3F89A

Nemo cozi domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
EDLRQQLQQAEEALVAKQELIDKLKEEAEQHNIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords NF-kappa-B essential modulator
publication title Specific recognition of linear ubiquitin chains by NEMO is important for NF-kappaB activation
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 3f89A00
3FX0A 2V4HA 4OWFA 4BWNA 2ZVNB 2ZVOB 3JSVC 3F89A
chains in the Genus database with same CATH superfamily
1SQQK 2QE7H 2O01J 2FYUG 2GUVA 4W7YA 1NTKE 3R2PA 3L70G 2E76D 1NGMB 3KZIE 1G1IA 2MJZA 2QM8A 5E79H 2FXOA 1DIPA 3VMAA 3I56P 1P84I 2IYPA 1ZLLA 3H1KD 3KXDA 1EZVI 2WZ7A 5M1BA 2IZ1A 4YPCA 2E43A 2QG4A 1AQ5A 1N73A 1NU1E 4I7ZC 2B87A 4H13C 1GW3A 3HUSA 4DOJA 3CCLP 1ZRTD 4Y28J 1YJ9P 3NTNA 1LP1B 1JY3N 3HTKA 3MP7B 1GL2D 3CWBJ 2PAJA 1GW4A 2E42A 3AEDC 2ZT9C 5KAFE 2W8ZA 1S5LH 1M90Q 2YKQA 4A7PA 1NTZE 1OXZA 2E74D 2ZFCA 1DX7A 1URQB 3S9OA 1BSHA 1RE3C 3CLQA 3V6IA 2J59M 1FE6A 3JC22 1OIPA 1LTJA 2M8RA 1KILC 3H1HE 1BCCJ 3UIAA 3KHUA 2KZIA 5GTIE 3H1JG 1CZQA 4NPEA 4TLFA 3S4RA 1WRGA 3GMAA 1N73B 1RY3A 2JWAA 3C8VA 1BE3D 4EYYQ 3TGUJ 5AVSB 2B87B 2CPBA 1SQXK 1NTMJ 2FFDC 4L73A 3HUSB 3Q5PA 1FZFA 1G1JA 1OZHA 1K73Q 2Q1KA 3FXEA 3HTKB 3NXSA 3V2QA 2V7QJ 4QMAA 1RF0C 3VP9A 1VPCA 4WVZA 1SVFA 2Q3EA 4EDFA 1WT6A 1YQ3C 2QJPC 5TJHA 4D6TG 2WSEJ 1LTBC 1S9KE 2N9YB 3MIWA 1SQBD 4L76A 1DD4A 1LTJB 3VTPC 3CCMP 2P1JA 3L75J 3QH9A 5APSA 1VF5C 1RE3A 2XNDH 1P84E 2WPQA 3KZIH 2BCCE 2H89C 5AW9B 1EZVE 1HJBA 3MD0A 3CXHI 1KILA 3VN0A 4DJGA 4ZMDA 1H89A 2G8YA 2AEFA 2R3CA 4IOIH 2XNXA 3GG2A 1TU3F 2O3JA 2K37A 4XFJA 5CJ0A 1KYOI 1ZXGA 3M0AA 4ZKUA 1OVVA 4I7ZB 3I5CA 4H13B 1S3JA 1X9VA 2JO1A 3G71P 2FFDA 1NU1D 3NFQA 3CCSP 1AJYA 3BVHA 2KS1A 1N7SD 2I1JA 5KLIC 2YNYA 2C0XA 1L0LE 2D2CC 5KJ7C 1JY2O 2ZT9B 3AE4C 3GHGC 1FJPA 1RF0A 3L37A 1HGVA 1E5WA 2K9YA 2KSEA 3WUVA 1FAVA 1J1DC 3HRNA 3A5TA 2WPRA 1CI6A 4PV1C 1KILB 2B88A 3CX5I 3H1IG 3VMZA 1VQPP 1X22A 1HH0A 4OGQD 4WY4D 3H1HD 2YKPA 3L71G 3O6QB 3FWNA 1KQFB 2RN0A 2WSFJ 1RF1C 1DEBA 1T6AA 2FFDB 2KIKA 1SQQD 2KS1B 2N1TD 3JSVC 1FZEA 1YQ4C 1DH3A 2GA1A 4IL6X 2IBZI 2LXBA 1K9MQ 1Q2NA 2NPSA 1VQNP 3BASA 5AW5B 1GD2E 2JR8A 1PP9G 2QVAA 2QJPB 3TNUA 1JY3O 5KJ7A 3PP5A 1OMIA 1G2CA 3F5HA 1LT1A 3GHGA 2P2UA 2AXTE 2E76C 1M8OB 1CI6B 1M1KQ 5AVWB 3SFEC 4WB4A 1FDMA 3CXHE 1VF5B 4JPZB 1JTHA 3GW6A 5CBOA 2XV5A 2FYUJ 3L70J 3U1CA 3N7NA 2IZ0A 4R4MA 1KYOE 2Y0DA 3BCCG 1P84D 1AV1A 5KLVJ 2BCCD 4JYCA 2P10A 5B5EE 4RJTA 2WPSA 3RBZA 1PZQA 4HJGH 4GKGA 2A45H 3AE6C 5B66H 3CCQP 1BDDA 1VQLP 1GL2C 1NKNA 1NO4A 1SQBK 5DJTB 2IYOA 1RF1A 2XKMA 1HGZA 1L0NG 1LTSC 2NPSB 4NPFX 2Z5IA 2YO3A 3FWLA 2E74C 1QX8A 2RMZA 5KLIB 1SLQA 3TNUB 4IFMA 2D2CB 4R4LA 1NH4A 1BGYD 1G2CB 4JQ0D 