3F89A

Nemo cozi domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
b'EDLRQQLQQAEEALVAKQELIDKLKEEAEQHNIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NF-kappa-B essential modulator
molecule tags Transcription
source organism Mus musculus
publication title Specific recognition of linear ubiquitin chains by NEMO is important for NF-kappaB activation
pubmed doi rcsb
total genus 27
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 3f89A00
2V4HA 3F89A 2ZVOB 3FX0A 3JSVC 4OWFA 4BWNA 2ZVNB
chains in the Genus database with same CATH superfamily
1X22A 2BCCD 2ZXXA 4WBAA 1X0TA 3CWBE 3H1IE 4GODA 1QVGO 2CPSA 1EC5A 1ZRTD 2HPCA 5AVZB 5GTHE 2H8PD 3OA7A 3C8VA 3H1LG 1KB9E 1SQVK 2JO1A 2P10A 3H1JE 2P2UA 3AEFC 3RK3D 3V2QA 2YKPA 2R5BA 3W68A 1JMBA 1JEKA 2FFDB 3FGAD 3A0BH 3P32A 5APQA 5KLIC 3BRVB 2WSCH 1G2CB 1RY3A 2ZYAA 3RL0g 5APVA 1N7LA 1VQ5P 2UWJE 3PLNA 3PTZA 2A45H 2K1AA 2XDJA 1OW8A 1QLED 2KZIA 3WU2H 1HJ0A 1N7SA 1SQVE 2Y0EA 4Z1MH 3TF5A 4EOTA 2B88A 1S72P 3CMAP 3VTPC 2NRGA 3G6EP 1JB0J 2AXTE 2FYUK 4LC1A 1YYCA 3AE6C 3BATA 3H1JJ 3AECC 3NMDA 4UB8H 1H8AA 3CCLP 1NOHA 1RF0C 3L74E 3L73E 4IFMA 5EFWB 1KFMA 2QJPC 1JNMA 1JY3N 4H13D 5AW5B 1NO4A 3D6ZA 1OW6A 2O1JA 4WY4C 1T2KC 4AUWA 1UIXA 3RK3B 2KSJA 5APWA 4BXLA 5B5EE 1FZCA 2E74C 3BASA 1NAFA 3NFQA 5AVYB 3SWKA 1H0TA 2HODA 5CJ0A 2Q3IA 2LXBA 5KKZC 4IFFA 5AW3B 1M8OB 4H13C 3V2RA 1N7SD 1MZ9A 1SQBK 1AQ5A 2FYNC 3L70D 2ITAA 1LTJC 1LTTC 1AA0A 2AXCA 3KXDA 2K88A 3B71A 1FZFA 1NAYA 1EXIA 3VMYA 2IFMA 2OYIA 2M5AB 3IFMA 4D6TJ 2KNCB 4GIFA 3TNUA 1M56D 4I6MC 1P84E 2JWAA 4R4LA 3RK2C 2WT7A 1IO4A 2YKQA 1CZQA 1IFIA 3AEAC 3FXEA 3PH0A 2XKMA 3HTKB 5AVUB 2RH0A 4OGQB 2ZVOB 1VQ6P 1G2CA 3CX5H 3HRNA 1IK7A 1U57A 1PIXA 1SQVD 1OXZA 3L73G 1ZP0C 4H0LD 4ASVA 5GTIH 3A2AA 1NHLA 1RE4C 3E7KA 1RF0A 4L75A 1BCCJ 1OW7A 5AVWB 4DT0A 3Q5PA 1H0TB 2K9YA 1M1JB 4KT0J 5CMZA 3G3ZA 1ZLLA 2ZJSE 2E42A 3L71G 1ZXGA 1N8RQ 1Q90D 2Q1KA 3L70G 4I2LC 4K35A 3BCCE 2QE7H 2MKVA 1FDOA 3AEDC 4PD4D 1L2PA 3RK3E 2YNYA 1URQB 1EDKA 4ZKUA 1KB9D 2FYNB 3II6A 5KLVE 1PP9D 3PRJA 1NTMJ 3N4XA 3NXSA 1FZEA 2VRSA 1ZRTE 1BCCE 1RF1A 5APSA 3FXDA 3RBZA 2E5YA 2BCCE 3AEGC 2E76C 2NPSD 3V4QA 2OTLP 1HGZA 1K73Q 2H88C 2QRXA 3AE9C 1RQVA 1AV1A 1NH4A 5AVRB 3T97A 3N7NA 3CWBG 1KFNA 1KYOE 3H1IG 4DOJA 1K9MQ 1SS1A 1NVOA 4JQ0D 2QEXP 2N9YB 1SP4A 5KTBA 1PZQA 3HE5B 2QA4P 2FYUJ 2O1KA 2P7JA 4RESB 1N2DC 1KILD 1NTME 2BCCG 2ZYGA 3GG2A 5KLVJ 3CD6P 2GA1A 3JC22 2K9JB 2WSSH 4YTPC 3AE5C 3PJSK 3RL0C 3S9OA 1BE3J 1GMJA 2OARA 2M3BA 4LGDE 1S4XA 2Z5HA 2A45I 2WSCJ 2KUBA 1L0LG 2Q9IA 2O3JA 2J5UA 1NTKJ 1YTZT 3NTNA 5H2FH 2KNCA 2R3CA 4OGQC 5CCGA 4OH8B 3BRTB 3FWLA 2IBZG 3TNUB 2Z4EA 2D2CD 2WT7B 1YIJP 1PPJE 1GDTA 5AVTB 4BWNA 5CCHD 3BCCD 1BCCG 1OFCX 