3F89A

Nemo cozi domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
EDLRQQLQQAEEALVAKQELIDKLKEEAEQHNIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NF-kappa-B essential modulator
publication title Specific recognition of linear ubiquitin chains by NEMO is important for NF-kappaB activation
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 27
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 3f89A00
4BWNA 2ZVNB 3F89A 2ZVOB 4OWFA 3FX0A 3JSVC 2V4HA
chains in the Genus database with same CATH superfamily
3BRVB 3H1HE 3HRNA 3CX5E 5E79E 2HG5D 1FJKA 1KC8Q 1CI6A 1WT6A 4K35A 5DJUB 1EC5A 1L2PA 5CBNA 2WQYC 2YMYA 1NYHA 1EZVI 3PH0A 1G2CA 1SFCD 2IZ1A 1NTMK 4HB1A 3L70J 3H1KG 1PPJD 3NTNA 1JY2N 3NFQA 1RE3C 3U1CA 4HJGH 1M1JB 5APSA 2A06G 1L4AA 2IFNA 2WPVB 2QM7A 5KLVD 4DJGA 2HPCA 4PD4D 4W80A 2K9JA 3IF4A 1ZR2A 1KORA 1RF0A 3M9HA 4XA4A 3N7NA 1N7SB 2N1TB 3D6YA 3Q5RA 3RK3D 1VQKP 4N6JA 1KFNA 3W68A 5B66H 2WSSH 3LIDA 5CJ4A 1BE3G 2Q6QA 2QVAA 3G6EP 4C7RA 3CI9A 2ZYAA 4H0LD 5KTBA 4IL6X 2CPSA 2W6JH 2IDBA 3GHGA 2WSEH 3H6PA 1YBKA 2WSCH 3G71P 1RE4A 1FS0E 3CCJP 1PP9D 1NTMJ 3FXEA 3WU2E 3CWBG 2NPSA 2NPSD 4WY4A 4WY4D 3CCEP 3E1IA 3BCCD 2YO2A 2P2UA 4BRYB 1Y8AA 1GZLA 1L0LK 1PGQA 1NAFA 1JMMA 1IFJA 1JOCA 1K05A 1SS1A 1DD3A 2FYNB 2VRSA 1OZHA 2KNCA 1JEKA 1S5LX 2B89A 3F5HA 3L72J 1J1EB 1Q2NA 2C9LY 3W67A 2Y9YA 1N73A 1OVVA 1FZCA 3JC22 3CC4P 5CMZA 1SQPD 4WB4A 1VQ7P 4NPDA 3H1LD 1IC2A 3MZWB 3GLMA 3H1HJ 1M7LA 1NHLA 1SQQK 3SFEC 2R44A 1LWUB 2KS1B 1FOSF 1SQVG 2WWWA 1USEA 5BU8B 2QJKB 2IFMA 4H13B 2E76B 2I1JA 2JWDA 1K8AQ 3I5CA 2AEMA 3VP8A 2PAJA 5CHXA 4WVZA 2QG4A 2PGDA 4HH2A 2R3SA 1EQ7A 1L0NG 5APXA 3HD7C 2N9YB 2MKVA 1H88A 2Q5UA 1NTZG 2P58A 1KILA 1KILD 2YKPA 1H89A 1HH0A 1KTMA 3P8CE 1L4AC 2I8DA 1L0LJ 3JCUE 5GTHH 3L73G 1FZFA 2FYZA 1VPCA 3CLQA 5KLIC 1RF0C 5CCGC 1VQ6P 1CSBA 2C0XA 1GL2D 2Y0DA 4Y99C 1M1KQ 1PGPA 2KB7P 1EDIA 3L75D 3IAOA 2ZYDA 1IO4A 3Q5PA 3CMAP 1RF1B 1JUNA 3H1JE 1GU5A 3PTZA 3L71G 3AE6C 1PZQA 3UIAA 1OFCX 5AVUB 1T3UA 3L36A 1SQQJ 2OYHB 3H1HD 1VF5C 3A0HH 4I6MC 4W7YA 2FYUK 4ASVA 3S4RA 3GHGC 1J2JB 3USSA 1ZXGA 2R32A 1YITP 2Q9IA 2HODB 3HUSB 1RE4C 1AJYA 4BXLA 3FGAD 3RK2B 2WPRA 3Q1MA 1SQVK 1AQTA 3TSIA 5KLVG 5BU5A 1M90Q 5AVTB 3L4FA 1JTHB 1W2BO 3AE2C 1WMKA 2YNYA 5AW8B 1ZV8A 1Q81Q 3PRJA 2A06D 2YXQB 2A45H 1GW3A 3HE4A 3VP9A 3I55P 5BVZA 1N73C 1ZW0A 2OYIA 1FZCC 1KV4A 1HUCA 2E74D 5TISH 1EDLA 5AVZB 2HLOA 2Q1KA 1LJ2A 3AEDC 1X9VA 1NKZB 1MZ9A 4PD4I 4MN4C 2WPQA 3HE5A 4JYCA 3H32B 1BE3D 2HYNA 3RGUA 1KN7A 4UB6H 1GW4A 5CBOA 1BDCA 2G3AA 1LGHB 2KSEA 2OTJP 3O6QA 1LP1A 4PV1B 2Q7CA 2W8ZA 3G3ZA 1Q86Q 1LTTC 3SWFA 2WSCJ 1PP9G 4C7NA 1S9KE 5APQA 5AVRB 3P8MC 4D6TE 1S72P 3Q5SA 3BCCG 3BASA 1LTAC 1HJ0A 2QSIA 4AUWA 