1S3JA

X-ray crystal structure of yuso protein from bacillus subtilis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
SADQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYLSFLTEEEMLQAAHITAKLAQAAETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YusO protein
publication title X-ray crystal structure of YusO protein from Bacillus subtilis, a member of MarR transcriptional regulator family
rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 47
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s3jA02
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1s3jA03
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1s3jA01
2J5PA 2ZO4A 2RC4A 2R7FA 4HLYA 1H9TA 2VE8A 2EA2A 3BWGA 4IXAA 2OQGA 2Y75A 2R7DA 4PGGA 4BNCA 1BOAA 5K1YA 1L3LA 3VODA 3QU3A 4Q4ZF 1U5TB 2P8TA 3HRMA 2XRNA 1K6OA 2VODA 2J5OA 2XAGA 3DPLC 2W57A 2DK5A 3HTSB 2MC3A 2DQLA 3EDPA 3MZHA 3MZWB 1FP2A 3WTSC 2F5CA 4ON0A 4IF4A 1Z1DA 1JMBA 2X0LA 3R0JA 2IJLA 1XDUA 4KA4A 3WE3A 1QBJA 2JTVA 2RKHA 4TV7A 3V4GA 5LRSA 3P7NA 2OQRA 2QLZA 4M9XA 2C6YA 2JWDA 5F1RA 4NPDA 4WX9A 4JK1X 3TOBA 4HQMA 4EVIA 1EH7A 3F23A 4HV6A 3F72A 3HRUA 1IXRC 3L09A 4XSXF 3IKTA 3BP8A 2FBIA 4RB1A 2GZWA 1SFEA 5CA3A 3C3WA 1O7LA 4HV5A 2GXGA 1HBXG 3QP5A 4I01A 1RUOA 3RPUA 1H9GA 1I1GA 1REPC 2D2WA 1EDIA 2EFPA 1ZREA 3V8JA 1ON2A 3QPHA 3DKWA 1MJ9A 3ZMSA 5DUIA 4MN4C 3SFZA 3SXYA 5FGMA 1R36A 1RZ4A 3EYIA 4A2UA 4KMUX 3Q9VA 3QWOC 3HTUA 2QBYB 1EH8A 2FQ3A 4KN7X 1G3TA 1LP1B 2SPZA 2P7VB 3HHGA 4GOFA 2HGCA 1ZGJA 1F4KA 3LAPA 2DLLA 5CJ9A 4DQ2A 2M45A 4KIGA 4KICA 3IL2A 3TKYA 2EWNA 2YU3A 4U0VA 4ENNA 2F2EA 5BOXA 3ZMTA 1XGMA 2HFHA 4P9FA 4WXCA 2F5FA 5DCMA 2DI3A 2ZFWA 2ZXJA 4L18B 3W7WA 4NPFX 3LSTA 2A69F 1WI9A 1J7KA 1UB9A 3GW2A 5E20A 1FC2C 2CYYA 1EDJA 2NAZA 1B6AA 1Y0UA 5L3CA 4YFKF 5HS9A 3FMQA 3CO7C 5FB2A 5K5OA 2KJBA 4EQQA 5LGUA 1CF7B 1CGPA 1G3SA 3OV8A 2BEOA 3FXUA 1EDKA 1K79A 2XIGA 2P6SA 1KU2A 2EA4A 2E7XA 4NHJA 2A3SA 3MCZA 2L4MA 4KFCA 1EV7A 3B02A 3T8RA 3KLOA 2FMLA 3F22A 1S7AA 1G3YA 3FMRA 2BE5F 1A04A 2V1XA 2FSWA 3I53A 3T5XA 3KP5A 2K7LA 3KFWX 3ELKA 1O57A 5A2QZ 3B73A 4WF2A 1BC7C 2CSOA 3L7WA 5A2QK 2Q0OA 2WAMA 2KRFA 2FOKA 3I59A 3JSPA 4L9JA 3C1DA 1YS7A 4RGSA 1HW5A 4LK0F 4BHPA 2RDPA 4G7ZF 2CGPA 3F8MA 2QWWA 3CLOA 2XKOA 2A5YB 4I7HA 2EV0A 4F7ZA 3RDIA 2QENA 2ISYA 2DPUA 2DPDA 4XLPF 3ZDMA 5H6RA 2GXBA 5CYVA 3K9TA 4IOIH 3V7CA 2V1UA 5DDGA 3GWZA 2DAOA 3VFZA 4ZYGA 5CBOA 1BIAA 4ZMDA 1ZRDA 2XAFA 1QGPA 5LGNA 2QZ8A 1ULYA 1W5TA 4HDUA 3RTRA 2PQ8A 1HKSA 2CFXA 1IZ1A 3M1EA 2QRXA 1OMIA 3WTZA 1SD4A 5EEHA 1ODDA 5ILSA 1U8RA 4BHCA 1P92A 2TDXA 2M0BA 5HS8A 5ILVA 2VBXA 3Q9SA 2LF7A 4HKZH 1J2XA 2D1HA 1YTFB 3MEXA 3I64A 1MJAA 3GYHX 5FD6A 1FNNA 3WGGA 4OU0A 4YFNF 1ZG3A 1XGOA 3O6BB 4A5NA 3HSFA 2RGVA 3G73A 4M72A 2O6GE 3RKYA 3D0SA 4Y17A 1ZAOA 3ECOA 4G7HF 4S05A 2JRTA 2OZUA 2EFOA 3EQLF 2UXNA 4L0YB 5D4RA 4NPEA 1HSJA 5D6EA 4EJWA 5HLGA 1XCVA 2GAUA 3RGUA 1YTYA 4G6QA 1KU9A 4RAYA 4U7DA 4UV8A 5CVIA 4MQVA 4MEYF 1U7MA 3ZPLA 2DTRA 5IT3A 1BIBA 4L5IA 4U0YA 3BOQA 3ZN0A 3MAJA 3EETA 2UZKA 1WKMA 1TQIA 3MFKA 1ZHFA 3GFIA 1R22A 5HDGA 1TW2A 1ONVA 2P5VA 2Z5UA 2WC2A 4AVPA 1U78A 1HW2A 3LWFA 1Z91A 4HLXA 1SMYF 3GEZA 1H0TA 1BI1A 2YX7A 2D1VA 3J80Z 4P55A 1LEBA 1NVPB 5D4SA 4M71A 4Y15A 4YFXF 4M73A 3J80K 3LAJA 3K1PA 4UVAA 1TNTA 4KDPA 2I8DA 3FXDA 4UNOA 5D5VB 4YIFA 3IRQA 2M5AB 2KJCA 4WXHA 4ESFA 1IXCA 2DO7A 1K78A 3SQNA 2FXAA 1OKRA 4UUVA 4EMSA 1FSEA 4EGZA 4ASVA 4HJGH 2H27A 1ZN2A 4IVNA 2QVOA 5FFXA 2RNJA 4GO1A 2IPQX 1G6NA 1KQ8A 1T0FA 2Z9OA 2VOOA 3VB2A 3FZVA 5K5RA 5D5XB 5L3EA 1TBXA 3R4KA 3F3XA 1JXSA 2UWJE 2RVCA 4E70A 4LB5A 1JE8A 3ROUA 4MEXF 3F6OA 3FWEA 5C39A 3BJ6A 2DW4A 1FC3A 2OBPA 3ECHA 2CWEA 3GFMA 4A0ZA 4H0EA 4IJAA 2W25A 2DU9A 4HDVA 4AD9A 5BPDA 3FXEA 1F1ZA 1MJBA 5DD4A 4BH9A 3HHHA 1LB2A 4WCGA 3JTHA 3R6SA 4MQ9F 2HS5A 4M74A 1U5TC 4G94A 5E18F 4N9IA 1S8NA 3GUDA 5D5UB 4HYEA 5ICCA 4LG0B 4G6DA 1MDMB 3BJOA 3CUOA 2KS1B 2GIVA 2ZMEB 1QNTA 2ADUA 5BS6A 4XRFA 1OYYA 5D8LB 1AOYA 3GF2A 5AONA 1S29A 5DYMA 2ESNA 4IRHA 1B1BA 4EJOA 5HS7A 2B87B 5HLHA 2XKPA 4HAMA 2ETHA 4QWQA 4HBLA 2VN2A 5E1WA 5L3GA 1BDCA 4KUMA 4RGXA 5LEJA 4Z2YA 1B9MA 2V1DA 1K7AA 3KE2A 1KYZA 2CO5A 5J8CA 1SAXA 1V4RA 1FPQA 4MNUA 2EV5A 2IA1A 4Q48A 1EH6A 1IN7A 1BJAA 1UHWA 5DUKA 4U7BA 5F64A 4EJUA 1MKMA 2K4BA 1GXQA 4IPAA 5H6QA 3K0LA 1OYIA 5J8FA 1BI2A 1QZYA 1KQ0A 1IRGA 1BI0A 4CDGA 3F8FA 1SD5A 4OOIA 5ILUA 4EM0B 3CTAA 3FM3A 3EUHA 1JGSA 2G7HA 2L02A 3ZMUA 1S6LA 3I4PA 1WWXA 3MZYA 5E17F 5DD8A 1U5TA 2STWA 1D8JA 1LQ1A 4GOEA 3IRRA 2GWRA 2M30A 3PH0A 2FMYA 2PJPA 3TDUC 3VEPA 2STTA 2FBKA 4HX8A 3M8FA 3FF5A 3CUQB 2BBYA 3GVAA 1FYLA 2H94A 4EM2A 2W84A 2LDUA 5HDKA 2L54A 2PMUA 1PP8F 4BXUA 2Z3YA 1BN5A 2DQRA 1O7FA 3WTYC 2H09A 3I54A 1Z9CA 3ISPA 1ZLJA 4JBZA 3NQOA 2NRAC 4K3AA 1IN4A 1JHFA 2VONA 4M9ZA 2Z99A 4ASWA 1FYMA 4UXNA 1HSTA 1QO0D 2NNNA 3V7RA 1G4DA 3W7TA 3P9CA 5HLIA 4CHUA 2W24A 1P6RA 3WTVC 4KYWA 2PI0A 4M9SA 2A61A 4FHTA 5FLXZ 3ZMZA 4P9UA 1XMKA 3W7XA 2HQRA 5FLXK 5JHUA 4KIBA 5E8IA 3ABTA 4OIOF 2LF8A 1YYVA 2YR2A 2V79A 4P5OA 1XMAA 4N9HA 3I71A 2OU2A 3F21A 3GZ6A 1Z7UA 2QBYA 4R1HA 4UV9A 3L2CA 2E1CA 5CVUA 1LT1A 3K2ZA 4G7OF 