4GODA

Crystal structure of the sgta homodimerization domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
47
structure length
47
Chain Sequence
MKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Small glutamine-rich tetratricopeptide repeat-containing pro
publication title Structures of the Sgt2/SGTA Dimerization Domain with the Get5/UBL4A UBL Domain Reveal an Interaction that Forms a Conserved Dynamic Interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 47
sequence length 47
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4godA00
4KJMA 2P58A 3RGUA 2JWDA 3ZDMA 2KS1B 5C39A 1U7JA 3FXEA 1ZW0A 1LP1B 4HJGH 1JMBA 2M0BA 4NPDA 1H0TB 2QVAA 1Q2NA 2B88A 2B87A 1OVUA 5K5GB 3QWOC 1EDLA 2KZJA 2Q1KA 1DEEG 2M5AA 5DJUB 2K3RA 3FXDA 2KUBA 4CPGA 4GODA 4IOIH 2I8DA 1LT1A 2OTKE 1EDJA 2QRXA 5CBOA 2RKLA 4EYYQ 4GOEA 2ZAEB 1LP1A 3S1KA 2UWJE 4HB1A 4MN4C 1S3JA 2KIKA 2LR2A 1JM0A 1H0TA 1EDKA 4ZNCA 5CBNA 2WMMA 4HKZH 2HR3A 1SS1A 3MHVA 1X0TA 4ASVA 1MFTA 1BDCA 4NPEA 1BDDA 3PH0A 1NVOA 2LXCB 4K35A 2R44A 2SPZA 4NPFX 1OVVA 2KI7B 3MZWB 2LXBA 1EDIA 2KZIA 2B87B 1FC2C 4ASWA 4WWIA 4GOFA 1OVRA 1EC5A 2B89A 2M5AB 5EFWB 4K3AA 1ZXGA 1Y47A 4JBZA 5DJTB 1U7MA 4ZMDA 4BXLA
chains in the Genus database with same CATH superfamily
4KJMA 3JC22 3RGUA 3CWBG 1SQQK 3H25A 3H1KG 2L91A 2O01N 1JMBA 2M0BA 3EFGA 2OGUA 4UB6H 1FZCA 2JJLA 1KYOH 2WSFH 2R3SA 4EI2A 1IFNA 1GDTA 2ZYAA 1OIPA 1KN7A 3JSVC 3G9RA 1YTZT 1QLED 2BEQD 1L4AC 3A0BE 1HBWA 3F5HA 3RL0D 1JY2O 3RL0C 2HODA 3U1AA 1R5LA 2Q9IA 3H1LJ 1VQ6P 2IFNA 3L70E 2D2CD 1FU1A 1ZP0C 1EZVG 5M1BA 1FDOA 1Z56A 3AE6C 3PTZA 3EQ2A 1X0TA 1FZGA 1VQPP 2IFMA 1RH5B 1PGQA 3PH0A 1G1JA 4H44D 1FOSE 1NO4A 5KKZB 1G2CA 2Q6QA 2D2CB 4R4MA 3GW6A 3M0AA 3H1JG 1GW3A 2E74C 3HD7A 1UIIA 4H0LD 1H89A 2M5AB 1RE4A 2WSEH 1JB0J 4PD4H 1LGHB 2FFDC 2HPCA 1BCCD 3GF7A 1AV1A 3II6A 2H7HA 1NTMK 3P32A 4H0LB 1LTAC 4HYTB 1U57A 3PRJA 3C9IA 1SP4A 3AE1C 2FYUG 3KYQA 1CZQA 2KUBA 1PGJA 1YIJP 2VRSA 1W5CE 4KHXA 1S5LH 5CCHA 5B5EH 3CXHE 3F89A 4EDFA 2R3CA 1IK9A 3V4QA 2QSIA 2K9YA 3RK2D 2Z5IA 1N2DC 5APWA 4C7NB 1NYHA 2A06G 2IYPA 3GHGC 1SQBD 4M3LA 1BDDA 1PP9G 1IZNB 3N7NA 1X8YA 1Q81Q 3P7KA 2SPZA 3E1IA 3W67A 3CCSP 2LXBA 4H13C 1VQ8P 4WWIA 4GOFA 1FAVA 2I1JA 2IBZI 2I1KA 1GU4A 3H6PA 2FYNC 3KQGA 4D6TE 1JOCA 3TGUD 1VDFA 2N1TC 1GL2A 1LT9A 5CCGD 1URQC 5APSA 2CPBA 3NFQA 1PZQA 5AW1B 4UB8H 1J2JB 4R4LA 2HODB 1NU1D 3L37A 3FWNA 4IFFA 2W8ZA 1M1JA 4DZOA 1KV4A 3H1HJ 4UB6E 3L75D 2KK7A 4WY4D 1KYOE 3C8VA 3M0DC 2ZJSE 1G2CB 1EDJA 3H1IE 1NTZD 1VQ7P 1SQPJ 1VQNP 4OH8B 4WY4B 2PFXA 1L0LD 1T2KD 1LNQA 1NTKD 2HPCB 1LTJA 3A7OA 1SQQE 2E5YA 1SQXD 5KLIC 3O6QA 3USSA 1JMMA 1VQ9P 4N3YB 1BGYE 2IBZD 3L73J 2JR8A 3L71J 5CCHD 5KLVD 2O3JA 1AVYA 2C0XA 5AVQB 1EC5A 1LTSC 2V4HA 1ZRTD 2YMYA 3T97B 2OYOA 3AE9C 2E75C 3SWYA 4PD4E 1GZLA 1IJDB 4YPCA 2PAJA 1ZW0A 2H89C 3VMZA 2R5DA 1GTWA 3L35A 4Y99B 1FJPA 2W83C 2K3RA 3IAOA 2YO3A 3FXDA 4GODA 4IOIH 2FYZA 2I8DA 1H8AA 5CHXA 1KFMA 1N8RQ 1RF1A 1NU1K 1NHLA 1RQUA 1S5LE 1SQVG 3S1KA 3MUDC 5B5EE 3L74D 5KJ7C 3L70J 3L72E 1N73C 3H1KE 1ZLLA 5AVWB 5TJHA 3BCCE 1YYCA 3G3ZA 2QEXP 1OFCX 