4R4MA 3L75J 2W27A 1FAVA 1ZN5A 2WVRA 1W5CE 2IBZI 2LKMA 2YMYA 1L0NE 1LTJA 1MFZA 2QSIA 1IJDB 3FX0A 3IF4A 3L73J 3P8CD 1KILA 2AEJA 1IFJA 2W90A 1OMIA 2KLVA 5CBNA 1R5LA 2P58A 4QMAA 2A45G 3Q3DA 3CMEP 2OTJP 5KJ7A 3VP9A 1AVYA 1FZCC 5KAFE 2R5DA 1P84H 4D6TG 1EDLA 2HR3A 3CCRP 4HYTB 1KQFB 1SQXK 2YO2A 2B89A 2O01H 1RHZB 2KS1A 1L0LK 1IFNA 2ZT9C 2BASA 5AW1B 5GTIE 1VQLP 4D6TE 2RKLA 2YKOA 3O8ZA 2FFDC 2HYNA 3TSIA 3MD0A 1N7SB 2IBZE 5APUA 2N1TB 1LGHB 2IYPA 3HUSB 2FY8A 2G8YA 1N7SC 2YXQB 3V4WA 1X9VA 1S5LH 3VN0A 2JR8A 1SQVJ 4N78D 2E75C 1LTAC 3KHUA 5KLVK 3RBXA 4JBZA 1Q81Q 1G1IA 1JTHB 1URQC 1SQBJ 2HFED 1FOSE 1AFOA 2K9JA 1NU1E 4IFDK 1E79H 1PV3A 3K5BA 4ASWA 3MHVA 4D6TD 2POHA 3C1LA 1YJWP 1CSBA 1JY3P 3B5NC 3L73D 3BCCG 2QJYC 1FE6A 4C46A 1YQ3C 3TYYA 1KD1Q 1YTZI 4HH2A 1FDMA 2IPPA 1GK6A 3I55P 2OYHC 3T97B 1HBWA 1YBKA 2AEMA 5AW7B 1T3JA 1YJ9P 1H89A 1E5WA 3SWFA 1JCCA 3LIDA 2E74B 1NTMK 2O01N 3U1CA 5AW2B 1LT9B 3UIAA 1NTZG 3H1JD 2I1JA 2JDIH 3H1LJ 1GL2A 1RE3A 2QJYB 3TGUJ 2J59M 3OW2O 3TGUD 1S5LX 4WY4A 1SQQJ 2Y9YA 3RL0B 1IZNB 2NPSC 2KLUA 1VQPP 2WSFH 4LLHA 1KQSO 1DX7A 1OX3A 4DZOA 2N1TC 1OWAA 2FXMA 1ZV8A 2O01J 3KDPB 1SQPJ 1SQPK 3L72G 3M91A 5H2FE 5DJTB 3RK3C 3L74J 1NTMG 4PJ0E 1EZVG 3R2PA 1BSHA 3CWBD 2PP6A 3H1ID 1FU1A 2XNDH 1QGKB 3A3YB 2H43A 1PGJA 1S2EA 2N9BA 2AEFA 1R5SA 1VL2A 3L70J 2IX7C 3H1HE 3ZDMA 1J1EB 4C7RA 1OVVA 1QVFO 4PV1D 1JCDA 2FXOA 4C7NA 1PL5A 1SFCD 1BSNA 1SQPG 4RKUJ 3CX5E 1JY2P 1LWUA 2Q6QA 3M0AA 5CHXA 3VMAA 4EIJA 2P67A 3H1KE 4H44D 1FJPA 5KAFH 3P8MC 1DIPA 1KYOD 5CBOA 1SQBE 1BE3D 1KZUB 1SQXE 3A0HE 3AE4C 1EZVI 2DW3A 3L72E 5L8RJ 1NKZB 5M1BA 3USSA 5BU8B 3H1HJ 4YXDC 1VQMP 3CXHE 2B9BA 3IR9A 3PHLA 1IFDA 2P1JA 2W83C 1EXJA 1GL2C 1EZVD 2G3AA 2WZ7A 1IC2A 4AYCA 1ZR4A 2IZ1A 1KYOI 1BCCD 1MFTA 1NYHA 2WSEH 3H1LD 3LW5J 1CI6A 3B8EB 3HE5A 1LTIC 1LP1A 1NTZE 3M0DC 1NTZD 3H1JG 3V6IA 2K3RA 1P84I 1TU3F 2R3SA 4L73A 3CC4P 1MUUA 3H32A 1QL2A 3VOPA 2XU6A 3C9IA 3A0BE 3EQ2A 4XE5B 5BVZA 2PFXA 1VQ9P 1KTMA 2QJKB 3R4YA 1LT9A 2A06E 1T2KD 3HE4B 1M7LA 1USEA 3H1LE 3V2NA 1KILE 3AE2C 1NTZK 4GOEA 4NPDA 2OYOA 1JY2N 2KIKA 3RK2B 3EFGA 2JP3A 1SQQE 3M06A 2KS1B 4JF7A 3A7OA 3S4RA 2M5AA 2LXCB 1SQXG 2AXTH 2JJLA 3GHGB 1FZAA 2QJKC 5AVSB 1GZLA 5APYA 1GTWA 1BGYG 1HH0A 1N73A 1SQBD 3MIWA 3B4SA 2H89C 4HB1A 4K3AA 1YJNP 1M1KQ 3L75E 3PP5A 2CPBA 1H88A 1WT6A 2KSEA 2XV5A 1VQ4P 4BRYB 3EWKA 3M9BA 3MP7B 2J58A 1FC2C 4XA4A 1S9KD 3MUDC 1VQ7P 1U7MA 3MZWB 1NU1J 1AQTA 1SQQK 3HUSC 5TJHA 1R8EA 1KQGB 3H1HD 1IFMA 1BE3G 1GK4A 1GL2B 2FXPA 2IZ0A 4HJGH 3B5NA 3WUVA 2R32A 2WQYC 4WY4B 3KYQA 1LWUB 2V7QJ 2XZRA 1RF1B 2C9LY 3TDKA 5GTHH 3V2PA 3IN6A 3TGUE 1VF5D 2ZYDA 1URQA 3RL0D 2BEZF 5TISE 2E76B 3I5CA 3CPWO 3D71A 4U3FE 2FYUG 2B87A 1VDFA 1SQQG 2JWDA 3F89A 3H6PA 3L75G 3H25A 