3F89A

Nemo cozi domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
EDLRQQLQQAEEALVAKQELIDKLKEEAEQHNIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NF-kappa-B essential modulator
publication title Specific recognition of linear ubiquitin chains by NEMO is important for NF-kappaB activation
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 27
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 3f89A00
3JSVC 2V4HA 3F89A 2ZVNB 4OWFA 2ZVOB 4BWNA 3FX0A
chains in the Genus database with same CATH superfamily
1QVFO 5AVRB 2NPSD 3WU2H 1PGJA 1T3JA 2P67A 4I7ZB 5B5EE 1LP1B 3D6ZA 3KYQA 3M9HA 2WPQA 5K5GB 3CCVP 4TT3H 2XKMA 2K9YA 1HWTC 3CI9A 1J1EC 5KJ7A 1S5LH 5KTBA 2FYNB 1MZ9A 1N7SA 5CBNA 1JO5A 1BCCJ 3PTZA 2P1JA 2K37A 2OTLP 5APTA 3L74D 5AW8B 1OVUA 2OYIC 4GOEA 4U3FJ 3H32B 1RE4A 1J2JB 2WVRA 3FXEA 3CX5D 1SQVD 4UB8H 4BXLA 1VQNP 1GL2D 2WSFH 1GD2E 4AUWA 3V4QA 1KYOI 3U59A 2E5TA 4LGDE 1XTGB 3V2QA 3A0HE 5KKZC 1W2EA 5CCGC 2B87A 2E74D 2Q1KA 2OGUA 2YMKA 2LXCB 1VF5D 1SQBG 5EFWB 5AVQB 2IFNA 3MTUE 1SFCB 2Q3EA 1NJIQ 2DW3A 1PIXA 2O1KA 3GMAA 2W90A 2Y0DA 4WY4B 4EOTA 2WSSH 4IL6X 2WT7A 2D2CD 3LIDA 1SQQG 5B5EH 4AYCA 3E1IA 2O01N 2WSFJ 3FXDA 2ZYAA 3H1KE 4ZKUA 2R5BA 2N9YB 1LTSC 1NTZE 1LTGC 3D71A 1SQPG 1CZQA 4BRYB 4JYCA 4PV1B 1LWUB 1LTTC 4WBAA 2YXRB 3H6PA 1T6AA 1OW6A 1OVVA 2FFDC 4PJ0E 1L4AA 2K9JB 1JB0J 2P2UA 2YMYA 2OYHB 1LTIC 3H1LJ 1SQBD 1Y8AA 2KI7B 1NTKG 1BCCG 3GW6A 3TYYA 4H0LC 2Q3IA 3UIAA 1L0NE 1Q90D 1GK4A 2G3AA 5TJHA 2QJKB 2IX7C 3A0HH 3HD7B 2I1KA 5B66E 2MJZA 1X8YA 4R4LA 4YPCA 2C0XA 5AW6B 4PD4D 1KILC 2R5DA 1RF0C 1K04A 1SQPD 3SSUA 1DEBA 5H2FE 4R4MA 2RMZA 1MKMA 1NGMB 1SS1A 1BSHA 1NTKD 1BCCD 1YITP 4AQRD 2WPRA 5AW1B 4ZNCA 3NXSA 2WZ7A 2ITAA 2KZIA 4ZKPA 4PJ0H 3C8VA 1L0LG 3TNUA 1J1EB 3AE9C 1CSBA 2J5UA 4GDOA 1JY3O 3CC2P 1Z56A 2NPSB 2ZXEB 3NFQA 2HFED 3ZDMA 1M1KQ 4DJGA 3RK3C 2OYIB 3H1KJ 1SQVE 4I1LA 5AW7B 2A06E 1NTZJ 5B66H 3CMAP 4YXDC 2QM8A 3MUDC 3CCMP 5KKZB 1U57A 3O6QB 2ZJSE 2E43A 1AVYA 1GU5A 2K88A 2HPCB 4B86A 1VQPP 5AW9B 5H2FH 2M5AA 4H44C 4C7NA 5E79H 1KFNA 1P84E 4H13D 4WWIA 1KQSO 3T97A 2WMMA 3MZWB 2PGDA 1GL2B 1NWQA 1L0NJ 1GZLA 3L72E 1L2PA 1S2EA 1N73A 3HUSC 3HE5B 3L70E 2FXOA 4I7ZC 1FZCC 2OQQA 2G8YA 4Z1MH 2FY8A 1NU1G 3D70A 1YJNP 3TDKA 2FFDB 1G2CB 1ZR2A 3KDPB 2KXPB 5APUA 4XA4A 4KHXA 1AVOA 3L71G 4GIFA 1S72P 5AW4B 2HYNA 3LW5H 1URQA 1SQBK 1Q86Q 1OWAA 4H0LB 5KLIC 2FYUK 3RK2D 4XFJA 1SQQE 2VRSA 2XZRA 3RBZA 2IBZG 1D7MA 1M1JC 1VQKP 1MFTA 1JY2N 1WT6A 1FS0E 2E5YA 3RL0g 1EXJA 5C39A 3HTKA 1KILB 1SQPE 3IN6A 1P84H 1ZV8A 5AVYB 3R2PA 1FZGA 3Q5PA 5BU5A 3H32A 1NU1D 1T2KD 1OFCX 2W83C 2P58A 4GT1A 1N86A 2AEMA 4DOJA 3KPEA 4D6TG 1SQVJ 1T3UA 3VP9A 3LW5J 3VMXA 1NTMG 3RBXA 1L0NG 1NTKE 2HLOA 3P8CD 