1LTBC 1NTME 1NTZK 1MFTA 1S4XA 1BDCA 1GL2B 1RQVA 1LT9B 1BE3D 5AVYB 1L0LK 1CSBA 1DIPA 1N86A 1NTKK 4D6TG 3RK3C 2AEMA 1K9MQ 1NAYA 1QX8A 1PFIA 3SWKA 1SQXK 2WPVB 4WB4A 5KTBA 3G6EP 1NH4A 1UIXA 3NTNA 3VTPC 1Y47A 2OTJP 2XKMA 1SVFA 2AXTH 4AYCA 1KORA 1BSNA 3R2PA 5KLVK 2K37A 3ZDMA 3FXEA 1JEKA 2AEJA 2W6AA 3SFEC 1N7LA 1RE3A 3HUSC 3B4SA 1Q86Q 4TT3H 1HGVA 1IFIA 3H1IG 4UB8E 1LTJB 2NPSC 1VPCA 1SQVK 4OWFA 3CC2P 1T3JA 3O6QB 3M91A 4PV1C 2RKLA 1SQQG 5AW6B 3FGAD 3CCJP 2QJYB 2FBWC 4U7JA 1KILD 4HKZH 1OMIA 1FE6A 3C1LA 1FDMA 3H1LD 1FJKA 4AQRD 2FY8A 2V7QJ 1MFZA 1QL2A 1Q82Q 1NKZB 2FFDA 5APVA 1YJWP 1G1IA 1HJBA 1BCCE 2LXCB 1KILB 5AW8B 2BCCG 3CX5I 1OW6A 1KD1Q 2KSEA 1JY2P 1S2EA 3CCLP 3B5NC 4PJ0H 3CMEP 1R8EA 2WSCJ 3MP7B 4AUWA 4ZMDA 1LTGC 1LTIC 2A06E 4I2LC 1WT6A 5BVZA 1P84I 5APQA 2E76D 1VF5C 2QG4A 1S9KD 1KC8Q 1RHZB 1FZAA 1PP9E 3EFFK 3AEAC 2WT7A 2E76B 2K9JA 2WSFJ 4OGQB 3L72G 2J58A 4GDOA 3GHGA 1AA0A 3BCCG 3LW5H 1NTMG 1PPJD 2ZAEB 2YMKA 3O8ZA 1T6AA 1YTZI 2ZXXA 1ZMEC 1L4AD 3M9QA 2N9YB 3CX5D 1KB9I 2ZVNB 3TGUE 1BGYJ 3CCMP 1M90Q 3CCQP 2WVRA 1X9VA 5CCGA 1GD2E 5AW5B 2HG5D 5EFWB 1FS0E 3HTKA 3RL0B 1LWUC 2JWAA 2A45I 2WSEJ 1U7MA 1P84D 3CC4P 2WQYC 2E74D 3M0DA 3M9BA 2IDBA 1VQMP 2AXTE 4WY4A 1A02J 2QVAA 3SWFA 4H44B 1NTZE 1OW7A 1KQFB 1AFOA 4U3FJ 2H8PD 5GTHH 2E74B 2M3BA 2KXPB 3E7KA 1PL5A 1IFPA 1L0LE 2MKVA 3TSIA 1MV8A 2OYHC 1L0NJ 3H1HD 2FFDB 4OVNF 3PLNA 3AEEC 2JP3A 1SQXE 2HYNA 3KPEA 1VQLP 3CWBJ 2K88A 3L72J 3KDPB 2LR2A 3H1KJ 4DOJA 1EDKA 1SQPD 2Y0EA 2FXOA 1BCCG 2IBZE 1YQ4C 1FDIA 1GK6A 3T97A 5KLVE 2WPQA 1KB9D 4DCKA 4RO0A 2L5GB 1ZRTE 2IZ1A 1L2PA 4IFDK 3MZWB 2B9BA 2ZYGA 1X79B 3V2PA 1FC2C 3L73D 3L71D 4I7ZB 5AVZB 1SQVE 2WTYA 4N78D 4DT0A 2FXPA 3WU2H 2WT7B 2K9JB 3MGNA 3RK2B 4L73A 4BXLA 1WMKA 4PJ0E 3OAKA 1OXZA 3GHGB 4H13D 3P8CE 3Q5SA 2YKOA 4W7ZA 1A02F 4HJGH 3V2NA 2QM8A 3NMDA 5AVVB 1SLQA 2N1TD 4L75A 1FZCC 3H1JJ 4QMAA 3CCEP 3CCRP 5AVUB 1URQD 2KZJA 2Q1KA 3L74E 4H13B 1YI2P 2C9LY 1AQ5A 3FX0A 2FYNB 3SSUA 2QJKC 4EYYQ 2KS1A 1URQB 2YXQB 4HB1A 3IR9A 3TGUG 2K1AA 1Y8AA 3L70D 4Z1MH 1OWAA 3I55P 3TNUA 2QIWA 3HTKB 3CMAP 1VL2A 4YXWH 3LIEA 2FYUJ 2AXCA 1SQPK 2J59M 4W7YA 1JY2N 3V5BA 2O01H 4LGDE 4GIFA 1NU1G 3PP5A 2RMZA 2RH0A 2NRGA 3A3YB 3RBZA 2R32A 3HD7C 3L75G 1HH0A 1MZ9A 1J1DC 5KAIH 4K3AA 3KHUA 4JBZA 3Q1MA 4BRYA 3V6IA 4YTPC 1NTZG 2WPSA 1OX3A 1K05A 3Q5PA 3AEBC 1LJ2A 1SQBK 5AW3B 5KLIB 1KFNA 1L0LG 1PP9J 2Y0CA 3AEGC 1NTKG 1N7SD 3NXSA 1Y9BA 2E75D 1OVUA 1N7SC 2BCCE 1EDLA 1SQXG 2ZVOB 1VQKP 2OYIC 4CPGA 1KILE 1IO4A 3MIWA 2IBZG 1KILA 5GTHE 1LT1A 2OTKE 5AW7B 5APUA 3TK1A 5KLVG 5TISH 2ZYDA 2FKWB 1JM0A 2OTLP 3MTUE 1S72P 5CBNA 3AEFC 1JY3O 2HR3A 3AE8C 3CPWO 2XZRA 5KJ7D 1PGPA 3SFDC 1D7MA 3M06A 4LLHA 1J1EC 2Y0DA 2Y9ZA 2YIUC 3D70A 1KQSO 1K8AQ 3H32A 2GUSA 1KTMA 2KOGA 1W2BO 3R4YA 2B89A 1S9KE 2Q5UA 3BASA 2ZT9C 1NGMB 1BSHA 3RK3D 3Q5RA 1GL2C 4O9BA 1LT9C 1DD4A 2P58A 4A7PA 3WU2E 1JCCA 3IN6A 3L74G 3TYYA 2KS1B 2CK3H 3VMAA 2RN0A 2DW3A 3IF4A 1PGOA 1PPJE 4RJTA 1QL1A 3HE5A 3TNUB 1BE3G 1T8ZA 1M1JC 3A0HH 5B66H 2QJPC 2BASA 5APXA 3HE4A 4LC1A 2IYOA 1L4AA 3K5BA 2UWJE 4EIJA 4IFMA 2NPSD 1E79H 3CLQA 3AE7C 2JEEA 4PV1D 