3GHGB 1SQXD 3B5ND 1NTKK 2O01N 2JEEA 1L0LD 1A02F 3H1KG 1QVFO 1IO4A 1JTHB 1OX3A 1JO5A 1J1DB 1HUCA 3CX5E 2ZVNB 3M91A 1NAFA 1NHLA 3O8ZA 5CBNA 4PJ0H 1USEA 3Q3DA 1SQVE 4PV1B 1NU1K 1MV8A 3MZWB 2QIWA 1VQ9P 3H1JJ 1CW5A 2KUBA 2ZAEB 4BRYA 2E75D 1QLED 3M0DC 1PL5A 2J5UA 1BDCA 2AEMA 2J58A 2E5TA 1KB9H 1RQVA 3W68A 1H0TA 1RF1B 3E1IA 3VP8A 4IL6H 2IBZE 3L73G 1JY2N 1NTZK 1KB9D 3II6A 1GL2A 3L70E 4L75A 5AW3B 1KV4A 3D6YA 2ZJSE 4I2LC 3V5BA 1LWUC 5APVA 2P7JA 1OFCX 1EDJA 1EQ7A 1GU5A 3CD6P 5KTBA 3RL0C 2OYOA 3Q1MA 3HE5A 2BASA 4D6TJ 2CPSA 3FGAD 3BRVB 3KPEA 1BE3G 3L35A 2E76B 5BU5A 3A0HH 4AUWA 1QL2A 2I1KA 1MFTA 3L72E 4BRYB 1KFNA 3TF5A 3A0BE 3CXHD 4Z1MH 3VMYA 2V4HA 1H8AA 3I55P 1Q82Q 1FBMA 4GOFA 1SFCC 5KLVG 1H0TB 4U3FD 3AE8C 5H2FE 1UIIA 3ZDMA 2M5AA 5AW4B 2WVRA 2FBWC 3M0DA 1N7SC 1KYOD 3AEFC 2XU6A 3SFDC 3IF4A 1CSBA 1GL2B 3SWKA 5AW0B 1SQBG 1L4AD 1JCCA 2HLOA 3WUTA 2YXQB 1R5SA 3JCUE 1N7LA 1ZW0A 2E74B 2G3AA 1VQ8P 2WSCH 3HE5B 1LWUA 2O1KA 4UB8E 3RK3D 1KORA 1EXJA 5AW2B 5CCGD 1FDIA 3LIDA 1FDOA 4WY4C 3EFFK 3OA7A 4DCKA 1L2PA 2KLUA 1ZR4A 3H25A 3CX5D 3IFMA 2HYNA 1NU1G 4GOEA 3H1IJ 3K5BA 2M5AB 5DJUB 4PD4I 2WPVB 1SQVD 1SQPE 3PLNA 1PGQA 3L71J 1URQD 4W7ZA 1KILE 1ZV8A 2IDBA 2W27A 2FYNC 1SFCA 1L0LK 3D6ZA 2RH0A 4HYTB 1N7SA 1YBKA 1LTAC 1YJWP 1FZGA 4RO0A 1LWUB 3LW5H 3B8EB 1GTWA 2FKWB 5GTHH 1NOHA 1H88A 3CC7P 2JWDA 2QJYC 2HPCA 3RL0B 2SPZA 1PP9J 3VYIA 3H1HG 2LXCB 3M9BA 3WU2H 2QA4P 3CCUP 5CJ4A 3F89A 4C7RA 2NRGA 1U57A 2PP6A 2OTLP 4HH2A 3RBXA 4IFFA 4KHXA 4I1LA 1SQQG 3AEAC 1Q86Q 1IFIA 3CCEP 4WY4A 3CWBE 2UWJE 1M56D 2P58A 5APQA 3BCCJ 1NTKD 3L72D 1SFCB 3Q2YA 2WSSH 4GIFA 2M3EA 3KQGA 3OAKA 1N7SB 1PPJE 1U7MA 1FOSE 3O6QA 5AVQB 1FS0E 2IX7C 2HODA 2CK3H 2FYZA 1T2KD 3WUUA 1L0NJ 4GDOA 1Y9BA 3U1AA 1BCCE 2HPCB 1S4XA 2FY8A 2K9JA 2Y0CA 2W6AA 3GF7A 1AVYA 5KAFH 5CCHD 1JY3P 3L71E 1YTZI 3TGUE 1NTME 4W80A 1RQUA 2BCCG 3M9HA 4H13D 4CPGA 3GF3A 3H1KJ 4ZNCA 1GDTA 3PRJA 1NTZD 1HVVA 4WY4B 2E75C 1EC5A 2Q3IA 4PD4E 3CMAP 3L36A 1OVRA 2YXRB 1JOCA 5CHXA 5GTIH 5BVZA 5TISE 3V4QA 2A45G 3P8CE 2ZT9D 3A7OA 4DZOA 4XE5B 1QEXA 1PP9E 1Y8AA 1IFPA 2BEZF 1K8AQ 2JJLA 3AE5C 3L4FA 1N2DC 3P8MC 2HODB 1IFDA 1BGYG 2FYNB 1IZNB 1SQXG 1SQPD 2YKOA 3L75E 1SS1A 1L0LG 3HE4A 2WSCJ 2O01H 1KILD 3L73J 2H88C 1S72P 2K9JB 2Z4EA 1T3JA 1M57D 1OWAA 4L74A 3L74G 3P7KA 4ZKPA 1K04A 1IFJA 1GK4A 3NMDA 2QJYB 1SQVK 2FXMA 5AVTB 4YXDC 4OH8B 1BE3J 2AXCA 1LT9C 4LLHA 1N86A 3AE7C 1S9KD 2A06E 2JDIH 1L0NE 4N78E 1P84H 3BRTB 3CI9A 4K35A 1PGPA 3GLMA 1JMBA 1NAYA 3SWFA 4UB6E 3ITKA 3RK2D 3RGUA 3OJAB 1XTGB 3CWBD 1L4AC 1EZVD 5APWA 2KK7A 3HE4B 3CPWO 2H7HA 4H0LD 1X0TA 3H1KE 1ZMEC 2W6JH 3D71A 3LW5J 4BXLA 5E79E 4KJMA 3H1LG 1SQBJ 2KYVA 5APUA 1LTGC 1VQOP 3HD7D 1PPJD 2W83C 2B9BA 3N4XA 3CCJP 