3L71D 2ZVNB 1X79B 3BRTB 1EDJA 4CPGA 2IZ0A 4OWFA 2N1TD 3G3ZA 3B5ND 3H1KD 3SWYA 1SFCA 2V7QH 4N6JA 2IBZD 3CXHE 1YHQP 4PV1C 4WY4A 4BWNA 3P32A 3CL3D 2CPBA 5AVSB 3CWBG 3E1RA 3A2AA 1NKZB 2W27A 3M91A 4NPEA 1CW5A 1H8AA 2E42A 3H25A 1A02J 1EZVE 1HF9A 1R5SA 3L72J 5AVUB 3FWLA 3RK3B 3L70J 5AW2B 1IFPA 4D6TD 4BRYA 1LWUA 1VQOP 2SPZA 1NTMD 1L0ND 2B88A 2Z4EA 3B4SA 2K9JA 1NO4A 1YI2P 1PP9J 1EC5A 2V7QJ 2CK3H 3D6YA 5CCHD 1KQLA 1TU3F 1DD3A 5AW0B 1FC2C 4H44B 4K3AA 4L74A 1SVFA 4M3LA 2K3RA 1L0LE 5KJ7D 3V4WA 3CWBD 1N7SD 5CJ4A 1CI6B 3CCQP 2R32A 1SQQJ 2A06G 1VQ6P 4L73A 3F89A 4N3YB 3HUSB 3H1IG 2QG4A 3V5BA 4DT0A 1LNQA 3CXHH 3EWKA 3C9IA 1FZCB 2Y9ZA 1Q82Q 1SQPJ 2KP8A 1Q7YQ 5CCHA 3M9BA 2QRXA 5KJ7C 3GF7A 3V2RA 2YIUB 2LR2A 1LT1A 1IO4A 5CHXA 4JYBA 2E76D 1M90Q 2E75C 2LKMA 2RKLA 1JMBA 3MGNA 1LJ2A 3CCRP 4MN4C 2IYPA 3N7NA 1AV1A 1FJKA 1M57D 3S4RA 3V2PA 1N8RQ 1NOHA 1NTKJ 1RE4C 1IFJA 4OGQD 3CPWO 3L72G 1YTZI 2NPSC 1LTAC 1RF1C 4PD4I 3EQ2A 1NVOA 3L70G 5KLIB 2JDIH 4JQ0D 1M8OB 1LGHB 2A06D 3G6EP 1S9KD 1M1JB 2K1AA 3H1ID 3V2NA 4HJGH 1YBKA 1PP9G 1KORA 1FZEA 2L91A 3HE4B 4IL6E 1NU1E 2OYIA 1RY3A 1OZHA 4JPZB 1L4AD 1P84D 1IK9A 4IFFA 3E7KA 1FOSE 1FDIA 1GK6A 1GL2C 2Z5HA 3P8CE 3L71E 2ZVOB 3L72D 3IR9A 5CCGA 4Y99C 1AQTA 1XTCC 1FDMA 2HPCA 1OW8A 1OIPA 1IC2A 2E74C 1VF5C 2KB7P 3L70D 2KIKA 3BASA 3Q5SA 2Q5UA 2IBZE 2WTYA 4HH2A 1LTJA 1L0LJ 1JCDA 2BCCE 1K05A 3PLNA 1NTZK 1PP9D 1KMIZ 2D2CC 3AE7C 3L4FA 1G1JA 3H1HE 3AEDC 1ZOYC 3HE5A 1JCCA 2YKOA 2WPVB 2Y9YA 4D6TE 1PL5A 2H88C 1NTME 2XNDH 5DJTB 1JMMA 1SQQD 2FFDA 1VQ7P 3PP5A 1L0NK 1VQ8P 4TLFA 1A02F 3QH9A 3AE3C 4IL6H 1VQ4P 2WWWA 4LC1A 2JEEA 3MP7B 1EZVG 1FZAA 3MD0A 3PJSK 3CWBE 2KNCB 1KB9E 4I6MC 2FYZA 3OJAB 2LXBA 1NYHA 2IYOA 5E79E 2POHA 2KZJA 2ZAEB 1YJWP 4A7PA 1EQ7A 1RH5B 1BE3G 1FZFA 2Q7CA 1IK7A 1SQXG 2PAJA 1RE3C 2J59M 1HGVA 1KILA 1RF0A 1IFMA 5KLVG 2Y0EA 1LT9C 2FKWB 1GDTA 4JF7A 2JJLA 1H0TB 2Q9IA 1KQGB 1UIIA 1NU1J 2E75B 3G4SP 3CXHD 2NRGA 3L35A 4L76A 1T8ZA 2KS1A 1ZR4A 3L71J 4GODA 1VPCA 1EZVD 1KZUB 3GHGC 2JR8A 1JY3P 1RF1B 1VQLP 1HJBA 5APXA 1PPJG 3BCCE 2XU6A 1PGQA 2B87B 1S9KE 1BE3D 3H1IE 1SQVK 2BCCJ 1ZMEC 1DIPA 1FBMA 2AXTE 5KLVD 4K35A 2HG5D 3FWNA 3AE4C 1KB9H 3QWOC 3H1HJ 1BGYE 2ZT9D 2QIWA 3B8EB 2YO2A 5CBOA 1RQUA 1L0LD 4HKZH 3VMAA 2PRRA 3VOPA 4D6TJ 3JC22 3MUDA 1NTMJ 2WQYC 2IBZI 3HRNA 1FU1A 4I2LC 1URQD 2QJPB 4Y99B 5KAIE 3H1JG 2KLUA 2O3JA 2QVAA 1PPJD 2E74B 1VF5B 5AW3B 3AE1C 4W7YA 3AE6C 4H13C 1L4AB 2C9LY 2V4HA 2YIUC 4L75A 3CWBJ 4Y28J 1PP9E 1CI6A 1AQ5A 1BSNA 3GF3A 2YNYA 4WVZA 2D2CB 3L73E 2ZFCA 1QL2A 1ZRTD 2N9BA 2OTJP 1OMIA 2OARA 5TISE 1W5CE 4UB6E 1LP1A 5CMZA 3CLQA 1HGZA 1ZN5A 1KILE 1DEEG 3O8ZA 3KZIE 3K5BA 3G71P 2AXTH 3WUUA 3CC7P 3H1JD 3P7KA 3CD6P 4C7RA 1FAVA 1H89A 2BCCG 1SFCD 1SQQK 