1JTHA 3V4WA 4BRYB 1LWUA 1FBMA 3JCUH 1DD3A 5CJ0A 1BGYD 4GKGA 1RY3A 1FZFA 2W27A 4PV1B 1SQVJ 2E42A 1GW4A 2XNXA 3CC7P 3VMXA 3IFMA 1FOSF 2KB7P 1HUCA 5BU5A 3B71A 5KAIE 2QA4P 1SFCC 2Q7CA 3WUTA 4B86A 1GMJA 2OYHA 1IC2A 3H1HE 5AW0B 5KAFH 5C39A 3B5ND 2YNYA 1EZVI 2OARA 3H1LG 4D6TJ 3TF5A 4N6JA 3QWOC 1S1CX 2W90A 1SQPE 1ZOYC 4U3FD 1VF5D 4JQ0D 2O1JA 1ZR2A 2Q3IA 2BEZF 1K04A 1L0ND 1RF1C 2GUVA 1YBKA 1ZN5A 3V2RA 3W68A 1PIXA 2YKQA 2Z4EA 3GMAA 2C0WA 2W6JH 3H32B 4WBAA 3CWBD 2Y9YA 3H1KD 5TISE 2YO2A 2WMMA 3M9HA 4ZKPA 2WWWA 3L73E 3L71E 2WSCH 4ASVA 3H1IJ 1SQBE 1AVOA 3N4XA 3BRTB 5CMZA 1JCDA 1QVGO 4XE5B 2KI7B 5APTA 2AEFA 1HWTC 1NJIQ 1SQQJ 3GF3A 2WITA 1OVRA 3E1RA 3HE5B 3BATA 3OJAB 4ZKUA 2XV5A 5DJTB 2P1JA 4IL6X 2PRRA 1PPJG 5GTIH 2N1TA 3ABVC 4JF7A 1X22A 3HE4B 1URQA 1EZVD 2HLOA 1L4AB 2PGDA 1USEA 3I56P 1H88A 1MUUA 3CI9A 3OA7A 5APYA 1RE3C 4RKUJ 2BCCJ 1Q2NA 2P2UA 1NU1E 1NAFA 2IX7C 1NKNA 3H1JD 2KYVA 2M8RA 3VP8A 1JTHB 3KZIH 3L36A 3L75E 1WRGA 1LWUB 5KKZC 3VN0A 3LIDA 2D2CC 3A0HE 5B66E 2MJZA 3B8EB 5CBOA 1FZEA 1QEXA 4L76A 5AVXB 4JPZB 3A5TA 4H44C 2ITAA 3CL3D 4TLFA 1L0NK 3P8MC 2P7JA 4HH2A 1NTKE 1JNMA 2FXMA 4H0LC 5AVSB 5AW4B 2FYUD 2Q3EA 2OYHB 1GK4A 1YITP 3BCCJ 2H43A 3RBXA 1EDIA 3JCUE 1NTMJ 1VQ5P 1RF0C 3H1HG 1N7SA 2JO1A 2XDJA 2E43A 4RESB 2H88C 2OYIA 1JUNA 2A06D 2P67A 2ZXEB 1SQPG 3PHLA 2XU6A 1IFMA 2YXRB 1PP9D 5E79H 1EXJA 4C46A 4WVZA 5KAFE 4I7ZC 5K5GB 1DX7A 4YXDC 1NWQA 3RK2C 4C7RA 2LKMA 3Q2YA 4DJGA 1DH3A 1HJ0A 2A45G 2QRXA 3L73G 3L71G 1EXIA 3V2QA 2C9NY 1SQBG 3MUDA 3AE2C 4W80A 1ZR4A 3Q3DA 2GM4A 1EQ7A 5KJ7A 1QGKB 1NOHA 1N73A 1K73Q 3HRNA 1PV3A 3CX5H 1FZCB 2WZ7A 1AJYA 1Q7YQ 2N1TB 1BE3E 3QH9A 3RK3E 3AE4C 2KLUA 3CXHI 4K35A 2J5UA 4XFJA 1OVVA 5AW9B 2QJKB 2O01J 5CCGC 2KZIA 4ASWA 2FYUK 1JO5A 1P84H 2ZFCA 1JY3P 1BCCJ 2R5BA 3S4RA 3PJSK 1CI6A 3AECC 3WUUA 2KNCA 4JYCA 3HD7D 5GTIE 5BU8B 3L70G 4WY4C 2G8YA 1KQGB 1RE4C 3HUSA 3VYIA 2B88A 2B87A 2GA1A 2WSSH 3HD7B 1IK7A 1J1DB 2NPSA 1T2KC 2JKVA 1HF9A 5AVTB 3KZIE 4BWNA 1LP1A 3GLMA 1H0TA 1KB9H 1YJ9P 2WPRA 1SQBJ 3H1LE 1N7SB 1SS1A 3MHVA 5CCHC 5H2FH 2E75B 3L4FA 3CXHD 1KYOI 3KXDA 2OYIB 1MKMA 1M8OB 1NVOA 2A45H 2KLVA 1M57D 1SFCA 2YKPA 1KQLA 4NPFX 4Y99C 3WMM0 3CCUP 4IL6H 1KZUB 4GT1A 2E5TA 3U59A 1SQVD 3B5NA 4JYBA 2Z5HA 3VP9A 3UIAA 3TGUJ 1AQTA 4EOTA 3WUVA 2G3AA 1IFDA 2XNDH 1M1KQ 4U3FE 3G4SP 1R5SA 3P8CD 3TDKA 1M7LA 2JWDA 1U7JA 2KSJA 3ITKA 1L0NE 2ZT9D 3RL0g 1J1EB 3D6YA 1TU3F 1NU1J 2M3EA 2YIUB 1N73B 1GL2D 4D6TD 1DEEG 3CWBE 2POHA 3L75J 5E79E 2O1KA 2JDIH 3A0BH 3EWKA 3BRVB 2ZT9B 1VQOP 4PD4I 1NTZJ 3RK3B 1YHQP 2QE7H 1S3JA 2IZ0A 2CPSA 1S5LX 2W6BA 1L0LJ 1NTKJ 3G71P 1KYOD 1LTTC 3A2AA 1CI6B 1SQXJ 3AE3C 1M1JB 1OW8A 4NPEA 2QJPB 3H1ID 3OW2O 3CX5E 2KNCB 4L74A 3I5CA 2NZ2A 1E5WA 1USDA 2R44A 1EZVE 3U1CA 1CW5A 5KLVJ 3HUSB 2B87B 1LTJC 1SQQD 1T3UA 3S9OA 3D71A 1ZXGA 1HGZA 2OQQA 1HTLC 2NPSB 3H1JE 2HFED 2IPPA 1P84E 2N9BA 2QJYC 1LP1B 1KMIZ 4I6MC 2KP8A 4NPDA 1H0TB 1W2EA 2BCCD 5CJ4A 1FZBA 1IFJA 1SFCD 3D6ZA 2M5AA 5DJUB 2QM7A 1ZV8A 4PD4D 3CXHH 5L8RJ 2P10A 1BGYG 1KILC 1YJNP 2FYUE 1SFCB 4GOEA 4I1LA 5AVRB 3L74J 4MN4C 1GU5A 3FWLA 2KIKA 1VQ4P 3BVHA 4ZNCA 2V7QH 3B5NB 3AEDC 3MD0A 3VOPA 1KB9E 1RF0A 1BE3J 3VMYA 3CD6P 5AW2B 1XTCC 3LW5J 3GG2A 5H2FE 4KT0J 3L72D 1RF1B 1VF5B 2PP6A 1DEBA 4U3FG 1JY3N 1XTGB 3BCCD 4OGQD 1NTMD 1OZHA 3AE5C 2E76C 4N78E 4C7NA 4OGQC 1L0NG 1Q90D 3CCVP 4IL6E 4XA4A 1QVFO 1M56D 4Y28J 1HVVA 1YQ3C
