4GODA

Crystal structure of the sgta homodimerization domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
47
structure length
47
Chain Sequence
MKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small glutamine-rich tetratricopeptide repeat-containing pro
publication title Structures of the Sgt2/SGTA Dimerization Domain with the Get5/UBL4A UBL Domain Reveal an Interaction that Forms a Conserved Dynamic Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 17
structure length 47
sequence length 47
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4godA00
1X0TA 4WWIA 1EDLA 1ZW0A 2I8DA 2HR3A 2JWDA 2QVAA 2ZAEB 2KUBA 2B89A 2R44A 5CBNA 2UWJE 1H0TB 1JMBA 1OVVA 2B87B 2KIKA 5DJUB 1LP1B 2P58A 1Y47A 4ZNCA 4NPEA 4ASWA 2K3RA 1EDIA 1ZXGA 2B87A 4MN4C 1LP1A 4BXLA 2RKLA 2M0BA 4CPGA 4HJGH 3FXEA 1U7JA 5C39A 5K5GB 1Q2NA 4K35A 1DEEG 3S1KA 1EC5A 1S3JA 1BDDA 4JBZA 2LXCB 1BDCA 2Q1KA 5CBOA 2KZJA 2KI7B 4EYYQ 3PH0A 2QRXA 2LXBA 1NVOA 4GOEA 2SPZA 1FC2C 4ASVA 2KZIA 5EFWB 1JM0A 1SS1A 1OVUA 2LR2A 4NPDA 2B88A 3QWOC 4ZMDA 4KJMA 2KS1B 3RGUA 1EDKA 4GODA 2WMMA 4HKZH 4NPFX 1MFTA 4K3AA 1OVRA 1LT1A 3MZWB 5DJTB 3MHVA 4GOFA 4IOIH 2M5AB 3FXDA 3ZDMA 4HB1A 1H0TA 1EDJA 1U7MA 2OTKE 2M5AA
chains in the Genus database with same CATH superfamily
3HTKB 3FWLA 1HWTC 1G2CA 1S72P 2JJLA 1VQKP 1SFCD 4I6MC 2V7QH 1M1JA 2KSEA 1KQGB 3H1ID 2ZT9D 3HUSB 5KKZC 2I1JA 2KOGA 2WSCH 3IAOA 1QVGO 1LP1A 1W2BO 1URQC 4BXLA 4ZKPA 1DX7A 2M0BA 3RK3C 1R8EA 1IO4A 2MKVA 1AVYA 4I2LC 1AQ5A 2WVRA 1RHZB 1LTBC 1NHLA 3H1KG 2D2CD 2AXCA 2W27A 3TGUG 2AEJA 1WRGA 3A0HH 5CCGA 4D6TE 1NTZD 4PD4D 4YPCA 1NTMJ 1KQSO 1LJ2A 1AJYA 1Q90D 1NJIQ 1NGMB 2Z4EA 3M9QA 2ZT9C 1G1IA 1KYOH 1M7LA 3G4SP 5CCHA 1RF1C 4UB6E 3GF3A 5DJTB 1VQOP 1JO5A 2N1TB 5AVXB 2JEEA 4N78D 2QJPC 3VMZA 2NPSA 2AXTH 2A06G 1T3UA 3O6QB 5B66H 3UIAA 1L0NG 2M8RA 2FXMA 4OH8B 3HUSC 3H1JJ 4ASWA 2OYIB 3BCCE 2JR8A 3H1KD 1KN7A 2ITAA 2XNXA 2KNCA 3TGUD 3H32B 2OGUA 1Q2NA 1DEEG 1NAYA 1PL5A 2P2UA 2JP3A 2OTJP 3PJSK 1BDCA 4OGQB 5CBOA 3N7NA 3I56P 3V2RA 3HD7B 2HG5D 2YKQA 4D6TJ 1ZR4A 3CD6P 1GL2D 1SQPK 5GTHE 3V5BA 1FZBA 3IFMA 1A02F 3Q1MA 1K73Q 1PFIA 3CXHE 1FDIA 1X22A 1L0LE 3L36A 1JNMA 2HFED 5AVSB 1LTJB 1S4XA 1T8ZA 3E7KA 2A06D 3WUUA 1LWUB 1L0ND 2N1TC 3KDPB 5KJ7A 1G2CB 3CWBG 3HD7D 5APQA 1NTMG 4GIFA 1PGQA 1FOSE 1ZR2A 4WVZA 3EFGA 2HODA 2YMYA 1JCDA 2KUBA 4M3LA 2QM7A 3HE5B 1LP1B 2W8ZA 2K3RA 2OYIC 2E43A 1WT6A 2OQQA 1ZN5A 2KXPB 1LTSC 1U7JA 2HPCA 1RE3C 1BDDA 1S9KD 3SWKA 4JBZA 4OGQC 3V2PA 1VQMP 3GW6A 3HD7C 3KZIH 3H1JG 3C9IA 1PP9E 2QJKB 4U3FJ 3AE4C 3II6A 3AE8C 2QE7H 2O1KA 3EWKA 4PD4E 3RGUA 2E5TA 3JCUE 3WUTA 2ZYDA 1JY3O 3V2NA 5B5EH 1CI6A 1GDTA 2PAJA 1NTMD 3M9HA 3RL0B 3GHGA 1LTJC 1FBMA 3Q3DA 1MFTA 2GM4A 1ZRTD 2WPQA 3TSIA 1YBKA 1LWUC 3SWFA 1VF5B 3I55P 2NPSB 1BSHA 4HB1A 4D6TG 1N7SB 5E79E 3CCVP 2CPSA 4N78E 3GF7A 3CCJP 1FZCA 3A2AA 1JMBA 2P58A 3AE5C 3AEDC 5CCHD 2WT7A 1SVFA 1GK6A 1Y9BA 2KNCB 1FS0E 1RY3A 1JY2P 1HGZA 3H1KE 3H1JD 1VF5D 2NPSD 4QMAA 1GD2E 2Q1KA 2WSFJ 5TISE 5CCGC 1IC2A 1KILA 2L91A 2SPZA 3CC7P 2QJKC 1PP9J 1ZLLA 1YTZI 1Z56A 2FXOA 2XU6A 5KAIH 5CCHC 2VRSA 