3B71A 4DZOA 1S3JA 1VQ9P 1JOCA 2R3CA 1PFIA 2WSEH 4WY4D 2L5GB 3WMM0 3H1HG 3BRVB 4RKUJ 3F5HA 2JP3A 2OYOA 3PH0A 3KQGA 4IOIH 1SQPK 1HJ0A 1X0TA 1JY3N 1OX3A 3RK2C 3BCCJ 5KAIH 1M1JA 3L37A 2A45H 1FZBA 4IFDK 2XDJA 3H1IJ 3RGUA 1JEKA 2QA4P 3M0DC 5KAFE 1S4XA 3OAKA 1NTKK 4EI2A 1LT9B 5GTIE 4HYTB 1BGYJ 2IDBA 3AE8C 1T2KC 1NKNA 2J58A 1KTMA 1WMKA 4ZMDA 1MUUA 2YKQA 2WSEJ 3RL0D 4OVNF 5L8RJ 2BCCD 3A3YB 1W2BO 5TISH 2BASA 3II6A 4UB6H 3SFDC 3H1HD 1GW3A 3GHGB 3AEGC 2N1TC 3B5NC 1BDDA 3KZIH 5APVA 2R3SA 2QEXP 2AEFA 3AECC 1BE3E 1P84I 1SQXE 3G9RA 1J1DC 2Q6QA 2PP6A 3NMDA 5KLVE 3M0AA 2OYHA 3FGAD 2JKVA 2JWDA 1KQFB 1K8AQ 3L73J 3IF4A 4EIJA 1S5LX 3NTNA 3T97B 1PZQA 2A45I 2W6AA 1KB9D 2B89A 2KK7A 3HD7A 5AW5B 1L0LK 3BCCG 5APSA 5KAFH 2FYUJ 3Q5RA 1PPJE 2AXCA 5CCHC 5GTIH 4DCKA 1QEXA 2XNXA 5AVTB 4H13B 1HTLC 2ZYGA 1BGYG 1N7SC 3S9OA 3MHVA 1ZRTE 1URQB 3L36A 3A0BE 2M3EA 3CCLP 3CCSP 1HUCA 3I5CA 1EDKA 5AVVB 1Q2NA 1EDLA 2A45G 1H0TA 1MV8A 2KSJA 1RQVA 3BCCD 3I56P 5CCGD 2E76C 3MIWA 3TGUG 3HTKB 3H1JE 4RESB 3PRJA 1QX8A 3L75E 3EFFK 2R44A 2NPSA 3U1AA 3P8MC 4OGQC 1RF1A 3L73G 2QJYC 2M0BA 1BGYD 4HB1A 1BDCA 1QGKB 2HR3A 3USSA 1USEA 1Y47A 3GG2A 3RK2B 3PHLA 1NAYA 1NU1K 1N2DC 1R5LA 3AEBC 2IZ1A 3CXHI 5AVZB 1BE3J 1SQXJ 2QJPC 3O6QA 1OVRA 1FJPA 4YXWH 2FYUG 3JSVC 3U1CA 5KLVJ 1JNMA 1LTJC 2CPSA 1VQMP 1EZVI 4ASWA 3TGUD 5APYA 2FXMA 1L4AC 2C9NY 1PGOA 1GL2A 5APQA 3A0BH 1HH0A 2RN0A 1YTZT 1YQ4C 4H0LD 3L73D 1N7LA 3VTPC 1IJDB 1K73Q 2N1TB 3B5NB 3JCUE 3W68A 4GKGA 2O01H 1M56D 1NHLA 2KYVA 3V6IA 3RL0B 1KILD 1E79H 2IFMA 1J1DB 1G2CA 1JTHB 2FYUD 2HODB 1NTMK 3N4XA 5APWA 4W80A 4GOFA 2BEZF 4IFMA 3CCEP 4U3FG 1MFZA 2RH0A 3Q3DA 2XV5A 1FDOA 4N78E 3OA7A 2B9BA 3AEEC 4JBZA 2H89C 3TK1A 2PFXA 1RHZB 1DD4A 3H1JJ 3I55P 2O01J 1KYOD 3L75J 1USDA 1IFDA 2O1JA 1IZNB 1AFOA 1N7SB 3VMZA 4OH8B 3VMYA 3SWKA 2OTKE 2P10A 3RK3D 4U3FD 3SWFA 4EDFA 3EFGA 1FE6A 1JY2O 1RE3A 3JCUH 3SFEC 5AVXB 1JY2P 1UIXA 1QL1A 1M7LA 1LT9A 2WITA 3A7OA 1AA0A 1IFIA 4XE5B 1R8EA 2UWJE 2I8DA 1OW7A 3BATA 1X22A 3M9QA 2E76B 1HBWA 3S1KA 3H1LG 3CCUP 2GUSA 3L74E 4H44D 1SQXD 3VYIA 3LIEA 2IPPA 1KD1Q 5AVWB 4KT0J 3CC4P 2P7JA 3CX5E 3GHGA 4OGQB 1WRGA 1G1IA 2QJYB 1OXZA 3Q1MA 2M3BA 1U7JA 5GTHE 2WT7B 1YYCA 1HVVA 5M1BA 1PV3A 2Z5IA 1N73C 3OW2O 1SLQA 2QSIA 3CCJP 4O9BA 1VDFA 2KSEA 2YXQB 1LTJB 3L75G 2FXPA 2ZT9C 3TGUE 3H1LD 3GLMA 3TF5A 3WUVA 1PGPA 2KOGA 3IAOA 1URQC 3HUSA 1E5WA 2GM4A 1FZCA 4YTPC 5DJUB 2QE7H 4RJTA 2YKPA 2FYNC 1SQBE 1KV4A 4NPDA 1GW4A 2GA1A 2H8PD 1KB9I 4NPFX 1IFNA 2FYUE 3CX5H 2W8ZA 2C0WA 4W7ZA 2FBWC 1SP4A 1KN7A 3L75D 4EYYQ 3H1KG 1NH4A 3BVHA 1JM0A 1DX7A 5GTHH 4U7JA 1ZLLA 1NTZG 1ZXGA 3AE5C 5BU8B 2WSCH 1VQ5P 4PD4E 1EXIA 3FX0A 4KJMA 1QVGO 2Y0CA 3L74J 3ABVC 5BVZA 1SFCC 2YO3A 1KYOE 2W6JH 4PV1D 