chains in the Genus database with same CATH topology
4KJMA 2P58A 3RGUA 2JWDA 3ZDMA 2KS1B 5C39A 1U7JA 3FXEA 1ZW0A 1LP1B 4HJGH 1JMBA 2M0BA 4NPDA 1H0TB 2QVAA 1Q2NA 2B88A 2B87A 1OVUA 5K5GB 3QWOC 1EDLA 2KZJA 2Q1KA 1DEEG 2M5AA 5DJUB 2K3RA 3FXDA 2KUBA 4CPGA 4GODA 4IOIH 2I8DA 1LT1A 2OTKE 1EDJA 2QRXA 5CBOA 2RKLA 4EYYQ 4GOEA 2ZAEB 1LP1A 3S1KA 2UWJE 4HB1A 4MN4C 1S3JA 2KIKA 2LR2A 1JM0A 1H0TA 1EDKA 4ZNCA 5CBNA 2WMMA 4HKZH 2HR3A 1SS1A 3MHVA 1X0TA 4ASVA 1MFTA 1BDCA 4NPEA 1BDDA 3PH0A 1NVOA 2LXCB 4K35A 2R44A 2SPZA 4NPFX 1OVVA 2KI7B 3MZWB 2LXBA 1EDIA 2KZIA 2B87B 1FC2C 4ASWA 4WWIA 4GOFA 1OVRA 1EC5A 2B89A 2M5AB 5EFWB 4K3AA 1ZXGA 1Y47A 4JBZA 5DJTB 1U7MA 4ZMDA 4BXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KJM A;  2P58 A;  3RGU A;  2JWD A;  3ZDM A;  2KS1 B;  5C39 A;  1U7J A;  3FXE A;  1ZW0 A;  1LP1 B;  4HJG H;  1JMB A;  2M0B A;  4NPD A;  1H0T B;  2QVA A;  1Q2N A;  2B88 A;  2B87 A;  1OVU A;  5K5G B;  3QWO C;  1EDL A;  2KZJ A;  2Q1K A;  1DEE G;  2M5A A;  5DJU B;  2K3R A;  3FXD A;  2KUB A;  4CPG A;  4GOD A;  4IOI H;  2I8D A;  1LT1 A;  2OTK E;  1EDJ A;  2QRX A;  5CBO A;  2RKL A;  4EYY Q;  4GOE A;  2ZAE B;  1LP1 A;  3S1K A;  2UWJ E;  4HB1 A;  4MN4 C;  1S3J A;  2KIK A;  2LR2 A;  1JM0 A;  1H0T A;  1EDK A;  4ZNC A;  5CBN A;  2WMM A;  4HKZ H;  2HR3 A;  1SS1 A;  3MHV A;  1X0T A;  4ASV A;  1MFT A;  1BDC A;  4NPE A;  1BDD A;  3PH0 A;  1NVO A;  2LXC B;  4K35 A;  2R44 A;  2SPZ A;  4NPF X;  1OVV A;  2KI7 B;  3MZW B;  2LXB A;  1EDI A;  2KZI A;  2B87 B;  1FC2 C;  4ASW A;  4WWI A;  4GOF A;  1OVR A;  1EC5 A;  2B89 A;  2M5A B;  5EFW B;  4K3A A;  1ZXG A;  1Y47 A;  4JBZ A;  5DJT B;  1U7M A;  4ZMD A;  4BXL A; 
#chains in the Genus database with same CATH topology
 4KJM A;  3JC2 2;  3RGU A;  3CWB G;  1SQQ K;  3H25 A;  3H1K G;  2L91 A;  2O01 N;  1JMB A;  2M0B A;  3EFG A;  2OGU A;  4UB6 H;  1FZC A;  2JJL A;  1KYO H;  2WSF H;  2R3S A;  4EI2 A;  1IFN A;  1GDT A;  2ZYA A;  1OIP A;  1KN7 A;  3JSV C;  3G9R A;  1YTZ T;  1QLE D;  2BEQ D;  1L4A C;  3A0B E;  1HBW A;  3F5H A;  3RL0 D;  1JY2 O;  3RL0 C;  2HOD A;  3U1A A;  1R5L A;  2Q9I A;  3H1L J;  1VQ6 P;  2IFN A;  3L70 E;  2D2C D;  1FU1 A;  1ZP0 C;  1EZV G;  5M1B A;  1FDO A;  1Z56 A;  3AE6 C;  3PTZ A;  3EQ2 A;  1X0T A;  1FZG A;  1VQP P;  2IFM A;  1RH5 B;  1PGQ A;  3PH0 A;  1G1J A;  4H44 D;  1FOS E;  1NO4 A;  5KKZ B;  1G2C A;  2Q6Q A;  2D2C B;  4R4M A;  3GW6 A;  3M0A A;  3H1J G;  1GW3 A;  2E74 C;  3HD7 A;  1UII A;  4H0L D;  1H89 A;  2M5A B;  1RE4 A;  2WSE H;  1JB0 J;  4PD4 H;  1LGH B;  2FFD C;  2HPC A;  1BCC D;  3GF7 A;  1AV1 A;  3II6 A;  2H7H A;  1NTM K;  3P32 A;  4H0L B;  1LTA C;  4HYT B;  1U57 A;  3PRJ A;  3C9I A;  1SP4 A;  3AE1 C;  2FYU G;  3KYQ A;  1CZQ A;  2KUB A;  1PGJ A;  1YIJ P;  2VRS A;  1W5C E;  4KHX A;  1S5L H;  5CCH A;  5B5E H;  