NRAC 2MH9A 4G28B 2VUMJ 4LLNA 1KYOF 2HPIA 1IO2A 2DA3A 2HTSA 3HD7B 4DK1A 5F1RA 2B89A 2ZXEB 1XSXA 1FZBA 2YS9A 1B6AA 1FBQA 2C0WA 1N8RQ 4NR1A 4IQ4A 1JCCA 2K27A 1YZBA 4X8AA 1XEQA 4I98B 4DR6B 1FDOA 2M7AA 3T4DA 2Q68A 5JVDB 3W7WA 2JT1A 3CCRV 4BHPA 1IRGA 4WY4B 4CH3A 1D1BA 4KICA 4ENJA 4F92B 4I2LC 2UWJE 1SQGA 1HW2A 4UXNA 4U0YA 5ICFA 4L9JA 2YIAA 5KJ7C 3P30A 1MBGA 5D6EA 1Z1DA 4F6RA 2NVYJ 1HNXB 4IL6H 2ISYA 1B6QA 2CH7B 3HOWJ 4IRIA 3V7RA 4FE7A 1T98A 4ZDPA 2CW8A 2XTAA 4LF7B 5E3MA 4XRSG 4PJJA 1YIJP 1G4DA 2JUGA 2QTSA 2DK5A 5GAEJ 1PP9E 2XHKA 3S3WA 1A5JA 4FCYA 2UU9B 3ZX6A 2DYSB 2FB5A 2PAJA 3G6BA 3G1LA 1XMQB 2NR5A 4ZJZA 3HSEA 4LLGF 3TGUE 3VQVA 1ZLKA 4J9ZB 3HD7A 1LWUC 2MLGA 4J41A 4BE2A 2A7WA 4K3AA 2UUZA 5DD4A 3V7SA 3H5AA 2UWMA 1K6OA 2M2EA 3L9DA 5LHHA 3RPUA 2LQTA 5KHIA 2IYOA 4W4LA 1KB9E 3ZS8C 3C7JA 4JPZB 5JVDA 3RQ4A 1SQPJ 3Q3SA 4WFHA 2X4HA 3LNMB 2IA2A 3CCUP 4UV9A 3M8EA 2ZSHB 2H8PD 2K86A 1XTAA 3G1MA 4BE1A 3G6EI 5CBGA 2Q5ZA 2KS1B 5APSA 1VNDA 2H89C 3CCLV 1Z67A 4H0LC 4BBSJ 4UFZA 4D5CA 1CSBA 1R6TA 1H2LA 4PFOA 2QSGX 3QO7A 3K7AJ 4G27B 3S93A 2CH7A 2OTLV 4JF7A 3RJPA 1H2KA 3A0HZ 1G3YA 4Y28J 4A7PA 3B2EE 3CWBD 5K5OA 1Q43A 2HJDA 4H4KC 1DEEG 3RDIA 3H9GA 3SWYA 4WFBV 1Y9BA 3OTFA 3GVMA 3CF5F 1XGMA 3PHLA 2GTSA 4M3DA 4GRIA 3DGEA 2L4MA 3H5RA 5KMGB 3QYBA 2W6JH 4B3TO 1OLTA 3FX7A 4D7TA 4U3FE 1E79G 2FU4A 1VQ4V 1XMOO 1H2MA 5FD5A 3NMDA 1G3SA 1SQVG 3AG3H 3FD9A 3FK6A 4A3LJ 2ZCWA 2R72A 5APXA 2A3SA 4GYGA 1SQXH 2ZFCA 3OAKA 4HB1A 4P9OA 3AL0C 2MC4A 4A6EA 3VBBA 1QU3A 2KS1A 4O3MA 1H0TA 3CCMP 4HZFA 1TZLA 2QA4P 5KAIZ 1A02F 1GM7A 4BWNA 2W4SA 3CP1A 2X1EA 2EINB 4L73A 3OS0A 2AW9A 3GZ6A 1Z6TA 2YICA 4OWRB 2W6IG 2YUAA 1RPWA 1JHHA 3VYTB 4EKWA 2NVTJ 5APQA 1FMVA 3A0BC 4PDKA 4KP4A 2IH1C 3IH2A 1RE3C 1UIXA 3QU3A 3HPLC 4H13B 5BOXA 1M1JA 1A32A 5H2FZ 1NTZK 1L4AB 4AU7A 4M9XA 1KC8W 1F5TA 2VXZA 5KAFE 4LWSB 4N21A 2KK7A 2W0FC 1V54C 4IL6X 1CGPA 5IT9N 3M3YJ 4WVZA 1BR4A 1M56C 2HFEC 1T2KD 4JI4O 4NHJA 4LFAB 2WTEA 2HVRA 2DQRA 1NBMG 1OCZC 2FTKA 2YUSA 2L9SA 3K5OA 3K4LA 4X1EA 4FETA 2MGQA 4OH8B 5EYRA 1BL0A 5JLWA 1Y47A 3KPEA 1HSJA 3K57A 1GLNA 5FFZA 5EF6A 2Y75A 2YX7A 2F48A 1JTHB 