3W67A 1YIJP 3CMEP 2KLVA 3HE4A 4WY4C 1AJYA 1GTWA 4ASVA 3TNUB 4C46A 1JUNA 3WUTA 1BCCE 2KS1B 3IFMA 2GUVA 3RK3E 4U3FE 1QLED 1Q81Q 1KFMA 4LLHA 1GU4A 1Y9BA 2I1JA 1YJ9P 2WSCJ 2H7HA 3WU2E 1NTZD 3M0DA 1LWUC 1ZW0A 1GMJA 3CX5I 3HD7D 3AEAC 2ZXXA 1S1CX 2W6BA 2QM7A 1VL2A 3TGUJ 5CJ0A 2OYHC 1YQ3C 2JWAA 1S5LE 3RL0C 1FOSF 2ZYDA 2M5AB 4C7NB 1K9MQ 4WB4A 3M06A 1SQXK 1KC8Q 2M8RA 2N1TA 2KUBA 3B5NA 2QJKC 5KLVK 3HD7C 4PD4H 4UB8E 1DH3A 3A5TA 2MKVA 2NZ2A 4N78D 3TSIA 1N73B 2JO1A 4RO0A 3Q2YA 1SQBJ 1JTHA 2HODA 1KYOH 3AE2C 4QMAA 3KHUA 3R4YA 1NAFA 3AEFC 3C1LA 1X9VA 3ITKA 3L74G 1U7MA 1ZP0C 2E75D 2AEJA 3KXDA 1EDIA 2H43A 2ZT9B 2WPSA 2KNCA 1SQVG 3VN0A 1H88A 3H1LE 1LTBC 2BEQD 3VP8A
chains in the Genus database with same CATH topology
3JSVC 2V4HA 3F89A 2ZVNB 4OWFA 2ZVOB 4BWNA 3FX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSV C;  2V4H A;  3F89 A;  2ZVN B;  4OWF A;  2ZVO B;  4BWN A;  3FX0 A; 
#chains in the Genus database with same CATH topology
 1QVF O;  5AVR B;  2NPS D;  3WU2 H;  1PGJ A;  1T3J A;  2P67 A;  4I7Z B;  5B5E E;  1LP1 B;  3D6Z A;  3KYQ A;  3M9H A;  2WPQ A;  5K5G B;  3CCV P;  4TT3 H;  2XKM A;  2K9Y A;  1HWT C;  3CI9 A;  1J1E C;  5KJ7 A;  1S5L H;  5KTB A;  2FYN B;  1MZ9 A;  1N7S A;  5CBN A;  1JO5 A;  1BCC J;  3PTZ A;  2P1J A;  2K37 A;  2OTL P;  5APT A;  3L74 D;  5AW8 B;  1OVU A;  2OYI C;  4GOE A;  4U3F J;  3H32 B;  1RE4 A;  1J2J B;  2WVR A;  3FXE A;  3CX5 D;  1SQV D;  4UB8 H;  4BXL A;  1VQN P;  1GL2 D;  2WSF H;  1GD2 E;  4AUW A;  3V4Q A;  1KYO I;  3U59 A;  2E5T A;  4LGD E;  1XTG B;  3V2Q A;  3A0H E;  5KKZ C;  1W2E A;  5CCG C;  2B87 A;  2E74 D;  2Q1K A;  2OGU A;  2YMK A;  2LXC B;  1VF5 D;  1SQB G;  5EFW B;  5AVQ B;  2IFN A;  3MTU E;  1SFC B;  2Q3E A;  1NJI Q;  2DW3 A;  1PIX A;  2O1K A;  3GMA A;  2W90 A;  2Y0D A;  4WY4 B;  4EOT A;  2WSS H;  4IL6 X;  2WT7 A;  2D2C D;  3LID A;  1SQQ G;  5B5E H;  4AYC A;  3E1I A;  2O01 N;  2WSF J;  3FXD A;  2ZYA A;  3H1K E;  4ZKU A;  2R5B A;  2N9Y B;  1LTS C;  1NTZ E;  1LTG C;  3D71 A;  1SQP G;  1CZQ A;  4BRY B;  4JYC A;  4PV1 B;  1LWU B;  1LTT C;  4WBA A;  2YXR B;  3H6P A;  1T6A A;  1OW6 A;  1OVV A;  2FFD C;  4PJ0 E;  1L4A A;  2K9J B;  1JB0 J;  2P2U A;  2YMY A;  2OYH B;  1LTI C;  3H1L J;  1SQB D;  1Y8A A;  2KI7 B;  1NTK G;  1BCC G;  3GW6 A;  3TYY A;  4H0L C;  2Q3I A;  3UIA A;  1L0N E;  1Q90 D;  1GK4 A;  2G3A A;  5TJH A;  2QJK B;  2IX7 C;  3A0H H;  3HD7 B;  2I1K A;  5B66 E;  2MJZ A;  1X8Y A;  4R4L A;  4YPC A;  2C0X A;  5AW6 B;  4PD4 D;  1KIL C;  2R5D A;  1RF0 C;  1K04 A;  1SQP D;  3SSU A;  1DEB A;  5H2F E;  4R4M A;  2RMZ A;  1MKM A;  1NGM B;  1SS1 A;  1BSH A;  1NTK D;  1BCC D;  1YIT P;  4AQR D;  2WPR A;  5AW1 B;  4ZNC A;  3NXS A;  