2I8DA 4IL6E 1K8AQ 3VYIA 2Q7CA 1K04A 1A02F 1LTGC 3BVHA 1W2BO 2ZVNB 1KB9I 5AW9B 3U1AA 1VQNP 1P84D 3TGUG 1Y47A 3KZIH 1M1JA 2CK3H 2KXPB 2WPVB 2WSFJ 2XNXA 3JSVC 4JPZB 1ZOYC 4O9BA 1FZCB 3GF3A 4DJGA 2QIWA 2R44A 4UB8E 2PAJA 1PGOA 1SFCC 3CCVP 1N73C 4U3FJ 4A7PA 1FJKA 1ZR2A 1AVOA 3L70E 1L0NJ 5KJ7D 3CXHH 1GW3A 4IOIH 2HPCB 1S5LE 3M0DA 2OYHB 4WVZA 3VMZA 1X79B 1GU5A 1GD2E 3CC7P 3CCMP 1FBMA 2IFNA 1NU1D 1VF5C 1XTGB 3CLQA 5DJUB 1L0LD 1SQXJ 2PGDA 1M90Q 2OYHA 4I1LA 1Y9BA 4N78E 1A02J 4JYCA 1LTBC 1RH5B 1YQ4C 2ZT9D 3CCQP 4XFJA 1FZBA 3O6QB 1M57D 5AVVB 2C9NY 1DD4A 3HD7A 3I56P 1WMKA 3VMXA 1KYOH 1LT9C 3ABVC 2W6JH 4W7ZA 5TISH 4WB4A 4Y28J 1S9KE 2QJPB 2WPRA 3O6QA 1SQQD 4JYBA 3JCUE 1PFIA 1T3UA 3BCCJ 3AEBC 3HTKA 3L75D 1D7MA 2W8ZA 2GUSA 3E1RA 1GU4A 3CC2P 4EYYQ 2KZJA 3CI9A 1SQPD 3WUUA 3KPEA 1SVFA 3L35A 2FBWC 4B86A 1PP9J 1HUCA 4WWIA 1LTSC 2A06G 5CCHA 5CCHC 1ZW0A 3Q5RA 2ZFCA 3L71E 1J2JB 3TK1A 2PRRA 1PPJD 1RE4A 2D2CC 1NJIQ 1SQVG 3W67A 1YHQP 4N3YB 2KP8A 1T8ZA 2E74D 1PGQA 1FZGA 1KV4A 1L0ND 1NKNA 3H1KJ 3HD7D 5K5GB 2E75D 1J1EC 1KORA 1LNQA 2WPSA 2ZT9B 3L71D 4PD4H 2V4HA 3HD7B 4H0LB 4RJTA 1GL2D 2GM4A 2FYUE 1Q2NA 1EQ7A 1U7JA 4L76A 3CCEP 2YO3A 2Z5IA 3GLMA 4GKGA 2M3EA 1RF1C 1L0LJ 1SQXD 4H44B 1Y8AA 4YXWH 1KILC 2WSEJ 2Y9ZA 1NGMB 1PP9G 3GHGA 2V7QH 1VQ8P 1VF5B 1L0NK 3Q5SA 1T6AA 2KK7A 1KILB 3AE1C 4KHXA 3CCSP 1OVRA 1JOCA 3AE8C 1J1DB 1DEEG 3E1IA 5KAIE 2GUVA 4EDFA 3A5TA 3A0HH 1SQPE 2H7HA 1BDCA 2WPQA 3KQGA 3M9QA 4YPCA 1JY3O 5KLVG 2Y0DA 2N1TA 1HWTC 3AEEC 3CXHD 2MJZA 3HE4A 3ITKA 3JCUH 3LIEA 4DCKA 4HKZH 4C7NB 4NPFX 1X8YA 4PV1C 1L0LE 1SFCA 1JM0A 1IK9A 4GT1A 4BRYA 1Z56A 2HG5D 3WUTA 2SPZA 1JTHA 4GDOA 4Y99C 1Q82Q 4Y99B 1LWUC 1N73B 3IAOA 1MKMA 1NWQA 1PPJG 4H13B 3S1KA 2RN0A 5AW8B 3CCUP 3D70A 2KOGA 3G9RA 4N6JA 1PP9E 2IYOA 5AW6B 5B5EH 1L0NG 2N1TD 3SSUA 4H0LC 1L4AD 3Q1MA 3D6YA 1HF9A 1KQLA 3L71J 4PD4E 4UB6E 2E75B 4AQRD 4OWFA 5AW4B 4M3LA 3P7KA 2NZ2A 3CXHI 5APTA 5B66H 2M8RA 4ZKPA 1OVUA 1NU1K 2RMZA 4ZMDA 5KJ7C 1YI2P 4GOFA 1N86A 4IL6X 1JUNA 1GW4A 5CCGD 1QL1A 3L4FA 1HTLC 1DH3A 1MV8A 3CWBJ 3H1IJ 3LW5H 4TLFA 5E79E 2NPSB 5AVXB 2WITA 5AW0B 2ZAEB 1Q86Q 1S3JA 2IDBA 1NTKD 4U3FD 2KYVA 4TT3H 2QG4A 1QEXA 3VP8A 4MN4C 1RQUA 1EDJA 2YIUC 3AE7C 3GW6A 2E76D 3MTUE 1L4AA 1JMMA 1HVVA 2L5GB 3Q2YA 2FKWB 3U59A 3OAKA 3L37A 3MGNA 3SWYA 2NPSA 1NTKK 2B87B 1HGVA 2KB7P 3F5HA 3GF7A 2LR2A 1XTCC 2QVAA 1ZMEC 1VPCA 2QM8A 1HJBA 2YXRB 4PV1B 2I1KA 2E43A 3V5BA 1NU1G 3M9HA 4IL6H 2M0BA 1Q7YQ 3HD7C 1FDIA 4CPGA 3EFFK 2C0WA 4I7ZC 1BGYJ 2OYIB 2OQQA 1WRGA 3B5NB 1JY2O 1SQBG 2IBZD 1LT1A 4NPEA 2Q3EA 2QM7A 4H44C 1KC8Q 1SLQA 3KZIE 3SFEC 1FS0E 1NTKE 3GHGC 3H1KG 4UB6H 4OVNF 2WMMA 3WMM0 4RO0A 5KAIH 3AE3C 1KMIZ 2E5TA 4PD4I 5B66E 1YITP 1PGPA 3FWNA 1OZHA 3L74D 3L36A 