2YKQA 4IL6H 1VQPP 2MJZA 4K3AA 1Q7YQ 1FZEA 4C46A 1NJIQ 2D2CB 2K1AA 2E75B 5KLVK 1LWUC 1SQPG 2Z5IA 2AXTE 3H1LG 1S2EA 5APYA 1NO4A 1KYOH 3M0DC 1H0TB 1S4XA 2QJYC 3CXHH 3IN6A 1CZQA 1KD1Q 4OGQB 3CX5H 2W27A 5AW0B 4JF7A 4L73A 4GODA 2XU6A 3CCVP 2YKOA 1FJPA 1YTZI 1S5LH 3RL0B 1M8OB 3EFGA 2YIUC 4YTPC 2B87B 4M3LA 1RQVA 2KZJA 3KZIH 1P84E 2O1KA 5AW7B 5APWA 1NTME 1ZP0C 1PGJA 1X0TA 1Y47A 2P7JA 3V5BA 3BVHA 1X22A 2ZAEB 2H89C 4I7ZB 2JKVA 3V2RA 2AEJA 3SWYA 2OTLP 2OYIC 1SFCB 1NTKD 1USDA 1GDTA 1IFNA 2AXCA 1KQFB 5APUA 3BATA 3H1HG 4ZMDA 3H1JD 3K5BA 3L74E 3CXHE 1KZUB 1IFMA 4EIJA 3EFFK 4ZNCA 3L35A 3L71D 2V4HA 4HKZH 2HPCB 1DH3A 1LTJA 1M57D 1EZVE 1R5LA 1UIIA 4N78D 1S5LE 4D6TJ 3KDPB 4EYYQ 2GUVA 3HTKB 1FOSE 3RBXA 2GA1A 2QE7H 3U59A 3WU2H 3KZIE 2IBZE 5KKZC 3HD7A 3HD7D 4JPZB 1UIXA 2FBWC 3LW5J 3KHUA 4H0LB 1U57A 1G1IA 1RH5B 1L4AD 3S1KA 3A2AA 1L0LE 1SQXK 3TGUJ 3AE1C 3WUTA 5CCGA 5CCGD 1BSNA 3EWKA 4U3FD 1NU1K 2BCCJ 1SQBD 2KZIA 3FX0A 1PIXA 1D7MA 4YXWH 1Q82Q 3TNUB 1MKMA 4EDFA 1JY3P 4PV1C 4DOJA 1K9MQ 3S9OA 1PFIA 5CCHA 1MV8A 3VN0A 2G8YA 1OW8A 1SQQE 1MFTA 1FZBA 1VF5D 2K88A 1R8EA 1HJBA 3B8EB 1QX8A 3A0BH 4DT0A 2IZ0A 4DCKA 2CPBA 4RJTA 1YIJP 2WTYA 1SP4A 1M1JA 2D2CC 3O8ZA 2ZFCA 1AVYA 2PFXA 1NOHA 1N7SA 2N1TA 3L70D 5AW2B 2NZ2A 4RKUJ 3JCUH 3P32A 3M9QA 1SQXJ 4KT0J 1G1JA 4H44C 4WWIA 1QL2A 2FFDB 1T2KC 2E5YA 4OGQC 3C9IA 1NU1J 1WRGA 3AE4C 1RHZB 1BGYJ 3L74J 2JJLA 3M9BA 5EFWB 5AVVB 3FWNA 1N7LA 3I56P 2W6AA 5AW4B 1LTJC 2XNXA 1MFZA 4KHXA 5KJ7C 2ZJSE 4ASWA 1GL2B 4OH8B 2FYUE 2R5BA 3A0BE 2B88A 3CC2P 3WUUA 2P1JA 4BRYA 2QJPB 2PP6A 4UB8E 4GT1A 4I7ZC 1URQB 2KP8A 5AVXB 3B71A 1NTMD 3N4XA 1SQVE 4JBZA 3BRTB 4JQ0D 3E7KA 2POHA 2ZT9B 1T8ZA 3MIWA 2WSFJ 2R3CA 1JY3N 3H1IE 5CJ0A 5H2FH 2E43A 3AEAC 1NTKG 3H1KJ 3V4WA 1K04A 1VQLP 4AQRD 1GK4A 5APVA 3H1JG 3L72D 1H8AA 3NMDA 1LWUA 2KS1A 3SFDC 2M5AB 1BDDA 4ZKPA 1KYOD 5CCHC 3M0DA 3MUDC 1LT9B 3CXHD 2H43A 2V7QJ 3A5TA 4LGDE 3CX5D 1LTGC 1AVOA 1VDFA 3TYYA 1JNMA 2E5TA 1DX7A 1ZRTE 1M56D 4DZOA 2WT7B 1KQSO 2FXOA 1BCCE 1M1JC 2E74B 1LT1A 1FC2C 3P7KA 2IBZD 1N86A 2M3BA 3AE3C 4O9BA 3B5NB 1N7SC 2N1TC 1X8YA 1JCCA 4BWNA 4IFDK 3OAKA 3LW5H 1IK7A 2Z5HA 3MTUE 1JY2O 1YHQP 1L0NK 4U3FG 1L0LD 4Y28J 1PPJE 4R4LA 3CWBJ 1RF1A 2KYVA 1SQBG 1AFOA 5H2FE 1NTZK 3T97B 2C9NY 3OA7A 3V2PA 2AXTH 2OYHA 2GM4A 5KLVE 2NRGA 4JYBA 1DEBA 3PLNA 3TF5A 4KJMA 1E5WA 5L8RJ 5GTIE 2ZXXA 3G4SP 3GG2A 1IK9A 2C0WA 2HODA 3HUSA 1SQQD 2P67A 4OVNF 3G9RA 1HWTC 1FAVA 2FYUJ 5AW3B 1KB9H 1EDJA 2KUBA 2FXPA 2OARA 3RBZA 1FDMA 2LR2A 1P84H 1JTHA 2WZ7A 1W2EA 3L70G 2FYNC 1SQVJ 1NAYA 3L37A 4XE5B 2Y0CA 3D71A 3CMEP 1J1EC 1ZLLA 2LXBA 3H1IJ 3ZDMA 1A02F 2P10A 2A45G 5DJTB 1KMIZ 1VL2A 1NTZJ 1IFIA 3TGUE 1N2DC 2L91A 1A02J 1OXZA 3H32A 5AVQB 2BCCE 3L73J 2K37A 1W5CE 