1S3JA

X-ray crystal structure of yuso protein from bacillus subtilis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
SADQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYLSFLTEEEMLQAAHITAKLAQAAETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of YusO protein from Bacillus subtilis, a member of MarR transcriptional regulator family
rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords YusO protein
total genus 47
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s3jA02
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1s3jA03
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1s3jA01
2H09A 2LNBA 1RIOH 2RV8A 3M9AA 3U2RA 3RKWA 3SXYA 5HDKA 3KEQA 3WTZA 3I64A 2DO7A 1ZN2A 4IRGA 4TV7A 3RYRA 3RI4A 1KYWA 3MHVA 4HYEA 3GZ5A 2ZXJA 1S7OA 3I54A 3V7SA 1ZW0A 3F3XA 1O7FA 4YG2F 2VBZA 4M9ZA 5LGUA 3HHHA 3T8RA 5EFWB 2DK5A 1FC2C 1RUNA 2CO5A 3IWZA 4S05A 4IOIH 1KA8A 5K1YA 2L4MA 3F8CA 3QU3A 1ULYA 4L9NA 2NAZA 1MJAA 3F6OA 5AONA 4ETSA 4KNYA 1P6RA 2HKXA 2IPQX 4E70A 2D1VA 3GWZA 2QENA 3GZ6A 3V7CA 5DV5A 4MQ9F 4EV0A 1JHHA 4D0PA 1MDMB 4IVNA 2H94A 1RI7A 4L9TA 2QBYA 2IJLA 3ELKA 3F8NA 2K27A 5E8GA 2DT5A 4Q5SF 1MZBA 4CXFA 3SZTA 2OAZA 1W5TA 1ZG5A 2D1HA 1IN6A 4M72A 2VOPA 3ZQ7A 4GYIA 2C6YA 5K5GB 2EFPA 4P5OA 1Z05A 2ISZA 3W7XA 2QBYB 2OD5A 2DPUA 2XASA 2E1CA 3VFZA 1F4KA 1ZH5A 5E1WA 2DQRA 2P58A 1HKSA 1K6OA 1QQIA 3FWEA 1AOYA 2VN2A 2XKPA 1IN5A 4I01A 4MEYF 1SS1A 5LEKA 1NVOA 3FX3A 2EJRA 5DD4A 4AIKA 1UB9A 3E5QA 4UV8A 1KU9A 1I5ZA 1W7PB 4HA8A 4I98B 3QPHA 2LDUA 1KYZA 1ZGAA 3TDUC 2Z9OA 1S6LA 3QPTA 1FY7A 2DI3A 4BAYA 2XUBA 5L3DA 3C7JA 2KS1B 3MWMA 2K86A 4LB5A 3MQ0A 4RGSA 3K2ZA 4IRIA 1CF7B 3RPUA 4U88A 5CVRA 1WWXA 2PLYA 2L01A 3CLOA 4KT5C 1FNNA 3CUQC 2FF4A 1LDJA 3E5UA 4GXOA 5F64A 1SD7A 4Y15A 2UXXA 4BNCA 1KQ9A 5FD6A 1V3FA 3ZMTA 1ZG3A 1QZYA 4HV5A 2RVCA 4KA4A 2MBFA 1OMIA 4GODA 4WCGA 3WODF 4IXAA 1JHFA 2KIFA 3TDZC 4A0YA 2VODA 5HLGA 3HHGA 1QZZA 3JTGA 1DDNA 3HOTA 3M8FA 2RDPA 2M1BA 3TO7A 2ESHA 5CBNA 2KZIA 3FMSA 3GFJA 3KFWX 3MCZA 2OZUA 4I02A 2X0LA 3ABTA 2DFIA 3E6CC 5D4SA 2NYXA 3ROUA 2PMHA 3W7TA 5JVTA 5J8FA 1NHAA 3D3IA 4GCVA 1SFXA 2VONA 2YX7A 5DCMB 2WC2A 1WSUA 1XSDA 1B9NA 1T98A 4HQEA 2ETHA 4OINF 3RDIA 3P7NA 1HW1A 2P5KA 5HVQC 2H6CA 4LB6B 4M6XA 1MFTA 1J5YA 1FOKA 1UFMA 3E5XA 3WGGA 4ZNCA 3I53A 2VXZA 4ENMA 3BPXA 4IF4A 1BC7C 4MQVA 3TQNA 2OQRA 1USTA 3RJPA 5DD8A 4BQAA 1O3TA 1OVUA 2GIVA 2DLLA 5BS6A 4I0AA 2IA2A 1FX7A 2HEOA 1OYWA 5E18F 4HDVA 3CDHA 1XGNA 3ZN0A 4WXCA 2JRTA 4O6JA 1IUYA 1FLIA 2KZJA 2HGCA 3PQJA 1YIOA 3E97A 1T0FA 2JSCA 4Y13A 2BEOA 3KP7A 1DEEG 1WI9A 4RGUA 2EFWA 4OMYA 4AIJA 3E6BA 2XAFA 2P90A 2L3DA 2JTVA 5DUKA 4XLNF 4YIFA 3ABUA 5HS9A 3CUOA 4L5IA 2XAHA 4BHPA 1R00A 1HSJA 2AS5F 3W6KB 5ILSA 1R1VA 2FA5A 4CPGA 1R5HA 4Q48A 5JFRA 1B6AA 4ZH4F 4ASVA 4ASWA 1VTNC 3FXEA 1D8JA 2ISYA 3KZYA 3V8LA 2QRXA 2FRHA 4OIRF 3P9IA 3IWFA 3HOSA 4GO1A 1Z6TA 1YO5C 2CYYA 3T1BA 2J5OA 4BXUA 3CUQA 1R1UA 1U7MA 2HDCA 3Q5FA 4EVIA 3LQQA 4NPFX 1KU3A 3RYPA 2K4BA 2WTEA 3HSRA 3EDPA 3M7GA 4N9IA 4MEXF 5L3CA 2FU4A 2GXBA 3HUGA 4U7DA 1ZAOA 1GHCA 2Z99A 3FMQA 3CO6C 5E20A 3WTWC 3BZ6A 1JGSA 1U6GA 4KIFA 4EM2A 4CYDA 4CDGA 1BI1A 1TQMA 1SFEA 4JBAA 2QWWA 4Z2YA 1U5TA 3FXUA 3HTUA 5ICGA 3DEUA 4ON0A 2CQKA 1PP7U 4K2EA 3WTYC 1Y47A 3I4PA 5GW7A 1H9GA 1D8KA 2EWNA 2W84A 2P8TA 2ZNYA 2DBBA 2VC1A 5IT3A 3LQRA 3JW4A 3ML6A 2JPCA 2M5WA 1OKRA 1YLFA 4JK1X 2F5DA 5D8KB 2PJPA 2EV5A 3TKYA 3K0LA 4N9HA 3VODA 4EM1A 3LWFA 2YU3A 1B9MA 4CO8A 3EETA 2D45A 2A07F 1PP8F 3NRVA 4PGHA 3I5UA 3T5XA 3NQOA 5LHIA 5FLXK 2O8XA 1EH6A 5CVIA 1S29A 3BJAA 1OYIA 4XSZF 1TBXA 3LA7A 4NPDA 1SD4A 4ENJA 1LDDA 1IAWA 2NS0A 5LGTA 3QP5A 4EJTA 1G3YA 3CTAA 1KU7A 2M0BA 2WAMA 1EDJA 2FMLA 2HTSA 4OOIA 2XAJA 2QLZA 1FC3A 3E35A 4M74A 3KP4A 5CA3A 1EDIA 1HBXG 3ZPLA 2Z33A 3I59A 1XGSA 3FXRA 1R5GA 5D8LB 1J9IA 2XGXA 1R1TA 1YTFB 3HTSB 4EGYA 4EQQA 3MZYA 5DDGA 1SD5A 4ESFA 5CBOA 3CO7C 1MJ9A 3BJOA 4NB5A 2JWDA 3GF2A 1WQ2A 5CYVA 2FOKA 1D5VA 3ZMDA 5DCMA 2I8DA 1YS6A 4RGXA 4UHTA 3EYIA 3I0TA 2DW4A 3U1DA 5BPIA 2MLKA 1U2WA 3F8MA 4ENKA 2LF8A 1O3QA 4B8XA 3R61A 3HIFA 5ILUA 1LEBA 1NVPB 1HQCA 4LD5A 5FB2A 3T0YA 1QGPA 4XLPF 1FYKA 2OQGA 2R44A 4IRHA 3ZDMA 1BIAA 5FD5A 2HTJA 1P4AA 2IT0A 1QNTA 2V79A 4FX0A 2XRNA 4L5JA 4HJGH 2EK5A 3L7WA 3P9KA 3QRFF 2PN6A 3R0AA 1BOAA 3B02A 3GYHX 1XSXA 1R7JA 1O3RA 3W7SA 3JAMK 2XV4S 3QAHA 4LGWA 1ZREA 1TQIA 2GA1A 2JT1A 3W7UA 4HX7A 1OVRA 2HQRA 4HBLA 5D6EA 3DP7A 1C0WA 2AXLA 5LHHA 2FEZA 1J75A 5D5UB 2B87A 2STWA 5A2QZ 3RTRA 5FO5A 4IHTA 3BROA 4R79A 2ZNZA 2COMA 2KJCA 3QU6A 2M87A 3MFKA 1T2KA 4Q4ZF 2W24A 3DPLC 2RKLA 5DUIA 2FQ3A 5BOXA 4HZFA 1IF1A 1Q1HA 1U78A 1U5TC 4PCQA 1DPRA 1O3SA 1ZRDA 1XD7A 4KDPA 5LBQA 4I09A 2IP2A 3RIRA 1S3JA 1KQ0A 2LKPA 1R58A 3IRQA 2V1XA 3GXOA 2ELHA 2VT3A 3KETA 1BJAA 1DPUA 5TJJA 3N97A 1Z6RA 1YYVA 2W57A 3M1EA 3TO6A 4EGZA 1K78B 2OZ6A 3GVAA 3F6VA 3JSPA 4HLXA 2DK8A 1H0TA 4U7BA 4P9FA 5E1ZB 2GQQA 2VBYA 3K1NA 1FT9A 1EC5A 3VEPA 5LRSA 4FHTA 1GVJA 5LGNA 4KN7X 3GW2A 4MTEA 2VC0A 3WE2A 2L02A 5AIPA 4Y17A 2H6BA 1G3TA 4UVAA 3KZZA 2RGVA 3CUQB 3IKTA 5H20A 4BXLA 3G3ZA 4WWIA 1YFHA 4MHGA 4RB1A 1E17A 3GO5A 4A0ZA 2K7LA 