4GODA

Crystal structure of the sgta homodimerization domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
47
structure length
47
Chain Sequence
MKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small glutamine-rich tetratricopeptide repeat-containing pro
publication title Structures of the Sgt2/SGTA Dimerization Domain with the Get5/UBL4A UBL Domain Reveal an Interaction that Forms a Conserved Dynamic Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 17
structure length 47
sequence length 47
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4godA00
1ZXGA 2OTKE 2ZAEB 1NVOA 4NPEA 2WMMA 2UWJE 1EDLA 1OVUA 2M0BA 4K35A 1U7JA 2QRXA 1FC2C 3RGUA 2I8DA 2M5AA 5C39A 4IOIH 4KJMA 4GOFA 5DJUB 4ZMDA 4ASVA 1DEEG 2KS1B 2B87A 4ASWA 2KIKA 3FXDA 4HJGH 3S1KA 1EC5A 2JWDA 1OVRA 5DJTB 2K3RA 1H0TA 4K3AA 3QWOC 2P58A 2LXCB 4JBZA 2Q1KA 2SPZA 3MZWB 4GODA 4ZNCA 2LR2A 1S3JA 1MFTA 5CBOA 1Q2NA 2M5AB 1JMBA 2QVAA 3FXEA 3ZDMA 4HKZH 1LT1A 4GOEA 4BXLA 4CPGA 4MN4C 2B88A 3MHVA 1Y47A 2B87B 1LP1A 1SS1A 2KI7B 1BDCA 4NPDA 5CBNA 2KUBA 2R44A 2LXBA 1U7MA 1X0TA 5K5GB 1EDJA 5EFWB 1LP1B 4EYYQ 1H0TB 1EDKA 3PH0A 1ZW0A 2RKLA 2KZIA 1BDDA 4HB1A 1OVVA 2B89A 1JM0A 2KZJA 2HR3A 1EDIA 4NPFX 4WWIA
chains in the Genus database with same CATH superfamily
3IFMA 2OTKE 3EFGA 4H13D 2OYHA 4U3FD 2FYUJ 3P8MC 4L76A 3I5CA 3HD7B 1VQ7P 2I8DA 2OYHB 1W2EA 4IFMA 5APVA 1Q82Q 1RQUA 1S9KE 3QH9A 1AQTA 1T8ZA 1EXIA 2QE7H 3AEBC 4YTPC 2Q5UA 2ZVOB 5DJTB 1RF1C 2GA1A 3USSA 1NTKK 2PAJA 4ZNCA 2AXTH 1PPJE 3GF7A 1Q2NA 2OARA 3CXHD 4BXLA 2KK7A 3VP9A 1YQ3C 2IBZE 1N2DC 2KUBA 1J1EC 1T2KC 2N1TB 1YTZI 3TDKA 1EZVD 3H1HD 1VQ9P 1MUUA 2WSFJ 1URQC 3L71E 5APWA 1VF5D 3HE5A 1SQQG 1EXJA 3SSUA 2NPSA 4N3YB 3RK2D 3BATA 2A45G 4L75A 3TF5A 1YJNP 5CJ0A 1OVUA 2W27A 3GG2A 3L74G 1GL2C 1L0LD 2O01J 1FC2C 3L74E 1JB0J 5KAIE 2WT7B 4IFDK 3L70G 2Q7CA 2E75D 3L70E 2KP8A 2W6JH 1R8EA 1PV3A 2K88A 4PV1B 2Q6QA 1VQKP 1DD4A 4C7NA 3L72G 2KYVA 1JNMA 1IK9A 