3CX5I 4D6TD 3AE3C 3RL0C 1SQVK 1YYCA 5AVUB 2HLOA 4WB4A 2QSIA 1VL2A 2H88C 5BU8B 2QA4P 1VF5C 2NPSC 4L76A 1KYOE 4U3FG 3VMXA 1N7SC 2Q3IA 1L0NE 2K9JA 1NU1J 2Z5IA 3L35A 2JWDA 1LT9A 1FDMA 1S5LE 3CCLP 1KMIZ 3IN6A 1L0LG 4C7RA 1LNQA 2H89C 3FWNA 2AXTE 3MUDA 1PGJA 2BEZF 4DZOA 3CC4P 3A0BH 2V7QJ 5GTIH 2YMKA 2WZ7A 5KJ7D 2HPCB 3P8CD 5KLVJ 1HJ0A 3HE4A 3H1HJ 3Q5SA 4K35A 4Z1MH 3N4XA 5KLIB 1HH0A 2WSCJ 4IL6E 4RKUJ 3G9RA 4EOTA 2FYUK 1S9KE 2POHA 1QX8A 2LXBA 3L4FA 4XE5B 2R5BA 1QL2A 1GMJA 1CI6B 3SWYA 2XDJA 3GHGB 4U3FD 1RE4A 4H13B 3CI9A 4HKZH 3AE7C 1AFOA 3E1IA 1JY2N 1SFCB 5KJ7C 2Z5HA 3B8EB 4U7JA 1VDFA 2K1AA 1P84H 2P7JA 1PP9G 1ZRTE 4W80A 3CMEP 1X0TA 3CX5H 1VQPP 3EQ2A 1NAFA 3AE1C 1FZCB 5KTBA 1L4AA 3LIDA 3V6IA 1SQBJ 2WT7B 4NPEA 2OYHB 3CCRP 2OARA 2AEMA 4YXWH 2D2CB 1WMKA 2J59M 4HJGH 1GW3A 1KD1Q 1NU1G 4BRYB 4RJTA 5AW7B 5KLIC 2ZJSE 5APVA 3H1JE 5APYA 1KILB 2N9YB 4TLFA 1EQ7A 1OXZA 2O1JA 2NZ2A 1VQ7P 1EZVI 1NTKJ 2KZIA 1ZOYC 3NFQA 1RH5B 1LTGC 5KLVG 2ZYGA 3KZIE 3H1HG 1HJBA 1KB9I 1PP9D 1GW4A 1IFNA 3GHGC 4O9BA 2WMMA 4H13C 2KK7A 3PP5A 1OVRA 3BASA 1UIIA 3MZWB 1SFCC 1KILD 3AECC 4A7PA 1LTTC 1H88A 4YTPC 3ZDMA 2K9JB 1RF0A 1IK9A 1H0TA 3H1LJ 3BRTB 3VMYA 1IFPA 1RQUA 1K9MQ 5AVZB 1LT9B 2FBWC 5APUA 3TNUA 1FZCC 2P1JA 2QVAA 5CBNA 3CX5D 2Y9ZA 3LW5H 1NU1D 1GK4A 1NKNA 2R5DA 1MFZA 2OYHC 2D2CC 1NO4A 3AEFC 5KAFE 3HE4B 1DIPA 2YNYA 3FGAD 1M1KQ 3P8CE 1G1JA 3RK2B 1GL2B 1SQBG 1OFCX 5KLVD 2C9LY 3H1HD 1N7LA 1T6AA 4JYBA 4DCKA 1JM0A 1NYHA 1QGKB 1GU4A 2KLVA 1E79H 3NMDA 1OWAA 3V2QA 1EDKA 2B9BA 4W7ZA 1YJNP 2NRGA 4K3AA 1LGHB 4U3FE 4I7ZB 2A45I 3RK2D 3B71A 5KAIE 5AVVB 1NTKG 1KB9H 1L4AB 1LT9C 1ZW0A 1USEA 3SFEC 1KV4A 1FOSF 1HBWA 4HYTB 1FZFA 3RBXA 1IFJA 3M06A 4DJGA 1EZVG 3K5BA 3QH9A 5H2FH 1KYOD 3OA7A 3MUDC 1JB0J 1R5SA 1EDIA 2Q5UA 2E74D 3AEBC 3MD0A 1SQBD 4BWNA 3H1LG 3CCEP 1M1JB 1L0LK 1N8RQ 1SQQE 3CCUP 2IX7C 1L4AD 2ZVOB 3A0BE 4AQRD 3RK2C 1GL2C 2LXCB 3AE9C 3S4RA 5GTIE 2BASA 3F89A 4H0LD 2QEXP 2JO1A 4L75A 1GTWA 3M0AA 1FC2C 2J5UA 3VTPC 2C9NY 1AA0A 3L71E 2E42A 4L73A 5AW6B 4R4MA 2GA1A 1RE4C 2XNDH 1E5WA 1NTKD 2IYPA 1SQPJ 2MJZA 1KC8Q 2ZFCA 4I7ZC 4GOFA 3L72J 2GUSA 3FXDA 1EZVD 3P7KA 3H6PA 2IZ0A 1KILE 1FZEA 2M5AA 4PJ0H 1L4AC 3SSUA 4Y99B 5CJ4A 2W83C 4UB8H 3AEAC 3LIEA 3H1LD 2A45H 5AW1B 4LC1A 2XKMA 2KIKA 5DJUB 3CX5E 3C8VA 2IFMA 1NU1E 3O8ZA 2FFDA 1NTZK 1M57D 1YI2P 3NTNA 2M3EA 3M9BA 1M1JC 3CPWO 4XFJA 1A02J 2P10A 2WQYC 3L75E 2J58A 1SQQJ 1SQXE 1KFMA 3S1KA 3CMAP 1H89A 3WU2H 2QM8A 3CCSP 1YITP 2E76B 1ZMEC 1XTGB 2ZYAA 5KLVE 3H1HE 3JSVC 1RF1A 1VQNP 3L71J 1X8YA 3B5NA 3EFFK 1EXIA 4WY4A 3FX0A 1QEXA 2KB7P 2Y9YA 1AVOA 4JYCA 2Q9IA 2N9BA 3OW2O 1GZLA 2WTYA 3T97A 1S1CX 4AUWA 5BVZA 1P84I 3HUSA 4PV1B 1YQ3C 1JTHA 4HH2A 4WWIA 1VQLP 2FYNB 3A7OA 2E76D 2I8DA 3A0HE 3D6ZA 3B4SA 4Y99C 1CZQA 1M8OB 2ZXXA 3MIWA 1SQPG 1CSBA 5GTHH 5AVQB 2B87A 1QL1A 3L72G 1U57A 2HODB 3IR9A 3CXHH 2GUVA 4JF7A 1SQBE 3JC22 1KORA 5AW9B 3L75J 1SQXJ 4WBAA 1FAVA 4PV1D 2RH0A 3E1RA 3OAKA 1BCCJ 2BCCE 4JPZB 2O3JA 5B66E 4L74A 4DT0A 2QRXA 2YKPA 1L0NK 5L8RJ 1JY3P 2E76C 1M56D 1OX3A 1PPJG 2C0XA 2LKMA 1OVUA 2OYOA 4N6JA 2OTLP 4ZMDA 1SQQG 2N1TA 1QVFO 5APWA 