1S3JA

X-ray crystal structure of yuso protein from bacillus subtilis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
SADQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYLSFLTEEEMLQAAHITAKLAQAAETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of YusO protein from Bacillus subtilis, a member of MarR transcriptional regulator family
rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords YusO protein
total genus 47
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s3jA02
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1s3jA03
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1s3jA01
2UWMA 2B0LA 1JMBA 2NS0A 3MCZA 5F1RA 3ECOA 1FLIA 3E5UA 1ZARA 1FOKA 1USSA 1D5VA 1KA8A 2R3SA 4U0WA 3VEPA 1F1ZA 1S29A 4XSXF 1IN8A 2K02A 3GLXA 4CICA 3WGGA 2D45A 1BBYA 4KNYA 1XDSA 1P92A 1MD0A 4ZYDA 1O57A 4OIPF 1ZG3A 1REPC 2ESNA 3P9IA 2W85A 3K1MA 3D0SA 2LNBA 4RGUA 2QRXA 3E35A 2VE8A 4LB5A 3VODA 3W7SA 2HGCA 1H0MA 3ZPLA 4UNOA 5J8FA 1FYMA 2DAOA 2FMYA 2VBZA 2B87B 2HTSA 2V1UA 3PH0A 4L18B 3IRRA 5AONA 2V79A 2KZIA 1PP7U 4I98B 2OU2A 1XN7A 3I64A 4FX4A 1QGPA 2OA4A 1IRGA 3FXDA 1G6NA 1MGTA 2A07F 5IT9Z 3C1DA 1XSXA 4CYDA 2R44A 3TDUC 1Z6TA 3BPXA 2GQQA 1ON1A 3F6OA 2ADUA 4BXUA 4NPEA 2DQRA 3RIRA 2JRTA 4UUVA 3J7AO 5D8KB 1H0TB 3WTXC 1T39A 3CO7C 4BXLA 1NVOA 2VONA 4PGHA 5LLQA 2ELHA 2KZJA 4XLPF 3FWEA 2XGXA 5FFZA 2HKOA 1G4DA 1X3UA 3M8EA 5E1WA 5K5OA 4GYIA 2BEOA 4HQEA 3BY6A 1NH2B 2ACJA 2CFXA 1U3EM 1Z05A 1W5TA 3MAJA 5JR3A 3F8CA 3Q5FA 3F8FA 2IRFG 1QZZA 4NHJA 5L3GA 2HZTA 3SQNA 3F21A 3ZN1A 4GXOA 4RGXA 1T6SA 2GXBA 2K27A 4LG0A 2UWJE 2DLLA 3TO7A 3JAMK 2M45A 1IZ1A 1YS7A 2QWWA 1ZRCA 4OIRF 5DV5A 2VXZA 3ZMSA 5DDGA 2HR3A 4OMZA 1BI2A 4LK1F 2EJRA 2A5YB 5L3EA 3ZP5A 3V8JA 3TDZC 5ERIA 3MQ0A 2P7CB 2O03A 2GA2A 5TJJA 4A5NA 3T0YA 3ZMUA 5E1XA 3ZMZA 3R61A 5LGNA 3QPHA 2A61A 1TQMA 2ZMEB 1Z91A 2PFBA 2R7DA 2H6BA 3TGNA 4G7OF 1H0TA 2STTA 4NPFX 1HSTA 5H6RA 2RN7A 3JTGA 2G7UA 3PQJA 2VOPA 3N4MA 1XGNA 2DO7A 4NB5A 3WTWC 3WG9A 3K69A 2EV5A 2KIUA 3T1BA 2RQPA 1ZGJA 5LGUA 1FPQA 2M5AB 2RGVA 4LFUA 2BYVE 3F23A 5DCMA 4LD5A 5BS6A 2K4JA 3M8FA 5E8IA 3DEUA 2WMMA 1IUYA 2VBYA 4KFCA 3TQNA 1ODDA 3W7XA 2UXNA 4ENNA 2STWA 4BNCA 2ZMEA 4L0YB 2XASA 3MZHA 1YS6A 4UVAA 5H6QA 4RB1A 2Q0OA 2O6GE 3V7RA 1T0FA 2AS5F 2QQBA 1O7FA 4M9ZA 1KQ8A 4ZZDA 2CO5A 2WTEA 2ZKZA 4IRHA 5FGMA 1XMKA 4PGGA 2DU9A 3ERED 3L00A 2KIKA 4G7HF 3E5QA 2ETHA 1JXSA 2ZNYA 1LDDA 2OZ6A 1O3SA 3BOQA 4ZZLA 3R0AA 1IXSB 1OYWA 4CHUA 1YYVA 4LJZF 1RZ4A 4IPAA 3U1DA 1UFMA 2XUBA 5FFXA 1LP1A 3WGIA 1NHAA 1QNTA 4MQVA 4EJUA 2IP2A 2VT2A 4LGWA 3W7WA 1WRJA 1XCVA 4ASNA 1RIOH 2M30A 1MDMA 1FT9A 1K7AA 1LNWA 5CVJA 3IWZA 1ZLKA 4UV8A 1TNTA 4IRGA 2IA1A 1RI7A 4EGZA 3CJNA 4I02A 4HDUA 1S7OA 3V8KA 4UV9A 3LQRA 1G3YA 2RVCA 3KP5A 4I0AA 3SZTA 2L02A 1X0TA 4Q47A 2HDCA 1J75A 2IA2A 4YFKF 3BPVA 2Q2EA 3BJOA 1EH7A 3WU1B 1U8RA 2Z9OA 1U7JA 3KP4A 1SFUA 2IVMA 5HLGA 1UHMA 1OVRA 3RDIA 1HW1A 1BC8C 2NNYA 2P8TA 4ENKA 2M5WA 1SD5A 3GW2A 3W6KB 2W25A 3HHGA 2F5CA 1S3JA 1WQ2A 3HRTA 2HKXA 3ML6A 5JFRA 2D1HA 1T2KA 4ESFA 1ZYRF 1BI1A 3DFGA 1B1BA 4LG0B 2EB7A 2ZJ2A 3RKWA 4ZYEA 2AXLA 1IF1A 4K2EA 4M72A 2FF4A 4ETSA 3HSEA 2LF7A 4Z2YA 3BJAA 4BHBA 5LHGA 3E97A 2CGPA 2NRAC 2F5FA 2PMHA 3RTRA 4AIKA 2BV6A 1BC7C 3D3IA 1YO5C 4O3MA 3JTHA 3W7TA 2D2WA 4XRFA 2ZNZA 4M73A 2LSOA 1OYIA 5JI6A 4WWCA 1PDNC 2L4AA 2XROA 3ABUA 4N9HA 4HA8A 4I09A 1YTFB 1U5TA 1KYWA 3U9GA 4K3AA 2FNAA 1R1UA 5CJ9A 3BZ6A 1IN4A 1IRFA 1J9IA 5ED4A 4EMSA 1FBSA 2HTJA 3K0LA 4WXCA 3DXJF 2A6HF 2GWRA 5A2QZ 4HF2A 1KU3A 5DJUB 5HS8A 5L3CA 4U0YA 2BBYA 2P6TA 2ZFWA 4HLYA 1E17A 3ZN0A 4LLGF 2KRFA 1I27A 4O5VA 3L2CA 4Y13A 3V8LA 3HYIA 1R36A 2DK5A 3GVAA 5LBQA 4RS8A 2M5AA 3QWOC 3M1EA 1EDJA 2FBIA 3L7WA 3DP7A 1BIAA 4Q5SF 3WGHA 1DEEG 5TRDA 1ZREA 2B87A 4WK8F 2XAGA 2RV8A 1I6XA 1FY7A 1GXQA 5DUIA 2EA4A 3E6MA 3MZYA 1TNSA 3K2ZA 3RPQA 1R1VA 3BWGA 1ZXGA 2VODA 4ZYHA 1SMYF 1FP1D 1T98A 2IW5A 3PFIA 3I59B 3EDPA 1W7PB 1TTYA 4OOIA 3BROA 2W24A 2WWYA 4UHTA 3QP6A 2KJCA 1YG2A 2K3RA 4GGGA 3L9FA 4KIBA 2B89A 4LB6B 2P5VA 3VB2A 2Y75A 1UCRA 4R8HA 1PUEE 2KI7B 4UXNA 2OBPA 4KYWA 2QM3A 4HB1A 2O3FA 3W6JB 5HLIA 1IN7A 1IN6A 4KN7X 5LGTA 3K1PA 2JSCA 4KMFA 1UHWA 2K7LA 3C3WA 3I5UA 1XDUA 1Y0UA 1CF7B 1Z1DA 4HZFA 4A0YA 2X4HA 3KFWX 4EM0B 5EEGA 1ZHFA 1YIOA 1FWZA 3CUQA 4WF2A 2VBXA 4FHTA 2LXCB 2HWVA 1LT1A 3QP5A 2G9WA 5J8CA 4OMYA 1HKTA 3F6VA 4MQ9F 2I8DA 1RUOA 3Q9VA 1K79A 1EH8A 2VC0A 2FRHA 1SMTA 1MDMB 4EJWA 3RKYA 5E20A 2ESHA 2VC1A 4M6YA 3J80Z 4A6EA 1K78B 5DD8A 4AWXB 4HKZH 1BOAA 5FO5A 4KN4X 2FE3A 4HDVA 2Q8KA 3MEXA 4UVBA 3S2WA 5GW7A 1BJAA 1WWXA 3RYRA 1MJAA 2A68F 2MLGA 4KDPA 3WTTC 2YSRA 1R7JA 2ZAEB 1HBXG 2VBWA 2ZBKA 3VOEA 3KP7A 3ISPA 4KT5C 2JTVA 3CDHA 4JK1X 2OQGA 2RKLA 1IXRC 1DDNA 2QYOA 4O6JA 3I58A 1G3SA 4NQWA 2NAZA 3ZQ7A 5K5GB 4A2UA 3W7UA 5JVTA 1W7PA 5IT9K 4D0PA 1XSVA 1EDKA 1HW5A 4OINF 3M7GA 3QPTA 2XKOA 3NQOA 1XGOA 2EFOA 2HOEA 4MNUA 4I0BA 3HRUA 2KUBA 2FA5A 5KVRA 2L3DA 5AIQA 3ZDMA 3FXRA 4BYYA 3I4PA 3J81Z 1V3FA 1LQ1A 3HUGA 3BP8A 5L3BA 5DUKA 4EYYQ 3RGUA 3T8RA 1XD7A 3WTYC 5HDKA 3ZMTA 4GODA 2M87A 1O7LA 2IA0A 2ISYA 4OU0A 2M0BA 1EC5A 3NEUA 5HLHA 4LLLA 