4W80A 2WWWA 2JEEA 5CJ4A 1CI6B 3RK2D 2KI7B 2YIUB 5E79H 2OGUA 2D2CB 1J1DC 1LJ2A 1NTKG 3OJAB 2OTKE 1KN7A 2Y0CA 2Q5UA 2YMKA 2W6AA 3HUSA 4U3FG 2A06D 2BEQD 1KB9H 5KLIB 3QWOC 4ZNCA 3P8CE 1M1JC 4OGQD 1QX8A 5BU5A 5AVQB 2FYUD 5KKZB 1EZVE 1UIIA 2WTYA 1FOSF 2ZXEB 2K37A 1VQOP 4L74A 3H1HG 5APXA 2JKVA 3L72J 2W6BA 1G1JA 3H32B 3CCJP 1BE3E 3L72D 3CX5I 4PJ0H 4W7YA 1NTMD 3WU2E 1BDDA 4WY4D 3G4SP 1IFPA 1LP1B 1VQKP 3CL3D 1K05A 3CX5D 1JO5A 3GMAA 2FFDA 1BGYD 1L4AB 1NTZJ 1DEBA 5CCGC 3RGUA 2HODB 2FYZA 4EI2A 3B5ND 2L91A 1LTJB 1SFCB 3H1KD 4I7ZB 2C0XA 1OIPA 5C39A 1EDIA 1RE3C 1S1CX 3L74G 3MUDA 1L4AC 1USDA 1URQD 2HLOA 4U7JA 5KLVD 3G71P 1W2EA 4KJMA 3SFDC 1AJYA 1BGYE 1CW5A 2BCCJ 2OYIC 1DD3A 3QH9A
chains in the Genus database with same CATH topology
2V4HA 3F89A 2ZVOB 3FX0A 3JSVC 4OWFA 4BWNA 2ZVNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V4H A;  3F89 A;  2ZVO B;  3FX0 A;  3JSV C;  4OWF A;  4BWN A;  2ZVN B; 
#chains in the Genus database with same CATH topology
 1X22 A;  2BCC D;  2ZXX A;  4WBA A;  1X0T A;  3CWB E;  3H1I E;  4GOD A;  1QVG O;  2CPS A;  1EC5 A;  1ZRT D;  2HPC A;  5AVZ B;  5GTH E;  2H8P D;  3OA7 A;  3C8V A;  3H1L G;  1KB9 E;  1SQV K;  2JO1 A;  2P10 A;  3H1J E;  2P2U A;  3AEF C;  3RK3 D;  3V2Q A;  2YKP A;  2R5B A;  3W68 A;  1JMB A;  1JEK A;  2FFD B;  3FGA D;  3A0B H;  3P32 A;  5APQ A;  5KLI C;  3BRV B;  2WSC H;  1G2C B;  1RY3 A;  2ZYA A;  3RL0 g;  5APV A;  1N7L A;  1VQ5 P;  2UWJ E;  3PLN A;  3PTZ A;  2A45 H;  2K1A A;  2XDJ A;  1OW8 A;  1QLE D;  2KZI A;  3WU2 H;  1HJ0 A;  1N7S A;  1SQV E;  2Y0E A;  4Z1M H;  3TF5 A;  4EOT A;  2B88 A;  1S72 P;  3CMA P;  3VTP C;  2NRG A;  3G6E P;  1JB0 J;  2AXT E;  2FYU K;  4LC1 A;  1YYC A;  3AE6 C;  3BAT A;  3H1J J;  3AEC C;  3NMD A;  4UB8 H;  1H8A A;  3CCL P;  1NOH A;  1RF0 C;  3L74 E;  3L73 E;  4IFM A;  5EFW B;  1KFM A;  2QJP C;  1JNM A;  1JY3 N;  4H13 D;  5AW5 B;  1NO4 A;  3D6Z A;  1OW6 A;  2O1J A;  4WY4 C;  1T2K C;  4AUW A;  1UIX A;  3RK3 B;  2KSJ A;  5APW A;  4BXL A;  5B5E E;  1FZC A;  2E74 C;  3BAS A;  1NAF A;  3NFQ A;  5AVY B;  3SWK A;  1H0T A;  2HOD A;  5CJ0 A;  2Q3I A;  2LXB A;  5KKZ C;  4IFF A;  5AW3 B;  1M8O B;  4H13 C;  3V2R A;  1N7S D;  1MZ9 A;  1SQB K;  1AQ5 A;  2FYN C;  3L70 D;  2ITA A;  1LTJ C;  1LTT C;  1AA0 A;  2AXC A;  3KXD A;  2K88 A;  3B71 A;  1FZF A;  1NAY A;  1EXI A;  3VMY A;  2IFM A;  2OYI A;  2M5A B;  3IFM A;  4D6T J;  2KNC B;  4GIF A;  3TNU A;  1M56 D;  4I6M C;  1P84 E;  2JWA A;  4R4L A;  3RK2 C;  2WT7 A;  1IO4 A;  2YKQ A;  1CZQ A;  1IFI A;  3AEA C;  3FXE A;  3PH0 A;  2XKM A;  3HTK B;  5AVU B;  2RH0 A;  4OGQ B;  2ZVO B;  1VQ6 P;  1G2C A;  3CX5 H;  3HRN A;  1IK7 A;  1U57 A;  1PIX A;  1SQV D;  1OXZ A;  