1S3JA

X-ray crystal structure of yuso protein from bacillus subtilis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
SADQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYLSFLTEEEMLQAAHITAKLAQAAETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YusO protein
publication title X-ray crystal structure of YusO protein from Bacillus subtilis, a member of MarR transcriptional regulator family
rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 47
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s3jA02
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1s3jA03
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1s3jA01
5J8FA 1ZGJA 4RGSA 2DQLA 3QWOC 4O6JA 1MFTA 3TO9A 1ZARA 2H27A 4A0ZA 1Z91A 3ZMSA 2VE8A 2NS0A 4UV9A 2HEOA 1FNNA 2CSOA 2V1UA 2D1HA 1J5YA 2HTSA 2V79A 1LDJA 3KFWX 1K7AA 4CDGA 1OYIA 3HSFA 1W5SA 3WTYC 3CUQA 4Y13A 2ELHA 2IRFG 4GO1A 1LNWA 3E35A 1P4AA 4YIIA 3WTXC 3TKYA 4PZJA 3L2CA 1SD6A 3RJPA 3IWFA 4A5MA 2IPQX 2KZJA 4MN4C 1BC8C 2XVCA 4OMZA 3CUQC 3HHGA 1HKSA 1HQCA 2HOEA 2QZ8A 1LVAA 4A0YA 3EYYA 1AWCA 1SS1A 3WTSC 4HAMA 1BDCA 4Q5SF 4RB0A 1LQ1A 3HSRA 2EWNA 2FU4A 2BEOA 2EFWA 3ZN0A 1EV7A 3KP6A 4KN4X 4WF2A 2MC3A 5LRSA 1RNLA 1ULYA 4ENMA 3IC7A 1HW1A 4A6EA 2STTA 2XAQA 1U78A 3U2RA 4OIQF 1S3JA 5K5OA 3F8NA 3DEUA 3C7JA 4I2OA 1T2KA 1MJAA 3W7WA 1XSDA 4A12A 1HKQA 1EC5A 4WK8F 2P58A 4UV8A 1XMAA 4ZZDA 4WWIA 2P4WA 4R8HA 1IXCA 1LDDA 4RAYA 5DCFA 4NQWA 3WODF 3K1PA 4ZYGA 3S2WA 4ZYEA 3J81Z 1IN7A 4BQAA 4I7HA 2PEXA 1G3TA 1LP1A 3F72A 2DO7A 3SZPA 3FWEA 3MZYA 5ED4A 5AIPA 2D1VA 4CPGA 3K2ZA 1WSUA 2ZMEA 1I1SA 4HX4A 3JAMK 2FE3A 2Z99A 2W57A 4I02A 5HVQC 2KZIA 1JHHA 4L9TA 4OMYA 4NB5A 3ABUA 4CHUA 2XAFA 5HLHA 3BJOA 4FX0A 1BI2A 3HUGA 4S05A 3D0SA 1KYZA 2FQ3A 3HOTA 3Q9VA 2XKPA 2ZKZA 2CG4A 1XMKA 1JHFA 3DPLC 3JSPA 1OPCA 3C3WA 3LQRA 5CVVA 1BJAA 2IP2A 3EETA 3FZVA 1S6LA 1YW9A 1PP7U 2EV6A 1U7JA 3U1DA 1P2FA 4B8XA 4UVCA 4GXOA 4UVAA 1DP7P 4KYWA 3ZMZA 1BI1A 2D45A 5F6FA 1UHMA 5TRDA 2EFOA 1KYWA 3TOBA 3F6OA 4GGGA 5FO5A 3F23A 5CBNA 3N97A 2BV6A 3K69A 3LWFA 3PQJA 3GFMA 4BNCA 1LJ9A 2KIUA 3SQNA 1O3QA 4K3AA 4M9ZA 1D3YA 4LK0F 3TO7A 2E1NA 2AS5F 4WWCA 1DDNA 5CVRA 1O7FA 3CTAA 4LJZF 5HS8A 3FM3A 3R0AA 2IA0A 1KA8A 1KGSA 3HRSA 2KIFA 3S1KA 3SZTA 2F5CA 1KU3A 1QO0D 3ELKA 3R61A 1TW3A 3MAJA 2NYXA 5ICFA 1W4MA 4HF0A 4AD9A 3CLOA 1RZ4A 2WTEA 5IT9Z 4IRIA 1W7PA 1SFUA 3M8EA 5DUIA 2J5OA 1UHWA 4I01A 3QAHA 5DV5A 3LA7A 3QPHA 2B88A 3F22A 4RGXA 2IA1A 3ZMDA 2A61A 4M73A 3RGUA 3W7XA 3COAC 2QBYA 4MEXF 2QBYB 5HDKA 1KQ0A 1GXQA 4CYDA 4A0XA 1CGPA 4M6XA 4U0VA 5D5VB 3L09A 4HKZH 1TNTA 1R5GA 4CO8A 4FT8A 3HRUA 2XHKA 1I1GA 2A69F 4HLYA 1MKMA 2VONA 1U5TA 4Y17A 1I27A 1IN8A 2EV5A 1U5TB 5E8GA 1FSHA 4BXLA 4HX8A 3P7NA 2RV8A 2UXXA 1YLFA 2PQ8A 3DFGA 4ENKA 5K5GB 1IXRC 4ENJA 5L3DA 4KNYA 5CLSA 3K9TA 2ZAEB 2M0BA 5E1ZB 2CW0F 3GVAA 3TOAA 1YYVA 5H20A 2O3FA 1BC7C 1Z6TA 5L3CA 2H6BA 2OQGA 4LLNA 1SD4A 4L9VA 2JSCA 2DU9A 4IHTA 4WX9A 1XGNA 5KK1A 2LXCB 4G6QA 4EV0A 1QZZA 2DPDA 1E17A 2HQRA 5H6RA 4ZYHA 2ZBKA 4XSXF 4P96A 2FNPA 2ZJ2A 3GFLA 5KVRA 2P90A 1OYWA 1R36A 3HTSB 3FXQA 4EMSA 3ABTA 1XB4A 3B02A 2K4JA 2KUBA 4U7DA 2FMYA 3WTTC 1J75A 3WTVC 1XCBA 3MEXA 2G9WA 1Y47A 4OOIA 1ON2A 5TJJA 1R22A 3FMSA 2VBWA 1FBSA 2MH2A 5EEHA 4AVPA 2VBZA 3M8FA 2KRFA 2MBFA 2QUFA 3KZZA 3M1EA 3LSTA 2B89A 5D8KB 3V7CA 2FNAA 2HYGD 2WWYA 3ZMTA 2X4HA 2QQBA 3FF5A 1JE8A 1H9GA 5DJTB 3E97A 1KQ9A 2ADUA 3V8KA 2CWEA 3KP4A 1KU7A 2PG4A 3VB2A 2QRXA 1JGSA 2OAZA 4EYYQ 2AXLA 5A2QZ 2Z3YA 4S04A 2MD5A 3LA3A 3GWZA 4HQMA 4PCQA 4PDKA 4P9UA 3O2PE 1FC3A 2ZXJA 1U3EM 2BE5F 2OBPA 2HDCA 2KJCA 4K2EA 2Q0OA 1ZG5A 3RYRA 5D6EA 1A04A 2BYVE 4XLNF 4AIHA 4ZYDA 1WKMA 4HYEA 4EM2A 4F7ZA 1S8NA 2XUBA 1FPQA 3F21A 1XN7A 4IVNA 1R1VA 3ZMUA 3T8TA 1IN6A 3GFJA 5E20A 3LA2A 2JTVA 3LFKA 2OZ6A 3MZWB 3O3KA 1ZYRF 2P7VB 2Z5UA 3V4GA 3BOQA 1KU9A 3RIRA 4U7BA 2RGVA 3F6VA 3HYIA 3T1BA 2C6YA 1ZHFA 2STWA 2XGXA 2ZFWA 5JR3A 2DI3A 5LLQA 1XSXA 5DD4A 3P9IA 3KZYA 4BXUA 4XLPF 2UWMA 1ONVA 3CUQB 5LGNA 5J6XA 1FYLA 4KJMA 2DBBA 3I5UA 5EEGA 1G4DA 2GAUA 1Z6RA 4KUMA 4I98B 1T6SA 3M7GA 5CYVA 2HR3A 5JHUA 4GOEA 5LGUA 2L3DA 3R4KA 4U0WA 3BP8A 4MHGA 2V9VA 5JFRA 3BPXA 2TDXA 1PUEE 4DNCA 5DEQA 1MDMA 4MEYF 2VC0A 3NRVA 1UFMA 4JBAA 3E6MA 3W7SA 3TO6A 5K5QA 4LG0A 3EUHA 1GVJA 4BYYA 2JPBA 3DPTA 1FT9A 1YTYA 4RS8A 3JTHA 1EDIA 1O3TA 5HOOA 2O8XA 5HDGA 4HDUA 1ZG1A 1B6AA 1FYKA 2HS5A 4EQQA 1G3YA 1TBXA 2EA4A 1FYMA 5LHIA 3EYIA 3EDPA 2LKPA 1G3WA 5E8IA 1W7PD 4Q48A 4TV7A 1WI9A 3BJ6A 4Z2YA 5IT9K 1IF1A 1OVRA 3C1DA 1FP2A 1BDDA 5EFWB 1U7MA 2GZWA 4OIPF 4BHPA 1QBJA 1T38A 5LRRA 2EK5A 1ZN2A 4HW0A 2RN7A 3U9GA 4G8XA 1S29A 2FEZA 4OIRF 1LP1B 3QP6A 1IW7F 1G6NA 2CGPA 2QQ9A 1NH2B 2B87A 2DTRA 4N9IA 5DDGA 3VEPA 2B87B 2P7CB 1QZYA 3RYPA 4KA4A 4U88A 3E5UA 2M30A 4M72A 5D8LB 2ZMEB 2A68F 1LEAA 1F9NA 2VT2A 4UNOA 4L5JA 1IAWA 5D5WB 1OVVA 3GUDA 4IPAA 5BQTA 2RNJA 5BMZA 3DXJF 4H0EA 2WC2A 3QRFF 1V3FA 4OIOF 1J59A 2E7XA 4O3MA 3W7TA 1XGMA 4Q47A 2VOPA 2E7WA 4ASWA 3RPQA 3F3XA 3M9AA 3LAJA 3F8BA 3RKYA 4ZH4F 2EFPA 1RUNA 2KIKA 2M8EA 2ZNZA 3DKWA 4AIKA 1S7AA 4Q4ZF 2HGCA 4CZZA 5FLXZ 2ISZA 1OKRA 2P6TA 2PBIA 5IT3A 3RPUA 4I0BA 