5KK1A 4HAMA 4L9VA 3MWMA 2XIGA 3T8TA 1ZGAA 1ZG1A 3WODF 4EJOA 1F5TA 2VN2A 1JHFA 1FP2A 1TW3A 1YQAA 3GF2A 3P9KA 1R5HA 1MJBA 1ON2A 2EFWA 1S6LA 2E7XA 2BGCA 2P6SA 4CGZA 1A04A 2LDUA 5CVUA 1JM0A 2WC2A 3PQKA 2PQ8A 3L09A 2ISZA 4ENMA 1B9NA 2O0YA 4G9YA 3EQLF 1Q2NA 1QPMA 2H94A 1LDKB 3LAJA 3CUOA 3FMSA 2WAMA 2DFIA 2E1CA 1R23A 1YW7A 4MTEA 4IXAA 3EYYA 4U7DA 1UB9A 4XBFA 3HTSB 2EK5A 2O8XA 4M9XA 4EM2A 3FXUA 2HS5A 3JSPA 2XAQA 1TQIA 4XLNF 4P55A 3R4KA 1KYZA 4EM1A 1KU9A 3RKXA 3HOSA 2RDPA 1OR7A 1U6GA 3TOAA 3BDDA 1YW9A 4QWQA 1GVJA 4HV5A 3QAHA 2FNPA 1R22A 2OTKE 4ZH4F 3E3VA 1RNLA 2V9VA 1DPRA 4I01A 3RI4A 1J5YA 1ULYA 3WE3A 1OMIA 2OQRA 4KIFA 3ULQB 1J59A 1YW8A 3FM3A 5DEQA 2KIMA 4MTDA 1OYYA 2L01A 3FX3A 3KLNA 5C39A 5F64A 3FMRA 4U88A 4PDKA 3DF8A 4B09A 4L9NA 3J81K 5HVQC 4IOIH 1YTYA 3H3ZA 2HQNA 3G3ZA 5LEJA 2W84A 4U7BA 3T5XA 1ZAOA 2VOOA 1E2XA 5HDGA 1FC2C 3LWFA 1V4RA 4G6QA 3EYIA 4BHCA 2QVAA 4MHGA 3ZMDA 2FBKA 1RUNA 5DD4A 3H92A 1HKSA 2PBIA 2YR2A 1IN5A 4HF0A 3IRQA 5J6XA 4ZYGA 1WI9A 3LQQA 4EV0A 2FMLA 4S04A 2KS1B 5LHHA 5HOOA 4JBAA 5FD6A 3LAPA 5K1YA 3RYPA 1C0WA 5EEHA 2K4BA 3F3XA 1BDCA 4MEXF 2J5OA 5E1ZB 3R6SA 5CVVA 4L0ZB 3DQVC 1HKQA 1MJ9A 2G7HA 2QVOA 3S1KA 2XAJA 2L54A 4N0BA 1ZLJA 2NYXA 3FMQA 2QQ9A 3CLOA 2HQRA 4DQ2A 4HJGH 4GO1A 3H3UA 5CBOA 4B8XA 1Z6RA 2Z5UA 4ENJA 2JT1A 5CLSA 4YFXF 2P90A 4LMYA 1QO0D 4BAYA 4A12A 2QLZA 2IT0A 4RAYA 1ONVA 1USTA 3EUHA 3U2RA 1K78A 2B88A 3JW4A 3KCCA 4GCVA 2O61A 1BN5A 3MHVA 3GYHX 1XSDA 2KIFA 5HDNA 2SPZA 3ECHA 2MLKA 4DNCA 2QBYB 4HX7A 2K86A 2EV0A 2H6CA 4Y15A 2Y0MA 3IC7A 3LFKA 4LK0F 1QBJA 5D5WB 1JE8A 4HW0A 1TLHB 2ZCWA 4P9FA 1QQIA 4IRIA 2EFPA 3F22A 4A0ZA 3E6BA 4AIJA 3HHHA 2HYFA 4L5IA 3GO5A 2PMUA 3NRVA 1DP7P 1KQ9A 5L3DA 1O3QA 1MKMA 1TQPA 4CO8A 4M71A 2DK8A 1FNNA 4PZJA 1FYLA 3E6DA 1HSJA 5ICGA 1GHCA 4P5OA 1Z9CA 1KU7A 3GZ5A 3E5XA 1P4XA 1QZYA 2ZXJA 4XSZF 4G8XA 1HXDA 2GZWA 1SS1A 5L3FA 3IKTA 2YU3A 3RPUA 2FSWA 3ROUA 2Z3YA 2MD5A 5FLXK 3E6CC 2CSOA 2Y48A 3F8MA 1D8JA 2COMA 1IAWA 1KQ0A 2YX4A 1B9MA 4Y17A 1DUXC 5AIPA 4K35A 1OVUA 2H09A 4GYGA 4EGYA 1ZH5A 5K5RA 2XRNA 3JAMZ 5D8LB 3SFZA 2EFNA 3O6BB 1TBXA 4G7ZF 5CVRA 5FB2A 2MBFA 3GFJA 6PAXA 1W4MA 2F2EA 1R00A 3FF5A 3FXEA 2JWDA 1ZW0A 5LRRA 3ZMVA 2GXGA 3I53A 4CXFA 1SD6A 2NNNA 2QBYA 1L0OC 3HTUA 2Q1KA 3TKYA 5ILSA 2L4MA 2EFQA 3HRSA 4WX9A 1LJ9A 1KU2A 1FZPB 4WCGA 1EDIA 1WKMA 5DCFA 5H20A 1SAXA 1FX7A 2QENA 4N9IA 2UZKA 2FOKA 2V1XA 1R5GA 2C6YA 4FT8A 2KJBA 5LHIA 1W7PD 3GX4X 2A69F 3SXYA 2OZUA 1AOYA 3IWFA 2DPDA 1H9TA 1FSHA 4HX8A 2H27A 3D5LA 5DCMB 1CGPA 4BHPA 5FLXZ 3KZYA 1BI3A 4BQAA 3FXQA 3VFZA 2XV4S 2PJPA 4KMUX 3SZPA 1I1SA 1I1GA 2KKOA 5D6EA 4EVIA 5ICFA 3GZ6A 2DI3A 3TO6A 3GUDA 1YLFA 2FQ3A 1HQCA 4I2OA 1S8NA 2CWEA 3ABTA 3LSTA 2CYYA 5A2QK 2LF8A 3F8NA 2DT5A 4I7HA 5BQTA 4ZNCA 2QQAA 1SFXA 1LB2A 3G73A 3V7SA 1XCBA 1XB4A 1MFTA 3KEQA 3C7JA 5ILUA 2XAHA 1B6AA 3MFKA 2HFHA 2EA2A 1OPCA 3Q9SA 1BDDA 4IJAA 3V7CA 2E1NA 2R7FA 2XHKA 3RJPA 2HEOA 3R60A 3KE2A 3O3KA 1B4AA 4F7ZA 2MA3A 2RNJA 5LRSA 5E18F 1U2WA 1L3LA 1EH6A 4IF4A 2Z99A 3FM5A 2JPCA 2IPQX 4L9TA 1SFEA 1RM1C 1SD4A 3COAC 1LP1B 1EV7A 1IXCA 1R1TA 3CTAA 1F9NA 2JZYA 5CYVA 3GFIA 4CDGA 4TV7A 1J2XA 3ELKA 2PG4A 3F72A 1IW7F 4ESBA 1FBUA 2V6CA 5DYMA 3I59A 1F4KA 3WE2A 4CPGA 3WU0A 2V1DA 4YG2F 4Q4ZF 2D1VA 4LLNA 4RAZA 4EJTA 4BH9A 4L9JA 2FEZA 1ZRDA 4KUMA 3HIFA 2RC4A 4YFNF 1LEBA 4E70A 4RGRA 3AAFA 3BJ6A 2A6EF 1P4AA 2P5LC 1FC3A 4A5MA 2GAUA 5HS9A 2QUFA 1Z7UA 2ZO4A 3GXOA 2GIVA 5LEKA 4EQQA 1P2FA 3KP6A 3CUQC 3K9TA 3DV8A 1VTNC 5D4SA 4IHTA 2PN6A 4CZZA 2WV0A 4ESJA 2VT3A 4JQFA 1B59A 5D4RA 4RGSA 2XVCA 2MH9A 1S7AA 1K6OA 3REOA 4HLXA 3WTZA 3HRMA 4M9SA 1XGMA 4YIFA 2F5EA 4MEYF 2M8EA 2FU4A 4ON0A 4KICA 3WTSC 2CG4A 4HOBA 1J0RA 2JPBA 3J80K 3HSRA 1U5TB 2IJLA 4YIIA 5FD5A 3HSFA 4M74A 3GFLA 2EV6A 4OIQF 4EJVA 1JHHA 2LR2A 2LXBA 2J5PA 4FX0A 4A0XA 4RB3C 5DJTB 1ZG5A 4M6XA 2BE5F 5CBNA 5EFWB 2DW4A 2M1BA 1D8KA 4KJMA 2FBHA 2W57A 4JBZA 2YX7A 1Y47A 4P9UA 4GOFA 4RB2C 3SHFA 1U78A 3TO9A 1FSEA 4KA4A 1U5TC 3KEOA 2MH2A 3CO6C 3KLOA 3C18A 3B73A 2XAFA 5BOXA 4OIOF 3QU6A 1D3YA 3GFMA 4A6DA 5ILVA 2DBBA 1XGSA 1W5SA 3WTUC 4QLCU 1BIBA 3JSOA 3KP2A 3O2PE 1NVPB 3N97A 3F8BA 4WXHA 4G94A 4G6DA 5K5QA 4ASWA 1XMAA 2F5DA 1OKRA 1ZRFA 3DKWA 4HF1A 4L5JA 3LA7A 1R58A 2DTRA 4GOEA 2OD5A 2UXXA 1LDJA 3KETA 1CF7A 3K1NA 1BM9A 5ICEA 2DPUA 1LVAA 4U0VA 4NPDA 2PI0A 4HQMA 3GWZA 4Q48A 1KGSA 4R79A 3QOPA 3DPTA 5BPIA 5D5XB 1HW2A 1G3TA 1AWCA 3DPLC 5CA3A 3FZVA 4IVNA 2OAZA 4AVPA 2Z33A 1MZBA 2DQLA 2MC3A 4H0EA 4IHSA 5E17F 4ASVA 3QU3A 3IL2A 4HYEA 3IHUA 1OVVA 1FYKA 4WWIA 3HOTA 3MZWB 1TW2A 1YFHA 1Q1HA 2YPRA 1J7KA 2VE9A 3CUQB 4P96A 4UVCA 3P7NA 1H9GA 4KIGA 1EDLA 3TOBA 1ZN2A 5E8GA 3LA3A 5IT3A 3I0TA 3EETA 1FBQA 3I54A 2CQKA 2XKPA 4MN4C 2X0LA 2P5KA 4PCQA 1STZA 2P58A 2RKHA 3V4GA 2PEXA 5D6FA 5ICCA 1SD7A 5BPDA 1BI0A 5D5UB 4HX4A 2GA1A 5CVIA 1U7MA 2A3SA 3QRFF 1DPUA 1O3RA 2TDXA 1I5ZA 3M9AA 3LA2A 3OOPA 3WTVC 1P4WA 2HYGD 1PP8F 3OV8A 2LKPA 3FHZA 1GXPA 4HBLA 5D5VB 3I71A 5HS7A 1P6RA 1O3TA 1G3WA 2EWNA 2E7WA 4WXDA 5JHUA 4RB0A 3GEZA 3KP3A 2P7VB 3R0JA 5BMZA 2PLYA 4AIHA 1WSUA 4MGRA 1T38A 1JGSA 1LEAA 2QZ8A 4AD9A 5F6FA 2P4WA 4ZMDA 4S05A 4R1HA 2FXAA 3KZZA 3P9CA 4HV6A 3B02A 3IKVA 2CW0F