3HIFA 1LP1A 3E3VA 1R00A 2RQPA 2A6HF 4PCQA 2L01A 4RB0A 1J59A 4RB2C 2ZAEB 2HOEA 4GYIA 3D5LA 1BBYA 5D6FA 2Q2EA 3JSOA 1H0MA 3D3IA 1NVOA 1P4AA 4HQEA 2PLYA 4CYDA 1ZRCA 1XGSA 2EB7A 1YLFA 3BPVA 3I58A 1BC8C 5ICEA 4L5JA 1W7PB 2WTEA 4LJZF 4I09A 3TO9A 4GYGA 3P9KA 3E5UA 1ZG1A 3IHUA 2M8EA 1R23A 3RKXA 4KNYA 4IRGA 1J0RA 3IWZA 2W85A 1CF7A 1D8KA 2F5DA 1R7JA 2PEXA 1LDDA 4NB5A 1DP7P 1YW9A 3ERED 1U6GA 5HVQC 2E7WA 2IT0A 5JVTA 1XD7A 1Z6TA 3KP7A 3MWMA 3REOA 5D8KB 3ZN1A 5E1XA 1ZLKA 2OTKE 3RKWA 1AWCA 1FX7A 3ZQ7A 5DV5A 2WMMA 2RN7A 4ENMA 2QQ9A 3PQJA 5KK1A 2VC0A 1YO5C 1FZPB 1IXSB 1LNWA 3JAMZ 2EFQA 4ZYDA 1I27A 4IRIA 1V3FA 1Z6RA 3WTXC 1SS1A 1U7JA 3JAMK 4HF1A 2O61A 3DF8A 2GA1A 2YPRA 4FT8A 5EEGA 4KMFA 2YSRA 1JM0A 3F6VA 5L3DA 4R8HA 4KIFA 2VBZA 1XCBA 4FX4A 4A12A 3E6BA 3M8EA 1U2WA 1YIOA 2XUBA 3TO6A 2DT5A 4HF2A 3GFLA 4LMYA 4BAYA 3FM5A 2FRHA 2GQQA 1D5VA 1FBUA 1IRFA 5ERIA 3KETA 2HYFA 1TLHB 4B09A 4N0BA 2O8XA 1ZG5A 3QP6A 3PQKA 4RGUA 1GVJA 3K1NA 4MTDA 4WWIA 4Q47A 5ED4A 2K02A 2DK8A 3GLXA 5D5WB 2CQKA 4G9YA 3COAC 4A6DA 3NRVA 4HX4A 4EYYQ 4ASNA 2EV6A 3T0YA 4CO8A 3QPTA 5LHHA 4IHTA 1YW8A 4G8XA 3E6CC 2VE9A 5LLQA 2M1BA 2MBFA 2BV6A 3V8KA 2FNPA 2O03A 1ZARA 1P4XA 5E8GA 1OVUA 3G3ZA 4ZNCA 5TJJA 3BZ6A 5AIQA 3W6KB 4M6YA 4DNCA 3GO5A 5LHGA 2O0YA 3WODF 1BM9A 3DV8A 2JT1A 3RPQA 4L9VA 3E5XA 4Y13A 4EJVA 5LGTA 2KKOA 3BJAA 3ABUA 5F6FA 1LEAA 3KP6A 5HOOA 4LD5A 3GZ5A 1DEEG 4D0PA 5L3BA 1LDKB 1X3UA 2K86A 2VBWA 3J7AO 4KN4X 1YG2A 1PP7U 4ENJA 4S04A 1Z05A 5DJTB 4LGWA 1I6XA 3AAFA 3R60A 4PDKA 5FO5A 1I5ZA 1XDSA 2LR2A 1R5HA 5ICGA 4EV0A 3S1KA 4WWCA 3F8CA 4NQWA 1IF1A 3BY6A 2M5AA 4BHBA 1DUXC 2VT3A 1MFTA 2XHKA 1KGSA 2FNAA 2Y48A 3TDZC 4RS8A 2XAQA 1W4MA 4ESBA 4O5VA 1FY7A 3K1MA 4L9TA 1MZBA 1HKTA 1OR7A 1WRJA 3FMSA 2PFBA 3ULQB 3HOTA 2ZKZA 3N97A 2HKOA 1L0OC 3L00A 1QZZA 2R3SA 2MH2A 2BYVE 3DEUA 2D45A 2KIFA 3TQNA 3ML6A 1TQPA 4HZFA 3Q5FA 3E6MA 4JBAA 4WXDA 4UVBA 3WE2A 3GXOA 1SFXA 4CZZA 1FBQA 2O3FA 4YIIA 3LA7A 3O3KA 3SZTA 3T1BA 1SMTA 4R79A 3VOEA 4BXLA 1TNSA 1KYWA 4JQFA 3N4MA 1EC5A 4AWXB 4RAZA 4U0WA 1WSUA 5AIPA 1T2KA 3T8TA 3I0TA 1VTNC 1S7OA 1RI7A 4GGGA 3LQRA 3WGHA 1O3QA 2K27A 2Z33A 5LBQA 4MGRA 4LG0A 2CG4A 1MDMA 3JW4A 2MLKA 5FFZA 2P58A 2KI7B 2PBIA 2ZMEA 4OMZA 1YFHA 3KCCA 2HEOA 2JPCA 3ZMDA 1OVRA 1FLIA 2P6TA 3CUQC 3JTGA 5CVRA 1FSHA 1BDDA 4AIKA 5LEKA 3P9IA 5L3FA 3R61A 4PZJA 2B89A 5CBNA 3RI4A 2MD5A 3H3ZA 5DCMB 3V7SA 3FHZA 2B87A 2OA4A 3TGNA 2ESHA 3C7JA 4ZZDA 1J75A 4ESJA 4CGZA 2OZ6A 4ZYHA 3KZZA 1FYKA 2XV4S 4MHGA 3KZYA 4YG2F 5KVRA 1E17A 1USTA 3W6JB 1YQAA 3HOSA 3RYRA 1RIOH 3HSEA 2P90A 2VOPA 3KEOA 3ZP5A 2AS5F 2QQAA 1T39A 1XN7A 2ZNZA 1F5TA 1X0TA 1FWZA 3CDHA 1Y47A 2M87A 2JZYA 1LVAA 1PUEE 2JPBA 2ZCWA 2HKXA 1R58A 2FEZA 1B59A 3U1DA 2X4HA 4A6EA 3EYYA 5K5GB 3BPXA 3LFKA 3R0AA 2COMA 2VBYA 2QQBA 2MLGA 5J6XA 1LDJA 2ISZA 2QVAA 3FXQA 4HA8A 4LK1F 3I59B 3KLNA 2Q1KA 4A5MA 1USSA 3HUGA 1TW3A 3W7SA 1MD0A 4I0AA 4ENKA 4LLNA 4Q5SF 2LXBA 4GXOA 2QM3A 3CUQA 1J5YA 4OMYA 2P4WA 2ZNYA 1XB4A 2G9WA 5TRDA 3DP7A 3V8LA 3L9FA 1GXPA 2RV8A 2KZIA 4M6XA 2YX4A 2V6CA 1DPUA 3KP2A 2JSCA 4OIPF 2XROA 1NHAA 1UHMA 3HSRA 4EJTA 4A0XA 5ICFA 1SD6A 3HRSA 4ETSA 2FE3A 2HYGD 4I98B 1GHCA 4BYYA 4XLNF 4I02A 1DDNA 1HW1A 4QLCU 2GA2A 4CPGA 3WG9A 3WU1B 5BQTA 2XAHA 1XSDA 1P2FA 4KJMA 1OVVA 2L3DA 4BQAA 1F9NA 4I2OA 1B9NA 1FBSA 1C0WA 1FOKA 4UVCA 4EGYA 3KP3A 1ZW0A 5EFWB 4RGRA 3ZMVA 5BPIA 1FP1D 3NEUA 1T6SA 3IKVA 5H20A 3O2PE 3H3UA 3KP4A 2QUFA 3K69A 2A68F 5DJUB 1OPCA 2NS0A 4HF0A 2FA5A 2IVMA 1W7PD 2K3RA 2XGXA 2UXXA 2PG4A 4LFUA 1YS6A 4LLLA 3GFJA 1XSXA 1T98A 4A0YA 1KU7A 1W5SA 5CVVA 2EFNA 1IN6A 1DPRA 3BDDA 2OAZA 2OD5A 3DPTA 4HB1A 2F5EA 2ZJ2A 4HW0A 1EDLA 4KT5C 5LHIA 3RJPA 1FT9A 4XSZF 4ZYEA 1KQ9A 1MGTA 2B0LA 2ELHA 2IP2A 4CXFA 2HTJA 2A07F 2PN6A 3CJNA 2B88A 1STZA 4P96A 1SD7A 3C18A 4PGHA 3IC7A 3I5UA 1TTYA 4AIJA 4FX0A 3WGIA 4U88A 1E2XA 2XAJA 1W7PA 2WWYA 1TQMA 1H0TB 1ZRFA 4CICA 1SFUA 2Y0MA 1R1UA 4AIHA 3MQ0A 2V9VA 2P5LC 1QPMA 2XVCA 4OIRF 2KIMA 1NH2B 1B4AA 2LXCB 1QQIA 4O3MA 3PFIA 4K2EA 4GODA 1KA8A 3DXJF 4HX7A 3S2WA 3KEQA 3LA3A 1RM1C 3BROA 1K78B 2LSOA 1I1SA 2LNBA 3U2RA 4EM1A 3J81Z 3FXRA 1RNLA 2DFIA 4XBFA 5E1ZB 2FF4A 2K4JA 1IN5A 2VXZA 3J81K 1PDNC 1R5GA 2MA3A 1T38A 3IWFA 4HOBA 1UCRA 4LB6B 3E6DA 2EK5A 2WV0A 1ZGAA 3M9AA 4I0BA 1JHHA 4RB3C 2RKLA 3SZPA 2XASA 1D3YA 5LRRA 3F8NA 3RYPA 2R44A 3OOPA 4UHTA 2EFWA 3QU6A 5BMZA 2DBBA 1HXDA 2H6BA 1BI3A 2A6EF 3E35A 1P4WA 2E1NA 1IAWA 2UWMA 1IW7F 3F8BA 3SHFA 4K35A 3RIRA 2IA2A 1XGNA 2KIUA 5FD5A 3E97A 1YW7A 5DEQA 1ON1A 3LA2A 2KIKA 1ZYRF 2KZJA 2HQNA 2IW5A 2VT2A 3GX4X 5HDNA 2L4AA 4L9NA 2CW0F 1IUYA 1HQCA 2LKPA 2EJRA 2QYOA 5JFRA 2IA0A 3QRFF 1XSVA 1R1TA 4GCVA 4OINF 1O3RA 2FBHA 5IT9Z 1G3WA 4LLGF 5IT9K 2HDCA 1IN8A 2HTSA 2HWVA 2H6CA 2VC1A 2FU4A 1ZXGA 2ACJA 4WK8F 2ZBKA 2M5WA 1LJ9A 5DCFA 4O6JA 2IRFG 2MH9A 1O3TA 2HZTA 4B8XA 1J9IA 1OYWA 3WTWC 2BGCA 1R1VA 1U3EM 1ZH5A 3U9GA 2NYXA 5JI6A 3W7UA 3HYIA 4L0ZB 1WQ2A 2HR3A 3TOAA 2Q8KA 2NNYA 4ZZLA 3QOPA 3CO6C 2KUBA 5CVJA 3HRTA 3WTUC 2P5KA 2AXLA 3MHVA 1Q1HA 5JR3A 5K5QA 3FX3A 1HKQA 3DFGA 2P7CB 1UFMA 4ZH4F 2G7UA 1KU3A 3WTTC 1O3SA 4OIQF 6PAXA 3DQVC 3LQQA 4IHSA 1Q2NA 3M7GA 5CLSA 2PMHA 1S3JA 1RUNA 5GW7A 4MTEA 3E5QA 3WU0A 3QAHA 3H92A 3TO7A