3AECC 3RK3C 2K3RA 2Y9YA 3TDKA 3S1KA 1MKMA 3QWOC 4H44D 4XA4A 1HJ0A 4RESB 1BCCD 4OWFA 1LJ2A 2IPPA 3AE3C 4U3FG 5KKZC 1NWQA 3L71D 3W67A 4LGDE 3LIEA 3TGUD 3L73E 2NPSD 3G6EP 1NTMD 1S5LE 1OW6A 2E75B 2KB7P 1LT9A 1DEEG 1ZOYC 3CCVP 1NU1J 5APXA 2D2CD 4MN4C 1GZLA 5KJ7D 4U7JA 2ZYGA 2WSEH 1FZAA 3SWYA 1RH5B 3PHLA 3VMXA 1QVGO 2POHA 3C1LA 2WQYC 5AVRB 1L4AA 2KP8A 4C46A 1ZN5A 2FYUE 5APYA 3H6PA 3B71A 3L75D 1VL2A 1S1CX 2R5DA 1AA0A 3MHVA 2HR3A 2W6BA 5KLVE 3FX0A 4EOTA 1SQVG 1ZP0C 1T8ZA 1A02J 3H1HJ 2AXTH 2QJKC 4RKUJ 1VQKP 1LT9B 1SQPK 3CXHH 1FZCC 2PRRA 3U59A 2KXPB 1GK6A 1EXIA 1T3UA 2R32A 2WTYA 1SQQJ 1IK7A 2K1AA 1NJIQ 2QM7A 2A06D 1S2EA 1L0ND 1W5CE 1KYOH 3R4YA 4N78D 5K5GB 2QRXA 1YHQP 4WWIA 1VQ4P 1Q81Q 1JUNA 5B5EH 3CCRP 1YIJP 1T2KC 1L4AB 2Z5HA 1PGJA 2HFED 1PIXA 3G3ZA 3V2PA 5AW7B 3G9RA 4EI2A 5CCHC 2R3SA 2RKLA 5L8RJ 2WMMA 2B89A 1PV3A 3EQ2A 4ASWA 3RK3B 3H1JE 5APTA 4O9BA 1Y47A 2Q5UA 4OVNF 2OYIC 3CL3D 3A2AA 3MUDC 1Q90D 2WSFH 2A45I 2E5YA 4TT3H 1NTKG 3L72G 2IFMA 2BCCJ 3C9IA 5KKZB 2H8PD 3CX5H 1N8RQ 1VQ5P 2OTJP 2QEXP 2LR2A 4OGQC 1AVOA 1YITP 3WMM0 1J2JB 4GODA 1FZCA 3L73D 1RE4C 3V2RA 1VQMP 5AVXB 2N1TC 4D6TE 1YTZT 2XDJA 3V4WA 1BGYJ 3B4SA 1SQXJ 3AEBC 1QL1A 1L0LJ 1GU4A 2LKMA 2XZRA 3MGNA 1YJNP 1SQQE 2GM4A 1NTZG 1NTMK 4IFDK 1JNMA 2L5GB 2KNCA 2L91A 1ZR2A 5CCHA 1EDLA 1JY2P 2IBZD 3L74J 1BSNA 4DT0A 2FYUD 3L70D 2ZVOB 1KB9I 1HTLC 1X8YA 4Y99C 3TK1A 1Z56A 1EDKA 3E7KA 2Q7CA 2ZXEB 3D70A 2OYIA 3MUDA 4I6MC 1NKZB 3USSA 2QJKB 1K05A 3ABVC 5KLVD 3KDPB 3IN6A 1HWTC 3RK2C 1KC8Q 1SQPG 1SP4A 1FZCB 3CC2P 1DD3A 1JEKA 1VDFA 5AW1B 2Q9IA 3A0BH 4H0LC 1R5LA 4WBAA 2MKVA 4ASVA 3RL0D 2KZJA 1U7JA 2W90A 1W2EA 5H2FH 1RE4A 4C7NA 2P67A 4K3AA 1KZUB 3HD7C 3H32A 2N1TA 1D7MA 3Q5RA 3FXDA 2K88A 2KNCB 3M06A 3AE2C 2ZXXA 3H1LJ 4H44C 2WT7A 3B5NC 3JCUH 2ZYAA 3H1IE 1AQTA 1MZ9A 1RHZB 5B66E 5KAIE 1FC2C 1SFCD 1L0NK 1MFZA 4UB8H 2NPSC 2OYIB 2M3BA 3H1JD 1J1EC 4JF7A 1BGYE 1WMKA 1SQXE 5AVVB 4U3FJ 2OQQA 3CWBG 1IFMA 1EZVG 3IAOA 1X79B 4BWNA 1M7LA 2YIUC 4OGQB 1Q7YQ 4B86A 3TYYA 3T97A 1OW8A 3Q5SA 1VQ6P 2OGUA 3L74E 1LTIC 1PPJG 3BATA 3AE1C 4C7NB 2DW3A 1PFIA 2YMYA 1KTMA 3H32B 1FJKA 2R44A 4AQRD 3AEGC 2N1TB 4PJ0E 2OYHC 3PH0A 2R5BA 5AVZB 4YTPC 1BCCG 2NZ2A 2JP3A 2H43A 2WT7B 4N3YB 4D6TD 3EFGA 3RL0g 3HD7A 1JM0A 1KN7A 3TGUG 1NTMG 1KB9E 2VRSA 1EDIA 2HG5D 2KOGA 2IFNA 4IL6E 3BCCE 3G4SP 3B5NA 2Y9ZA 1QGKB 1SQVJ 4Y99B 1W2BO 2C9LY 2Y0EA 1M1JC 1GMJA 3T97B 4YXWH 3A3YB 3H1LE 2KI7B 3RK2B 1JCDA 1HBWA 1KMIZ 4EIJA 1IFNA 2C0WA 5BU8B 1PGOA 4H0LB 4JBZA 3L75G 1OW7A 4LC1A 2KSJA 3A0HE 2FYUK 5CMZA 2BEQD 1JMMA 1JB0J 3HD7B 2QSIA 4U3FE 1KFMA 2ZYDA 2OYHA 5EFWB 1LTTC 1LNQA 1VF5D 2OARA 5KLVK 4KT0J 3SSUA 4H44B 3VOPA 3B5NB 1KQSO 5AVUB 1ZRTE 3CMEP 5KAIH 1LGHB 2I8DA 1OVUA 5CCGC 