3L73 G;  1ZP0 C;  4H0L D;  4ASV A;  5GTI H;  3A2A A;  1NHL A;  1RE4 C;  3E7K A;  1RF0 A;  4L75 A;  1BCC J;  1OW7 A;  5AVW B;  4DT0 A;  3Q5P A;  1H0T B;  2K9Y A;  1M1J B;  4KT0 J;  5CMZ A;  3G3Z A;  1ZLL A;  2ZJS E;  2E42 A;  3L71 G;  1ZXG A;  1N8R Q;  1Q90 D;  2Q1K A;  3L70 G;  4I2L C;  4K35 A;  3BCC E;  2QE7 H;  2MKV A;  1FDO A;  3AED C;  4PD4 D;  1L2P A;  3RK3 E;  2YNY A;  1URQ B;  1EDK A;  4ZKU A;  1KB9 D;  2FYN B;  3II6 A;  5KLV E;  1PP9 D;  3PRJ A;  1NTM J;  3N4X A;  3NXS A;  1FZE A;  2VRS A;  1ZRT E;  1BCC E;  1RF1 A;  5APS A;  3FXD A;  3RBZ A;  2E5Y A;  2BCC E;  3AEG C;  2E76 C;  2NPS D;  3V4Q A;  2OTL P;  1HGZ A;  1K73 Q;  2H88 C;  2QRX A;  3AE9 C;  1RQV A;  1AV1 A;  1NH4 A;  5AVR B;  3T97 A;  3N7N A;  3CWB G;  1KFN A;  1KYO E;  3H1I G;  4DOJ A;  1K9M Q;  1SS1 A;  1NVO A;  4JQ0 D;  2QEX P;  2N9Y B;  1SP4 A;  5KTB A;  1PZQ A;  3HE5 B;  2QA4 P;  2FYU J;  2O1K A;  2P7J A;  4RES B;  1N2D C;  1KIL D;  1NTM E;  2BCC G;  2ZYG A;  3GG2 A;  5KLV J;  3CD6 P;  2GA1 A;  3JC2 2;  2K9J B;  2WSS H;  4YTP C;  3AE5 C;  3PJS K;  3RL0 C;  3S9O A;  1BE3 J;  1GMJ A;  2OAR A;  2M3B A;  4LGD E;  1S4X A;  2Z5H A;  2A45 I;  2WSC J;  2KUB A;  1L0L G;  2Q9I A;  2O3J A;  2J5U A;  1NTK J;  1YTZ T;  3NTN A;  5H2F H;  2KNC A;  2R3C A;  4OGQ C;  5CCG A;  4OH8 B;  3BRT B;  3FWL A;  2IBZ G;  3TNU B;  2Z4E A;  2D2C D;  2WT7 B;  1YIJ P;  1PPJ E;  1GDT A;  5AVT B;  4BWN A;  5CCH D;  3BCC D;  1BCC G;  1OFC X;  4R4M A;  3L75 J;  2W27 A;  1FAV A;  1ZN5 A;  2WVR A;  1W5C E;  2IBZ I;  2LKM A;  2YMY A;  1L0N E;  1LTJ A;  1MFZ A;  2QSI A;  1IJD B;  3FX0 A;  3IF4 A;  3L73 J;  3P8C D;  1KIL A;  2AEJ A;  1IFJ A;  2W90 A;  1OMI A;  2KLV A;  5CBN A;  1R5L A;  2P58 A;  4QMA A;  2A45 G;  3Q3D A;  3CME P;  2OTJ P;  5KJ7 A;  3VP9 A;  1AVY A;  1FZC C;  5KAF E;  2R5D A;  1P84 H;  4D6T G;  1EDL A;  2HR3 A;  3CCR P;  4HYT B;  1KQF B;  1SQX K;  2YO2 A;  2B89 A;  2O01 H;  1RHZ B;  2KS1 A;  1L0L K;  1IFN A;  2ZT9 C;  2BAS A;  5AW1 B;  5GTI E;  1VQL P;  4D6T E;  2RKL A;  2YKO A;  3O8Z A;  2FFD C;  2HYN A;  3TSI A;  3MD0 A;  1N7S B;  2IBZ E;  5APU A;  2N1T B;  1LGH B;  2IYP A;  3HUS B;  2FY8 A;  2G8Y A;  1N7S C;  2YXQ B;  3V4W A;  1X9V A;  1S5L H;  3VN0 A;  2JR8 A;  1SQV J;  4N78 D;  2E75 C;  1LTA C;  3KHU A;  5KLV K;  3RBX A;  4JBZ A;  1Q81 Q;  1G1I A;  1JTH B;  1URQ C;  1SQB J;  2HFE D;  1FOS E;  1AFO A;  2K9J A;  1NU1 E;  4IFD K;  1E79 H;  1PV3 A;  3K5B A;  4ASW A;  3MHV A;  4D6T D;  2POH A;  3C1L A;  1YJW P;  1CSB A;  1JY3 P;  3B5N C;  3L73 D;  3BCC G;  2QJY C;  1FE6 A;  4C46 A;  1YQ3 C;  3TYY A;  1KD1 Q;  1YTZ I;  4HH2 A;  1FDM A;  2IPP A;  1GK6 A;  3I55 P;  2OYH C;  3T97 B;  1HBW A;  1YBK A;  