2IA2A 4CXFA 3ZQ7A 3HHHA 2P8TA 5FD5A 4HDVA 3VODA 4YFXF 2BBYA 3HRTA 2L54A 1MJBA 4EM0B 5BPIA 3T8RA 2Y0MA 1LDKB 4ZMDA 2EV0A 2X0LA 3IRRA 5E18F 4EGYA 4MGRA 3KEQA 4M74A 3N4MA 2PI0A 1SFXA 2OU2A 1Y0UA 2DK5A 4PGGA 1BOAA 5ICEA 4A5NA 1ZW0A 1VTNC 1LEBA 1QPMA 3NQOA 4KMUX 3B73A 2XASA 2RKLA 2QWWA 4U0YA 2ACJA 2EFNA 3MQ0A 3CDHA 1P92A 2GA1A 3BPVA 4IRGA 1FSEA 1MZBA 1KU2A 2HQNA 2DFIA 3WTWC 1BI3A 3WGHA 2E1CA 5C39A 3ISPA 3TQNA 3V7SA 4EVIA 1Z05A 3I0TA 4LLLA 4B09A 3WU0A 4EJOA 5E1WA 4QLCU 1R23A 3R0JA 3MZHA 2RKHA 1XDUA 4KIBA 3BJAA 5A2QK 3RI4A 2H6CA 2LF8A 4GYIA 1QQIA 1W7PB 3ECOA 4A2UA 3CUOA 2QVAA 2BGCA 1XDSA 3P9KA 5GW7A 1NVOA 2PMUA 2OZUA 4YG2F 2KJBA 2JRTA 1MJ9A 4IOIH 1J0RA 4ASVA 3CO6C 2M5AA 4EM1A 5BOXA 3IKTA 2MH9A 4DQ2A 4HB1A 1TQIA 2WV0A 4M71A 5LHHA 1OYYA 4R1HA 3QOPA 3KLOA 1STZA 2ESNA 2RQPA 3O6BB 3ZP5A 1X3UA 4OINF 2QLZA 4GODA 3VOEA 1P6RA 4IRHA 2VXZA 5LBQA 1J2XA 3T5XA 3FXEA 3KP2A 3KEOA 2H09A 3CJNA 1SD5A 2G7UA 2FOKA 2CYYA 2A3SA 1EDLA 4ASNA 1DPUA 1IN4A 3I4PA 2GIVA 3E6DA 1EH7A 2R7DA 5L3FA 1P4XA 2DQRA 1USTA 2L4MA 3H3ZA 3C18A 1T98A 3WG9A 4AWXB 3I59A 2RC4A 1T39A 4RB2C 2FA5A 3E6BA 1G3SA 1SD7A 1LB2A 2FBIA 4CICA 1USSA 2CFXA 1PDNC 4L18B 4WXHA 4ESFA 5CVUA 1ZREA 4NPFX 3V8JA 2KI7B 3QP5A 1X0TA 3PQKA 1ZGAA 1IRFA 3H3UA 4HBLA 1LT1A 2GQQA 1UB9A 4KICA 2K27A 4LFUA 4G9YA 3W6JB 2WAMA 5CA3A 2L02A 2P5LC 1BI0A 1SAXA 2VC1A 5DCMA 1YS7A 2ISYA 3L00A 1CF7A 3REOA 2UZKA 2W84A 3ECHA 5CJ9A 4L0YB 4HQEA 5J8CA 4P55A 2O03A 4HJGH 1YW7A 3D5LA 5D6FA 2FMLA 1MGTA 1U6GA 4HF1A 4EJVA 4E70A 3V8LA 2V1DA 3KP7A 1QGPA 5LEKA 4RGRA 2HKXA 3FMQA 3I58A 3KCCA 1D8KA 3FXUA 1Z9CA 1IXSB 2Q2EA 4A6DA 1I5ZA 4HF2A 2QENA 1XGSA 1DPRA 2LSOA 4L0ZB 5BPDA 5CBOA 2KIMA 2J5PA 4M9SA 5CVIA 4WCGA 1RIOH 2EFQA 1OVUA 1L3LA 1ZAOA 3GZ6A 2B0LA 4MTDA 1FZPB 1Q1HA 4LLGF 5H6QA 2DLLA 3RKWA 2ZCWA 2O6GE 2GXBA 3JTGA 3R60A 2PJPA 3DF8A 3SXYA 5LHGA 1ZG3A 1R1UA 4GCVA 4EJWA 4D0PA 3OOPA 3K1NA 5JI6A 4QWQA 3R6SA 4ESJA 1K78A 3WE3A 2M5WA 3GF2A 4KMFA 5K5RA 4GYGA 3LAPA 2GA2A 5ILUA 2QM3A 1XGOA 5D5UB 4KFCA 2HTJA 3KP3A 3GX4X 4LD5A 3FX3A 3I53A 4O5VA 2KS1B 2JWDA 1ZRCA 2NNNA 1WWXA 4WXCA 5ERIA 1E2XA 1YTFB 1YO5C 2V1XA 1PP8F 3Q5FA 2R7FA 3LQQA 4ENNA 1XCVA 1H0MA 1OR7A 1ZLJA 4I09A 4XBFA 2FRHA 1D8JA 4BH9A 4MQVA 1F5TA 3AAFA 1REPC 4YIFA 3D3IA 1RUOA 5FLXK 1J7KA 5ICCA 4G7HF 2K86A 1EDJA 5DYMA 4EJUA 3FHZA 1ZRDA 2MA3A 1KQ8A 2EJRA 3I54A 4AIJA 1FWZA 1FP1D 1FOKA 4CGZA 3Q9SA 1H9TA 2O61A 3L9FA 1Z7UA 2K4BA 5L3EA 2M1BA 3L7WA 1FX7A 3F8FA 5DJUB 3ZN1A 1JM0A 4L9JA 2H94A 2VBYA 1MDMB 2A6EF 1WQ2A 2IW5A 2M87A 2FXAA 2PMHA 3V7RA 3WTZA 3ZMVA 2YR2A 4LG0B 5E17F 2XV4S 1BM9A 1ON1A 2COMA 3G73A 4NHJA 2F5FA 1D5VA 1WRJA 1O3SA 1R00A 1IN5A 1XSVA 2NRAC 5DD8A 2LF7A 1GXPA 2QYOA 1HSTA 1MD0A 2LR2A 2RVCA 5FFXA 1BN5A 2WMMA 3KE2A 1SFEA 3HRMA 3MWMA 2HFHA 4XSZF 2OA4A 3MCZA 4BHBA 5LGTA 2LXBA 3QU3A 4Y15A 1JMBA 3FMRA 3FM5A 4JBZA 4G7OF 1BBYA 3F8CA 3JW4A 3IHUA 4M9XA 5D4RA 2I8DA 2ZNYA 2K02A 2VODA 3F8MA 2CO5A 4LB6B 4N9HA 1F1ZA 4HZFA 4EGZA 4LB5A 5F1RA 4ZNCA 4N0BA 5HLGA 3SHFA 2Q1KA 5ILSA 5F64A 3ERED 3QPTA 2ESHA 1TQMA 1BIBA 1NVPB 2YSRA 1K79A 2DAOA 2LNBA 2F5EA 3RDIA 3HTUA 2GXGA 1TNSA 3KP5A 1B9MA 3KETA 1S7OA 3GXOA 2XROA 4UUVA 3K1MA 2OQRA 3IL2A 4LMYA 1O3RA 2MLGA 3GYHX 3ROUA 3BWGA 1ODDA 3IWZA 4JK1X 4L9NA 2QVOA 1HBXG 1YFHA 3ZDMA 3I64A 1HXDA 2F5DA 2YPRA 3WU1B 1B59A 1YQAA 2L01A 1BIAA 3H92A 1K6OA 4OU0A 2A5YB 4UHTA 4YFNF 2DT5A 2IJLA 2MLKA 1B4AA 3WGGA 1UCRA 2Y75A 1TW2A 2XAHA 2IVMA 4IXAA 2HYFA 1O7LA 4IJAA 2JT1A 2UXNA 1FBQA 5DUKA 1Z1DA 1HSJA 1EDKA 1C0WA 2K3RA 1I6XA 5ILVA 2XKOA 4G94A 2JPCA 3HOSA 1L0OC 1F4KA 5ICGA 4BAYA 5L3BA 2L4AA 2RDPA 1GHCA 1TQPA 4HV5A 2ETHA 2W24A 2FF4A 5K1YA 3FXDA 2OD5A 5CVJA 3JSOA 3MHVA 2DK8A 4RB1A 2GWRA 4RGUA 4KT5C 4GOFA 3SFZA 3NEUA 5HS7A 4YFKF 3ZPLA 1W5TA 2HKOA 2YX7A 1FBUA 5D5XB 1ZH5A 3GEZA 1XD7A 4ON0A 1ZRFA 2EA2A 4KIGA 3P9CA 3TDZC 3GW2A 4UVBA 4K35A 4NPDA 1OMIA 2D2WA 4PGHA 2PLYA 4I0AA 2VOOA 4G6DA 1JXSA 1DUXC 3J7AO 5BS6A 3J80K 1IUYA 5E1XA 4KIFA 4ETSA 2KKOA 1V4RA 3T0YA 1IZ1A 4P9FA 1FC2C 3DV8A 4M6YA 4ZZLA 3BZ6A 4MTEA 1T0FA 5HDNA 5FD6A 1U8RA 3BROA 2VT3A 2M5AB 1Q2NA 3TDUC 1ZXGA 1YS6A 4IHSA 4UXNA 4MQ9F 4LGWA 4HX7A 5FGMA 1HW5A 3MFKA 3IKVA 3FXRA 2G7HA 3ML6A 4FX4A 3IRQA 3DQVC 2ZO4A 3CO7C 2YX4A 4KN7X 1EH6A 3WE2A 2O0YA 1AOYA 1SMYF 3JAMZ 3E5QA 5AONA 3VFZA 1R1TA 2VE9A 2K7LA 4HOBA 4NPEA 2QQAA 3I59B 2YU3A 2A6HF 3PFIA 5LEJA 5FB2A 1NHAA 3GLXA 2Q8KA 1HW2A 5HS9A 2EB7A 2W25A 3HIFA 3WTUC 2SPZA 2PN6A 2NAZA 3EQLF 3ULQB 2R3SA 5FFZA 2R44A 2NNYA 3BDDA 2A07F 1U5TC 1YG2A 4ESBA 3WGIA 4JQFA 1SMTA 1TLHB 4L5IA 4BHCA 5DCMB 2Z33A 3PH0A 1DEEG 1R7JA 1CF7B 2OTKE 2XRNA 5D4SA 2M45A 4HV6A 2P6SA 1P4WA 2XAGA 1EH8A 2F2EA 5JVTA 1YIOA 1HKTA 4LK1F 5AIQA 1B1BA 2LDUA 3GO5A 1RI7A 4EJTA 6PAXA 2HWVA 2HZTA 2XIGA 4G7ZF 1R5HA 2DPUA 3QU6A 2CQKA 3HSEA 2FBKA 1R58A 3W6KB 2VBXA 4WXDA 3E3VA 1ZLKA 3KLNA 2VN2A 2UWJE 2P5KA 4RAZA 2XAJA 3W7UA 3DP7A 2Z9OA 1IRGA 3E5XA 1QNTA 2DW4A 4R79A 3BY6A 3E6CC 2W85A 4RB3C 4P5OA 4IF4A 4KDPA 3J80Z 2FBHA 1FY7A 1H0TA 4MNUA 1O57A 3OV8A 1H0TB 1TTYA 1J9IA 3J81K 3K0LA 1B9NA 2JZYA 3G3ZA 1RM1C 3GFIA 2V6CA 5HLIA 1U2WA 3TGNA 4XRFA 3RKXA 2P5VA 1K78B 2FSWA 3GZ5A 5L3GA 4FHTA 4HA8A 2Y48A 1YW8A 2PFBA 4HLXA 3I71A 1FLIA 2IT0A 3RTRA