3PJSK 3H1ID 3E1RA 2A06G 1HF9A 2AEJA 1YYCA 2YO2A 2C9NY 1J1EB 1NTKJ 1KQLA 3L72J 1IJDB 1FU1A 3RK3E 1YI2P 1FZBA 2PFXA 1KD1Q 4PD4H 2YIUB 3OW2O 1M1JA 1URQC 2V7QH 5TISH 3PTZA 1XTCC 2WWWA 1S5LX 4AYCA 4HKZH 4PD4D 2KLVA 1R8EA 3MTUE 1NVOA 3IR9A 2O1JA 3V2NA 3L74D 4NPDA 2OYHB 5AW6B 4JYBA 1IK9A 3P8CD 2YMKA 1USDA 1BE3E 1VQ7P 1PP9D 1N73C 3TSIA 1KQGB 4PV1D 1IC2A 5AW8B 2Q6QA 1NTZJ 3HUSC 3AE9C 1AFOA 1MUUA 4N6JA 3M9QA 2GUSA 2WITA 4HB1A 3P32A 2N9BA 5CCGA 3BCCD 2OTKE 4GT1A 1NYHA 3CC4P 5GTHE 1M1JB 1LP1A 2JKVA 1SQBE 1SQPJ 1E79H 2M0BA 5AVYB 1UIXA 2PGDA 3EWKA 5C39A 2ITAA 4M3LA 1LTJC 2FXPA 3WU2E 3AEEC 3H1LD 4UB6H 1FOSF 3KYQA 1URQA 2IBZG
chains in the Genus database with same CATH topology
3FX0A 2V4HA 4OWFA 4BWNA 2ZVNB 2ZVOB 3JSVC 3F89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FX0 A;  2V4H A;  4OWF A;  4BWN A;  2ZVN B;  2ZVO B;  3JSV C;  3F89 A; 
#chains in the Genus database with same CATH topology
 1SQQ K;  2QE7 H;  2O01 J;  2FYU G;  2GUV A;  4W7Y A;  1NTK E;  3R2P A;  3L70 G;  2E76 D;  1NGM B;  3KZI E;  1G1I A;  2MJZ A;  2QM8 A;  5E79 H;  2FXO A;  1DIP A;  3VMA A;  3I56 P;  1P84 I;  2IYP A;  1ZLL A;  3H1K D;  3KXD A;  1EZV I;  2WZ7 A;  5M1B A;  2IZ1 A;  4YPC A;  2E43 A;  2QG4 A;  1AQ5 A;  1N73 A;  1NU1 E;  4I7Z C;  2B87 A;  4H13 C;  1GW3 A;  3HUS A;  4DOJ A;  3CCL P;  1ZRT D;  4Y28 J;  1YJ9 P;  3NTN A;  1LP1 B;  1JY3 N;  3HTK A;  3MP7 B;  1GL2 D;  3CWB J;  2PAJ A;  1GW4 A;  2E42 A;  3AED C;  2ZT9 C;  5KAF E;  2W8Z A;  1S5L H;  1M90 Q;  2YKQ A;  4A7P A;  1NTZ E;  1OXZ A;  2E74 D;  2ZFC A;  1DX7 A;  1URQ B;  3S9O A;  1BSH A;  1RE3 C;  3CLQ A;  3V6I A;  2J59 M;  1FE6 A;  3JC2 2;  1OIP A;  1LTJ A;  2M8R A;  1KIL C;  3H1H E;  1BCC J;  3UIA A;  3KHU A;  2KZI A;  5GTI E;  3H1J G;  1CZQ A;  4NPE A;  4TLF A;  3S4R A;  1WRG A;  3GMA A;  1N73 B;  1RY3 A;  2JWA A;  3C8V A;  1BE3 D;  4EYY Q;  3TGU J;  5AVS B;  2B87 B;  2CPB A;  1SQX K;  1NTM J;  2FFD C;  4L73 A;  3HUS B;  3Q5P A;  1FZF A;  1G1J A;  1OZH A;  1K73 Q;  2Q1K A;  3FXE A;  3HTK B;  3NXS A;  3V2Q A;  2V7Q J;  4QMA A;  1RF0 C;  3VP9 A;  1VPC A;  4WVZ A;  1SVF A;  2Q3E A;  4EDF A;  1WT6 A;  1YQ3 C;  2QJP C;  5TJH A;  4D6T G;  2WSE J;  1LTB C;  1S9K E;  2N9Y B;  3MIW A;  1SQB D;  4L76 A;  1DD4 A;  1LTJ B;  3VTP C;  3CCM P;  2P1J A;  3L75 J;  3QH9 A;  5APS A;  1VF5 C;  1RE3 A;  2XND H;  1P84 E;  2WPQ A;  3KZI H;  2BCC E;  2H89 C;  5AW9 B;  1EZV E;  1HJB A;  3MD0 A;  3CXH I;  1KIL A;  3VN0 A;  4DJG A;  4ZMD A;  1H89 A;  2G8Y A;  2AEF A;  2R3C A;  4IOI H;  2XNX A;  3GG2 A;  1TU3 F;  2O3J A;  2K37 A;  4XFJ A;  5CJ0 A;  1KYO I;  1ZXG A;  3M0A A;  4ZKU A;  1OVV A;  4I7Z B;  3I5C A;  4H13 B;  1S3J A;  1X9V A;  