2QG4A 3H25A 1RH5B 3WUUA 3A0HE 1HF9A 3HE4A 4C7NB 4H13B 3AE6C 1NU1D 3MP7B 1SQVJ 1N73A 1RE3A 1IFPA 3FGAD 2JEEA 1IFJA 1RE4A 4GDOA 1IFMA 1AVYA 3JC22 1T3UA 3AECC 2N9BA 1N73B 5L8RJ 4O9BA 1FZCB 3VOPA 1HGZA 1T6AA 1OXZA 4EI2A 4ZKPA 4DCKA 5CCGA 3B5ND 3TSIA 2K1AA 2H88C 2RH0A 1JM0A 4I6MC 3HD7C 2O1KA 1KB9D 5M1BA 2OYHC 1FU1A 3O6QB 4PJ0E 2KNCA 2FXMA 3VN0A 1OFCX 4RJTA 2M0BA 2YKQA 2OTJP 1U7JA 3RGUA 1KORA 2K9JB 2M5AA 1GW3A 2KNCB 4ZMDA 3AEAC 4XE5B 1WRGA 3CCQP 3L35A 3CXHI 2WTYA 1VF5B 3OJAB 2DW3A 3AEGC 3BCCD 1KC8Q 5APTA 3V2PA 1BGYJ 1SQVE 3IAOA 3JCUH 1KYOD 2WPVB 1SQPD 1EZVI 1SQXD 3H1IJ 1OMIA 4OH8B 2OTLP 2QSIA 1OZHA 2N1TC 3G3ZA 3RK3E 3CX5E 2E75B 2H7HA 1T2KD 4WY4A 1URQD 1SLQA 3GLMA 3A5TA 5KLVD 1E79H 3SFDC 4WY4B 3L72D 3NXSA 5AW0B 1E5WA 4H44D 4IL6E 1VQ4P 2AEFA 1VQ6P 1GL2D 1CZQA 5AVUB 3CWBE 2XNXA 1OW6A 1QX8A 1KB9H 1X9VA 4KJMA 4PV1C 3T97B 4ASVA 1NTZG 2IPPA 1W2BO 1SQVK 4RESB 2YKPA 4XFJA 3CC4P 1BGYE 4H13C 3H1JD 3B5NB 3FXDA 3CCRP 1ZLLA 4HH2A 3H1KG 3M06A 1LJ2A 1HJBA 2GUVA 2WPSA 4UB8H 1MFTA 4WVZA 4C46A 1JMMA 1N73C 1L0NG 1JMBA 1NTMG 4HKZH 1FZCC 4XA4A 1QLED 4QMAA 1QEXA 1L0NE 1RE4C 4PD4E 1KB9I 4KT0J 2OYIA 1YHQP 1YBKA 1S5LX 1VQ5P 3Q2YA 3R2PA 2R44A 2Y0DA 3RL0g 4U3FG 4JF7A 5CCGC 2VRSA 2W6AA 1AV1A 1WMKA 2C0WA 2OYIB 4U3FE 3VTPC 2WPQA 4HB1A 1MKMA 2CK3H 1LTSC 1NO4A 3L75J 1H89A 1N7SA 2ZFCA 3AE7C 1M1JA 1L2PA 5AVRB 2W6BA 4KHXA 4D6TG 3IF4A 5BVZA 1NTKJ 2NRGA 2FYNB 3H32A 3TGUD 1VF5C 1PP9D 1CI6A 1JY2N 2FYZA 3GMAA 1YQ4C 1AJYA 3PRJA 3H1LJ 2FXOA 1VQOP 3B8EB 3CXHE 2JWAA 3A0BE 5AVSB 1L0NK 2ZJSE 3H6PA 4H44B 3LW5J 3P8CE 1EZVG 3HUSA 1KQGB 2E75C 3ZDMA 5GTIH 1EZVE 3H1HE 1PFIA 1X22A 1VQMP 2WSFH 4JPZB 2WITA 1NGMB 4IL6X 2BCCD 1Y8AA 1FE6A 4WY4C 3V2NA 5AW7B 1NTZD 1X0TA 2LXBA 5K5GB 1NH4A 1EDJA 3M9BA 5EFWB 1K9MQ 3CC7P 3PH0A 3AEFC 1PZQA 3L4FA 1M56D 1L0LE 2ZT9D 3WU2H 1M90Q 1S5LH 1JY3O 1HTLC 1H8AA 1AA0A 3GHGB 2A06E 2C9NY 2H43A 4JYCA 5AW4B 3KZIH 1Q90D 1IJDB 2WMMA 1LWUA 5AVYB 2Z4EA 2P2UA 5TJHA 1KMIZ 3BRTB 