The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
47
|
sequence length |
143
|
structure length |
143
|
Chain Sequence |
b'SADQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYLSFLTEEEMLQAAHITAKLAQAAETD'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
YusO protein
|
| publication title |
X-ray crystal structure of YusO protein from Bacillus subtilis, a member of MarR transcriptional regulator family
rcsb |
| source organism |
Bacillus subtilis
|
| molecule tags |
Transcription
|
| total genus |
47
|
| structure length |
143
|
| sequence length |
143
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2004-01-13 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01047 | MarR | MarR family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant, subunit A | Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | ||
| Mainly Alpha | Orthogonal Bundle | Helix Hairpins | Helix Hairpins | ||
| Mainly Alpha | Up-down Bundle | Single alpha-helices involved in coiled-coils or other helix-helix interfaces | Immunoglobulin FC, subunit C |