chains in the Genus database with same CATH superfamily
1JTHA 4Y3OA 4FLUA 2WY7Q 2LQTA 4IFMA 2GUZA 1R3LC 3UT5B 4GKJB 3TGUE 4O6JA 1WVRA 1WLEA 2XDJA 1S9KE 3H1KH 1FZCA 5CN0A 2HEOA 4QPQA 3L73H 1GW4A 5J2TB 1ZQ3P 2NZ2A 1FYJA 1LDJA 4X1EA 2QEXV 4OH8B 2ELHA 2IRFG 2K3FA 4JF3A 2DN9A 2VJJA 2DCEA 2GOXB 5EG0A 1R71A 2R5ZA 4PZJA 2HLOA 2YIBD 4BR6A 1DLBA 4V2GA 3OSGA 2D2CD 1HJ0A 3ZHTA 5J4YA 1HBWA 4O9BA 1IDYA 2V7FA 2XVCA 4BQNA 1SQFA 3L71E 2HJFC 3BRTB 3L74H 4RB0A 2Q3IA 1VQ8V 3DLLF 4B3MB 2R7TA 2YO2A 3AE6C 1GO3F 2KG7A 4YXDC 1WGXA 1HW1A 2JS5A 1SQQE 1VQMP 3OS2A 1U78A 1JMKC 4OIQF 1MMSA 3HKDA 1U9NA 3LSQA 1DF4A 3M1CA 2YDEA 2X1EA 1QVGU 3OM3B 4C3JJ 1L4AD 3W7WA 3BG5A 1XSDA 3L1PA 3SJMA 4LH7A 3VDXA 1KONA 4N78D 3DWLE 4H0LC 4IL6H 5ITZA 4DR6B 1GDTA 3FIWA 3CWBD 3FD9A 4H4KC 4U7NA 4C3HJ 3HDDA 4JASA 4PA4A 2EIMC 5EBMC 2A3QA 1IXCA 1LDDA 4RAYA 1Y1VJ 3WODF 3OMIB 4ZYGA 4NQWB 3EPZA 4DO2A 4TQDA 2PEXA 3CC2P 1H8AC 3SYPA 5KCMA 3D5SC 2YXYA 1WT6A 2ZM6O 3TF5A 2GBYA 3DU6A 3K4LA 3JARA 1M1KW 2XGCA 1VQMV 3K08A 3DTUB 2FOWA 3I56I 4YJ2A 4CCLA 4G6TB 3ITKA 4N6JA 4LF6B 1M4UA 2Z99A 1A6QA 2WPRA 3AK2A 3Q5RA 1JHHA 5DM6F 4OMYA 2XPVA 4HNAB 1FIPA 5J1UA 5IJ0B 4S05A 2WAQN 2HNHA 1KYZA 3GF3A 3HOTA 5CBGA 4A3JJ 1W1WE 1OCPA 2IFMA 3AG2C 1J5EB 2ME0A 1OPCA 4XONA 5B66E 5CVVA 2F4IA 2EZIA 4BQOA 4GT1A 3OTOB 3FZVA 3H1LE 3NWTA 4G12A 3CC2V 4JYAO 4LFAB 1XOUA 4WCEV 3CWBH 4O4IA 1DGWY 1P2FA 1QRYA 4UVCA 1DP7P 4D6TJ 2EZPA 3SJAC 3AEIA 1UHMA 5GAEJ 3J80N 3TOBA 2V4DA 3RSNA 4L87A 3H1KG 3E8BA 2KDZA 3TBIA 2DFFA 1CQTA 2BV6A 2YKQA 4DZJA 1JOCA 4MVRA 3K69A 4E4HA 3R66A 2D2CB 3GFMA 5JCOC 2ZSIB 2JA7J 4JX4A 5JQGA 3O8GA 3S1NJ 1H2GA 1O3QA 4B3SO 4NTXA 3CDLA 2DA3A 2BEZF 3L70H 1SF9A 3RN4A 3VN0A 2XGDA 4BW9A 1RETA 5CVRA 2A05A 2E36A 4DW0A 2E74D 1N73B 3CC4P 1IJWC 4I4TA 3R0AA 1AROP 1SA0B 4EKWA 1SQPD 2HVRA 2CQ7A 1KU3A 2DYRB 3A01B 1G59A 5ICFA 3MHHC 3P8MC 3L74G 1IBKO 5CBFA 1L4AB 3CZ6A 3OYHA 2CV0A 1ETXA 4DOJA 2WTEA 4MVSA 5IT9Z 1IRXA 1OCRC 4IRIA 1W7PA 4JQ0D 2OPTA 2BCCD 2NPSB 2HXOA 5LP6B 5DV5A 4BJ6C 2F4OB 1ZN5A 2ZSHB 3IH3A 3JATB 2A61A 1JQ0A 1J1DC 1MMAA 3COAC 3RL0g 2W7NA 4F91B 1FS0E 1GXQA 5D5VB 3S15J 4X9QA 3O6QA 3ZS8C 4I9QA 1TVKA 4HLYA 1MKMA 1DTOA 1GMJA 2VONA 1EKEA 4YHHO 5E3OA 1U5TA 1A31A 1BS3A 2XSJC 1FSHA 1JY3O 3UIAA 4HX8A 4RM3A 4IKFA 1M90Q 2LGQA 5D5PA 3DFGA 4ENKA 5K5GB 2PTMA 1K83J 3OAAG 3RVZA 5H20A 4JOMA 2WSEJ 4X1IB 5L3CA 1PYVA 5JH7B 1OCCC 2OQGA 4LLNA 4PI2A 2QEXI 1K73W 1YIJP 1ZTRA 4IHTA 4E7IA 2BCCH 1Y6IA 1BR1A 5IJ9A 5FRNA 1K7DA 4IX7A 2ZBKA 4P96A 2EIKC 5K1XA 2P90A 1OYWA 1GN6A 3HTSB 4KISA 1K97A 3FXQA 4QNHB 1WJDA 5GADJ 2XF6A 3FB7C 1XB4A 1Q6IA 4UUSA 4YXWH 2E2IJ 3M4OJ 3FHNA 4Z1VA 1UG0A 3FISA 3CWBG 3H1IJ 1J75A 1XCBA 3BLYA 2G9WA 3B5NC 1QLEB 1R22A 3FMSA 3CMEI 1W0UA 3WG7H 2VBZA 1OW7A 3LSTA 1VQ8I 5D8KB 4MSWC 1RM1B 3KIOA 4KL1A 3CHXA 4BJTA 2HYGD 4O2BB 1XMOB 4OX9O 1RPOA 2Q1ZB 2GOMA 1FTZA 2E74B 2O3JA 1XI1A 2ARHA 1H9GA 4JI0B 3E97A 1H8EG 4AM3A 1KQ9A 5FLMJ 2CWEA 1KU7A 2IBZI 4B47A 1JGSA 2EPFA 2DTZA 2Z3YA 2CUFA 2MD5A 1VF7A 4BWNA 4PCQA 1MG1A 2WPQA 4NKGB 1L0LJ 3WUUA 1FC3A 3MKWB 1NVPD 1U3EM 3G67A 1FZAA 3GF7A 4DV5O 1NK3P 1JKOC 3E1IA 2HDCA 4K2EA 1ZG5A 4XLNF 1HF9A 4ZYDA 1YJWP 5IYCJ 1Q5OA 1OWAA 4PFPA 4NUBA 2M0MA 1Y39A 5APQA 1XN7A 4J7JA 3D5RC 3ZMUA 3GFJA 1OCOC 1JTHB 3GTOJ 2ZJQF 1DF5A 2KS1A 1VQMI 2NN4A 1ZYRF 1YJ9P 2GUZB 2Z5UA 3V4GA 1PFIA 2CK3H 2DWDC 2C6YA 1BE3D 1FZCB 3WG7B 3AE9C 2EBOA 4XRSA 2GHYA 3TXSA 1HNZB 3G80A 2DQ3A 3K06A 2Q4PA 3APOA 4K8ZA 1SZXA 1VZ0A 4UB6E 1PUFB 3JC22 2IM9A 2ZXWH 4KJMA 1K5QA 3TSIA 5K7ZA 5EG0B 1YJWV 2FUG2 3HOXJ 2AEMA 3OEHG 1T6SA 4O2AA 1X79B 3M7GA 4UB8H 2HR3A 2QWQB 5JHUA 3CC2I 2TDXA 1QU3A 2HG5D 1UFMA 3K04A 3G71P 3E6MA 2N9BA 1YJ9V 3TO6A 5CQGA 4KP4A 2RJZA 1SQPG 4MVOA 1KFMA 4DV2B 4UY8I 1GVJA 4CSWA 4A5UB 4LBEC 3WU2H 2O01H 1YTYA 4RS8A 3JTHA 1RF1C 1BHAA 3TNUB 5APYA 2JJ2G 2KG7B 4X62O 2VI6A 3LSPA 1BGYH 2RQ6A 2EIJB 4M3EA 5HODA 1M56C 2BCCG 4D1QA 2O8XA 5JVDB 3HKDB 5HDGA 2OYHC 1W0KG 4X89A 3BR6A 4D5FA 1H8AA 2HS5A 3G6EP 2H7HA 2J58A 2HI3A 1W7PD 4Q48A 4TV7A 5ITZB 3JSLA 1VF5C 1Y0NA 4JZ2A 3JAWB 4YXWG 1T8ZA 2LO1A 1BDDA 1HNWO 4IYHA 3RQ4A 3MZ8A 1GH6A 3PUFA 2ZXWB 3ZOBA 2QCOA 4UB8Z 4TV8A 4OIPF 4JI4B 1Y74A 5LRRA 1K9MQ 2ID3A 2R5BA 4W80A 4GCZA 1Z56A 1S5HC 4N21A 3HGGA 4IYIA 1H2KA 2EULA 4RUEA 2F23A 4ZDOA 1IW7F 3BZCA 4IHXA 4RM2A 2W6JH 1AI5A 3AFHA 2DTRA 1XTGB 4N9IA 5DDGA 4AHCA 4PD4D 1DH3A 1W2BU 1DD4A 4YJ2B 3ZQQA 4PA3A 3WU2Z 2HEPA 4N4OB 1NTZK 2XV5A 3HOWJ 3G6EV 1MBGA 1IAWA 2ITDC 1IC2A 3H35A 1RH5B 1CZQA 5BQTA 1BCCE 2JN6A 2WC2A 1Y8QB 4RAIA 4OIOF 3JRHA 1MBKA 2E7XA 3L72H 1XGMA 1K05A 1TU3F 2E7WA 1KQSU 3A0BE 2WPVB 1QPIA 1WZ2A 5DEDA 2WSFJ 3LAJA 3F8BA 1SQGA 3I4NJ 2EFPA 3HKCA 4FLTA 2L5GB 4AIKA 1VQ9P 5JCOA 4L74A 1NU1K 1ITYA 2EJ7A 4CZZA 1AR1B 3CCLP 2ISZA 4O4IB 5M3MJ 1OKRA 2KQRA 5IT3A 5BY1A 3N7NA 4BXXJ 3KYLA 3FB8C 2FX0A 4GRIA 2AXTH 3FB6C 3IFMA 2KZVA 2HODA 4YFXF 2CK3G 2AZ0A 2C9NY 3HRTA 5EDNA 5GAGJ 1A32A 1LDKB 1LTJC 2H8PC 1Q6UA 1KC8W 3ABLH 2E76D 1E0EA 1SFXA 1NTKD 1MBJA 2CPBA 1NTKK 2OU2A 1YXBA 5J40A 4PD4H 1P7GA 4RESB 2DK5A 4PGGA 1BOAA 5IWAB 1ZW0A 3TGUD 