4WK8F 5E1XA 2MLGA 2VBWA 4UVCA 4KFCA 3E6DA 1BN5A 4LFUA 3F23A 3F8FA 2HZTA 4N0BA 2A69F 2P7VB 2FE3A 3C18A 4A5MA 4ASNA 5BMZA 1WKMA 2BYVE 2VE8A 2W25A 4WWCA 5J8CA 3LAPA 5F6FA 1LNWA 3GFMA 1LP1B 3W7WA 4HX8A 1EDKA 1B4AA 4KUMA 1SD6A 3SHFA 5FGMA 5HDGA 4EJVA 5DEQA 5ICCA 1KGSA 2L4AA 1UCRA 5HDNA 3R6SA 2ZCWA 3H3ZA 2FNPA 4LK0F 1ZRCA 2O6GE 3WTVC 4PDKA 1K7AA 2QQ9A 4UV9A 2EB7A 3REOA 3TO9A 1E2XA 4O3MA 5JI6A 3SFZA 1BI2A 1U7JA 4I0BA 2EA2A 1FPQA 3D0SA 3WU1B 4EJOA 3DXJF 2YR2A 3FXDA 3KCCA 3ECHA 1UHMA 2F2EA 1J0RA 4XSXF 5ERIA 3HRSA 2OBPA 4GOFA 1OYYA 2Z5UA 3WTSC 5KVRA 1MJBA 4ZZLA 4AD9A 5A2QK 2BV6A 5D5WB 3FMRA 2DPDA 1FBUA 2HKOA 5LLQA 4OIQF 1K78A 5IT9Z 4AWXB 4QWQA 1P4XA 2E1NA 3MAJA 2B88A 4EJUA 3QP6A 2P6TA 1PDNC 1YTYA 4HV6A 1Z1DA 1I27A 3QWOC 3BPVA 4RAZA 1IW7F 4ENNA 1G3SA 4M73A 1RNLA 3Q9SA 5LHGA 3TGNA 4WXDA 4I2OA 1W5SA 5ICEA 4RB3C 1CGPA 1JM0A 2HYFA 2PMUA 1EH8A 1TW2A 1F9NA 1ZLKA 2IRFG 1SMTA 2IW5A 4KIGA 2FNAA 3GEZA 5JR3A 4UVBA 4HDUA 2DQLA 3TOBA 1XMKA 2MC3A 3R0JA 3COAC 4OMZA 4LMYA 1SMYF 5BPDA 5LRRA 5ILVA 2HS5A 5DYMA 3WU0A 2KIMA 3KP5A 1S7AA 4L9VA 4GGGA 4R8HA 4B09A 2F5FA 2GWRA 2JPBA 3HSEA 1FSEA 1IN7A 1QO0D 2A6EF 1SAXA 4ESBA 4BH9A 5CJ9A 1L0OC 1TTYA 1USSA 1RM1C 4BHCA 3ZMUA 2BGCA 4P9UA 3WGHA 3HRMA 4KICA 2O03A 1H0MA 3TOAA 1A04A 3DV8A 2UWJE 1SFUA 4KIBA 2GXGA 3V4GA 3FM3A 1XGMA 2Z3YA 1YQAA 3ISPA 2K4JA 3MZHA 5E8IA 1TQPA 1L3LA 4ZZDA 5CVVA 1BM9A 5K5QA 2ZMEA 5DCFA 1ZXGA 1BI3A 2ZKZA 1JMBA 3E6MA 2RN7A 2PQ8A 1LDKB 5D4RA 3ZMSA 2LXBA 6PAXA 3T8TA 3JSOA 4K35A 3E3VA 1ZRFA 5D6FA 1BIBA 1I1GA 4MN4C 1F5TA 4UXNA 2CGPA 3FXQA 4RB0A 4HF0A 2Q2EA 4S04A 4ZYEA 4BYYA 4IJAA 4YFNF 1OPCA 5H6QA 2DU9A 1J2XA 2NNNA 3KP6A 2LR2A 1H0TB 1P92A 3OV8A 3RGUA 5D5XB 2L54A 5FFZA 1TW3A 1IXCA 3LA2A 4GYGA 2WMMA 4PZJA 5DJTB 2D2WA 3V8JA 1ZG1A 2RC4A 2PG4A 2QZ8A 4LG0A 4IHSA 1J59A 2G7UA 3K1PA 3O3KA 2LXCB 4ESJA 2QVOA 1Z7UA 1LB2A 3N4MA 5TRDA 1KQ8A 2QQAA 2RQPA 4CGZA 3DKWA 5HLHA 4UUVA 1IN8A 2TDXA 3NEUA 4A5NA 2KI7B 2M5AB 2KRFA 4L9JA 4L0ZB 5AIQA 1R23A 4RB2C 2FSWA 4M71A 3GFLA 1BDCA 3GFIA 1IRGA 2V1DA 4YFKF 1U8RA 4JBZA 3FM5A 2ESNA 2FXAA 4XBFA 2LF7A 1BC8C 3BJ6A 1UHWA 4WXHA 2QYOA 4LLGF 2FMYA 1I6XA 4IPAA 3L00A 1IN4A 4K3AA 2GZWA 1QPMA 1ZARA 2EV0A 4ZYDA 2KIUA 1FSHA 1YW7A 1DUXC 4P55A 1JE8A 5H6RA 1XB4A 3Q9VA 3FF5A 1XCVA 4QLCU 3PQKA 1XDSA 5E17F 3F21A 2ZJ2A 3ZMZA 2NRAC 3GX4X 2HR3A 4JQFA 1ON1A 4HQMA 1Q2NA 3J7AO 1BI0A 2J5PA 2PEXA 4HF2A 2PFBA 2BBYA 2NNYA 5L3GA 5F1RA 2XHKA 1FWZA 3S1KA 1RZ4A 2OTKE 1J7KA 3ULQB 1R36A 5HS8A 1HXDA 2KIKA 1U5TB 5ICFA 1LEAA 2Q8KA 1PUEE 4RGRA 1G4DA 2EFQA 5C39A 2XAQA 2MH2A 1Y0UA 1HSTA 3PFIA 1G3WA 1EDLA 3EUHA 1YG2A 1OVVA 5HS7A 4A6EA 3KP3A 1O7LA 1TNTA 4UNOA 1T6SA 4O5VA 4A0XA 2FBIA 1XDUA 3RPQA 4L0YB 3DQVC 2RKHA 3S2WA 4EYYQ 2M30A 3ZMVA 4EJWA 3M8EA 3J80K 4MNUA 3CJNA 3GUDA 3H92A 4M6YA 3LFKA 2P7CB 1GXQA 2GAUA 4L18B 1FZPB 4ZMDA 3D5LA 4HF1A 2K3RA 4Q47A 3HRTA 3K69A 3J81Z 5HLIA 1TNSA 4BHBA 4G6QA 3F8BA 4CZZA 1TLHB 1LP1A 2KJBA 1LVAA 5HOOA 2LSOA 1ONVA 5LEJA 3WTTC 2A3SA 3WGIA 1BDDA 3BP8A 1YS7A 2CWEA 2XAGA 3C3WA 1HKQA 3KE2A 2CSOA 2G7HA 3G73A 3LSTA 2M45A 2ZMEB 2VBXA 1H9TA 2E7WA 2HWVA 4LK1F 2MH9A 1LJ9A 3HSFA 4XRFA 2CW0F 4HOBA 3EYYA 1HW2A 2P5LC 1CF7A 2A61A 4EM0B 4LLNA 2O0YA 4ZYGA 2HOEA 1T38A 2GA2A 2A68F 5CLSA 4G7OF 2B89A 3EQLF 3P9CA 2M5AA 1Z9CA 4R1HA 5J6XA 1QBJA 3DFGA 3ECOA 4G7HF 1X3UA 4U0WA 4G8XA 4KMFA 3B73A 3FHZA 3O6BB 3U9GA 4DQ2A 1MGTA 2B0LA 4RAYA 1WRJA 4G7ZF 2V9VA 3ZP5A 1XSVA 2EA4A 3WTUC 1Z91A 4G94A 1R22A 2X4HA 3V7RA 1JXSA 2XIGA 2UWMA 2EV6A 3KLNA 1ZGJA 2P4WA 3C1DA 4H0EA 2BE5F 2PI0A 4LLLA 4KN4X 1RUOA 2MD5A 2WWYA 2UXNA 4U0YA 4G6DA 2QM3A 2OU2A 2IA1A 3L09A 3VOEA 2UZKA 1P4WA 4EMSA 3KEOA 2VOOA 4RS8A 1MKMA 4YIIA 4HKZH 2FBKA 2VE9A 2F5CA 5K5OA 2IVMA 1BBYA 1T39A 2XROA 3BY6A 1IZ1A 1XCBA 3BWGA 1GXPA 4LG0B 5CVUA 2ZAEB 1I1SA 1W4MA 2STTA 3I58A 3QOPA 4F7ZA 2V6CA 3K1MA 3R4KA 2ZBKA 2VT2A 1FP1D 5FLXZ 5ED4A 1P2FA 3I59B 3R60A 3JAMZ 2XVCA 1FP2A 2FBHA 2YX4A 3HYIA 5K5RA 2Q1KA 3H3UA 2YPRA 2ADUA 4AIHA 1K79A 4M9SA 2IA0A 3GLXA 2KUBA 1ZLJA 2CG4A 3DPTA 4HX4A 1EV7A 1B1BA 2F5EA 2HFHA 2M8EA 4OIPF 1XN7A 4FT8A 3KLOA 4FX4A 1F1ZA 4NHJA 4A6DA 3LA3A 5D5VB 1IXRC 4M9XA 2B87B 3W6JB 1HKTA 3LAJA 1NH2B 1DP7P 4KMUX 3RKXA 1EH7A 1AWCA 1ZYRF 2ZFWA 1W7PA 4OU0A 3SQNA 4PGGA 3F72A 2PBIA 5FFXA 3L9FA 4ZYHA 4DNCA 1OR7A 3IRRA 2DTRA 5IT9K 1IXSB 2P6SA 5CVJA 4CHUA 3KP2A 3DF8A 2H27A 4P96A 2RNJA 4WF2A 3V8KA 3L2CA 3ZN1A 4U0VA 3BOQA 3MEXA 3K9TA 1O57A 2QVAA 3WE3A 5BQTA 1V4RA 2XKOA 1S8NA 1STZA 5L3FA 1XGOA 1MDMA 4I7HA 3J81K 1FYMA 4HB1A 4KJMA 4G9YA 2WV0A 1D3YA 3IL2A 1LT1A 3FZVA 4NPEA 2O61A 2KKOA 3VB2A 2SPZA 2P5VA 2ACJA 4OIOF 2A5YB 2JZYA 3J80Z 4CICA 2R3SA 1B59A 3I71A 2W85A 5EEGA 4MGRA 2EFNA 2R7DA 2DAOA 1ON2A 1XMAA 1IRFA 3HRUA 4WX9A 3IHUA 1MD0A 3PH0A 2EFOA 1ODDA 1W7PD 5EEHA 4HLYA 1KU2A 1REPC 2QUFA 1YW9A 2CFXA 2OA4A 1FBQA 2R7FA 2ZO4A 4KYWA 3OOPA 2MA3A 5L3BA 3IC7A 4GOEA 3BDDA 2Y0MA 2Y48A 2QQBA 3WG9A 4LJZF 5KK1A 3ERED 5L3EA 1X0TA 4HAMA 3JTHA 3IKVA 4A12A 2V1UA 2Q0OA 3WTXC 3AAFA 1G6NA 3MZWB 2E7XA 2HYGD 2YSRA 1FYLA 1ZHFA 1U3EM 2O3FA 3RKYA 4YFXF 1FBSA 3F22A 2G9WA 1HW5A 4HW0A 5JHUA 5DJUB 3SZPA 4NQWA 4AVPA 2A6HF 2K02A 3O2PE 2Y75A 4MTDA 1LQ1A 2HQNA 1YW8A 4A2UA