3CXH E;  3F89 A;  4EDF A;  2R3C A;  1IK9 A;  3V4Q A;  2QSI A;  2K9Y A;  3RK2 D;  2Z5I A;  1N2D C;  5APW A;  4C7N B;  1NYH A;  2A06 G;  2IYP A;  3GHG C;  1SQB D;  4M3L A;  1BDD A;  1PP9 G;  1IZN B;  3N7N A;  1X8Y A;  1Q81 Q;  3P7K A;  2SPZ A;  3E1I A;  3W67 A;  3CCS P;  2LXB A;  4H13 C;  1VQ8 P;  4WWI A;  4GOF A;  1FAV A;  2I1J A;  2IBZ I;  2I1K A;  1GU4 A;  3H6P A;  2FYN C;  3KQG A;  4D6T E;  1JOC A;  3TGU D;  1VDF A;  2N1T C;  1GL2 A;  1LT9 A;  5CCG D;  1URQ C;  5APS A;  2CPB A;  3NFQ A;  1PZQ A;  5AW1 B;  4UB8 H;  1J2J B;  4R4L A;  2HOD B;  1NU1 D;  3L37 A;  3FWN A;  4IFF A;  2W8Z A;  1M1J A;  4DZO A;  1KV4 A;  3H1H J;  4UB6 E;  3L75 D;  2KK7 A;  4WY4 D;  1KYO E;  3C8V A;  3M0D C;  2ZJS E;  1G2C B;  1EDJ A;  3H1I E;  1NTZ D;  1VQ7 P;  1SQP J;  1VQN P;  4OH8 B;  4WY4 B;  2PFX A;  1L0L D;  1T2K D;  1LNQ A;  1NTK D;  2HPC B;  1LTJ A;  3A7O A;  1SQQ E;  2E5Y A;  1SQX D;  5KLI C;  3O6Q A;  3USS A;  1JMM A;  1VQ9 P;  4N3Y B;  1BGY E;  2IBZ D;  3L73 J;  2JR8 A;  3L71 J;  5CCH D;  5KLV D;  2O3J A;  1AVY A;  2C0X A;  5AVQ B;  1EC5 A;  1LTS C;  2V4H A;  1ZRT D;  2YMY A;  3T97 B;  2OYO A;  3AE9 C;  2E75 C;  3SWY A;  4PD4 E;  1GZL A;  1IJD B;  4YPC A;  2PAJ A;  1ZW0 A;  2H89 C;  3VMZ A;  2R5D A;  1GTW A;  3L35 A;  4Y99 B;  1FJP A;  2W83 C;  2K3R A;  3IAO A;  2YO3 A;  3FXD A;  4GOD A;  4IOI H;  2FYZ A;  2I8D A;  1H8A A;  5CHX A;  1KFM A;  1N8R Q;  1RF1 A;  1NU1 K;  1NHL A;  1RQU A;  1S5L E;  1SQV G;  3S1K A;  3MUD C;  5B5E E;  3L74 D;  5KJ7 C;  3L70 J;  3L72 E;  1N73 C;  3H1K E;  1ZLL A;  5AVW B;  5TJH A;  3BCC E;  1YYC A;  3G3Z A;  2QEX P;  1OFC X;  1LTB C;  1NTM E;  1NTZ K;  1MFT A;  1S4X A;  1BDC A;  1GL2 B;  1RQV A;  1LT9 B;  1BE3 D;  5AVY B;  1L0L K;  1CSB A;  1DIP A;  1N86 A;  1NTK K;  4D6T G;  3RK3 C;  2AEM A;  1K9M Q;  1NAY A;  1QX8 A;  1PFI A;  3SWK A;  1SQX K;  2WPV B;  4WB4 A;  5KTB A;  3G6E P;  1NH4 A;  1UIX A;  3NTN A;  3VTP C;  1Y47 A;  2OTJ P;  2XKM A;  1SVF A;  2AXT H;  4AYC A;  1KOR A;  1BSN A;  3R2P A;  5KLV K;  2K37 A;  3ZDM A;  3FXE A;  1JEK A;  2AEJ A;  2W6A A;  3SFE C;  1N7L A;  1RE3 A;  3HUS C;  3B4S A;  1Q86 Q;  4TT3 H;  1HGV A;  1IFI A;  3H1I G;  4UB8 E;  1LTJ B;  2NPS C;  1VPC A;  1SQV K;  4OWF A;  3CC2 P;  1T3J A;  3O6Q B;  3M91 A;  4PV1 C;  2RKL A;  1SQQ G;  5AW6 B;  3FGA D;  3CCJ P;  2QJY B;  2FBW C;  4U7J A;  1KIL D;  4HKZ H;  1OMI A;  1FE6 A;  3C1L A;  1FDM A;  3H1L D;  1FJK A;  4AQR D;  2FY8 A;  2V7Q J;  1MFZ A;  1QL2 A;  1Q82 Q;  1NKZ B;  2FFD A;  5APV A;  1YJW P;  1G1I A;  1HJB A;  1BCC E;  2LXC B;  1KIL B;  5AW8 B;  2BCC G;  3CX5 I;  1OW6 A;  1KD1 Q;  2KSE A;  1JY2 P;  1S2E A;  3CCL P;  3B5N C;  4PJ0 H;  3CME P;  1R8E A;  2WSC J;  3MP7 B;  4AUW A;  4ZMD A;  1LTG C;  1LTI C;  2A06 E;  4I2L C;  1WT6 A;  5BVZ A;  1P84 I;  5APQ A;  2E76 D;  1VF5 C;  2QG4 A;  1S9K D;  1KC8 Q;  1RHZ B;  1FZA A;  1PP9 E;  3EFF K;  3AEA C;  2WT7 A;  2E76 B;  2K9J A;  2WSF J;  4OGQ B;  3L72 G;  2J58 A;  4GDO A;  3GHG A;  1AA0 A;  3BCC G;  3LW5 H;  1NTM G;  1PPJ D;  2ZAE B;  2YMK A;  3O8Z A;  1T6A