chains in the Genus database with same CATH superfamily
2IXSA 1KYOD 4KISA 2XC7A 3UKGA 4W80A 2L7MP 1BCCJ 4FZ1A 5KLIB 5BU5A 2CUJA 1X1PA 1KA8A 2R3SA 2K37A 1ZK8A 3ETDA 1PVEA 1S29A 4XSXF 4XK4A 1M56D 1JO5A 1VQ9I 2D45A 4DV6B 1NAYA 1NAFA 3B4SA 1KZHA 2W6IG 4WFBV 2JKVA 1IG7A 2PMZA 4I7ZC 3A01A 3L74E 1TL8A 3S1QJ 1GW3A 3P9IA 3K1MA 3I9V2 4RGUA 1MSFC 2QRXA 2YI9A 1E0EA 1R71A 2O7OA 4HNAA 1FS0G 5JHFA 3SYOA 5KLVH 5KMGB 1FYMA 4X1IA 1X3ZB 2DAOA 4H0LC 2V1UA 1XHZA 3LW5J 3PH0A 2LH9A 3H9GA 5AONA 3K04A 2V79A 2OIEA 1HDDC 4FX4A 1QGPA 3K5OA 2OA4A 1TVKB 1G6NA 1MGTA 1TWAJ 2R44A 5IYZB 2H89C 3KG2A 1ZTEA 4F91B 4NPEA 4DR3B 1XTCC 2GHYA 4UUVA 1XNRB 4BXLA 2DA6A 2G3AA 3V42A 2ELHA 1QU3A 2Q9IA 1T95A 3L75G 2HNHA 1L4AD 4JOMA 3SDGA 1FAVA 3M8EA 5IY5B 4CYCA 1BGYG 2NVTJ 4GYIA 2ARHA 2YUAA 2OV7A 4HQEA 3PM1A 1EZJA 4RUEA 3BY6A 1LJ2A 3K06A 5KAIC 1K8AQ 1VQ5I 2CMPA 5JR3A 5AW1B 5IWAB 3IAS2 5LMUO 1MBFA 5KAFZ 3I56V 2YIDA 5L3GA 3J7YJ 3Q0UA 3SQNA 4GT1A 4FJCC 3UCSC 2WLIB 3FK6A 3H1LJ 3CCRI 3EXAA 3ABKB 2DLLA 4PD4I 2XHBA 1AROP 1D2DA 3PTZA 2M45A 1SKVA 2WSCJ 5B5EE 2QR4A 3H3VK 2PZSA 3G6EP 4LF7B 4L87A 5DV5A 5DDGA 2JJLA 3A2FA 4ZBMA 4LK1F 2A5YB 4LCUC 2HVQA 2TCTA 2L7FP 5ERIA 3DGEA 3M7MX 2P7CB 2O03A 1MOFA 1P7GA 1M1JA 2V6EA 3L75H 2HFEC 3SWYA 1SQBG 1B04A 4XICA 1XOUA 1BGYD 2ZT9C 3H1HG 3ZHUA 4IX7A 1DGWY 1WHUA 1DH3A 1LNQA 3EWKA 2H6BA 1NKDA 1WA8A 4G7OF 1FOSE 1H0TA 3ZRVA 2N8GA 1RF0A 3JTGA 4PDRA 1LPQA 2G7UA 2VI6A 2QM7A 2ZM6O 3HOZJ 1OCOC 2QWRB 1GL2D 5FJ8J 1JKOC 1AILA 1HDJA 3WTWC 3K69A 5GONB 2KIUA 2RQPA 3I55P 2VIXA 3DKXA 2WLIA 2A06G 2E42A 2RGVA 3LSUA 2YNYA 4H0LD 3LNMB 5E79H 1GN3A 4G28B 2B9ZA 3M8FA 2ZFCA 3DEUA 1YITP 1PP9H 2UUZA 1NU1K 1ODDA 5GPCA 3FFQA 3W7XA 3FHNA 4BNCA 1KECA 4L0YB 1SQVH 2XASA 2ZJPF 3JRCA 1Q86Q 4IL6Z 4UVAA 1JOYA 4RB1A 3PFYA 2Q0OA 3V7RA 1RKWA 4B3TO 4ZZDA 2CO5A 2RNBA 1PUFB 1XMKA 4ZHQA 2R32A 3C2GA 3RYHB 2WPSA 4R8CA 2MD0A 2UXDO 3E5QA 5CN0A 1V55C 3P7KA 3L73G 1JXSA 3JAKB 2OZ6A 1H88A 1XQ8A 3V5BA 3BOQA 1MMAA 4UUJC 3KX2A 1IXSB 1OYWA 3OTFA 2VQCA 1N2DC 3AEBC 3BRVB 2FKWB 5FFXA 2VQEB 3WGIA 2WSEJ 4GCZA 1TGOA 5JCOA 2YIUB 2IP2A 2VT2A 4LGWA 3BTCA 1OCPA 5F04A 3OYHA 5GP9A 3RL0C 4LF6O 1H2LA 2QJYB 4EGZA 1O9GA 3CJNA 3E7KA 2OTLP 4ZKPA 4A3MJ 4H13C 1XUQA 4D6TD 3CDLA 2NS7A 1X0TA 3CJQB 4Q47A 2EZPA 1EZVE 1QR9A 1VQ4P 4B1RA 3WU1B 4LFAB 1L8DA 5IP9J 2CH7B 2IBZE 2Z9OA 1SQBH 1URQB 4Y3OA 1EZVH 3K4BA 4GKGA 1SFUA 5HLGA 1UHMA 2E1MB 4ENKA 2ME6A 5APYA 3CD6V 3GW2A 1IFMA 2F5CA 1S3JA 3IP4B 2HKXA 5JFRA 2D1HA 3GVMA 3CCRV 3L4FA 1BI1A 2Z4EA 3DFGA 4DOZA 3ASNB 2JVGA 1B1BA 4PA3A 2ZJ2A 2FY8A 1SANA 4B3XA 2AXLA 2E2HJ 1IF1A 1V54C 2DA4A 1L4AB 1WGXA 2FF4A 1MMNA 4Z2YA 3BJAA 4X66B 3E97A 4N78E 3CL3D 2M8GX 2E1MC 1H2SB 2R5BA 1L0NJ 2NRGA 1R3IC 2BV6A 5J9PC 4TOIA 3BHPA 4WY4B 4TT3G 2D2WA 2C0XA 2LRDA 1MZEA 2WLMA 2COBA 5B1BH 2YKOA 1PDNC 3L75E 1KB9E 1S9HA 1I08A 4LFCO 1K4DC 4N9HA 2DDAA 1YTFB 3IH2A 2FNAA 2DA7A 1Q82W 1L0LE 1IN4A 2Q7GA 1J9IA 3NTNA 5KAFE 4RMNA 2X7RB 2ZDIA 2JGUA 2BEQD 3BR2A 4BE1A 1IVSA 3DXJF 5A2QZ 4D6TH 1V5EA 3CE2A 3PNVA 4DV7B 1KU3A 4A3IJ 2P6TA 4E4EA 3A03A 2ZFWA 2X6AA 1WCMJ 2C2AA 2GM4A 2DN9A 5J2UA 2YMYA 3WU2Z 1M57C 1PKXA 2WLKA 3DBLB 3HYIA 3GVAA 3S8PA 3CHXA 2RDCA 4LITA 1N4CA 3ZQQA 3S2HJ 1A31A 4Y99B 3QWOC 2VXDA 1SFCC 1W0KG 4FFKA 5B1OA 1BIAA 1DEEG 1W0UA 5TRDA 2B87A 2ZQMA 3B5ND 2RV8A 1FXVA 2EA4A 1M56B 3UNGC 3E6MA 2FTKA 1SQVE 3MZYA 3CRMA 3KQGA 1USDA 1BGYJ 1WT6A 1CSBA 2IU0A 1R1VA 1I5YA 1GL2C 2OYIB 1NT2B 3MMYB 2VODA 3T2MA 1OCCC 4GKKO 3N27A 1SMYF 3PFIA 5E79E 1TTYA 5EJCA 1T33A 1YF2A 3QP6A 1Q8IA 4HSRA 5FLMJ 5FLVA 1WJCA 4KIBA 4LB6B 1FZBA 2MABA 3KCXA 3VB2A 3HOUJ 1T2KC 3H36A 4O4HB 1JI8A 1N36O 5HLIA 1IRXA 2X1DA 4KN7X 3K1PA 2OF7A 3JALA 4KMFA 3MKZA 1UHWA 4AC0A 1Z1DA 2K3FA 3TF5A 3FXLA 2Q3EA 1YIOA 5CJ4A 1FWZA 4WF2A 1D1AA 3X2QH 2QA4I 3CCUI 4FHTA 3W68A 3J7AU 1EXJA 1PGOA 1CEZA 4X1KB 1EH8A 3H1HD 4CA0A 2VC0A 1RF0C 2P10A 4X1KA 1K5QA 3Q5PA 5B5EH 3CRRA 4DBRA 4WBAA 2GBYA 4A6EA 3J80Z 4AYBA 2E74B 5CBGA 3Q4HA 1BOAA 3M99B 5F0CA 4HDVA 2Q8KA 1XNRO 2PYJA 1SQBD 3QO5A 4CH5A 4F92B 1RESA 3I55V 4HRIA 4PDVA 2A68F 2QJYC 1MFZA 3JATB 2YSRA 1R7JA 4O4HA 2ZAEB 2R5ZB 3ISPA 1X1DA 3CDHA 1QHGA 2B9SA 1HR0B 1JTHB 1IXRC 4O6JA 1YITV 1SQPE 3K4NA 1BZKA 1NTCA 3K70D 2BY3A 5LL6Y 3W7UA 4EDFA 1W7PA 1VQ8I 3L73E 3P30A 4PK4A 1G2CA 2WB1A 3S4RA 1EDKA 4UCRA 3KYQA 2V7QJ 2XKOA 1O9HA 4C3HJ 2V4HA 3ASOB 4JI8O 4TUYB 2L3DA 2A7WA 3H1JH 1PP9J 3M07A 5IJ9B 3FK7A 4JYYA 3TGUD 1OJLA 5CCHA 4TQDA 4L76A 5CPRB 4BL0B 4EYYQ 1KQSU 3X2QB 1AQ5A 4XKBA 1ZAUA 5IYBO 4GODA 2H8WA 1NG6A 2JA2A 1GN4A 1NWQA 2R7TA 2UU9O 4C7NA 2ZIOA 4S0HB 4V19K 4ASUG 3B5NA 3MWMA 2M9HA 4YTPC 4OWRB 4LG3A 2GDSA 1K7DA 2XDVA 1ZG1A 1XBLA 4XE5B 2LMDA 2W4SA 4RAGA 3GF2A 4YELA 2HPCB 1KTMA 4BKXA 5B5EC 1ON2A 4IHJB 3F5HA 4JI6O 1IDZA 5KHJA 3LSQA 2JA8J 1NO4A 3VSKA 4D7TA 4FLYA 4FM2A 3O8ZA 3S9OA 2MW8A 3CC2V 4TV8B 2E5ZA 4XM3A 2ISZA 4ENMA 1YQ4C 3LAJA 1LDKB 3CUOA 3E0JB 3FMSA 2WAMA 3U1AA 2DFIA 1XHXA 1YW7A 4ZI7A 2N9BA 3M4OJ 3EYYA 3OR1C 3D36C 4XBFA 3HTSB 2O8XA 1AI7A 4F3QA 2B63J 4MVUA 2KMUA 2LK2A 2DOSA 1ZRTE 2Q3IA 1KYZA 5KTBA 3CCLI 4EM1A 1HOMA 4H13B 4BBRJ 