chains in the Genus database with same CATH superfamily
2CH7A 1EZVE 3CJHA 2PP6A 3M9AA 2Y0DA 3V4WA 3FKJA 3WTZA 4QPOA 3AE4C 1W36C 5H2FE 1ZN2A 1JNMA 5CCGD 3G6EI 1BJZA 1KC8Q 5IYZB 1KYWA 3ICXA 2PFXA 1NK3P 1S7OA 1F43A 2W6JH 4ABMA 1HH0A 2JRMA 1IFNA 2QWNB 3RK3B 3CCSI 3CC2V 5KHHA 1I94O 2VQGA 1QVGO 2ME6A 1LTJB 5IYBO 3MAQA 1YX3A 1XILA 2VKEA 2VQLA 5K7ZA 4BDYA 1R3IC 1VF6A 3R65A 3F8CA 1BE3J 4L9NA 3DEWA 4LNUB 4IL6Z 1X22A 2Z1DA 1IVSA 3T4ZA 2HKXA 2CV0A 4PUSA 3MKWB 3QNEA 2HPIA 2IPQX 2UXCB 2LH9A 2NVTJ 5CMUA 3V7CA 1SQVJ 1MSDA 5H2FC 5GTHC 1SVLA 1B72A 4IVNA 1YBKA 2IGOA 2Z16A 3L72E 1GZLA 2QEXV 1A31A 2K27A 3JD0A 1K4DC 1NTZE 5E8GA 4Q5SF 1MZBA 3M06A 3SZTA 2H8PD 3H1IG 2QM4A 1SVMA 4FLYA 1YQ4C 3ETEA 1IN6A 2QM8A 1PFIA 3ZQ7A 4GYIA 3PP5A 3FBNB 2EFPA 4W1UA 2AW9A 1L4AD 1W2BO 3HKZA 4U3FE 4ICGA 5TGTA 2QBYB 1SERA 2XASA 1ZH5A 5E1WA 1PP9E 2DQRA 2P58A 1YXBA 1HKSA 4LG3A 2QKSA 1K6OA 3I56I 2CQNA 1AOYA 1PV3A 3KEYA 4JI6B 3SPIA 3JAKB 5DTDA 5LEKA 1NVOA 3FX3A 4IHWA 3HUGB 4MTXA 4EI2A 1XMOO 1KU9A 2A06H 1X59A 4DRXB 1PL4A 1TVKB 1FEXA 3QPHA 5B1OA 4XDJA 1ZGAA 3TDUC 3LNQA 3ASOH 4D7NA 2Z9OA 2CE4A 2PYLA 3BCCH 4B4CA 1HOMA 4J11A 3JCUE 2DI3A 3KG2A 4BAYA 1VQPV 2XUBA 5L3DA 1NTKE 3C7JA 4XN3A 3MWMA 3AG2H 4DCKA 1MZFA 1NHLA 3MQ0A 4QJFB 3K2ZA 2ZYGA 3RPUA 3SYCA 2LGQA 1WWXA 2PLYA 1KD1W 1B6QA 2W48A 2QKAA 2F4MB 1BS3A 3CUQC 1ZMEC 3M1CA 5F64A 1GT0C 4FLTA 1V3FA 2FX0A 4E7SA 4HV5A 3UKMA 3SFIA 4KA4A 2MBFA 4WCGA 3WODF 3L70D 4MVRA 3M9QA 1VDFA 5KMGA 5HLGA 1JCCA 3JTGA 3RYCA 4TT3H 1IV6A 2TCTA 3HOTA 2ADQB 4NR1A 3KFWX 3MCZA 1RQUA 2R5DA 5IYDO 1EZVH 3OR2C 1M56B 1EN4A 2OIGA 3A1YA 5HNHA 2EIKC 3CD6I 2BOLA 4K0KB 3ABTA 4PV1C 3E6CC 5D4SA 2PMHA 2OQQA 2A0LA 5J8FA 1HW7A 2H8PC 4DT0A 2YX7A 5EC2C 1OCTC 4Y99C 3TP0A 5KAFZ 4OINF 3P7NA 1HW1A 2P5KA 4JI3B 1GW4A 4JOMA 4EEFG 1BCCJ 2KT0A 1VQ9I 5TISZ 3CCJI 1O9GA 3HXLA 2VXZA 1YJWV 3M8AA 4I4TA 4IF4A 1K5QA 1BC7C 4MQVA 1DX7A 2OQRA 3AG7A 1O4XA 1OVUA 2GIVA 2DLLA 1FX7A 2KISA 5E18F 2JRIA 1S5HC 4RUFA 1AU7A 1OXZA 1FYJA 1SQQG 5CJ0A 1JMMA 2HGCA 1PM9A 3E97A 5JCOC 2JSCA 2NRGA 3OGCC 3ML0A 5FKOA 4UB6H 2WPVB 2DTZA 1D5YA 3LNMB 4RGUA 4I0XA 4OMYA 4AIJA 1WJEA 2BOCC 3RK3C 4GT1A 3ABUA 1EZVG 3PL8A 2CV1A 1J2JB 2QQ8A 1QR9A 1Q7YQ 3AE9C 1R00A 1HSJA 1MA1A 3F89A 1SAUA 3HPGA 3W2WA 2EINC 3STLC 1R5HA 4RA2A 3OSFA 5B1BC 2WLNA 1VTNC 3SYPA 3IFMA 3V8LA 3MD2A 2GUSA 4OIRF 2P4KA 4GDFA 1MSFC 4BXUA 1U7MA 3K2AA 1GV2A 3HRNA 4EKWA 3LDEA 3RYCB 5KLVE 2HPMA 1THZA 1NQTA 1SQVE 1P84I 5L3CA 3CCEP 2FU4A 2GXBA 5LP6A 3PRJA 3BTLA 3ZRGA 1N8RQ 1ZAOA 3A5TA 2LP7A 3FMQA 3CO6C 2Q4PA 4KIFA 4EM2A 2NVUB 4GRIA 4O4HA 2ZR3A 3CC7V 2YO2A 1NTMG 4CDGA 3IP4B 1L4AA 3FB8C 4ZOLB 3D3QA 2JA7J 3H01A 4NYKA 1GM7A 1RP3B 2LOOA 3OYAA 1NI8A 4ON0A 2CQKA 2OT5A 1T56A 2Y4UA 4FETA 2DA6A 1VQ9V 3LSMA 2P81A 2WSFH 1XTAA 2VXDA 3I4PA 5GW7A 2DT6A 4RESB 1H9GA 5FLVA 1FOXA 1NAFA 3RWRD 2VPLA 5CJ4A 2JPCA 1ZOYC 1LTBC 4LIVA 3LSGA 4EATA 1B9MA 4CO8A 2MABA 3CX5F 2E76C 3TCUA 2YIUC 4DZOA 2FD5A 3T5XA 5APYA 1CZQA 5LHIA 2R7TA 3KPHA 1NTME 1T3JA 1WPXA 1IC2A 4CC6A 4BKXA 4AUXA 4NXNB 4ENJA 1V55H 1LDDA 1ZELA 3OEEG 2IDBA 2NS0A 4LFAB 3F7YC 3AG2B 2M0BA 2EX3A 4X1YA 1OR7C 4JV5O 5AVSB 1L8DA 1JVMA 2XAJA 3H1LG 3L74E 4DRXA 4AYBA 4ZTJA 4M74A 3L71H 1GU5A 3E22A 1LR1A 3ZPLA 1XGSA 5D8LB 2XAUA 1J9IA 1OHHG 1R1TA 2HDDA 1YTFB 3BABA 4EGYA 2R7SA 5DDGA 1SD5A 1MJ9A 4NB5A 1UFIA 1W0JG 3UQ8A 5CA1B 5LXTB 4UB6Z 2AXTZ 3A0HH 5B1AH 2WWWA 1FMWA 5KX5B 5KHIA 3BTJA 2V4JC 4WFFA 2DW4A 1Z77A 4NQWB 1BGYD 3U1DA 1N7SA 2MLKA 1A6IA 4ENKA 1O3QA 2WPQA 3G6EV 4ZDPA 1WJFA 2I10A 2LG4A 4LD5A 2N05A 4YJ3A 1QGPA 2IYOA 3GF7A 4C7NB 1FYKA 3K5OA 2W4SA 3GHGB 3T97B 1MMMA 1FKAO 5KLVH 4DV2O 5FD5A 4JI8B 3CCRV 1HA8A 5LOVA 4R4LA 5KHDA 4HG2A 2L91A 3B2EE 2FY8A 4FX0A 4PSWA 4E7IA 2XRNA 3ZQLA 4AC0A 3RK3E 2EK5A 3L7WA 3QRFF 5JJEB 3H1IH 4FLZA 3OW2O 2WBMA 2XV4S 3K7AJ 1NGMB 1BCCE 3S2HJ 3I56P 3OE7G 1NH2D 1TQIA 2GA1A 3UKGA 5IJ9A 3W7UA 2HQRA 4HRIA 4E7KA 3CWBH 2IM9A 2BY1A 1TWFJ 3OYBA 3IH2A 2B87A 2JJ7A 4FLXA 1KYOF 1SZXA 3A2KA 3EVKA 2M7BA 3HE4B 2A05A 2ZNZA 1KB9F 2Y0SN 3DC5A 4F4LA 2A5WA 2M87A 3E0JB 3MFKA 4W4KA 3EPZA 3OYFA 2J59M 1U78A 2W6BA 2E35A 2YICA 1PP9D 2X6BA 4BXFA 4Y7NJ 1HC8A 3DCFA 1XD7A 4KDPA 2J5UA 2OYOA 2M0MA 1FZFA 1I3QJ 1PZQA 3RK2B 1JEKA 2HOSA 3OY9A 1BJAA 1N77A 3TO6A 1RF1C 3ZGKA 1K78B 3AG4H 1YE9A 5FPOA 5KLVJ 1H88C 3AG4B 4RAIA 2FTKA 1K05A 2O01H 4E6KG 2KRCA 1FT9A 2HXIA 3M0AA 2M3AA 1EC5A 4N78D 1K3EA 4DR2B 3RBXA 3APOA 3AK1A 3K70C 2O5RA 5AIPA 2H6BA 3S2DJ 3CB2A 5IYCJ 3OR7C 4R8CA 1VF5C 5BXZA 1H38A 2RGVA 3TGUD 1H89A 2IPPA 3WB1A 4C46A 4ZHQB 1AI5A 2DMPA 2VKDA 4A3DJ 4AQRD 1PNMA 5BMVB 2HPCB 4MW8A 1KQFB 1E17A 2KZGA 5CPRB 4I9WA 4KISA 1UIXA 3WU2E 1HTLC 1FXKB 3F23A 2HZTA 5C44J 1VQOI 2FE3A 3C18A 4DGWB 4MVUA 3A7OA 3TK1A 2QGUA 1AI7A 1M93A 5DM6V 4ASNA 2P6JA 5BMZA 2W25A 3P8CE 3ASNC 3GFMA 1MNMC 1LP1B 2BXZA 2Q69A 2Q9IA 1S72I 5H2FZ 5APTA 1EDKA 3MD0A 1L0NG 3A03A 1TUBB 1NVPD 3JCUH 5IDJA 4F6RB 4EJVA 2CU7A 5ICCA 2KOGA 4JI3O 4YEJA 1UCRA 4OH8B 5HDNA 1L0LH 4J7JA 3R6SA 2ZCWA 4B7KA 2R5YA 2FNPA 3WTVC 4AQYO 1YIJI 2YXQB 1G2CB 4O3MA 1L0NJ 5IJ0A 2EIJH 4CCKA 1BI2A 3H36A 2KIQA 