2AEM A;  5AW7 B;  1T3J A;  1YJ9 P;  1H89 A;  1E5W A;  3SWF A;  1JCC A;  3LID A;  2E74 B;  1NTM K;  2O01 N;  3U1C A;  5AW2 B;  1LT9 B;  3UIA A;  1NTZ G;  3H1J D;  2I1J A;  2JDI H;  3H1L J;  1GL2 A;  1RE3 A;  2QJY B;  3TGU J;  2J59 M;  3OW2 O;  3TGU D;  1S5L X;  4WY4 A;  1SQQ J;  2Y9Y A;  3RL0 B;  1IZN B;  2NPS C;  2KLU A;  1VQP P;  2WSF H;  4LLH A;  1KQS O;  1DX7 A;  1OX3 A;  4DZO A;  2N1T C;  1OWA A;  2FXM A;  1ZV8 A;  2O01 J;  3KDP B;  1SQP J;  1SQP K;  3L72 G;  3M91 A;  5H2F E;  5DJT B;  3RK3 C;  3L74 J;  1NTM G;  4PJ0 E;  1EZV G;  3R2P A;  1BSH A;  3CWB D;  2PP6 A;  3H1I D;  1FU1 A;  2XND H;  1QGK B;  3A3Y B;  2H43 A;  1PGJ A;  1S2E A;  2N9B A;  2AEF A;  1R5S A;  1VL2 A;  3L70 J;  2IX7 C;  3H1H E;  3ZDM A;  1J1E B;  4C7R A;  1OVV A;  1QVF O;  4PV1 D;  1JCD A;  2FXO A;  4C7N A;  1PL5 A;  1SFC D;  1BSN A;  1SQP G;  4RKU J;  3CX5 E;  1JY2 P;  1LWU A;  2Q6Q A;  3M0A A;  5CHX A;  3VMA A;  4EIJ A;  2P67 A;  3H1K E;  4H44 D;  1FJP A;  5KAF H;  3P8M C;  1DIP A;  1KYO D;  5CBO A;  1SQB E;  1BE3 D;  1KZU B;  1SQX E;  3A0H E;  3AE4 C;  1EZV I;  2DW3 A;  3L72 E;  5L8R J;  1NKZ B;  5M1B A;  3USS A;  5BU8 B;  3H1H J;  4YXD C;  1VQM P;  3CXH E;  2B9B A;  3IR9 A;  3PHL A;  1IFD A;  2P1J A;  2W83 C;  1EXJ A;  1GL2 C;  1EZV D;  2G3A A;  2WZ7 A;  1IC2 A;  4AYC A;  1ZR4 A;  2IZ1 A;  1KYO I;  1BCC D;  1MFT A;  1NYH A;  2WSE H;  3H1L D;  3LW5 J;  1CI6 A;  3B8E B;  3HE5 A;  1LTI C;  1LP1 A;  1NTZ E;  3M0D C;  1NTZ D;  3H1J G;  3V6I A;  2K3R A;  1P84 I;  1TU3 F;  2R3S A;  4L73 A;  3CC4 P;  1MUU A;  3H32 A;  1QL2 A;  3VOP A;  2XU6 A;  3C9I A;  3A0B E;  3EQ2 A;  4XE5 B;  5BVZ A;  2PFX A;  1VQ9 P;  1KTM A;  2QJK B;  3R4Y A;  1LT9 A;  2A06 E;  1T2K D;  3HE4 B;  1M7L A;  1USE A;  3H1L E;  3V2N A;  1KIL E;  3AE2 C;  1NTZ K;  4GOE A;  4NPD A;  2OYO A;  1JY2 N;  2KIK A;  3RK2 B;  3EFG A;  2JP3 A;  1SQQ E;  3M06 A;  2KS1 B;  4JF7 A;  3A7O A;  3S4R A;  2M5A A;  2LXC B;  1SQX G;  2AXT H;  2JJL A;  3GHG B;  1FZA A;  2QJK C;  5AVS B;  1GZL A;  5APY A;  1GTW A;  1BGY G;  1HH0 A;  1N73 A;  1SQB D;  3MIW A;  3B4S A;  2H89 C;  4HB1 A;  4K3A A;  1YJN P;  1M1K Q;  3L75 E;  3PP5 A;  2CPB A;  1H88 A;  1WT6 A;  2KSE A;  2XV5 A;  1VQ4 P;  4BRY B;  3EWK A;  3M9B A;  3MP7 B;  2J58 A;  1FC2 C;  4XA4 A;  1S9K D;  3MUD C;  1VQ7 P;  1U7M A;  3MZW B;  1NU1 J;  1AQT A;  1SQQ K;  3HUS C;  5TJH A;  1R8E A;  1KQG B;  3H1H D;  1IFM A;  1BE3 G;  1GK4 A;  1GL2 B;  2FXP A;  2IZ0 A;  4HJG H;  3B5N A;  3WUV A;  2R32 A;  2WQY C;  4WY4 B;  3KYQ A;  1LWU B;  2V7Q J;  2XZR A;  1RF1 B;  2C9L Y;  3TDK A;  5GTH H;  3V2P A;  3IN6 A;  3TGU E;  1VF5 D;  2ZYD A;  1URQ A;  3RL0 D;  2BEZ F;  5TIS E;  2E76 B;  3I5C