2QJKC 4H13C 1S1CX 2E76C 4PV1D 1E79H 1SQBK 4XFJA 1QLED 4AYCA 2O01J 3AEEC 2QJPC 1URQC 2Y0EA 3F89A 1BCCJ 2A45I 3VYIA 1PGOA 1KB9E 2ZT9C 4RESB 4Z1MH 1LTSC 2XDJA 3B4SA 1NTMG 5APTA 3A7OA 4PJ0E 2DW3A 3CCSP 4QMAA 2D2CD 2Q3EA 1XTCC 2BEQD 2M3EA 3P8CD 5KAFE 2RMZA 4EOTA 1OVRA 1OMIA 1LTIC 1CI6B 2WSFH 2LKMA 1RF1C 2IYPA 3M0AA 1VQ8P 1GTWA 1H0TA 2L5GB 1SQXE 2JDIH 3L72G 1OWAA 4H44D 2XZRA 2OYHC 2H7HA 5KLVJ 1T2KD 1G2CB 4OGQD 1NU1E 3L74G 2IX7C 2WITA 3R4YA 1BGYE 2W6BA 3HUSC 1IFPA 1VQ4P 3C8VA 1L4AB 3RK2C 2V7QH 3L75E 3C1LA 2B87A 1YQ3C 2UWJE 4IFMA 1SQPK 2K9JB 2AEFA 2HFED 1GK6A 5KJ7A 5KJ7D 1ZRTD 3B5NC 3RK3B 2OYOA 3GF3A 2IBZG 1KYOI 4I2LC 1FDOA 2R5DA 3CXHI 5KAIE 1JMBA 3KPEA 3V2QA 1CW5A 2M0BA 5AW5B 2FXMA 5AW9B 3CX5I 3SWKA 4A7PA 2XKMA 1PP9J 3CCMP 1L0LG 1VF5B 4RO0A 3CC7P 1SFCA 1DIPA 2KI7B 2KOGA 3GHGB 3MGNA 3BCCJ 2IBZI 3V2NA 3H1KE 1J1DB 2QA4P 3QH9A 1X79B 1FBMA 1FU1A 4TT3H 2A06E 2NPSB 4WY4B 5AW6B 1SQQG 5CCHD 3MUDA 2E42A 3VMZA 3HTKA 1SQPJ 3H1LJ 2JEEA 1HVVA 1RY3A 1HF9A 1SLQA 1FZAA 3WMM0 2YO3A 3AEGC 2KNCB 1YQ4C 1EXJA 2YXRB 3RL0g 1BE3E 1S9KD 5AVYB 3MHVA 1JM0A 4D6TD 2K9YA 1N73B 1VQNP 1FZCB 1AA0A 4UB8H 2KLVA 1GMJA 2WPSA 2Y9ZA 3CCLP 1N7SD 2N1TD 2E75C 2KK7A 3IR9A 3TNUA 1YI2P 4GKGA 3TGUD 2RN0A 4N3YB 3CWBE 1KQLA 2QRXA 1GD2E 3VOPA 2BCCD 2K3RA 3VMYA 1KILB 1OW6A 3II6A 2QIWA 3ITKA 3RL0C 3TDKA 3L75J 4YXDC 3AE5C 2O01H 1K73Q 2ZYGA 5B66E 2FYUG 1AV1A 4LC1A 1DEEG 1YYCA 1KB9D 3A3YB 3PP5A 1PL5A 2GUSA 3WUVA 2SPZA 1IZNB 1P84D 1JB0J 4IFFA 3FXDA 3GMAA 1OIPA 2QJYB 3M91A 1OX3A 2FFDA 1NGMB 3AE8C 1SFCC 3H1IG 3EQ2A 1ZN5A 1L0NE 1QVGO 4ZKUA 2KIKA 1SQXD 1QGKB 3OW2O 1AQ5A 2B9BA 1NTZE 2YIUB 3MP7B 1LTBC 1ZOYC 3NXSA 2J5UA 1NU1D 4PD4H 1TU3F 1OVUA 1HTLC 4I1LA 4NPEA 1IFDA 3CD6P 1BGYD 1GL2A 3RK3C 2RKLA 3L73E 5GTIH 3L74D 1XTGB 3Q3DA 1JCDA 3FWLA 4H13D 2E76D 2JO1A 1T3JA 2W90A 1NTKE 2FY8A 3CCUP 1BCCG 3AEFC 2XV5A 1DD4A 1EZVD 1KQGB 3ABVC 1URQA 1URQD 1BE3J 2JWAA 3HE4B 2OYIB 3L71E 4H0LC 1GU4A 2ZT9D 2WVRA 3R2PA 1OW7A 3AEBC 2PRRA 4N78E 4L74A 3HE5B 2QM8A 4U7JA 1J1DC 2KSJA 1ZMEC 1PPJG 3VMAA 1EDKA 3CCQP 3O6QB 1LP1B 3AE7C 5B5EH 1RQUA 2NPSC 4WY4C 2M5AA 4GIFA 3IFMA 2BEZF 3MD0A 2QEXP 4C7NB 3Q2YA 3PHLA 1LT9A 3H1KD 4L76A 1EXIA 1N8RQ 5GTHE 4PD4E 2XNDH 1FDIA 4GDOA 4LLHA 2LXCB 2ZVNB 5KKZB 2OGUA 3SSUA 1BSHA 3V6IA 4U3FE 3KXDA 2WT7A 3RK3E 1NTKK 3E1RA 1Y9BA 1SQBE 1PV3A 3TK1A 2H8PD 3RK2D 2IYOA 5C39A 5AW1B 4D6TG 4CPGA 3CPWO 3B5NA 3B5ND 4TLFA 2JR8A 3QWOC 3JSVC 3A0HE 1NVOA 1KFMA 4NPFX 1HGZA 3KQGA 4PJ0H 1VQOP 2WSEJ 2ITAA 2FFDC 1Q90D 2CK3H 2Q3IA 5TJHA 3M06A 1QL1A 5KAFH 3T97A 3V4QA 2HR3A 4WBAA 3PJSK 1YJWP 1PP9E 2I1KA 3TGUG 1L0NJ 1SVFA 1KILC 5B5EE 3GW6A 3L70E 2BCCG 3CWBD 3GF7A 1T6AA 1QEXA 3BCCE 1RE3A 1ZR4A 2O1JA 1JO5A 4OWFA 4L75A 2Z4EA 1MUUA 1S3JA 