1QPMA 1I6HJ 3RK2C 4JI2O 1S9KD 3E89A 2Q8VA 2R70A 1E79H 4IEJA 4U0YA 1V55C 1N7SA 3CDHA 4BACA 3CCLV 2GA1A 2M4GA 1BI3A 1SQXK 1SFOJ 1T8IA 3ISPA 1P84E 3S1MJ 1T08B 4QLCU 2XB0X 2BY0A 3R0JA 3CXHH 2X9DA 1GK6A 3JRDA 2HU9A 2K5CA 3OGCC 4KIBA 4AC0A 3BJAA 5A2QK 2BVMA 1SVOA 2H6CA 1NU1H 2LF8A 4OAZA 4CCMA 1W7PB 1J95A 4A2UA 1IX9A 3G2BA 3CUOA 2WWWA 2L7FP 4J80A 2AXTZ 5AW2B 2BGCA 1UIXA 3P9KA 2ELJA 1FZFA 3UM7A 1NVOA 2OZUA 1SC7A 2KJBA 3SYAA 3KPHA 2M9HA 2YICA 2V7QH 3L71D 1BE3G 1J0RA 4ASVA 1NTMJ 4EM1A 3KPEA 1TQIA 1U97A 4M71A 3ZGKA 1OYYA 3CCUP 4CCKA 4D7TA 2JGDA 1Z67A 2RQPA 3ABLB 3AG4C 3C2BA 1NTKH 3O6QB 3GTKJ 5KA5A 2P7JA 4RMNA 1SQQD 1M57C 2O9LA 1SQQK 1TVKB 1R6TA 3TGUH 4KHPB 3W68A 4BGDA 3VOPA 2AQFA 3KEOA 1W5CE 1SD5A 2G7UA 2H8RA 1DPUA 1DP3A 2ZR2A 3OL4A 4HNVA 2W6JG 4MTFA 2QJ1A 2DJVA 1J2JB 3H3ZA 3KDPB 1SQXH 5J2UA 3WG9A 1ZR2A 3OIQA 3SWFA 1BQZA 4MVMA 4WXHA 4ESFA 1PD3A 5CVUA 3PM1A 4NPFX 1QL1A 2LY1A 3CCUV 1X0TA 3PQKA 1KN7A 2O57A 2GQQA 1H89C 4LFUA 4XOPA 4X66B 1YJWI 1FIAA 4WF9V 5DCMA 1YS7A 3L00A 3AG1H 1ZR4A 3L71H 4NC7A 4E4EA 5J8CA 3ZQIA 2IJKA 4LG3A 4UUSB 3FAVA 1LNQA 4QMAA 4NR1A 1JT6A 1AKHA 1Q82W 3K59A 2JSPA 2FMLA 2E76B 3BC8A 1U6GA 5FKLA 3PJRA 4TWKA 1SQQH 2D3OW 3V6IA 2XPUA 4CYCA 3ETQA 5KLVD 5M1BA 1D5AA 3FXUA 2Y30A 1QCEA 3OTFA 4WY4C 3H1LD 5IP9J 1O4XA 2Q2EA 4A6DA 1XTAA 1I5ZA 2QENA 3NAUA 5M5XJ 4L0ZB 5CBOA 1RIOH 1MIJA 1APLC 2B0LA 4MTDA 2OCCH 2KISA 2FYUE 5CCHD 1JY3N 2DLLA 1CI6A 1O9HA 1JGGA 3RKWA 2ZCWA 1E79G 3HE4A 2NS7A 3R60A 5CA1A 1PJRA 2WB1N 1IK9A 1QVFU 1ZG3A 4UCOA 2QSIA 2HOSA 1SFKA 4ESJA 4QWQA 2LH9A 1TT0A 3WE3A 4N4NB 1MMGA 3AG1B 2EX3A 5F0CA 3LAPA 1IV8A 4LC1A 2ZB9A 5D5UB 1P49A 3F5WC 2HTJA 3KP3A 4TOIA 3I53A 4DV0B 2ZINA 2KS1B 2NNNA 2YUSA 4CCOA 3RWRD 5TISE 2WAEA 5M3FJ 5IYDO 3CCYA 5BR8O 2R7FA 1ZGWA 2QWPB 2V7QG 1XCVA 4JI1O 1ZLLA 4I09A 1YF2A 5B66H 4DZOA 2AGAA 3H1LH 3MAQA 1REPC 4Y99B 3MHSC 3Q1MA 1RUOA 5FLXK 5DYMA 3FHZA 4CUGA 1NTKG 4JV5B 3LSUA 4NYKA 4AIJA 2OCCB 4O2AB 1COWG 1RF1A 3TGUG 3W67A 1Z7UA 5L3EA 1B06A 2R32A 3BRCA 3ZN1A 5K7HA 2H94A 2O8KA 2PJRA 2OYHA 1RF0A 1WQ2A 2M87A 4PA9A 3SDGA 2FXAA 2PMHA 5LMUB 3ZMVA 2H1KA 1TGOA 1XHXA 1V5EA 5E17F 4B86A 3QOEA 2COMA 3LSHA 1N7SD 2F5FA 1ERDA 1O3SA 1XSVA 3LW5H 5DD8A 2QYOA 3MD2A 1DD3A 4BW5A 2RVCA 4PI0A 5FFXA 1SFEA 3HRMA 4PJ0C 2P10A 2HFHA 4HH2A 2XDVA 5B66Z 1BOBA 4XIDA 4NTYA 4BIOA 4Z1MH 3L71G 3GWOA 1IUFA 2R5DA 3D1NI 3CCLI 2OYIC 4RDUA 5D4RA 1KD1W 2ZNYA 2K02A 2CO5A 2ODMA 5CCGA 5H2FE 4TV8B 2ADPA 4N0BA 3VYUB 4U7OA 3K4BA 1JOYA 4OPHA 2KDOA 2Q1KA 2JA5J 2OJED 1WJZA 2Q73A 4KJZA 1TQMA 1BIBA 2E1MC 1Q3EA 4F55A 1K79A 2DAOA 1EA3A 3JSVC 2F5EA 3RDIA 4AUWA 1GN2A 3S4RA 3OYNA 4BXFA 2GXGA 3U1AA 1TNSA 3KETA 1ENHA 2P81A 3V5BA 2OC6A 2OQRA 3IL2A 3GYHX 4JI6B 3BWGA 5GTHE 5IYZA 4U3FE 4LIVA 1XBLA 4Q20A 2BY1A 4F4LA 2QVOA 2ITCC 3I64A 4JYBA 4JTAB 1JO5A 1FOSF 1K6OA 3H92A 3ICXA 5BVZA 3DU5A 4DRXA 3RBZA 1Z77A 3BG6A 3CCVP 3JSNA 4UHTA 2DT5A 2IJLA 2ZVNB 3HKCB 3VQWA 1UCRA 1TW2A 2ZNIA 2IVMA 4YEJA 3EFGA 4J00A 1O7LA 4AU7A 3E86A 1RE3A 5DUKA 1U96A 2HODB 5ILVA 3BCAA 3GHGB 2XKOA 1A35A 3IGAC 2JPCA 4I7ZC 5KLVG 4EEFG 3K70C 4OWFA 1GHCA 3CCUI 1SFCD 1OZ0A 3ESWB 1ZRTD 4HV5A 4DR7B 3H1LG 5LFAA 3AG3H 3WHBA 5K1YA 2BXZA 2OD5A 1VQNP 5CVJA 3JSOA 4R4LA 2WTYA 5FRMA 1OCCH 1VQ4V 1RR7A 1HR0O 4GOFA 3SFZA 3NEUA 4XLAA 1YJNV 3CC7P 2EILH 1N7SB 3SPCA 4I5SA 1ZH5A 3M06A 2Q6QA 2QJKC 3BG7A 5HFMA 2QG4A 4ON0A 1SQVJ 3TDZC 2EIKH 2H88C 2JQ7A 4LFCB 2BW3A 2D2WA 1TUBA 3M9QA 4I0AA 4XOTA 2W1OA 2W27A 1KQFB 2VKVA 1MNMC 1UELB 3J7AO 1I50J 1WHUA 5BS6A 3STLC 2FTKA 3OGIB 5HNHA 2V1NA 1S77D 3BVOA 1IZ1A 2F6CA 1URFA 4P9FA 1FC2C 4DUYB 1X3ZB 3BZ6A 4MTEA 5HDNA 1X4TA 3QNEA 5FD6A 1U8RA 5KHIA 1BT8A 1PGOA 3CC7V 4YTPC 1ZXGA 1YS6A 2XT9A 2FY8A 3ZRWB 3ZQLA 4MQ9F 4HX7A 2DN0A 2JGDB 3AG3B 4WVZA 1EZJA 3OIPA 4B3RB 2CTPA 3AECC 2YMYA 1NJIW 2ZO4A 1FDOA 1OCCB 2YX4A 3SEZA 1T0FC 2O0YA 1SERA 2E5LB 2EILB 1J5EO 3ZHUA 1P4RA 1H88A 4IFDK 4IHVA 2R9RB 2Q7CA 2VE9A 3H9VA 3OTOO 4UB6H 2EIKB 1FS0G 3FX7A 3BG3A 3GLXA 2R3CA 4XRMA 2YI8A 2EB7A 2W25A 2KZGA 3F5TA 2SPZA 1JTXA 1UMQA 1L8DA 3PO2J 3DEWA 3Q3DA 4IL6X 2JGUA 3CCQV 4XA4A 5FFZA 3LL7A 1I7FA 1LFUP 1HCRA 5J1RA 1AA0A 3JD1A 1SMTA 4IQ4A 1L0NE 5DCMB 1DEEG 1R7JA 2NVTJ 3A0HC 4HV6A 1KQLA 1P4WA 4ZTFA 3FAVB 2DW3A 1SFCB 2XF7A 1MSWD 1OQYA 4OXSA 1BCCD 3BA9A 1NOHA 2QM4A 4EJTA 3CJQB 2HWVA 2HZTA 1F51A 4L76A 4CYCB 1RPWA 4M6VA 2Z4EA 1EXIA 4WXDA 3SDBA 5KAFC 3E3VA 4E7SA 1F7YA 1MSDA 1T2KD 2GM4A 3KEYA 4UB6Z 2CPSA 2UWJE 4HYOA 2XAJA 4A3DJ 2DW4A 5CCGD 1KILE 1MBFA 2K9QA 1QVTA 3E6CC 1QVUA 2W85A 2OGUA 1WJ5A 1LT9C 4ZI7A 5KKZC 4QPOA 2OT5A 3HE4B 4M3GA 1AHDP 3OV8A 1H0TB 3K2AA 4E7HA 3J81K 2ME6A 3G3ZA 3CRAA 3DGEA 2XC7A 3S32A 4AUXA 5L3GA 3LOCA 3AEBC 1WPBA 4FHTA 2Y48A 1XEQA 1FLIA 1MZEA 5B1AH 2DOSA 1VQPP 1T5EA 3RTRA 1BCCH 3CMYA 2VQCA 1HA8A 2CW8A 2Z5HA 5APSA 2JUGA 3M8JA 1P84D 2R72A 1ZGJA 1AFOA 4RGSA 2DQLA 3VYRB 4Y7NJ 3NXSA 5C44J 1Z21A 4OWRB 3VYTB 1RFYA 1YQ4C 1U9OA 3LIDA 4YELA 2A6TA 1F36A 4JI5B 3TEDA 3KYDB 4DCKA 4C2MJ 2HTSA 2E5YA 2V79A 1K7AA 4AQRD 4IOCF 1MOFA 3HSFA 1W5SA 3CUQA 1OV9A 4EFBA 4X88A 3G6BA 5CJ0A 4E7JA 1AR5A 1OCZC 2BTQA 4B4CA 3WTXC 1GD2E 1Y66A 2PJRB 3BTJA 1VQPV 2R93J 