3F89A

Nemo cozi domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
EDLRQQLQQAEEALVAKQELIDKLKEEAEQHNIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Specific recognition of linear ubiquitin chains by NEMO is important for NF-kappaB activation
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords NF-kappa-B essential modulator
total genus 27
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.990 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Nemo cc2-lz domain - 1d5 darpin complex 3f89A00
4BWNA 2ZVOB 3F89A 3JSVC 4OWFA 2ZVNB 2V4HA 3FX0A
chains in the Genus database with same CATH superfamily
1GZLA 3A2AA 3HE4A 1VF5D 3B8EB 3OAKA 1HGVA 1FS0E 2WSSH 2C0XA 4MN4C 4IFDK 1T2KC 1X22A 3AE4C 2M0BA 4KJMA 5CCGD 3D71A 1L0NJ 4WY4D 1HH0A 2JWAA 3VMAA 3M9QA 5CCGC 4D6TD 3G71P 2ZXXA 1L0NE 2B89A 1T3UA 3RK3E 2YXRB 5CHXA 5KLVD 1FZFA 1VQNP 2K37A 3N7NA 1SS1A 3L75E 3O8ZA 4H13C 4ZNCA 4JF7A 2FXMA 3L72E 4GKGA 4GIFA 4I7ZC 5KLIB 5TISH 2GUSA 5CJ4A 3SWYA 1LWUA 1NTZD 1PPJG 1RF0A 3HD7A 1YITP 1YJ9P 2POHA 3KPEA 1SQPJ 4ASWA 2IFMA 1S4XA 3CCMP 1ZV8A 1NTMJ 2IYOA 2V7QJ 4OVNF 2XKMA 3HTKA 5KAIE 1MV8A 5KLIC 3VMYA 5BVZA 3CCJP 2QA4P 1OVRA 3MTUE 2E75B 5CCHC 5CJ0A 1NTME 1PGPA 4DOJA 1USDA 2R3SA 2O01N 2O01H 1ZN5A 3L37A 3BCCG 3CWBJ 3GW6A 2W6JH 4JPZB 3VN0A 3L70G 1URQB 2NZ2A 1CW5A 3H1LJ 1KV4A 3CCRP 3E7KA 2FKWB 1NTMK 2I8DA 5L8RJ 3GF3A 1KD1Q 1D7MA 3PP5A 2E76B 3BCCD 4WBAA 4WY4C 2JR8A 1N7SB 2B87A 3FXEA 5CCHA 3Q3DA 2PRRA 3FX0A 2FYZA 2KOGA 2WTYA 2OYIC 5AVSB 1HVVA 2N1TB 1U57A 2WITA 2P67A 2ZT9B 5AW1B 5B66E 2C0WA 1S5LX 3GG2A 5KJ7A 1LT1A 2XNXA 3L72D 2BCCD 3B5NC 4Y28J 2JP3A 4YPCA 2FYNB 1FU1A 1OIPA 1SQPK 1NU1K 4H44C 2RH0A 3HUSA 1KB9H 3T97B 1EZVD 4PV1B 3Q5PA 2CPSA 1H88A 2BCCG 3GMAA 3AE6C 2E5TA 2OYIA 2OYHC 1IK7A 3KZIH 5GTHE 3HD7D 4D6TG 1SQPE 3IR9A 1R5LA 2K9YA 1BDDA 1OW7A 3H1KG 3UIAA 4AQRD 5AVUB 1JB0J 2WVRA 5B5EE 3CCUP 1KILB 4H13D 4B86A 1HJ0A 1QL1A 3L74E 3CPWO 1YI2P 2QM7A 1JY3P 1KILE 2LKMA 3NMDA 4I1LA 4XA4A 1BE3G 1BGYG 1J1EB 2YNYA 1BCCD 3EQ2A 2WT7A 1BSNA 1AFOA 1R5SA 2O3JA 1KILA 1JY2O 1OVUA 1S5LH 5KLVG 3VP9A 2IFNA 1JY2P 2W83C 1GDTA 1VQPP 3MUDC 2A45G 1L4AC 1LT9C 1NU1G 2P2UA 3V2QA 3L71D 1Q82Q 1NTMD 3AEGC 1VQLP 1N73B 1DEEG 1ZOYC 4DJGA 1PGOA 2WWWA 4HB1A 2KNCB 2E75C 4O9BA 1NTMG 5M1BA 1YHQP 1HF9A 1Z56A 2E74C 2H43A 3M9HA 1GMJA 2XV5A 3EFGA 3TDKA 2IBZI 3BRVB 2QJPC 1GW3A 1L4AA 2E74B 2MKVA 4IL6X 3M06A 3BCCE 1NTKD 2E75D 3FGAD 1NH4A 3H1LE 3JCUH 1JMMA 4EI2A 2OARA 3CCEP 3AE5C 2YIUC 1J1DC 2IBZE 1M56D 3CCQP 1NJIQ 1L4AB 4Y99B 1MKMA 1L0LE 2KI7B 4HKZH 5AW6B 1LP1A 3BRTB 3KHUA 4NPDA 3VMZA 3Q1MA 3I55P 3Q2YA 2NPSA 1FJPA 3CXHE 3CL3D 1QVGO 1FDMA 3AEAC 1ZP0C 4LGDE 4H0LD 5AW3B 2OTKE 2E43A 1J1EC 1L0LK 1SQXG 1MZ9A 1VQ9P 3L75G 