4I0BA 1N8RW 2JS3A 2QEXP 4NKGB 2GHYA 1KYOE 3ECHA 1UHMA 4XSXF 3HRSA 1E3PA 4GOFA 4XOPA 3RK2C 3I55V 3MKZA 1MJBA 4PDVA 2L7FP 3VMYA 2PY5A 1XG1A 5D5WB 2XRLA 4NC7A 5B3SB 4O4JB 3E8FA 5LLQA 2QKCA 1SFCC 3NFQA 1K78A 4AWXB 3OMNB 2KXPB 2HODA 1YTYA 1Z1DA 2XDVA 1KILB 1B06A 4P2ZA 2W6AA 3ZHTA 3W67A 4OXSA 2JJLA 4GX5A 3ASNB 4AUWA 3H32A 3TGNA 1NJIW 5ICEA 2GXAA 2WA3A 5AVZB 3FKIJ 1TW2A 5KHKA 2F48A 5JWPA 2NOGA 2L5QA 3H1KJ 1ZLKA 2FB5A 2XC7A 3BEHA 2FNAA 1NKZB 1QCEA 1SQXJ 1XMKA 2AEFA 2Q2EB 2MC3A 4BY1J 2F66C 3COAC 3LNNA 3L2VA 2KLVA 2YEVA 4I50B 1TC3C 5LRRA 2IU3A 5DYMA 3WU0A 3VP9A 2KIMA 2A45H 3K6GA 4L9VA 1Q82Q 2WT7A 5IWAB 4UFZA 2JPBA 2K9PA 1FSEA 3PO3J 2HVJC 3HPLC 3AE6C 1YI2I 1L0OC 3Q2YA 1SQQH 2HU9A 2IAIA 1RM1C 1IK7A 2DE0X 4KICA 3HD7A 2O03A 1H0MA 2UUCO 3OIQA 2IX7C 5J40A 4QPQA 1GKFA 1VF9A 2GXGA 4FCYA 3SSUA 3V4GA 1SVOA 3FM3A 5IYZA 3ISPA 5K7FA 3JAKA 2WSCJ 3MZHA 5E8IA 1TQPA 4BU2A 2ZMEA 2EIMC 1BR4A 1ZXGA 1M9NA 3KZIZ 1OQYA 2X51A 3C2HA 2E74C 1NTZH 3ZMSA 2LXBA 3T8TA 3JSOA 1E1RG 4UUJC 1ZRFA 2IZ0A 3OYCA 2LFBA 2DMXA 4KITB 1R6KA 2VJJA 4LF6B 3ZRXA 3QO5A 3UCSC 3JRBA 4BIZA 1D0YA 5B66H 3GLMA 3S17J 2LC2A 3R4YA 1KC8W 1H0TB 3ETQA 2DYSC 5D5XB 1WI3A 4H0LD 1IXCA 2GBYA 4GYGA 2KFDA 2BW3B 4DR2O 2J58A 2WITA 4OAZA 4PZJA 3N27A 3V8JA 2LBFB 1RRJA 2QWPB 3B09A 4QSHA 4CUGA 4LG0A 2JQ7A 3V2QA 4IHSA 3LSHA 3ZHUA 2LXCB 2NPSD 1TUBA 2BCCG 2O1JA 2QJYC 4WFEA 1RF1A 1F51A 1ZRTE 4XOTA 1QEXA 2TDXA 1H2MA 2JVGA 2CDYA 3HKZN 5BR8O 4L9JA 1VL2A 1U8RA 4YFKF 2IJKA 4PA4A 2ESNA 4BWAA 1WA8B 1DF4A 2WLLB 2QYOA 4LLGF 4LBEC 1S5LX 2FMYA 3OYMA 4XKBA 1XMOB 1JMKC 3CCRI 1SFCA 1YW7A 1DUXC 2KDOA 4I7ZB 4DYLA 3FF5A 4DR6B 1SVFA 1ZLLA 1LJ2A 4FK5C 1ON1A 4HQMA 1BI0A 1PYVA 3HJEA 4NBQA 2PFBA 3VYSB 1JO5A 3F7VC 2XHKA 5E3LA 1BGYE 3I3LA 3S1KA 4F6RA 1SA0B 2OTKE 1NG7A 3ULQB 5IPAA 1YZBA 1N33O 1R36A 1JFFA 2K9LA 2BVLA 2W83C 5J3LA 2DMTA 1QLEC 1RC9A 3ABLB 2H7HA 2KIKA 2Q8KA 1PUEE 4RGRA 1G4DA 2EFQA 4YIPA 1ZLZA 2XAQA 2YIBA 1SQPJ 4GKJB 1M56D 3KP3A 4W80A 1SF9A 5B5EZ 1O7LA 1K8AW 5HFLA 3OYEA 1PGQA 3SEQA 1YHQP 4O5VA 2E74B 4ITVA 2F23A 2KMUA 1XDUA 1NU1H 3AG2C 4BIUA 4IL6X 2JEXA 4EYYQ 2RQQA 4XORA 4EJWA 2OC6A 3M8EA 3CJNA 4LFBO 2OUMA 1XMXA 2GAUA 3SWYA 1KQSU 4DV7O 3D5LA 2X1DA 4HF1A 3EFFK 3QQAA 4J00A 5HLIA 5EBMC 3FXOA 4BHBA 3JARA 4IYHA 3GMAA 1YX5A 3AG1B 3ZQQA 4UCVA 1ONVA 4YRVA 3WTTC 1ZTRA 2A3SA 3TSIA 3WGIA 4BS9A 1YS7A 3BATA 5DN6G 4ZKPA 2CWEA 3W68A 2WPDG 2R7UA 3G73A 4P9OA 1MV8A 4X1IB 4B44A 2E7WA 3A0BH 4LK1F 4CS2A 3RBZA 2CGOA 5LYJA 3DGEA 1FDIA 2DA7A 2CS3A 2D2CC 4LC1A 1SZTA 2BASA 4EM0B 1QX8A 1JPXA 4ZYGA 4DZPA 2HOEA 2VL8A 3JAWB 1M4UA 4EFBA 1LGHB 1VQOP 1N36O 3MUDA 5LYJB 2G38A 5J6XA 2R7VA 2D2CD 3L72J 1D0XA 3ECOA 4C7UA 1X3UA 4ABZA 4F91B 3G2BA 4AU7A 3O6BB 1LWUA 5EZGA 1WA8A 5AVTB 1SFOJ 2R0QC 3CMYA 2B0LA 1WRJA 2MK3A 2DFHA 4G7ZF 2EA4A 1K9MW 1QHHD 3WTUC 1Z91A 2LKSA 1B8IA 2P5OA 4DJGA 1R22A 1JXSA 3JD1A 3RZDJ 4PA6A 5LMNB 2EV6A 3KLNA 1ZGJA 2P4WA 2VB6A 3OL4A 5F0FA 2PI0A 1ZX3A 4KN4X 4TUYA 1RUOA 1HR0B 4FM0A 1PP9J 2OU2A 1E3OC 3L09A 2PUSA 1N73A 2UZKA 2VOOA 4JI1O 1MKMA 4A3IJ 4HKZH 2CRGA 4O2BA 1KYOH 2AQFA 1JX9A 3K5NA 3G71I 2IVMA 1RHZB 2R4GA 3EUKL 4LNUA 3BR2A 3A8TA 3Q4HA 2XROA 4NTWA 2GLOA 1IZ1A 1XCBA 1XBLA 4LG0B 5CVUA 2ZAEB 1L4AC 1W4MA 5JLXA 3I58A 1OCZB 2W00A 5J1RA 3R4KA 2ZBKA 2VT2A 3BHPA 1P2FA 3JAMZ 5CN0A 2NZ2A 1K92A 3HYIA 1XMQO 1J1DC 2ELKA 3HTKA 1FS0E 2OYHB 1RE4A 3H3UA 4JASA 5FNVB 3RVZA 3HKDB 3VDXA 1K79A 2KDZA 4M9SA 2KUBA 2Y69B 2VKHA 2CG4A 2YS9A 2YI9A 2R72A 2M8EA 4RDUA 4OIPF 3VOPA 2G8YA 4A6DA 3CCUV 1I50J 2AO9A 2Z2SB 1IXRC 2B87B 4QMAA 5KLVK 4KMUX 4Z6YA 2R7XA 3SQNA 2QJYB 2EBIA 5EZYA 5EBLC 2OTLV 3L71J 2DTRA 1IXSB 5CVJA 1I5YA 3HG9A 2M4GA 3KP2A 1BSNA 3DF8A 3OS0A 1DU6A 4TV9A 2M9HA 3CMEP 1FTZA 3O65A 1AI6A 3ZN1A 2ZXWH 1Q90D 2A06E 1HLVA 3MEXA 2YKPA 3K58A 2WQYC 2R7RA 5AW7B 2RJZA 1MDMA 2CTRA 3L70E 4XDLA 3ZXSA 3J81K 3HOVJ 1ZRTD 1D3YA 5EGOA 3CCVP 2LLKA 5EF6A 1KILA 3VB2A 2P5VA 4OIOF 1SQQE 2JIZG 1H88A 1URQC 3C2GA 2VQEB 3PTZA 4A3MJ 1F36A 5CQGA 1XMAA 5EBWC 4ZJZA 4N21A 3BRCA 3VQVA 1ODDA 4FM1A 1W7PD 2LK2A 4HLYA 3APQA 1ROPA 3W3CA 2OTJV 1R8EA 2JA8J 4IHJA 1YW9A 2CFXA 2OA4A 2R7FA 5JH7A 3L36A 1IFIA 4LF8B 4IOAF 3KCXA 2DDBA 3BDDA 5F1JA 4GOEA 4MT8A 5KJ7C 2Y9ZA 3GWKC 1M1JC 1B04A 3SGIA 4IFMA 3IKVA 2BSKA 2YC0A 1N75A 4A12A 3GWOA 3LDDA 1MH3A 2V1UA 3BZCA 3AAFA 4PDLA 5KJ7D 2HYGD 1YTZT 1U8BA 3CX5E 2O3FA 1QVFU 4C7RA 4B3MO 2G9WA 5DJUB 3ZQCA 4PK4A 4XKVA 5E3OA 2H89C 5APXA 3BTCA 2A6HF 2HQNA 4LGDE 1PJRA 3G67A 1S9KD 4IHVA 2KKWA 2V7QG 4A2UA 1USEA 1DGWY 1K61A 1XL6A 1B3QA 2A45G 5GTIH 4YJ2B 3RKWA 1CP9A 3SXYA 4X64B 4ZHQA 3KEQA 1TVKA 3PSIA 3I64A 3LOCA 2DO7A 4B3RO 3RI4A 5B5EH 2RH0A 1RF0C 3MHVA 2WY8Q 3H35A 2XHBA 2ZXJA 4HSRA 2VQCA 3I54A 1BQ0A 2CGNA 5IT9N 2QJPC 1JJOA 2MKVA 4YG2F 2VBZA 1YCIA 1P84H 3HHHA 3T8RA 2DK5A 1FC2C 2K9JB 2JKVA 1SQVK 5ITZB 1S5LC 2IJJA 1KA8A 2L4MA 4CCJA 3BR1A 3LSKA 5LA6A 1ULYA 1HNXB 2AZ0A 2Q68A 4CCNA 4PV1B 1FU1A 5L8RJ 4L74A 3RL0C 3AG1H 3BQZA 2ZQMA 3GZ6A 2QENA 5AW5B 2Y0SA 1L0ND 5DV5A 3WG7B 2NNUA 2ID3A 5KKZB 3I56V 1MDMB 4HH2A 2DCEA 2XZRA 1SQBK 2OJED 2IJLA 4LLHA 2JA6J 4FFKA 4U3JB 5JCOA 2W1OA 2DT5A 3HPHA 5BU5A 5AW4B 3HBLA 