1IO2A 2RDPA 3ZS8C 1U6GA 3FX7A 1AR1B 2WPRA 3BDDA 3VBBA 2Z16A 1K33A 4DIQA 3GTMJ 2HYNA 2IGKA 2ELJA 1PZQA 1AQTA 4DJAA 4OX9B 2V9VA 2OYIC 2P5OA 3AE9C 3ERMA 2UV1A 3LOCA 3OMYA 1UAAA 1KYOE 1OCRH 5EC1C 5KX5A 3WE3A 2DYRH 3TNUB 5KHGA 4MTDA 2KIMA 5E79Z 2M7AA 5C39A 1LKXA 4U88A 1Y67A 4B09A 5K7FA 3J81K 3TEDA 5HVQC 2M4GA 4DV2B 2PJRA 3H3ZA 3CP1A 1S5LC 3JAWA 2HQNA 3G3ZA 4F55A 3JAWB 4DYLA 3L2UA 1GZLA 4NC7A 1E2XA 5HDGA 1FC2C 1WPKA 2HYJA 3GF7A 4YJ2B 3LWFA 4G6QA 3D71A 3WG7B 4DV4B 3ETGA 2R9IA 1D1CA 1KB9H 1M5IA 3L35A 1RUNA 2KK7A 1HKSA 2M34A 2PBIA 3FBNB 1VQKV 4BU2A 3IRQA 3FB6C 5JJNB 2V7QH 4S04A 3TDKA 3A7OA 2FMLA 1CP9A 4PDMA 5LHHA 1FZCC 5HOOA 5C4XJ 2E1OA 4PD4E 1YTFD 3OA7A 2X6YA 3RYPA 5GTIC 4AQRD 1OCOH 3U1CA 1RSOB 3OE7G 2KXPB 3K7AJ 3CCJV 2UXCB 2LW1A 3R6SA 4C2TA 1N33O 4RUFA 3DQVC 1LTAC 1HKQA 1MJ9A 4MFEA 1FXKA 1K9MW 3H6PA 1HNWB 4MT8A 1FZCA 4QPKA 3CCSV 2HPIA 2QQ9A 4RO2A 3H3UA 2ZXWC 4PD4F 5K7HA 2JDIH 3U11A 2JT1A 1BQZA 1BCCH 5CLSA 4YFXF 2P90A 1X58A 4A12A 2QLZA 4RAYA 1NQTA 2BSKA 5LYJA 1K78A 1FBMA 5EDNA 1JFFA 1VMGA 2QM8A 4ZKUA 1BN5A 1I3AA 3OUSA 3MHVA 5HDNA 2DYRC 2B5UA 2CE4A 4XN3A 2NOGA 4H4KC 3B5NC 4H37A 4JI1B 4H44D 4LK0F 1QBJA 1J1DC 4RM3A 1WAZA 3E86A 1U57A 4I7ZB 2YC0A 1TWFJ 3OM3B 3OGCC 1V55B 3HHHA 2NR5A 4DR5O 4EATA 3GO5A 2PMUA 4W4KA 4X8AA 1KQ9A 1WJDA 5DEDA 3KXDA 5L3DA 1JTHA 2CPSA 2IGOA 4X88A 2LP0A 4M71A 2R5ZA 1YTZI 1JUPA 4PZJA 4KHPO 1ERDA 1HSJA 4MTXA 1YJWV 2EBIA 1KU7A 3ZBHA 3TXSA 4U3FE 3GZ5A 2ZXJA 1QZYA 1PV3A 4G8XA 1HXDA 3CCQI 3HTKB 3V4WA 1SS1A 4ZTFA 2BVMA 2ELKA 2L9NA 2FSWA 3RVZA 3ROUA 1JT0A 1BT8A 3I4NJ 1JY3N 2FYUD 1BS3A 5AVQB 4V2GA 4NTYA 1K34A 1LUWA 4W1UA 5B1NA 2COMA 4PJ0H 3H1KG 2XF5A 1DF4A 1Y6IA 3HE4B 2FBWC 1BR1A 4N4OB 4RWUA 2A3QA 4K35A 1OVUA 3N2KA 1SA0B 2LKMA 1F7YA 5B5EZ 5E3OA 1OCTC 2F4VB 4D6TJ 2EFNA 4H0LB 2EIMC 3V2PA 4D6TE 1XX5A 5CBHA 5M3FJ 4XMYA 1XG1A 2A06D 1Y74A 1OLTA 1ZW0A 1P84H 3I53A 4CXFA 1LTJB 1F51A 2ZYAA 3P8CE 2QBYA 2KRCA 3CESA 3STZC 1YHQI 2FYZA 2EFQA 3BLYA 3ICXA 2ZYDA 1FZPB 4DYCA 4WCGA 1SFCD 1WKMA 3TJTA 5DCFA 2XAUA 3GHGB 2UZKA 1FOSF 1D0ZA 3MD0A 2A69F 1M1JC 2L35A 3N05A 1ETYA 3I55I 1UJ8A 3FXMA 2RMKB 1X3WB 1AI5A 2WA4A 5GONA 4UCTA 3PIOF 1NTZE 2BW3A 5LXTB 3C9IA 1OXZA 5BMVA 3KZYA 4MLOA 4X65O 4BJ6C 1QGKB 4IGGA 3AG1H 4JX6A 1B8IB 3HC7A 1SQBJ 5B1BB 4DV3O 2QE7H 2CWEA 3ABTA 3TNUA 2CYYA 4A69C 2IBZD 2M4KA 3BPZA 1EZVG 3V7SA 1URQA 4N78D 1XB4A 1QU7A 1AB3A 2CTRA 2KLVA 3UO3A 3C7JA 1B6AA 1FKAO 3H25A 2WY7Q 2HFHA 4HNVA 3B6AA 4UUTA 3Q9SA 3CC2P 1KD1W 2Y0EA 2R9RB 2E1NA 3JCUC 3KIOA 2LR8A 2LFRA 2BSKB 3RJPA 3OMAB 2EIMH 1OZHA 3KE2A 1IFDA 5B1BC 2WSEH 2Q4PA 1LTIC 3EHBB 1QQCA 1H89A 2IPQX 2ZNIA 3T1YO 1RM1C 2O3JA 5BXZA 3H1JE 3COAC 5AVSB 3B77A 3X2QC 1TVKA 1DK1A 1ZR4A 5C44J 1DQUA 1P7BA 3GFIA 4U87A 3ZRWB 4FE4A 3LIDA 1MA1A 1W36C 3ZQLA 3FB7C 4ESBA 2R7ZJ 3IC9A 1FBUA 3ABVC 3D6ZA 1D1BA 2W6AA 2D1VA 4YRVA 4J19A 3CWBE 2FEZA 4KUMA 5M5WJ 1LE8A 4D7SA 4YFNF 1LEBA 2K3PA 2A6EF 3H32A 3L36A 1OQYA 5DM7F 3AG2C 2W0XA 1DU0A 1Z7UA 3AK1A 3BR3A 1VQMI 1SP4A 1FJKA 3AG1C 3DV8A 3ABLB 1QHTA 2HLOA 3TXQA 2TRTA 4JQFA 1NTZH 1KILA 3GCMA 1HWYA 2HVKC 4PUSA 1P84I 2BZTA 4RGSA 2MH9A 4XDJA 4M9SA 1YX3A 4YIFA 1VQKP 3HE5A 1APLC 3RGBA 4ON0A 1HW7A 3E89A 1N34O 1NTMD 3DCFA 2ZDIC 1J0RA 1FXHA 3L2QA 1VDFA 1U5TB 3W2VA 2ZXEB 3CJHA 3IH4A 1WJFA 3A5TA 2PYLA 2J5PA 4FX0A 4A0XA 2L91A 1BHBA 1ZG5A 2WSCH 5JH7B 3E1SA 4I1LA 1JJ6C 4IFFA 3RK3E 2V9KA 3K0DA 1N7LA 1SQQG 1YCIA 4D9JA 2FBHA 1NBMG 4JBZA 1Y47A 2JUGA 2E76C 2EX3A 1OWAA 1VQ5V 2M3EA 1FSEA 1U5TC 3Q4HB 4UB6H 2BOBC 1BCCD 4W97A 4LF7O 4CZCA 1Z5WA 4TUYA 5AVWB 3ZHVA 3QU6A 1EQ7A 3HXLA 1FU1A 1YJWP 2ILMA 4QPQA 2R7WA 2DBBA 3VYRB 1GL2A 5AW0B 2Q5UA 1NTMK 2Q9LA 1LTGC 4BIOA 1SQPD 3T1HO 3JYCA 3OTOB 4C7UA 3ZHRA 2P67A 4LR3A 4IHJA 2NPSA 4XLFA 2WSSH 1JUSA 1D5NA 3KZIZ 2F5DA 3FXKA 1SFCA 4L5JA 2NZ2A 5EC2C 2EQRA 2LG4A 2P81A 4O2BB 1NH2D 3LA7A 2DTRA 2H43A 1VQLV 4DV6O 4D6TG 4MVSA 3G1OA 3KETA 4DO2A 1CF7A 1AA7A 3D5SC 4K0KB 2LD5A 1SFKA 5F1JA 1RF1A 3GWZA 3JD4A 1LT9C 4CH7A 5D5XB 3OW2U 2AGAA 1RE3A 1K97A 4AVPA 2ZXHA 5J4VA 2DQLA 1GK9A 1GAXA 2IJKA 1TUEB 2KDOA 1DU6A 1LFPA 5CMUA 1WMKA 1FYKA 3MZWB 5EZYB 2ZINA 2YXRB 3CMYA 2YPRA 3GMAA 2WAQN 4P96A 4UVCA 3P7NA 3RSNA 4IEJA 4DZOA 1I5XA 2KNCB 3TOBA 4IHWA 3I0TA 3I5CA 2CQKA 3AG3H 3ITKA 4PCQA 3CYOA 3CCVV 3S14J 2QKCA 3V4GA 4N21A 4AM3A 3ZRWA 3PRJA 1R49A 1B8IA 1SD7A 5IYBJ 3RT3C 2WLLA 1H8EG 3QRFF 2GTSA 2TDXA 1I5ZA 4D1QA 4UCUA 1YI2P 2WVRA 2XB0X 3S3MA 3CCMI 3OOPA 3WTVC 4IHYA 1JKRC 2LY1A 4A5UB 1P4WA 2HYGD 3AEFC 2LKPA 3BQYA 1GXPA 3L2WA 3GG2A 3OYBA 1ETQA 3AEEC 3I71A 5HS7A 1N73A 1P6RA 1O3TA 1MSWD 3W2AA 2M2EA 2P06A 1DP3A 1JCCA 1WSUA 1T38A 2KB7P 2PFXA 2L6LA 2ZJQF 1GM7A 4DR3O 2K1AA 1TZLA 3KPHA 2HOSA 5F6FA 5EF6A 5KJ7C 4R1HA 3KZZA 4HV6A 3B40A 3CWBG 2ZT9D 1JPXA 3H5NA 1LGHB 4I99C 1KILC 1G1XB 3OMNB 2B0LA 3MCZA 3S32A 5F1RA 1T0FC 3ECOA 4DR4O 2XKMA 2CUGA 3E5UA 2R7SA 1FDIA 2RMZA 2BEZF 1D5VA 1HC8A 2QSGX 1F1ZA 4AQYB 2N04A 2PI4A 4IZZA 3CSXA 4CICA 4ZI7B 3WGGA 3CMAI 3SJMA 1ETOA 1Z2GA 4KNYA 5IY5C 1SC5B 5CB4B 3SWKA 1JVMA 1XDSA 3PLNA 4HNAB 1MD0A 4ZYDA 1SQPG 2GTAA 3L71D 2N1TC 3IJ4A 4BBSJ 3ZX6A 1REPC 1MSEC 3ZCCA 2W85A 3G1MA 1G1IA 