A;  1YTZ I;  2ZXX A;  1ZME C;  1L4A D;  3M9Q A;  2N9Y B;  3CX5 D;  1KB9 I;  2ZVN B;  3TGU E;  1BGY J;  3CCM P;  1M90 Q;  3CCQ P;  2WVR A;  1X9V A;  5CCG A;  1GD2 E;  5AW5 B;  2HG5 D;  5EFW B;  1FS0 E;  3HTK A;  3RL0 B;  1LWU C;  2JWA A;  2A45 I;  2WSE J;  1U7M A;  1P84 D;  3CC4 P;  2WQY C;  2E74 D;  3M0D A;  3M9B A;  2IDB A;  1VQM P;  2AXT E;  4WY4 A;  1A02 J;  2QVA A;  3SWF A;  4H44 B;  1NTZ E;  1OW7 A;  1KQF B;  1AFO A;  4U3F J;  2H8P D;  5GTH H;  2E74 B;  2M3B A;  2KXP B;  3E7K A;  1PL5 A;  1IFP A;  1L0L E;  2MKV A;  3TSI A;  1MV8 A;  2OYH C;  1L0N J;  3H1H D;  2FFD B;  4OVN F;  3PLN A;  3AEE C;  2JP3 A;  1SQX E;  2HYN A;  3KPE A;  1VQL P;  3CWB J;  2K88 A;  3L72 J;  3KDP B;  2LR2 A;  3H1K J;  4DOJ A;  1EDK A;  1SQP D;  2Y0E A;  2FXO A;  1BCC G;  2IBZ E;  1YQ4 C;  1FDI A;  1GK6 A;  3T97 A;  5KLV E;  2WPQ A;  1KB9 D;  4DCK A;  4RO0 A;  2L5G B;  1ZRT E;  2IZ1 A;  1L2P A;  4IFD K;  3MZW B;  2B9B A;  2ZYG A;  1X79 B;  3V2P A;  1FC2 C;  3L73 D;  3L71 D;  4I7Z B;  5AVZ B;  1SQV E;  2WTY A;  4N78 D;  4DT0 A;  2FXP A;  3WU2 H;  2WT7 B;  2K9J B;  3MGN A;  3RK2 B;  4L73 A;  4BXL A;  1WMK A;  4PJ0 E;  3OAK A;  1OXZ A;  3GHG B;  4H13 D;  3P8C E;  3Q5S A;  2YKO A;  4W7Z A;  1A02 F;  4HJG H;  3V2N A;  2QM8 A;  3NMD A;  5AVV B;  1SLQ A;  2N1T D;  4L75 A;  1FZC C;  3H1J J;  4QMA A;  3CCE P;  3CCR P;  5AVU B;  1URQ D;  2KZJ A;  2Q1K A;  3L74 E;  4H13 B;  1YI2 P;  2C9L Y;  1AQ5 A;  3FX0 A;  2FYN B;  3SSU A;  2QJK C;  4EYY Q;  2KS1 A;  1URQ B;  2YXQ B;  4HB1 A;  3IR9 A;  3TGU G;  2K1A A;  1Y8A A;  3L70 D;  4Z1M H;  1OWA A;  3I55 P;  3TNU A;  2QIW A;  3HTK B;  3CMA P;  1VL2 A;  4YXW H;  3LIE A;  2FYU J;  2AXC A;  1SQP K;  2J59 M;  4W7Y A;  1JY2 N;  3V5B A;  2O01 H;  4LGD E;  4GIF A;  1NU1 G;  3PP5 A;  2RMZ A;  2RH0 A;  2NRG A;  3A3Y B;  3RBZ A;  2R32 A;  3HD7 C;  3L75 G;  1HH0 A;  1MZ9 A;  1J1D C;  5KAI H;  4K3A A;  3KHU A;  4JBZ A;  3Q1M A;  4BRY A;  3V6I A;  4YTP C;  1NTZ G;  2WPS A;  1OX3 A;  1K05 A;  3Q5P A;  3AEB C;  1LJ2 A;  1SQB K;  5AW3 B;  5KLI B;  1KFN A;  1L0L G;  1PP9 J;  2Y0C A;  3AEG C;  1NTK G;  1N7S D;  3NXS A;  1Y9B A;  2E75 D;  1OVU A;  1N7S C;  2BCC E;  1EDL A;  1SQX G;  2ZVO B;  1VQK P;  2OYI C;  4CPG A;  1KIL E;  1IO4 A;  3MIW A;  2IBZ G;  1KIL A;  5GTH E;  1LT1 A;  2OTK E;  5AW7 B;  5APU A;  3TK1 A;  5KLV G;  5TIS H;  2ZYD A;  2FKW B;  1JM0 A;  2OTL P;  3MTU E;  1S72 P;  5CBN A;  3AEF C;  1JY3 O;  2HR3 A;  3AE8 C;  3CPW O;  2XZR A;  5KJ7 D;  1PGP A;  3SFD C;  1D7M A;  3M06 A;  4LLH A;  1J1E C;  2Y0D A;  2Y9Z A;  2YIU C;  3D70 A;  1KQS O;  1K8A Q;  3H32 A;  2GUS A;  1KTM A;  2KOG A;  1W2B O;  3R4Y A;  2B89 A;  1S9K E;  2Q5U A;  3BAS A;  2ZT9 C;  1NGM B;  1BSH A;  3RK3 D;  3Q5R A;  1GL2 C;  4O9B A;  1LT9 C;  1DD4 A;  2P58 A;  4A7P A;  3WU2 E;  1JCC A;  3IN6 A;  3L74 G;  3TYY A;  2KS1 B;  2CK3 H;  3VMA A;  2RN0 A;  2DW3 A;  3IF4 A;  1PGO A;  1PPJ E;  4RJT A;  1QL1 A;  3HE5 A;  3TNU B;  1BE3 G;  1T8Z A;  1M1J C;  3A0H H;  5B66 H;  2QJP C;  2BAS A;  5APX A;  3HE4 A;  4LC1 A;  2IYO A;  1L4A A;  