1N78A 1EJ9A 1ZG5A 3TETA 4JZ2A 1RM1B 1R3JC 4X66O 1SQPE 1IZNB 2ZDIA 3DKYA 1JY3P 3W7XA 2DPUA 2PJRB 2E1CA 5M5YJ 3ZQIA 2DFEA 1VZ0A 4GIFA 5FRNA 2BTQB 4DYCA 3FYIB 2VN2A 5KAFC 1HDPA 1OJLA 2K9SA 1GTWA 4PFPA 1D2DA 2O8KA 3JRHA 1HWTC 2JS5A 3VYTB 1IJWC 3MGNA 2EJRA 1KZHA 1NTZK 1UB9A 3O6QB 4KXRA 1MBKA 2HJDA 1SQBH 4DR3B 4I98B 4UB8E 3HDDA 1NYHA 2Q5ZA 2JGUA 1CI6A 4D7SA 1S6LA 3CX5H 5H5NA 4BL0B 3THOA 3V2RA 1HNWO 1H8HG 2NS8A 2WY7Q 5KAIC 2XNXA 1FAFA 1JTYA 2G0EA 2LY1A 3RN4A 2FFDA 4RGSA 1JCHA 4U88A 1SQBG 2CV2A 3KIOA 4C2UA 3CLOA 2ZXIA 5B3SC 3TBIA 3K4KA 5E3MA 1SD7A 3LSPA 1KBHA 4Y15A 4UB8Z 3SJQC 2UXXA 2QR4A 4X89A 3CWBE 5ITZA 2E1MB 3JCZA 3T1HO 3L70J 5JH7B 2XV5A 3ZS8C 4RM3A 4F3QA 3GHGA 2KRHA 3TF5A 1FFXB 2QEXI 4IXAA 3TDZC 4X62B 2CTPA 5GADJ 2D2CB 1UELB 2QSIA 2EILH 4U3FJ 3E83A 2Q9LA 1FJGO 3OUSA 3SZGA 2YXRB 3M8FA 3NARA 1KILD 2M1BA 3TO7A 1AILA 1NR1A 4G28B 1LTGC 5CBNA 2KZIA 2YO3A 4D7MA 3ABVC 1YJ9V 2OZUA 4I02A 2ID6A 1P7GA 4NUBA 3G6EP 3PIOF 3U59A 3CS5A 3BRVB 1IBMO 1NHAA 4JTCB 1JUPA 1OV9A 5DCMB 1WSUA 1XSDA 1KFMA 4X1EA 5EC1C 5EZYB 1B9NA 4HQEA 3B8NA 2ETHA 4ZDOA 1ITYA 5KHGA 3F5WC 5B66C 4IHJB 3BG5A 4RLQA 2F1MA 3H1HG 2H6CA 4LB6B 2W8ZA 2Y0PA 4M6XA 1J5YA 1FOKA 5KA6A 1BR2A 1UFMA 3BR3A 2IBDA 2YS8A 3WGGA 3FKSG 4J19A 2RNBA 3I53A 2K3PA 1JY2P 2ATKC 3H1KG 1VF5B 5LMNO 3RJPA 1OCCC 4IIJA 1XS9A 1O3TA 2JGDA 1QL2A 4I0AA 1AQTA 2IA2A 2ME0A 1AQ5A 4I0XB 1Z21A 2BHZA 3WU2H 3CDHA 5F08A 1UPGA 3ZN0A 1JT6A 4WXCA 3CPWO 4DW6A 2Y0EA 2N04A 3RSNA 1FOSF 1WI9A 4DBRA 4JF7A 1X79B 1MNEA 3E6BA 2XAFA 2ZSHB 3SPHA 3TL4X 2XTAA 2Q7HA 1GK6A 2WB1N 5DUKA 3SPGA 4R50A 4Z1MG 5AW3B 2E5LB 3CUOA 2KL4A 2BOBC 1QBZA 2RNGA 3W6KB 2P7TC 3CXCU 4UUSA 5M3FJ 3WUTA 2FA5A 2AGAA 3V2PA 1MMNA 2XU6A 4FQGA 2JEUA 3H25A 4B3MB 4ASVA 1B6AA 3H1LD 1HUCA 4IHYA 2ZT9C 1FIPA 1Y74B 3S16J 2FYNB 4RJTA 3MMYB 2FRHA 1UMQA 2ETNA 3AEFC 3P9IA 1GN2A 3IWFA 4GO1A 1Z6TA 2ICWG 4PI0A 1FXKC 2J5OA 3K57A 1R1UA 3BCAA 2L7MP 3Q5FA 1ZGWA 2JA2A 1T95A 4JGSA 2RDCA 5GONB 3RYPA 3I5DA 4FM2A 1RF0A 4BWNA 3J7AU 1OFCX 3EDPA 4A3EJ 5APWA 2Y69C 1HNZB 1N34O 3FB5C 1YYCA 3QVNA 3Q5SA 1PIXA 1SA0A 2PX9A 3HUGA 3UO3A 3RYIA 2RN0A 2Z99A 3G1OA 4HZ3A 3BZ6A 3G1LA 3UR3C 2V6EA 2EZKA 1P7BA 1BI1A 1SFEA 3K5MA 2X85A 2LY2A 3IAOA 2EIMH 4II2A 2WLIB 3CRAA 4UCSA 4R6ZA 2LD5A 1LFPA 4K2EA 2OPTA 5AVRB 3CXHH 2K5CA 3W2AA 2HNHA 3II6A 2ZXEB 2P8TA 3OMAB 1CPYA 3ML6A 5C8YA 3E86A 3H9QA 4JYAO 1VQ5P 3IV5A 3LSJA 4EM1A 3ASOC 1SQQD 3VYUB 3EETA 1FJKA 5C4JJ 3D1NI 2A07F 1PP8F 1I08A 1YTFD 3NRVA 4PGHA 1N7SD 3NQOA 2O8XA 2ZXHA 2V7QH 2E1OA 3H1LJ 2R32A 1TBXA 3LA7A 4NPDA 3OYJA 2DMQA 1MBGA 1VFCA 3I55I 5LGTA 1G3YA 2A7WA 1KU7A 3OYGA 4BGDA 2FMLA 3IN6A 2DA4A 2M8GX 3FXLA 3C8VA 2QLZA 1FC3A 3E35A 1BL8A 2K85A 1IV8A 1VQ7I 2HHHB 3CMMA 1GL2D 1YHQI 3I59A 1OISA 3FXRA 1R5GA 3CWBJ 3HKBA 3QH9A 4EB6A 3DEEA 1X1BA 3HTSB 3K03A 5KLIB 5GTIE 1RE3C 1N32O 4XLHA 4ESFA 5CBOA 2BCCE 4C3JJ 5CYVA 3N7NA 2FOKA 4V2GA 3ZMDA 3RCOA 2I8DA 4RGXA 4UHTA 1NKDA 1FOWA 4CCMA 3E1SA 2JVDA 3SPJA 1U2WA 3F8MA 1KMIZ 3R61A 2C9LY 3HIFA 2PMZA 3RYIB 5ILUA 1IJDB 3AL0C 1NVPB 1HQCA 3CHXA 4GKKB 2FYZA 5FB2A 1SEUA 1WCMJ 2ZSIB 4MTFA 2FYUD 2UXBB 2X6AA 2XOKG 4CH7A 1QLNA 1GK9A 1IFMA 1BIAA 4UUTA 2IT0A 3WG7C 1QNTA 3PHLA 4F92B 3B02A 3BC8A 3W7SA 3M9HA 4B43A 3G9RA 3DLAA 2QKMB 1Y9BA 4HX7A 1JY3N 3VYRB 5D6EA 1N0NA 1YVWA 3DP7A 1C0WA 5LHHA 2Q6QA 1BZKA 3Q1MA 5E79Z 1XUQA 2QJPB 2LMDA 1J75A 1FOYA 1V5EA 2N1TC 4BJTA 2STWA 5A2QZ 1M1EB 5CHXA 3RTRA 3RGBA 1QHTA 2ZKOA 5K1XA 2YKQA 2PF4E 5EIBD 3ABKB 3VMXA 1FZCA 4Y33A 5IJ9B 1NJIQ 2X9DA 1T2KA 1ZR2A 2W24A 3DPLC 4LF8O 2GSMB 4HZFA 1Q1HA 2OGUA 4PCQA 1WZ2A 1JY3O 4BBRJ 3M9BA 3A2FA 1O3SA 3CMAV 4WFBV 1ZRDA 3HC7A 5IY5C 1YOVB 5LBQA 5EDNA 1WJAA 2IP2A 1BQZA 4DZJA 2DYRH 1S3JA 1YHQV 2LKPA 2V7FA 3CCMI 1WP7A 2V1XA 4GX0A 1ETWA 1M90W 1K8AQ 1IG7A 1LPQA 4B86A 2X6OA 5TJJA 4PD4H 1YYVA 5EGOB 3CWBG 4J9ZB 2E74D 3LDCA 1EXIA 3GVAA 5AW6B 2NN4A 3RQIA 3O8HA 3ABMB 1H0TA 4P9FA 4U7BA 3A0HE 5E1ZB 1AP6A 1LVKA 4FIPC 1KD1Q 1BE3D 2FYNC 1AFOA 3VEPA 3CDLA 2VQFO 3K0DA 4ZC3A 5LGNA 1ORKA 1FDMA 3TNUB 2DYSH 3TGUJ 5KNLA 2L02A 3AEEC 4UVAA 2QJ1A 3KZZA 4X66B 1Y8AA 3CUQB 3IKTA 3CC4P 5H20A 3B8MA 1BA5A 3PUBA 4CH4A 3E1RA 3AE8C 4BXLA 1TZLA 2WAQA 4WWIA 2BCCH 1LUVA 4E4EA 3ZRSA 2CTWA 3EUAA 5E1XA 5M5XJ 2VBWA 4FTHA 4LF4O 4KFCA 4IX7A 4LFUA 2P7VB 3CWBD 2JJ2G 1OLTA 2E75D 4WWCA 5J8CA 3MIWA 1FXHA 1ACIA 1LNWA 2P22C 1Y39A 4MS2A 2DMNA 3W7WA 3CF2A 4HX8A 1B4AA 1AJYA 1VQ4P 1P49A 1UG2A 4N23A 2R5BA 2K9NA 1UIIA 1SD6A 4H0LB 1M56C 1YIJP 3WU2Z 4ZOLA 3L73E 1KGSA 4HNAB 3H3ZA 4WY4C 4LK0F 1MMAA 1K7AA 1SQXK 4UV9A 3REOA 2F4IA 3TO9A 1W59A 1VQ9P 1UAAA 1K34A 2EA2A 3PN1A 1AV1A 3D0SA 3SFDC 3DXJF 2LYCA 1Q6HA 3SDBA 4DR1O 2BY3A 4BEHA 2OBPA 2Z5UA 1J1DB 4FFBB 5LOVB 1HGZA 2AXTE 2CW7A 2R93J 4YTPC 4ZI7A 3ABMC 2E1NA 3E2EA 1L4AB 4EJUA 1JQ0A 1OCOB 1BW6A 5B66E 4RAZA 2UXCO 4A5UB 3G4SV 3HD7D 4M73A 3CP2A 3UNGC 2W0XA 4OX9O 2XKMA 1W5SA 1CGPA 3ONQA 1MSEC 3OYLA 3OEHG 4WY4B 3OTOB 1F9NA 2QWOB 3VSLA 3ZR8X 1MBFA 4FVMA 1IUFA 4CH6A 1ENVA 2NVYJ 3MHHC 2E3CA 1CSBA 2IW5A 3AE7C 3GEZA 2UUCB 3H1HE 2I1JA 1DU0A 4HYTB 1KUQA 1SMYF 5BPDA 2DYSB 2HS5A 3AKZA 4PJ0H 3OWTA 3FX0A 1PPJE 1A02F 1HDDC 5AVQB 