2LNBA 2OTJI 3CC7I 5KLVE 2VE8A 1KONA 4JZGA 1PL0A 4RBOA 4LFBO 3RZOJ 4ZKIA 3CWBD 2JWAA 4M6VA 1NTKG 4E7JA 2OIGA 4M3GA 4FQGA 1RPRA 3OR7C 2M6YA 4DV1O 2FMYA 5KHKA 9ANTA 4BGDA 4L18B 1ZR2A 3UR3C 2E2IJ 3AE4C 4I98B 2KDZA 1J5EB 3I64A 3OIQA 4MW8A 1PP9E 1WPBA 1NTMH 3V2RA 3RZDJ 3C1DA 1XSXA 4CYDA 4YJ3A 1RKTA 4XA4A 2GQQA 3L74G 3F6OA 2EILB 2JRTA 1QLEB 4HYOA 2QWQB 3WTXC 3PHLA 1T39A 3CO7C 2NXNB 2Y2ZA 3BTLA 5LLQA 2WSSG 4PDLA 4GX5A 2ZSIB 1GN6A 4JI4O 4HH2A 4XLPF 3RL0B 3SJBC 3DPUA 5B1AC 1NH3A 1N32B 1SZXA 1PL4A 5E1WA 3K4JA 1FXKB 2BEOA 5KLVG 3DLLF 1EXIA 4PI0A 1U9NA 2ACJA 3VWBA 1LWUB 2UXDB 1Z05A 1NTKE 5CCHD 3F8CA 3Q5FA 4BUPA 3OEEG 1QZZA 3SYCA 2DFHA 4KXRA 2IS4A 3WHBA 2LFSA 2L5GB 3M0AA 4RGXA 3QVNA 2CV0A 2ZVNB 2GXBA 2K27A 5IJ0A 3ZGKA 2Z5HA 3TO7A 3M0DC 4JI2O 3BA8A 1OCRB 4OIRF 1BI2A 2EJRA 3KKYA 3CXHI 3M06A 4E7LA 4FK5C 1XDCA 5CA1A 1Z3XA 2Y69B 4QE9A 3ZXSA 4NXNO 2V4JC 3MQ0A 1GLNA 2OCCH 5TJJA 1JKPC 1YE9A 2FXPA 3ZMUA 1EF4A 2AXTC 4E2LA 1XMXA 5EZHA 3ZMZA 3H5RA 3L74D 2PFBA 2WTYA 2VJJA 2R7DA 1JR9A 2STTA 4M3FA 4OGQB 1BMFG 2PUSA 2PF4E 2OYHA 2LKSA 5H6RA 1U8BA 1PPJH 4WY4C 4EB6A 4JAVA 3N4MA 3JC22 4GX2A 3BT9A 3VQYA 3S3XA 5GAEJ 1XL4A 3T1BA 3J7AY 1DF5A 3GLMA 3G71V 2HVRA 1VEWA 2FJ1A 3CC7P 4JTCB 1YJ9I 1SQPK 3N7NA 5IYCO 2K4JA 1V9PA 2WLJA 2WMMA 5BNGA 4IQ4A 5LP6B 1PV0A 3TQNA 3H1KD 2UXNA 3GTKJ 5CKTA 1IBKB 3T1CA 2ZMEA 4XQFA 2HODA 3ABLH 4GZRB 3L70H 4D7NA 3S1MJ 5FROA 1D7MA 1FMVA 3JCUH 1O7FA 1KQ8A 5FGMA 1Z56A 2QJKB 4PGGA 3ERED 3L00A 4E7HA 2KIKA 3A01B 4JI0B 1PL5A 4QPOA 2ETHA 1LDDA 1SQVG 2PRRA 2IBDA 1WP7A 3EUKL 1DGSA 2YXLA 1PUFA 2D5VA 1DTOA 3OIPA 2R7XA 3SPHA 1Z7LA 3QTCA 1VQNI 3L70J 4CHUA 3ESWB 1XNQB 1EFRG 1RZ4A 4IPAA 1UFMA 2CS3A 3HOVJ 1ETVA 1RE4A 1NHAA 1QNTA 2QJPC 2JRIA 3K59A 2OWOA 2K9JA 1R5ID 5EIBC 1WRJA 3W7WA 4ASNA 3H9JA 1MDMA 1LNWA 5KA5A 4UV8A 1K73Q 1OW7A 4I0XA 1RI7A 2QA4P 3K9SA 3BCCE 1KQLA 3MUDC 4HDUA 1S7OA 2VQFO 4BW5A 4BJTA 5HODA 1OCZB 3RYFA 3G9RA 2Q2EA 2KZVA 5JCOC 2CRGA 1Q81W 1KZUB 3CF5F 3K9AA 3KP4A 2XSJC 1T6AA 3RDIA 1HW1A 2NNYA 4IYHA 4X62B 4XLCA 2M5WA 2IGMA 2ZC2A 2E5TA 3W6KB 4ZDPA 3B09A 4FLUA 2BY2A 3ML6A 4DUZB 3CDIA 4ESFA 1YTZT 1BSNA 5IJ0B 3RKWA 2KT0A 1R5SA 1P7JA 4ZOLA 3HSEA 3HKEB 3T97A 4BHBA 2YO3A 5LHGA 2YIBD 2XPUA 2OCHA 2DMNA 2JVDA 1NHLA 4XOTA 1XMQO 1BC7C 3D3IA 1YO5C 4YIRX 4O3MA 4LC1A 1KN7A 3JTHA 3W7TA 3BABA 3I5DA 4L8JA 4JI5O 4IO9F 4M73A 2F43G 2LSOA 5JI6A 1G2HA 2XROA 1LWUC 3DLAA 3AG4C 4PA9A 1U5TA 2BCCD 1KYWA 1AJPA 5CB4A 2ZR3A 1WJZA 2M3AA 3E1IA 2A45H 3UKMA 1XS9A 4EMSA 1FBSA 2Q8VA 1WH5A 3HKCA 4WXCA 2QG4A 2A6HF 3F89A 2DMXA 4HLYA 2KRFA 1N77A 1NR1A 1I27A 4PSXA 4WFGA 1PP9D 3FDYA 5APSA 1MMDA 4Y13A 3V8LA 3UO2A 1R36A 2DK5A 1KB9F 1GTOA 4RS8A 2BCCJ 2YIBA 2VPRA 4UCSA 3M1EA 2LTPA 3L71J 3ABMC 4LF5B 4F4LA 3SJAC 2ZXIA 4O9BA 2X6XA 1R6TA 2RNGA 2CUFA 1MNDA 3CF2A 2VASA 1H8AA 4OGQC 3RPQA 1D5YA 1JT6A 4XKWA 4C3JJ 2DXIA 2K9QA 2WV1A 1T98A 4AQYO 2IW5A 1W7PB 2W6JH 4OOIA 2AHZA 2OTJV 3G80A 3BROA 2WWYA 3OS2A 1IZNB 2KJCA 2UXCO 2B89A 1H2GA 2CJJA 4NVPA 2DCEA 1MIJA 2KI7B 2PX9A 4R8HA 4RAFA 1K92A 4KYWA 5FNVA 4HB1A 4R4MA 2FX0A 1YSCA 2A9HA 1IN6A 5LGTA 4NUBA 1WN7A 2R0QC 3CCYA 3TP0A 3HKBA 4MVMA 3LSKA 4HZFA 1N7SD 3I56P 4U3FD 2OUMA 4LP8A 3PSIA 3HM5A 2A5WA 3G71I 2BASA 3K3WA 2R7OA 2NPSD 1M9NA 3RL0g 2VBXA 2LXCB 2QGNA 2HWVA 3K0GA 2G9WA 5J8CA 1T08B 4XOPA 4FE7A 4XDKA 1Y76A 4MQ9F 4PFOA 5KHHA 1K79A 1J5EO 4BEHA 1R4MB 1MDMB 3RKYA 5E20A 4LNUA 1GDTA 3TL4X 3CCEP 4HKZH 3PNYA 3H1IJ 3MKLA 5FO5A 3QF7A 4JZ2A 4L75A 3OIOA 1A6QA 3S2WA 2P1JA 1EKEA 3TETA 1MJAA 2DOAA 4ZYAA 5JWPA 4RKUJ 2ZBKA 3VOEA 1SQVK 1S9KE 1GM9A 2MYSA 4G2KA 4KT5C 2JTVA 2EIMB 2XGDA 2OQGA 3NMDA 1DDNA 4UCOA 3I58A 4NQWA 2NAZA 3ZQ7A 5KKZC 2HI3A 3A0HZ 5JVTA 2GUVA 3WU2H 4CH4A 1ZX3A 3H1ID 1XSVA 4J11A 1HW5A 5D5PA 1GU4A 3QPTA 3NQOA 1XGOA 2EFOA 2HOEA 4MNUA 4AVZA 1L1FA 1VFCA 3ZDMA 5HNHA 3J81Z 1H89C 1LQ1A 3GTJJ 3HUGA 5L3BA 1R6NA 2ZE8A 3D8CA 4NC8A 1V54B 2ZCEA 1XD7A 3AG3C 3WTYC 1QHHD 1O7LA 1HNZO 4OU0A 1FJGO 3FKIJ 5HLHA 3AE7C 4LLLA 2LP7A 4KHPB 3CCJP 2WPDG 3ETEA 3K5LA 2VRSA 4KITB 1HVVA 1FTTA 3BCCD 3VOPA 1I6HJ 2ZJSE 3OAKA 1WJBA 1F5TA 2KP8A 1YOVB 5LMUB 4PSWA 1FP2A 1B06A 3QOEA 4D5FA 1R5HA 1VL2A 1RRJA 1MJBA 3KZIE 4B3SO 2EFWA 3E8HA 3MDSA 3GTGJ 4IL6H 2R7RA 1S6LA 4XRSG 2E7XA 3CPWO 2BGCA 1Q7YW 2A79B 5CCHC 2LDUA 5CVUA 2FYUG 1ZL8A 3OYKA 3EFGA 3PQKA 2PQ8A 4A3CJ 3EQLF 1NKZB 1QPMA 2H94A 2J5UA 1MABG 4J7JA 1PIXA 1XMOB 1F23A 1S5LE 1R23A 4IXAA 2W8ZA 2XB5A 4LF9B 1VQ4V 4E7IA 4N4NB 2FXMA 4ABMA 2ZE7A 2N1TA 2AHQA 1FTZA 4ZOLB 4ABZA 2VQFB 4DR1B 4XLNF 4P55A 1DD3A 4FM0A 3FBIB 5GTHE 3OYNA 4RM2A 2IDBA 1JJ2U 1SQQH 4EFEA 3WU2C 1IBMO 4KP4A 3TOAA 4QWQA 5ITZA 4TV9A 1N34B 2B1IA 4DR5B 2X6CA 3HKDB 2FNPA 1OR7C 4XLHA 4N6JA 4ZH4F 2RREA 1RNLA 2HVSA 4QIWF 1HUCA 1DPRA 2VJ4A 4YPCA 2ZMEC 3LSIA 2VS0A 3Q5SA 3BG7A 4LF8O 1J5YA 1ULYA 2FFDC 1OMIA 1J59A 2XV5A 2WLNA 1CI6B 3FM3A 5F0HA 1PNMA 1OYYA 3H1HJ 3W2WA 5F64A 3PN1A 1GO3F 3UQ8A 2DA2A 2LC2A 4I4TB 4L9NA 1AA0A 1JEKA 3L72H 3PL8A 3PJSK 4BRYA 5APQA 4BJ5C 4FFBB 5LEJA 1EN6A 4BACA 5IOYA 3T5XA 2BHYA 3U0ZA 1ZAOA 2RAEA 4OH8B 4JX4A 1AI4A 1V4RA 1S5LH 2OARA 2QSHX 4DV3B 5KMGA 3A0HC 3GW6A 3ZMDA 3R66A 3BZKA 2BCCG 