3K5B A;  2UWJ E;  4EIJ A;  4IFM A;  2NPS D;  1E79 H;  3CLQ A;  3AE7 C;  2JEE A;  4PV1 D;  1JTH A;  3V4W A;  4BRY B;  1LWU A;  1FBM A;  3JCU H;  1DD3 A;  5CJ0 A;  1BGY D;  4GKG A;  1RY3 A;  1FZF A;  2W27 A;  4PV1 B;  1SQV J;  2E42 A;  1GW4 A;  2XNX A;  3CC7 P;  3VMX A;  3IFM A;  1FOS F;  2KB7 P;  1HUC A;  5BU5 A;  3B71 A;  5KAI E;  2QA4 P;  1SFC C;  2Q7C A;  3WUT A;  4B86 A;  1GMJ A;  2OYH A;  1IC2 A;  3H1H E;  5AW0 B;  5KAF H;  5C39 A;  3B5N D;  2YNY A;  1EZV I;  2OAR A;  3H1L G;  4D6T J;  3TF5 A;  4N6J A;  3QWO C;  1S1C X;  2W90 A;  1SQP E;  1ZOY C;  4U3F D;  1VF5 D;  4JQ0 D;  2O1J A;  1ZR2 A;  2Q3I A;  2BEZ F;  1K04 A;  1L0N D;  1RF1 C;  2GUV A;  1YBK A;  1ZN5 A;  3V2R A;  3W68 A;  1PIX A;  2YKQ A;  2Z4E A;  3GMA A;  2C0W A;  2W6J H;  3H32 B;  4WBA A;  3CWB D;  2Y9Y A;  3H1K D;  5TIS E;  2YO2 A;  2WMM A;  3M9H A;  4ZKP A;  2WWW A;  3L73 E;  3L71 E;  2WSC H;  4ASV A;  3H1I J;  1SQB E;  1AVO A;  3N4X A;  3BRT B;  5CMZ A;  1JCD A;  1QVG O;  4XE5 B;  2KI7 B;  5APT A;  2AEF A;  1HWT C;  1NJI Q;  1SQQ J;  3GF3 A;  2WIT A;  1OVR A;  3E1R A;  3HE5 B;  3BAT A;  3OJA B;  4ZKU A;  2XV5 A;  5DJT B;  2P1J A;  4IL6 X;  2PRR A;  1PPJ G;  5GTI H;  2N1T A;  3ABV C;  4JF7 A;  1X22 A;  3HE4 B;  1URQ A;  1EZV D;  2HLO A;  1L4A B;  2PGD A;  1USE A;  3I56 P;  1H88 A;  1MUU A;  3CI9 A;  3OA7 A;  5APY A;  1RE3 C;  4RKU J;  2BCC J;  1Q2N A;  2P2U A;  1NU1 E;  1NAF A;  2IX7 C;  1NKN A;  3H1J D;  2KYV A;  2M8R A;  3VP8 A;  1JTH B;  3KZI H;  3L36 A;  3L75 E;  1WRG A;  1LWU B;  5KKZ C;  3VN0 A;  3LID A;  2D2C C;  3A0H E;  5B66 E;  2MJZ A;  3B8E B;  5CBO A;  1FZE A;  1QEX A;  4L76 A;  5AVX B;  4JPZ B;  3A5T A;  4H44 C;  2ITA A;  3CL3 D;  4TLF A;  1L0N K;  3P8M C;  2P7J A;  4HH2 A;  1NTK E;  1JNM A;  2FXM A;  4H0L C;  5AVS B;  5AW4 B;  2FYU D;  2Q3E A;  2OYH B;  1GK4 A;  1YIT P;  3BCC J;  2H43 A;  3RBX A;  1EDI A;  3JCU E;  1NTM J;  1VQ5 P;  1RF0 C;  3H1H G;  1N7S A;  2JO1 A;  2XDJ A;  2E43 A;  4RES B;  2H88 C;  2OYI A;  1JUN A;  2A06 D;  2P67 A;  2ZXE B;  1SQP G;  3PHL A;  2XU6 A;  1IFM A;  2YXR B;  1PP9 D;  5E79 H;  1EXJ A;  4C46 A;  4WVZ A;  5KAF E;  4I7Z C;  5K5G B;  1DX7 A;  4YXD C;  1NWQ A;  3RK2 C;  4C7R A;  2LKM A;  3Q2Y A;  4DJG A;  1DH3 A;  1HJ0 A;  2A45 G;  2QRX A;  3L73 G;  3L71 G;  1EXI A;  3V2Q A;  2C9N Y;  1SQB G;  3MUD A;  3AE2 C;  4W80 A;  1ZR4 A;  3Q3D A;  2GM4 A;  1EQ7 A;  5KJ7 A;  1QGK B;  1NOH A;  1N73 A;  1K73 Q;  3HRN A;  1PV3 A;  3CX5 H;  1FZC B;  2WZ7 A;  1AJY A;  1Q7Y Q;  2N1T B;  1BE3 E;  3QH9 A;  3RK3 E;  3AE4 C;  2KLU A;  3CXH I;  4K35 A;  2J5U A;  4XFJ A;  1OVV A;  5AW9 B;  2QJK B;  2O01 J;  5CCG C;  2KZI A;  4ASW A;  2FYU K;  1JO5 A;  1P84 H;  2ZFC A;  1JY3 P;  1BCC J;  2R5B A;  3S4R A;  3PJS K;  1CI6 A;  3AEC C;  3WUU A;  2KNC A;  4JYC A;  3HD7 D;  5GTI E;  5BU8 B;  3L70 G;  4WY4 C;  2G8Y A;  1KQG B;  1RE4 C;  3HUS A;  3VYI A;  2B88 A;  2B87 A;  2GA1 A;  2WSS H;  3HD7 B;  1IK7 A;  1J1D B;  2NPS A;  1T2K C;  2JKV A;  1HF9 A;  5AVT B;  3KZI E;  4BWN A;  1LP1 A;  3GLM A;  1H0T A;  1KB9 H;  1YJ9 