1GL2C 1YJ9P 1JY2P 5K5GB 4EI2A 2OQQA 1NTKJ 4YPCA 2J59M 2IPPA 1U7JA 2ZXEB 5M1BA 4IOIH 3H1JJ 4R4MA 5TISE 1SQPE 1IJDB 5AVWB 3H1LE 2FYUD 4H44B 3L71J 3KYQA 5E79H 2YMKA 4GOFA 4UB6E 5KAIH 4GOEA 2KLUA 5AVSB 2ZVOB 2W83C 3CL3D 1SQVD 2JP3A 3D6ZA 2E75D 4B86A 1LTJB 1QVFO 1SQXG 1KB9I 1FE6A 3H1ID 3VTPC 1Z56A 3H25A 1R5SA 1VQMP 2FKWB 1L0ND 1KILE 2OTKE 3D70A 1LT9C 2KXPB 1NWQA 2M8RA 1NU1G 1LNQA 1P84I 3AE9C 1YTZT 1JY3O 3CCRP 1NTZD 1NKNA 1HGVA 3VMXA 1BGYG 4IL6E 1VQ9P 3HD7B 4U3FJ 2H88C 1NH4A 3L73D 1FZGA 3L75G 2N9BA 1SQBJ 1U7MA 2WMMA 2O3JA 3RL0D 2E74C 3AECC 3LIEA 3OJAB 2BASA 1EZVG 3L72E 3U1AA 1VQ5P 1YJNP 1HBWA 5KLIB 1KYOE 2J58A 4HYTB 4W7ZA 2RH0A 4Y99B 1BCCD 2O01N
chains in the Genus database with same CATH topology
4BWNA 2ZVNB 3F89A 2ZVOB 4OWFA 3FX0A 3JSVC 2V4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BWN A;  2ZVN B;  3F89 A;  2ZVO B;  4OWF A;  3FX0 A;  3JSV C;  2V4H A; 
#chains in the Genus database with same CATH topology
 3BRV B;  3H1H E;  3HRN A;  3CX5 E;  5E79 E;  2HG5 D;  1FJK A;  1KC8 Q;  1CI6 A;  1WT6 A;  4K35 A;  5DJU B;  1EC5 A;  1L2P A;  5CBN A;  2WQY C;  2YMY A;  1NYH A;  1EZV I;  3PH0 A;  1G2C A;  1SFC D;  2IZ1 A;  1NTM K;  4HB1 A;  3L70 J;  3H1K G;  1PPJ D;  3NTN A;  1JY2 N;  3NFQ A;  1RE3 C;  3U1C A;  4HJG H;  1M1J B;  5APS A;  2A06 G;  1L4A A;  2IFN A;  2WPV B;  2QM7 A;  5KLV D;  4DJG A;  2HPC A;  4PD4 D;  4W80 A;  2K9J A;  3IF4 A;  1ZR2 A;  1KOR A;  1RF0 A;  3M9H A;  4XA4 A;  3N7N A;  1N7S B;  2N1T B;  3D6Y A;  3Q5R A;  3RK3 D;  1VQK P;  4N6J A;  1KFN A;  3W68 A;  5B66 H;  2WSS H;  3LID A;  5CJ4 A;  1BE3 G;  2Q6Q A;  2QVA A;  3G6E P;  4C7R A;  3CI9 A;  2ZYA A;  4H0L D;  5KTB A;  4IL6 X;  2CPS A;  2W6J H;  2IDB A;  3GHG A;  2WSE H;  3H6P A;  1YBK A;  2WSC H;  3G71 P;  1RE4 A;  1FS0 E;  3CCJ P;  1PP9 D;  1NTM J;  3FXE A;  3WU2 E;  3CWB G;  2NPS A;  2NPS D;  4WY4 A;  4WY4 D;  3CCE P;  3E1I A;  3BCC D;  2YO2 A;  2P2U A;  4BRY B;  1Y8A A;  1GZL A;  1L0L K;  1PGQ A;  1NAF A;  1JMM A;  1IFJ A;  1JOC A;  1K05 A;  1SS1 A;  1DD3 A;  2FYN B;  2VRS A;  1OZH A;  2KNC A;  1JEK A;  1S5L X;  2B89 A;  3F5H A;  3L72 J;  1J1E B;  1Q2N A;  2C9L Y;  3W67 A;  2Y9Y A;  1N73 A;  1OVV A;  1FZC A;  3JC2 2;  3CC4 P;  5CMZ A;  1SQP D;  4WB4 A;  1VQ7 P;  4NPD A;  3H1L D;  1IC2 A;  3MZW B;  3GLM A;  3H1H J;  1M7L A;  1NHL A;  1SQQ K;  3SFE C;  2R44 A;  1LWU B;  2KS1 B;  1FOS F;  1SQV G;  2WWW A;  1USE A;  5BU8 B;  2QJK B;  2IFM A;  4H13 B;  2E76 B;  2I1J A;  2JWD A;  1K8A Q;  3I5C A;  2AEM A;  3VP8 A;  2PAJ A;  5CHX A;  4WVZ A;  2QG4 A;  2PGD A;  4HH2 A;  2R3S A;  1EQ7 A;  1L0N G;  5APX A;  3HD7 C;  2N9Y B;  2MKV A;  1H88 A;  2Q5U A;  1NTZ G;  2P58 A;  1KIL A;  1KIL D;  2YKP A;  1H89 A;  1HH0 A;  1KTM A;  3P8C E;  1L4A C;  2I8D A;  1L0L J;  3JCU E;  5GTH H;  3L73 G;  1FZF A;  2FYZ A;  1VPC A;  3CLQ A;  5KLI C;  1RF0 C;  5CCG C;  1VQ6 P;  1CSB A;  2C0X A;  1GL2 D;  2Y0D A;  4Y99 C;  1M1K Q;  1PGP A;  2KB7 P;  1EDI A;  3L75 D;  3IAO A;  2ZYD A;  1IO4 A;  3Q5P A;  3CMA P;  1RF1 B;  1JUN A;  3H1J E;  1GU5 A;  3PTZ A;  3L71 G;  3AE6 C;  1PZQ A;  3UIA A;  1OFC X;  5AVU B;  1T3U A;  3L36 A;  1SQQ J;  2OYH B;  3H1H D;  1VF5 C;  3A0H H;  4I6M C;  4W7Y A;  2FYU K;  4ASV A;  3S4R A;  3GHG C;  1J2J B;  3USS A;  1ZXG A;  2R32 A;  1YIT P;  2Q9I A;  2HOD B;  3HUS B;  1RE4 C;  1AJY A;  4BXL A;  3FGA D;  3RK2 B;  2WPR A;  3Q1M A;  1SQV K;  1AQT A;  3TSI A;  5KLV G;  5BU5 A;  1M90 Q;  5AVT B;  3L4F A;  1JTH B;  1W2B O;  3AE2 C;  1WMK A;  2YNY A;  5AW8 B;  1ZV8 A;  1Q81 Q;  3PRJ A;  2A06 D;  2YXQ B;  2A45 H;  1GW3 A;  3HE4 A;  3VP9 A;  3I55 P;  5BVZ A;  1N73 C;  1ZW0 A;  2OYI A;  1FZC C;  1KV4 A;  1HUC A;  2E74 D;  5TIS H;  1EDL A;  5AVZ B;  2HLO A;  2Q1K A;  1LJ2 A;  3AED C;  1X9V A;  1NKZ B;  1MZ9 A;  4PD4 I;  4MN4 C;  2WPQ A;  3HE5 A;  4JYC A;  3H32 B;  1BE3 D;  2HYN A;  3RGU A;  1KN7 A;  4UB6 H;  1GW4 A;  5CBO A;  1BDC A;  2G3A A;  1LGH B;  2KSE A;  2OTJ P;  3O6Q A;  1LP1 A;  4PV1 B;  2Q7C A;  2W8Z A;  3G3Z A;  1Q86 Q;  1LTT C;  3SWF A;  2WSC J;  1PP9 G;  4C7N A;  1S9K E;  5APQ A;  5AVR B;  3P8M C;  4D6T E;  1S72 P;  3Q5S A;  3BCC G;  3BAS A;  1LTA C;  1HJ0 A;  2QSI A;  4AUW A;  2YKQ A;  4IL6 H;  1VQP P;  2MJZ A;  4K3A A;  1Q7Y Q;  1FZE A;  4C46 A;  1NJI Q;  2D2C B;  2K1A A;  2E75 B;  5KLV K;  1LWU C;  1SQP G;  2Z5I A;  2AXT E;  3H1L G;  1S2E A;  5APY A;  1NO4 A;  1KYO H;  3M0D C;  1H0T B;  1S4X A;  2QJY C;  3CXH H;  3IN6 A;  1CZQ A;  1KD1 Q;  4OGQ B;  3CX5 H;  2W27 A;  5AW0 B;  4JF7 A;  4L73 A;  4GOD A;  2XU6 A;  3CCV P;  2YKO A;  1FJP A;  1YTZ I;  1S5L H;  3RL0 B;  1M8O B;  3EFG A;  2YIU C;  4YTP C;  2B87 B;  4M3L A;  1RQV A;  2KZJ A;  3KZI H;  1P84 E;  2O1K A;  5AW7 B;  5APW A;  1NTM E;  1ZP0 C;  1PGJ A;  1X0T A;  1Y47 A;  2P7J A;  3V5B A;  3BVH A;  1X22 A;  2ZAE B;  2H89 C;  4I7Z B;  2JKV A;  3V2R A;  2AEJ A;  3SWY A;  2OTL P;  2OYI C;  1SFC B;  1NTK D;  1USD A;  1GDT A;  1IFN A;  2AXC A;  1KQF B;  5APU A;  3BAT A;  3H1H G;  4ZMD A;  3H1J D;  3K5B A;  3L74 E;  3CXH E;  1KZU B;  1IFM A;  4EIJ A;  3EFF K;  4ZNC A;  3L35 A;  3L71 D;  2V4H A;  4HKZ H;  2HPC B;  1DH3 A;  1LTJ A;  1M57 D;  1EZV E;  1R5L A;  1UII A;  4N78 D;  1S5L E;  4D6T J;  3KDP B;  4EYY Q;  2GUV A;  3HTK B;  1FOS E;  3RBX A;  2GA1 A;  2QE7 H;  3U59 A;  3WU2 H;  3KZI E;  2IBZ E;  5KKZ C;  3HD7 A;  3HD7 D;  4JPZ B;  1UIX A;  2FBW C;  3LW5 J;  