chains in the Genus database with same CATH superfamily
3I3LA 1PIXA 2HFEC 1LFBA 1NU1K 3SPIA 3QYEA 1YF2A 1PL4A 2OQGA 2R7DA 1PPJG 1L3LA 3IUOA 1WNSA 5FNVA 4DUZB 3OGIB 4MFDA 3AKZA 3HRMA 1K6OA 3H1JG 1XEQA 2IBDA 2MC3A 2XGCA 1L0LH 3MZWB 3R2PA 1YJNP 1BQ0A 2POHA 2X0LA 4KA4A 2ZSIB 3W2WA 1AR5A 2QLZA 2BASA 4AYCA 2M7AA 5F1RA 4CUGA 2OTLI 3TOBA 1OCZC 2R92J 3RK3E 2CV0A 2M4KA 2HFED 3CXHH 1WRGA 1VQ9V 2RMKB 1DU0A 5AW7B 5BXZA 3RKQA 4JX5A 1KMIZ 3HL2A 2EZIA 1TUBA 3RL0g 2BCCD 5LYJA 2GXGA 3JASB 3CCVI 2Y0CA 4YTPC 3HM5A 3RPUA 1H9GA 3WHCA 2DQ3A 1REPC 2R7UA 2D2WA 2R70A 1KC8W 2EFPA 3GTLJ 3G6BA 3VN0A 2E1MC 2KPMA 4A3DJ 1Q7YW 3QPHA 3WUUA 1MJ9A 4MN4C 2OYIC 2VQHA 3K03A 1YIJP 3IAOA 2BOLA 4BL0B 2W7NA 5JH7A 1XMXA 3Q9VA 1W1WE 2Q0OC 3EFFK 4U3FE 1G3TA 1FDMA 3BG3A 2BY0A 2IBZI 3MUDA 3OTFA 4GKJB 4MLOA 1Z5VA 1K05A 1HP8A 2E42A 3CCJI 2D5VA 3S2HJ 5CJ9A 2R7RA 2M45A 3HUSA 1SANA 5KLVJ 4U0VA 4ENNA 2F2EA 1XGMA 2DI3A 2K9NA 2FBWC 2N8GA 1UG0A 4XK4A 4ZKUA 3ZXSA 2ZXJA 3W7WA 2DYRC 2JA2A 3LSTA 2A69F 3K4CA 1J7KA 3ZRVA 3SYCA 4BE2A 4JPZB 1M57C 3S1RJ 2XPWA 5GAGJ 4H13B 2E71A 5B5EH 4YFKF 4X62B 4MVSA 2C9LY 5K5OA 2JVHA 2Q9LA 2AHZA 5B1OA 3K04A 4DR1B 3OV8A 2BEOA 4FZ0A 2XIGA 2P6SA 2GV9A 1S5LC 2YUAA 5FPOA 5CMZA 2DA4A 2EA4A 2IPPA 4NHJA 4XKWA 2VS0A 2A3SA 1JTYA 2HG5D 3CCEI 2E2IJ 3T8RA 3KLOA 1OCOC 2CQNA 2R5DA 2FMLA 3F22A 3AG4C 2FFDA 3FMRA 1OJLA 3I53A 3T5XA 3M0DC 1O57A 3G71I 3B5NC 1M57D 1NJIW 5A2QK 4XOTA 2KRFA 2FOKA 1YS7A 4RGSA 3B71A 2EIJB 1JJ8C 4XLFA 4TQFA 2EZHA 3N7NA 5IDJA 3GF7A 2Q5ZA 2NOGA 5CYVA 3K9TA 2DTZA 3V4WA 2HPCB 3GWZA 4I4TA 4LF4O 3CX5I 2DAOA 3QNEA 1BIAA 1OCRB 1FXKC 2XAFA 4Y99C 3SPCA 4DR6O 2Y0DA 1M1KW 1QVTA 1ZKGA 4BQOA 4JI4O 1IZ1A 3M1EA 3I55I 4A3IJ 1BSHA 1SD4A 5EEHA 1A02J 5ILSA 4BHCA 1ZRTD 3TCUA 2R7WA 5HS8A 2DMTA 2MKVA 4NTWA 5ILVA 4BKXA 3WHBA 2VBXA 2YSUB 4JI7B 2D2CD 4TOIA 1J2XA 1J09A 1MJAA 3C1LA 2P4KA 1FNNA 2YO2A 3WGGA 4YFNF 1QR8A 3LNQA 1XGOA 3O6BB 3CJHA 4A5NA 1Y74A 2KIQA 4M72A 3RKYA 1BMFG 1YTFD 3ECOA 1BCCJ 4UUSB 4G7HF 3TBIA 2CH0A 3BG9A 2EFOA 5GP9A 1AI4A 2B1IA 2YDEA 5E1AC 2QR4A 3S3WA 5KAFZ 2GAUA 4PSXA 2PP6A 3RGUA 3D70A 1KU9A 4RAYA 5CVIA 3CD6I 3D5RC 1U7MA 2LR8A 2DTRA 4YXDC 4L5IA 2BOCC 1P7IA 4ASUG 3ZN0A 1ZR2A 2GIZA 2PI4A 3MFKA 1ZHFA 3GFIA 5JVDB 5C93A 2P5VA 3ZRXA 3JCUZ 2K9PA 2HJDA 4B86A 3LWFA 4HLXA 1SMYF 3L71D 2NRGA 1RQVA 2JJLA 1YE9A 3J80Z 2C2AA 1NVPB 4DV1B 4Y15A 4YFXF 2B1GA 3AG1H 1S7EA 2ZE8A 4TQDA 3VQWA 3QPSA 2EIKC 1N34B 3LAJA 3K1PA 3SPHA 4UNOA 1NU1G 4ZKPA 1JO5A 3C2BA 4NQWB 2YIUC 2WPQA 2M5AB 2ECBA 2Q73A 2LRDA 1EKEA 2KJCA 3CCMI 5IYBJ 2V7QH 3SQNA 1I94B 4BW9A 1TWCJ 1XNRO 3F7VC 2X6XA 4JTAB 2YKQA 4E7KA 1AB3A 2LFSA 2K9QA 1KD1W 3ZQFA 4A69C 5LMNO 4GO1A 3H1HE 1KQ8A 3UM7A 1T0FA 2ZCEA 3JAMN 3G4SP 3U1AA 2PYJA 4B3XA 3KPEA 3FZVA 1FEXA 5K5RA 3VMAA 3AE8C 3H5NA 2XGDA 2N1TA 4E70A 3RK2C 2KQXA 2CUFA 2VQLA 1DTOA 4O4LB 2AZ2A 2VQEB 3CMAI 1SQXH 3ECHA 4JI5O 1Q8IA 3AECC 2G0EA 4IJAA 4DR2O 2VQFB 3CZ6A 1TAEA 1QZEA 4H37A 1JCHA 3E8BA 4LFCB 3JTHA 3MZ8A 2JGDB 1M93A 3P30A 5BMVB 3FXJA 3OSFA 4G94A 5FKNA 4RLQA 5GTHC 1S8NA 2GOXB 3OYFA 5KNLA 3SDGA 1T08B 1MDMB 3BR2A 2KS1B 2GIVA 5JHFA 1OYYA 3RK2D 2CW8A 5D8LB 1NTZE 2IJHA 2ZKOA 2IU3A 2NVYJ 3SYQA 1B1BA 4PV1D 5EYPA 1B06A 1SQBE 2ZE6A 4HAMA 4DV5B 5TISH 4HBLA 4XN0A 5E1WA 5L3GA 5GTIZ 1Q81W 4DK1A 4CCLA 1MOFA 1PPJH 1N25A 4Z2YA 2V1DA 4JI7O 4FCYA 3KE2A 2ZYAA 3LW5H 1P7GA 3CB2A 3H1JH 1EFRG 2UUBB 2LW7A 1NTKD 2IA1A 2VJ4A 1GV5A 2K4BA 1GXQA 3K0LA 1FZFA 1KQ0A 1R5SA 1BI0A 1VQ7V 3F8FA 5DTDA 1SD5A 1S0VA 4EM0B 1SF9A 4A3LJ 2HXIA 3CTAA 3FM3A 3CE2A 2CFOA 3JARB 1Z21A 2RJZA 1XL6A 1ZK8A 2N74A 2G7HA 2YIAA 4DV2B 2L02A 3ZMUA 3L70G 1COWG 3JCZA 3CC4V 3MZYA 5E17F 5HODA 1VFCA 5LXTB 2QWNB 4DR5O 3LSHA 1BCCE 2XC7A 4HX8A 3M8FA 1H89A 4JI3O 4EM2A 1QGKB 2LDUA 4PELA 3CX5F 2CDYA 2K9SA 3BT9A 4BXUA 2Z3YA 2P7TC 5CCGC 4DV1O 3ASOB 2KSJA 4H13C 2H09A 1YI2P 1Z9CA 4P2ZA 1Z3XA 3ZQLA 1MBGA 1L0LE 1V55B 1IN4A 5KX5A 3OS0A 1R4NB 4M9ZA 2VWJA 4EDFA 1S9KD 4I50A 1LFUP 3W7TA 1ORQC 4KYWA 2PI0A 4E6KG 2DYSB 2UXCO 2A61A 3ZRGA 1PV0A 5FLXZ 4ZBMA 3ZMZA 3DXRB 1V9PA 3CESA 5JHUA 4UB6C 4YEJA 3CXHE 3TETA 3ABTA 1PV3A 1U0JA 4K0KO 1SLQA 2YR2A 2CW7A 3F21A 3GZ6A 3HE4A 3VP9A 5EYRA 4UV9A 3L2CA 3RYCB 4H13D 1IDYA 1I50J 3JRHA 3K2ZA 2OJED 2DOSA 2EIJC 3KYDB 2IYOA 9ANTA 5EEAA 4LP8A 2BTQA 2DFEA 2AEFA 4RB0A 1FXHA 2UV1A 1YCIA 3VPRA 3OWTA 2Q2EA 5LD2C 1TWGJ 3OYEA 3H1KJ 2FYUJ 1E79G 3SFEC 3H36A 1P4AA 1LUWA 4CYDA 1OCRC 1BC8C 4C30A 4PSWA 3LIEA 4I09A 1BOBA 3QQAA 1XMQO 4GYGA 1ZG1A 2V7QJ 5CQGA 2K3FA 4X1IB 1B3QA 3A2AA 3UO2A 5C4XJ 5KMGA 1F23A 3HBLA 1OISA 1OXZA 4EOTA 2F5DA 2BSKA 3I56V 3Q3SA 3LDEA 4PDLA 4CCOA 3OSGA 1UZCA 3X2QB 3E83A 3FB5C 5BU8B 2PX9A 3ZQHA 4IKFA 4M3FA 5E1XA 2OTKE 1O9GA 4IHYA 3RKWA 1FX7A 2KDOA 5B5EE 1Z77A 3OL4A 2CH7A 1GN2A 4JX4A 3PQJA 1YO5C 4PD4H 1IXSB 2VWKA 4IRIA 5APTA 1SS1A 2NLJC 3JAMK 2O61A 3DF8A 2LD5A 1IDZA 1N86A 3LFUA 2GA1A 1H2KA 1HJBA 4KMFA 5J40A 1GH6A 3F6VA 4AM3A 4LFBB 3RL0D 4R8HA 5EGOA 3E86A 3DC6A 1A6IA 4A12A 2HODA 4AYBA 1U2WA 3HE5B 3B2EE 2XUBA 3GFLA 1I3AA 1JQ0A 5ERIA 2LO1A 3C2HA 1MV8A 1VQ9P 4HG2A 4C9YA 1MBEA 4GKGA 