4I1LA 2Q7CA 2QJYB 1NTKE 2IFNA 2Q3EA 3O6QA 3L73E 1KZUB 2M5AB 3G71P 1SQPD 2OTKE 4PV1C 1BSNA 2P67A 3L71G 1EZVE 1SQVJ 2FYNC 2K88A 3L72D 5APSA 1IFDA 3Q2YA 1VQ5P 2JWAA 3TDKA 3CCMP 1KB9E 4ZNCA 2FFDB 1FDOA 3H1LE 3L74E 4PD4H 5AW4B 2FY8A 3JCUH 2RKLA 5H2FE 1MV8A 3CL3D 3LW5J 2WSSH 1PPJD 1NTMK 3RK3D 2BCCJ 5E79H 2W90A 1ZP0C 1SQQD 1D7MA 1T3JA 2Y0DA 3KPEA 2YIUB 3B5NB 5AVWB 2BEQD 4OWFA 4WY4B 4H44B 2IBZI 2FYUJ 1OZHA 2B88A 1Y8AA 2WWWA 3M0DA 3L70J 3L75G 1SQXG 1MZ9A 3W67A 3D71A 1BCCG 3L71D 2QJYC 1XTCC 3T97B 5BU5A 2V4HA 2WSEH 1Q81Q 3ITKA 3L73J 3SFDC 1FU1A 1JTHB 3HE5A 1EDJA 2WPSA 1PGOA 4YXDC 1EDLA 5TISH 1H8AA 3B5ND 1L2PA 4KHXA 2H8PD 1JCCA 4WY4D 1JY3N 4H44D 3MP7B 1YJWP 2WPRA 2PRRA 2B87B 1ZV8A 1N2DC 4PJ0E 2FFDC 5B5EE 2QIWA 3USSA 3L74J 3F5HA 2YKOA 4UB8E 2KSJA 3GG2A 1P84D 3GLMA 1GU5A 3GMAA 5AW2B 1SP4A 3CWBJ 1SQVG 2AEFA 1BGYJ 3VMAA 3KXDA 2G3AA 2O01H 1W5CE 1BE3J 2PP6A 1HUCA 1J1DB 3L75D 4GOEA 1SQXD 2YIUC 4C7NA 3PRJA 3B5NC 3BRVB 1BCCD 1S5LH 4WY4C 2W6BA 4H44C 3WU2E 5AW0B 3G3ZA 4KJMA 1KILC 3L37A 1JOCA 1N7SA 2KS1A 2YXQB 2H43A 3PTZA 1DD4A 1X79B 2BCCG 1FJPA 1IFIA 3P8MC 1NWQA 3AE2C 2HYNA 3Q5RA 2FKWB 1YIJP 3MGNA 4IL6H 2W6JH 1T2KD 2FYUG 4LLHA 1HTLC 1OW6A 1USDA 1SQPE 2E74B 3L70G 2N1TD 1IJDB 1PV3A 1R5LA 3L72E 1J2JB 1SQVD 2IBZG 2Y0CA 1Q82Q 5AW8B 4GKGA 3L73G 4IFMA 3CCQP 1J1EB 4H0LB 1FJKA 1K04A 4IFFA 1W2EA 5M1BA 1VQ4P 3TK1A 5APXA 2R3SA 1JY2O 2YXRB 3M91A 1PPJE 1M90Q 1NKZB 3PHLA 1J1DC 3L74G 3RK3E 1TU3F 3WMM0 1FZAA 1T2KC 4ASVA 2G8YA 4KT0J 4GDOA 2YO3A 1RQVA 1IFMA 4OGQD 2BCCD 3BATA 2FXPA 1EXJA 3PLNA 1PZQA 1BGYG 1UIXA 2K9YA 5CHXA 1BE3G 3A3YB 4NPFX 3RBZA 2FYUD 1LT1A 1FE6A 2H7HA 3MHVA 3L70D 1N73A 3R4YA 3D70A 1HVVA 1SQQK 1PGPA 3H1IE 3BCCJ 1JUNA 4ZKUA 2IBZD 2JKVA 2FYZA 5CMZA 1LTAC 1VPCA 3L73D 2E74C 1YHQP 2R44A 1NH4A 1X9VA 2PFXA 2XV5A 1YQ4C 2L5GB 1H0TB 2IZ1A 3CC2P 3C1LA 3TNUB 1DEBA 2C0WA 3W68A 2CK3H 2O01N 3CXHI 1J1EC 1OIPA 4H0LC 1URQA 2E75B 1IK7A 1KB9D 2K37A 5K5GB 5AVTB 1P84E 3L74D 1EC5A 1NTZE 1S3JA 4EDFA 3H25A 2IYOA 1OW8A 1OW7A 1JEKA 1Q86Q 4Y28J 3CWBD 1L0LJ 4C7NB 4JQ0D 1BGYD 1N86A 1NVOA 2DW3A 3VN0A 4N3YB 3A5TA 5EFWB 3S9OA 3CLQA 1BE3D 4UB6H 3M0DC 2A45G 2LR2A 1SFCA 3KHUA 5CCGD 2Y0EA 3QWOC 1BCCE 2KS1B 4GODA 1NOHA 2E75D 3U59A 4TT3H 1NU1K 3AEGC 5KAFH 1KTMA 4R4LA 4GT1A 1FZGA 2RMZA 4RO0A 1YJ9P 1QLED 1SQXK 1LTIC 2XZRA 3H1IJ 3RL0D 1CW5A 2OYHA 2HR3A 3VP8A 4EI2A 2RN0A 3HTKA 2ZAEB 1S5LX 2ZVNB 1DH3A 2CPBA 1RF0C 1KQLA 1N7SD 1OVVA 5AW5B 4BRYA 3TGUE 5KLVK 1K05A 1Y47A 3AE6C 5TJHA 2JDIH 1VQ6P 3BVHA 1ZXGA 5APTA 3TF5A 3ABVC 2QG4A 1SQVE 4PD4I 2ZXEB 4OVNF 3OJAB 3VP9A 3BCCG 3FXEA 2E75C 5C39A 1AQTA 2PGDA 3VOPA 4RESB 3R2PA 1NTZJ 1VQ9P 4IL6X 3V4WA 4AYCA 1IZNB 2IDBA 4EYYQ 3TYYA 2KYVA 2Q6QA 1SS1A 2A06E 2R3CA 3P32A 1K8AQ 5CJ0A 1S2EA 1HF9A 2I1KA 4C46A 5AVYB 3U1CA 1N73B 1JMMA 3KYQA 5AW3B 2FYUE 1SQBK 3AEEC 3MTUE 3L70E 4EIJA 3IF4A 2WSEJ 3H1KJ 2IBZE 1YTZT 2B89A 4B86A 3U1AA 2UWJE 5AVRB 3BCCD 3TGUJ 5KKZB 3G6EP 2KLUA 1AV1A 3D6YA 4MN4C 1URQB 1GL2A 4XA4A 3V4QA 2OYIA 2WSFH 4CPGA 3RK3B 3Q5PA 2R32A 3H1IG 1KFNA 2WPVB 1NTKK 1DD3A 3H32A 1HGVA 1RE3A 2E5YA 2WITA 2KZJA 2KI7B 3PH0A 1KYOI 1SLQA 1VQ8P 3HD7A 3CWBE 3I5CA 4IFDK 1NTME 1MUUA 1BGYE 3CXHD 2W6AA 1Q7YQ 2O01J 3HRNA 4W7YA 4NPDA 3RL0g 1L0LD 1URQD 2IPPA 1BE3E 2ZT9B 3WUVA 1L0NJ 4LGDE 2YO2A 1NTZG 1OMIA 1RF1B 1PIXA 4DOJA 1N73C 2KP8A 3NXSA 1KQFB 2M3BA 1LTJA 3VYIA 4IOIH 1MKMA 1LWUA 2QJPB 1U7MA 4H13D 3KQGA