2JO1 A;  3G71 P;  2FFD A;  1NU1 D;  3NFQ A;  3CCS P;  1AJY A;  3BVH A;  2KS1 A;  1N7S D;  2I1J A;  5KLI C;  2YNY A;  2C0X A;  1L0L E;  2D2C C;  5KJ7 C;  1JY2 O;  2ZT9 B;  3AE4 C;  3GHG C;  1FJP A;  1RF0 A;  3L37 A;  1HGV A;  1E5W A;  2K9Y A;  2KSE A;  3WUV A;  1FAV A;  1J1D C;  3HRN A;  3A5T A;  2WPR A;  1CI6 A;  4PV1 C;  1KIL B;  2B88 A;  3CX5 I;  3H1I G;  3VMZ A;  1VQP P;  1X22 A;  1HH0 A;  4OGQ D;  4WY4 D;  3H1H D;  2YKP A;  3L71 G;  3O6Q B;  3FWN A;  1KQF B;  2RN0 A;  2WSF J;  1RF1 C;  1DEB A;  1T6A A;  2FFD B;  2KIK A;  1SQQ D;  2KS1 B;  2N1T D;  3JSV C;  1FZE A;  1YQ4 C;  1DH3 A;  2GA1 A;  4IL6 X;  2IBZ I;  2LXB A;  1K9M Q;  1Q2N A;  2NPS A;  1VQN P;  3BAS A;  5AW5 B;  1GD2 E;  2JR8 A;  1PP9 G;  2QVA A;  2QJP B;  3TNU A;  1JY3 O;  5KJ7 A;  3PP5 A;  1OMI A;  1G2C A;  3F5H A;  1LT1 A;  3GHG A;  2P2U A;  2AXT E;  2E76 C;  1M8O B;  1CI6 B;  1M1K Q;  5AVW B;  3SFE C;  4WB4 A;  1FDM A;  3CXH E;  1VF5 B;  4JPZ B;  1JTH A;  3GW6 A;  5CBO A;  2XV5 A;  2FYU J;  3L70 J;  3U1C A;  3N7N A;  2IZ0 A;  4R4M A;  1KYO E;  2Y0D A;  3BCC G;  1P84 D;  1AV1 A;  5KLV J;  2BCC D;  4JYC A;  2P10 A;  5B5E E;  4RJT A;  2WPS A;  3RBZ A;  1PZQ A;  4HJG H;  4GKG A;  2A45 H;  3AE6 C;  5B66 H;  3CCQ P;  1BDD A;  1VQL P;  1GL2 C;  1NKN A;  1NO4 A;  1SQB K;  5DJT B;  2IYO A;  1RF1 A;  2XKM A;  1HGZ A;  1L0N G;  1LTS C;  2NPS B;  4NPF X;  2Z5I A;  2YO3 A;  3FWL A;  2E74 C;  1QX8 A;  2RMZ A;  5KLI B;  1SLQ A;  3TNU B;  4IFM A;  2D2C B;  4R4L A;  1NH4 A;  1BGY D;  1G2C B;  4JQ0 D;  3GHG B;  1SQX D;  3B5N D;  1NTK K;  2O01 N;  2JEE A;  1L0L D;  1A02 F;  3H1K G;  1QVF O;  1IO4 A;  1JTH B;  1OX3 A;  1JO5 A;  1J1D B;  1HUC A;  3CX5 E;  2ZVN B;  3M91 A;  1NAF A;  1NHL A;  3O8Z A;  5CBN A;  4PJ0 H;  1USE A;  3Q3D A;  1SQV E;  4PV1 B;  1NU1 K;  1MV8 A;  3MZW B;  2QIW A;  1VQ9 P;  3H1J J;  1CW5 A;  2KUB A;  2ZAE B;  4BRY A;  2E75 D;  1QLE D;  3M0D C;  1PL5 A;  2J5U A;  1BDC A;  2AEM A;  2J58 A;  2E5T A;  1KB9 H;  1RQV A;  3W68 A;  1H0T A;  1RF1 B;  3E1I A;  3VP8 A;  4IL6 H;  2IBZ E;  3L73 G;  1JY2 N;  1NTZ K;  1KB9 D;  3II6 A;  1GL2 A;  3L70 E;  4L75 A;  5AW3 B;  1KV4 A;  3D6Y A;  2ZJS E;  4I2L C;  3V5B A;  1LWU C;  5APV A;  2P7J A;  1OFC X;  1EDJ A;  1EQ7 A;  1GU5 A;  3CD6 P;  5KTB A;  3RL0 C;  2OYO A;  3Q1M A;  3HE5 A;  2BAS A;  4D6T J;  2CPS A;  3FGA D;  3BRV B;  3KPE A;  1BE3 G;  3L35 A;  2E76 B;  5BU5 A;  3A0H H;  4AUW A;  1QL2 A;  2I1K A;  1MFT A;  3L72 E;  4BRY B;  1KFN A;  3TF5 A;  3A0B E;  3CXH D;  4Z1M H;  3VMY A;  2V4H A;  1H8A A;  3I55 P;  1Q82 Q;  1FBM A;  4GOF A;  1SFC C;  5KLV G;  1H0T B;  4U3F D;  3AE8 C;  5H2F E;  1UII A;  3ZDM A;  2M5A A;  5AW4 B;  2WVR