3ETGA 1I0HA 4B09A 2IJJA 3PQKA 1YQ4C 2WSFH 4E7LA 1NGMB 1NG6A 2GUZB 2VRZA 1VQPI 1X2NA 4LC1A 3GLXA 3ASNB 2CQKA 1GN3A 2WB1A 1AFOA 4RO0A 3NRVA 5J2UA 4HX4A 4H0LD 5LHHA 2R7QA 4ZHQA 3LW5J 2GHYA 3E6CC 1SKVA 2MBFA 1DF4A 2FNPA 2BCCG 4M3DA 4J00A 3PTZA 5E8GA 2F1MA 4D9JA 2X6CA 4C7NA 2BW3B 1QR9A 2PJRA 1RF0A 4DNCA 3GO5A 4LF7B 4HH2A 1VQ5I 1PUFA 1A35A 3G80A 1NVPD 3V2NA 2JDIG 3WODF 1BM9A 2E1OA 2Q3IA 3A0RA 2CQXA 1GU5A 1DD3A 3E5XA 4Y13A 5IJ9A 1Y76B 3H9VA 2IH3C 1LEAA 1LPQA 1JTHB 1FE6A 2E5ZA 2VJJA 4UCUA 1R6NA 2YXRB 1DX7A 1URQA 2PFXA 5BY1A 2E2JJ 1LDKB 1KYOI 2Y0PA 3CWBG 2UXDO 2HVJC 1AJQA 4XORA 2DN0A 1DK1A 2VPLA 3JSLA 5FNVB 1NTKK 3CDIA 4CC5A 1Z05A 5F04A 4LGWA 4JYAO 2X48A 3WUVA 2LR2A 5EBWC 2EINB 1R5HA 1AQ5A 3L74H 3KHUA 2KP8A 3K9AA 5IOZA 2YUSA 2VT3A 1MFTA 1KFMA 1KGSA 3FXLA 2FNAA 1SQGA 5EIBC 2XAQA 1W4MA 3ZS8C 2FXOA 2ZYGA 2QE7G 1FY7A 4XOPA 3K1MA 1OR7A 3JAWA 4B7EA 3J81N 2FYUE 4XDLA 2VPRA 5EC1C 2ZKZA 3CXCU 3AE6C 2UXBB 3L00A 3SEZA 1QZZA 2LTPA 1S1CX 2P67A 2D45A 4JAAA 4HZFA 2OYQA 1TUBB 4CCMA 4BIOA 5LYJB 1YDXA 4LIUA 1FOXA 4EB6A 1IBLO 3RQIA 3O3KA 1SMTA 2XF6A 4RBOA 2CUGA 2L9RA 2W4SA 3VOEA 1TNSA 5H2FH 3N4MA 4L87A 3H1ID 5EIBD 1U97A 2B9SA 2AEMA 3DBRB 2FY8A 1WSUA 2IFNA 2LY9A 2VKEA 4FPPA 1IBMB 3HGGA 3T8TA 3I0TA 5JH7B 1S7OA 1O3QA 4MVMA 2E60A 1X1CA 3W3CA 1N7SA 1L1FA 1WJEA 3JW4A 4FK5C 2X7RB 4NR1A 1YFHA 2JPCA 3ZMDA 3L72D 2XV5A 1FSHA 1RE3C 1X19A 3HUSB 3P9IA 2V4JC 1GZLA 3AE4C 1Q86Q 5CBNA 3V2RA 3V7SA 4MTXA 3ASOC 2OA4A 3L75J 2CQ7A 4OAZA 1VQ4I 3TGNA 2DXIA 4P9PA 4ZZDA 2FX0A 4ZYHA 3KZZA 3ITKA 1N78A 1V55C 5B1BB 4NXMO 1AR1B 2VQGA 4YG2F 2V4HA 1LKXA 1UJ8A 3RYIA 1HNWO 2LLKA 2P90A 4LIVA 2QQAA 5TISZ 4DZJA 5KUMA 3K2AA 2DYSC 4X8AA 4EI2A 1FWZA 1H2SB 3RK3B 1K7DA 2V9KA 2JGUA 1ZLLA 1VIBA 4B43A 2JPBA 1FS0E 1KB9E 3CX5D 2ZD9A 2ZXWH 5J4YA 4IYIA 1VQLI 4JI2B 3BPXA 2FFDB 3LFKA 3H1JE 5E3MA 2Q4PA 3R0AA 3OOUA 2GUVA 3A0HZ 2Y69H 1QL1A 2MLGA 4PJNA 3ZIAG 4V2FA 2YEVA 2O01N 1LDJA 1JKRC 2ISZA 3FXQA 1FXVA 1RC9A 2JVGA 1JKQC 3L71G 2Q1KA 3SZGA 4L76A 1ITYA 2WSFJ 1EZVD 4GXOA 2Q68A 2R5BA 4BY1J 4X89A 3V8LA 3OIOA 3L9FA 2RV8A 4W80A 2M0MA 2V6CA 2ZT9B 3KP2A 4I4TB 5C8YA 3IH3A 1GLNA 3TW6A 3HSRA 4WCEV 4A0XA 4YIRX 2KLVA 5ICFA 4MTFA 1QLED 4XM3A 4XLNF 4QLCU 4CPGA 2ID3A 3WU1B 3F5TA 4M6VA 4KJMA 4JV5O 1X79B 1QCEA 5APUA 3D5SC 3X2QC 4C3JJ 1B9NA 1C0WA 4EGYA 4D5CA 2LY1A 2R7OA 1E79H 5BPIA 2AXTC 1FFTB 1GAXA 4JYCA 3IKVA 4I76A 5GAEJ 3K69A 1S72I 3CJHB 2JEUA 3OT7A 1OPCA 1Y74B 3J7AY 4DJAA 2PG4A 5IY5H 2BY2A 4ABMA 1D0ZA 3JRCA 3NWSA 2BY3A 1FKAO 5CBHA 1IN6A 4R8CA 4HB1A 2ZJ2A 4B3TO 4KT5C 1FT9A 5C44J 4XSZF 2CPBA 3F89A 1YXBA 4WFFA 1MGTA 2ELHA 3I4NJ 5HNFA 2JP3A 4FLVA 3MTUE 2B88A 1IGNA 3H1LG 4DW1A 1SD7A 1MSDA 3ZR8X 3IC7A 3I5UA 1NKNA 1KYOF 1YJ9I 4AIJA 4DBRA 3WGIA 1ERDA 3L74J 1M1JA 3L73J 1W7PA 2O8KA 1TQMA 2Z1DA 1H8AA 4DZOA 3GCMA 1ZRFA 1AHDP 1U57A 3QF7A 3VOPA 4GDOA 2DMPA 2F43G 1NH2B 3ASNC 3FK7A 5EG0A 1N33O 4O3MA 2LXCB 3FWLA 3L4FA 2F4MB 3BLYA 1VQ7P 5J1UA 3WB1A 3ZRWA 3DXJF 2H3OA 5GONA 3BROA 1EN5A 1Y1VJ 4FE4A 1NTKG 1I1SA 4UB8Z 2HHHB 2C9NY 3H3VK 4V2GA 4Y3OA 5FL7G 2ZXIA 1PNLA 2PUSA 3CC4P 2MJZA 3OAKA 5E1ZB 1RE4A 2VXZA 3J81K 2MA3A 1TWFJ 3IWFA 1I3QJ 1YJNI 2OWOA 1IUFA 2RKLA 2EBOA 4MIMA 2YMKA 1ROPA 2EFWA 4UUJC 2OC6A 2DBBA 3CXHI 4PI2A 3U21A 2N1TB 4MW8A 5CMUA 4DV4O 4QE9A 3JSVC 5AW4B 3CMEI 4PD4E 3RIRA 1QVGO 3CJTB 3A01A 5FD5A 2FKXA 2IFMA 1ZOYC 1YW7A 2DMUA 1HF9A 1GMJA 2DN9A 3LA2A 2KIKA 1ZYRF 1J95A 1VQMV 3GX4X 3O6QA 5HDNA 4F3QA 2W6JH 1VZ0A 2GLOA 4LFAO 2PMZA 2QYOA 4LNUA 5JFRA 2JDIH 3ZX6A 2IA0A 4I5SA 2XPVA 2ZDIA 2YXYA 2EINC 4GCVA 2FBHA 5LP6B 4LLGF 4DR7B 2HDCA 2HTSA 5AVTB 2HWVA 4ZOLA 2CS3A 2VC1A 3ABKB 4O6JA 2IRFG 3CRRA 5IP6A 2CAZC 1YEWA 1E0EA 5EYPB 1WPBA 3CWBH 1MG1A 2IX7C 4IHWA 2PY5A 3LSPA 1SQPK 4NC7A 2NZ2A 4WFGA 2ZIMA 2VJ5A 1L4AD 2IH1C 1N75A 1T95A 5E79H 1PZQA 1WQ2A 3FXOA 4ZZLA 3PJRA 3DKXA 2OTLV 4I6MC 1IZNB 1NAYA 4OVNF 3MHVA 2HVKC 1M1EB 2H1LA 4RWUA 3CP1A 1AP6A 1UFMA 3S3XA 3MKZA 2Q7GA 1HNXB 1AJPA 3T4ZA 4RJTA 2EZOA 1AR4A 2QE7H 3SJQC 3S3MA 4CZCA 2HOTA 1S3JA 2O9LA 4U7JA 1WGXA 3QAHA 2WY8Q 3WU0A 3CCVV 3H92A 4BHPA 4LB6B 4XLCA 2J5PA 1H88A 2ZO4A 3CCSI 2MD0A 1LJ2A 2EA2A 4RA2A 2Y75A 3I56P 1WA8A 4DT0A 3MUDC 3VODA 4Q4ZF 1J1DB 3PL8A 1IFDA 1THZA 1MMAA 4JASA 4B3MB 2XAGA 2CGOA 4G2KA 5EZHA 4GX5A 2OCHA 1R4MB 3H9JA 1SERA 3MZHA 2J59M 2QGUA 3HUSC 1NR7A 1S2EA 2IJLA 2R72A 3VQYA 4TLFA 4U3JA 4GKKB 2RKHA 3CCJV 4TV7A 3K3WA 3M4OJ 4IQJA 2OQRA 4NBQA 1M56B 3LSKA 2JWDA 4B47A 2BXZA 4WX9A 5B1BC 1H2NA 1IBKB 2NPSA 3F72A 4IYHA 2Q9IA 2BTOA 1P49A 3FD9A 3L74E 1BGYD 2E75B 5KX5B 1GDTA 5B1AB 2FBIA 2ZE5A 4YJ2A 4I50B 5AVUB 2GZWA 4W7ZA 2CMPA 4HV5A 3RK3C 4NTYA 4J9YB 1Y8QB 2WPRA 1HBXG 2Y4UA 4FLXA 1N4CA 1MZEA 3GHGA 1I1GA 4BU2A 1LWUA 1ZREA 3V8JA 2B63J 4JI6B 4LF8O 2FFDC 4II3A 1IJDB 3ZMSA 1NT2B 1GL2A 2AQEA 5FGMA 3CCEV 1LNQA 1RZ4A 1UPGA 3HOWJ 4KMUX 1JR9A 3HE4B 3QWOC 1A02F 4KN7X 5H2FZ 3E7KA 1W2BU 3LSRA 3PHLA 2X85A 4MVOA 4FM0A 1V5GA 3HHGA 2YMYA 3WU2H 2BTQB 2ZYDA 3RK3D 2WSCH 4X64O 1LUJB 4JYKA 1XMOO 2EWNA 2YU3A 2EZPA 2Q2EB 5BOXA 2HFHA 2ZT9C 2F5FA 3AEFC 4MVZA 2QSHX 1WP8A 1IFPA 3TW7A 1Q86W 3I4MJ 3RSNA 4BE1A 1WI9A 1UB9A 5E20A 2KKWA 1EDJA 2R0QC 