chains in the Genus database with same CATH topology
1X0TA 4WWIA 1EDLA 1ZW0A 2I8DA 2HR3A 2JWDA 2QVAA 2ZAEB 2KUBA 2B89A 2R44A 5CBNA 2UWJE 1H0TB 1JMBA 1OVVA 2B87B 2KIKA 5DJUB 1LP1B 2P58A 1Y47A 4ZNCA 4NPEA 4ASWA 2K3RA 1EDIA 1ZXGA 2B87A 4MN4C 1LP1A 4BXLA 2RKLA 2M0BA 4CPGA 4HJGH 3FXEA 1U7JA 5C39A 5K5GB 1Q2NA 4K35A 1DEEG 3S1KA 1EC5A 1S3JA 1BDDA 4JBZA 2LXCB 1BDCA 2Q1KA 5CBOA 2KZJA 2KI7B 4EYYQ 3PH0A 2QRXA 2LXBA 1NVOA 4GOEA 2SPZA 1FC2C 4ASVA 2KZIA 5EFWB 1JM0A 1SS1A 1OVUA 2LR2A 4NPDA 2B88A 3QWOC 4ZMDA 4KJMA 2KS1B 3RGUA 1EDKA 4GODA 2WMMA 4HKZH 4NPFX 1MFTA 4K3AA 1OVRA 1LT1A 3MZWB 5DJTB 3MHVA 4GOFA 4IOIH 2M5AB 3FXDA 3ZDMA 4HB1A 1H0TA 1EDJA 1U7MA 2OTKE 2M5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X0T A;  4WWI A;  1EDL A;  1ZW0 A;  2I8D A;  2HR3 A;  2JWD A;  2QVA A;  2ZAE B;  2KUB A;  2B89 A;  2R44 A;  5CBN A;  2UWJ E;  1H0T B;  1JMB A;  1OVV A;  2B87 B;  2KIK A;  5DJU B;  1LP1 B;  2P58 A;  1Y47 A;  4ZNC A;  4NPE A;  4ASW A;  2K3R A;  1EDI A;  1ZXG A;  2B87 A;  4MN4 C;  1LP1 A;  4BXL A;  2RKL A;  2M0B A;  4CPG A;  4HJG H;  3FXE A;  1U7J A;  5C39 A;  5K5G B;  1Q2N A;  4K35 A;  1DEE G;  3S1K A;  1EC5 A;  1S3J A;  1BDD A;  4JBZ A;  2LXC B;  1BDC A;  2Q1K A;  5CBO A;  2KZJ A;  2KI7 B;  4EYY Q;  3PH0 A;  2QRX A;  2LXB A;  1NVO A;  4GOE A;  2SPZ A;  1FC2 C;  4ASV A;  2KZI A;  5EFW B;  1JM0 A;  1SS1 A;  1OVU A;  2LR2 A;  4NPD A;  2B88 A;  3QWO C;  4ZMD A;  4KJM A;  2KS1 B;  3RGU A;  1EDK A;  4GOD A;  2WMM A;  4HKZ H;  4NPF X;  1MFT A;  4K3A A;  1OVR A;  1LT1 A;  3MZW B;  5DJT B;  3MHV A;  4GOF A;  4IOI H;  2M5A B;  3FXD A;  3ZDM A;  4HB1 A;  1H0T A;  1EDJ A;  1U7M A;  2OTK E;  2M5A A; 
#chains in the Genus database with same CATH topology
 3HTK B;  3FWL A;  1HWT C;  1G2C A;  1S72 P;  2JJL A;  1VQK P;  1SFC D;  4I6M C;  2V7Q H;  1M1J A;  2KSE A;  1KQG B;  3H1I D;  2ZT9 D;  3HUS B;  5KKZ C;  2I1J A;  2KOG A;  2WSC H;  3IAO A;  1QVG O;  1LP1 A;  1W2B O;  1URQ C;  4BXL A;  4ZKP A;  1DX7 A;  2M0B A;  3RK3 C;  1R8E A;  1IO4 A;  2MKV A;  1AVY A;  4I2L C;  1AQ5 A;  2WVR A;  1RHZ B;  1LTB C;  1NHL A;  3H1K G;  2D2C D;  2AXC A;  2W27 A;  3TGU G;  2AEJ A;  1WRG A;  3A0H H;  5CCG A;  4D6T E;  1NTZ D;  4PD4 D;  4YPC A;  1NTM J;  1KQS O;  1LJ2 A;  1AJY A;  1Q90 D;  1NJI Q;  1NGM B;  2Z4E A;  3M9Q A;  2ZT9 C;  1G1I A;  1KYO H;  1M7L A;  3G4S P;  5CCH A;  1RF1 C;  4UB6 E;  3GF3 A;  5DJT B;  1VQO P;  1JO5 A;  2N1T B;  5AVX B;  2JEE A;  4N78 D;  2QJP C;  3VMZ A;  2NPS A;  2AXT H;  2A06 G;  1T3U A;  3O6Q B;  5B66 H;  3UIA A;  1L0N G;  2M8R A;  2FXM A;  4OH8 B;  3HUS C;  3H1J J;  4ASW A;  2OYI B;  3BCC E;  2JR8 A;  3H1K D;  1KN7 A;  2ITA A;  2XNX A;  2KNC A;  3TGU D;  3H32 B;  2OGU A;  1Q2N A;  1DEE G;  1NAY A;  1PL5 A;  2P2U A;  2JP3 A;  2OTJ P;  3PJS K;  1BDC A;  4OGQ B;  5CBO A;  3N7N A;  3I56 P;  3V2R A;  3HD7 B;  2HG5 D;  2YKQ A;  4D6T J;  1ZR4 A;  3CD6 P;  1GL2 D;  1SQP K;  5GTH E;  3V5B A;  1FZB A;  3IFM A;  1A02 F;  3Q1M A;  1K73 Q;  1PFI A;  3CXH E;  1FDI A;  1X22 A;  1L0L E;  3L36 A;  1JNM A;  2HFE D;  5AVS B;  1LTJ B;  1S4X A;  1T8Z A;  3E7K A;  2A06 D;  3WUU A;  1LWU B;  1L0N D;  2N1T C;  3KDP B;  5KJ7 A;  1G2C B;  3CWB G;  3HD7 D;  5APQ A;  1NTM G;  4GIF A;  1PGQ A;  1FOS E;  1ZR2 A;  4WVZ A;  3EFG A;  2HOD A;  2YMY A;  1JCD A;  2KUB A;  4M3L A;  2QM7 A;  3HE5 B;  1LP1 B;  2W8Z A;  2K3R A;  2OYI C;  2E43 A;  1WT6 A;  2OQQ A;  1ZN5 A;  2KXP B;  1LTS C;  1U7J A;  2HPC A;  1RE3 C;  1BDD A;  1S9K D;  3SWK A;  4JBZ A;  4OGQ C;  3V2P A;  1VQM P;  3GW6 A;  3HD7 C;  3KZI H;  3H1J G;  3C9I A;  1PP9 E;  2QJK B;  4U3F J;  3AE4 C;  3II6 A;  3AE8 C;  2QE7 H;  2O1K A;  3EWK A;  4PD4 E;  3RGU A;  2E5T A;  3JCU E;  3WUT A;  2ZYD A;  1JY3 O;  3V2N A;  5B5E H;  1CI6 A;  1GDT A;  2PAJ A;  1NTM D;  3M9H A;  3RL0 B;  3GHG A;  1LTJ C;  1FBM A;  3Q3D A;  1MFT A;  2GM4 A;  1ZRT D;  2WPQ A;  3TSI A;  1YBK A;  1LWU C;  3SWF A;  1VF5 B;  3I55 P;  2NPS B;  1BSH A;  4HB1 A;  4D6T G;  1N7S B;  5E79 E;  3CCV P;  2CPS A;  4N78 E;  3GF7 A;  3CCJ P;  1FZC A;  3A2A A;  1JMB A;  2P58 A;  3AE5 C;  3AED C;  5CCH D;  2WT7 A;  1SVF A;  1GK6 A;  1Y9B A;  2KNC B;  1FS0 E;  1RY3 A;  1JY2 P;  1HGZ A;  3H1K E;  3H1J D;  1VF5 D;  2NPS D;  4QMA A;  1GD2 E;  2Q1K A;  2WSF J;  5TIS E;  5CCG C;  1IC2 A;  1KIL A;  2L91 A;  2SPZ A;  3CC7 P;  2QJK C;  1PP9 J;  1ZLL A;  1YTZ I;  1Z56 A;  2FXO A;  2XU6 A;  5KAI H;  5CCH C;  2VRS A;  3CX5 I;  4D6T D;  3AE3 C;  3RL0 C;  1SQV K;  1YYC A;  5AVU B;  2HLO A;  4WB4 A;  2QSI A;  1VL2 A;  2H88 C;  5BU8 B;  2QA4 P;  1VF5 C;  2NPS C;  4L76 A;  1KYO E;  4U3F G;  3VMX A;  1N7S C;  2Q3I A;  1L0N E;  2K9J A;  1NU1 J;  2Z5I A;  3L35 A;  2JWD A;  1LT9 A;  1FDM A;  1S5L E;  3CCL P;  1KMI Z;  3IN6 A;  1L0L G;  4C7R A;  1LNQ A;  2H89 C;  3FWN A;  2AXT E;  3MUD A;  1PGJ A;  2BEZ F;  4DZO A;  3CC4 P;  3A0B H;  2V7Q J;  5GTI H;  2YMK A;  2WZ7 A;  5KJ7 D;  2HPC B;  3P8C D;  5KLV J;  1HJ0 A;  3HE4 A;  3H1H J;  3Q5S A;  4K35 A;  4Z1M H;  3N4X A;  5KLI B;  1HH0 A;  2WSC J;  4IL6 E;  4RKU J;  3G9R A;  4EOT A;  2FYU K;  1S9K E;  2POH A;  1QX8 A;  2LXB A;  3L4F A;  4XE5 B;  2R5B A;  1QL2 A;  1GMJ A;  1CI6 B;  3SWY A;  2XDJ A;  3GHG B;  4U3F D;  1RE4 A;  4H13 B;  3CI9 A;  4HKZ H;  3AE7 C;  1AFO A;  3E1I A;  1JY2 N;  1SFC B;  5KJ7 C;  2Z5H A;  3B8E B;  4U7J A;  1VDF A;  2K1A A;  1P84 H;  2P7J A;  1PP9 G;  1ZRT E;  4W80 A;  3CME P;  1X0T A;  3CX5 H;  1VQP P;  3EQ2 A;  1NAF A;  3AE1 C;  1FZC B;  5KTB A;  1L4A A;  3LID A;  3V6I A;  1SQB J;  2WT7 B;  4NPE A;  2OYH B;  3CCR P;  2OAR A;  2AEM A;  4YXW H;  2D2C B;  1WMK A;  2J59 M;  4HJG H;  1GW3 A;  1KD1 Q;  1NU1 G;  4BRY B;  4RJT A;  5AW7 B;  5KLI C;  2ZJS E;  5APV A;  3H1J E;  5APY A;  1KIL B;  2N9Y B;  4TLF A;  1EQ7 A;  1OXZ A;  2O1J A;  2NZ2 A;  1VQ7 P;  1EZV I;  1NTK J;  2KZI A;  1ZOY C;  3NFQ A;  1RH5 B;  1LTG C;  5KLV G;  2ZYG A;  