1V5GA 2JDIG 3CMAP 1IN5A 3CCMV 3V4QA 3FKSG 3LQQA 4EV0A 2KS1B 4IL6C 2A05A 2EZHA 1FZGA 5IOZA 1QVFO 4F6EA 1VQ7P 4C2UA 3LAPA 3AG4B 2XF7A 4XR6A 2WA0A 2NVXJ 2K4BA 2X1CA 4M3BA 1XC5A 2XT9A 1RQUA 4MEXF 4GDOA 2Y9ZA 2G7HA 2O5RA 3HPLC 2XAJA 3JD0A 1AVMA 3JATA 3SPCA 2E75D 3L73J 3SJCC 2RN9A 2LKXA 4D7MA 3VOUA 4EOTA 3FMQA 2QEXV 4HJGH 4B8XA 3OR2C 2Z5UA 4ENJA 2V26A 5J2UB 3NWSA 2K88A 1QX8A 4DV2O 3SGIA 1QO0D 1JJ8C 4BAYA 2IT0A 3D5RC 1ZOYC 1ZL8B 1ONVA 2NPSC 2Y9YA 3U2RA 4H44C 3KCCA 2KFDA 2W27A 4JF3A 4GCVA 4PJ0E 1BE3E 2K40A 3GYHX 3ECHA 2MLKA 4DNCA 2E76D 2Q0OC 3VYTB 2JWTA 3H1KE 3RYCA 2K86A 4Y15A 2Y0MA 3OMIB 3CWBJ 3PO2J 3HB3B 3IC7A 4YIOA 1FFTB 1S72V 1TT5B 4X20B 1IO4A 3F7YC 2DQ3A 2LW7A 4P9FA 2EFPA 3F22A 4A0ZA 2D3OW 2R7UA 1P84F 3TBIA 3E83A 1A6IA 2OTJP 4IYIA 2L9RA 4KT6A 3KYCB 3CCJI 4DW6A 1MKMA 1SQFA 4CO8A 3BZCA 4MS2A 3G6BA 1QVFU 1FNNA 4X1EA 3PIPF 3RYIA 3MHHC 5FKOA 4YXWH 3E6DA 5ICGA 1S9KD 4DOJA 3OUFA 3OEHG 3Q3SA 3E5XA 1P4XA 3RWRD 1SQXH 3CC4I 1JUNA 3UIAA 4GKJB 5L3FA 1VQMP 3CJHB 3IKTA 5B1AB 2YU3A 5FLXK 4CS2A 2FUG2 2Q68A 3E6CC 1K8AW 1NTKJ 3N2GB 4GYCB 3F8MA 1AHDP 5F27A 3JRBA 2PI5A 1ETWA 3KCYA 1IAWA 2O01J 4X89A 2E34A 5LA6B 4NR1A 4H33A 3CXHD 5APTA 2H8RA 4B3AA 3O8GA 4DV0O 4FVMA 3SSUA 4NQWB 5AIPA 2QWOB 2R92J 4B08A 1ZH5A 5K5RA 2XRNA 2L9SA 5FKKA 5D8LB 1IXMA 2DT6A 1XNQO 4FLXA 1TWHJ 2QWNB 2E71A 3O6BB 3T4DA 5J1RA 1UIXA 3ML0A 4G7ZF 1XTGB 2MBFA 2AO9A 5APXA 2Z1DA 4A3BJ 2F2EA 1R00A 2K85A 3SDBA 1TP4A 3O6QA 2EIJB 2A45G 5TISE 3S93A 3ZMVA 2QEXI 1OCZC 1V55H 4MVQA 1XTAA 2NNNA 4OGQD 2CTPA 4B44A 1XPXA 1PNKA 2FFDB 1KD1Q 1PPJE 5ILSA 3HRSA 4WX9A 4JAUA 1AR4A 1EDIA 4C30A 1A36A 2V1XA 4FT8A 2E19A 4PJMA 1Y8AA 2X6WA 4L73A 5LHIA 2CGOA 2YO2A 4HZ3A 1VF6C 1AOYA 1Y9BA 1H9TA 4WFFA 2AXCA 1FSHA 4HX8A 4XRMA 5DCMB 5EYPA 2RCVA 4BQAA 3CRQA 3FXQA 2XSDC 1O4XA 3SZPA 5H9CA 2FYUH 3BG9A 2F4MB 5ICFA 2QGUA 1E1RG 3GUDA 2YXYA 2FQ3A 1HQCA 4XIDA 2IS2A 2N9YB 1N8RQ 2JVHA 5C8YB 1S8NA 1EN4A 3RYFB 3L71E 5BQTA 2DJIA 4ZNCA 4B3SB 3G73A 1XCBA 1NU1H 1WNSA 3QO7A 4K8XA 2EULA 3KEQA 1S5HC 5ILUA 2FFDA 1I0HA 2XAHA 4ANJA 1S0VA 5BY1A 2E43A 2KQRA 2L5QA 3WG7H 4IKFA 1OPCA 2CGNA 4OVNF 1BDDA 3STLC 2Y69H 1Y66A 2FYUE 4QIWN 3V7CA 1M1KW 1VQ6V 2HEOA 1B4AA 5E18F 3AG4H 4IF4A 3T97B 2YEVA 4I55A 1N73B 1W36D 1SD4A 1HTLC 1ENHA 2M0CA 3AE3C 4IFDK 5JVDB 1Z21A 4JYKA 1S77D 2QSFX 3RN4A 1MSDA 3FKJA 1OISA 3ELKA 2PG4A 1NOHA 3CMAV 3AK2A 1YQ3C 2GOMA 1VQLP 5DYMA 1F4KA 3WE2A 3A2AA 3ONQA 3TP3A 1BE3G 4YG2F 1BGYE 3RBZA 4RAZA 1DEBA 1NH4A 3GZNB 3AG2H 3HIFA 1SRYA 1Q6IA 4U3JB 4E70A 1L2PA 5HFMA 2P5LC 3OSFA 4A5MA 2OCEA 2GAUA 1XL6A 5HS9A 1SQXK 4YJ2A 3HBLA 2ICWG 3G71P 3GXOA 5LEKA 3WUUA 4A3EJ 4KL1A 1V5FA 2UUCB 5JLXA 1VQKI 2BTOA 3OYAA 4LF8B 4CH3A 4FLVA 4E7ZA 1P84E 2MJZA 4XORA 1SA0A 3BVHA 3CCUV 2NVQJ 3TSIA 5D4RA 1RHZB 1ROPA 3A3YB 2VQLA 1S7AA 4HLXA 3WTZA 1D5AA 1TUBB 2ZNJA 1CI6A 1X8YA 1COWG 4DZJA 1XGMA 4L5EA 1T3UA 4ICGA 1V54H 3LDEA 4MEYF 2Y0DA 2FU4A 3L72J 3WTSC 2H8PD 3H1HE 1NK2P 2JPBA 4CCOA 1Q82Q 3J80K 3QWLA 5KKZB 2Y69C 2ZFUA 4DCKA 2CW7A 5FRNA 4YIIA 1N32O 2XF6A 5FD5A 5C3EJ 4M74A 3GFLA 2EV6A 4Y4RA 4OIQF 3AEIA 5BR8B 3OY9A 2JSPA 3DC5A 1JHHA 2LR2A 2LXBA 4DV1B 1NI8A 2BE5F 1VARA 5EBLC 5EFWB 2DW4A 2M1BA 1P7IA 2ITAA 2XNXA 2W57A 1SQXD 4J7ZA 3H1LE 2MKVA 3S16J 3KDPB 3HPHA 5C93A 4U3FG 3TO9A 1FE6A 4KA4A 3KEOA 5APWA 4B4CA 2MH2A 1IUFA 1HCRA 5TISZ 4WVZA 1I94O 1JY3O 1IFPA 5M5XJ 2IJJA 1RFYA 4CBCA 3GFMA 4A6DA 5ILVA 4EB6B 4GKKB 2WADA 1X22A 4AHCA 3BCAA 1HNZB 3O2PE 1SETA 2E75C 1DLBA 3ASNH 4F6RB 3G6EV 2E5LB 1FIAA 1ZRFA 2HOAA 3JREA 1R58A 3EUAA 4GOEA 2OD5A 2UXXA 2GSMB 4UCVA 5ICEA 3CCQP 1LVAA 4X1IB 2PI0A 3HZJA 4JI8B 4J80A 1ZLZA 2K9JB 3O65A 1KGSA 2UUAB 1SQGA 4DR4B 4EEQA 1HW2A 1Y39A 3IAOA 4BQNA 4U7OA 5CA3A 2ECCA 4I6ZA 2R9AA 1M1EB 2CQ7A 2Z33A 2H3OA 2OC6A 3F7VC 2O01H 4DV5B 2YUSA 1WH7A 3IHUA 4Y7NJ 5DS9A 4WWIA 3H1JJ 1TW2A 3F0CA 1F4MA 2VE9A 1K4SA 1M56C 2WQYC 3FGAD 2LO1A 1ZN2A 5IT3A 3G67A 5FRMA 2Q6AA 3I54A 3CC4V 3K4KA 5CJ0A 1UFIA 1MBJA 1H8HG 3MHSC 4W7ZA 1OHHG 1RF1B 2CTQA 2LGQA 2RKHA 1RR8C 3KZIH 3L1PA 4DW1A 5ICCA 2ZYGA 1U7MA 2A3SA 3M1CA 4YHHO 3M9AA 4OWFA 2XPVA 3HJEA 1US6A 1NU1D 4PFPA 1J1EB 1PP8F 2RN0A 2ZM6B 1SFOJ 3VTPC 5D5VB 1CZQA 4Z1MH 4AU7A 4RQFA 5TJHA 2EWNA 2E7WA 1UIIA 2CV2A 4HNTA 2P7VB 3R0JA 1KKCA 5BMZA 1B72B 4AIHA 3SFDC 2LJ2A 1VPCA 2UU9B 2ATKC 3BCCG 3CXCU 2P4WA 4D5CA 2HG5C 2FXAA 1AJYA 2KLUA 1SC7A 1M7LA 2HXIA 4DRXA 2XTAA 1JMBA 5EEAA 2NS0A 4H13D 2DJVA 2XRLA 1IFIA 1VQ6P 5B3SC 3OOUA 1FLIA 3DBRB 2LREA 3BEHA 3E8GA 3TGUG 1JA8A 4ZTJA 1S1CX 1OZ0A 1X4TA 5BMVB 3VEPA 5JH7A 1IN8A 2K02A 4LH6A 4RO0A 3L73H 2ZJRF 1BBYA 3BRCA 5BR8O 4BDZA 2JUCA 5HFLA 4JI6B 4XKCA 1O57A 5H2FH 1WB8A 2W48A 4OIPF 4A3FJ 1L0NG 3CD6P 1ZG3A 4MVZA 2ZSHB 3C2HA 4G12A 4TSFG 3SYAA 2EBOA 3D0SA 1NK3P 3E35A 4B3RB 3BR5A 2DTZA 1E79G 4ZDLA 1JMKC 3VODA 3W7SA 1S5LZ 2HGCA 3ZPLA 4UNOA 1UPGA 1N25A 5J8FA 2NS8A 2JP3A 4C46A 4B86A 4XFJA 4DYRA 2PGGA 4M3EA 1FZEA 2VBZA 2B87B 3F9KA 1PGJA 3RPUD 3OYIA 2KZIA 3NAUA 5E3LA 2IS1A 5GTHZ 1N36B 4NXMB 3BTIA 4NKGB 2IPPA 1SZTA 1IRZA 1IRGA 3FXDA 2QQ8A 5CCGC 2FYNB 4CC5A 1GKFA 4WY4D 2LYCA 3M9BA 1DIPA 1Z6TA 1ON1A 3KYLA 2K9MA 2BCCE 2ADUA 4BXUA 1IURA 