4GGGA 1SQXG 3CRRA 1G2HA 2N74A 4XL9A 1E79G 5KUMA 5IYBJ 2C0WA 4NXMO 3E1IA 2PTMA 1SAXA 1HNXO 2BSKB 3FXKA 4BHCA 2IJIA 2BGCA 1XL4A 4P9UA 4JPRA 2Q67A 1NTKJ 3HRMA 3DV8A 4FLUA 1W0TA 4XDKA 1SFUA 3DXRA 4KIBA 3BAAA 3ZHSA 1YQAA 4NC6A 1R4MB 3K4JA 1L3LA 4ZZDA 4B3TB 4LF7O 3CC7P 2G3AA 1BM9A 2QGNA 1VQKV 2QJKB 3BCCG 2R7QA 1JMBA 4U3FD 2WLIA 3CL3D 2RN7A 2PQ8A 4M3LA 3WHCA 3BR0A 2VRZA 4OGQD 4LITA 4K35A 3E3VA 1AVMA 2LQTA 2JSPA 4M3FA 4XLCA 5D6FA 4JI8O 1I1GA 2M3EA 2HG5C 2Y4TA 1K04A 2AHYA 1F5TA 1IBLB 2CGPA 3CCJP 4HF0A 2KLUA 1SQXD 4OPAA 4ZYEA 2IGNA 4WBNB 4MTOA 3CJHB 1YJNP 2HVQA 3L72D 4A3BJ 1KB9H 3K70D 3FBIB 2LREA 2DT7B 4RAFA 1FAVA 1DH3A 1IDYA 5GTIZ 3AE1C 2NNNA 3CCQP 3H1KH 2M0CA 1XNQB 3QOEA 5KLIC 3QO7A 2L54A 2P7JA 3ABKH 3BCCE 1T8ZA 1GU4A 2K9JA 2OF7A 5DJTB 3JREA 4O9BA 1YQ3C 1NG6A 2RC4A 1RETA 2G7UA 3OA7A 3K1PA 1X3WB 2YDEA 1J1EB 1Z7UA 5TRDA 1KQ8A 3L74D 2RQPA 1Y8QB 2CMPA 2XF6A 5B1NA 2CH0A 3WHBA 4YPCA 1IN8A 2A06D 2M5AB 4PJLA 2KRFA 2ZVOB 1VQ8I 5AIQA 2E1MC 5M5WJ 1SRYA 2CAZC 2HJFC 3FM5A 3K9AA 2AXTH 2LF7A 4EB6B 5JVDB 2ZJQF 2GZWA 1ZARA 3L72G 1PNKA 3BASA 1VQNV 1JE8A 3S3WA 4QLCU 3PQKA 2RCVA 2EINH 3F21A 1WFXA 1XHXA 2YU9J 3MHSC 3HGYA 1PD3A 3VYIA 3F5TA 3B5NC 1SANA 2N9BA 2PEXA 1KTMA 4BW9A 3CCJV 3BTIA 4XLEA 1HCRA 2WPRA 2YSUB 1Q1VA 2NNYA 1ORQC 5L3GA 2NR5A 2WAQN 1SQPK 4C9YA 1FWZA 4PFOA 1YTZI 5IYDJ 1YITP 1E3HA 3STZC 4X20B 1FDOA 1HXDA 1TT0A 3KKYA 1U5TB 1N25A 5C39A 4GKKO 2MH2A 4D5FA 1G3WA 4U7OA 3TMOA 4DXWA 4GLXA 1NT2B 3EUHA 1OVVA 2YXYA 1FE6A 3K08A 3P8CD 1T6SA 2E42A 2C2AA 4W7ZA 4DK1A 3DWLE 1JJ2U 4FZ1A 5DM7F 2EBOA 3ZMVA 3J80K 1PGOA 5IP9J 1G59A 2FQ4A 1R6TA 2K1EA 2P7CB 4A3GJ 3A0BC 5K7HA 4O2BB 3Q0VA 2R7OA 3CCMV 4DV7B 1FZPB 1R3KC 5E3NA 1MNGA 3L74J 1FMVA 1Z56A 4HSTA 1Y74A 2K3RA 1R1BA 1X1DA 2ZM6O 3HRTA 2Q3IA 3J81Z 2DWEC 1Q8IA 1BE3E 2GOXB 4G6QA 3F8BA 4CZZA 1FZCC 4FFBA 1LP1A 4HBNA 1LVAA 4DUZO 3K5BA 2GTAA 4BIOA 5LEJA 4FJCC 4X1KA 2MW2B 1VQNP 1Q86W 3BP8A 2ZJSE 4ZIBA 2DMUA 2ILMA 3PLNA 2XAGA 1HKQA 2CUEA 2M45A 2ZMEB 4XFJA 2JO1A 2LJ2A 1LWUC 4A7PA 2HWVA 3FFQA 3Q3SA 2MH9A 4LF4B 3HSFA 3K4NA 4XRFA 2CW0F 4HOBA 1SQGA 1N33B 2AEMA 3Q0UA 2DYRB 4QPKA 2O0YA 2WA4A 2IBZH 1RESA 4LF5O 4LF9O 3K04A 2QWRB 1U97A 3EQLF 4H13C 2M5AA 2OYHC 1CEZA 1QBJA 5FNVA 1IX9A 4IL6E 1RR8C 4U0WA 4KMFA 2KP8A 5GAHJ 3B73A 3FHZA 4DQ2A 4RAYA 1XNRB 2V9VA 2CH7B 1KN7A 1JY2O 4PD4I 2CUGA 4G94A 2EH3A 1HVVA 4KL1A 4I76A 3TYYA 1X58A 4CYCA 4DUZB 3L2QA 4JAAA 3HZJA 2R9IA 1AA0A 4RUEA 1Q5OA 4H0EA 5DECA 4PHZA 4JTDB 2BE5F 2K9YA 4CH3A 5LMUB 4G6DA 1H8AC 2L9VA 3CQZJ 1VQMV 1SQPG 4RS8A 1JKOC 3DBHB 3D36A 4DUYO 2FBKA 3WUVA 1L0NE 2VE9A 2ZDIC 4AM3A 5K5OA 5FJ8J 1H2LA 1T39A 1JTHB 3BRTB 3D70A 4U87A 2E5NA 4JI2O 1AROP 1NKNA 3BWGA 1GXPA 3H9GA 2RMKB 1I1SA 4X6AJ 3RT3C 2M8RA 2FYUE 5FRMA 4J80A 3QOPA 3CP8A 4F7ZA 2Q8VA 3K1MA 1DLBA 1QHGA 2GV9A 1FZAA 3I59B 3U1KA 4FZ0A 2XVCA 3HKBB 2FBHA 2UUZA 3SJMA 5K5RA 2Q1KA 4AIHA 3U21A 1JUMA 1VF5D 3CDIA 4L76A 3DPTA 1XREA 1KP2A 3GF3A 4O4JA 5J1YA 1YI2V 1B1BA 2F5EA 2HFHA 5KAFE 1XN7A 5IJ0B 4FX4A 4YXWH 4H0LC 4GKJO 1EZVD 1VI0A 3R2PA 1PUFB 5M1BA 2C9NY 3IH3A 4YJ2A 3G80A 1ZAUA 3L71G 4HEA2 4PJ0Z 3W6JB 1HKTA 2DA2A 3UT5A 3RKXA 1AWCA 1ZYRF 1W7PA 4CS3A 1M7LA 1OW7A 1WGXA 4W97A 2L0KA 1WJZA 2H1KA 2ZD9A 3CCSP 4Y3OA 2QDOA 5B1AB 5B3SH 3H1LH 5IT9K 1NR7A 2HYNA 4P96A 4H37A 2E36A 5KAIZ 3RK2D 1SQVH 2DJVA 3BOQA 5KJ7A 2QVAA 3WE3A 1TAEA 3E8BA 3TXQA 1V4RA 2XKOA 3BT9A 2KLOA 1AI4A 4I7HA 3FK6A 2ZM6B 2OV7A 4HB1A 2DN0A 4GX1A 1A02J 1FD9A 3D36C 5EK0A 4BE2A 4JI7O 2LVSA 1S5LE 2SPZA 3J80Z 4O2AB 1LTAC 2R3SA 3JRIA 1M1JA 3I71A 3BCCD 4J42A 5CBFA 3B6CA 2KNCB 5EEHA 1MW7A 2AZ2A 1QLEB 1WLEA 1EM1A 4QTRA 2ZO4A 2RAEA 3OOPA 3B77A 3JSLA 3FB7C 3QPLA 4DO2A 4M3DA 1FZBA 5KK1A 2X6WA 3ERED 2GUZA 1X0TA 4HAMA 2VUMJ 4GUNA 4PA7A 2LW1A 2QF7A 1OCCB 2H43A 1NTKH 3WTXC 3HKEA 3MZWB 3IAM2 2YSRA 1FYLA 1BHAA 2L5GB 3OUFA 1K9MQ 2YNYA 1Q43A 2O9LA 2WVRA 3F22A 2L6LA 4HW0A 1HW5A 5JHUA 4I55B 3B5NA 2B9ZA 3FWLA 4OVNF 5APSA 2K02A 1DQUA 3K59A 4UCOA 3T2MA 3DBLB 1SQBE 4IO9F 3GTOJ 1ENHA 1YW8A 3GTGJ 2H09A 3GW6A 4O4IB 2HLDG 5IP6A 1EA3A 3VTPC 2RV8A 2X7RB 1NTKG 4FLWA 3RYRA 4TV7A 3A02A 4BUPA 2KK7A 3HOXJ 4HYEA 3GZ5A 2X1EA 4I99C 1F7YA 2B63J 1JT0A 4E2LA 3EUHC 1ZW0A 3E8HA 3F3XA 5IOZA 4GX2A 5LGUA 2M7WA 2VQHA 1VQLI 2QTOA 1D1AA 2CO5A 1G8MA 5K1YA 2K1AA 3CCLI 3QU3A 2NAZA 3F6OA 2V26A 4ETSA 4KNYA 1P6RA 4E70A 3L2RA 2JN6A 3LSQA 1SFKA 3V2NA 2NS7A 3LSIA 2OTLI 1KQLA 1JHHA 4D0PA 2HFED 3G1MA 2QSGX 4JI2B 3JAMN 2R70A 2DA3A 5EEAA 2CUZA 4L9TA 2QBYA 1NOHA 3I4MJ 2AXTC 5FKKA 1T2KC 1T6AA 3ELKA 3WMM0 4CS4A 2WPSA 2EIJB 1W2EA 4BBSJ 3NR7A 1SQVG 3VPRA 3DSQA 1HP8A 1KONA 2JMWA 3SJAC 1W5TA 2D1HA 1LFUP 2VOPA 4DYRA 2C6YA 5K5GB 2KNCA 2EIMB 3CCYA 2Q7CA 5BZBA 1T8IA 1FZCB 1AR1B 1Z05A 2ISZA 1Q6IA 3ZRWA 2OD5A 3M91A 1ZL8B 3U0ZA 1F4KA 2BCCJ 4CSWA 3GTKJ 1ETOA 3MDSA 1VQPP 4IT5A 1GDTA 3SYTA 1QQIA 1P84F 1TWGJ 1X1PA 3C2BA 1M57D 4LF7B 3V4QA 5APVA 5DD4A 1Y1VJ 2O1KA 5GTHZ 3E5QA 4UV8A 3DU6A 1SC5B 1I5ZA 4B3AA 1APLC 1W7PB 4HA8A 2LDUA 2PGGA 4PD4E 2YXLA 5TJHA 5HFMA 1KYZA 2MD0A 4W7YA 5GTHE 4P9PA 1OZ0A 2UUAO 1DK1A 1Y66A 3TXSA 4HYOA 4UB6C 1KV4A 1KECA 3H1CA 3CC4V 2HHHO 3CSXA 1JJ8C 2KS1B 1KORA 