3IWFA 1Y76B 3C1LA 4MN4C 4BIZA 1BC8C 2OYIA 3BR3A 2HOEA 3HKEB 4A0YA 3EYYA 1AWCA 3WTSC 3CE2A 1LQ1A 3HSRA 2EWNA 2BEOA 5B1AB 1YVWA 4R50A 1EV7A 3KP6A 4WF2A 4ZC3A 3LSJA 3B40A 3A0BZ 4B48A 1AQTA 1VQ4I 1P84H 4GKKO 2XAQA 3A2FA 1YJNI 4JI0O 4CC5A 1S3JA 3F8NA 3BCCE 4DV3O 4PJLA 4B3SB 4I2OA 5DM7F 3A4CA 3K79A 2ZIOA 4F3QA 4W97A 4XLCA 2N9YB 2L9VA 3A2AA 4E2LA 4DK1A 4DK0A 1QR8A 1EC5A 4DYLA 2A7WA 5LYJA 1UIIA 1Q81Q 2CQXA 1HW7A 4YRVA 3HD7C 4R8HA 4XNFA 3ZQGA 3APQA 3K1PA 3HPLC 3S2WA 3FXLA 3J81Z 2LP7A 1IBKB 1NI8A 1IN7A 1NT2B 3JR9A 4O4HA 2N1TC 3V4WA 5EJCA 2IAIA 3FWEA 3MZYA 5ED4A 1MNEA 2KNCA 2E1OA 3K0GA 1WRGA 4M3LA 2YXLA 3CC7I 1PP9J 5B5EE 2Y9ZA 5IYZB 4RLQA 4XDKA 1HDPA 2JJLA 4LF8O 1MBHA 3JAMK 3CS5A 2FE3A 4FETA 4I02A 2P67A 1HNZO 1RY3A 4NB5A 3ABUA 2XAFA 1FOYA 4FX0A 1BI2A 4I2LC 1K34A 3D0SA 1GVDA 4A3GJ 5KJ7C 1N4CA 4WFHA 4RO0A 4DRXB 2YXRB 1JNMA 1FMVA 3DPLC 2FYUD 3JSPA 2EZOA 5FKNA 2FYUK 3LQRA 4YHHB 1BJAA 1XL6A 2IP2A 3EETA 2EINH 1PP7U 3U1DA 1VQOP 1X58A 1I08A 1BCCG 3L73E 1Y56A 9ANTA 1UPGA 4B8XA 2JS3A 4KFMA 3VQXA 1Q86Q 4KYWA 1UG2A 1FFTB 5B1NA 2VQEO 5TRDA 3E22A 4GGGA 5FO5A 1XILA 5CPRB 3K9AA 3CCQI 5CBNA 2UUCB 5F0HA 3B6CA 3LWFA 3PQJA 3I55V 1MW7A 2RNGA 4JAAA 1EN4A 4BNCA 3K4MA 2KIUA 3SQNA 3P7KA 4O4LA 2NS8A 4K3AA 1D3YA 2IJJA 1F4NA 4GLXA 2E1NA 2V4JC 1JMMA 2AS5F 4WWCA 2DA2A 1DDNA 2NVYJ 3JCUE 1URQC 2BW3B 3M3YJ 3FM3A 1E1QG 1KA8A 1TWCJ 3HRSA 3S1KA 1MH3A 4JI4O 2NRGA 1QO0D 2FYUH 4DV7B 2ZDIA 1TW3A 3AG4B 3MAJA 2NYXA 2X51A 4AD9A 3OMAB 3CB2A 1D1AA 3N05A 1M90W 2EINB 3RCOA 3B8NA 4IQJA 2CW7A 3CJRB 5DUIA 1O9GA 4IL6E 2J5OA 1M1JA 2IJIA 3OYKA 1WI3A 3K5OA 3LA7A 1IO4A 1ZSPA 2B88A 4RGXA 2IA1A 3VP8A 1FE6A 5K7FA 4F52A 3H1JJ 4M73A 1VQKV 3H32A 1RSOA 4FCYA 4NBQA 2QBYB 2W0XA 2VKHA 2UXCO 4A0XA 1CGPA 2BHYA 4M6XA 3CRMA 1SQBE 4U0VA 5TISH 4HKZH 1R5GA 4FT8A 1W36C 2VKEA 3HRUA 4HNTA 2LKSA 1I1GA 1X1PA 4Y17A 5FKMA 3W3CA 2EV5A 5E8GA 4BXLA 3O8ZA 3I5DA 1AI4A 5J47A 3KCXA 2W4SA 3P7NA 2UXXA 1N75A 3L2UA 1KILA 1PIXA 1IZ3A 1HNXB 3Q4HA 3K9TA 2ZAEB 3H1CA 3S93A 2M0BA 1JPXA 3K4NA 2TRTA 1GV5A 4A93J 3AE8C 5GTIC 3MKLA 4X20A 1I39A 1IK7A 1R8EA 5AG2A 2B1IA 4GUNA 1XGNA 1LE8B 4G6QA 1QZZA 2DPDA 1IFPA 5EYPA 1JKQC 5IWAO 2ZJ2A 4LGDE 1LUVA 3GFLA 5KVRA 1FJLA 4U3FD 1R36A 1VQPI 4E6KG 4QSHA 3FKIJ 1LT9A 5TISZ 1DU0A 2FMYA 3WTTC 4QPKA 1Y47A 4OOIA 3S3OA 1U0JA 5C4XJ 3ZHQA 2MH2A 5EEHA 4AVPA 1VARA 3H1KJ 4C7NA 2QUFA 1J1EB 2CV1A 2B7EA 1KECA 4I50B 1PVEA 3L70E 3JD2A 2ZVOB 1ZELA 4D9JA 4X62B 2QWNB 1JE8A 4F93B 5DJTB 4ZI7B 2Y31A 2VS0A 4LFBB 2LLKA 2PG4A 3IH2A 2AHZA 3C2GA 2OAZA 4EYYQ 1L0LK 4S04A 2Q7EA 4HQMA 1IXBA 1KQGB 3T1CA 1QGKB 1X19A 2ZXJA 5AW3B 3VP9A 4X1YA 3G4SV 1HNWB 2BE5F 2OBPA 1UAAA 2POHA 4K8XA 1RE4C 2DWEC 1I5XA 3M99B 2BYVE 1WKMA 2LBFA 4HYEA 2FYUG 3EHBB 2VQFB 3L74J 3HZJA 5GTHH 2F95B 4F6EA 4U3FH 3F21A 4LP8A 4KHPO 2HFEC 1XMQO 3GTPJ 4D7SA 3B8MA 3SPJA 4IVNA 3CX5F 1YDXA 4JZGA 1IN6A 5E20A 3LA2A 2JTVA 4JI3B 2OZ6A 2P7VB 3L9DA 4EB6A 1KU9A 3RIRA 1SLQA 3F6VA 4IGGA 2LJ2A 2IGKA 2Q0OC 2JK5C 4IHWA 3JRFA 2BY2A 5EK0A 5LLQA 2QJYC 1XSXA 2KLOA 2P4KA 3VTPC 5H2FZ 3LNMB 1VQ5P 3CUQB 4FE7A 3QO8A 5J6XA 1AVYA 2HPMA 2GAUA 1SETA 2K9PA 4X66O 2IGOA 2BTQB 1ETVA 1L0LH 2L3DA 3HUSA 4MHGA 2VQHA 3BPXA 3K4KA 1OR7C 3FWNA 4R8CA 2CH7A 4MEYF 3THOA 2EZLA 3HOZJ 2WA0A 2OYIB 3LNQA 5GTHZ 3PL8A 3DSQA 4ZHQA 1LTTC 2JRIA 1DQUA 5TJHA 3CD6P 1NS1A 3FBIB 3DPTA 3I55I 5DS9A 2YXQB 1KB9F 2HPCA 2WA3A 2HYNA 2BASA 4MW8A 4A3EJ 2E1MB 4PA7A 3LDEA 4HDUA 4IIJA 4B3AA 4BBSJ 2N1TA 5KLIC 5LHIA 2YNYA 4I76A 3EYIA 4J11A 3EDPA 5EC1C 1T3UA 1I3QJ 1ZV8A 2GLOA 4BRYA 4ZOLB 3JAKA 1OVRA 3CWBJ 1FP2A 5EFWB 1MSEC 1U7MA 1E1RG 4DUZB 1L0ND 1D1CA 1L0NK 4BHPA 1QBJA 5KX5A 4X65O 2FL4A 5FJ8J 4J9ZB 4G8XA 1XHZA 2DOEA 4H13D 2L6LA 1MUUA 5KJ7A 4PV1C 4OGQC 3SWYA 3QP6A 2W6BA 1GTWA 2QQ9A 2I10A 3JD4A 4EI2A 2B87A 3Q2YA 2KNCB 3VEPA 4DV0O 2P7CB 3RYPA 4KA4A 2M30A 2A68F 3VMZA 3FBNB 2VT2A 3K7AJ 4JX5A 1VQKI 4UNOA 1H2SB 2X6OA 1OVVA 2HP8A 4KT6A 2NXNB 3DXJF 2QF7A 2WSCH 1KILD 2ZJSE 2Y0PA 1TL8A 4TLFA 2M2EA 3RPQA 3F3XA 2ADQB 3A7OA 4JV5O 1L2PA 4DZPA 3RKYA 2K88A 2KIKA 2VJ4A 4TUYA 1VF9A 2ZNZA 3DTEA 4H44C 2E5NA 4Q4ZF 1WNSA 2HGCA 4B3XA 3ZEDA 1Y8RB 4JPZB 2V26A 3PNTA 4XL9A 2P6TA 3FB5C 5LMNB 3RPUA 4I0BA 2IA2A 1GV2A 1LWUC 2ZXXA 4ZTJA 1L0NH 1M1KQ 4FZ0A 3ASOH 3E22B 3N2GB 2E5ZA 2P22C 2L54A 3BCBA 4EM0B 5BPIA 1H2NA 1ZTEA 2EV0A 2X0LA 1QQCA 1D7MA 4MGRA 2BSKA 3N4MA 3BR1A 3WHCA 4MO7A 1R5SA 1SRYA 5ICEA 4Q6GA 1VTNC 1YRNB 4GX2A 2ZQMA 2DXIA 3B73A 2XASA 2JEXA 3CCSV 1YI2I 3I56P 2LOOA 4DYRA 4PHZA 4JP0A 1BGYE 2E1CA 3ML0A 1U57A 3NWSA 3TJTA 2K1AA 3TQNA 2BZTA 1TWFJ 5GPCA 1SQPJ 1Z05A 4LLLA 4B09A 4QE9A 5GONA 2XPWA 2YEVA 5KAIE 3X2QH 4D5CA 2WITA 3RI4A 1T3JA 3IC9A 4GYIA 2WLJA 3PFYA 3JASB 3ECOA 3KZIE 1M1JB 2BCCJ 2DFHA 2B63J 2DA7A 5GW7A 2DYSH 4LF4B 4YG2F 3GMAA 2JRTA 2OIEA 3ASOB 1YCIA 1NTMK 3OW2U 3RK3C 4PELA 1MJ9A 2N04A 4X64B 2M8RA 1TA8A 3CO6C 1RSOB 2IS1A 4JI6O 2MH9A 3HOUJ 2WV0A 2PGGA 3RL0C 4WB4A 4XFJA 3G4SI 4BDYA 3KLOA 2YSUB 2ESNA 4D7MA 2QE7H 4PA6A 2A45I 3ZP5A 3U1CA 1E5WA 3H9GA 3VOEA 4C7RA 4B1RA 2JVDA 3U21A 2KP8A 3CCMV 5LBQA 3K58A 3FXEA 3BCCD 1ZWIC 2OQQA 3VMYA 4ASNA 4FM2A 3I4PA 4H13C 2GIVA 1EH7A 2VL8A 