2QJKB 1LWUB 4DZOA 4TLFA 1HH0A 3B5NC 1HVVA 4AYCA 1IC2A 3L71J 1NU1E 2G8YA 4R4LA 3A3YB 1SQQJ 3M0AA 2HPCA 2WSEJ 2V7QJ 3QWOC 2LXCB 4JBZA 3MZWB 3L74J 1JCCA 2E74D 4D6TD 1LGHB 1GK6A 3V4WA 2OYIC 3VP8A 1VQLP 1L0LK 3L70J 1KB9E 2E43A 3MGNA 5CCGD 2Y0CA 2HODA 3RL0B 4UB6H 1Q7YQ 3L73D 1KFMA 2B89A 2HR3A 2FYNC 1NKZB 5E79H 2MJZA 5APQA 1HBWA 1NVOA 2YIUB 4I1LA 5KTBA 1JY2O 1NU1K 2UWJE 1JTHA 3HTKA 1KILA 4W80A 3D70A 3S4RA 1M8OB 3BCCG 3E1RA 3LIDA 1HGVA 3OAKA 1JTHB 3HTKB 1KILB 1ZR2A 1SQQE 2WWWA 3AE1C 1DEEG 3B71A 1SQPG 3W67A 3CCJP 1SQXG 1N8RQ 4H44C 1KYOE 3HE5B 4RKUJ 1SQPE 1QL1A 2NPSB 1SQXE 5KAFH 2C0XA 4JQ0D 2WQYC 2ZT9B 3G9RA 2FYUG 1G2CA 1FZFA 2W8ZA 2GUSA 2IX7C 3LIEA 3G4SP 1J2JB 1R5SA 3C9IA 3D6YA 4M3LA 1AFOA 3N7NA 1NKNA 1SFCA 2YXRB 5B66E 5GTHE 2JDIH 2WPRA 2Y9YA 1BE3D 3GW6A 5KLVG 1SFCB 5KLVE 1EQ7A 1NOHA 3L72E 4WY4D 1G1IA 3AE9C 1BCCD 3GHGC 1FOSE 5B5EH 3M0DA 3VMXA 3CMAP 2C9LY 2HG5D 1QVFO 2ZXEB 2KXPB 5AW8B 3HE4B 2YMYA 4YXDC 3KHUA 3O8ZA 3P32A 2R5BA 2QJKC 1LWUC 5H2FE 1SQQK 2L91A 2PFXA 3V2RA 5CJ4A 3H1JG 3CCSP 1SQPK 2E5TA 2E74B 1SQXK 3PHLA 3H1JE 2Z5HA 3MUDC 4BRYA 3S9OA 3V6IA 1LTIC 2XNDH 2J5UA 1S9KD 5AVWB 1A02F 2B87A 3II6A 2R3CA 3FWLA 2ZVNB 3C1LA 3NFQA 2WZ7A 5KJ7A 2YKOA 2IYOA 5APUA 1OVRA 1USDA 4OWFA 5KLVK 3EFFK 1FZEA 1S72P 4GODA 3CWBJ 5TISE 2KLUA 2M5AB 1YI2P 2QVAA 3FXEA 3KZIE 1SQBD 2QIWA 2QJYB 2Q3IA 3EWKA 1JEKA 2J59M 3EQ2A 3WMM0 3RL0C 1NTZJ 1L4AA 1DEBA 3CCVP 5APSA 2P10A 2FFDA 1ZN5A 1NWQA 1FS0E 2OGUA 1KV4A 1L4AB 1TU3F 4EYYQ 3G71P 1ZW0A 2YIUC 3H1KJ 3TGUG 5KKZB 2KS1A 2FFDB 1PP9G 1FZBA 3TGUE 2FYUD 4R4MA 1QL2A 1FDOA 4I7ZB 4L74A 1PP9E 2W83C 3CCUP 3AE5C 4JYBA 1QVGO 1Y9BA 1L0NJ 1Q86Q 1NTMJ 4NPEA 1KILC 1HJ0A 2XZRA 4H0LB 2NPSC 3WUVA 1GTWA 4DOJA 2ZT9C 4GOFA 5AW5B 1YJWP 2MKVA 2R32A 3R4YA 4U3FJ 3LW5H 2QEXP 2O3JA 1GMJA 2WSCH 1IFDA 3Q5PA 4ASWA 2AXTE 1JY3N 4OGQD 3D6ZA 1JY2P 3NMDA 3HRNA 2BCCG 1SFCC 1P84D 2BCCE 5AW6B 1NTZE 4D6TJ 5AW3B 2IZ1A 4AUWA 1LT1A 4MN4C 1VPCA 1IK7A 1K04A 1ZRTD 3H1KE 4DT0A 