2M8RA 3A0HH 1S1CX 3N4XA 1P84I 1S72P 2KIKA 2P58A 2M3BA 3WUVA 1H0TA 3V2PA 3L73G 2C9LY 2V7QH 1NHLA 1EDIA 2I1KA 2K3RA 2GUVA 4GDOA 3RL0D 2A06E 5KKZB 1PP9J 1WMKA 2KK7A 1NTZG 1PPJD 1YQ3C 3G3ZA 3A3YB 4I2LC 4PV1D 3H1KD 1NTKJ 1SQBD 1NKZB 1JM0A 2PGDA 3KDPB 2Q7CA 3KXDA 2QJYB 1K9MQ 2OYHB 3CWBE 3AE8C 3IFMA 4W80A 2XDJA 1VPCA 2KXPB 1SVFA 3L35A 2D2CC 2FYUD 3GHGA 4KHXA 3AE9C 2H89C 5AVXB 3ABVC 1RF1C 2ZYGA 1FOSE 3NXSA 5CCGA 2K9JA 5B5EH 3TF5A 3RK3D 1SQXK 4PD4H 5AVYB 1OZHA 2Q3IA 1U7JA 2H8PD 1RY3A 1XTGB 2WSCH 3W67A 1FE6A 2VRSA 2Q3EA 3HTKB 4UB8H 5KLVJ 3CMEP 2WSFH 1IK9A 2N9YB 2KLUA 3PRJA 2K9JB 3R2PA 1DD3A 3AE3C 3GLMA 3F5HA 3RK3C 1RF1A 5CBNA 5BU8B 1SQXJ 1J2JB 4TT3H 3WUUA 2D2CD 4WB4A 1URQA 3SWKA 3O6QB 1SQQD 2YKQA 1CZQA 1E79H 4W7ZA 1GK6A 5APQA 1M57D 2HPCA 2Y0DA 3V2RA 5BU5A 3AE1C 1RF1B 2CPBA 4R4MA 1GU5A 3NFQA 2L91A 1PGJA 3QWOC 1EZVG 1SQBE 1SQQG 3Q5SA 2IBZD 3HE4B 2Y9YA 1PPJE 1NTKG 1PGQA 3PTZA 4OGQB 3S4RA 3TSIA 1T3JA 1RQVA 3L75D 1VQ5P 2O01J 3A5TA 1OMIA 4U3FG 1HUCA 1M1KQ 2JKVA 1SQBK 3CX5D 1X9VA 4H44B 1IFJA 1LTGC 3B71A 4RKUJ 3B5NB 1S3JA 2RMZA 2FXPA 1RHZB 1UIIA 3V4QA 1MFZA 5KLVK 1MFTA 1RQUA 2FFDB 1OW6A 5AW2B 1U7MA 1BE3J 2GA1A 2KS1B 1L4AD 3H1JG 4C7RA 3U1CA 2Q9IA 3CXHH 1FZCB 2OGUA 1NYHA 2OQQA 4LLHA 1L0ND 2WSFJ 1LTBC 4IL6H 4L74A 1YJNP 1H8AA 1L0LD 3L75J 5AW9B 2Y9ZA 1LT9A 3HRNA 2NRGA 2NPSB 2WSEH 1QGKB 2YMYA 3M91A 3QH9A 4Y99C 1P84D 1KB9D 5TISE 2FY8A 1VQMP 2OTLP 4AYCA 1JTHB 2IZ0A 4L73A 3H1ID 3M9BA 3U59A 4RJTA 2WT7B 1LTSC 4N6JA 5E79H 2KZIA 4UB6E 1FJKA 1M1JC 4GODA 2JDIH 2FYUG 4RO0A 2AEJA 3D70A 3P32A 1EXJA 2IZ1A 2R44A 3MZWB 4GOEA 1VQ7P 3A0BH 3P8MC 3C1LA 1YJWP 1LGHB 4PJ0H 4RESB 2R32A 3H1KE 1FBMA 1S9KE 1OXZA 1N73C 1SQPD 2V4HA 4CPGA 2WSCJ 2QJKC 2YO2A 4TLFA 1HGZA 2IYPA 1VQ6P 2NPSC 2Y0CA 4PJ0E 1M90Q 3L36A 1PP9D 2HR3A 1S5LE 4C7NA 3L74D 2BASA 2B9BA 1T2KD 1LTIC 1VF5B 1YQ4C 1SQXE 3V4WA 4QMAA 1KQSO 4ZKPA 1X79B 2RKLA 1J1DB 1VL2A 1EC5A 3H1HE 1IC2A 1YIJP 2HPCB 2ITAA 3WU2H 5APSA 2WZ7A 3D6YA 2QG4A 1Q7YQ 3CX5E 3CCLP 3V2NA 5APUA 3H1JD 2Y0EA 1HBWA 1JY2N 2FYUK 2HLOA 2E5YA 2HODB 2QJPB 2W6AA 2ZJSE 3A0BE 2Q1KA 2KYVA 3R4YA 5AVZB 2G8YA 2O1KA 2WMMA 4U3FE 3CCSP 3U1AA 4K3AA 1RF0C 2ZVNB 3HD7C 4DT0A 1E5WA 1FAVA 2FYUE 4A7PA 3H25A 1VQ8P 2UWJE 1JY3N 1SFCC 1EQ7A 2M5AA 1OWAA 1H0TB 3BCCJ 3CWBG 2BCCE 4L76A 4IL6E 3CC4P 4DZOA 4JBZA 1VQOP 2Q5UA 2XZRA 3SFEC 1KQLA 3B5ND 2BEQD 2FXOA 1PFIA 1LTJB 2ZYAA 5GTIE 1URQD 2I1JA 1YYCA 1IFPA 2LXCB 2M5AB 3Q5RA 1ZR2A 3CD6P 1NAYA 2A06D 1LTTC 1SFCA 3BASA 2AXCA 4GT1A 4JYCA 3H1IJ 3L74G 2E76D 1FZBA 4WY4B 5KLVE 1EDLA 1R8EA 4KT0J 1LJ2A 1S2EA 2N1TA 4HJGH 1W5CE 2XU6A 2A45I 2A06G 3T97A 1PIXA 2N1TD 1IFIA 2WQYC 2W6BA 2QSIA 1NKNA 1SQBJ 2H88C 1LWUC 1SFCB 1NAFA 3H1HJ 1VQ4P 1EDJA 2N9BA 1NTKK 3HUSB 3TGUG 2HFED 2WSEJ 