4XKWA 1YF2A 2EZPA 1DTOA 2HG5D 1YJ9P 3AEBC 1LE8A 2R5ZB 1CF7B 5CB4B 1ETYA 2ZE5A 1MOFA 3TEDA 3CCEV 5AVVB 3EQ2A 4HPQA 4KT5C 1FNNA 1V54B 3E5UA 3K0GA 3H1JJ 3M99B 1KQ9A 5FD6A 3OMYA 3A01B 3ZMTA 3S1RJ 1I7FA 2Q6AA 1ZG3A 1QZYA 1J09A 4PI2A 2AEJA 3C90A 1AKHA 1WNSA 2DW3A 4MFEA 2KIFA 3CCRP 1N2DC 1I0HA 5IY5B 2COBA 2BE3A 5J9PC 2Q7EA 5IYCO 3HHGA 3ZHVA 5GTHH 3RYHB 1URQB 1DDNA 2M4KA 2DFFA 3QTCA 5FL7G 2QCOA 2X0LA 3M0DA 1N73B 2E34A 1RKTA 4IFDK 1WJBA 2BCCD 4MFDA 2IZ1A 2NYXA 3ESWB 4IQ4A 3PJRA 2F4OB 1P84D 5JVTA 1HR0O 3D3IA 3VN0A 4GCVA 4XK4A 1SFXA 2YUAA 2WC2A 1R73A 3RDIA 1K73W 5HVQC 4PV1D 2DJNA 4B3XA 3X2QC 4O4HB 4WBNA 1NZ6A 2MW8A 4P1WA 2O3JA 3FXMA 1ZR4A 4DOZA 2ZXWC 1E0EA 1R5SA 4PDRA 1HNZO 5DD8A 2EIKB 2KPMA 2IS6A 5GAGJ 1I94B 2GM4A 5BS6A 3TGUH 1OCOC 5HLTA 2HEOA 1JKQC 4HDVA 4KT6A 5AW2B 4WF9V 1FLIA 3PQJA 1YIOA 5KUKA 1T0FA 2BEOA 1M90Q 4DW0A 1KQSO 1M5IA 2XT9A 2POHA 3H1JD 5GAEJ 2IS2A 1BE3H 2EFWA 4YY3B 1WH5A 2P90A 2NOJB 3A2AA 2JTVA 4YIFA 4XLNF 4CCLA 3VWBA 2A06G 4WY4A 1NO4A 2XAHA 1AVYA 3LL7A 3OTFA 3DTKA 3B6AA 3L2UA 1KB9I 2UUAB 3OYDA 4CPGA 4ZH4F 5EIBC 4ASWA 3OMIB 2CQ7A 3CC7I 3CJTB 3ZEDA 1WMKA 3BG3A 3N2GB 3HOSA 3E89A 1YO5C 3T1BA 3MZ8A 3CUQA 4A93J 1US6A 1BCCH 5B5EE 2QE7G 4EVIA 3LQQA 1MNDA 4IGGA 2ZE6A 1QRYA 4AYBN 3V6IA 1H8AA 4D6TG 1URQA 5KAIE 2K4BA 3HSRA 1NTZG 2LY9A 2WA0A 4X9QA 3IF4A 4N9IA 3E22B 3BG7A 3JATB 3TW7A 3KHUA 1RFYA 4LWSA 2Y30A 5DEDA 4U7DA 3OW2U 3J80N 5EG0B 2PYJA 2E2HJ 1GHCA 5AG2A 3WTWC 1JGSA 1U6GA 3P5JA 1QLED 4Z1MH 3AEDC 1TQMA 3A4CA 3OIOA 1BT8A 4Z2YA 1XTGB 1U5TA 3S1QJ 1JFFB 3HTUA 1VQMI 3DEUA 5FLXN 5C3EJ 3ZOBA 4PJJA 1QU3A 4DR7B 2N9YB 1Y47A 5F0HA 1AJPA 3RZOJ 3D6ZA 1GMJA 2CUJA 1N36B 1A32A 1GL2A 2EWNA 5AVXB 4C2MJ 2W84A 3VP8A 3H1HH 2ZNYA 1A5JA 1G6UA 2VC1A 2E60A 3JW4A 2XNDG 4BE1A 2M5WA 3NAUA 1OKRA 1FZGA 2F5DA 2DN9A 2EV5A 3TKYA 3K0LA 1L0LJ 3B4SA 3LWFA 2YU3A 2D45A 2V4HA 3P30A 3RQ4A 3PSFA 1URFA 3RW0A 1EH6A 2WT7B 3L4FA 5CVIA 3BJAA 3AE2C 5E79E 3E7KA 3FD9A 4XSZF 1RH5B 4IZZA 1WT6A 2DOEA 4OGQB 5AW8B 1NTMD 3QP5A 4B08A 3CTAA 3AEIA 4DV5B 1DD3A 1FTTA 1IFJA 2HTSA 2CK3G 4ASUG 1NTMH 4XQFA 4RAGA 2PI4A 3JSNA 1VF6C 1HNWB 1AP5A 4JAVA 1K83J 4EIJA 1EDIA 2VRSA 1ZK8A 4G12A 1XOUA 3BA9A 2HQAA 2GUZB 1YJWI 4RLFA 4KHXA 5LD2C 3CCLV 2X1CA 2ZT9B 2OARA 2JVHA 2JWDA 3GF2A 1WQ2A 5F2VO 4DR1B 1N73C 3I55P 5DCMA 3SPCA 1ZQ3P 3CCMP 3EYIA 4V19K 1IDSA 4J7ZA 3SFEC 3GTQJ 2JK3A 3ABMH 3I0TA 1VARA 1Y4MA 5BPIA 1AB3A 1S72V 4XRSG 3K79A 2LF8A 4B8XA 2ZVNB 4MO7A 1LEBA 3N05A 2P4VA 1G4YB 3BVOA 5KAIH 1KILE 1TT5B 4MVQA 1M1KQ 4XLPF 2WLKA 4UCTA 1T2KD 3HOYJ 4ZKIA 2KG7B 3J81N 2OQGA 1R6RA 2PZSA 3CZ6A 2R44A 2B7EA 4F52A 2IGMA 2L9NA 1SQVD 5AW1B 1P4AA 3TNUA 3VMZA 4L5JA 4HJGH 1W0UA 1SETA 2Q5UA 3P9KA 4PJNA 1FXVA 3GYHX 4X1YB 1XSXA 1X1AA 2V7QJ 1HGVA 4GZRB 2E76B 2P06A 4DR4O 4IEJA 4X65B 1ZREA 2CPBA 2O7OA 4E4HA 1YEWA 3FAVA 1IDZA 3H3VK 2AXLA 2FEZA 4II3A 4ZBMA 2LFSA 3K10A 3UT5B 3LUTB 5D5UB 1RSOA 4PJ0E 3CCUI 2V1NA 5FO5A 1A35A 4IHTA 3BROA 2HDWA 1PPJH 3HR0A 4BQOA 1SP4A 4I50A 2XSDC 3OYIA 4JYAB 4JYKA 4WY4D 4MW3A 1ZV8A 5DUIA 3IC9A 1FS0G 3EHBB 5BOXA 3HUSB 1AR5A 1W1WE 1S7EA 1U5TC 3LSUA 3CEIA 1DPRA 1J95A 4HNTA 2IBZE 4ZI7B 4DIQA 4Z1VA 3KZIE 4I09A 3HOUJ 3TDKA 2QIWA 5CKTA 4TSFG 3RIRA 4KHPO 1KQ0A 1OCPA 3HKDA 3GXOA 2VT3A 3KETA 5HNFA 1DPUA 3N97A 1Z6RA 1URQD 3RL0D 3M1EA 4DR5O 4EGZA 1W5CC 3A0HC 3CXHI 3EXAA 3JSPA 2DK8A 2PGDA 2E5YA 2WLHA 1Z3YA 1H2SB 1OWAA 3K1NA 2YMKA 3FB6C 4FHTA 4KN7X 5E79H 5IY5H 3GW2A 4BRYB 4MTEA 1EXJA 1IRXA 4DYQA 1H2KA 1ZWIC 4RWUA 2NPSC 4EEQA 4YY3O 3OJAB 3G3ZA 5JHFA 4TUYB 4RB1A 3OAAG 5LMUO 3GO5A 1Z0XA 4A0ZA 2K7LA 4LFAO 2H8RA 2MLGA 4LWSB 3E6DA 4DV0O 1BN5A 1UJ8A 2JDIH 4UY8I 1RY3A 3FWNA 3F8FA 3C3TA 1XHZA 4N0BA 1DF5A 2A69F 3G4SP 3P7KA 3O9OA 2OTJI 2VS0A 5AVYB 1FIAA 2BHYA 4A5MA 1IXBA 4G2KA 3OIPA 2R7ZJ 2Q73A 1KFNA 4WB4A 3LAPA 1HDJA 3RK3D 1JTXA 2N1TD 2F93B 4LP8A 4DV3O 1WJ5A 1HF0A 4KUMA 5GPCA 2KB1A 3HOWJ 5HDGA 1F4MA 1LT9B 3JD4A 2X6CA 5DEQA 2M34A 2BY2A 2L4AA 5EJCA 3UO2A 3PFYA 1PUFA 1OCRH 3M3YJ 4Y99B 3SDGA 3C3SA 3LSSA 3PJSK 1U9OA 2QQ9A 4TV8B 5JI6A 4L8JA 1OCRB 3I5CA 1VQLV 1U7JA 2HPCA 4U3FG 3H9VA 1FPQA 2DA5A 3KCYA 1IXMA 4EJOA 4JPZB 2YR2A 3FXDA 1WJDA 1KILC 2AXCA 2FFDB 2DJIA 4RM2A 4XMYA 2DOSA 4ZZLA 1VEWA 4YHHB 5A2QK 3LSRA 2BV6A 3Q4HB 5KCMA 3AG4C 4EDFA 3SYOA 4OIQF 4QWQA 1P4XA 1LT9C 3JALA 3MAJA 2B88A 3QP6A 3L75G 2P6TA 4HV6A 3L75E 1L2PA 1Z5WA 1IW7F 4ENNA 4N6JA 3LFUA 3OT7A 1G3SA 3K3WA 2NVXJ 3NXSA 2VPRA 5E79C 1V5GA 3Q9SA 2ZFUA 4AYCA 1L0LE 1D5NA 3PNVA 1BCCG 4RB3C 1JM0A 2HYFA 1EH8A 4JI7B 1PGJA 1R49A 2IRFG 4WBAA 1SMTA 3VMAA 1MH4A 2A9HA 4JQ0D 5JR3A 4UVBA 2AHZA 2IBZI 2FKXA 4HDUA 2DQLA 1F4NA 3FDYA 1IGNA 5DM6F 2KS1A 2E5ZA 4UUSB 2EZLA 3HE5A 1VQMP 2D5VA 4A69C 3OYNA 5BVZA 3Q3DA 3RYFB 4XA4A 2E2JJ 1SLQA 1USDA 2O01N 1GN6A 3SWFA 2ZCEA 1S7AA 5LFAA 3K4BA 4DV1O 4B09A 4R8HA 3T4DA 4NC8A 2GWRA 5EYPA 3L75H 4B7EA 4J41A 1YRNA 4ESBA 5CJ9A 3DU5A 2E75C 2OCHA 1TTYA 4QE9A 2Y69H 3ZIAG 1MUUA 1X8YA 3WGHA 3G71P 2R5ZA 3ERMA 4KT0J 4J7KA 3OAKA 3ZX6A 2JGDB 2QSAA 1SFCB 5FKLA 5CBGA 3S3OA 4QNHB 1PL5A 1XGMA 2OTJP 4GCZA 1MBHA 3Q0WA 2AHQA 5DCFA 4YIRX 4CH5A 2PI5A 1NK2P 1LDKB 3LIEA 4FE7A 2BXYA 2HODB 1JOYA 