3M0DC 1RE3C 3B4SA 5KAFE 3H1IG 1NYHA 1NTME 2GM4A 3RBZA 3V2QA 2E74C 4YXWH 2D2CD 3H1HJ 3Q5SA 1MZ9A 3NTNA 3BRVB 1DD3A 1PGJA 3SWYA 1LT9A 2Y0EA 4N6JA 3Q3DA 1HUCA 5KLIB 1LT9B 1H88A 3N4XA 2WSEH 3L37A 1LTJA 1RF1A 2A45H 1OX3A 2V7QH 1JCDA 3TK1A 2CPBA 3CL3D 2HYNA 1L0LJ 2M3BA 3AEDC 1GU5A 1NTZK 1XTCC 2QM7A 1LTJB 1N7SB 3U1CA 5B5EE 5KAIH 4HJGH 3S1KA 4D6TE 1M1JB 2JWDA 1M7LA 2IBZI 2N9YB 2QJYC 1ZP0C 1N7LA 1YTZT 3H32B 2L5GB 2LR2A 1S3JA 3ABVC 2Y9ZA 5CMZA 1YJ9P 2KSEA 3RBXA 1CI6B 3L73G 5APYA 1JO5A 4N78D 3RK3D 1L4AC 3RL0D 3A0HH 3CI9A 2PGDA 1NU1J 1Y47A 1NTMK 1P84H 1PGPA 5KKZC 2FFDC 3KXDA 1ZOYC 4I7ZC 2E42A 4C7RA 1ZR4A 3AE8C 4OGQB 2RKLA 4GKGA 3CMEP 1D7MA 2CPSA 1FAVA 4H0LC 1OVVA 3HUSB 3TYYA 1M1KQ 1ZXGA 2KSJA 1KILD 2J58A 1HWTC 4TT3H 4DJGA 2H8PD 2NPSD 2ZYGA 2Z5IA 5AVVB 2O01H 2W90A 1P84I 4PJ0H 1VDFA 2H89C 1BE3G 3JCUE 1BGYD 3C8VA 4OVNF 1LTBC 2D2CB 3H1ID 3CPWO 3F5HA 1T3JA 1H0TA 1SFCD 2XV5A 1BCCG 3PTZA 1G1JA 3BCCJ 3H1LG 4PD4D 4CPGA 2PRRA 2POHA 3KQGA 1WT6A 3CCMP 1SQPJ 1SS1A 1SQXJ 4LC1A 3HD7A 2HPCB 1RHZB 4Y99B 3UIAA 2QA4P 2KZIA 3CX5H 1BDDA 2ZYDA 3U1AA 1KFNA 4ZKUA 2P7JA 5KLIC 1LT9C 3M91A 4U7JA 5KLVJ 1NJIQ 3RK3B 1JOCA 3L72J 4W7YA 3F89A 4K35A 3G6EP 1LTJC 1N7SC 4IL6H 4GT1A 1YYCA 2YO3A 1KD1Q 1PPJG 2HODB 3FX0A 1M1JC 3VYIA 2AXCA 1SQBG 1K05A 1PGQA 5KJ7D 1PIXA 3Q5RA 4UB8E 2FBWC 1SQBE 1XTGB 3CX5I 2IBZG 2N1TA 3P7KA 3BCCE 4K3AA 3P8CD 4WB4A 2FKWB 2K9YA 1M57D 2Q1KA 2SPZA 3H1JJ 2IYPA 5CCHA 3L71G 3TNUA 5CHXA 1L4AD 2JJLA 1PL5A 2JP3A 1GW4A 4OGQC 4EOTA 3TNUB 1GU4A 2FYUE 2XU6A 2FXPA 1BDCA 1VQ8P 4EDFA 3HUSC 3KYQA 1G2CB 3L75D 1U7MA 2I1JA 3A2AA 4PD4H 2WT7A 1VQPP 4H0LD 1UIIA 1FDMA 3ITKA 2NZ2A 5AVXB 2LKMA 1NTKD 1EDIA 2A06D 2E76B 2V4HA 3V4QA 2Q9IA 1Q81Q 1EDLA 1RF0A 3CD6P 1SQBK 3H1LD 1NAFA 2QM8A 3GF3A 1S4XA 1UIXA 5AVZB 5DJUB 2D2CC 3FWNA 1P84E 2WVRA 1GZLA 2IFNA 4PD4I 1KQSO 3TGUJ 5BU5A 5AVTB 1PP9J 1R5LA 3SWFA 5GTIE 1FZCA 3AE4C 2K3RA 1KZUB 1ZRTE 1LTAC 2FYUK 4Y28J 4BRYB 3CXHH 3VMAA 1JY3P 3A0BH 1J1DB 