5CMZA 4EIJA 1SQVK 1FZAA 3G9RA 4PD4I 1PP9E 1ZRTD 2AEFA 1YTZI 3L71J 1JOCA 3MD0A 1NTKE 1USEA 3L72G 5GTHH 5K5GB 1SQPG 3K5BA 4U3FJ 3TGUD 2IDBA 1NO4A 3NTNA 3O6QA 1HJBA 1FOSF 2FYNC 3WMM0 4PD4E 1H89A 5EFWB 5DJUB 1W2EA 1SQVJ 4WVZA 1CI6A 3I5CA 3RBXA 4DCKA 1KQGB 1IO4A 2ZYDA 3H1JJ 3MIWA 3MHVA 3L70J 1VF5C 1JCCA 4C46A 4N78D 3RGUA 4BRYB 2E76C 3L73D 2KSEA 1CI6B 1KN7A 4JYBA 4U3FD 3SSUA 1KYOE 1GL2A 3TNUB 1RE3A 4NPFX 3TYYA 2QJKB 3B5NA 3AEBC 5KJ7C 3P7KA 1PZQA 1X0TA 1GL2D 2B88A 1SQXD 1DH3A 3CCVP 3GHGB 1BCCG 3BATA 1FZCA 3A0HE 1IJDB 1HTLC 2YKOA 3MUDA 2OYHA 1KYOI 5H2FE 2PAJA 1PV3A 2W27A 3D6ZA 3V6IA 1GK4A 2FYUJ 3RK2C 2IX7C 2WPVB 1Q90D 1GU4A 5KAIH 3CWBD 1JMBA 3L71G 3IF4A 3FWLA 4OWFA 2H7HA 3PJSK 3E1IA 3LW5H 3SFDC 5GTIH 4H13B 2R5DA 3IAOA 1LP1B 3CMAP 2XNDH 2KB7P 2OYOA 4IOIH 5CBOA 2QEXP 1K73Q 1LWUB 4U7JA 1KC8Q 1T6AA 3C8VA 2ZFCA 3H1IE 3H1LD 3II6A 3BVHA 3AEFC 3F89A 4N3YB 3PLNA 1P84H 3CI9A 4W7YA 3AE7C 1KORA 1OW8A 3FXDA 2AEMA 3FWNA 4H0LC 3TNUA 1FZGA 3M0DC 2Z5HA 2FFDC 2Q6QA 1Y47A 3TGUE 4ZMDA 1QX8A 5AW7B 1OX3A 3CXHD 3WUTA 3H1HG 4BRYA 1WRGA 5KTBA 1EDKA 3M0AA 1LTJC 4ASVA 3L73J 3G6EP 2Z4EA 2AXTH 2AXTE 3TGUJ 3V5BA 1N7SA 2B87B 4BWNA 4C7NB 3VTPC 4EOTA 5APYA 1NU1J 1PP9G 1N73A 1SFCD 1NTZJ 3EFFK 1KQFB 1Y8AA 3USSA 3HE5B 3RL0B 1QVFO 1AJYA 3M0DA 2K88A 1G2CA 2Z5IA 1FC2C 2W8ZA 3CXHI 1M7LA 2E74D 5AVWB 4XFJA 3G4SP 2QE7H 4D6TE 1NWQA 2PP6A 2GM4A 1OFCX 1SQVE 2ZXEB 5TJHA 5APVA 2KS1A 1ZRTE 3E1RA 1LT9B 3LW5J 1Q2NA 1M8OB 2WPQA 2HODA 2ZT9C 3GHGC 1L2PA 3RK3B 1JTHA 2OYIB 1BE3D 1LTAC 2M3EA 1JNMA 1AV1A 3ZDMA 2WPRA 3H6PA 3MP7B 2K1AA 2YO3A 3H1IG 3L74J 4H0LB 2KLVA 2JEEA 2L5GB 2KSJA 3L4FA 1VDFA 2O1JA 4LC1A 3AEEC 1L0NG 2RN0A 4OH8B 4M3LA 5H2FH 4UB6H 1HWTC 2R3CA 3KQGA 1AVOA 1BCCJ 1EZVE 1SQBG 2BEZF 1NVOA 1FZEA 1GL2B 2D2CB 3ITKA 3OA7A 1KYOD 1DEBA 3S9OA 1BGYD 4EDFA 4Z1MH 3P8CD 2QJYC 4IFMA 5B66H 3OW2O 1KB9I 1JO5A 3PHLA 1ZR4A 4WY4A 3AEDC 1JUNA 5AVVB 1T8ZA 5KAFH 2SPZA 1KFNA 5KAFE 2JJLA 3KZIE 2W90A 3L72J 4PV1C 3W68A 5KKZC 1ZXGA 2ZVOB 1NU1D 3LIDA 3KYQA 3RK2B 4AUWA 4OGQD 2G3AA 1JEKA 1KB9E 1TU3F 1KMIZ 2LXBA 3P8CE 2YKPA 4I7ZB 5APXA 5AW0B 1MUUA 1SQVG 4EYYQ 3HUSC 2N1TC 3LIEA 1JY3O 2J58A 4YXDC 1K05A 1QLED 2P7JA 1RH5B 3I56P 2CK3H 3AECC 1BE3E 4K35A 5APWA 2P10A 2P1JA 1L0NK 4YTPC 1RE3C 3H1HD 1KFMA 3VYIA 2A45H 1URQC 2YIUB 1YBKA 1N8RQ 2HG5D 1AVYA 1FZCC 2FBWC 3CC7P 3EWKA 2YMKA 1NTZE 3IN6A 1RE4A 4BXLA 3CLQA 2J59M 3PH0A 1DX7A 1IZNB 2QRXA 1S9KD 2KUBA 1JCDA 5CCHD 3RL0g 1AQ5A 5AVRB 1IFMA 1NTZK 2YXQB 1OVVA 2BCCJ 2LR2A 3S1KA 1A02J 4OGQC 4I6MC 1SQQJ 3HE5A 1ZLLA 3VOPA 2DW3A 1RE4C 1K04A 3JSVC 1G2CB 4H44D 3RL0C 3SWFA 1K8AQ 3AE2C 4JQ0D 1A02F 5AW5B 1SQQE 1DD4A 3H32A 5AW4B 3H1KJ 1GL2C 3TK1A 2KP8A 2R5BA 2MJZA 3RBZA 1GD2E 2ZAEB 4NPEA 4R4LA 1L0LG 1N86A 3JC22 