A;  2FBW C;  3M0D A;  1N7S C;  1KYO D;  3AEF C;  2XU6 A;  3SFD C;  3IF4 A;  1CSB A;  1GL2 B;  3SWK A;  5AW0 B;  1SQB G;  1L4A D;  1JCC A;  2HLO A;  3WUT A;  2YXQ B;  1R5S A;  3JCU E;  1N7L A;  1ZW0 A;  2E74 B;  2G3A A;  1VQ8 P;  2WSC H;  3HE5 B;  1LWU A;  2O1K A;  4UB8 E;  3RK3 D;  1KOR A;  1EXJ A;  5AW2 B;  5CCG D;  1FDI A;  3LID A;  1FDO A;  4WY4 C;  3EFF K;  3OA7 A;  4DCK A;  1L2P A;  2KLU A;  1ZR4 A;  3H25 A;  3CX5 D;  3IFM A;  2HYN A;  1NU1 G;  4GOE A;  3H1I J;  3K5B A;  2M5A B;  5DJU B;  4PD4 I;  2WPV B;  1SQV D;  1SQP E;  3PLN A;  1PGQ A;  3L71 J;  1URQ D;  4W7Z A;  1KIL E;  1ZV8 A;  2IDB A;  2W27 A;  2FYN C;  1SFC A;  1L0L K;  3D6Z A;  2RH0 A;  4HYT B;  1N7S A;  1YBK A;  1LTA C;  1YJW P;  1FZG A;  4RO0 A;  1LWU B;  3LW5 H;  3B8E B;  1GTW A;  2FKW B;  5GTH H;  1NOH A;  1H88 A;  3CC7 P;  2JWD A;  2QJY C;  2HPC A;  3RL0 B;  2SPZ A;  1PP9 J;  3VYI A;  3H1H G;  2LXC B;  3M9B A;  3WU2 H;  2QA4 P;  3CCU P;  5CJ4 A;  3F89 A;  4C7R A;  2NRG A;  1U57 A;  2PP6 A;  2OTL P;  4HH2 A;  3RBX A;  4IFF A;  4KHX A;  4I1L A;  1SQQ G;  3AEA C;  1Q86 Q;  1IFI A;  3CCE P;  4WY4 A;  3CWB E;  2UWJ E;  1M56 D;  2P58 A;  5APQ A;  3BCC J;  1NTK D;  3L72 D;  1SFC B;  3Q2Y A;  2WSS H;  4GIF A;  2M3E A;  3KQG A;  3OAK A;  1N7S B;  1PPJ E;  1U7M A;  1FOS E;  3O6Q A;  5AVQ B;  1FS0 E;  2IX7 C;  2HOD A;  2CK3 H;  2FYZ A;  1T2K D;  3WUU A;  1L0N J;  4GDO A;  1Y9B A;  3U1A A;  1BCC E;  2HPC B;  1S4X A;  2FY8 A;  2K9J A;  2Y0C A;  2W6A A;  3GF7 A;  1AVY A;  5KAF H;  5CCH D;  1JY3 P;  3L71 E;  1YTZ I;  3TGU E;  1NTM E;  4W80 A;  1RQU A;  2BCC G;  3M9H A;  4H13 D;  4CPG A;  3GF3 A;  3H1K J;  4ZNC A;  1GDT A;  3PRJ A;  1NTZ D;  1HVV A;  4WY4 B;  2E75 C;  1EC5 A;  2Q3I A;  4PD4 E;  3CMA P;  3L36 A;  1OVR A;  2YXR B;  1JOC A;  5CHX A;  5GTI H;  5BVZ A;  5TIS E;  3V4Q A;  2A45 G;  3P8C E;  2ZT9 D;  3A7O A;  4DZO A;  4XE5 B;  1QEX A;  1PP9 E;  1Y8A A;  1IFP A;  2BEZ F;  1K8A Q;  2JJL A;  3AE5 C;  3L4F A;  1N2D C;  3P8M C;  2HOD B;  1IFD A;  1BGY G;  2FYN B;  1IZN B;  1SQX G;  1SQP D;  2YKO A;  3L75 E;  1SS1 A;  1L0L G;  3HE4 A;  2WSC J;  2O01 H;  1KIL D;  3L73 J;  2H88 C;  1S72 P;  2K9J B;  2Z4E A;  1T3J A;  1M57 D;  1OWA A;  4L74 A;  3L74 G;  3P7K A;  4ZKP A;  1K04 A;  1IFJ A;  1GK4 A;  3NMD A;  2QJY B;  1SQV K;  2FXM A;  5AVT B;  4YXD C;  4OH8 B;  1BE3 J;  2AXC A;  1LT9 C;  4LLH A;  1N86 A;  3AE7 C;  1S9K D;  2A06 E;  2JDI H;  1L0N E;  4N78 E;  1P84 H;  3BRT B;  3CI9 A;  4K35 A;  1PGP A;  3GLM A;  1JMB A;  1NAY A;  3SWF A;  4UB6 E;  3ITK A;  3RK2 D;  3RGU A;  3OJA B;  1XTG B;  3CWB D;  1L4A C;  1EZV D;  5APW A;  2KK7 A;  3HE4 B;  3CPW O;  2H7H A;  4H0L D;  1X0T A;  