2WZ7 A;  2ITA A;  2KZI A;  4ZKP A;  4PJ0 H;  3C8V A;  1L0L G;  3TNU A;  1J1E B;  3AE9 C;  1CSB A;  2J5U A;  4GDO A;  1JY3 O;  3CC2 P;  1Z56 A;  2NPS B;  2ZXE B;  3NFQ A;  2HFE D;  3ZDM A;  1M1K Q;  4DJG A;  3RK3 C;  2OYI B;  3H1K J;  1SQV E;  4I1L A;  5AW7 B;  2A06 E;  1NTZ J;  5B66 H;  3CMA P;  4YXD C;  2QM8 A;  3MUD C;  3CCM P;  5KKZ B;  1U57 A;  3O6Q B;  2ZJS E;  2E43 A;  1AVY A;  1GU5 A;  2K88 A;  2HPC B;  4B86 A;  1VQP P;  5AW9 B;  5H2F H;  2M5A A;  4H44 C;  4C7N A;  5E79 H;  1KFN A;  1P84 E;  4H13 D;  4WWI A;  1KQS O;  3T97 A;  2WMM A;  3MZW B;  2PGD A;  1GL2 B;  1NWQ A;  1L0N J;  1GZL A;  3L72 E;  1L2P A;  1S2E A;  1N73 A;  3HUS C;  3HE5 B;  3L70 E;  2FXO A;  4I7Z C;  1FZC C;  2OQQ A;  2G8Y A;  4Z1M H;  2FY8 A;  1NU1 G;  3D70 A;  1YJN P;  3TDK A;  2FFD B;  1G2C B;  1ZR2 A;  3KDP B;  2KXP B;  5APU A;  4XA4 A;  4KHX A;  1AVO A;  3L71 G;  4GIF A;  1S72 P;  5AW4 B;  2HYN A;  3LW5 H;  1URQ A;  1SQB K;  1Q86 Q;  1OWA A;  4H0L B;  5KLI C;  2FYU K;  3RK2 D;  4XFJ A;  1SQQ E;  2VRS A;  2XZR A;  3RBZ A;  2IBZ G;  1D7M A;  1M1J C;  1VQK P;  1MFT A;  1JY2 N;  1WT6 A;  1FS0 E;  2E5Y A;  3RL0 g;  1EXJ A;  5C39 A;  3HTK A;  1KIL B;  1SQP E;  3IN6 A;  1P84 H;  1ZV8 A;  5AVY B;  3R2P A;  1FZG A;  3Q5P A;  5BU5 A;  3H32 A;  1NU1 D;  1T2K D;  1OFC X;  2W83 C;  2P58 A;  4GT1 A;  1N86 A;  2AEM A;  4DOJ A;  3KPE A;  4D6T G;  1SQV J;  1T3U A;  3VP9 A;  3LW5 J;  3VMX A;  1NTM G;  3RBX A;  1L0N G;  1NTK E;  2HLO A;  3P8C D;  3L71 D;  2ZVN B;  1X79 B;  3BRT B;  1EDJ A;  4CPG A;  2IZ0 A;  4OWF A;  2N1T D;  3G3Z A;  3B5N D;  3H1K D;  3SWY A;  1SFC A;  2V7Q H;  4N6J A;  2IBZ D;  3CXH E;  1YHQ P;  4PV1 C;  4WY4 A;  4BWN A;  3P32 A;  3CL3 D;  2CPB A;  5AVS B;  3CWB G;  3E1R A;  3A2A A;  1NKZ B;  2W27 A;  3M91 A;  4NPE A;  1CW5 A;  1H8A A;  2E42 A;  3H25 A;  1A02 J;  1EZV E;  1HF9 A;  1R5S A;  3L72 J;  5AVU B;  3FWL A;  3RK3 B;  3L70 J;  5AW2 B;  1IFP A;  4D6T D;  4BRY A;  1LWU A;  1VQO P;  2SPZ A;  1NTM D;  1L0N D;  2B88 A;  2Z4E A;  3B4S A;  2K9J A;  1NO4 A;  1YI2 P;  1PP9 J;  1EC5 A;  2V7Q J;  2CK3 H;  3D6Y A;  5CCH D;  1KQL A;  1TU3 F;  1DD3 A;  5AW0 B;  1FC2 C;  4H44 B;  4K3A A;  4L74 A;  1SVF A;  4M3L A;  2K3R A;  1L0L E;  5KJ7 D;  3V4W A;  3CWB D;  1N7S D;  5CJ4 A;  1CI6 B;  3CCQ P;  2R32 A;  1SQQ J;  2A06 G;  1VQ6 P;  4L73 A;  3F89 A;  4N3Y B;  3HUS B;  3H1I G;  2QG4 A;  3V5B A;  4DT0 A;  1LNQ A;  3CXH H;  3EWK A;  3C9I A;  1FZC B;  2Y9Z A;  1Q82 Q;  1SQP J;  2KP8 A;  1Q7Y Q;  5CCH A;  3M9B A;  2QRX A;  5KJ7 C;  3GF7 A;  3V2R A;  2YIU B;  2LR2 A;  1LT1 A;  1IO4 A;  5CHX A;  4JYB A;  2E76 D;  1M90 Q;  2E75 C;  2LKM A;  2RKL A;  1JMB A;  3MGN A;  1LJ2 A;  