A;  3CPW O;  3D71 A;  4U3F E;  2FYU G;  2B87 A;  1VDF A;  1SQQ G;  2JWD A;  3F89 A;  3H6P A;  3L75 G;  3H25 A;  2I8D A;  4IL6 E;  1K8A Q;  3VYI A;  2Q7C A;  1K04 A;  1A02 F;  1LTG C;  3BVH A;  1W2B O;  2ZVN B;  1KB9 I;  5AW9 B;  3U1A A;  1VQN P;  1P84 D;  3TGU G;  1Y47 A;  3KZI H;  1M1J A;  2CK3 H;  2KXP B;  2WPV B;  2WSF J;  2XNX A;  3JSV C;  4JPZ B;  1ZOY C;  4O9B A;  1FZC B;  3GF3 A;  4DJG A;  2QIW A;  2R44 A;  4UB8 E;  2PAJ A;  1PGO A;  1SFC C;  3CCV P;  1N73 C;  4U3F J;  4A7P A;  1FJK A;  1ZR2 A;  1AVO A;  3L70 E;  1L0N J;  5KJ7 D;  3CXH H;  1GW3 A;  4IOI H;  2HPC B;  1S5L E;  3M0D A;  2OYH B;  4WVZ A;  3VMZ A;  1X79 B;  1GU5 A;  1GD2 E;  3CC7 P;  3CCM P;  1FBM A;  2IFN A;  1NU1 D;  1VF5 C;  1XTG B;  3CLQ A;  5DJU B;  1L0L D;  1SQX J;  2PGD A;  1M90 Q;  2OYH A;  4I1L A;  1Y9B A;  4N78 E;  1A02 J;  4JYC A;  1LTB C;  1RH5 B;  1YQ4 C;  2ZT9 D;  3CCQ P;  4XFJ A;  1FZB A;  3O6Q B;  1M57 D;  5AVV B;  2C9N Y;  1DD4 A;  3HD7 A;  3I56 P;  1WMK A;  3VMX A;  1KYO H;  1LT9 C;  3ABV C;  2W6J H;  4W7Z A;  5TIS H;  4WB4 A;  4Y28 J;  1S9K E;  2QJP B;  2WPR A;  3O6Q A;  1SQQ D;  4JYB A;  3JCU E;  1PFI A;  1T3U A;  3BCC J;  3AEB C;  3HTK A;  3L75 D;  1D7M A;  2W8Z A;  2GUS A;  3E1R A;  1GU4 A;  3CC2 P;  4EYY Q;  2KZJ A;  3CI9 A;  1SQP D;  3WUU A;  3KPE A;  1SVF A;  3L35 A;  2FBW C;  4B86 A;  1PP9 J;  1HUC A;  4WWI A;  1LTS C;  2A06 G;  5CCH A;  5CCH C;  1ZW0 A;  3Q5R A;  2ZFC A;  3L71 E;  1J2J B;  3TK1 A;  2PRR A;  1PPJ D;  1RE4 A;  2D2C C;  1NJI Q;  1SQV G;  3W67 A;  1YHQ P;  4N3Y B;  2KP8 A;  1T8Z A;  2E74 D;  1PGQ A;  1FZG A;  1KV4 A;  1L0N D;  1NKN A;  3H1K J;  3HD7 D;  5K5G B;  2E75 D;  1J1E C;  1KOR A;  1LNQ A;  2WPS A;  2ZT9 B;  3L71 D;  4PD4 H;  2V4H A;  3HD7 B;  4H0L B;  4RJT A;  1GL2 D;  2GM4 A;  2FYU E;  1Q2N A;  1EQ7 A;  1U7J A;  4L76 A;  3CCE P;  2YO3 A;  2Z5I A;  3GLM A;  4GKG A;  2M3E A;  1RF1 C;  1L0L J;  1SQX D;  4H44 B;  1Y8A A;  4YXW H;  1KIL C;  2WSE J;  2Y9Z A;  1NGM B;  1PP9 G;  3GHG A;  2V7Q H;  1VQ8 P;  1VF5 B;  1L0N K;  3Q5S A;  1T6A A;  2KK7 A;  1KIL B;  3AE1 C;  4KHX A;  3CCS P;  1OVR A;  1JOC A;  3AE8 C;  1J1D B;  1DEE G;  3E1I A;  5KAI E;  2GUV A;  4EDF A;  3A5T A;  3A0H H;  1SQP E;  2H7H A;  1BDC A;  2WPQ A;  3KQG A;  3M9Q A;  4YPC A;  1JY3 O;  5KLV G;  2Y0D A;  2N1T A;  1HWT C;  3AEE C;  3CXH D;  2MJZ A;  3HE4 A;  3ITK A;  3JCU H;  3LIE A;  4DCK A;  4HKZ H;  4C7N B;  4NPF X;  1X8Y A;  4PV1 C;  1L0L E;  1SFC A;  1JM0 A;  1IK9 A;  4GT1 A;  4BRY A;  1Z56 A;  2HG5 D;  3WUT A;  2SPZ A;  1JTH A;  4GDO A;  4Y99 C;  1Q82 Q;  4Y99 B;  1LWU C;  1N73 B;  3IAO A;  1MKM A;  1NWQ A;  1PPJ G;  4H13 B;  3S1K A;  2RN0 A;  5AW8 B;  3CCU P;  