3BG9A 1ETVA 4DV6O 3PNTA 5EG0A 3HOZJ 4MN4C 4LF6O 2Q2EA 5K1PA 4S04A 3K5LA 1G8XA 4YJ3B 5FKNA 4IJAA 1IRZA 4YFNF 1OPCA 3JALB 3L73G 1J2XA 4GYCB 3KP6A 2FL4A 2LR2A 3QODA 1P92A 1IZ3A 4QIWF 4E7JA 3OV8A 1XNQO 1JR9A 3L71E 1T33A 1I6HJ 2VI6A 2ZNJA 3CCSV 5FFZA 2QA4P 1TW3A 3QO8A 1GD2E 2WSSG 2HLOA 2YIAA 4Q20A 4A3KJ 2R9AA 1FFXA 1K4SA 2D2WA 4XNFA 1ZG1A 2QZ8A 4DW1A 1V9PA 2WSEJ 4L5EA 3O3KA 5BNGA 4ESJA 2KSEA 2B1GA 3QYBA 4N3YB 1LB2A 3W6VA 2ZJPF 4QPJA 4K8XA 5TISE 2LRDA 3DKXA 2Y31A 4CGZA 4DR5B 1KQGB 4MVSA 5JVDA 4UUVA 2KQXA 5BY1A 4A3JJ 2KI7B 4XM3A 2D3OW 2QJKC 4RB2C 3GFLA 3KYCB 3GFIA 1NTMK 2V1DA 4JBZA 2HOAA 4XKCA 3BJ6A 1BC8C 5J2TB 4IKFA 1I6XA 2LGWA 4IPAA 3L00A 4K3AA 3AE3C 1QPMA 2EV0A 4ZYDA 1FSHA 1VF7A 2MJZA 1DGSA 4P55A 2WSCH 1XB4A 4IL6H 1XCVA 4I1LA 2N1TA 5E17F 2ECCA 2ZJ2A 2VJ5A 4BQNA 1GAXA 1SQQJ 5CQEA 3GX4X 3CI9A 2PJRA 1Q2NA 3J7AO 1D7MA 4DV4O 1JOCA 3GHGC 1I39A 3C1LA 1ETKA 1NU1G 1J7KA 1R5LA 2VJ4A 5HS8A 1K5SA 2B9SA 5APUA 2Z5HA 1T08B 1JTHA 1UG0A 2UXDB 1EKEA 3H5NA 1MABG 3M07A 1EQ7A 2WZ7A 4N78E 2XF5A 1EDLA 1TU3F 5HS7A 3CMEI 2LR8A 4YXDC 4JI6O 3E7LA 2ZC2A 4AHCA 4QE7A 1SQPD 2FBIA 1PV0A 4L0YB 3DQVC 4I55A 3L72H 2PMZN 2RKHA 3S3XA 3IAS2 1L0NH 1ETQA 3T1HB 3MUDC 4XE5B 1Y0NA 2L7KA 3QYEA 3GUDA 3CE2A 3RKQA 4M6YA 4YHHO 3LFKA 1NWQA 1GXQA 4BJ5C 3JSVC 2VQFB 1W2BU 2R92J 4J10A 4OPHA 3K4MA 4H4KC 4RO0A 3VSKA 1NTZD 4Q47A 3S4RA 1VP7A 1TNSA 3CMAP 3KYDB 4TV8A 1AVOA 1NU1D 5HOOA 2ZE8A 2OWOA 2DA1A 2WLLA 3HE4A 1M57B 3L74G 1I3AA 4LOCA 1V54C 1PGPA 1BDDA 1LT9A 3AECC 2H1LA 3C3WA 3TGUE 1HBWA 4XIDA 3KE2A 5EZHA 1H9TA 1Y56A 3B8EB 3DTIA 1Q81W 1IBKO 1LJ9A 4EOTA 5J2TA 5KKZC 1HW2A 2P5LC 2BTOA 4X8AA 1FFTB 5D5QA 4S0HB 4CZCA 2A68F 5CLSA 2B89A 3O8ZA 5C93A 1CW5A 3QPSA 3OYHA 2HQ5A 3DFGA 1Y6XA 3FX7A 2P10A 2QKLB 1PPJG 1JKPC 1MMGA 3U9GA 3JRAA 1MGTA 1HF9A 2UV1A 2W7NA 1KKCA 2I1KA 3ZRVA 5FLMJ 1V55C 2XIGA 3AK2A 2ZIMA 4EFEA 1OW6A 2UWMA 3P32A 1L1FA 3C1DA 2KQRA 2A6TA 1OCOH 1OJHA 2BZTA 2VASA 4LLLA 4F6EA 3E8GA 2WWYA 2XGCA 4R4MA 2UXNA 4U0YA 2QM3A 1A6QA 1Y76B 2IA1A 3VOEA 3DC6A 1ZUQA 1WJCA 3BG6A 3Q5RA 4EMSA 3L74H 1SQQK 3JRCA 4M6VA 1H2NA 4YIIA 4A3CJ 1NBMG 1J5EO 2DXIA 1BBYA 1WH7A 2LTPA 3OR1C 4RBOA 1K97A 1RPWA 2M2EA 2V6CA 4LR3A 2ITAA 1FP1D 3TP3A 2EINB 1PPJD 2H8WA 5FLXZ 4I2LC 1NU1E 3P3NA 4RKUJ 3R60A 1IBMB 2OYIC 3CXHE 3JR9A 1FP2A 2YX4A 3ZQHA 2X6YA 2B1IA 3F5HA 2Y2ZA 1YRNB 3H5AA 2YPRA 3AG3B 3SEZA 4XRSA 4I6MC 1M57C 2Q7GA 4JI4B 1QR8A 4HX4A 1EV7A 3J7YJ 1L0NK 3KLOA 2OIEA 2FXOA 3K9SA 4FPPA 4B3TO 2OCCC 4RMNA 4JX5A 5IE9A 5LL6Y 3LA3A 3T1YB 1X3ZB 2WAFA 5D5VB 4M9XA 4BEHB 3PM1A 3IR9A 2NPSB 4D6TE 1NH2B 5GONA 4D5CA 2Y0IA 2WSFJ 1EH7A 2ZFWA 1GK4A 4OU0A 1VQ6P 2OYQA 2HI3A 1LUWA 4PGGA 1BR1A 2ELJA 2PBIA 5FFXA 1Z5VA 3H32B 4DR4B 1VQ6I 4ZYHA 1OR7A 5IOYA 1SQPH 1LTTC 3N4XA 2Z4EA 1N0JA 1EZVI 4CHUA 3ZBHA 1IC8A 2H27A 1OZHA 1Z7LA 2RNJA 4WF2A 3L2CA 3SJCC 4Q6GA 3JD3A 3ZQGA 2ZT9D 2VQEO 4X88A 5BQTA 1S8NA 1STZA 3VBBA 4DBQA 1BGYJ 1XGOA 5B1BB 4NDLA 4KJMA 4G9YA 2WV0A 1K33A 3B5ND 4NPEA 2HVKC 2W6JG 1X4TA 4F93B 2ZYDA 2KKOA 1UHSA 2A5YB 2ACJA 2JWTA 4CICA 3FISA 1O9HA 4PJ0C 2B5UA 4X0GA 1MZ9A 1PP9G 4WVZA 2HVSA 1DD4A 4XONA 1G2CA 4RQFA 2EFNA 2DAOA 3IGAC 2Q0AA 1ON2A 2WB1A 3S3MA 4WX9A 2DWDC 1MD0A 2IFMA 4M3EA 1LNQA 3PH0A 4G27B 1KZUB 3AL0B 1REPC 2QUFA 2PAJA 2CUFA 1AKHB 1FBQA 2XUMA 3HTKB 3D5RC 2DOAA 4PA3A 3IC7A 5KLVG 2Y0MA 2QQBA 3S14J 4KP4A 2GBOA 4CA0A 3KYLA 4M3BA 2MYSA 2O57A 1S5LZ 3X2QH 1WP8A 1YSCA 2E43A 3I9V2 1QVFO 5KAFH 2BW3A 3JC22 1E5WA 1G6NA 2P0WA 2E7XA 2CJJA 4LF5B 1N32B 1SESA 1RKWA 3PUFA 1FPOA 3RKYA 4E7HA 1JA8A 5IP7J 5B1AC 4D7TA 2E75B 3SZPA 4NQWA 4AVPA 2XB0X 1TL8A 4TV9B 2OCCH 3S93A 2LNBA 2QG4A 2DQ3A 1RIOH 1KKDA 4JTAB 3U2RA 5HDKA 1W0KG 1U0JA 1DGRM 1WRGA 4JYYA 4IRGA 3FAVB 2IJHA 2JDIG 3WU2C 2MSYA 3V7SA 3H9JA 2EZIA 3OM3B 3V42A 1O7FA 2FBWC 4M9ZA 2WTYA 5EFWB 3T1YO 5KLVD 1RUNA 2K37A 2CFOA 4S05A 3IWZA 2IS4A 3HM5A 4IOIH 3ABKC 5FROA 2YEVB 1D1CA 3AEAC 2IS1A 3C9IA 4DR7O 1MJAA 3VQXA 3CCEI 5AONA 3B71A 2P1JA 4RO2A 2D1VA 3EFGA 2MGQA 3GWZA 4JI1B 2IEKA 4MQ9F 4LH7A 4EV0A 1DEBA 1NH4A 4JI5B 1XEQA 2ZE7A 1M8OB 1IBLO 2H94A 1RI7A 2FYUG 1LUJB 3D6YA 3A0RA 1AA7A 3AK3A 3F8NA 1T0FC 4UB8H 5LP6B 4CXFA 1B72B 4FLVA 3H0GJ 2OAZA 2Q1ZB 2XDJA 4IHXA 4IFFA 5CA1A 4HNAA 4M72A 2CW8A 4IL6C 3AG3C 3H1JH 1SQBD 4PJMA 4DV2B 1BGYH 4P5OA 2EJ7A 3B40A 3CPWU 1VQ7V 2NXNB 1NU1K 3VFZA 3ETGA 1VQ7P 1LTJC 4MSWC 1XC5A 1JKRC 5J2UA 3CX5D 3SWKA 2E19A 2FKWB 2ZYAA 3FWEA 2F95B 4BXXJ 1YJWP 4DOJA 2BY0A 2XKPA 1IN5A 4I01A 4MEYF 1SS1A 1QU7A 4DV3B 3SJBC 3ZHQA 1RPOA 4JF3A 4AIKA 1GN4A 2N8GA 3HD7C 2Y9YA 4C2TA 1QVGU 1OW8A 3JRGA 2N1TB 3BR6A 1JUNA 1ETXA 3QPTA 3H1JE 1SQFA 1FY7A 4CYCB 3H1JG 3K4LA 1TWCJ 2LKXA 1H89C 2OYIA 2ZMEC 2DOFA 2K86A 4LB5A 5CCGC 2F43G 3CCVV 4IRIA 2F6CA 5CVRA 2EULA 2L01A 3J7AY 3OGIB 5M3MJ 2FF4A 1F23A 1LDJA 4GXOA 3RL0B 1RPRA 3CD6P 1RF1B 1CI6B 1P7JA 3ZCCA 4BNCA 2F4VB 2JEEA 3L37A 2KSDA 3KYQA 1TWHJ 4A3LJ 2RVCA 1OMIA 4GODA 1L0LD 1BSHA 4K0KO 3AG1C 2LBFA 1JHFA 1BE3G 3RFRA 1VQ5V 4A0YA 5HODA 2VODA 1QZZA 4XICA 1K4TA 3MTUE 1VNDA 1Q7YW 1QVTA 2RDPA 2UXBO 2ESHA 3S1NJ 3FMSA 3GFJA 5KX5A 3RL0g 1RE4C 2K9QA 1RQVA 4N4NB 3CRQA 3H1IE 2WAEA 2DFIA 2E71A 3ROUA