3CCR P;  4MN4 C;  2IYP A;  3N7N A;  1AV1 A;  1FJK A;  1M57 D;  3S4R A;  3V2P A;  1N8R Q;  1NOH A;  1NTK J;  1RE4 C;  1IFJ A;  4OGQ D;  3CPW O;  3L72 G;  1YTZ I;  2NPS C;  1LTA C;  1RF1 C;  4PD4 I;  3EQ2 A;  1NVO A;  3L70 G;  5KLI B;  2JDI H;  4JQ0 D;  1M8O B;  1LGH B;  2A06 D;  3G6E P;  1S9K D;  1M1J B;  2K1A A;  3H1I D;  3V2N A;  4HJG H;  1YBK A;  1PP9 G;  1KOR A;  1FZE A;  2L91 A;  3HE4 B;  4IL6 E;  1NU1 E;  2OYI A;  1RY3 A;  1OZH A;  4JPZ B;  1L4A D;  1P84 D;  1IK9 A;  4IFF A;  3E7K A;  1FOS E;  1FDI A;  1GK6 A;  1GL2 C;  2Z5H A;  3P8C E;  3L71 E;  2ZVO B;  3L72 D;  3IR9 A;  5CCG A;  4Y99 C;  1AQT A;  1XTC C;  1FDM A;  2HPC A;  1OW8 A;  1OIP A;  1IC2 A;  2E74 C;  1VF5 C;  2KB7 P;  3L70 D;  2KIK A;  3BAS A;  3Q5S A;  2Q5U A;  2IBZ E;  2WTY A;  4HH2 A;  1LTJ A;  1L0L J;  1JCD A;  2BCC E;  1K05 A;  3PLN A;  1NTZ K;  1PP9 D;  1KMI Z;  2D2C C;  3AE7 C;  3L4F A;  1G1J A;  3H1H E;  3AED C;  1ZOY C;  3HE5 A;  1JCC A;  2YKO A;  2WPV B;  2Y9Y A;  4D6T E;  1PL5 A;  2H88 C;  1NTM E;  2XND H;  5DJT B;  1JMM A;  1SQQ D;  2FFD A;  1VQ7 P;  3PP5 A;  1L0N K;  1VQ8 P;  4TLF A;  1A02 F;  3QH9 A;  3AE3 C;  4IL6 H;  1VQ4 P;  2WWW A;  4LC1 A;  2JEE A;  3MP7 B;  1EZV G;  1FZA A;  3MD0 A;  3PJS K;  3CWB E;  2KNC B;  1KB9 E;  4I6M C;  2FYZ A;  3OJA B;  2LXB A;  1NYH A;  2IYO A;  5E79 E;  2POH A;  2KZJ A;  2ZAE B;  1YJW P;  4A7P A;  1EQ7 A;  1RH5 B;  1BE3 G;  1FZF A;  2Q7C A;  1IK7 A;  1SQX G;  2PAJ A;  1RE3 C;  2J59 M;  1HGV A;  1KIL A;  1RF0 A;  1IFM A;  5KLV G;  2Y0E A;  1LT9 C;  2FKW B;  1GDT A;  4JF7 A;  2JJL A;  1H0T B;  2Q9I A;  1KQG B;  1UII A;  1NU1 J;  2E75 B;  3G4S P;  3CXH D;  2NRG A;  3L35 A;  4L76 A;  1T8Z A;  2KS1 A;  1ZR4 A;  3L71 J;  4GOD A;  1VPC A;  1EZV D;  1KZU B;  3GHG C;  2JR8 A;  1JY3 P;  1RF1 B;  1VQL P;  1HJB A;  5APX A;  1PPJ G;  3BCC E;  2XU6 A;  1PGQ A;  2B87 B;  1S9K E;  1BE3 D;  3H1I E;  1SQV K;  2BCC J;  1ZME C;  1DIP A;  1FBM A;  2AXT E;  5KLV D;  4K35 A;  2HG5 D;  3FWN A;  3AE4 C;  1KB9 H;  3QWO C;  3H1H J;  1BGY E;  2ZT9 D;  2QIW A;  3B8E B;  2YO2 A;  5CBO A;  1RQU A;  1L0L D;  4HKZ H;  3VMA A;  2PRR A;  3VOP A;  4D6T J;  3JC2 2;  3MUD A;  1NTM J;  2WQY C;  2IBZ I;  3HRN A;  1FU1 A;  4I2L C;  1URQ D;  2QJP B;  4Y99 B;  5KAI E;  3H1J G;  2KLU A;  2O3J A;  2QVA A;  1PPJ D;  2E74 B;  1VF5 B;  5AW3 B;  3AE1 C;  4W7Y A;  3AE6 C;  4H13 C;  1L4A B;  2C9L Y;  2V4H A;  2YIU C;  4L75 A;  3CWB J;  4Y28 J;  1PP9 E;  1CI6 A;  1AQ5 A;  1BSN A;  3GF3 A;  2YNY A;  4WVZ A;  2D2C B;  3L73 E;  2ZFC A;  1QL2 A;  1ZRT D;  2N9B A;  2OTJ P;  1OMI A;  2OAR A;  5TIS E;  1W5C E;  4UB6 E;  1LP1 A;  5CMZ A;  3CLQ A;  1HGZ A;  1ZN5 A;  1KIL E;  1DEE G;  3O8Z A;  3KZI E;  3K5B A;  3G71 P;  2AXT H;  3WUU A;  3CC7 P;  3H1J D;  3P7K A;  3CD6 P;  4C7R A;  1FAV A;  1H89 A;  2BCC G;  1SFC D;  1SQQ K;  3B71 A;  4DZO A;  1S3J A;  1VQ9 P;  1JOC A;  2R3C A;  1PFI A;  2WSE H;  4WY4 D;  2L5G B;  3WMM 0;  3H1H G;  3BRV B;  4RKU J;  3F5H A;  2JP3 A;  2OYO A;  3PH0 A;  3KQG A;  4IOI H;  1SQP K;  1HJ0 A;  1X0T A;  1JY3 N;  1OX3 A;  3RK2 C;  3BCC J;  5KAI H;  1M1J A;  3L37 A;  2A45 H;  1FZB A;  4IFD K;  2XDJ A;  3H1I J;  3RGU A;  1JEK A;  2QA4 P;  3M0D C;  5KAF E;  1S4X A;  3OAK A;  1NTK K;  4EI2 A;  1LT9 B;  5GTI E;  4HYT B;  1BGY J;  2IDB A;  3AE8 C;  1T2K C;  1NKN A;  2J58 A;  1KTM A;  1WMK A;  4ZMD A;  1MUU A;  2YKQ A;  2WSE J;  3RL0 D;  4OVN F;  5L8R J;  2BCC D;  3A3Y B;  1W2B O;  5TIS H;  2BAS A;  3II6 A;  4UB6 H;  3SFD C;  3H1H D;  1GW3 A;  3GHG B;  3AEG C;  2N1T C;  3B5N C;  1BDD A;  3KZI H;  5APV A;  2R3S A;  2QEX P;  2AEF A;  3AEC C;  1BE3 E;  1P84 I;  1SQX E;  3G9R A;  1J1D C;  2Q6Q A;  2PP6 A;  3NMD A;  5KLV E;  3M0A A;  2OYH A;  3FGA D;  2JKV A;  2JWD A;  1KQF B;  1K8A Q;  3L73 J;  3IF4 A;  4EIJ A;  1S5L X;  3NTN A;  3T97 B;  1PZQ A;  2A45 I;  2W6A A;  1KB9 D;  2B89 A;  2KK7 A;  3HD7 A;  5AW5 B;  1L0L K;  3BCC G;  5APS A;  5KAF H;  2FYU J;  3Q5R A;  1PPJ E;  2AXC A;  5CCH C;  5GTI H;  4DCK A;  1QEX A;  2XNX A;  5AVT B;  4H13 B;  1HTL C;  2ZYG A;  1BGY G;  1N7S C;  3S9O A;  3MHV A;  1ZRT E;  1URQ B;  3L36 A;  3A0B E;  2M3E A;  3CCL P;  3CCS P;  1HUC A;  3I5C A;  1EDK A;  5AVV B;  1Q2N A;  1EDL A;  2A45 G;  1H0T A;  1MV8 A;  2KSJ A;  1RQV A;  3BCC D;  3I56 P;  5CCG D;  2E76 C;  3MIW A;  3TGU G;  3HTK B;  3H1J E;  4RES B;  3PRJ A;  1QX8 A;  3L75 E;  3EFF K;  2R44 A;  2NPS A;  3U1A A;  3P8M C;  4OGQ C;  1RF1 A;  3L73 G;  2QJY C;  2M0B A;  1BGY D;  4HB1 A;  1BDC A;  1QGK B;  2HR3 A;  3USS A;  1USE A;  1Y47 A;  3GG2 A;  3RK2 B;  3PHL A;  1NAY A;  1NU1 K;  1N2D C;  1R5L A;  3AEB C;  2IZ1 A;  3CXH I;  5AVZ B;  1BE3 J;  1SQX J;  2QJP C;  3O6Q A;  1OVR A;  1FJP A;  4YXW H;  2FYU G;  3JSV C;  3U1C A;  5KLV J;  1JNM A;  1LTJ C;  2CPS A;  1VQM P;  1EZV I;  4ASW A;  3TGU D;  5APY A;  2FXM A;  1L4A C;  2C9N Y;  1PGO A;  1GL2 A;  5APQ A;  3A0B H;  1HH0 A;  2RN0 A;  1YTZ T;  1YQ4 C;  4H0L D;  3L73 D;  1N7L A;  3VTP C;  1IJD B;  1K73 Q;  2N1T B;  3B5N B;  3JCU E;  3W68 A;  4GKG A;  2O01 H;  1M56 D;  1NHL A;  2KYV A;  3V6I A;  3RL0 B;  1KIL D;  1E79 H;  2IFM A;  1J1D B;  1G2C A;  1JTH B;  2FYU D;  2HOD B;  1NTM K;  3N4X A;  5APW A;  4W80 A;  4GOF A;  2BEZ F;  4IFM A;  3CCE P;  4U3F G;  1MFZ A;  2RH0 A;  3Q3D A;  2XV5 A;  1FDO A;  4N78 E;  3OA7 A;  2B9B A;  3AEE C;  4JBZ A;  2H89 C;  3TK1 A;  2PFX A;  1RHZ B;  1DD4 