3KZI E;  3H1H G;  1HJB A;  1KB9 I;  1PP9 D;  1GW4 A;  1IFN A;  3GHG C;  4O9B A;  2WMM A;  4H13 C;  2KK7 A;  3PP5 A;  1OVR A;  3BAS A;  1UII A;  3MZW B;  1SFC C;  1KIL D;  3AEC C;  4A7P A;  1LTT C;  1H88 A;  4YTP C;  3ZDM A;  2K9J B;  1RF0 A;  1IK9 A;  1H0T A;  3H1L J;  3BRT B;  3VMY A;  1IFP A;  1RQU A;  1K9M Q;  5AVZ B;  1LT9 B;  2FBW C;  5APU A;  3TNU A;  1FZC C;  2P1J A;  2QVA A;  5CBN A;  3CX5 D;  2Y9Z A;  3LW5 H;  1NU1 D;  1GK4 A;  1NKN A;  2R5D A;  1MFZ A;  2OYH C;  2D2C C;  1NO4 A;  3AEF C;  5KAF E;  3HE4 B;  1DIP A;  2YNY A;  3FGA D;  1M1K Q;  3P8C E;  1G1J A;  3RK2 B;  1GL2 B;  1SQB G;  1OFC X;  5KLV D;  2C9L Y;  3H1H D;  1N7L A;  1T6A A;  4JYB A;  4DCK A;  1JM0 A;  1NYH A;  1QGK B;  1GU4 A;  2KLV A;  1E79 H;  3NMD A;  1OWA A;  3V2Q A;  1EDK A;  2B9B A;  4W7Z A;  1YJN P;  2NRG A;  4K3A A;  1LGH B;  4U3F E;  4I7Z B;  2A45 I;  3RK2 D;  3B71 A;  5KAI E;  5AVV B;  1NTK G;  1KB9 H;  1L4A B;  1LT9 C;  1ZW0 A;  1USE A;  3SFE C;  1KV4 A;  1FOS F;  1HBW A;  4HYT B;  1FZF A;  3RBX A;  1IFJ A;  3M06 A;  4DJG A;  1EZV G;  3K5B A;  3QH9 A;  5H2F H;  1KYO D;  3OA7 A;  3MUD C;  1JB0 J;  1R5S A;  1EDI A;  2Q5U A;  2E74 D;  3AEB C;  3MD0 A;  1SQB D;  4BWN A;  3H1L G;  3CCE P;  1M1J B;  1L0L K;  1N8R Q;  1SQQ E;  3CCU P;  2IX7 C;  1L4A D;  2ZVO B;  3A0B E;  4AQR D;  3RK2 C;  1GL2 C;  2LXC B;  3AE9 C;  3S4R A;  5GTI E;  2BAS A;  3F89 A;  4H0L D;  2QEX P;  2JO1 A;  4L75 A;  1GTW A;  3M0A A;  1FC2 C;  2J5U A;  3VTP C;  2C9N Y;  1AA0 A;  3L71 E;  2E42 A;  4L73 A;  5AW6 B;  4R4M A;  2GA1 A;  1RE4 C;  2XND H;  1E5W A;  1NTK D;  2IYP A;  1SQP J;  2MJZ A;  1KC8 Q;  2ZFC A;  4I7Z C;  4GOF A;  3L72 J;  2GUS A;  3FXD A;  1EZV D;  3P7K A;  3H6P A;  2IZ0 A;  1KIL E;  1FZE A;  2M5A A;  4PJ0 H;  1L4A C;  3SSU A;  4Y99 B;  5CJ4 A;  2W83 C;  4UB8 H;  3AEA C;  3LIE A;  3H1L D;  2A45 H;  5AW1 B;  4LC1 A;  2XKM A;  2KIK A;  5DJU B;  3CX5 E;  3C8V A;  2IFM A;  1NU1 E;  3O8Z A;  2FFD A;  1NTZ K;  1M57 D;  1YI2 P;  3NTN A;  2M3E A;  3M9B A;  1M1J C;  3CPW O;  4XFJ A;  1A02 J;  2P10 A;  2WQY C;  3L75 E;  2J58 A;  1SQQ J;  1SQX E;  1KFM A;  3S1K A;  3CMA P;  1H89 A;  3WU2 H;  2QM8 A;  3CCS P;  1YIT P;  2E76 B;  1ZME C;  1XTG B;  2ZYA A;  5KLV E;  3H1H E;  3JSV C;  1RF1 A;  1VQN P;  3L71 J;  1X8Y A;  3B5N A;  3EFF K;  1EXI A;  4WY4 A;  3FX0 A;  1QEX A;  2KB7 P;  2Y9Y A;  1AVO A;  4JYC A;  2Q9I A;  2N9B A;  3OW2 O;  1GZL A;  2WTY A;  3T97 A;  1S1C X;  4AUW A;  5BVZ A;  1P84 I;  3HUS A;  4PV1 B;  1YQ3 C;  1JTH A;  4HH2 A;  4WWI A;  1VQL P;  2FYN B;  3A7O A;  2E76 D;  2I8D A;  3A0H E;  3D6Z A;  3B4S A;  4Y99 C;  1CZQ A;  1M8O B;  2ZXX A;  3MIW A;  1SQP G;  1CSB A;  5GTH H;  5AVQ B;  2B87 A;  1QL1 A;  3L72 G;  1U57 A;  2HOD B;  3IR9 A;  3CXH H;  2GUV A;  4JF7 A;  1SQB E;  3JC2 2;  1KOR A;  5AW9 B;  3L75 J;  1SQX J;  4WBA A;  1FAV A;  4PV1 D;  2RH0 A;  3E1R A;  3OAK A;  1BCC J;  2BCC E;  4JPZ B;  2O3J A;  5B66 E;  4L74 A;  4DT0 A;  2QRX A;  2YKP A;  1L0N K;  5L8R J;  1JY3 P;  2E76 C;  1M56 D;  1OX3 A;  1PPJ G;  2C0X A;  2LKM A;  1OVU