1CXZB 4ESBA 2QEXP 2CTPA 3HE4B 3FHZA 1OCCB 4K0KO 5HNHA 1YIJV 1HNZB 1NT2B 2F4VO 4EI2A 5APUA 1IFMA 1YE9A 2XASA 2ID6A 5IOZA 2M4GA 2CGNA 5IDJA 1PPJH 1ACIA 4RMNA 3WU2H 2WLIB 1HKSA 4FIPC 4DV2B 3GWZA 2XAFA 2Z3YA 3SDLA 3L75G 1YBKA 1UELB 3BCAA 1HQCA 4DYRA 2IM9A 1PL0A 4O9BA 2E5LO 3BTJA 2ZT9C 1BCCD 1NTKJ 1SS3A 3H1LG 2Y0IA 2WBMA 3D8CA 1N7SA 4XA4A 1Z7LA 4BJTA 4LWSA 4NYKA 3CCUV 4RGUA 4IL6C 1YVWA 2A5YB 2P5LC 2NLJC 1T0FA 1RM1B 3PIPF 1RF0C 2WT7B 1M4UA 3K70D 3G4SI 2QM7A 3CMAI 4MHGA 1RC9A 4HZ3A 3X2QH 2X6WA 4QTRA 3LSHA 1IF1A 4HX4A 3W7TA 3WB1A 4IFFA 3ABUA 5C4JJ 1QCEA 1Z9CA 1JTHA 4CH5A 3A03A 5BZBA 3HE4A 4LF9B 1XILA 3OL4A 4OPAA 2RQQA 4WXCA 2VKEA 4Y13A 3PFIA 4MIMA 5AVUB 4YRVA 5CJ4A 2VODA 4B3RB 1I5ZA 1T33A 4DV1O 1N36B 1OCOC 4L9NA 1OZHA 1L2PA 1M9NA 3HUGB 3RK3B 4KIFA 1WFXA 5ILVA 4H44C 1V4RA 1Q90D 1S9HA 1ULYA 4CICA 3FKSG 4QIWF 3M7GA 1E1QG 1IGNA 2QJYC 2VJ5A 3RN4A 4BJ6C 4XKCA 4IIJB 3MHSC 4N78E 4IFDK 3IRQA 3MZYA 1X3UA 1GL2D 3P5JA 1S5LC 2VJ4A 2OIGA 4BKXA 3KCCA 4HV5A 1R5GA 1CPYA 2WT7A 4QE9A 1WP8A 1S0VA 4YY3O 1BIBA 5GTHZ 3R2PA 4AILC 4F52A 3SJAC 4BY7J 2KDOA 5JLXA 3DQVC 1UMQA 2P0WA 2QWNB 2RGVA 1MIJA 4X20A 4ZKPA 1SFUA 4DR6O 1MMGA 3DXRB 2VBYA 2FYZA 3QQAA 3GCMA 4Y3OA 2XKMA 3QP5A 4DJGA 4JBAA 2PMHA 3J7ZI 2YIBD 2Q73A 1FP2A 2FYNB 3G1OA 4GYCB 3MP7B 4FT8A 4FZ1A 1BE3E 2EZHA 3SPCA 1KMIZ 3W68A 3L70E 2O01N 3JSLA 2PYJA 3ERMA 1VQLI 1EDJA 3FWLA 4I9WA 5KHDA 2E76C 2QJPC 1YQAA 1IFDA 1HNXO 4W97A 1VQKI 1HOMA 2DMUA 1K7DA 4FQGA 3WGGA 2JEUA 2NZ2A 4ZNCA 1YSCA 5FLVA 4X1IB 2WA4A 2JDIG 4IIJA 5KUMA 2BXYA 4RUFA 2V4HA 4BYYA 2Y69H 5CPRB 2KG7B 2WAQA 4MO7A 3HKZA 4E7ZA 2VASA 1Q82W 1K79A 3B73A 4BIOA 3CXHI 3H1JE 2DJNA 3ZMUA 1KA8A 3M8AA 3RKWA 2LW1A 1G1JA 2UXNA 3HYIA 1W5CE 4N23A 1VQ8V 1KGSA 1P84D 2EJRA 2YI8A 1NTZH 4JI6O 3CDLA 3WTVC 3B6CA 2DXIA 5DEQA 1BDCA 4X6AJ 4DGWB 5M5XJ 2XAUA 4ENMA 5JJJB 2OF7A 1BJZA 5B66Z 4BY1J 2DMTA 3WE3A 1SQPG 1OZ0A 2VT2A 3W6KB 2DN0A 1B9NA 3GYHX 2Q8VA 4GX0A 4YJ3B 3K58A 5KLVD 2NVQJ 4FASD 4IEJA 4BJ5C 2F23A 5J8FA 1KV4A 4M3BA 3ETDA 2NS7A 2RNJA 2K9PA 3I5DA 1MG1A 1X3WB 2Y0EA 5DUIA 3RGBA 3G3ZA 3OSFA 2ZQMA 2YMKA 2DDBA 2FQ4A 3BP8A 1IN5A 1MMDA 3VOUA 4I50B 