4YXWH 1LNQA 5AVQB 1Q86Q 1NGMB 2J5UA 1G1JA 3A7OA 5KJ7D 1BGYE 1N2DC 1ZW0A 3H1JE 1SQQK 4L75A 2FFDA 2QVAA 3H1LG 1N7SD 1VQKP 3B4SA 1AA0A 1P84E 2IPPA 1AQTA 4HH2A 1BGYJ 4IFFA 1FDIA 4WWIA 2KNCA 1Q81Q 1BCCE 1NOHA 1PL5A 2NPSD 5AVTB 2ZT9D 2JO1A 1BSHA 1GTWA 1NU1E 1FDOA 4UB8E 1KILC 1UIXA 1DIPA 3VP8A 1SP4A 2WPSA 2HYNA 3CX5H 4HYTB 1QEXA 3L73E 3L71E 3WU2E 1M1JA 1XTCC 1QL2A 3MGNA 2OTJP 2QIWA 3L70D 1G1IA 1N7LA 1SLQA 4ZKUA 1IFNA 2PFXA 1EZVI 1YTZT 3CX5I 3HD7B 1ZMEC 2C9NY 3GF7A 5APTA 1SQVD 3CC2P 3C9IA 4GOFA 1W2BO 2JWDA 1M1JB 1GW4A 4PD4D 5E79E 3H32B 5C39A 3RK2D 1IFDA 1Y9BA 4D6TJ 1EXIA 1KILD 1X8YA 2QM8A 1BDCA 3L70E 1CSBA 3VMXA 2E42A 1KZUB 1WT6A 2KZJA 1L0LJ 2IBZG 4XE5B 3OJAB 1LTJA 3JCUE 1KYOH 5DJTB 1KTMA 4N78E 5AW8B 1N7SC
chains in the Genus database with same CATH topology
4BWNA 2ZVOB 3F89A 3JSVC 4OWFA 2ZVNB 2V4HA 3FX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BWN A;  2ZVO B;  3F89 A;  3JSV C;  4OWF A;  2ZVN B;  2V4H A;  3FX0 A; 
#chains in the Genus database with same CATH topology
 1GZL A;  3A2A A;  3HE4 A;  1VF5 D;  3B8E B;  3OAK A;  1HGV A;  1FS0 E;  2WSS H;  2C0X A;  4MN4 C;  4IFD K;  1T2K C;  1X22 A;  3AE4 C;  2M0B A;  4KJM A;  5CCG D;  3D71 A;  1L0N J;  4WY4 D;  1HH0 A;  2JWA A;  3VMA A;  3M9Q A;  5CCG C;  4D6T D;  3G71 P;  2ZXX A;  1L0N E;  2B89 A;  1T3U A;  3RK3 E;  2YXR B;  5CHX A;  5KLV D;  1FZF A;  1VQN P;  2K37 A;  3N7N A;  1SS1 A;  3L75 E;  3O8Z A;  4H13 C;  4ZNC A;  4JF7 A;  2FXM A;  3L72 E;  4GKG A;  4GIF A;  4I7Z C;  5KLI B;  5TIS H;  2GUS A;  5CJ4 A;  3SWY A;  1LWU A;  1NTZ D;  1PPJ G;  1RF0 A;  3HD7 A;  1YIT P;  1YJ9 P;  2POH A;  3KPE A;  1SQP J;  4ASW A;  2IFM A;  1S4X A;  3CCM P;  1ZV8 A;  1NTM J;  2IYO A;  2V7Q J;  4OVN F;  2XKM A;  3HTK A;  5KAI E;  1MV8 A;  5KLI C;  3VMY A;  5BVZ A;  3CCJ P;  2QA4 P;  1OVR A;  3MTU E;  2E75 B;  5CCH C;  5CJ0 A;  1NTM E;  1PGP A;  4DOJ A;  1USD A;  2R3S A;  2O01 N;  2O01 H;  1ZN5 A;  3L37 A;  3BCC G;  3CWB J;  3GW6 A;  2W6J H;  4JPZ B;  3VN0 A;  3L70 G;  1URQ B;  2NZ2 A;  1CW5 A;  3H1L J;  1KV4 A;  3CCR P;  3E7K A;  2FKW B;  1NTM K;  2I8D A;  5L8R J;  3GF3 A;  1KD1 Q;  1D7M A;  3PP5 A;  2E76 B;  3BCC D;  4WBA A;  4WY4 C;  2JR8 A;  1N7S B;  2B87 A;  3FXE A;  5CCH A;  3Q3D A;  2PRR A;  3FX0 A;  2FYZ A;  2KOG A;  2WTY A;  2OYI C;  5AVS B;  1HVV A;  2N1T B;  1U57 A;  2WIT A;  2P67 A;  2ZT9 B;  5AW1 B;  5B66 E;  2C0W A;  1S5L X;  3GG2 A;  5KJ7 A;  1LT1 A;  2XNX A;  3L72 D;  2BCC D;  3B5N C;  4Y28 J;  2JP3 A;  4YPC A;  2FYN B;  1FU1 A;  1OIP A;  1SQP K;  1NU1 K;  4H44 C;  2RH0 A;  3HUS A;  1KB9 H;  3T97 B;  1EZV D;  4PV1 B;  3Q5P A;  2CPS A;  1H88 A;  2BCC G;  3GMA A;  3AE6 C;  2E5T A;  2OYI A;  2OYH C;  1IK7 