A;  2OYO A;  4N6J A;  2OTL P;  4ZMD A;  1SQQ G;  2N1T A;  1QVF O;  5APW A;  4I1L A;  2Q7C A;  2QJY B;  1NTK E;  2IFN A;  2Q3E A;  3O6Q A;  3L73 E;  1KZU B;  2M5A B;  3G71 P;  1SQP D;  2OTK E;  4PV1 C;  1BSN A;  2P67 A;  3L71 G;  1EZV E;  1SQV J;  2FYN C;  2K88 A;  3L72 D;  5APS A;  1IFD A;  3Q2Y A;  1VQ5 P;  2JWA A;  3TDK A;  3CCM P;  1KB9 E;  4ZNC A;  2FFD B;  1FDO A;  3H1L E;  3L74 E;  4PD4 H;  5AW4 B;  2FY8 A;  3JCU H;  2RKL A;  5H2F E;  1MV8 A;  3CL3 D;  3LW5 J;  2WSS H;  1PPJ D;  1NTM K;  3RK3 D;  2BCC J;  5E79 H;  2W90 A;  1ZP0 C;  1SQQ D;  1D7M A;  1T3J A;  2Y0D A;  3KPE A;  2YIU B;  3B5N B;  5AVW B;  2BEQ D;  4OWF A;  4WY4 B;  4H44 B;  2IBZ I;  2FYU J;  1OZH A;  2B88 A;  1Y8A A;  2WWW A;  3M0D A;  3L70 J;  3L75 G;  1SQX G;  1MZ9 A;  3W67 A;  3D71 A;  1BCC G;  3L71 D;  2QJY C;  1XTC C;  3T97 B;  5BU5 A;  2V4H A;  2WSE H;  1Q81 Q;  3ITK A;  3L73 J;  3SFD C;  1FU1 A;  1JTH B;  3HE5 A;  1EDJ A;  2WPS A;  1PGO A;  4YXD C;  1EDL A;  5TIS H;  1H8A A;  3B5N D;  1L2P A;  4KHX A;  2H8P D;  1JCC A;  4WY4 D;  1JY3 N;  4H44 D;  3MP7 B;  1YJW P;  2WPR A;  2PRR A;  2B87 B;  1ZV8 A;  1N2D C;  4PJ0 E;  2FFD C;  5B5E E;  2QIW A;  3USS A;  3L74 J;  3F5H A;  2YKO A;  4UB8 E;  2KSJ A;  3GG2 A;  1P84 D;  3GLM A;  1GU5 A;  3GMA A;  5AW2 B;  1SP4 A;  3CWB J;  1SQV G;  2AEF A;  1BGY J;  3VMA A;  3KXD A;  2G3A A;  2O01 H;  1W5C E;  1BE3 J;  2PP6 A;  1HUC A;  1J1D B;  3L75 D;  4GOE A;  1SQX D;  2YIU C;  4C7N A;  3PRJ A;  3B5N C;  3BRV B;  1BCC D;  1S5L H;  4WY4 C;  2W6B A;  4H44 C;  3WU2 E;  5AW0 B;  3G3Z A;  4KJM A;  1KIL C;  3L37 A;  1JOC A;  1N7S A;  2KS1 A;  2YXQ B;  2H43 A;  3PTZ A;  1DD4 A;  1X79 B;  2BCC G;  1FJP A;  1IFI A;  3P8M C;  1NWQ A;  3AE2 C;  2HYN A;  3Q5R A;  2FKW B;  1YIJ P;  3MGN A;  4IL6 H;  2W6J H;  1T2K D;  2FYU G;  4LLH A;  1HTL C;  1OW6 A;  1USD A;  1SQP E;  2E74 B;  3L70 G;  2N1T D;  1IJD B;  1PV3 A;  1R5L A;  3L72 E;  1J2J B;  1SQV D;  2IBZ G;  2Y0C A;  1Q82 Q;  5AW8 B;  4GKG A;  3L73 G;  4IFM A;  3CCQ P;  1J1E B;  4H0L B;  1FJK A;  1K04 A;  4IFF A;  1W2E A;  5M1B A;  1VQ4 P;  3TK1 A;  5APX A;  2R3S A;  1JY2 O;  2YXR B;  3M91 A;  1PPJ E;  1M90 Q;  1NKZ B;  3PHL A;  1J1D C;  3L74 G;  3RK3 E;  1TU3 F;  3WMM 0;  1FZA A;  1T2K C;  4ASV A;  2G8Y A;  4KT0 J;  4GDO A;  2YO3 A;  1RQV A;  1IFM A;  4OGQ D;  2BCC D;  3BAT A;  2FXP A;  1EXJ A;  3PLN A;  1PZQ A;  1BGY G;  1UIX A;  2K9Y A;  5CHX A;  1BE3 G;  3A3Y B;  4NPF X;  3RBZ A;  2FYU D;  1LT1 A;  1FE6 A;  2H7H A;  3MHV A;  3L70 D;  1N73 A;  3R4Y A;  3D70 A;  1HVV A;  1SQQ K;  1PGP A;  3H1I E;  3BCC J;  1JUN A;  4ZKU A;  2IBZ D;  2JKV A;  2FYZ A;  5CMZ A;  1LTA C;  1VPC A;  3L73 D;  2E74 C;  1YHQ P;  2R44 A;  1NH4 A;  1X9V A;  2PFX A;  2XV5 A;  1YQ4 C;  2L5G B;  1H0T B;  2IZ1 A;  3CC2 P;  3C1L A;  3TNU B;  1DEB A;  2C0W A;  3W68 A;  2CK3 H;  2O01 N;  3CXH I;  1J1E C;  1OIP A;  4H0L C;  1URQ A;  2E75 B;  1IK7 A;  1KB9 D;  2K37 A;  5K5G B;  5AVT B;  1P84 E;  3L74 D;  1EC5 A;  1NTZ E;  1S3J A;  4EDF A;  3H25 A;  2IYO A;  1OW8 A;  1OW7 A;  1JEK A;  