3RIRA 5GAGJ 4CS3A 4NXMO 1NTMG 3J7AO 1URQC 5D8KB 3SPGA 3H1HH 3ASOH 4E7SA 1LTJC 1KYOH 3V6IA 4PGHA 3FYIB 1Y4MA 5FFZA 2A45I 1SVLA 4OPHA 2HKOA 1Y8QB 1G4DA 1Y1WJ 1SVOA 1X3UA 1UG2A 4TT3H 4UUSA 2KOGA 5KJ7A 1HP8A 1Q5OA 1NH2B 2CFXA 3D3QA 1U3EM 4PA7A 3BR1A 3F8FA 2IRFG 2EJ7A 1KFMA 2O57A 2HZTA 4IHVA 2F4OB 3ZN1A 4GXOA 4DK1A 3LNQA 1E5WA 1T6SA 1MH4A 3G2BA 2UWJE 2QCOA 2Q73A 1LT9B 1XI1A 3APQA 1MBKA 4MVOA 4UB8H 1YS7A 2QWWA 3HKZN 5LXTA 4X66O 3ZMSA 2VXZA 2HR3A 2JA5J 4BXXJ 4OMZA 5L3EA 1Q7YQ 4BEHB 4GX1A 3TDZC 2DMTA 5M1BA 2GA2A 3II6A 3T0YA 3CXHF 1VF9A 1W0TA 1K9MQ 3QPHA 2HPCA 1TQMA 1Z91A 3G4SV 2W6BA 1N75A 2NNUA 4PV1C 3JRDA 3TGNA 4IIJB 2WZ7A 3C1LA 4O4JA 4JI2B 5FPRA 3CMEP 4J00A 1JMMA 1LTSC 5LYJB 1XGNA 5AW6B 2DO7A 2D2CB 3H9VA 4NB5A 1VF5B 3WG9A 1UMQA 2EV5A 1ZGJA 1VQ6I 1J1EC 2MFZA 4C2MJ 1RY3A 3HGYA 1FPQA 1VQ8P 2M5AB 3JSVC 4M3DA 1OX3A 2BYVE 2QKMB 2EINB 5DCMA 3CMEI 4OAZA 4PV1B 1IUYA 4AIDA 4KFCA 4WCEV 4I50B 3FX0A 3SR2C 3VYUB 4ENNA 4FLWA 1KB9D 4PJLA 1Q81Q 1HGVA 5JJJB 3MZHA 1R8EA 1YS6A 1IDYA 5H6QA 2P4VA 2HQAA 2O6GE 2AS5F 1T0FA 2QQBA 5APUA 2WTEA 1SQPH 3FYEB 2DOEA 1SF9A 3GTPJ 4G7HF 4DR2O 1TC3C 4JYBA 2ZNYA 4WBNB 4ZZLA 3ABMB 3R0AA 1HH0A 1PP9G 4QJFB 1SVFA 4UB8C 4LJZF 2B1GA 3OGIB 1LP1A 5GTIZ 4OPAA 4JASA 1RIOH 3H1IH 2GV9A 5CVJA 2KISA 3IWZA 1ZLKA 1TNTA 2WLHA 3CCMP 4UB8E 4UV9A 3LSHA 4JI5B 2RVCA 4X1YB 2L02A 1YI2V 2LY9A 2HDCA 3J80N 3U10A 3DEWA 3IN6A 4YFKF 3BJOA 1EH7A 2Q1ZB 2JS3A 3KYDB 3N2GA 3B5NB 4MTFA 1S72P 2L2OA 2I1KA 1U7JA 3S3NA 1IV8A 1OVRA 4JTDB 3CC4P 2R93J 2AZ2A 2YXHA 3HHGA 3HGGA 3IR9A 5J40A 4LF5O 1WQ2A 3HRTA 5E79C 4J42A 1X4PA 2EB7A 4ZYEA 3S3OA 3CRCA 4M72A 2V4DA 1ZELA 1S7EA 2DN0A 1ORKA 5LP6C 2EPFA 4DXWA 2K9YA 4MFDA 2LF7A 1BL8A 3CX5D 3OYCA 2CGPA 5FKMA 2CQXA 3CCEI 2PMHA 4AIKA 1YJNI 1EBOA 2V7FA 4BWNA 1AJNA 2JJ7A 3JSNA 1J09A 1G59A 4X65B 1EM1A 3CXHH 3T4ZA 4DK0A 4XRFA 2M3BA 1JTYA 2R72A 2AHYA 3K4CA 4WWCA 2L4AA 3PUBA 3HKZA 4LFCB 1TWCJ 5FL7G 5CJ9A 3BZ6A 1YRNA 4K8ZA 1IRFA 5ED4A 4LH7A 1LFBA 3NWTA 1L0LJ 4BQOA 1KC8W 2GWRA 3ZQGA 1IJDB 2K9LA 2H1KA 5L3CA 2YIUC 2BBYA 3LDCA 4HPQA 1K83J 3ZN0A 1NTKK 3BAAA 4KT0J 1Y8RB 4R4LA 2Q67A 2F93B 3DXRA 1NGMB 3ZRXA 1S72I 3L2CA 1L0LH 1M90W 3A0BE 1NTMJ 1P9QC 3L73D 3HE4A 2PTMA 1AFOA 2F66C 4DUZO 1EDJA 3L7WA 1VQMV 4Q5SF 3WGHA 1ZREA 1NTKH 4WK8F 3SWFA 1L0LD 1I6XA 2MW2B 1FY7A 5DUIA 1GU5A 3C2BA 2ZE6A 5AW8B 1Q1VA 1KBHA 1SQXJ 2E35A 3K10A 3BWGA 3DTIA 1ZXGA 4KJZA 4ZYHA 1MV8A 5KHIA 1FP1D 1AVOA 3CRAA 3EDPA 3FAVB 1FJGB 4A3LJ 4PV1D 3L70D 4FMTA 2K3RA 4DZPA 4GGGA 1WJ5A 1YZBA 4FFBA 1LT9A 4LF4B 3H1LG 1ETKA 1UCRA 1E3HA 4FPPA 4P9OA 4UY8I 4UXNA 2OBPA 4LF6B 4JTAB 2QM3A 1R1BA 2O3FA 3A0HE 5AG2A 4MO7A 3Q3DA 1BA5A 2AEMA 1VF5D 1E3PA 2JSCA 4O2AA 3SYPA 5BVZA 2K7LA 1ZKGA 3C3WA 3I5UA 1XDUA 1K5SA 4DUYO 4EM0B 3KFWX 1R6RA 5EEGA 1ZHFA 1KQFB 5EIBD 3CUQA 2R5YA 4TLFA 2BOLA 2I10A 2LOOA 3PJRA 3J81N 4DT0A 3QP5A 1PPJD 4RQEA 4B3RO 3BCCH 3FD9A 5JQGB 5FKNA 4WFAV 3Q5RA 1RUOA 3Q9VA 3G4SP 5GAHJ 3CXHE 3LUTB 1SMTA 3MP7B 4EJWA 2OTLV 2ESHA 2VC1A 3TK1A 2L0KA 2J58A 4HBNA 5DD8A 1P84D 1Z77A 4AWXB 3R4YA 3WB0A 3LSJA 1Y1VJ 4KN4X 2GOXB 1N0JA 3K03A 4C7RA 3WUTA 1FZCB 4P30A 5GW7A 1BJAA 1WWXA 2XGEA 2MLGA 2Y4TA 1IJWC 2VBWA 4TWKA 4U7JA 3JRGA 1ACIA 2WWWA 1RM1B 4J01A 2QYOA 4PELA 1N0NA 1FYJA 1BE3J 5CMZA 3U59A 4RDUA 1IV6A 5K5GB 4A2UA 1IFJA 2JQ7A 2KNCA 4D0PA 2IX7C 4OINF 3F5TA 2GUZB 1PGPA 1Q43A 2UUBB 4DV4O 2CQQA 4I0BA 1PYVA 2KUBA 1VF6A 2FA5A 3CX5E 1SQXE 5AIQA 3OS0A 1OCRC 3I4PA 4DR6O 1AU7A 1VQ4I 5KUKA 3BP8A 2BCCH 2VB6A 5DUKA 1TAEA 4B3MB 4CCJA 3MD2A 3RGUA 3ZMTA 3FB8C 5H2FC 1H88C 2VRZA 3O8HA 4I4TA 3CEIA 4W4LA 2LBFA 2M0BA 1EC5A 3PUFA 1GUUA 3NEUA 3KZIC 2QWPB 1PM9A 4L9VA 1A02J 5A2QN 2RH0A 2KP6A 3CS5A 2XIGA 3G6EI 2XNDG 4I6MC 1YRNB 1T3JA 1ZGAA 3QQAA 4O4JB 2Y0IA 4EJOA 2VN2A 3WB1A 1JHFA 4UB6C 1YQAA 2B7EA 2JO1A 3GB7C 2N74A 3P9KA 2OGUA 1KYOF 1TA8A 2P6SA 4CGZA 2Y0PA 2QM4A 3AKZA 1JM0A 2WC2A 2Y0SN 1N86A 5KUMA 2O0YA 2R3CA 1SQQK 3Q1MA 2K5CA 1E1QG 4I50A 3HOXJ 2QTOA 4LFAO 1NR7A 1QL1A 5F0FA 2BY0A 4M9XA 3FXUA 5IP7J 1NYHA 2IJIA 3JSPA 3OYJA 3ASOC 3GHGC 2F4IA 2XAQA 1TQIA 2CH0A 5IYCJ 4N3YB 2ZXWB 3ZHTA 3A0BZ 2Q7HA 1X79B 1KU9A 3HOSA 4DR7B 3K79A 3HG9A 1W2EA 3WHCA 1RE3C 3OSGA 1KV4A 4HV5A 1WJEA 2BXZA 3QAHA 2CPBA 2W90A 1R22A 4DYQA 2OTKE 4QPJA 3CC2I 2AXTE 3RI4A 2VUMJ 1E3OC 4KIFA 3ULQB 3HPGA 1M8OB 3P8MC 1NJIQ 1S76D 3I3LA 2VKDA 5CCGA 1A02F 2L01A 3I4MJ 1KYOI 1I39A 3FMRA 4LWSA 2H88C 3K57A 1NTZG 4IOIH 1YTYA 1LR1A 2E2JJ 4U7BA 5K1XA 2XUMA 2B9BA 3CCLP 2F6CA 2BY1A 4MTGA 1RPOA 1X1AA 3EYIA 3APOA 2QVAA 3JRHA 2OYIA 2W83C 2NVYJ 3A0RA 4HF0A 1HNWO 3H1JG 1WFXA 1P4RA 2XOKG 4HYTB 2ADQB 5K1YA 3SEQA 1SQXG 1S2EA 3H32B 1BE3H 1MUUA 4II3A 4L74A 4BE0A 1HJBA 1B3QA 3ETQA 5E1ZB 3MAQA 3HDDA 5CVVA 2EINC 1YYCA 5AW4B 1LUVA 3S1KA 5APVA 1AVYA 4N0BA 1UELB 1AKHB 3DC6A 2IZ1A 1YBKA 2NYXA 2LGWA 2JR8A 1HBWA 3H1LD 4JF7A 2HQRA 4GO1A 4DRXB 1Z6RA 3HKCB 1WB7A 1Y56A 2LBFB 4LBEC 4LMYA 4NDLA 4LNUB 1FDMA 1OJHA 2CV1A 5JQGA 3D36A 2FB5A 1R3KC 2B88A 3JW4A 1WJAA 3BCCJ 3H1CA 3HD7D 3JASB 4GLXA 3S1RJ 1GT0C 4WY4A 2KIFA 2HPMA 4UUSB 3FB5C 4PI2A 1AI6A 2VL8A 2EV0A 2H6CA 2DMQA 4X64B 3CP8A 2P0WA 3BG3A 2HLDG 1JE8A 4HW0A 2YSUB 