A;  3KZI H;  5GTH E;  3HD7 D;  4D6T G;  1SQP E;  3IR9 A;  1R5L A;  2K9Y A;  1BDD A;  1OW7 A;  3H1K G;  3UIA A;  4AQR D;  5AVU B;  1JB0 J;  2WVR A;  5B5E E;  3CCU P;  1KIL B;  4H13 D;  4B86 A;  1HJ0 A;  1QL1 A;  3L74 E;  3CPW O;  1YI2 P;  2QM7 A;  1JY3 P;  1KIL E;  2LKM A;  3NMD A;  4I1L A;  4XA4 A;  1BE3 G;  1BGY G;  1J1E B;  2YNY A;  1BCC D;  3EQ2 A;  2WT7 A;  1BSN A;  1AFO A;  1R5S A;  2O3J A;  1KIL A;  1JY2 O;  1OVU A;  1S5L H;  5KLV G;  3VP9 A;  2IFN A;  1JY2 P;  2W83 C;  1GDT A;  1VQP P;  3MUD C;  2A45 G;  1L4A C;  1LT9 C;  1NU1 G;  2P2U A;  3V2Q A;  3L71 D;  1Q82 Q;  1NTM D;  3AEG C;  1VQL P;  1N73 B;  1DEE G;  1ZOY C;  4DJG A;  1PGO A;  2WWW A;  4HB1 A;  2KNC B;  2E75 C;  4O9B A;  1NTM G;  5M1B A;  1YHQ P;  1HF9 A;  1Z56 A;  2E74 C;  2H43 A;  3M9H A;  1GMJ A;  2XV5 A;  3EFG A;  3TDK A;  2IBZ I;  3BRV B;  2QJP C;  1GW3 A;  1L4A A;  2E74 B;  2MKV A;  4IL6 X;  3M06 A;  3BCC E;  1NTK D;  2E75 D;  3FGA D;  1NH4 A;  3H1L E;  3JCU H;  1JMM A;  4EI2 A;  2OAR A;  3CCE P;  3AE5 C;  2YIU C;  1J1D C;  2IBZ E;  1M56 D;  3CCQ P;  1NJI Q;  1L4A B;  4Y99 B;  1MKM A;  1L0L E;  2KI7 B;  4HKZ H;  5AW6 B;  1LP1 A;  3BRT B;  3KHU A;  4NPD A;  3VMZ A;  3Q1M A;  3I55 P;  3Q2Y A;  2NPS A;  1FJP A;  3CXH E;  3CL3 D;  1QVG O;  1FDM A;  3AEA C;  1ZP0 C;  4LGD E;  4H0L D;  5AW3 B;  2OTK E;  2E43 A;  1J1E C;  1L0L K;  1SQX G;  1MZ9 A;  1VQ9 P;  3L75 G;  2M8R A;  3A0H H;  1S1C X;  3N4X A;  1P84 I;  1S72 P;  2KIK A;  2P58 A;  2M3B A;  3WUV A;  1H0T A;  3V2P A;  3L73 G;  2C9L Y;  2V7Q H;  1NHL A;  1EDI A;  2I1K A;  2K3R A;  2GUV A;  4GDO A;  3RL0 D;  2A06 E;  5KKZ B;  1PP9 J;  1WMK A;  2KK7 A;  1NTZ G;  1PPJ D;  1YQ3 C;  3G3Z A;  3A3Y B;  4I2L C;  4PV1 D;  3H1K D;  1NTK J;  1SQB D;  1NKZ B;  1JM0 A;  2PGD A;  3KDP B;  2Q7C A;  3KXD A;  2QJY B;  1K9M Q;  2OYH B;  3CWB E;  3AE8 C;  3IFM A;  4W80 A;  2XDJ A;  1VPC A;  2KXP B;  1SVF A;  3L35 A;  2D2C C;  2FYU D;  3GHG A;  4KHX A;  3AE9 C;  2H89 C;  5AVX B;  3ABV C;  1RF1 C;  2ZYG A;  1FOS E;  3NXS A;  5CCG A;  2K9J A;  5B5E H;  3TF5 A;  3RK3 D;  1SQX K;  4PD4 H;  5AVY B;  1OZH A;  2Q3I A;  1U7J A;  2H8P D;  1RY3 A;  1XTG B;  2WSC H;  3W67 A;  1FE6 A;  2VRS A;  2Q3E A;  3HTK B;  4UB8 H;  5KLV J;  3CME P;  2WSF H;  1IK9 A;  2N9Y B;  2KLU A;  3PRJ A;  2K9J B;  3R2P A;  1DD3 A;  3AE3 C;  3GLM A;  3F5H A;  3RK3 C;  1RF1 A;  5CBN A;  5BU8 B;  1SQX J;  1J2J B;  4TT3 H;  3WUU A;  2D2C D;  4WB4 A;  1URQ A;  3SWK A;  3O6Q B;  1SQQ D;  2YKQ A;  1CZQ A;  1E79 H;  4W7Z A;  1GK6 A;  5APQ A;  1M57 D;  2HPC A;  2Y0D A;  3V2R A;  5BU5 A;  3AE1 C;  1RF1 B;  2CPB A;  4R4M A;  1GU5 A;  3NFQ A;  2L91 A;  1PGJ A;  3QWO C;  1EZV G;  1SQB E;  1SQQ G;  