2NAZA 1M90Q 4IFMA 1KV4A 1R71A 5KMGB 3QO8A 3L71H 3LDCA 1WMKA 1CGPA 2LVSA 2BSKB 3FXUA 2LK2A 4X66B 4F6EA 1MIJA 2WSSH 2WT7A 4BY7J 1SQFA 2I10A 2K1EA 1W0JG 1VF7A 1SQPJ 3ETQA 4U3FD 3QWLA 3OD4A 1G3YA 2CH7B 3KZIH 1BR4A 4DYLA 2NS7A 3KP5A 3LSSA 4X1EA 2K7LA 4HYOA 2ETNA 5A2QZ 4DZPA 3NWTA 3V5BA 2ZXEB 1FJGB 3IR9A 4Z1VA 2UU9B 3JD1A 4BIUA 1JMKC 3JSPA 4X6AJ 2RDPA 3CXHF 5M5YJ 1DD4A 3F8MA 2QWWA 2XKOA 1HVVA 4QPOA 2H8WA 2H8PC 5EGOB 1WCMJ 2QENA 2DPUA 3BZKA 2DPDA 2HODB 4YXWH 2RN9A 4NNJA 3GWOA 2W82A 5CB4A 1R5ID 3DWLE 4C46A 3CD6V 2JVDA 4ZYGA 4ZMDA 2O5RA 4L5EA 1ZRDA 4B3MO 3RZDJ 5AVVB 3OS1A 1W5TA 1QVFO 3GLLA 3CCRI 2E76B 4LF9O 3BRTB 3C3TA 2QA4V 1HKSA 2CFXA 1RRJA 2L9SA 4WFEA 4WBNA 2QRXA 1OMIA 3WTZA 4XMYA 3O65A 4GYCB 3TYYA 4U87A 4L75A 4W1UA 1GU4A 3AEIA 5J2TA 1KORA 4HKZH 2QJKB 5J2UB 3KQGA 3H1LH 4FASD 2H8PD 4ZHQB 1NWQA 1OLTA 2EIMH 4OU0A 3G6EI 4C2MJ 3RQ4A 5CJ4A 1KYOD 1HGZA 4HBNA 3ZQCA 1BT8A 3G73A 1R6KA 4C7NB 4Y17A 1ZAOA 1T0FC 2DA6A 1UIXA 1HDDC 2PJRB 3TMOA 2JRTA 1LGHB 3QH9A 3M9BA 1HR0B 3EQLF 3H1IG 1PUFB 4L0YB 2UUAB 1HSJA 4EEQA 5D6EA 1GD2E 1EBOA 5HLGA 2N1TC 5JQGA 1KB9I 1TUEB 4G6QA 5IJ9B 4RAFA 4F93B 1OZ0A 2HXOA 1BIBA 2FYNB 1MMGA 3MAJA 4PJJA 5KCMA 2UZKA 3CP8A 1TQIA 1URQB 1R22A 1X1DA 1FIAA 3DU5A 3DLLF 3L72G 2WC2A 1Q6UA 1KFNA 2WY7Q 3A0BH 1Z91A 5KAFC 4I9WA 2M3EA 1H0TA 2F6CA 3D36A 2D1VA 4P55A 1VF5B 2XAUA 3A2FA 4M71A 4OPAA 3BCCJ 4P9OA 4M73A 2DODA 4OX9B 4AILC 4DYCA 4UVAA 3S8PA 4Z2WA 4I9QA 3FXDA 3P8CE 4R7CA 3ABKC 2N1TD 1KILE 4TV8A 4U7NA 2YXQB 4WXHA 4ESFA 1IXCA 2DO7A 2ZVNB 1WAZA 2VL8A 3OMIB 3K08A 1FSEA 4EGZA 4IOAF 2H27A 3JAWB 2DT7B 3A02A 4IVNA 1LVKA 2QGNA 4B3AA 5F1JA 2RNJA 4DV6O 3CMYA 3ZHVA 3U1KA 4A3JJ 3VB2A 4HRIA 5D5XB 1SVMA 1WT6A 3R4KA 3RGBA 3F3XA 2FYZA 2RVCA 4ZKIA 4GX2A 1ETKA 3W2AA 4LB5A 4IGGA 4EB6B 1SFKA 2Z16A 3DC5A 3FWEA 3BJ6A 4IX7A 2NVUB 2OBPA 2LJ2A 2CWEA 3GFMA 4A0ZA 1PNMA 3FX7A 5KHIA 2ZMEC 2W25A 2ZM6O 1FZBA 4HDVA 4NXNO 1EZVG 3BABA 4BWNA 3CCUV 2WSCJ 1LB2A 4EFBA 1MBFA 3R6SA 3KPHA 2WAQN 3OR6C 4M74A 1XNQO 3A8TA 5C3EJ 5IYBO 1J1DC 3E7LA 2V4DA 1E3HA 3DEEA 3JSNA 4YIOA 1X58A 1MABG 3BR5A 4N9IA 4FVMA 1Y67A 2B7EA 5D5UB 3LSIA 1Z67A 1N7SB 4G6DA 4PA7A 3KEYA 3EXAA 2HYJA 1QNTA 4M3GA 3BTLA 2GBOA 4B3RO 4XDKA 1H89C 5LA6A 4A3MJ 3H1HD 5AONA 2KSDA 1S29A 1M56C 1CSBA 1FMVA 5DYMA 5HS7A 4EJOA 2FXPA 5HLHA 2XKPA 3MVPA 3RYHA 1OZHA 3Q4HA 4I55A 2KL4A 1BDCA 4KUMA 1KILA 4RGXA 2E75C 1K83J 1GN4A 5B1AC 4RESB 3F7YC 1N73A 1MUUA 3OIPA 3RYIB 1P9QC 1OHHG 1SAXA 1V4RA 2WADA 5J1RA 1LUVA 2HLOA 2LY2A 1IN7A 2QIWA 2DWDC 4FLYA 3AG1B 3CWBE 4X1KA 4OPHA 1XREA 1PL0A 2V7FA 4CH3A 5GTIC 2KMUA 5E79E 5ILUA 2FB5A 2AHQA 1M56D 3EUHA 3L2VA 4BBSJ 3V2PA 5APYA 3L1PA 1SQQH 2KLUA 5M5XJ 1OCCH 4A5UB 5EC2C 4F91B 2YEVB 3OA7A 3B8NA 2E75D 1U5TA 1NTZD 4E2LA 4GOEA 2WLIA 3CS5A 1G1XB 2WWWA 2ZB9A 1XL4A 2M30A 4PD4I 1K4SA 4MTGA 1SQBD 2FMYA 2PJPA 2FBKA 4C3IJ 2AW9A 3FF5A 1D0YA 1SQVH 1MA1A 2W84A 3U0ZA 5HDKA 4FJCC 4B3SO 1Q43A 3J7YJ 1AI5A 2DQRA 4DV7B 5IYZA 5C8YB 3WTYC 5B3SH 5EDNA 5L8RJ 1W36D 1RSOA 2OYOA 3JC22 2ZNIA 1VQ6P 1S76D 4JI8O 4K3AA 1JHFA 3WB2A 4O2BA 4LF5B 1G1IA 2E74B 2Z99A 1FYMA 4UXNA 4GDFA 5K1XA 2NNNA 1J5EB 1S5LZ 3L2UA 3TEDA 1VQ9I 1IC8A 4OGQD 2W0FC 2W24A 1FMWA 2B9ZA 4M9SA 4P9UA 1NK2P 3BTJA 4FMTA 4IFFA 1VQMP 3SFIA 2WLMA 3TP3A 5E8IA 3LSGA 3FKJA 1MSEC 3K5NA 1BCCD 4P5OA 2YC0A 2ZINA 3I71A 4DJGA 2OU2A 1AVOA 3DTKA 3RVZA 1R73A 5AW0B 2LBFA 3CC2I 3LIDA 4DYRA 4G7OF 1TL8A 3DGEA 4RQFA 4ZDOA 1US6A 1KB9F 1ZR4A 2A6HF 4IL6H 3ERMA 4PCQA 2L01A 4HSTA 4AQYO 1VMGA 1D5YA 1WJCA 3E8FA 3D5LA 1BBYA 3SWFA 1EXJA 1QHGA 4AVZA 4ZIBA 1W0TA 2PLYA 1KTMA 1ZRCA 1YLFA 2L7KA 2OTLP 3BPVA 3I58A 3WU2Z 1M1JB 1R6RA 1W7PB 2E76C 4LJZF 1X2MA 3P9KA 2DMXA 3IHUA 1WI3A 3WU2E 1M9NA 3UNGC 1CQTA 4E7HA 3RWRD 2OCCC 1GK6A 3CC7P 1M90W 2OGUA 2W85A 1CF7A 1D8KA 4BJTA 1SZTA 5EG0B 4JZ2A 3CXHD 5KAIH 1R7JA 4JYBA 2QJKC 1YW9A 3OYGA 2O1KA 2XOKG 4D5FA 1U6GA 1L0NJ 1FOSE 3ZRWB 1HWYA 3CCVP 3ZCOA 2XZRA 5GONB 1VQPV 3V4QA 1RPOA 2E7WA 3AG7A 3MWMA 3REOA 4LF6B 1FFXA 2Y9ZA 4Q20A 4YJ3A 3ZQ7A 3OTOO 2WMMA 1L8DA 4TT3G 1GTOA 1RF0C 5KK1A 2ODMA 3CCQI 2M9HA 1LNWA 3JAMZ 2EFQA 4O2AA 4ZYDA 2E76D 1F36A 1ZTEA 1X8YA 4YHHO 1Z6RA 1GW3A 5B5EC 2YPRA 4C2UA 1N32O 5L3DA 1ETXA 1VQ5V 5AW2B 4AYBN 4KIFA 4B48A 2VBZA 2FYNC 1K92A 3VYSB 5KKZB 3HKZN 3KZIE 1URQC 3EUAA 2B5UA 3HKDA 2TCTA 1WP7A 3FM5A 2FRHA 1D5VA 4XN3A 3A01B 3KETA 3B6CA 2LFBA 1Y8RB 3O6QB 4F92B 4N0BA 2UUCB 1ZG5A 1VF5C 2LGWA 2F5VA 2JMWA 4BACA 1RR7A 4LNUB 3A5TA 4H44B 2QCOA 3HKEA 4WWIA 2WB1N 3E1SA 3VQXA 4DV3O 3COAC 4AUWA 4N21A 3MD0A 3S17J 3PLNA 4ZOLB 3L37A 4AU7A 1YJWI 1BGYG 4IHTA 1K9MQ 2WSEH 4G8XA 1RM1B 2Y31A 3CCEP 3L72H 1OR7C 2AEJA 1URQD 4J41A 2O03A 1VI0A 1ZARA 1T33A 4QE7A 2OCEA 4O4JA 5TJJA 3BZ6A 2MFZA 2X1DA 3ZBHA 1SVLA 1KQSU 4DYQA 1NKZB 3AG2H 1O9HA 1DGWY 3U10A 3H1LE 2XSDC 4HSRA 2KKOA 3G1LA 3BJAA 1NBMG 3ABUA 1SQQJ 3HPGA 1GM7A 5F6FA 2WAEA 3H0DA 5HOOA 1NTMJ 3OJAB 1I6HJ 2O01H 3CF5F 2DA5A 1YYCA 1DEEG 4Y52J 4D0PA 2JO1A 1IK7A 1MMMA 4EKWA 2WVRA 2IS2A 2K86A 2VBWA 1BE3H 1X1BA 3V6IA 3CX5H 3IAYA 1SQVJ 2KQRA 3VP8A 3ABMH 4X0GA 5JCOA 1MBKA 1WA8B 3BAAA 3G2BA 4ENJA 3BG5A 1N7SC 4NKGB 3AAFA 4PD4F 4PDKA 5FO5A 3PNVA 