1BCCG 1QQIA 3DTKA 1YEWA 3P32A 3VYIA 3C8VA 2WAQA 4AIJA 2IYPA 2D2CC 3CX5I 3LIEA 1PNLA 1QEXA 3ZIAG 5M5YJ 2NLJC 3NRVA 1J2JB 1M1JB 1O3QA 4NXNB 1NKNA 1OV9A 1TQPA 4B48A 1FD9A 1CW5A 2O8KA 2DK8A 3H1LH 2JEEA 1JJOA 4IOCF 4CS4A 3DU6A 1GHCA 4JI4B 4JAAA 1H2KA 4P5OA 2KB1A 1Z9CA 2BE3A 1L0NE 4X20A 3DEEA 2GZWA 1Z0XA 3OYFA 2ECBA 2MD5A 2FYNC 4BY1J 2V7QG 5EGOB 2P22C 1SQVD 2YX4A 1UG0A 4Y17A 1ZUQA 3LL7A 4WFEA 4AYCA 5KA6A 5B66E 1XREA 2P7TC 2ZXWH 4E7KA 1WLEA 2H09A 1QLNA 4GYGA 3AEGC 4EGYA 4EFBA 3JAMZ 3AEDC 3O6QB 3LSSA 3SFZA 1NS1A 2P4KA 4U7NA 3CPWU 3D70A 1FFXB 4UB6Z 4P2ZA 4DV5O 5CVRA 2P2UA 1OCZH 6PAXA 3MGNA 1RH5B 2VWKA 2R7VA 2Y31A 2GXGA 3SYQA 2HQ5A 1SD6A 3OL3A 3K4MA 1JOCA 1RSOA 3HTUA 3TKYA 3L71G 5GTHC 3BR6A 1LJ9A 3IFXA 3CI9A 3JRIA 3BC8A 5CCGD 3GLLA 5H20A 2DQ0A 1SAXA 2QENA 4N9IA 3VQWA 5M3MJ 1R5GA 2C6YA 2AXTH 2E5LO 3ZR8X 1W7PD 1ZN5A 5J1YA 2JK3A 2OZUA 4XKVA 3UT5A 3IGAC 5EZYA 1X19A 2IH3C 3M91A 1ZGWA 3D5LA 1CGPA 3DTEA 4J9YB 3A02A 4KMUX 4IT5A 2ZKOA 5F2VO 1GD2E 2H7HA 2EZIA 1I1SA 1I1GA 5D6EA 4BWAA 2DI3A 2ZB9A 5AVTB 1WVRA 3CCVP 3LSTA 3CD6I 1KKDA 5A2QK 2DT5A 1YDXA 2YXQB 1OCCH 1LB2A 3ZQIA 3RK3B 3BG6A 4DR2B 2WBMA 1MFTA 2ZD9A 1ITYA 2KSDA 5AVRB 1HA8A 1ZRTD 4B3TB 2VKEA 5HLTA 3ABLC 3NARA 2FKXA 1MMSA 5CA0B 3SEZA 1QNMA 4X62O 1GN2A 1Y74B 2R7FA 2XPWA 3WG7C 5CA1B 1NTZJ 1GM8A 1FZAA 1K4TA 3R60A 2UUCO 3O3KA 4XRSA 4F7ZA 2MA3A 1LTJA 1L3LA 5EK0A 2JA6J 2V9PA 1JY2N 1YXBA 1SFEA 2M7WA 1HF0A 4BQQA 4B47A 4BW9A 4YY3O 1LP1B 1IXCA 1R1TA 3CTAA 1NTME 1F9NA 1MBEA 4B43A 1MZFA 1SEUA 4CDGA 4QTRA 3CP2A 2Q7EA 4MVRA 4U3JA 3USSA 1WZ2A 5IYDJ 1XMQB 4X6AJ 1X1CA 2G38A 3F72A 2O9LA 5FLXN 1SQPJ 3NR7A 5H2FE 3I59A 2YDEA 3RYHA 3HRNA 4CPGA 3BR0A 4Q4ZF 4LLNA 2VQHA 3LSRA 4L9JA 1OW6A 2QF7A 1GV5A 2Z0AA 4XLAA 1YJWI 3BJ6A 2CUZA 3CMEV 1Q90D 3HKEA 3ZHQA 5CQGA 3TGUE 3RQIA 2KG7A 1SVMA 4V2FA 4PA4A 4JI7O 2ZO4A 1IDSA 2OYOA 2GIVA 3W3CA 5CBFA 3OAAG 1P2FA 4O4IA 3CUQC 3K9TA 1IBLB 2M0MA 1VTNC 1GV2A 3LSGA 5D4SA 1SQQE 4CZZA 2WV0A 2QJPB 2RQQA 3ZQFA 3NFQA 1M57D 2QSAA 1URFA 5K7ZA 3AK3A 4OX9O 4AYBN 1B59A 3VP9A 3JAMN 2XVCA 3IV5A 1K6OA 3REOA 4G27B 3U21A 2H8PC 5K1PA 2QEXP 5GADJ 4YXDC 1WA8B 2CG4A 5IPAA 5JVGF 3S2DJ 4ZC3A 4LWSB 3A0BH 1LFUP 1QVGU 3RK2B 1QLEC 2QKAA 4FASD 4EJVA 2D2CD 5B66Z 2QSIA 3C3TA 3S3WA 1GL2B 2ID3A 2KYVA 1RQVA 3M0DA 5DJTB 4CH6A 4M6XA 1H2MA 4GUNA 2PAJA 2FYUJ 4FLTA 4IL6E 4RJTA 2LFBA 3M3YJ 1D8KA 3FISA 2PP6A 2HVJC 4LFBB 2YX7A 4UB6E 1G8MA 4GOFA 3CCSI 4RB2C 1VF5C 2JIZG 2JGDB 1JKQC 3ZEDA 3CO6C 1U0JA 3KLOA 1Z3YA 3C18A 2CK3H 3B73A 2XAFA 2BHZA 3E22B 5AW9B 4ZHQB 1LVKA 5TISC 1RF1C 3MKYB 1Q6UA 1GMGA 1GRJA 1W5SA 4NTXA 1RR7A 4FCYA 4QLCU 3RYCB 3KP2A 2CDYA 5H5NA 1NVPB 3N97A 3CQZJ 4WXHA 3HUSC 4ASWA 1L0LG 1XMAA 4JV5O 2O01N 3SZGA 5IT9N 1YJ9V 1YIJI 3DKWA 3HKBB 4HF1A 5DECA 4A93J 1SS3A 5IYZA 3AG1B 3LSMA 1IXBA 4PJ0Z 4B7KA 1KILE 4KFMA 2KKWA 1LDJA 5AW5B 2UXBB 3K1NA 4IHXA 4CCMA 2KLOA 2DPUA 1RE4C 2DJNA 2NOJB 1ENVA 4K0KO 4U0VA 4NPDA 4GDFA 2GIZA 1YI2I 2X6OA 2CW8A 2AZ0A 4DW0A 3QOPA 2OT5A 1N33B 3ABKC 3DPTA 1G1JA 1RP3B 3AL0C 2KRHA 1G3TA 1AWCA 1W59A 1DX7A 3A0BC 1JX9A 1XEQA 5EYPB 2OAZA 3VMYA 1JCDA 2CAZC 1MZBA 4IHSA 4ASVA 1OVVA 3MVPA 3HOTA 2X48A 1YFHA 3B8MA 4LIVA 3VQXA 5B3SB 3UT5B 3CUQB 3L2VA 3QH9A 4FTHA 2J59M 2WSFJ 1KP2A 5E8GA 3LA3A 1KC8Q 1IC8A 3EETA 2XKPA 2Q69A 2X0LA 2P5KA 2F48A 4PA6A 1STZA 3JD1A 4E6KG 2YU9J 1BHAA 2DOFA 2PEXA 2MGQA 5D6FA 2YKQA 5BPDA 4A3GJ 1FXKC 4HX4A 2GA1A 3W67A 1M90Q 3L70G 2HOTA 3MN2A 1FIPA 1OCOB 1DPUA 2HU9A 4DJGA 3OYLA 3JCUZ 3B71A 1ETXA 3LA2A 2YICA 2XGCA 2BTQB 3K6GA 3TGUH 3OV8A 2O1JA 3RFRA 1BSHA 1ZQ3P 2IBZI 5DM6F 3JARA 2AQFA 2NPSB 3A1YA 4UFZA 4Z2WA 3VN0A 1VQLI 2QTSA 4XN0A 5JHUA 1JNMA 4RB0A 2UUAO 5J47A 5H2FZ 2FQ4A 2PLYA 3L72D 2EINH 2PMZN 4MGRA 2XZRA 1JGSA 1LEAA 2QZ8A 4AD9A 5IE9A 4B7EA 3SYTA 2R5YB 4R7CA 3PO3J 3P9CA 4IFMA 1OW8A 2R4GA 1K4CC 4EKWA 5B1AH 3VMZA 4RA2A 3IKVA 2CW0F 3BA9A 3GTLJ 4JYCA 2UWMA 5LOVB 4A3JJ 2F1MA 3SPJA 4FISA 4Q20A 1ZARA 1FOKA 1USSA 1WRGA 3Q2YA 2IZ0A 4HG2A 4U0WA 4Y28J 3V2NA 5B3SH 3AFHA 2OJED 1FDOA 3FIWA 3GLXA 2JA7J 5FNVB 3K5MA 4FLZA 2DWEC 2M8RA 3IAYA 4O4LB 3AE2C 1P92A 2KZGA 1QZEA 2CTWA 1YX5A 4NYKA 2WT7A 5EYRA 1U9OA 2ESNA 3DTUB 3JSLA 3OTOO 1W5CC 4LB5A 1VQ8V 1G2CB 4XLEA 3GHGA 1H0MA 1FOXA 4FIPC 3L2RA 2NN4A 1FEXA 1HGZA 2HTSA 3A0HH 3IRRA 1PP7U 2OU2A 1XN7A 1URQD 1VI0A 2ID6A 4CSWA 1NTZD 4YY3B 2JMWA 3AG3B 3MZ8A 4JV5B 2A07F 5IT9Z 4B3MO 4Q6GA 3M9HA 2P6JA 3L74H 3TDUC 2Y4UA 3BPXA 2DQRA 2OYHB 1LE8B 1H8AC 1H0TB 4GKJO 2BOCC 5CHXA 1NU1E 4PJ0C 1NVOA 2VONA 3QPLA 3GBGA 2WITA 2KZJA 1JQ0A 2IFMA 2AEJA 2H1LA 2VKVA 3FWEA 4WBNA 2XGXA 1VQ5P 2ETNA 5K5OA 1T5EA 3CCUP 4GIFA 4GFBA 2LLKA 3JD2A 4WB4A 2KPMA 3HEFA 1QR8A 1DGRM 1Y0NA 1E79H 1W5TA 3MAJA 3HTKA 4I55B 4NHJA 2E5NA 3E8FA 3F21A 4W7YA 2ZIMA 4IQJA 4U3FH 4LG0A 5EBWC 3JAMK 3P5JA 1IZ1A 1ZRCA 3PP5A 3GWKC 2VKHA 2Z2SB 3VYSB 2WAFA 3K58A 1N73C 2F5VA 3ZP5A 2IAIA 3V8JA 1FAFA 2DYSB 3QODA 1L0NK 4I2LC 2F95B 2R7QA 4A5NA 3E2EA 5E1XA 1MG1A 3R61A 1K05A 5LGNA 2A61A 2ZMEB 3LNNA 5KAFH 5KLIC 2X9DA 2LVSA 3RKQA 5GTIE 1FJPA 3CJRB 5KJ7D 4NPFX 1HSTA 5KLVD 3OS1A 5AW3B 2RN7A 1WP8A 3PQJA 2VOPA 5FKLA 1QVUA 2DFEA 2GBOA 2OYQA 3BFRA 1YJ9P