3Q5S A;  2IBZ D;  3HE4 B;  2Y9Y A;  1PPJ E;  1NTK G;  1PGQ A;  3PTZ A;  4OGQ B;  3S4R A;  3TSI A;  1T3J A;  1RQV A;  3L75 D;  1VQ5 P;  2O01 J;  3A5T A;  1OMI A;  4U3F G;  1HUC A;  1M1K Q;  2JKV A;  1SQB K;  3CX5 D;  1X9V A;  4H44 B;  1IFJ A;  1LTG C;  3B71 A;  4RKU J;  3B5N B;  1S3J A;  2RMZ A;  2FXP A;  1RHZ B;  1UII A;  3V4Q A;  1MFZ A;  5KLV K;  1MFT A;  1RQU A;  2FFD B;  1OW6 A;  5AW2 B;  1U7M A;  1BE3 J;  2GA1 A;  2KS1 B;  1L4A D;  3H1J G;  4C7R A;  3U1C A;  2Q9I A;  3CXH H;  1FZC B;  2OGU A;  1NYH A;  2OQQ A;  4LLH A;  1L0N D;  2WSF J;  1LTB C;  4IL6 H;  4L74 A;  1YJN P;  1H8A A;  1L0L D;  3L75 J;  5AW9 B;  2Y9Z A;  1LT9 A;  3HRN A;  2NRG A;  2NPS B;  2WSE H;  1QGK B;  2YMY A;  3M91 A;  3QH9 A;  4Y99 C;  1P84 D;  1KB9 D;  5TIS E;  2FY8 A;  1VQM P;  2OTL P;  4AYC A;  1JTH B;  2IZ0 A;  4L73 A;  3H1I D;  3M9B A;  3U59 A;  4RJT A;  2WT7 B;  1LTS C;  4N6J A;  5E79 H;  2KZI A;  4UB6 E;  1FJK A;  1M1J C;  4GOD A;  2JDI H;  2FYU G;  4RO0 A;  2AEJ A;  3D70 A;  3P32 A;  1EXJ A;  2IZ1 A;  2R44 A;  3MZW B;  4GOE A;  1VQ7 P;  3A0B H;  3P8M C;  3C1L A;  1YJW P;  1LGH B;  4PJ0 H;  4RES B;  2R32 A;  3H1K E;  1FBM A;  1S9K E;  1OXZ A;  1N73 C;  1SQP D;  2V4H A;  4CPG A;  2WSC J;  2QJK C;  2YO2 A;  4TLF A;  1HGZ A;  2IYP A;  1VQ6 P;  2NPS C;  2Y0C A;  4PJ0 E;  1M90 Q;  3L36 A;  1PP9 D;  2HR3 A;  1S5L E;  4C7N A;  3L74 D;  2BAS A;  2B9B A;  1T2K D;  1LTI C;  1VF5 B;  1YQ4 C;  1SQX E;  3V4W A;  4QMA A;  1KQS O;  4ZKP A;  1X79 B;  2RKL A;  1J1D B;  1VL2 A;  1EC5 A;  3H1H E;  1IC2 A;  1YIJ P;  2HPC B;  2ITA A;  3WU2 H;  5APS A;  2WZ7 A;  3D6Y A;  2QG4 A;  1Q7Y Q;  3CX5 E;  3CCL P;  3V2N A;  5APU A;  3H1J D;  2Y0E A;  1HBW A;  1JY2 N;  2FYU K;  2HLO A;  2E5Y A;  2HOD B;  2QJP B;  2W6A A;  2ZJS E;  3A0B E;  2Q1K A;  2KYV A;  3R4Y A;  5AVZ B;  2G8Y A;  2O1K A;  2WMM A;  4U3F E;  3CCS P;  3U1A A;  4K3A A;  1RF0 C;  2ZVN B;  3HD7 C;  4DT0 A;  1E5W A;  1FAV A;  2FYU E;  4A7P A;  3H25 A;  1VQ8 P;  2UWJ E;  1JY3 N;  1SFC C;  1EQ7 A;  2M5A A;  1OWA A;  1H0T B;  3BCC J;  3CWB G;  2BCC E;  4L76 A;  4IL6 E;  3CC4 P;  4DZO A;  4JBZ A;  1VQO P;  2Q5U A;  2XZR A;  3SFE C;  1KQL A;  3B5N D;  2BEQ D;  2FXO A;  1PFI A;  1LTJ B;  2ZYA A;  5GTI E;  1URQ D;  2I1J A;  1YYC A;  1IFP A;  2LXC B;  2M5A B;  3Q5R A;  1ZR2 A;  3CD6 P;  1NAY A;  2A06 D;  1LTT C;  1SFC A;  3BAS A;  2AXC A;  4GT1 A;  4JYC A;  3H1I J;  3L74 G;  2E76 D;  1FZB A;  4WY4 B;  5KLV E;  1EDL A;  1R8E A;  4KT0 J;  1LJ2 A;  1S2E A;  2N1T A;  4HJG H;  1W5C E;  2XU6 A;  2A45 I;  2A06 G;  3T97 A;  1PIX A;  2N1T D;  1IFI A;  2WQY C;  2W6B A;  2QSI A;  1NKN A;  1SQB J;  2H88 C;  1LWU C;  1SFC B;  1NAF A;  3H1H J;  1VQ4 P;  1EDJ A;  2N9B A;  1NTK K;  3HUS B;  3TGU G;  2HFE D;  2WSE J;  5CMZ A;  4EIJ A;  1SQV K;  1FZA A;  3G9R A;  4PD4 I;  1PP9 E;  1ZRT D;  2AEF A;  1YTZ I;  3L71 J;  1JOC A;  3MD0 A;  1NTK E;  1USE A;  3L72 G;  5GTH H;  5K5G B;  1SQP G;  3K5B A;  4U3F J;  3TGU D;  2IDB A;  1NO4 A;  3NTN A;  3O6Q A;  1HJB A;  1FOS F;  2FYN C;  3WMM 0;  4PD4 E;  1H89 A;  5EFW B;  5DJU B;  1W2E A;  1SQV J;  4WVZ A;  1CI6 A;  3I5C A;  3RBX A;  4DCK A;  1KQG B;  1IO4 A;  2ZYD A;  3H1J J;  3MIW A;  3MHV A;  3L70 J;  1VF5 C;  1JCC A;  4C46 A;  4N78 D;  3RGU A;  4BRY B;  2E76 C;  3L73 D;  2KSE A;  1CI6 B;  1KN7 A;  4JYB A;  4U3F D;  3SSU A;  1KYO E;  1GL2 A;  3TNU B;  1RE3 A;  4NPF X;  3TYY A;  2QJK B;  3B5N A;  3AEB C;  5KJ7 C;  3P7K A;  1PZQ A;  1X0T A;  1GL2 D;  2B88 A;  1SQX D;  1DH3 A;  3CCV P;  3GHG B;  1BCC G;  3BAT A;  1FZC A;  3A0H E;  1IJD B;  1HTL C;  2YKO A;  3MUD A;  2OYH A;  1KYO I;  5H2F E;  2PAJ A;  1PV3 A;  2W27 A;  3D6Z A;  3V6I A;  1GK4 A;  2FYU J;  3RK2 C;  2IX7 C;  2WPV B;  1Q90 D;  1GU4 A;  5KAI H;  3CWB D;  1JMB A;  3L71 G;  3IF4 A;  3FWL A;  4OWF A;  2H7H A;  3PJS K;  3E1I A;  3LW5 H;  3SFD C;  5GTI H;  4H13 B;  2R5D A;  3IAO A;  1LP1 B;  3CMA P;  2XND H;  2KB7 P;  2OYO A;  4IOI H;  5CBO A;  2QEX P;  1K73 Q;  1LWU B;  4U7J A;  1KC8 Q;  1T6A A;  3C8V A;  2ZFC A;  3H1I E;  3H1L D;  3II6 A;  3BVH A;  3AEF C;  3F89 A;  4N3Y B;  3PLN A;  1P84 H;  3CI9 A;  4W7Y A;  3AE7 C;  1KOR A;  1OW8 A;  3FXD A;  2AEM A;  3FWN A;  4H0L C;  3TNU A;  1FZG A;  3M0D C;  2Z5H A;  2FFD C;  2Q6Q A;  1Y47 A;  3TGU E;  4ZMD A;  1QX8 A;  5AW7 B;  1OX3 A;  3CXH D;  3WUT A;  3H1H G;  4BRY A;  1WRG A;  5KTB A;  1EDK A;  3M0A A;  1LTJ C;  4ASV A;  3L73 J;  3G6E P;  2Z4E A;  2AXT H;  2AXT E;  3TGU J;  3V5B A;  1N7S A;  2B87 B;  4BWN A;  4C7N B;  3VTP C;  4EOT A;  5APY A;  1NU1 J;  1PP9 G;  1N73 A;  1SFC D;  1NTZ J;  3EFF K;  1KQF B;  1Y8A A;  3USS A;  3HE5 B;  3RL0 B;  1QVF O;  1AJY A;  3M0D A;  2K88 A;  1G2C A;  2Z5I A;  1FC2 C;  2W8Z A;  3CXH I;  1M7L A;  2E74 D;  5AVW B;  4XFJ A;  3G4S P;  2QE7 H;  4D6T E;  1NWQ A;  2PP6 A;  2GM4 A;  1OFC X;  1SQV E;  2ZXE B;  5TJH A;  5APV A;  2KS1 A;  1ZRT E;  3E1R A;  1LT9 B;  3LW5 J;  1Q2N A;  1M8O B;  2WPQ A;  2HOD A;  2ZT9 C;  3GHG C;  1L2P A;  3RK3 B;  1JTH A;  2OYI B;  1BE3 D;  1LTA C;  2M3E A;  1JNM A;  1AV1 A;  3ZDM A;  2WPR A;  3H6P A;  3MP7 B;  2K1A A;  2YO3 A;  3H1I G;  3L74 J;  4H0L B;  2KLV A;  2JEE A;  2L5G B;  2KSJ A;  3L4F A;  1VDF A;  2O1J A;  4LC1 A;  3AEE C;  1L0N G;  2RN0 A;  4OH8 B;  4M3L A;  5H2F H;  4UB6 H;  1HWT C;  2R3C A;  3KQG A;  1AVO A;  1BCC J;  1EZV E;  1SQB G;  2BEZ F;  1NVO A;  1FZE A;  1GL2 B;  2D2C B;  3ITK A;  3OA7 A;  