4XLFA 2P22C 3H1KE 1FD9A 1NU1G 2K1AA 2QQ9A 4X1IA 4KXRA 3QNEA 2CGOA 2Q0OA 3WU2C 3L74D 4UB8E 3E22B 4PJMA 2KG7A 1SANA 4BDYA 3R4YA 4RJTA 3WTXC 3LAJA 1PM9A 4AYCA 2KLOA 1M57C 2M0MA 4JBZA 3OJAB 1URFA 1NTMK 4ZMDA 3T8TA 2KLVA 2UUBB 3O9OA 2E7XA 5EGOA 5JWPA 4FISA 2AZ0A 1DP3A 1YJNP 1RE4C 3F6OA 3OAAG 2CQ7A 3Q5RA 3K0DA 4D6TH 2Y9YA 2ID3A 1LWUB 4JI1B 3QPHA 3QU6A 2H1KA 1WJBA 5D5WB 4JV5B 3HTKB 2HDCA 2A61A 5EBMC 4L18B 1IVSA 1JEKA 2XPVA 1G6UA 2CV1A 3X2QC 3FIWA 4DIQA 3KZIC 1AR5A 4B08A 3H1HG 3FZVA 2DOFA 4XLHA 2Y0SA 3RT3C 5AW6B 4IFMA 4MFDA 5FPRA 5JCOA 2B1GA 2XKPA 4HQEA 3QOEA 1X79B 1KD1Q 3UT5B 4XR6A 5H20A 5KJ7A 3C2GA 2K5CA 1D1AA 2L7MP 1WAZA 3TCUA 2NNNA 4H0LB 3P3NA 3BR2A 1O3RA 3E22A 1SFCC 2FXMA 2DQ0A 4P96A 4CC6A 1Q6UA 3H01A 2KHMA 4Y99C 1EFRG 2FYUD 4G94A 4GOFA 4RAIA 3I59A 3BPVA 3WU0A 2UXDO 3ZHVA 3CCSV 5CCGD 1R3KC 1PPJG 2R7TA 4R79A 2CDYA 4ZYEA 3E1SA 1AR4A 2LO1A 2CFOA 3CCQP 4QLCU 5KLVJ 2CAZC 3EDPA 1Y8QB 3A0RA 4CCJA 2L5GB 1VF7A 2H6BA 4DYLA 2FXAA 4TV8B 4X0GA 3UKGA 5AW9B 3S9OA 2KQXA 1NKNA 4CA0A 3OIOA 3RKQA 4XICA 4C30A 1K34A 5TISE 4R7CA 1EQ7A 1HNZO 3PSFA 3GMAA 2CYYA 2PJRB 4GOEA 2NYXA 3QWLA 1A36A 1R7JA 1F36A 3AL0B 2LY9A 4NDLA 2NPSD 1M1KW 4NTWA 3ML6A 1IK9A 3B4SA 4DV2O 1VQMV 4KNYA 3BJAA 3H1IG 1HC8A 1HWTC 2QBYA 2W00A 4QE7A 2IU3A 3L74J 4DR1B 3G71I 3TO6A 1HBWA 4F4LA 1NTKG 3K4BA 3CTAA 3MDSA 1UHMA 4HYEA 2VONA 4LG0A 4P5OA 3ZCCA 2IGMA 1JR9A 1OW6A 2VRZA 3CP2A 4E7JA 1Z21A 2CU7A 3OYFA 2KZIA 4DXWA 3L35A 3SYPA 5C4XJ 4G12A 1L0LE 2E75D 4RM3A 1N0NA 4RB3C 3CX5E 1HGZA 1V54B 2Y69C 3VP8A 3OL3A 1YITP 1XD7A 4UY8I 1VP7A 2R70A 1KU9A 2ZMEC 3BEHA 3VYSB 2A06G 5EJCA 5IYZB 1OCZB 4FLXA 1PZQA 3OYIA 3DEUA 4LF9O 4DBQA 2WQYC 2PJRA 1W0UA 2DFEA 4FK5C 4WWIA 2ZC2A 2O8KA 3FHNA 1F1ZA 1LT9B 1YYCA 5BU5A 2JSPA 3ZQGA 2L9RA 5FFXA 4YPCA 3TP0A 1AJPA 2BY1A 1K7AA 1N36O 1PP9D 2LH9A 2DWDC 3JCUE 4V2FA 3WE2A 4DR5O 2KIUA 4Y52J 1EXJA 2FYUJ 3OOUA 2X6AA 4WX9A 1K05A 2RVCA 1KB9D 3C2HA 1RE3A 2AZ2A 1XL6A 2JMWA 2XZRA 3E6BA 1RKWA 2ZT9B 1P9QC 1KILC 1O4XA 1KQ8A 3AE6C 1Z5VA 3E0JB 3ASNH 3CC2V 1LVAA 4C2MJ 3Q0UA 3F8NA 1YEWA 5FB2A 1FBUA 1JY2N 1HLVA 2QVOA 4B8XA 5IYZA 3H9QA 3CD6V 1K6YA 1M90W