2G38A 2DQRA 5E79E 4QE7A 2L4MA 1KILB 3C18A 3V42A 3AKZA 1LUJB 3Q4HB 3L72E 4RB2C 3E6BA 1G3SA 3JD3A 3RQIA 2GBOA 1LB2A 1DEBA 1G1XB 2FBIA 2CFXA 4DV6O 2FYNB 2PI4A 3X2QB 3HPHA 2P4VA 1QVGO 1BL8A 3JRGA 1A5JA 1S9HA 2TCTA 3QP5A 1X4PA 1GL2C 4DR7O 2E75C 4HBLA 1AI7A 1LT1A 3GB7C 4KICA 4G9YA 3W6JB 2WAMA 2L02A 3AE4C 2XRLA 1Y9BA 2K9YA 2VC1A 1G4YB 3P8CE 1NTMH 3REOA 1S5LC 5CJ9A 2NOGA 4NXMB 4JI7O 4P55A 4IHJA 3H3VK 4FE4A 5KHKA 2XU6A 4HNUA 3F7VC 4E70A 2E5TA 4LFCO 4II2A 3KP7A 4DR4O 1L0NG 4C7NB 2JA2A 3L36A 2HKXA 2O01N 3BCCH 1QLNA 2M8GX 1NTZE 1Z9CA 4LWSA 3GWKC 1LFBA 1FXKA 4MVUA 5B3SH 4HF2A 1GAXA 1S2EA 2BOLA 1XGSA 1VEWA 3L73D 5BPDA 1K73Q 2J5PA 3ZHVA 5CVIA 4ZJZA 5AVTB 3OS0A 1KYOF 1X1CA 3BA8A 4DUYO 1AILA 5JLXA 1M5IA 2E2HJ 2UUAO 1JUSA 3L75E 3B09A 5CQEA 2GTSA 3T97A 3K5NA 1EBOA 3FXJA 4F6RB 3DF8A 1AJQA 1NU1E 5EEAA 2B5UA 4TSFG 5IYBJ 4UUJC 1SS3A 2MFZA 4QIWF 1NG6A 1HF0A 4WBNA 3TMOA 4GCVA 4EJWA 4B3RO 4D0PA 4PK4A 2QEXP 5JI6A 1K8AQ 3GF2A 2DMTA 5K5RA 5ILUA 2JR8A 1Q43A 2O01J 1XG1A 2RDCA 3RYCB 1QHTA 3RKQA 2E5LO 4KFCA 1VQ7I 1AR4A 4LH6A 4O5VA 1MNGA 2JWDA 1ZRCA 4BE1A 5IP7J 4WXCA 5ERIA 1WPKA 2V1XA 1BE3J 5LA6B 2X1CA 3SPIA 1OR7A 3OYMA 3M0DA 1B6QA 3CMEP 1BL0A 1F5TA 2JP3A 3AAFA 4YIFA 5J4VA 3RPUD 5B3SB 3PSFA 5ICCA 4G7HF 4FASD 1QR9A 1VQ8P 2QE7G 1R49A 4BL0B 3P3PA 5KHHA 1TUEB 1SQXE 2MA3A 4FVMA 1FWZA 3BATA 5FKOA 1FOKA 4CGZA 3Q9SA 1H9TA 3KYQA 2IH1C 3HUSB 3L9FA 2PP6A 5FLVA 1FX7A 3F8FA 5CA0A 1LTAC 2CH7B 1AP5A 1RC9A 2IW5A 4GDOA 1A6IA 2X6BA 5B5EZ 1SQBD 3DTIA 1SQBK 4ZHQB 4LF5B 1N33B 4RWUA 1Z0XA 2XV4S 1BM9A 3G73A 1WRJA 3CMEV 2NRAC 2LF7A 2CQNA 1HSTA 1MD0A 4ZDPA 3VOUA 3LSGA 2WMMA 1BN5A 3JCUH 1SKVA 4X6AJ 1G1IA 4IIJB 2JUCA 3MCZA 4BHBA 5AW4B 2HQ5A 5LGTA 4BBRJ 3QU3A 1HR0B 3CCSI 3TW6A 1G2CB 1EJ9A 4LIUA 4BIUA 1R3IC 1BBYA 5APVA 3JAKB 2XAUA 3D36A 3F8MA 4DGWB 3H1JG 5EZGA 2M34A 1ETQA 4LB5A 4LR3A 5F1RA 3EWKA 5KX5B 3HKBB 2NPSD 5B1BH 3SHFA 3OR1C 2E43A 2IXSA 4AQYO 5F64A 5CB4A 1Z7LA 1NH4A 3BCCG 1BJZA 2Q68A 5C8YA 3IV5A 1ETKA 3HRNA 2YSRA 3K10A 1KUQA 1YYCA 2A06E 1JUMA 5L8RJ 4YIOA 2R92J 3HTUA 1B9MA 1SQBH 1S7OA 3D6ZA 3GXOA 3K1MA 4LMYA 1O3RA 1UJ8A 4P30A 2QR4A 3ZQHA 5JJEB 3A3YB 4JK1X 2GDSA 3JCUZ 3P32A 4L9NA 1LWUA 2PYLA 1HBXG 3L70D 4JI5O 4GIFA 3WU1B 1YQAA 4FLZA 1BIAA 3QG5A 4XKWA 3B6AA 3CCMI 3HKZA 4X1KA 1WCMJ 2WADA 4YFNF 2HDWA 2PYJA 3K03A 2Y75A 4FZ1A 4JAUA 2XAHA 1YTZT 2DYRH 2FKXA 4IJAA 3K5MA 4IL6Z 1HSJA 3ZX6A 5JJNB 2K3PA 2HOAA 3OEEG 1ETYA 3FKJA 3EVKA 5B1BB 2V7QJ 1I6XA 4G94A 2VB6A 2I1JA 4BAYA 2RDPA 3A0RA 2A79B 1VF6C 2ETHA 2L7ZA 3SFEC 2W24A 2Z5IA 1RESA 2JWAA 5J3LA 2W82A 2A45H 1NTKJ 3FXDA 3L73G 4JI8B 4YPCA 2DK8A 4RB1A 1V54H 2QWRB 4RGUA 1QLED 3TGUJ 2R5YA 3MGNA 4FJCC 3ZPLA 2PX9A 1W5TA 4A3CJ 4CH5A 2ZT9D 3DCFA 1SQVK 1XQ8A 2RAEA 1ZRFA 2EA2A 4A3KJ 4UVBA 1PNKA 1JUPA 1NGMB 2KMUA 3J7YJ 2D2CC 2YEVB 1JXSA 2IH3C 3IH4A 5KHGA 1IUYA 3UQ8A 4BJ5C 5E1XA 2KKOA 1PGPA 1KC8Q 1QHGA 2LC2A 4M6YA 3RT3C 2W6AA 4ZZLA 4EOTA 4Y52J 1IBLB 2M3AA 4BEHA 1N73C 3BROA 3L71J 1IFJA 4V2FA 4NDLA 1Q2NA 2XGEA 3L2RA 2H8WA 3H9JA 1ZUQA 3V2NA 1WP7A 4LGWA 3J7ZI 1AA7A 3MFKA 3IKVA 1L4AC 3FXRA 3HTKA 3PO3J 2NR5A 3H1HE 1XUQA 2OYQA 3IRQA 1IO2A 4TV9B 3TDKA 1V54B 1SQQJ 1EH6A 4PD4I 5LP6C 5AONA 2CDYA 1N8RQ 3H5RA 1PL5A 1SQVH 3TXQA 1F4MA 5C3EJ 4HOBA 2DODA 2OWOA 2QQAA 2RN9A 3E8GA 2A6HF 4BUPA 1BMFG 1NHAA 2Q8KA 1HW2A 5FNVA 1SQBG 5HS9A 3WMM0 3HIFA 3VWBA 1MA1A 2NAZA 5H5NA 2ZXEB 5EF6A 3CXHI 2HPIA 3BDDA 1JJOA 2UUCO 1YG2A 3PIPF 1ORQC 1G8MA 3LSIA 5IY5H 2Z33A 1ROPA 1NKZB 2CAZC 2OTKE 2P6JA 1SC5B 1WA8A 5D4SA 2M45A 2BVLA 2DDBA 2F2EA 1AJYA 4JYCA 4IHJB 4LK1F 2R7SA 3OY9A 3OYIA 3CYOA 2QM8A 2FBWC 3FK7A 2LDUA 1FDMA 3SFDC 2ZC2A 6PAXA 1Y67A 5AVXB 4G7ZF 1W2BO 2Y69H 2Q7HA 1R5ID 2CQKA 1R58A 2QJPC 5KLVJ 1I94B 4LWSB 2ZT9B 1FXKB 1ZLKA 4DV7O 3CJHA 2VN2A 3H1LJ 4UFZA 2NOJB 2DMNA 3PHLA 3E5XA 1DX7A 4R79A 2A45G 2GUSA 4LF7B 4P5OA 3HXLA 1D0ZA 4GKKB 4KDPA 4CH6A 1KQSO 5CMZA 2CU7A 2FBHA 4DV3B 5IOZA 1BZKA 2R7VA 5FLXN 1O57A 1NG7A 1TTYA 1J9IA 1H38A 3OL3A 3L70G 2Y4TA 2E3CA 1RM1C 5LXTA 1Q82Q 1PGQA 5IY5B 2QSHX 2P5VA 1Y8AA 2E74C 1YW8A 4HLXA 2IEKA 4HEA2 3LW5J 1OISA 5B1OA 2VRSA 1QBZA 1ORKA 1BGYD 3E8FA 2EIJH 4JPRA 2Y69B 3QWOC 3A02A 1HNXO 1ZARA 2H27A 3FWLA 4LF8B 4BE0A 1Z91A 1JKRC 1D5NA 1GMGA 2NS0A 3T1HB 2YIUB 4DW1A 3SJCC 1J5YA 5E3MA 4GX1A 3KFWX 3CCRV 3O9OA 4CDGA 2JA6J 1LTIC 4Y13A 2JVHA 4GO1A 1EM1A 1LNWA 5CA0B 1P4AA 2R5ZB 5IOYA 3WG7C 3RJPA 1CPYA 1MSFC 1Q81W 5KLIB 2OV7A 1G8XA 2BE3A 5CBHA 1FOSE 1VP7A 2KZJA 3RZDJ 3OMNB 4I6MC 4OMZA 2YIAA 4RKUJ 2FJ1A 3HHGA 1LVAA 2VQEB 5KTBA 2UUBB 4HAMA 1BDCA 4Q5SF 3LSMA 3BG9A 3ZN0A 4KN4X 2E71A 3HM5A 2MC3A 3VMXA 3OSFA 4ENMA 2BY3A 3IC7A 1Y4MA 4A6EA 3L72D 2STTA 3AL0B 3ABVC 3U2RA 2Z1DA 3DC6A 3D70A 2ID6A 2QM7A 3DEUA 4ABZA 4LFBO 2UV1A 3WB2A 5KAIH 3JD0A 1LFPA 2NVQJ 1VL2A 3EUHC 2J5UA 3KZIH 3PRJA 4WK8F 1R5LA 4UV8A 1GT0C 1XMAA 3LUTB 1PPJE 4ZZDA 4P9PA 4WWIA 5CB4B 5LL6Y 2P4WA 1MMMA 3P8CD 5DCFA 4NQWA 2F5VA 2QWOB 3AE7C 2VQFO 4BQAA 2E42A 4I7HA 5CMUA 1G3TA 1LP1A 2X6XA 3F72A 3K6GA 2D1VA 4JF7A 3JARB 4JI3O 3CMAI 3K2ZA 2JK3A 2YS8A 2JJ7A 2Z2SB 4PJNA 1I1SA 4HX4A 2VQLA 1NTZD 1YQ3C 2NVXJ 4CHUA 4UB8C 5IJ0A 3BJOA 2J59M 3HUGA 2DJIA 1KD1Q 