1KYO D;  1DEB A;  3S9O A;  1BGY D;  4EDF A;  4Z1M H;  3P8C D;  2QJY C;  4IFM A;  5B66 H;  3OW2 O;  1KB9 I;  1JO5 A;  3PHL A;  1ZR4 A;  4WY4 A;  3AED C;  1JUN A;  5AVV B;  1T8Z A;  5KAF H;  2SPZ A;  1KFN A;  5KAF E;  2JJL A;  3KZI E;  2W90 A;  3L72 J;  4PV1 C;  3W68 A;  5KKZ C;  1ZXG A;  2ZVO B;  1NU1 D;  3LID A;  3KYQ A;  3RK2 B;  4AUW A;  4OGQ D;  2G3A A;  1JEK A;  1KB9 E;  1TU3 F;  1KMI Z;  2LXB A;  3P8C E;  2YKP A;  4I7Z B;  5APX A;  5AW0 B;  1MUU A;  1SQV G;  4EYY Q;  3HUS C;  2N1T C;  3LIE A;  1JY3 O;  2J58 A;  4YXD C;  1K05 A;  1QLE D;  2P7J A;  1RH5 B;  3I56 P;  2CK3 H;  3AEC C;  1BE3 E;  4K35 A;  5APW A;  2P10 A;  2P1J A;  1L0N K;  4YTP C;  1RE3 C;  3H1H D;  1KFM A;  3VYI A;  2A45 H;  1URQ C;  2YIU B;  1YBK A;  1N8R Q;  2HG5 D;  1AVY A;  1FZC C;  2FBW C;  3CC7 P;  3EWK A;  2YMK A;  1NTZ E;  3IN6 A;  1RE4 A;  4BXL A;  3CLQ A;  2J59 M;  3PH0 A;  1DX7 A;  1IZN B;  2QRX A;  1S9K D;  2KUB A;  1JCD A;  5CCH D;  3RL0 g;  1AQ5 A;  5AVR B;  1IFM A;  1NTZ K;  2YXQ B;  1OVV A;  2BCC J;  2LR2 A;  3S1K A;  1A02 J;  4OGQ C;  4I6M C;  1SQQ J;  3HE5 A;  1ZLL A;  3VOP A;  2DW3 A;  1RE4 C;  1K04 A;  3JSV C;  1G2C B;  4H44 D;  3RL0 C;  3SWF A;  1K8A Q;  3AE2 C;  4JQ0 D;  1A02 F;  5AW5 B;  1SQQ E;  1DD4 A;  3H32 A;  5AW4 B;  3H1K J;  1GL2 C;  3TK1 A;  2KP8 A;  2R5B A;  2MJZ A;  3RBZ A;  1GD2 E;  2ZAE B;  4NPE A;  4R4L A;  1L0L G;  1N86 A;  3JC2 2;  4YXW H;  1LNQ A;  5AVQ B;  1Q86 Q;  1NGM B;  2J5U A;  1G1J A;  3A7O A;  5KJ7 D;  1BGY E;  1N2D C;  1ZW0 A;  3H1J E;  1SQQ K;  4L75 A;  2FFD A;  2QVA A;  3H1L G;  1N7S D;  1VQK P;  3B4S A;  1AA0 A;  1P84 E;  2IPP A;  1AQT A;  4HH2 A;  1BGY J;  4IFF A;  1FDI A;  4WWI A;  2KNC A;  1Q81 Q;  1BCC E;  1NOH A;  1PL5 A;  2NPS D;  5AVT B;  2ZT9 D;  2JO1 A;  1BSH A;  1GTW A;  1NU1 E;  1FDO A;  4UB8 E;  1KIL C;  1UIX A;  1DIP A;  3VP8 A;  1SP4 A;  2WPS A;  2HYN A;  3CX5 H;  4HYT B;  1QEX A;  3L73 E;  3L71 E;  3WU2 E;  1M1J A;  1XTC C;  1QL2 A;  3MGN A;  2OTJ P;  2QIW A;  3L70 D;  1G1I A;  1N7L A;  1SLQ A;  4ZKU A;  1IFN A;  2PFX A;  1EZV I;  1YTZ T;  3CX5 I;  3HD7 B;  1ZME C;  2C9N Y;  3GF7 A;  5APT A;  1SQV D;  3CC2 P;  3C9I A;  4GOF A;  1W2B O;  2JWD A;  1M1J B;  1GW4 A;  4PD4 D;  5E79 E;  3H32 B;  5C39 A;  3RK2 D;  1IFD A;  1Y9B A;  4D6T J;  1EXI A;  1KIL D;  1X8Y A;  2QM8 A;  1BDC A;  3L70 E;  1CSB A;  3VMX A;  2E42 A;  1KZU B;  1WT6 A;  2KZJ A;  1L0L J;  2IBZ G;  4XE5 B;  3OJA B;  1LTJ A;  3JCU E;  1KYO H;  5DJT B;  1KTM A;  4N78 E;  5AW8 B;  1N7S C; 
#chains in the Genus database with same CATH homology
 4BWN A;  2ZVO B;  3F89 A;  3JSV C;  4OWF A;  2ZVN B;  2V4H A;  3FX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...