5ICGA 1HH0A 1VQNP 3LNMB 3S1KA 3F8CA 4PJ0H 3AG3H 1FZAA 3A0BE 2EQRA 3TDZC 2H7HA 1IO4A 3CP2A 4U3JB 1QHTA 2ZFUA 1SEUA 2ID6A 2QF7A 2R4GA 1EZVH 2YI9A 1PP9H 1WRJA 2P7JA 1MBHA 2CUEA 1Y56A 2B9BA 2N9BA 3FMSA 2PFBA 3K58A 2E5TA 2NPSB 1XTAA 4U3FG 1NTZK 2EZLA 1VQ4V 3RBZA 2L9VA 3TJTA 5KA6A 3BA8A 1TT5B 3OYNA 1SQBK 4LF6O 1D0XA 2WPSA 3ML6A 4YJ2B 1N7SD 1UIIA 3AG1C 2PZSA 3E6MA 4KISA 4JBAA 3DBLB 3GXOA 2ATKC 1SFXA 1J1EB 1QL2A 1FBQA 1ETOA 3SZTA 3T1BA 5APVA 1Y0NA 3GHGB 4FZ1A 1LWUB 2KB1A 1KYWA 1L0NE 4KHPO 3RCOA 3APOA 2V26A 2QA4P 2A06D 2Y0EA 1GL2B 5AIPA 2HDDA 2KZGA 1OV9A 4GGGA 3LQRA 2CJJA 1VQLV 3OEHG 3E8HA 1S9KE 3TXQA 2EULA 1YTZT 2HDWA 4MGRA 5KJ7A 4LH6A 4BQQA 1K33A 5IT9N 2P58A 2A79B 2ICWG 3S1NJ 4JI1O 3H1KD 2P6TA 3JTGA 5CA0A 2FYUD 1LTBC 5LEKA 5L3FA 4PZJA 1CI6A 5AW9B 2B87A 2H8RA 3ABLH 2JJ2G 3QYFA 1P84H 2ESHA 3O8GA 4QTRA 4DR3B 2OZ6A 1YITI 1FYKA 2R9AA 2E74C 1MH4A 2R7ZJ 1USTA 1X22A 3RYRA 1B8IA 1RIOH 3HSEA 1T39A 3MGNA 2RREA 3FX0A 1F5TA 5IJ0A 2WT7B 3T1HB 2M87A 1FOWA 3HG9A 1L0LK 3NFQA 1PUEE 3ABVC 4NC8A 3TGUH 3HC7A 1MMDA 2PYLA 3U1DA 4D7SA 4YY3O 1YBKA 2LKSA 1E3OC 3M7MX 3HEFA 3FXMA 1S72V 5J6XA 1K5SA 3CRCA 2HOAA 2XSJC 4DUYO 4HA8A 3AK2A 3H1HJ 4MS2A 4HNUA 4B44A 3HUGA 1TW3A 5E3NA 2R5ZA 3W7SA 2LXBA 2CUZA 2QM3A 3CUQA 1J5YA 2P4WA 1SC7A 5TRDA 3H9QA 1SQQE 5CB4B 2YX4A 4OWFA 3ONQA 1M1JC 2XTAA 1IFIA 1DPUA 1NTME 4FETA 4YRVA 4OIPF 2XROA 1R5LA 1H8AC 3WFVA 3ZGKA 1SRYA 4EJTA 5KHJA 2VKHA 3OE7G 1B04A 1YJ9V 2A9HA 5APQA 4CYCA 4ETSA 2FE3A 2Y0SA 4I98B 2CTQA 1GHCA 4I02A 4WBNB 3OIQA 4D6TJ 4TSFG 3WG9A 3ZEDA 4MO7A 1AV1A 4BW5A 1KB9D 1SQVE 3BA9A 2ZFCA 3K6GA 1TU3F 2E43A 2L3DA 1Y1WJ 4RUEA 1F9NA 4XE5B 3ZQIA 3G9RA 1FOKA 5J2TB 3KP3A 1ZW0A 4RGRA 1FP1D 2OV7A 3CCUP 1PGPA 1T6SA 2M3BA 3H3UA 1RE4C 1NTZJ 2WPDG 3AL0B 4HF0A 3JD2A 1BW6A 2IVMA 2VASA 1W7PD 2XGXA 1SQBJ 2X6OA 1JOCA 2PGDA 5HLTA 1LTJA 1YS6A 4LLLA 2QKAA 1XSXA 2CTWA 1T98A 5CVVA 4DUZO 2EFNA 1DPRA 3BDDA 3S93A 3DPTA 1P7JA 1D1CA 3NR7A 4HW0A 2A45I 1EDLA 1H2LA 1BE3J 5JQGB 5KLIB 3LSJA 3TL4X 3I5CA 4NTXA 1KQ9A 4XQFA 1SA0A 2B0LA 4QMAA 5KKZC 4WB4A 2A07F 1Z56A 2PN6A 1BS3A 3CJNA 1STZA 2XF5A 3C18A 3CMMA 3FBIB 3B5ND 4IHVA 3RZOJ 4TT3H 5M5WJ 4IL6Z 5KLVG 4U88A 5FKOA 4EFEA 2KB7P 4IIJA 3CMEV 2ZXWB 2HJFC 1H0TB 3K4LA 4H44C 2Q3EA 1KQFB 2ZDIC 2ITCC 3EFGA 2MGQA 2V9VA 4OIRF 1AP5A 1B4AA 5IYCJ 1R9TJ 1PP9J 2Y69B 2ZC2A 1BHBA 4K2EA 1JI8A 4PDRA 4JP0A 2L5QA 3JD0A 1KA8A 2R7VA 2DFHA 1IG7A 3N27A 1Y9BA 1RM1C 4D7MA 1ZAUA 4TV8B 3I56I 4A3KJ 1HNZB 1P7BA 2LSOA 1MSFC 4HYTB 2LNBA 4EM1A 5KAIZ 3J81Z 3FXRA 3DSQA 3KCXA 4XBFA 2FF4A 3HKCA 3MDSA 1R5GA 5KAFE 4HOBA 2MSYA 5KAIE 2EK5A 3M9AA 4AHCA 3JAKA 4I0BA 2GXAA 4ZTJA 2XASA 2P5OA 3R66A 1D3YA 1NI8A 1UJWB 4CS4A 4ZDPA 1L0LJ 3SJCC 3QU6A 5BMZA 1HXDA 4GKJO 4LGDE 1BI3A 1DGSA 1P4WA 4FLZA 3JCUE 3UQ8A 3F8BA 3FYIB 1X59A 3SHFA 1JA8A 2ZJSE 2V9PA 1H88C 3WG7H 2K5CA 2QKLB 2KZJA 2VT2A 1YZBA 3NTNA 2YIDA 1GK9A 2A3QA 2L4AA 3THOA 2AGAA 1WHUA 3L35A 2EJRA 1H2MA 4FFKA 1ZV8A 5AW6B 2YKOA 2ZQMA 4I0XA 3CCSV 1XSVA 5IYDJ 2IJIA 4X62O 5IY5B 4UCOA 1G3WA 1AQTA 3BG7A 5IT9K 2JA6J 2ZJQF 5JJEB 4A7PA 1IN8A 3T1YB 4DR1O 4I6ZA 2FU4A 4RAGA 4WK8F 4XR6A 2XB0X 2WA0A 1VQ8I 4OXSA 2VQCA 3Q0WA 4AQRD 4JI0B 3BCBA 1LJ9A 3HR0A 5LA6B 3L75D 4BUPA 2CK3G 1JY3O 2HZTA 4B8XA 5B1NA 1J9IA 1K9MW 3AE2C 1BW5A 5ITZA 1OYWA 4MVUA 3WTWC 2DMNA 2NPSC 3RYHB 3U9GA 4BR6A 3Q4HB 4I55B 3IV5A 1KZUB 2DA3A 1RFYA 4L0ZB 1KILB 2O1JA 5CHXA 2ZJPF 1N8RQ 3TGUJ 1N73B 3QOPA 3CO6C 4DR4B 1D7MA 1BCCG 4PD4D 2LP7A 2VLAA 3C8VA 4FLUA 2JKVA 2FYUK 5K5QA 2QJ1A 2FKWB 2IZ1A 3GHGC 3MN2A 2P7CB 2JEEA 3SJAC 4D6TE 1GT0C 1LWUC 1FAVA 4ZH4F 4X1KB 1KU3A 3EVKA 3LQQA 4X1YA 4IHSA 3LSUA 1TC3C 1PGQA 2M34A 5GW7A 5LP6A 3E5QA 3SSUA 1GL2C 3P3NA 2W0XA 3N05A 3AE7C 5IWAB 4IXAA 5DECA 3B77A 4L8JA 4KL1A 4PGGA 4BNCA 2RNBA 1J2JB 1BOAA 2EILH 3KCYA 3E8GA 2IS1A 3AE5C 1CW5A 1U5TB 5E3LA 4MSWC 2XRNA 2J5OA 1VQPP 3OYMA 3DPLC 2W57A 3ZCCA 2WLIB 1HJ0A 2F4VB 2DK5A 2O7OA 2DQLA 1N36B 2E5LB 1RQUA 5D5PA 1FP2A 4NDLA 4ON0A 4IF4A 1FDOA 1JMBA 3R0JA 3OR7C 2Q69A 1BE3E 2JTVA 5GTIE 3CX5E 2KT0A 3UCSC 3P7NA 2C6YA 5EBMC 3BHPA 3LSMA 2OTJP 4HQMA 1EH7A 3F23A 5IYZB 4HV6A 4PJ0Z 5DN6G 2V6EA 3A0HH 2HPIA 3HRNA 3L09A 1RSOB 3IKTA 2LQTA 2IXSA 2CRGA 1IFJA 3VSLA 1VQ5P 3IAS2 5KHGA 4PJ0E 3BP8A 1X1PA 3CCYA 2W6AA 3ZHSA 4O2BB 4RB1A 4Y7NJ 1Y4MA 3VMZA 1O7LA 2CUJA 4F6RA 4BWAA 1EZVE 1PP9E 1AI7A 4XLAA 1S77D 3DTEA 1ON2A 2JK5C 1BJZA 2DW3A 2W8ZA 1HGVA 3DKWA 4X65B 2K3PA 3N2KA 1NZ6A 3SFZA 3SXYA 1ENVA 1VEWA 2R7SA 3EYIA 4A2UA 1KYOH 3HTUA 1EH8A 2BEZF 5EZYA 2LBFB 1PVEA 1Y39A 3JRAA 4LLHA 3OW2O 4R6ZA 2JUCA 2SPZA 2QEXV 5M1BA 2P7VB 1WJBA 4NC6A 4CSWA 3KX2A 3FFQA 3IFMA 4BXFA 1N34O 2WLLA 2VXDA 3CPWU 2HGCA 1ZGJA 1SP4A 2DLLA 5EJCA 4DQ2A 2IGKA 2JJ1G 5LMUB 3IL2A 3G1MA 5CQEA 3TKYA 3KXDA 3UT5A 3L74D 4WXCA 1KQSO 2ARHA 3L73D 1I94O 2IJKA 1KP3A 5H2FC 1BQZA 2KDZA 4L18B 4NPFX 3CDLA 2R7TA 1ZWIC 3OYKA 3T1YO 1Y0UA 5L3CA 5APXA 3AE1C 1ZELA 3FMQA 2D3OW 3K4JA 3CO7C 5FB2A 1N0NA 2YI8A 4JGSA 1KUQA 5DS9A 1CF7B 3CCRV 2XRLA 1G3SA 2O57A 5CCGD 1M1KQ 1PL5A 1PGJA 4JX6A 2HPMA 2RMZA 1K8AQ 2HVQA 1ZLZA 1KU2A 5JJNB 2AXTZ 5BR8B 4FM1A 1P84E 3FHNA 3N2GA 1WFXA 5EZGA 1FFXB 2VQEO 3LL7A 5FLVA 