5AW0B 2QKAA 5E79H 2UXCB 3Q9VA 3CQZJ 4ITVA 1XMKA 1U8BA 2YKOA 4BY1J 1VF6A 5KAIZ 3CCEP 5EIBD 3ZRVA 1RKTA 3C3WA 3L75D 2IYPA 5DECA 3KZIZ 3CXHD 1S6LA 3RVYA 2EV6A 1IFMA 3MN2A 2UXDO 1NZ6A 3VMAA 3WU2C 1NU1D 3D6YA 1FD9A 3LIEA 2L2OA 4DT0A 1OJHA 4GXOA 4UVAA 3ZMZA 1BI1A 3BABA 1XDCA 1KYWA 3F6OA 3F23A 1VQ6V 2F48A 3N97A 3V2RA 3S3XA 5FKKA 4W4KA 1EQ7A 2ZJPF 4HZ3A 1QVFO 3MDSA 2C2AA 2Y0SA 2FQ4A 5JQGB 3CCEV 2KSJA 2K85A 1KKCA 1P7BA 4RJTA 5GP9A 1JY2O 3DKYA 1NTZH 5E79Z 4XLEA 3CTAA 2Y0CA 5HS8A 2FD5A 4NNJA 3OS1A 3S17J 4B3TO 1EXJA 4I4TB 3CP8A 1SQXD 2HG5C 3RL0B 2MGQA 4DUZO 1D2DA 3L75H 3D71A 1L4AA 3DPUA 3QPLA 4JYYA 1SFUA 3M8EA 4Z6YA 1S4XA 4B43A 1AJNA 3IP4B 1BGYG 1B3QA 2K40A 1JY3P 5BNGA 3NR7A 1D0YA 5APUA 1GKFA 4E7KA 5IYCO 3F22A 3MMYB 4RUFA 3ZMDA 2Q5UA 2GV9A 3RGUA 1NR1A 3W7XA 2RMKB 1WP8A 4MEXF 4U3JA 4JGSA 2KXPB 3G1LA 1KQ0A 4CYDA 3L09A 3H01A 1TNTA 4CO8A 3M91A 3IF4A 2XHKA 2CJJA 2AXTC 2G8YA 1I27A 1U5TB 2O1KA 2L5QA 1XMQB 4NVPA 5GAHJ 1YLFA 5LMNO 1IXRC 1IDZA 4ENJA 2QSAA 2JEEA 3ABLC 2QTOA 5TGTA 2CW0F 5AVQB 3TOAA 1YYVA 1W59A 3KHUA 2O3FA 1FJKA 2EZKA 3F0CA 3G1MA 5IP6A 2H6BA 2E35A 3CCRI 4XKBA 2A06D 4L9VA 1V5FA 2JSCA 2H89C 4WX9A 3B5NA 1TWAJ 1MFZA 5KK1A 2LXCB 4EV0A 2DA4A 1WA8B 1XNQB 5IJ9B 2HQRA 3L72G 5H6RA 1G6UA 2FNPA 4AYCA 4H0LD 1B04A 3OUSA 1SVLA 3J81N 2YIDA 3E83A 3B02A 2K4JA 4XLHA 1BCCJ 1EF4A 2K9MA 4U7DA 2DMPA 2ZKOA 3CSXA 1FJGO 2KFDA 2WVRA 3B8EB 5TJJA 2VBWA 1FBSA 2WLHA 1ZAUA 3C8VA 3M8FA 3M1EA 4AYBA 2B89A 4L5EA 1PV0A 2HVKC 2FNAA 3B71A 4O2BA 3BQZA 4PDLA 3ZMTA 2X4HA 3T4ZA 1WB8A 2QQBA 2CFOA 3ZIAG 3LSSA 1QHHD 2ADUA 4LF4O 2E76C 2LR8A 3U11A 3KP4A 2QRXA 2VJ5A 3VB2A 3AE1C 2HHHB 2AXLA 5A2QZ 2N8GA 3GWZA 1NTZG 4X64O 4P9UA 3ZXSA 2DJNA 4RA2A 1T33A 2A06H 1NH2D 2EBIA 2A0LA 1KTMA 1S72V 1MMDA 2KJCA 4D6TE 2OCHA 1N7LA 3RYRA 2ZYAA 1GTOA 4AIHA 4X65B 2Z16A 2QKCA 4F7ZA 1K4DC 5JWPA 4X0GA 4F92B 2XUBA 4ICGA 3TP0A 1R1VA 2CRGA 3T1YO 4EEQA 3W2VA 1EZVE 1NU1G 3LDDA 2EIMH 3MZWB 3O3KA 2DMUA 5DN6G 2RGVA 3HYIA 3EXAA 1ZHFA 1QU7A 2XGXA 4PDVA 2BTOA 5JR3A 2DI3A 5KA6A 3AG1C 4DXWA 3JREA 3P9IA 1PUFA 1FAFA 3KZYA 1X1BA 3PUBA 3ETDA 4FK5C 5LGNA 4OVNF 2IBZE 5EEGA 2KRHA 4FLVA 3ABMC 2HQAA 2VXDA 2R7RA 1WH7A 3ETGA 4GOEA 2RCVA 2R9AA 3BT9A 4YJ3A 4U0WA 3BP8A 2F4VO 1JEKA 1Q8IA 4NXMO 1WJBA 5JFRA 2LVSA 1KBHA 1PUEE 4HG2A 2GUVA 1MDMA 5E3LA 3GTGJ 1HGVA 2Y0EA 4XN0A 3BRVB 3CPWU 3AG2H 3H1HD 4Y99C 4CH4A 2H3OA 1SQXG 1HH0A 4LG0A 1N32O 1VQ6I 3EUHA 5AVUB 4BYYA 4H0LB 2N74A 3AEAC 2OCCC 1FT9A 3TNUA 4UCRA 1DIPA 3TETA 3E8HA 3VBBA 4WFFA 1E3HA 5JVDA 2EIMB 3BTLA 5H9CA 3CCEI 3HJEA 1YHQP 3HB3B 3JAMN 4B7EA 1A02J 2MC4A 1ZG1A 4TQFA 2KOGA 3LMMA 2EA4A 3U10A 2OF7A 3ZRSA 5E8IA 3JAWA 1QEXA 4Z2YA 5IT9K 3C1DA 1AJPA 4DBRA 2GXAA 3AEGC 3N27A 1T38A 2EK5A 2RN7A 1IZNB 1Y74B 2L7MP 2EQRA 1SQQG 4XRSG 1S29A 4PJ0E 2FEZA 1LP1B 4UCSA 1G6NA 5AW5B 2CGPA 5C93A 5B66C 1K92A 1NH2B 3AG2B 3H1HH 3WB1A 1RP3B 1AB3A 3JYCA 4U88A 3E5UA 4M72A 1NO4A 2K9NA 5D8LB 1YHQV 2X6CA 1LEAA 2MG4A 4HRIA 4L5JA 1OCRH 5CCHC 3HUGB 1R3JC 2RNJA 1BSMA 3TK1A 2QKMB 2A06G 4H0EA 1IG7A 4FM0A 1VDFA 3H1IE 3W7TA 3DKXA 2IYOA 2VOPA 4ASWA 5KLVE 5EZHA 2KK7A 3M9AA 2N05A 1WFXA 4E7ZA 1P84I 2FYUJ 5K1PA 1VQ4P 1LTJA 1K4SA 3K57A 3GTJJ 4R7CA 3DKWA 2LG4A 1YJNP 5FPOA 1S7AA 4EDFA 1JY2P 5FLXZ 3B5ND 4J7ZA 1I0HA 3VYIA 4DV4O 4AI8A 2B9BA 4C7UA 4FMTA 2PMZA 5AW9B 2P8TA 3EUKL 3DEEA 5FD5A 4GZRB 1KKDA 4I99C 4LF5O 1BR2A 1N33O 3ZCCA 3T8RA 4DV6B 2YU9J 4ZMDA 1L0LE 2WA4A 4RQFA 2O1JA 3IRRA 1M1EB 1AP6A 5LOVA 5E18F 4GKGA 2PI0A 2F66C 4FISA 1Y0UA 2CS3A 2P0WA 3FXOA 2VKDA 4JAVA 4A5NA 4XQFA 4GX5A 1SEUA 3IAS2 3NQOA 3C2HA 1FBMA 4W7YA 3UKGA 4YIPA 2RKLA 3F89A 1OCRB 2QWWA 4FPPA 3FGAD 4JI7B 3GHGC 3MQ0A 1P92A 3BPVA 4I1LA 1FSEA 3PNVA 3SPGA 2DFIA 3WTWC 3WGHA 3F9KA 1SQPK 4PJMA 3A8TA 5C39A 3V7SA 1LTSC 4EVIA 1GM9A 3I0TA 3WU0A 5E1WA 4DR4B 1J1DB 2HVJC 2XZRA 3MZHA 3STZC 2RKHA 1XDUA 1OFCX 1P9QC 1WJFA 1QQIA 4RQEA 1N7SC 2DA1A 3EUAA 1XDSA 3RW0A 4XN3A 2PMUA 2X6WA 1IFDA 4RAGA 4C2TA 3B4SA 3ASNC 4IOIH 4RLFA 3QO7A 4E7LA 2UUAB 1R6RA 2M5AA 3PSIA 5BOXA 1JB0J 3IKTA 4MVQA 1GLNA 2HJDA 4Z1MG 4BE2A 4U3JB 4HB1A 2FFDC 3C90A 5LHHA 3CC4V 4R1HA 3QOPA 1K4CC 1S72I 1STZA 5EYRA 3CCQP 1RPRA 1IJDB 1GN3A 4FLWA 1YTFD 2L7KA 1X3UA 1CXZB 4IRHA 2HLDG 1LJ2A 2Q0AA 1NR7A 3IAM2 1JT0A 3AE2C 1DGSA 4BU2A 2A3SA 1EDLA 1IN4A 1N86A 3PN1A 5A9GA 3SFIA 1H89A 1P4XA 1USTA 1Q7YW 1SQPH 4AWXB 2LK2A 5J2UB 3H1HG 2RC4A 2PF4E 1V9PA 1ACIA 3AG3C 1JY2N 3E2EA 2MKVA 3M9BA 1F43A 5E3NA 1PPJD 1SD7A 4CICA 1CSBA 4L18B 4MFDA 3A1YA 1OCOH 4I9WA 1ZREA 3BZKA 1M56D 3CX5E 1MZFA 3B5NB 2EILC 3NMDA 2QJPB 1UB9A 2K27A 4GX0A 4P9OA 2IJHA 2P5LC 4JI8O 1BI0A 3LDCA 2R7QA 2UZKA 1VF5D 2W84A 4FM1A 4L0YB 4WY4A 4HQEA 4U3FJ 1OJLA 1OW8A 2LW7A 3I3LA 1BA5A 3DC5A 3KQGA 4HJGH 3UR3C 1YW7A 5D6FA 1EZVI 1USEA 1K8AW 1MGTA 1AKHB 4IO9F 2Q9LA 4EJVA 1B72A 5APXA 2LW1A 1QGPA 5LEKA 3WUTA 4IT5A 4RGRA 2WAQA 2OTLP 1NKNA 5APTA 1LUWA 3FMQA 3I58A 3KCCA 4V19K 1AI6A 1HLVA 1IXSB 3R65A 1YIJV 2UXBO 2Q2EB 3A0HE 1DPRA 2LSOA 3SJQC 1SFCC 5KMGA 4WCGA 1OVUA 1L3LA 1ZAOA 3GZ6A 1Q1HA 1PPJH 3MTUE 1IBLO 4LLGF 5H6QA 2DOAA 2O6GE 4DR5B 1CI6B 2GSMB 3UO3A 3JTGA 1OCOB 2VLAA 2PJPA 3SXYA 1JI8A 5LHGA 5CA1B 