4Y99C 3O6QA 3CCEP 3I56P 1S2EA 2IZ0A 1MFZA 5AW2B 2B87B 3WU2E 3KDPB 3W68A 4NPDA 5AW1B 1S5LE 3MD0A 5CBNA 1PPJD 2K9JA 1SP4A 4AQRD 1FZGA 1EDKA 4A7PA 2IDBA 1IO4A 2FY8A 3RK3C 2BCCJ 2IBZD 1IFIA 1GK4A 2Q3EA 4WWIA 1RQVA 1AVOA 5APXA 3L71D 1N7SD 1SQVG 3RK2B 4BWNA 4IOIH 1SQQD 5BU8B 3M9QA 2KS1B 2AEMA 2YNYA 2P67A 3MTUE 1LNQA 4B86A 1USEA 4N78E 2WSSH 2ZXXA 3L74D 2PP6A 1ZMEC 1DX7A 5CCHC 1N86A 3L70D 5CBOA 3V5BA 1K73Q 1BSHA 2HFED 3CLQA 4UB6E 2OQQA 1NAYA 1SVFA 1GDTA 2QJPB 5E79E 1KILE 2E76C 1FZAA 3CWBG 3T97A 4LGDE 2HLOA 2ITAA 3U59A 3Q1MA 1OW7A 1GD2E 1FJPA 3VMYA 2AEJA 2KZJA 1VQNP 3PP5A 3B5NA 4NPFX 1BGYG 2ZAEB 1FOSF 2YMKA 2OYOA 3L73J 2B9BA 1RF0C 2JO1A 1QGKB 2YXQB 2KB7P 3PLNA 4Z1MH 1AQ5A 1PGOA 3JSVC 3H1IE 1JUNA 1KQFB 3E1IA 1MV8A 3AE3C 2JR8A 2BEZF 2KOGA 3SWKA 2O1JA 2O01N 4IFFA 1EC5A 2I1KA 1J1DC 1KYOH 4YPCA 2P58A 1KTMA 1LTGC 2M3EA 1CW5A 3IN6A 2IFMA 3E7KA 1YIJP 5KJ7C 2RMZA 3CCLP 1RF1B 3D71A 2P1JA 3MHVA 3HD7D 2KI7B 1SQVD 1KN7A 5AVQB 1BE3J 5B66H 3BVHA 5GTHH 2E5YA 3WUTA 1DIPA 1U57A 2M8RA 4EIJA 2R3SA 3OA7A 1IFNA 1URQA 3L36A 1OW8A 3L73E 3I55P 1J1EB 4RO0A 3CX5D 1BCCJ 1KYOI 4HYTB 2A45I 3RK2C 1ZV8A 1URQB 2KLVA 1YITP 3AE2C 1NHLA 3BASA 3KPEA 2QRXA 1K8AQ 1IZNB 3A7OA 5C39A 1GL2A 1W5CE 5H2FH 1A02J 2JKVA 2WSCJ 3H1HG 3AEEC 1GL2B 4L73A 2KIKA 3M9HA 2N1TD 1OIPA 3CWBD 5AW9B 3IR9A 3K5BA 4GIFA 1CSBA 1OWAA 5CCHD 1DH3A 3L75G 1KQLA 3L75E 1Z56A 1X8YA 1FDIA 4LLHA 3GHGA 1L0LG 2QJPC 2XKMA 4GOEA 1BE3E 3MIWA 2B88A 1NTKG 2A06G 3SFEC 2BEQD 1NTKE 1LP1A 3H1KD 5TISH 1S1CX 1FBMA 1X79B 4WBAA 1SQBJ 2R5DA 1RY3A 1FJKA 2E76D 4W7ZA 3VMZA 1BCCE 1LP1B 2XDJA 1H0TB 2K37A 2RN0A 2BASA 1L0ND 3PJSK 1NTMD 2G3AA 4I2LC 4PV1D 3H1LE 2ZYAA 3MUDA 1VL2A 1LTTC 1BSNA 1NU1G 3OW2O 2YO2A 3CC2P
chains in the Genus database with same CATH topology