1Q86 Q;  4Y28 J;  3CWB D;  1L0L J;  4C7N B;  4JQ0 D;  1BGY D;  1N86 A;  1NVO A;  2DW3 A;  3VN0 A;  4N3Y B;  3A5T A;  5EFW B;  3S9O A;  3CLQ A;  1BE3 D;  4UB6 H;  3M0D C;  2A45 G;  2LR2 A;  1SFC A;  3KHU A;  5CCG D;  2Y0E A;  3QWO C;  1BCC E;  2KS1 B;  4GOD A;  1NOH A;  2E75 D;  3U59 A;  4TT3 H;  1NU1 K;  3AEG C;  5KAF H;  1KTM A;  4R4L A;  4GT1 A;  1FZG A;  2RMZ A;  4RO0 A;  1YJ9 P;  1QLE D;  1SQX K;  1LTI C;  2XZR A;  3H1I J;  3RL0 D;  1CW5 A;  2OYH A;  2HR3 A;  3VP8 A;  4EI2 A;  2RN0 A;  3HTK A;  2ZAE B;  1S5L X;  2ZVN B;  1DH3 A;  2CPB A;  1RF0 C;  1KQL A;  1N7S D;  1OVV A;  5AW5 B;  4BRY A;  3TGU E;  5KLV K;  1K05 A;  1Y47 A;  3AE6 C;  5TJH A;  2JDI H;  1VQ6 P;  3BVH A;  1ZXG A;  5APT A;  3TF5 A;  3ABV C;  2QG4 A;  1SQV E;  4PD4 I;  2ZXE B;  4OVN F;  3OJA B;  3VP9 A;  3BCC G;  3FXE A;  2E75 C;  5C39 A;  1AQT A;  2PGD A;  3VOP A;  4RES B;  3R2P A;  1NTZ J;  1VQ9 P;  4IL6 X;  3V4W A;  4AYC A;  1IZN B;  2IDB A;  4EYY Q;  3TYY A;  2KYV A;  2Q6Q A;  1SS1 A;  2A06 E;  2R3C A;  3P32 A;  1K8A Q;  5CJ0 A;  1S2E A;  1HF9 A;  2I1K A;  4C46 A;  5AVY B;  3U1C A;  1N73 B;  1JMM A;  3KYQ A;  5AW3 B;  2FYU E;  1SQB K;  3AEE C;  3MTU E;  3L70 E;  4EIJ A;  3IF4 A;  2WSE J;  3H1K J;  2IBZ E;  1YTZ T;  2B89 A;  4B86 A;  3U1A A;  2UWJ E;  5AVR B;  3BCC D;  3TGU J;  5KKZ B;  3G6E P;  2KLU A;  1AV1 A;  3D6Y A;  4MN4 C;  1URQ B;  1GL2 A;  4XA4 A;  3V4Q A;  2OYI A;  2WSF H;  4CPG A;  3RK3 B;  3Q5P A;  2R32 A;  3H1I G;  1KFN A;  2WPV B;  1NTK K;  1DD3 A;  3H32 A;  1HGV A;  1RE3 A;  2E5Y A;  2WIT A;  2KZJ A;  2KI7 B;  3PH0 A;  1KYO I;  1SLQ A;  1VQ8 P;  3HD7 A;  3CWB E;  3I5C A;  4IFD K;  1NTM E;  1MUU A;  1BGY E;  3CXH D;  2W6A A;  1Q7Y Q;  2O01 J;  3HRN A;  4W7Y A;  4NPD A;  3RL0 g;  1L0L D;  1URQ D;  2IPP A;  1BE3 E;  2ZT9 B;  3WUV A;  1L0N J;  4LGD E;  2YO2 A;  1NTZ G;  1OMI A;  1RF1 B;  1PIX A;  4DOJ A;  1N73 C;  2KP8 A;  3NXS A;  1KQF B;  2M3B A;  1LTJ A;  3VYI A;  4IOI H;  1MKM A;  1LWU A;  2QJP B;  1U7M A;  4H13 D;  3KQG A; 
#chains in the Genus database with same CATH homology
 1X0T A;  4WWI A;  1EDL A;  1ZW0 A;  2I8D A;  2HR3 A;  2JWD A;  2QVA A;  2ZAE B;  2KUB A;  2B89 A;  2R44 A;  5CBN A;  2UWJ E;  1H0T B;  1JMB A;  1OVV A;  2B87 B;  2KIK A;  5DJU B;  1LP1 B;  2P58 A;  1Y47 A;  4ZNC A;  4NPE A;  4ASW A;  2K3R A;  1EDI A;  1ZXG A;  2B87 A;  4MN4 C;  1LP1 A;  4BXL A;  2RKL A;  2M0B A;  4CPG A;  4HJG H;  3FXE A;  1U7J A;  5C39 A;  5K5G B;  1Q2N A;  4K35 A;  1DEE G;  3S1K A;  1EC5 A;  1S3J A;  1BDD A;  4JBZ A;  2LXC B;  1BDC A;  2Q1K A;  5CBO A;  2KZJ A;  2KI7 B;  4EYY Q;  3PH0 A;  2QRX A;  2LXB A;  1NVO A;  4GOE A;  2SPZ A;  1FC2 C;  4ASV A;  2KZI A;  5EFW B;  1JM0 A;  1SS1 A;  1OVU A;  2LR2 A;  4NPD A;  2B88 A;  3QWO C;  4ZMD A;  4KJM A;  2KS1 B;  3RGU A;  1EDK A;  4GOD A;  2WMM A;  4HKZ H;  4NPF X;  1MFT A;  4K3A A;  1OVR A;  1LT1 A;  3MZW B;  5DJT B;  3MHV A;  4GOF A;  4IOI H;  2M5A B;  3FXD A;  3ZDM A;  4HB1 A;  1H0T A;  1EDJ A;  1U7M A;  2OTK E;  2M5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...