3D70 A;  2KOG A;  3G9R A;  4N6J A;  1PP9 E;  2IYO A;  5AW6 B;  5B5E H;  1L0N G;  2N1T D;  3SSU A;  4H0L C;  1L4A D;  3Q1M A;  3D6Y A;  1HF9 A;  1KQL A;  3L71 J;  4PD4 E;  4UB6 E;  2E75 B;  4AQR D;  4OWF A;  5AW4 B;  4M3L A;  3P7K A;  2NZ2 A;  3CXH I;  5APT A;  5B66 H;  2M8R A;  4ZKP A;  1OVU A;  1NU1 K;  2RMZ A;  4ZMD A;  5KJ7 C;  1YI2 P;  4GOF A;  1N86 A;  4IL6 X;  1JUN A;  1GW4 A;  5CCG D;  1QL1 A;  3L4F A;  1HTL C;  1DH3 A;  1MV8 A;  3CWB J;  3H1I J;  3LW5 H;  4TLF A;  5E79 E;  2NPS B;  5AVX B;  2WIT A;  5AW0 B;  2ZAE B;  1Q86 Q;  1S3J A;  2IDB A;  1NTK D;  4U3F D;  2KYV A;  4TT3 H;  2QG4 A;  1QEX A;  3VP8 A;  4MN4 C;  1RQU A;  1EDJ A;  2YIU C;  3AE7 C;  3GW6 A;  2E76 D;  3MTU E;  1L4A A;  1JMM A;  1HVV A;  2L5G B;  3Q2Y A;  2FKW B;  3U59 A;  3OAK A;  3L37 A;  3MGN A;  3SWY A;  2NPS A;  1NTK K;  2B87 B;  1HGV A;  2KB7 P;  3F5H A;  3GF7 A;  2LR2 A;  1XTC C;  2QVA A;  1ZME C;  1VPC A;  2QM8 A;  1HJB A;  2YXR B;  4PV1 B;  2I1K A;  2E43 A;  3V5B A;  1NU1 G;  3M9H A;  4IL6 H;  2M0B A;  1Q7Y Q;  3HD7 C;  1FDI A;  4CPG A;  3EFF K;  2C0W A;  4I7Z C;  1BGY J;  2OYI B;  2OQQ A;  1WRG A;  3B5N B;  1JY2 O;  1SQB G;  2IBZ D;  1LT1 A;  4NPE A;  2Q3E A;  2QM7 A;  4H44 C;  1KC8 Q;  1SLQ A;  3KZI E;  3SFE C;  1FS0 E;  1NTK E;  3GHG C;  3H1K G;  4UB6 H;  4OVN F;  2WMM A;  3WMM 0;  4RO0 A;  5KAI H;  3AE3 C;  1KMI Z;  2E5T A;  4PD4 I;  5B66 E;  1YIT P;  1PGP A;  3FWN A;  1OZH A;  3L74 D;  3L36 A;  4W80 A;  2WWW A;  2JEE A;  5CJ4 A;  1CI6 B;  3RK2 D;  2KI7 B;  2YIU B;  5E79 H;  2OGU A;  2D2C B;  1J1D C;  1LJ2 A;  1NTK G;  3OJA B;  2OTK E;  1KN7 A;  2Y0C A;  2Q5U A;  2YMK A;  2W6A A;  3HUS A;  4U3F G;  2A06 D;  2BEQ D;  1KB9 H;  5KLI B;  3QWO C;  4ZNC A;  3P8C E;  1M1J C;  4OGQ D;  1QX8 A;  5BU5 A;  5AVQ B;  2FYU D;  5KKZ B;  1EZV E;  1UII A;  2WTY A;  1FOS F;  2ZXE B;  2K37 A;  1VQO P;  4L74 A;  3H1H G;  5APX A;  2JKV A;  3L72 J;  2W6B A;  1G1J A;  3H32 B;  3CCJ P;  1BE3 E;  3L72 D;  3CX5 I;  4PJ0 H;  4W7Y A;  1NTM D;  3WU2 E;  1BDD A;  4WY4 D;  3G4S P;  1IFP A;  1LP1 B;  1VQK P;  3CL3 D;  1K05 A;  3CX5 D;  1JO5 A;  3GMA A;  2FFD A;  1BGY D;  1L4A B;  1NTZ J;  1DEB A;  5CCG C;  3RGU A;  2HOD B;  2FYZ A;  4EI2 A;  3B5N D;  2L91 A;  1LTJ B;  1SFC B;  3H1K D;  4I7Z B;  2C0X A;  1OIP A;  5C39 A;  1EDI A;  1RE3 C;  1S1C X;  3L74 G;  3MUD A;  1L4A C;  1USD A;  1URQ D;  2HLO A;  4U7J A;  5KLV D;  3G71 P;  1W2E A;  4KJM A;  3SFD C;  1AJY A;  1BGY E;  1CW5 A;  2BCC J;  2OYI C;  1DD3 A;  3QH9 A; 
#chains in the Genus database with same CATH homology
 2V4H A;  3F89 A;  2ZVO B;  3FX0 A;  3JSV C;  4OWF A;  4BWN A;  2ZVN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...