3B02A 3AL0C 5LOVA 1M5IA 4YJ3B 2VQFO 3VYIA 3G6EV 2OF7A 4MT8A 4LFCO 5B66H 3ELKA 3B73A 4WF2A 1BC7C 4UCTA 4O2AB 4BE0A 4WBAA 1EM1A 1Q90D 3L7WA 4J7ZA 1XHZA 1RESA 2L2OA 3C1DA 2WLNA 5KLIC 2VUMJ 4LK0F 3A3YB 3SR2C 1BSNA 3CLOA 3TGUE 2MW2B 2A5YB 4I7HA 1E1RG 4A3EJ 3HPHA 4F7ZA 3RDIA 4XLPF 2DOEA 3CCLI 5H6RA 3G1OA 4UB8H 1K73Q 2HYNA 2KISA 2L7ZA 3V7CA 3HKDB 2V1UA 1XTCC 1XPXA 5DDGA 1VF9A 3DPUA 2LKMA 3O8ZA 3VFZA 1VQ4P 5CBOA 1JY3N 2ZXWC 1S5HC 4DV5O 3M06A 4L73A 4MVRA 4KFMA 2F4VO 1ULYA 1N77A 3D36C 1N36O 4DGWB 2D2CB 2PQ8A 3M07A 1MW7A 5CPRB 4KT0J 2Y69C 1WH5A 3HKEB 2F4IA 3OFNG 3HXLA 1ZN5A 1USDA 2M0BA 3OYAA 1POGA 2UUBO 4DK0A 1DEBA 3L36A 3Q9SA 2LF7A 2XT9A 1SC5B 1VQKI 2D1HA 2FD5A 1SQXJ 3STZC 1YTFB 3MEXA 3GYHX 4O4HA 5FD6A 2W1OA 1QNMA 1XUQA 1V54H 1QA6A 2Z4EA 1ZG3A 5KLVH 2NVTJ 4XIDA 2PAJA 3HSFA 1VQLP 2GUSA 2FXMA 3BASA 2LMDA 1MNEA 2L9NA 4O4JB 3E0JB 5IP7J 4DV2O 2A7WA 4I2LC 4B4CA 1BL0A 2BXYA 4X9QA 3IJ4A 1VL2A 2A06G 5D4RA 4NPEA 1U96A 3GG2A 4EJWA 1XC5A 1F4MA 5IOYA 3GTGJ 2LH9A 4U7DA 4UV8A 4MQVA 4MEYF 3QVNA 3OUFA 2WLHA 4U0YA 2QDOA 3EETA 3N4XA 2HI3A 1TW2A 1IVSA 2VKVA 2J58A 2Z5UA 1JVMA 5M3FJ 4AVPA 2FYUG 3H1KG 1U78A 1HA8A 5CN0A 3GEZA 2K9LA 1BI1A 3K70C 3ZHRA 1MNDA 3H1JJ 2YX7A 5IY5C 5LMUO 2KNCA 2V7QG 1E3PA 3K06A 1X3ZB 3M9HA 3BTIA 5J9PC 2X6BA 1DU6A 2DJNA 1FJLA 1FPOA 4C3HJ 1OKRA 5H5NA 1YHQI 3EPZA 3S15J 4EMSA 1F43A 1NU1H 1S72P 4ASVA 3JD3A 1S9HA 1KILC 2QVOA 5FFXA 4Z1MG 4Y28J 1N73C 3UR3C 1G6NA 2YIUB 3K70D 3D8CA 1ZSPA 4XKCA 3S14J 2VOOA 3LMMA 3SDLA 2M7WA 2JRIA 4PDVA 2ZR2A 4LWSA 3C2GA 1JXSA 2UWJE 1I7FA 3VYRB 5F0CA 1JE8A 4MEXF 5C39A 3I5DA 2CK3H 4G28B 1VQ6I 3MIWA 2DW4A 1FC3A 4N23A 3OYJA 5AW5B 3EUHC 2AHYA 1N7LA 1YJ9P 1QLNA 3B09A 3ML0A 3FXEA 1MJBA 2EIMB 3HHHA 1ZGWA 1HUCA 3EQ2A 3P8CD 4E7IA 1RPRA 1U5TC 1NH3A 1VQMI 5AG2A 4PV1B 3GUDA 2HNHA 1G1JA 2DA7A 3O8HA 3BJOA 3CUOA 3HTKA 2GSMB 4BXXJ 5BS6A 1L4AA 2C0XA 5CA0B 3RT3C 1FS0G 2IBZD 5E3OA 1AOYA 1CI6B 2XNXA 3SFDC 2ESNA 4IRHA 4LF4B 2B87B 2R32A 2ETHA 2K9JA 2VN2A 4DR6B 3CJQB 4E7JA 3PSFA 1ZUQA 3OMNB 4JI4B 4ANJA 2HVRA 2FOWA 4ZTFA 2CO5A 2CE4A 1NK3P 1B8IB 1N8RW 4CH6A 4MNUA 2EV5A 4Q48A 1EH6A 4LFBO 1ACIA 3M91A 4U7BA 5F64A 4EJUA 1MKMA 1I5YA 5IJ0B 1SQPD 3F9KA 5CKTA 1OW8A 5J8FA 1MNMC 2V1NA 1HWTC 3CMEP 4CDGA 1Y6XA 2QSFX 4TUYA 3CC7I 3CSXA 1D5NA 4QPJA 1SQXE 4I1LA 2K9YA 4I99C 3CEIA 4KITB 1NO4A 1S6LA 3FGAD 2QWOB 1WWXA 1X1AA 2W90A 1Q1VA 2Q7EA 5E79C 1KBHA 5DD8A 2STWA 4BDZA 4IEJA 1LQ1A 3T97A 3PH0A 4A93J 3CC2V 2UUZA 3HUGB 3L70H 2R5ZB 5TGTA 2JWAA 2KLOA 2F23A 1AVMA 2ZSHB 2R3CA 2OCCH 3CUQB 3GVAA 2WAFA 2H94A 1JKOC 1WVRA 2L54A 2PMUA 2QJYB 2KZVA 5KHHA 4DXWA 1BN5A 1O7FA 4ABZA 3SYTA 2XGEA 4IOCF 1BSMA 3ISPA 1ZLJA 1OX3A 5TISE 2YS9A 1AJNA 2NR5A 2NRAC 5GPAA 2HG5C 3CWBD 4J19A 4CYCB 3HOXJ 2ELKA 1JY2O 1PPJE 4LF7O 4PJLA 1WJAA 4A3CJ 1QRYA 3UKMA 4D7NA 4ASWA 3P32A 4N78E 1QVUA 1HSTA 3V7RA 1G4DA 3PO3J 3B4SA 3T4DA 1DIPA 4N6JA 3PIPF 1X4OA 4E7SA 4CHUA 4KXRA 3WTVC 2NVQJ 1NHLA 1XG1A 4UUTA 3A0HE 1UELB 1XNRB 5APWA 2AZ0A 2LYCA 2HP8A 1WB8A 2LF8A 1YX3A 3CCSP 5CCHA 2V79A 4N9HA 5LMNB 2P22C 2HZDA 5KA5A 2OPTA 1IK9A 4BIZA 1Z7UA 1LTJB 2QBYA 3GB7C 2E1CA 5CVUA 2I5UA 1LP1A 2XDVA 2RQPA 4XLHA 4IO9F 3NAUA 4GCZA 3B40A 2KRCA 3CCQV 3H5RA 2TRTA 1ETYA 2DOFA 4MVQA 2BHYA 4RKUJ 2RDCA 1KP2A 1J59A 4RB2C 3S16J 2X9DA 3J7ZI 2ZAEB 1SA0B 1PM9A 5J1YA 4Y4RA 2IM9A 5D6FA 4JI5B 2M6YA 3D3IA 4DR2B 1NVOA 1JCCA 1KYOE 4HQEA 2EB7A 3HB3B 1QQCA 5ICEA 3U11A 3S9OA 1MBJA 3HGYA 4L5JA 4N4NB 2D2CC 4IIJB 2KSEA 1GV2A 1VNDA 3L75G 3TO9A 3B8MA 3VOUA 2MYSA 1EZJA 1R23A 3BCCD 3ZHQA 2UXBO 4KNYA 2Y0IA 4WY4A 4IRGA 1NU1J 1OCCB 1GTWA 4JPRA 2PEXA 3IP4B 1LDDA 1PJRA 1T56A 3ERED 4BQNA 1SFCA 2RN0A 5HVQC 4M3BA 3WU2C 2CU7A 5C4JJ 1K5QA 2IT0A 3QTCA 1XD7A 1Z6TA 3KP7A 1K8AW 5D8KB 2YIBA 1ZLKA 1VQOV 1CZQA 1AWCA 2R93J 2IS6A 1LTTC 1YJWV 4ENMA 2QQ9A 1VQNI 3RL0B 3K7AJ 3HKCB 5JJJB 4JOMA 3UIAA 3C9IA 2VC0A 1FZPB 1IBMO 4N3YB 3JAKB 1U7JA 1EZVI 4HF1A 3STLC 5B3SB 2YKPA 1H8EG 4X88A 1GM8A 2WV1A 1GN6A 1JM0A 3SWKA 1A32A 4O4IA 4FLTA 2HQ5A 5DM6F 2ZJRF 5B66Z 1IRXA 4R50A 3K5LA 3E6BA 3M8EA 4RMNA 2GDSA 3E1RA 4BAYA 2LP0A 1EJ9A 3BTCA 2JSPA 5B66E 3SPJA 2GQQA 1IRFA 1K73W 2HYFA 1TLHB 2LG4A 2KHMA 5JCOC 2O8XA 1RY3A 1NH4A 4H0LB 5J4VA 3QP6A 3KZIC 4RGUA 2A06H 1LR1A 1GVJA 3K1NA 4I0XB 4DR5B 5ED4A 5D5WB 2QA4I 4UB8E 4YPCA 1IFNA 4A6DA 1JUNA 3BCAA 3BEHA 4IL6X 4ASNA 4JI3B 3T0YA 3QPTA 2DDBA 2VE9A 4QSHA 2E19A 3V8KA 3K0DA 5ITZB 3H1KH 2FYUH 1VDFA 1P4XA 3DKYA 1R3IC 3G3ZA 4JI2O 2QEXP 4ZNCA 3CPWO 4M6YA 3FIWA 5LHGA 4PA3A 2A6TA 4IZZA 2BCCH 2O0YA 1P84I 3AEBC 2JT1A 1WB7A 1NYHA 4L9VA 3JRIA 5AVXB 1K61A 4FLWA 5KLVE 2UXCB 4E4EA 1JPXA 2P2UA 4LD5A 3SDBA 1USEA 3GZ5A 2PTMA 3KIOA 4X1YB 4JTCB 1OCZH 5L3BA 4K0KB 2EIMC 3L70J 2DOAA 2KFDA 4KN4X 1YIJI 4Z1MH 1TVKA 3L74G 3BR6A 1Z0XA 3L73G 3CCRP 4OWRB 2KG7A 1QHHD 3II6A 4ZDLA 4PV1C 5HFLA 1OQYA 5KJ7C 1I6XA 2PI5A 3C3SA 3MKWB 1JMMA 2W6IG 1JY2N 4EV0A 1R3JC 2L0KA 4CS3A 1O4XA 2QWQB 2QM7A 3H32A 3BY6A 2P10A 1DUXC 2XHKA 2Y48A 3OUSA 4EATA 2P0WA 3G6EP 2WAQA 4ESBA 2ELJA 1IXBA 4PHZA 4L9TA 1MZBA 3H1LD 4K8XA 1RF1A 5LL6Y 3B6AA 5KHKA 1XMQB 4DCKA 3RYFA 3HOTA 2HKOA 3A0BC 1FD9A 2MH2A 2BYVE 2KIFA 1YITV 4PK4A 