3H1K E;  1ZME C;  2W6J H;  3D71 A;  3LW5 J;  4BXL A;  5E79 E;  4KJM A;  3H1L G;  1SQB J;  2KYV A;  5APU A;  1LTG C;  1VQO P;  3HD7 D;  1PPJ D;  2W83 C;  2B9B A;  3N4X A;  3CCJ P;  3AEC C;  3RK3 C;  2K3R A;  2Y9Y A;  3TDK A;  3S1K A;  1MKM A;  3QWO C;  4H44 D;  4XA4 A;  1HJ0 A;  4RES B;  1BCC D;  4OWF A;  1LJ2 A;  2IPP A;  3AE3 C;  4U3F G;  5KKZ C;  1NWQ A;  3L71 D;  3W67 A;  4LGD E;  3LIE A;  3TGU D;  3L73 E;  2NPS D;  3G6E P;  1NTM D;  1S5L E;  1OW6 A;  2E75 B;  2KB7 P;  1LT9 A;  1DEE G;  1ZOY C;  3CCV P;  1NU1 J;  5APX A;  2D2C D;  4MN4 C;  1GZL A;  5KJ7 D;  4U7J A;  2ZYG A;  2WSE H;  1FZA A;  3SWY A;  1RH5 B;  3PHL A;  3VMX A;  1QVG O;  2POH A;  3C1L A;  2WQY C;  5AVR B;  1L4A A;  2KP8 A;  4C46 A;  1ZN5 A;  2FYU E;  5APY A;  3H6P A;  3B71 A;  3L75 D;  1VL2 A;  1S1C X;  2R5D A;  1AA0 A;  3MHV A;  2HR3 A;  2W6B A;  5KLV E;  3FX0 A;  4EOT A;  1SQV G;  1ZP0 C;  1T8Z A;  1A02 J;  3H1H J;  2AXT H;  2QJK C;  4RKU J;  1VQK P;  1LT9 B;  1SQP K;  3CXH H;  1FZC C;  2PRR A;  3U59 A;  2KXP B;  1GK6 A;  1EXI A;  1T3U A;  2R32 A;  2WTY A;  1SQQ J;  1IK7 A;  2K1A A;  1NJI Q;  2QM7 A;  2A06 D;  1S2E A;  1L0N D;  1W5C E;  1KYO H;  3R4Y A;  4N78 D;  5K5G B;  2QRX A;  1YHQ P;  4WWI A;  1VQ4 P;  1Q81 Q;  1JUN A;  5B5E H;  3CCR P;  1YIJ P;  1T2K C;  1L4A B;  2Z5H A;  1PGJ A;  2HFE D;  1PIX A;  3G3Z A;  3V2P A;  5AW7 B;  3G9R A;  4EI2 A;  5CCH C;  2R3S A;  2RKL A;  5L8R J;  2WMM A;  2B89 A;  1PV3 A;  3EQ2 A;  4ASW A;  3RK3 B;  3H1J E;  5APT A;  4O9B A;  1Y47 A;  2Q5U A;  4OVN F;  2OYI C;  3CL3 D;  3A2A A;  3MUD C;  1Q90 D;  2WSF H;  2A45 I;  2E5Y A;  4TT3 H;  1NTK G;  3L72 G;  2IFM A;  2BCC J;  3C9I A;  5KKZ B;  2H8P D;  3CX5 H;  1N8R Q;  1VQ5 P;  2OTJ P;  2QEX P;  2LR2 A;  4OGQ C;  1AVO A;  1YIT P;  3WMM 0;  1J2J B;  4GOD A;  1FZC A;  3L73 D;  1RE4 C;  3V2R A;  1VQM P;  5AVX B;  2N1T C;  4D6T E;  1YTZ T;  2XDJ A;  3V4W A;  1BGY J;  3B4S A;  1SQX J;  3AEB C;  1QL1 A;  1L0L J;  1GU4 A;  2LKM A;  2XZR A;  3MGN A;  1YJN P;  1SQQ E;  2GM4 A;  1NTZ G;  1NTM K;  4IFD K;  1JNM A;  2L5G B;  2KNC A;  2L91 A;  1ZR2 A;  5CCH A;  1EDL A;  1JY2 P;  2IBZ D;  3L74 J;  1BSN A;  4DT0 A;  2FYU D;  3L70 D;  2ZVO B;  1KB9 I;  1HTL C;  1X8Y A;  4Y99 C;  3TK1 A;  1Z56 A;  1EDK A;  3E7K A;  2Q7C A;  2ZXE B;  3D70 A;  2OYI A;  3MUD A;  4I6M C;  1NKZ B;  3USS A;  2QJK B;  1K05 A;  3ABV C;  5KLV D;  3KDP B;  3IN6 A;  1HWT C;  3RK2 C;  1KC8 Q;  1SQP G;  1SP4 A;  1FZC B;  3CC2 P;  1DD3 A;  1JEK A;  1VDF A;  5AW1 B;  2Q9I A;  3A0B H;  4H0L C;  1R5L A;  4WBA A;  2MKV A;  4ASV A;  3RL0 D;  2KZJ A;  1U7J A;  2W90 A;  1W2E A;  5H2F H;  1RE4 A;  4C7N A;  2P67 A;  4K3A A;  1KZU B;  3HD7 