3KHU A;  4H0L B;  1U57 A;  1G1I A;  1RH5 B;  1L4A D;  3S1K A;  3A2A A;  1L0L E;  1SQX K;  3TGU J;  3AE1 C;  3WUT A;  5CCG A;  5CCG D;  1BSN A;  3EWK A;  4U3F D;  1NU1 K;  2BCC J;  1SQB D;  2KZI A;  3FX0 A;  1PIX A;  1D7M A;  4YXW H;  1Q82 Q;  3TNU B;  1MKM A;  4EDF A;  1JY3 P;  4PV1 C;  4DOJ A;  1K9M Q;  3S9O A;  1PFI A;  5CCH A;  1MV8 A;  3VN0 A;  2G8Y A;  1OW8 A;  1SQQ E;  1MFT A;  1FZB A;  1VF5 D;  2K88 A;  1R8E A;  1HJB A;  3B8E B;  1QX8 A;  3A0B H;  4DT0 A;  2IZ0 A;  4DCK A;  2CPB A;  4RJT A;  1YIJ P;  2WTY A;  1SP4 A;  1M1J A;  2D2C C;  3O8Z A;  2ZFC A;  1AVY A;  2PFX A;  1NOH A;  1N7S A;  2N1T A;  3L70 D;  5AW2 B;  2NZ2 A;  4RKU J;  3JCU H;  3P32 A;  3M9Q A;  1SQX J;  4KT0 J;  1G1J A;  4H44 C;  4WWI A;  1QL2 A;  2FFD B;  1T2K C;  2E5Y A;  4OGQ C;  3C9I A;  1NU1 J;  1WRG A;  3AE4 C;  1RHZ B;  1BGY J;  3L74 J;  2JJL A;  3M9B A;  5EFW B;  5AVV B;  3FWN A;  1N7L A;  3I56 P;  2W6A A;  5AW4 B;  1LTJ C;  2XNX A;  1MFZ A;  4KHX A;  5KJ7 C;  2ZJS E;  4ASW A;  1GL2 B;  4OH8 B;  2FYU E;  2R5B A;  3A0B E;  2B88 A;  3CC2 P;  3WUU A;  2P1J A;  4BRY A;  2QJP B;  2PP6 A;  4UB8 E;  4GT1 A;  4I7Z C;  1URQ B;  2KP8 A;  5AVX B;  3B71 A;  1NTM D;  3N4X A;  1SQV E;  4JBZ A;  3BRT B;  4JQ0 D;  3E7K A;  2POH A;  2ZT9 B;  1T8Z A;  3MIW A;  2WSF J;  2R3C A;  1JY3 N;  3H1I E;  5CJ0 A;  5H2F H;  2E43 A;  3AEA C;  1NTK G;  3H1K J;  3V4W A;  1K04 A;  1VQL P;  4AQR D;  1GK4 A;  5APV A;  3H1J G;  3L72 D;  1H8A A;  3NMD A;  1LWU A;  2KS1 A;  3SFD C;  2M5A B;  1BDD A;  4ZKP A;  1KYO D;  5CCH C;  3M0D A;  3MUD C;  1LT9 B;  3CXH D;  2H43 A;  2V7Q J;  3A5T A;  4LGD E;  3CX5 D;  1LTG C;  1AVO A;  1VDF A;  3TYY A;  1JNM A;  2E5T A;  1DX7 A;  1ZRT E;  1M56 D;  4DZO A;  2WT7 B;  1KQS O;  2FXO A;  1BCC E;  1M1J C;  2E74 B;  1LT1 A;  1FC2 C;  3P7K A;  2IBZ D;  1N86 A;  2M3B A;  3AE3 C;  4O9B A;  3B5N B;  1N7S C;  2N1T C;  1X8Y A;  1JCC A;  4BWN A;  4IFD K;  3OAK A;  3LW5 H;  1IK7 A;  2Z5H A;  3MTU E;  1JY2 O;  1YHQ P;  1L0N K;  4U3F G;  1L0L D;  4Y28 J;  1PPJ E;  4R4L A;  3CWB J;  1RF1 A;  2KYV A;  1SQB G;  1AFO A;  5H2F E;  1NTZ K;  3T97 B;  2C9N Y;  3OA7 A;  3V2P A;  2AXT H;  2OYH A;  2GM4 A;  5KLV E;  2NRG A;  4JYB A;  1DEB A;  3PLN A;  3TF5 A;  4KJM A;  1E5W A;  5L8R J;  5GTI E;  2ZXX A;  3G4S P;  3GG2 A;  1IK9 A;  2C0W A;  2HOD A;  3HUS A;  1SQQ D;  2P67 A;  4OVN F;  3G9R A;  1HWT C;  1FAV A;  2FYU J;  5AW3 B;  1KB9 H;  1EDJ A;  2KUB A;  2FXP A;  2OAR A;  3RBZ A;  1FDM A;  2LR2 A;  1P84 H;  1JTH A;  2WZ7 A;  1W2E A;  3L70 G;  2FYN C;  1SQV J;  1NAY A;  3L37 A;  4XE5 B;  2Y0C A;  3D71 A;  3CME P;  1J1E C;  1ZLL A;  2LXB A;  3H1I J;  3ZDM A;  1A02 F;  2P10 A;  2A45 G;  5DJT