1ZXGA 2OTKE 2ZAEB 1NVOA 4NPEA 2WMMA 2UWJE 1EDLA 1OVUA 2M0BA 4K35A 1U7JA 2QRXA 1FC2C 3RGUA 2I8DA 2M5AA 5C39A 4IOIH 4KJMA 4GOFA 5DJUB 4ZMDA 4ASVA 1DEEG 2KS1B 2B87A 4ASWA 2KIKA 3FXDA 4HJGH 3S1KA 1EC5A 2JWDA 1OVRA 5DJTB 2K3RA 1H0TA 4K3AA 3QWOC 2P58A 2LXCB 4JBZA 2Q1KA 2SPZA 3MZWB 4GODA 4ZNCA 2LR2A 1S3JA 1MFTA 5CBOA 1Q2NA 2M5AB 1JMBA 2QVAA 3FXEA 3ZDMA 4HKZH 1LT1A 4GOEA 4BXLA 4CPGA 4MN4C 2B88A 3MHVA 1Y47A 2B87B 1LP1A 1SS1A 2KI7B 1BDCA 4NPDA 5CBNA 2KUBA 2R44A 2LXBA 1U7MA 1X0TA 5K5GB 1EDJA 5EFWB 1LP1B 4EYYQ 1H0TB 1EDKA 3PH0A 1ZW0A 2RKLA 2KZIA 1BDDA 4HB1A 1OVVA 2B89A 1JM0A 2KZJA 2HR3A 1EDIA 4NPFX 4WWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZXG A;  2OTK E;  2ZAE B;  1NVO A;  4NPE A;  2WMM A;  2UWJ E;  1EDL A;  1OVU A;  2M0B A;  4K35 A;  1U7J A;  2QRX A;  1FC2 C;  3RGU A;  2I8D A;  2M5A A;  5C39 A;  4IOI H;  4KJM A;  4GOF A;  5DJU B;  4ZMD A;  4ASV A;  1DEE G;  2KS1 B;  2B87 A;  4ASW A;  2KIK A;  3FXD A;  4HJG H;  3S1K A;  1EC5 A;  2JWD A;  1OVR A;  5DJT B;  2K3R A;  1H0T A;  4K3A A;  3QWO C;  2P58 A;  2LXC B;  4JBZ A;  2Q1K A;  2SPZ A;  3MZW B;  4GOD A;  4ZNC A;  2LR2 A;  1S3J A;  1MFT A;  5CBO A;  1Q2N A;  2M5A B;  1JMB A;  2QVA A;  3FXE A;  3ZDM A;  4HKZ H;  1LT1 A;  4GOE A;  4BXL A;  4CPG A;  4MN4 C;  2B88 A;  3MHV A;  1Y47 A;  2B87 B;  1LP1 A;  1SS1 A;  2KI7 B;  1BDC A;  4NPD A;  5CBN A;  2KUB A;  2R44 A;  2LXB A;  1U7M A;  1X0T A;  5K5G B;  1EDJ A;  5EFW B;  1LP1 B;  4EYY Q;  1H0T B;  1EDK A;  3PH0 A;  1ZW0 A;  2RKL A;  2KZI A;  1BDD A;  4HB1 A;  1OVV A;  2B89 A;  1JM0 A;  2KZJ A;  2HR3 A;  1EDI A;  4NPF X;  4WWI A; 
#chains in the Genus database with same CATH topology
 3IFM A;  2OTK E;  3EFG A;  4H13 D;  2OYH A;  4U3F D;  2FYU J;  3P8M C;  4L76 A;  3I5C A;  3HD7 B;  1VQ7 P;  2I8D A;  2OYH B;  1W2E A;  4IFM A;  5APV A;  1Q82 Q;  1RQU A;  1S9K E;  3QH9 A;  1AQT A;  1T8Z A;  1EXI A;  2QE7 H;  3AEB C;  4YTP C;  2Q5U A;  2ZVO B;  5DJT B;  1RF1 C;  2GA1 A;  3USS A;  1NTK K;  2PAJ A;  4ZNC A;  2AXT H;  1PPJ E;  3GF7 A;  1Q2N A;  2OAR A;  3CXH D;  4BXL A;  2KK7 A;  3VP9 A;  1YQ3 C;  2IBZ E;  1N2D C;  2KUB A;  1J1E