P;  2WPR A;  1SQB J;  3H1L E;  1N7S B;  1SS1 A;  3MHV A;  5CCH C;  5H2F H;  2E75 B;  3L4F A;  3CXH D;  1KYO I;  3KXD A;  2OYI B;  1MKM A;  1M8O B;  1NVO A;  2A45 H;  2KLV A;  1M57 D;  1SFC A;  2YKP A;  1KQL A;  4NPF X;  4Y99 C;  3WMM 0;  3CCU P;  4IL6 H;  1KZU B;  4GT1 A;  2E5T A;  3U59 A;  1SQV D;  3B5N A;  4JYB A;  2Z5H A;  3VP9 A;  3UIA A;  3TGU J;  1AQT A;  4EOT A;  3WUV A;  2G3A A;  1IFD A;  2XND H;  1M1K Q;  4U3F E;  3G4S P;  1R5S A;  3P8C D;  3TDK A;  1M7L A;  2JWD A;  1U7J A;  2KSJ A;  3ITK A;  1L0N E;  2ZT9 D;  3RL0 g;  1J1E B;  3D6Y A;  1TU3 F;  1NU1 J;  2M3E A;  2YIU B;  1N73 B;  1GL2 D;  4D6T D;  1DEE G;  3CWB E;  2POH A;  3L75 J;  5E79 E;  2O1K A;  2JDI H;  3A0B H;  3EWK A;  3BRV B;  2ZT9 B;  1VQO P;  4PD4 I;  1NTZ J;  3RK3 B;  1YHQ P;  2QE7 H;  1S3J A;  2IZ0 A;  2CPS A;  1S5L X;  2W6B A;  1L0L J;  1NTK J;  3G71 P;  1KYO D;  1LTT C;  3A2A A;  1CI6 B;  1SQX J;  3AE3 C;  1M1J B;  1OW8 A;  4NPE A;  2QJP B;  3H1I D;  3OW2 O;  3CX5 E;  2KNC B;  4L74 A;  3I5C A;  2NZ2 A;  1E5W A;  1USD A;  2R44 A;  1EZV E;  3U1C A;  1CW5 A;  5KLV J;  3HUS B;  2B87 B;  1LTJ C;  1SQQ D;  1T3U A;  3S9O A;  3D71 A;  1ZXG A;  1HGZ A;  2OQQ A;  1HTL C;  2NPS B;  3H1J E;  2HFE D;  2IPP A;  1P84 E;  2N9B A;  2QJY C;  1LP1 B;  1KMI Z;  4I6M C;  2KP8 A;  4NPD A;  1H0T B;  1W2E A;  2BCC D;  5CJ4 A;  1FZB A;  1IFJ A;  1SFC D;  3D6Z A;  2M5A A;  5DJU B;  2QM7 A;  1ZV8 A;  4PD4 D;  3CXH H;  5L8R J;  2P10 A;  1BGY G;  1KIL C;  1YJN P;  2FYU E;  1SFC B;  4GOE A;  4I1L A;  5AVR B;  3L74 J;  4MN4 C;  1GU5 A;  3FWL A;  2KIK A;  1VQ4 P;  3BVH A;  4ZNC A;  2V7Q H;  3B5N B;  3AED C;  3MD0 A;  3VOP A;  1KB9 E;  1RF0 A;  1BE3 J;  3VMY A;  3CD6 P;  5AW2 B;  1XTC C;  3LW5 J;  3GG2 A;  5H2F E;  4KT0 J;  3L72 D;  1RF1 B;  1VF5 B;  2PP6 A;  1DEB A;  4U3F G;  1JY3 N;  1XTG B;  3BCC D;  4OGQ D;  1NTM D;  1OZH A;  3AE5 C;  2E76 C;  4N78 E;  4C7N A;  4OGQ C;  1L0N G;  1Q90 D;  3CCV P;  4IL6 E;  4XA4 A;  1QVF O;  1M56 D;  4Y28 J;  1HVV A;  1YQ3 C; 
#chains in the Genus database with same CATH homology
 4KJM A;  2P58 A;  3RGU A;  2JWD A;  3ZDM A;  2KS1 B;  5C39 A;  1U7J A;  3FXE A;  1ZW0 A;  1LP1 B;  4HJG H;  1JMB A;  2M0B A;  4NPD A;  1H0T B;  2QVA A;  1Q2N A;  2B88 A;  2B87 A;  1OVU A;  5K5G B;  3QWO C;  1EDL A;  2KZJ A;  2Q1K A;  1DEE G;  2M5A A;  5DJU B;  2K3R A;  3FXD A;  2KUB A;  4CPG A;  4GOD A;  4IOI H;  2I8D A;  1LT1 A;  2OTK E;  1EDJ A;  2QRX A;  5CBO A;  2RKL A;  4EYY Q;  4GOE A;  2ZAE B;  1LP1 A;  3S1K A;  2UWJ E;  4HB1 A;  4MN4 C;  1S3J A;  2KIK A;  2LR2 A;  1JM0 A;  1H0T A;  1EDK A;  4ZNC A;  5CBN A;  2WMM A;  4HKZ H;  2HR3 A;  1SS1 A;  3MHV A;  1X0T A;  4ASV A;  1MFT A;  1BDC A;  4NPE A;  1BDD A;  3PH0 A;  1NVO A;  2LXC B;  4K35 A;  2R44 A;  2SPZ A;  4NPF X;  1OVV A;  2KI7 B;  3MZW B;  2LXB A;  1EDI A;  2KZI A;  2B87 B;  1FC2 C;  4ASW A;  4WWI A;  4GOF A;  1OVR A;  1EC5 A;  2B89 A;  2M5A B;  5EFW B;  4K3A A;  1ZXG A;  1Y47 A;  4JBZ A;  5DJT B;  1U7M A;  4ZMD A;  4BXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...