B;  1KMI Z;  1VL2 A;  1NTZ J;  1IFI A;  3TGU E;  1N2D C;  2L91 A;  1A02 J;  1OXZ A;  3H32 A;  5AVQ B;  2BCC E;  3L73 J;  2K37 A;  1W5C E;  2QJK C;  4H13 C;  1S1C X;  2E76 C;  4PV1 D;  1E79 H;  1SQB K;  4XFJ A;  1QLE D;  4AYC A;  2O01 J;  3AEE C;  2QJP C;  1URQ C;  2Y0E A;  3F89 A;  1BCC J;  2A45 I;  3VYI A;  1PGO A;  1KB9 E;  2ZT9 C;  4RES B;  4Z1M H;  1LTS C;  2XDJ A;  3B4S A;  1NTM G;  5APT A;  3A7O A;  4PJ0 E;  2DW3 A;  3CCS P;  4QMA A;  2D2C D;  2Q3E A;  1XTC C;  2BEQ D;  2M3E A;  3P8C D;  5KAF E;  2RMZ A;  4EOT A;  1OVR A;  1OMI A;  1LTI C;  1CI6 B;  2WSF H;  2LKM A;  1RF1 C;  2IYP A;  3M0A A;  1VQ8 P;  1GTW A;  1H0T A;  2L5G B;  1SQX E;  2JDI H;  3L72 G;  1OWA A;  4H44 D;  2XZR A;  2OYH C;  2H7H A;  5KLV J;  1T2K D;  1G2C B;  4OGQ D;  1NU1 E;  3L74 G;  2IX7 C;  2WIT A;  3R4Y A;  1BGY E;  2W6B A;  3HUS C;  1IFP A;  1VQ4 P;  3C8V A;  1L4A B;  3RK2 C;  2V7Q H;  3L75 E;  3C1L A;  2B87 A;  1YQ3 C;  2UWJ E;  4IFM A;  1SQP K;  2K9J B;  2AEF A;  2HFE D;  1GK6 A;  5KJ7 A;  5KJ7 D;  1ZRT D;  3B5N C;  3RK3 B;  2OYO A;  3GF3 A;  2IBZ G;  1KYO I;  4I2L C;  1FDO A;  2R5D A;  3CXH I;  5KAI E;  1JMB A;  3KPE A;  3V2Q A;  1CW5 A;  2M0B A;  5AW5 B;  2FXM A;  5AW9 B;  3CX5 I;  3SWK A;  4A7P A;  2XKM A;  1PP9 J;  3CCM P;  1L0L G;  1VF5 B;  4RO0 A;  3CC7 P;  1SFC A;  1DIP A;  2KI7 B;  2KOG A;  3GHG B;  3MGN A;  3BCC J;  2IBZ I;  3V2N A;  3H1K E;  1J1D B;  2QA4 P;  3QH9 A;  1X79 B;  1FBM A;  1FU1 A;  4TT3 H;  2A06 E;  2NPS B;  4WY4 B;  5AW6 B;  1SQQ G;  5CCH D;  3MUD A;  2E42 A;  3VMZ A;  3HTK A;  1SQP J;  3H1L J;  2JEE A;  1HVV A;  1RY3 A;  1HF9 A;  1SLQ A;  1FZA A;  3WMM 0;  2YO3 A;  3AEG C;  2KNC B;  1YQ4 C;  1EXJ A;  2YXR B;  3RL0 g;  1BE3 E;  1S9K D;  5AVY B;  3MHV A;  1JM0 A;  4D6T D;  2K9Y A;  1N73 B;  1VQN P;  1FZC B;  1AA0 A;  4UB8 H;  2KLV A;  1GMJ A;  2WPS A;  2Y9Z A;  3CCL P;  1N7S D;  2N1T D;  2E75 C;  2KK7 A;  3IR9 A;  3TNU A;  1YI2 P;  4GKG A;  3TGU D;  2RN0 A;  4N3Y B;  3CWB E;  1KQL A;  2QRX A;  1GD2 E;  3VOP A;  2BCC D;  2K3R A;  3VMY A;  1KIL B;  1OW6 A;  3II6 A;  2QIW A;  3ITK A;  3RL0 C;  3TDK A;  3L75 J;  4YXD C;  3AE5 C;  2O01 H;  1K73 Q;  2ZYG A;  5B66 E;  2FYU G;  1AV1 A;  4LC1 A;  1DEE G;  1YYC A;  1KB9 D;  3A3Y B;  3PP5 A;  1PL5 A;  2GUS A;  3WUV A;  2SPZ A;  1IZN B;  1P84 D;  1JB0 J;  4IFF A;  3FXD A;  3GMA A;  1OIP A;  2QJY B;  3M91 A;  1OX3 A;  2FFD A;  1NGM B;  3AE8 C;  1SFC C;  3H1I G;  3EQ2 A;  1ZN5 A;  1L0N E;  1QVG O;  4ZKU A;  2KIK A;  1SQX D;  1QGK B;  3OW2 O;  1AQ5 A;  2B9B A;  1NTZ E;  2YIU B;  3MP7 B;  1LTB C;  1ZOY C;  3NXS A;  2J5U A;  1NU1 D;  4PD4 H;  1TU3 F;  1OVU A;  1HTL C;  4I1L A;  4NPE A;  1IFD A;  3CD6 