1KB9E 2Z0AA 3QH9A 3SJBC 2ZE6A 3OJAB 5KAFE 3RGBA 4BS9A 2DFEA 4UB6C 3K1NA 3R6SA 1K78A 2OTLV 2FXMA 5M5WJ 4Y4RA 4AQYB 1ZRTE 4KMFA 2CE4A 3QTCA 2GA2A 2QM3A 2IPPA 4FFBA 5LD2C 2KHMA 4RBOA 2ETNA 2Q6AA 3IR9A 1VFCA 4DR2B 4LF9B 1WWXA 2M3BA 1E2XA 1YTFB 1YHQI 3S14J 1YO5C 1HUCA 1PP8F 5AVRB 3LQQA 3R2PA 4ENNA 1VQLP 2H8PD 1ZLJA 1D8JA 2VASA 3CF2A 3D3IA 1EDJA 4PD4F 3RK2D 1GW3A 2AHQA 2ZE5A 1Z5VA 4A7PA 2YS9A 1BR4A 1RF1B 4YJ3B 1FZBA 2K4BA 5DJUB 3KXDA 1KMIZ 2QGNA 2AXCA 1M56B 1MDMB 3GCMA 4M3DA 3CRQA 2OYHB 2QIWA 3BAAA 5C4JJ 3WTZA 2YR2A 4LG0B 1VPCA 3CXHF 3FDYA 1VQLV 1VF5B 1NTME 2M4KA 4NHJA 1I94O 1R00A 4XR6A 3M8AA 1NWQA 1JKPC 1OZHA 2WSCJ 2BXYA 2LR2A 5CHXA 4JTDB 3KE2A 2KSEA 3MWMA 1RF0C 4DR3O 4XSZF 4IZZA 3LSRA 1BE3H 2OA4A 3BASA 3RBXA 2CGOA 4LF7O 4AIDA 1JMBA 2X6YA 3H6PA 3FMRA 1A36A 3OYLA 2NLJC 4G7OF 5EC2C 4M9XA 3G71V 2VODA 1M57D 2WLKA 4ABMA 4N9HA 3S1RJ 4HZFA 5B1AC 1L0NJ 1G2HA 4QGPA 5CCHA 1V55H 5ILSA 2JEUA 5IPAA 3ERED 2DDAA 4ASUG 3A0BC 2ESHA 1LPQA 3S2DJ 1NVPB 3CP2A 3QODA 3MKZA 1T2KC 2LNBA 3QWLA 2VJIA 1OIPA 4HYTB 2DA6A 1X1DA 1Z3YA 5KHJA 3KP5A 5CCGC 1PPJG 1POGA 2MLGA 4DR1O 1N25A 4UCVA 2WT7A 3CC4I 4DBQA 2B1GA 1YEWA 3T1HO 4YY3B 2F5DA 3CL3D 2L01A 3KYCB 2XTAA 4OU0A 3I55P 3P3NA 5IYDJ 4LITA 3E1RA 4OAYA 3WGGA 1LTJB 1YSCA 4W4LA 2H43A 1JJ6C 2PI5A 1OCTC 2HYFA 3AG4H 2JT1A 1X9VA 2UXNA 2ELKA 3OE7G 1P7IA 2ZMEC 2M7WA 2AW9A 3UKMA 1AVOA 2R7WA 2MK3A 3RK2B 1C0WA 4D6TD 3GHGA 4WY4D 1V55B 2W48A 1L0OC 3I9V2 1F4KA 5ICGA 3CCJP 5L3BA 4DV1B 1TQPA 5LOVB 2UUBO 3ERMA 4B08A 2K9JA 1EZVD 3WB0A 3HR0A 1RE3C 2ZD9A 2IS4A 3GMEA 2MYSA 4KT5C 3TCUA 4YFKF 1TT5B 2LYCA 1VQ9V 3GLLA 4ZKUA 1N77A 2YX7A 1FBUA 5D5XB 3H0GJ 5CJ4A 2CTWA 1XD7A 1VQKP 4KIGA 3P9CA 3AK1A 3GW2A 5AVVB 2JKVA 1DK1A 3CESA 2IU0A 2IBZD 3SEQA 1N0NA 5EZYA 1TUBB 1N8RW 2FFDA 2VOOA 1Q90D 3OYEA 1OHHG 2DE0X 3RYIA 1YIJI 3CCJV 1HC8A 2XKMA 3J80K 3HOYJ 1V4RA 2I1KA 3CX5I 1M57B 4XDLA 1W5CC 5JHFA 1T0FA 2C9LY 4D6TH 1SAUA 2VT3A 3DTKA 5BMVA 2K9LA 2M5AB 3ZRWA 3TDUC 2QSGX 4BQQA 4IHSA 4BDZA 4UXNA 3NTNA 2FXOA 5HLTA 1MH4A 1JFFA 3QVNA 3BTIA 3P30A 3ML6A 1EZVH 2EINC 1LTGC 1B8IA 3F5HA 4KXRA 2OTLI 2P2UA 1RQUA 3VSKA 4CCJA 4JTCB 4FLXA 1KYOE 3A5TA 4KN7X 1RRJA 3WE2A 1TWGJ 3BCCJ 2IGNA 1SMYF 3JAMZ 1NYHA 3E5QA 1PZQA 1MBEA 3AEFC 1NK2P 5M5YJ 4LNUA 4O4JA 2LP0A 2XHBA 3PFIA 2KLVA 1FFXA 5FB2A 1YI2P 1GM8A 1AVMA 2IBZH 2ZE8A 1W0TA 1GM7A 4KHXA 3K4JA 2LRDA 4NXNO 1JVMA 2R44A 3V2PA 1H88C 2NNYA 2MSYA 3HBLA 4CC6A 3H36A 2A07F 2V9KA 2IU3A 3WGIA 1KB9I 3OR2C 1TLHB 4L5IA 3PH0A 1FOXA 2XRNA 4WY4B 3H9QA 3K3WA 5JVTA 1SFCA 1YIOA 2YC0A 3ABMH 1HKTA 1YJ9I 3Q5SA 1PNLA 1TP4A 1X59A 1B1BA 2WY8Q 1PNMA 1ENVA 1OXZA 3GO5A 1B72B 1YITP 3H1ID 1YI2V 2XIGA 3G4SP 5GTIE 3U1KA 5KLVK 1VQLI 3HSEA 3W6KB 1WH5A 3AE5C 1XMXA 5KHDA 3T4DA 4RAZA 3DP7A 1QNTA 2RQQA 5KMGB 2KSDA 3BY6A 3HEFA 3L73J 2DMQA 3JALA 4BY7J 3S8PA 4IF4A 1WPXA 3K5BA 1JUNA 2DT6A 3J80Z 2RMZA 1D1BA 1YX5A 4XKVA 4PSXA 3OIOA 5TISC 3G71I 2WSEH 1FY7A 1H0TA 4PJ0H 1L0LD 2VUMJ 3K0LA 2JZYA 3CF5F 3GFIA 1J1EC 3UO2A 2V6CA 1YITV 3MVPA 1N36B 3RKXA 1K78B 1BW5A 2PAJA 1HJBA 2FSWA 1M7LA 4CCNA 2OARA 1HVVA 1FKAO 2PFBA 4FFBB 3I71A 3S3MA 3AEDC 3TYYA 2R7OA 1GN4A 2L35A 3ABMB 3C9IA 4A3FJ 1M8OB 1GRJA 4J7KA 3KKYA 1XNRB 2ZNJA 5J8FA 4GDFA 3H1IH 1K5SA 3G6EI 2A9HA 3K70D 2IGMA 5KLVH 4D6TG 2LMDA 1MFTA 3TO9A 1R73A 4A0ZA 3ZMSA 2VE8A 1N34B 4UV9A 2QKSA 1FNNA 2CSOA 4QIWN 2V1UA 1JX9A 1S5LX 1FOWA 2D1HA 3CP1A 5HFLA 1SQVE 1EZVG 3BVHA 1OYIA 2E34A 3WTYC 4FTHA 2Q9IA 3C3SA 4K0KB 3IUOA 1XNQO 3EFFK 4PJ0Z 3OD4A 3E35A 4YIIA 2V4HA 2L9RA 3L2CA 3TKYA 4EIJA 1SD6A 3HC7A 1J09A 1R9TJ 1SZTA 2CUEA 1Y76A 2UXDB 2RNBA 4A5MA 4NC6A 2KLUA 2IPQX 1SQBJ 3HG9A 2BOCC 1K9MW 2IBZG 3HKEA 3CUQC 4MTOA 3HPGA 1HKSA 1HQCA 2QZ8A 3QF7A 2VPRA 3U59A 5H2FC 1SS1A 1HDDC 3OW2O 1VMGA 3N4XA 2FU4A 3JRCA 4DIQA 2Q7GA 3H5NA 2EFWA 3Q0VA 3IFXA 2CUJA 5LRSA 1RNLA 1ULYA 1VQ7P 3HD7A 3GG2A 3DXRA 2O7OA 1KZUB 1VQ9I 2YI9A 1QL2A 1AU7A 5K5OA 3ZHSA 3CDIA 3C7JA 2IS6A 4KITB 4M3BA 1T2KA 1MJAA 2HHHO 1NKDA 3HL2A 2QTSA 1Q1VA 1BHBA 4A12A 2A5WA 3CX5D 5GTHC 2E19A 5CKTA 2UU9B 1HKQA 1NTCA 4B3TB 3FXMA 2P58A 2W0FC 5DM6V 5LYJB 4ZKPA 2WLMA 3CCJI 1E3PA 2JWTA 1KFNA 4W7ZA 4ZYEA 3L37A 4DOZA 4Y33A 4A3BJ 2BOBC 4O4HB 2DO7A 3AK3A 2Y0IA 3SZPA 4IOAF 3L2VA 5AIPA 1VQ7V 4CPGA 1D5YA 4GKJO 1MABG 1WSUA 2WT7B 1GU4A 2ZMEA 3BQYA 2W57A 5HVQC 2KZIA 2LFSA 4L9TA 4KT0J 1Y6XA 3ASNH 5HLHA 3L70J 2Y4UA 2KL4A 4J42A 2FQ3A 2XKPA 2ZKZA 2XNXA 2CG4A 4I7ZB 3PIOF 3MKYB 1JHFA 1D0XA 1X8YA 2LKXA 2IS2A 3ZRGA 4UCTA 2R4GA 5EGOA 1YW9A 3M07A 2IFNA 3CCSP 1U7JA 4U3FG 3CX5H 1T6AA 4XORA 1KB9D 2QQ8A 3H1IG 2WB1A 3GTLJ 2R7UA 4CS3A 2D45A 2QGUA 1IURA 5F6FA 3ABKC 2EFOA 2QJKB 2OUMA 4XM3A 3TL4X 2K9JB 1URQA 4B3MO 1Y1WJ 3R4YA 1VIBA 5BXZA 1E3OC 3CCVV 2GIZA 1JJ2U 1P7JA 1HP8A 1LJ9A 1KYOI 2AEJA 3IJ4A 4O4LB 1T56A 4EATA 4M9ZA 4C3IJ 4LK0F 3TO7A 1XL4A 4PJJA 2OIGA 1X22A 3TW7A 3ASNB 1IBMB 1L0LG 4AVZA 4DR6O 1O7FA 1YTZI 4LJZF 1MV8A 3A0HH 4CBCA 2YUAA 2ECBA 4S0HB 1FJGB 1MNDA 2IA0A 5EZYB 1KGSA 2FFDB 2KIFA 2WSFH 3S1QJ 3SZTA 2AZ2A 2F5CA 2VWKA 2WLIA 3RYIB 3ELKA 3R61A 5JLWA 1W4MA 4HF0A 5D5QA 3CCMP 4R4MA 3CLOA 1RZ4A 3OYAA 3CJTB 1VQNV 3ZCOA 1N0JA 1KB9H 1UHWA 2WLNA 3ONQA