2YICA 5KJ7D 3BR0A 2LREA 1ZTRA 1ZQ3P 1X4PA 4WXDA 3WE2A 2F48A 4F6RB 4CZZA 1NU1E 3KYQA 1RKTA 2O3FA 1RETA 1KB9H 2IAIA 2YXHA 4PUSA 4DOZA 2A5WA 4BXLA 3APQA 4JQFA 2DYRH 1EC5A 4IT5A 4FFBA 4AWXB 2PF4E 2XU6A 1YRNA 2BVLA 3N2KB 1T2KA 2KK7A 1PYVA 1GKFA 3RPUD 1VTNC 4WFBV 5AVYB 3H0GJ 5EZYB 3WGHA 2JJ7A 3CCUI 4QPQA 2Z33A 5LBQA 3HOYJ 4LG0A 4RDUA 5FKLA 1S5LH 5FFZA 1H2GA 3PUFA 2KI7B 3BATA 2ZMEA 2WLLB 4OMZA 1MH3A 3KCCA 3AG2B 1YOVB 3CUQC 1OW7A 5CVRA 4AIKA 4HPQA 1ENHA 2JUGA 1OCOH 2QJYC 2B89A 3UT5B 4J7JA 2VI6A 2OARA 3AG4H 3LSQA 2MD5A 1PKXA 2BVMA 3H3ZA 5JWPA 3FHZA 4DO2A 2HHHO 5DM7F 3SPGA 3SYOA 1M8OB 3F5HA 1J75A 4ESJA 4CGZA 1GVDA 2XV4S 4MHGA 2QKCA 1ZP0C 2DWEC 2R9RB 1JUPA 3W6JB 1YQAA 3HOSA 1APLC 1L0ND 3VYTB 3ABMB 1JJ2U 1K4DC 1XN7A 3IF4A 2ZNZA 2LOOA 2R5YA 1X0TA 3OS2A 3CDHA 3V2QA 1Y47A 3PNTA 2JZYA 1LVAA 3GTMJ 3K79A 1TP4A 3N2GB 1QVGU 2QWPB 3DTUB 2CTRA 4H4KC 2HKXA 5CA1B 1R58A 5F08A 5LOVB 2PGGA 3AG3B 4XDJA 5H2FE 3G71V 2KRHA 3M8JA 3EYYA 2Q7HA 3NARA 1XOUA 5CBFA 1LTJC 2RQQA 4PJMA 2Q6AA 2QQBA 2M2EA 2FUG2 2QVAA 2X51A 4LK1F 2Q6QA 4LH7A 1IFMA 1KN7A 3CL3D 4NUBA 3T1CA 4DR7O 3GW6A 4ENKA 4LLNA 5K1PA 1TWAJ 1QLEB 4DRXA 3HJEA 1GXPA 2KZIA 4M6XA 2Y4TA 2Z5IA 1FOYA 2JSCA 2UXDB 5AW3B 1FBMA 1FIPA 2EH3A 1UHMA 3OY9A 2Q8VA 5BU5A 2Y0SN 3I55V 1HW7A 3UKGA 2LW1A 3L70E 3HKBA 4JYAB 1OCCC 1DDNA 1RR8C 3DBHB 2GA2A 1R6TA 2ZT9D 5BQTA 3ETEA 2XAHA 3ICXA 1XSDA 3Q3DA 1P2FA 2QG4A 1GK4A 1OVVA 2MK3A 4I2OA 1FBSA 3GWKC 4DW6A 2BCCJ 5EFWB 1W59A 4O4HB 3NEUA 2OYHA 1HNXO 4PA6A 3KP4A 3K9SA 2QUFA 4NYKA 3RL0C 3FAVA 2NS0A 3FWNA 4M3EA 3WUTA 3L75H 2K3RA 2RH0A 2HLDG 1TA8A 2UXXA 4JYYA 3KDPB 4LFUA 4J7KA 3ABLB 5B5EZ 2ITAA 2P81A 5B3SC 1UHSA 2EIKH 1P84F 3G4SI 1KU7A 1I5XA 2C0WA 1SQQD 2OD5A 2JRMA 3RJPA 1NTMD 4ZYEA 1IBLB 4PA9A 3HD7A 3E2EA 1JT6A 2IP2A 4C7RA 2K88A 2HTJA 2IGMA 1Z7LA 3M0AA 4P96A 3MP7B 3PP5A 1FZCA 1LFPA 4GZRB 3CWBJ 4GKKO 1TTYA 3PSIA 1AKHA 1E2XA 1N0JA 2XAJA 3GTJJ 3AK1A 3NXSA 1SQVD 4H0LC 1KZHA 2IBZG 2WA4A 1IRZA 3H5AA 3JALA 1IBKO 4CICA 1QX8A 1R1UA 2ME6A 2W00A 3MQ0A 5KUKA 1QPMA 2VJIA 4F52A 2KNCB 4D7TA 4TWKA 3HKZA 3P8MC 2K9MA 1JFFA 4E4HA 3CCMV 3OM3B 1R3KC 3RVYA 3S2WA 3KEQA 4IL6C 3PRJA 2IEKA 4LG3A 1NH2D 2GTAA 1KQGB 1RNLA 4JI6O 1KONA 1VQ8V 2ZR3A 1SQPG 2K4JA 4XONA 1IN5A 2QJPB 2Q1ZB 5EF6A 1T38A 2IGOA 4NXMB 3MHHC 1UCRA 3E6DA 1NTKH 5GTHH 4J80A 5F2VO 1HNWB 2X6AA 1ZGAA 3CC2P 1JHHA 1FTZA 4PA4A 4MW3A 3SZPA 5LRRA 5F0FA 3F8NA 3RYPA 4BBRJ 2X6WA 3R4YA 5KHDA 4PDMA 3OOPA 3OYHA 4UHTA 1VF6A 2XPUA 3CMAV 4LWSB 2OTJI 2EJ7A 3OYBA 1AA7A 2W27A 5KAIC 2HOSA 1WLEA 3E35A 2KP6A 2E1NA 4BEHA 1IW7F 2W6JG 1M7LA 2K40A 5LP6C 1SFOJ 5IYCO 4K35A 1U8BA 1IDSA 2IA2A 1AU7A 3GLMA 1XGNA 2KIUA 3S1MJ 3BRVB 3CJRB 5DEQA 1ON1A 2HEPA 1EN6A 1BA5A 5APSA 3JCUC 1JT0A 1IUYA 2LKPA 3TP0A 2AQFA 1DP3A 3G67A 1HF0A 3W2VA 4B1RA 3QRFF 1R1TA 1OCPA 3GTKJ 5IT9Z 2L7MP 1NG7A 3LNNA 1XI1A 1JUMA 3HTKB 3OL3A 1MFZA 1ZXGA 4P1WA 2ACJA 1K4TA 4X66O 1L4AB 5FKKA 2A45G 3HOZJ 1LT9A 2W48A 2Y9YA 3PNYA 2A06E 1CXZB 3JATA 2IGNA 3LDDA 2BGCA 5FRNA 4WFAV 1SVFA 2K9JB 1ZH5A 3QG5A 3L73H 2NYXA 1YI2I 5JI6A 3HYIA 3CCQP 2WZ7A 2Q8KA 3BZCA 4CH5A 5CVJA 1FJGO 2UU9O 4XNFA 2JS3A 2AXLA 4JV5B 1Q1HA 3B8EB 3FKIJ 1DLBA 3FX3A 3H1KE 2H1KA 1TT0A 5AVWB 3WTTC 4OIQF 6PAXA 1BR1A 4GT1A 1B6QA 3M7GA 5CLSA 1T5EA 5IYDO 1RUNA 1LTAC 3RBXA 3DU6A 4TUYB 3LAPA 5BZBA 3TO7A 3QOEA 4HNTA 2BCCE 1W5CC 5FKMA 2RC4A 2JS5A 2R7FA 4HLYA 1H9TA 3H9GA 2VE8A 1R1BA 2E34A 1YVWA 1R3LC 1QVFU 3BWGA 2N9YB 4R4LA 3H1CA 2CTPA 3OEEG 1GW4A 5K1YA 3L71J 3K4NA 1JY3P 1L0NK 2QSGX 3JRFA 2K85A 3QU3A 3J80N 4B3TB 2P8TA 4XA4A 2VODA 3Q1MA 2IYPA 5K7ZA 2QTOA 3T97B 3AG2C 3E22A 1ZL8A 3HTSB 2IS4A 4E7ZA 3EDPA 1VQOP 3BCCG 3WTSC 3K4MA 2F5CA 4LITA 2OT5A 1YJWP 1Z1DA 5F27A 4UB6H 1XDUA 4W4LA 3WE3A 1QBJA 4EIJA 2X1EA 3V4GA 3S3OA 5LRSA 3OAAG 3OYCA 4M9XA 2BY1A 4NPDA 1GM9A 4J10A 4JK1X 2MC4A 4EVIA 1FDIA 2G3AA 2ZNJA 2MG4A 4HZ3A 3HRUA 3WG7B 1IXRC 5AW1B 4XSXF 2EIJH 3FBNB 4D6TD 2HU9A 3ABMC 1SETA 2EX3A 1HR0O 1I39A 1N33B 2H89C 2UUAO 4X20A 2GM4A 1NAFA 1SFEA 5CA3A 3C3WA 2QKSA 3QP5A 4I01A 1RUOA 4BJ6C 1W0KG 2ILMA 4PJ0C 1OCRH 2WBMA 3TK1A 1EDIA 2QKMB 3AG3C 3EWKA 2DDAA 3JREA 5DUIA 1WN7A 5GAHJ 1R36A 2FQ4A 4PFOA 2QBYB 2JEXA 2FQ3A 1RP3B 4HEA2 2KYVA 1WJFA 1BE3D 3F0CA 1LP1B 4OX9O 2G38A 4GOFA 3ZQQA 3H1LJ 2L5GB 4DV4B 1F4KA 1BR2A 5JLWA 1QLEC 4KIGA 4KICA 1W2EA 5GPCA 3ZMTA 2NS8A 4P9FA 4DBQA 5K7HA 5DCMA 1RH5B 2Y2ZA 2ZFWA 4LFAB 1KECA 3CCLV 1JKPC 3GW2A 1FC2C 2CYYA 1S5LE 4RLFA 2WSSG 1HCRA 3M3YJ 1B6AA 1PP9D 1SQQK 4XFJA 4UY8I 4NVPA 5HS9A 1HOMA 4WY4B 1NTMK 2KJBA 3JRDA 4EQQA 3J7AU 5LGUA 1LE8A 2EILB 1EDKA 1K79A 1NTKJ 3SYPA 1SFCB 2E7XA 2W6BA 4KT6A 1WZ2A 1IJWC 4JF7A 3MCZA 3AEGC 2L4MA 4OH8B 4KFCA 4XRSG 1EV7A 1SQVK 2F95B 3PIOF 2FTKA 2W83C 1ZRTE 1VQKV 1YQ3C 4HNAA 4JZGA 1S7AA 3K10A 4FTHA 5DEDA 2I1KA 2H43A 2BE5F 3ABLC 1FJPA 1A04A 2V1XA 2FSWA 2OYIA 3FDYA 3KFWX 1S4XA 1SS3A 2CSOA 2Y30A 1L0LD 2Q0OA 4YXWG 2WAMA 2QM4A 4L9JA 3I59A 4WVZA 1HW5A 4G7ZF 2MW8A 2CGPA 4O4IB 1IZ3A 2EV0A 1B72A 2ISYA 1JB0J 3ZOBA 3ZDMA 1MMNA 2GXBA 4IOIH 2M4GA 4ZJZA 4GX1A 2K37A 1QGPA 4CCJA 5LGNA 2QZ8A 1YITP 4HDUA 3RTRA 4CCKA 2YS8A 1P84D 3GVMA 4P30A 4ZI7A 3QYBA 3UO3A 1ODDA 1U8RA