P;  1BGY D;  1GL2 A;  3RK3 C;  2RKL A;  3L73 E;  5GTI H;  3L74 D;  1XTG B;  3Q3D A;  1JCD A;  3FWL A;  4H13 D;  2E76 D;  2JO1 A;  1T3J A;  2W90 A;  1NTK E;  2FY8 A;  3CCU P;  1BCC G;  3AEF C;  2XV5 A;  1DD4 A;  1EZV D;  1KQG B;  3ABV C;  1URQ A;  1URQ D;  1BE3 J;  2JWA A;  3HE4 B;  2OYI B;  3L71 E;  4H0L C;  1GU4 A;  2ZT9 D;  2WVR A;  3R2P A;  1OW7 A;  3AEB C;  2PRR A;  4N78 E;  4L74 A;  3HE5 B;  2QM8 A;  4U7J A;  1J1D C;  2KSJ A;  1ZME C;  1PPJ G;  3VMA A;  1EDK A;  3CCQ P;  3O6Q B;  1LP1 B;  3AE7 C;  5B5E H;  1RQU A;  2NPS C;  4WY4 C;  2M5A A;  4GIF A;  3IFM A;  2BEZ F;  3MD0 A;  2QEX P;  4C7N B;  3Q2Y A;  3PHL A;  1LT9 A;  3H1K D;  4L76 A;  1EXI A;  1N8R Q;  5GTH E;  4PD4 E;  2XND H;  1FDI A;  4GDO A;  4LLH A;  2LXC B;  2ZVN B;  5KKZ B;  2OGU A;  3SSU A;  1BSH A;  3V6I A;  4U3F E;  3KXD A;  2WT7 A;  3RK3 E;  1NTK K;  3E1R A;  1Y9B A;  1SQB E;  1PV3 A;  3TK1 A;  2H8P D;  3RK2 D;  2IYO A;  5C39 A;  5AW1 B;  4D6T G;  4CPG A;  3CPW O;  3B5N A;  3B5N D;  4TLF A;  2JR8 A;  3QWO C;  3JSV C;  3A0H E;  1NVO A;  1KFM A;  4NPF X;  1HGZ A;  3KQG A;  4PJ0 H;  1VQO P;  2WSE J;  2ITA A;  2FFD C;  1Q90 D;  2CK3 H;  2Q3I A;  5TJH A;  3M06 A;  1QL1 A;  5KAF H;  3T97 A;  3V4Q A;  2HR3 A;  4WBA A;  3PJS K;  1YJW P;  1PP9 E;  2I1K A;  3TGU G;  1L0N J;  1SVF A;  1KIL C;  5B5E E;  3GW6 A;  3L70 E;  2BCC G;  3CWB D;  3GF7 A;  1T6A A;  1QEX A;  3BCC E;  1RE3 A;  1ZR4 A;  2O1J A;  1JO5 A;  4OWF A;  4L75 A;  2Z4E A;  1MUU A;  1S3J A;  1GL2 C;  1YJ9 P;  1JY2 P;  5K5G B;  4EI2 A;  2OQQ A;  1NTK J;  4YPC A;  2J59 M;  2IPP A;  1U7J A;  2ZXE B;  5M1B A;  4IOI H;  3H1J J;  4R4M A;  5TIS E;  1SQP E;  1IJD B;  5AVW B;  3H1L E;  2FYU D;  4H44 B;  3L71 J;  3KYQ A;  5E79 H;  2YMK A;  4GOF A;  4UB6 E;  5KAI H;  4GOE A;  2KLU A;  5AVS B;  2ZVO B;  2W83 C;  3CL3 D;  1SQV D;  2JP3 A;  3D6Z A;  2E75 D;  4B86 A;  1LTJ B;  1QVF O;  1SQX G;  1KB9 I;  1FE6 A;  3H1I D;  3VTP C;  1Z56 A;  3H25 A;  1R5S A;  1VQM P;  2FKW B;  1L0N D;  1KIL E;  2OTK E;  3D70 A;  1LT9 C;  2KXP B;  1NWQ A;  2M8R A;  1NU1 G;  1LNQ A;  1P84 I;  3AE9 C;  1YTZ T;  1JY3 O;  3CCR P;  1NTZ D;  1NKN A;  1HGV A;  3VMX A;  1BGY G;  4IL6 E;  1VQ9 P;  3HD7 B;  4U3F J;  2H88 C;  1NH4 A;  3L73 D;  1FZG A;  3L75 G;  2N9B A;  1SQB J;  1U7M A;  2WMM A;  2O3J A;  3RL0 D;  2E74 C;  3AEC C;  3LIE A;  3OJA B;  2BAS A;  1EZV G;  3L72 E;  3U1A A;  1VQ5 P;  1YJN P;  1HBW A;  5KLI B;  1KYO E;  2J58 A;  4HYT B;  4W7Z A;  2RH0 A;  4Y99 B;  1BCC D;  2O01 N; 
#chains in the Genus database with same CATH homology
 4BWN A;  2ZVN B;  3F89 A;  2ZVO B;  4OWF A;  3FX0 A;  3JSV C;  2V4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...