A;  3H1J J;  3I55 P;  2O01 J;  1KYO D;  3L75 J;  1USD A;  1IFD A;  2O1J A;  1IZN B;  1AFO A;  1N7S B;  3VMZ A;  4OH8 B;  3VMY A;  3SWK A;  2OTK E;  2P10 A;  3RK3 D;  4U3F D;  3SWF A;  4EDF A;  3EFG A;  1FE6 A;  1JY2 O;  1RE3 A;  3JCU H;  3SFE C;  5AVX B;  1JY2 P;  1UIX A;  1QL1 A;  1M7L A;  1LT9 A;  2WIT A;  3A7O A;  1AA0 A;  1IFI A;  4XE5 B;  1R8E A;  2UWJ E;  2I8D A;  1OW7 A;  3BAT A;  1X22 A;  3M9Q A;  2E76 B;  1HBW A;  3S1K A;  3H1L G;  3CCU P;  2GUS A;  3L74 E;  4H44 D;  1SQX D;  3VYI A;  3LIE A;  2IPP A;  1KD1 Q;  5AVW B;  4KT0 J;  3CC4 P;  2P7J A;  3CX5 E;  3GHG A;  4OGQ B;  1WRG A;  1G1I A;  2QJY B;  1OXZ A;  3Q1M A;  2M3B A;  1U7J A;  5GTH E;  2WT7 B;  1YYC A;  1HVV A;  5M1B A;  1PV3 A;  2Z5I A;  1N73 C;  3OW2 O;  1SLQ A;  2QSI A;  3CCJ P;  4O9B A;  1VDF A;  2KSE A;  2YXQ B;  1LTJ B;  3L75 G;  2FXP A;  2ZT9 C;  3TGU E;  3H1L D;  3GLM A;  3TF5 A;  3WUV A;  1PGP A;  2KOG A;  3IAO A;  1URQ C;  3HUS A;  1E5W A;  2GM4 A;  1FZC A;  4YTP C;  5DJU B;  2QE7 H;  4RJT A;  2YKP A;  2FYN C;  1SQB E;  1KV4 A;  4NPD A;  1GW4 A;  2GA1 A;  2H8P D;  1KB9 I;  4NPF X;  1IFN A;  2FYU E;  3CX5 H;  2W8Z A;  2C0W A;  4W7Z A;  2FBW C;  1SP4 A;  1KN7 A;  3L75 D;  4EYY Q;  3H1K G;  1NH4 A;  3BVH A;  1JM0 A;  1DX7 A;  5GTH H;  4U7J A;  1ZLL A;  1NTZ G;  1ZXG A;  3AE5 C;  5BU8 B;  2WSC H;  1VQ5 P;  4PD4 E;  1EXI A;  3FX0 A;  4KJM A;  1QVG O;  2Y0C A;  3L74 J;  3ABV C;  5BVZ A;  1SFC C;  2YO3 A;  1KYO E;  2W6J H;  4PV1 D;  3W67 A;  1YIJ P;  3CME P;  2KLV A;  3HE4 A;  4WY4 C;  1AJY A;  1GTW A;  4ASV A;  3TNU B;  4C46 A;  1JUN A;  3WUT A;  1BCC E;  2KS1 B;  3IFM A;  2GUV A;  3RK3 E;  4U3F E;  1QLE D;  1Q81 Q;  1KFM A;  4LLH A;  1GU4 A;  1Y9B A;  2I1J A;  1YJ9 P;  2WSC J;  2H7H A;  3WU2 E;  1NTZ D;  3M0D A;  1LWU C;  1ZW0 A;  1GMJ A;  3CX5 I;  3HD7 D;  3AEA C;  2ZXX A;  1S1C X;  2W6B A;  2QM7 A;  1VL2 A;  3TGU J;  5CJ0 A;  2OYH C;  1YQ3 C;  2JWA A;  1S5L E;  3RL0 C;  1FOS F;  2ZYD A;  2M5A B;  4C7N B;  1K9M Q;  4WB4 A;  3M06 A;  1SQX K;  1KC8 Q;  2M8R A;  2N1T A;  2KUB A;  3B5N A;  2QJK C;  5KLV K;  3HD7 C;  4PD4 H;  4UB8 E;  1DH3 A;  3A5T A;  2MKV A;  2NZ2 A;  4N78 D;  3TSI A;  1N73 B;  2JO1 A;  4RO0 A;  3Q2Y A;  1SQB J;  1JTH A;  2HOD A;  1KYO H;  3AE2 C;  4QMA A;  3KHU A;  3R4Y A;  1NAF A;  3AEF C;  3C1L A;  1X9V A;  3ITK A;  3L74 G;  1U7M A;  1ZP0 C;  2E75 D;  2AEJ A;  3KXD A;  1EDI A;  2H43 A;  2ZT9 B;  2WPS A;  2KNC A;  1SQV G;  3VN0 A;  1H88 A;  3H1L E;  1LTB C;  2BEQ D;  3VP8 A; 
#chains in the Genus database with same CATH homology
 3JSV C;  2V4H A;  3F89 A;  2ZVN B;  4OWF A;  2ZVO B;  4BWN A;  3FX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...