C;  3H32 A;  2N1T A;  1D7M A;  3Q5R A;  3FXD A;  2K88 A;  2KNC B;  3M06 A;  3AE2 C;  2ZXX A;  3H1L J;  4H44 C;  2WT7 A;  3B5N C;  3JCU H;  2ZYA A;  3H1I E;  1AQT A;  1MZ9 A;  1RHZ B;  5B66 E;  5KAI E;  1FC2 C;  1SFC D;  1L0N K;  1MFZ A;  4UB8 H;  2NPS C;  2OYI B;  2M3B A;  3H1J D;  1J1E C;  4JF7 A;  1BGY E;  1WMK A;  1SQX E;  5AVV B;  4U3F J;  2OQQ A;  3CWB G;  1IFM A;  1EZV G;  3IAO A;  1X79 B;  4BWN A;  1M7L A;  2YIU C;  4OGQ B;  1Q7Y Q;  4B86 A;  3TYY A;  3T97 A;  1OW8 A;  3Q5S A;  1VQ6 P;  2OGU A;  3L74 E;  1LTI C;  1PPJ G;  3BAT A;  3AE1 C;  4C7N B;  2DW3 A;  1PFI A;  2YMY A;  1KTM A;  3H32 B;  1FJK A;  2R44 A;  4AQR D;  3AEG C;  2N1T B;  4PJ0 E;  2OYH C;  3PH0 A;  2R5B A;  5AVZ B;  4YTP C;  1BCC G;  2NZ2 A;  2JP3 A;  2H43 A;  2WT7 B;  4N3Y B;  4D6T D;  3EFG A;  3RL0 g;  3HD7 A;  1JM0 A;  1KN7 A;  3TGU G;  1NTM G;  1KB9 E;  2VRS A;  1EDI A;  2HG5 D;  2KOG A;  2IFN A;  4IL6 E;  3BCC E;  3G4S P;  3B5N A;  2Y9Z A;  1QGK B;  1SQV J;  4Y99 B;  1W2B O;  2C9L Y;  2Y0E A;  1M1J C;  1GMJ A;  3T97 B;  4YXW H;  3A3Y B;  3H1L E;  2KI7 B;  3RK2 B;  1JCD A;  1HBW A;  1KMI Z;  4EIJ A;  1IFN A;  2C0W A;  5BU8 B;  1PGO A;  4H0L B;  4JBZ A;  3L75 G;  1OW7 A;  4LC1 A;  2KSJ A;  3A0H E;  2FYU K;  5CMZ A;  2BEQ D;  1JMM A;  1JB0 J;  3HD7 B;  2QSI A;  4U3F E;  1KFM A;  2ZYD A;  2OYH A;  5EFW B;  1LTT C;  1LNQ A;  1VF5 D;  2OAR A;  5KLV K;  4KT0 J;  3SSU A;  4H44 B;  3VOP A;  3B5N B;  1KQS O;  5AVU B;  1ZRT E;  3CME P;  5KAI H;  1LGH B;  2I8D A;  1OVU A;  5CCG C;  3PJS K;  3H1I D;  3E1R A;  2A06 G;  1HF9 A;  2AEJ A;  1YYC A;  2YO2 A;  2C9N Y;  1J1E B;  1NTK J;  1KQL A;  3L72 J;  1IJD B;  1FU1 A;  3RK3 E;  1YI2 P;  1FZB A;  2PFX A;  1KD1 Q;  4PD4 H;  2YIU B;  3OW2 O;  1M1J A;  1URQ C;  2V7Q H;  5TIS H;  3PTZ A;  1XTC C;  2WWW A;  1S5L X;  4AYC A;  4HKZ H;  4PD4 D;  2KLV A;  1R8E A;  3MTU E;  1NVO A;  3IR9 A;  2O1J A;  3V2N A;  3L74 D;  4NPD A;  2OYH B;  5AW6 B;  4JYB A;  1IK9 A;  3P8C D;  2YMK A;  1USD A;  1BE3 E;  1VQ7 P;  1PP9 D;  1N73 C;  3TSI A;  1KQG B;  4PV1 D;  1IC2 A;  5AW8 B;  2Q6Q A;  1NTZ J;  3HUS C;  3AE9 C;  1AFO A;  1MUU A;  4N6J A;  3M9Q A;  2GUS A;  2WIT A;  4HB1 A;  3P32 A;  2N9B A;  5CCG A;  3BCC D;  2OTK E;  4GT1 A;  1NYH A;  3CC4 P;  5GTH E;  1M1J B;  1LP1 A;  2JKV A;  1SQB E;  1SQP J;  1E79 H;  2M0B A;  5AVY B;  1UIX A;  2PGD A;  3EWK A;  5C39 A;  2ITA A;  4M3L A;  1LTJ C;  2FXP A;  3WU2 E;  3AEE C;  3H1L D;  4UB6 H;  1FOS F;  3KYQ A;  1URQ A;  2IBZ G; 
#chains in the Genus database with same CATH homology
 3FX0 A;  2V4H A;  4OWF A;  4BWN A;  2ZVN B;  2ZVO B;  3JSV C;  3F89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...