C;  1T2K C;  2N1T B;  1YTZ I;  3TDK A;  1EZV D;  3H1H D;  1VQ9 P;  1MUU A;  2WSF J;  1URQ C;  3L71 E;  5APW A;  1VF5 D;  3HE5 A;  1SQQ G;  1EXJ A;  3SSU A;  2NPS A;  4N3Y B;  3RK2 D;  3BAT A;  2A45 G;  4L75 A;  3TF5 A;  1YJN P;  5CJ0 A;  1OVU A;  2W27 A;  3GG2 A;  3L74 G;  1GL2 C;  1L0L D;  2O01 J;  1FC2 C;  3L74 E;  1JB0 J;  5KAI E;  2WT7 B;  4IFD K;  3L70 G;  2Q7C A;  2E75 D;  3L70 E;  2KP8 A;  2W6J H;  1R8E A;  1PV3 A;  2K88 A;  4PV1 B;  2Q6Q A;  1VQK P;  1DD4 A;  4C7N A;  3L72 G;  2KYV A;  1JNM A;  1IK9 A;  2QG4 A;  3H25 A;  1RH5 B;  3WUU A;  3A0H E;  1HF9 A;  3HE4 A;  4C7N B;  4H13 B;  3AE6 C;  1NU1 D;  3MP7 B;  1SQV J;  1N73 A;  1RE3 A;  1IFP A;  3FGA D;  2JEE A;  1IFJ A;  1RE4 A;  4GDO A;  1IFM A;  1AVY A;  3JC2 2;  1T3U A;  3AEC C;  2N9B A;  1N73 B;  5L8R J;  4O9B A;  1FZC B;  3VOP A;  1HGZ A;  1T6A A;  1OXZ A;  4EI2 A;  4ZKP A;  4DCK A;  5CCG A;  3B5N D;  3TSI A;  2K1A A;  2H88 C;  2RH0 A;  1JM0 A;  4I6M C;  3HD7 C;  2O1K A;  1KB9 D;  5M1B A;  2OYH C;  1FU1 A;  3O6Q B;  4PJ0 E;  2KNC A;  2FXM A;  3VN0 A;  1OFC X;  4RJT A;  2M0B A;  2YKQ A;  2OTJ P;  1U7J A;  3RGU A;  1KOR A;  2K9J B;  2M5A A;  1GW3 A;  2KNC B;  4ZMD A;  3AEA C;  4XE5 B;  1WRG A;  3CCQ P;  3L35 A;  3CXH I;  2WTY A;  1VF5 B;  3OJA B;  2DW3 A;  3AEG C;  3BCC D;  1KC8 Q;  5APT A;  3V2P A;  1BGY J;  1SQV E;  3IAO A;  3JCU H;  1KYO D;  2WPV B;  1SQP D;  1EZV I;  1SQX D;  3H1I J;  1OMI A;  4OH8 B;  2OTL P;  2QSI A;  1OZH A;  2N1T C;  3G3Z A;  3RK3 E;  3CX5 E;  2E75 B;  2H7H A;  1T2K D;  4WY4 A;  1URQ D;  1SLQ A;  3GLM A;  3A5T A;  5KLV D;  1E79 H;  3SFD C;  4WY4 B;  3L72 D;  3NXS A;  5AW0 B;  1E5W A;  4H44 D;  4IL6 E;  1VQ4 P;  2AEF A;  1VQ6 P;  1GL2 D;  1CZQ A;  5AVU B;  3CWB E;  2XNX A;  1OW6 A;  1QX8 A;  1KB9 H;  1X9V A;  4KJM A;  4PV1 C;  3T97 B;  4ASV A;  1NTZ G;  2IPP A;  1W2B O;  1SQV K;  4RES B;  2YKP A;  4XFJ A;  3CC4 P;  1BGY E;  4H13 C;  3H1J D;  3B5N B;  3FXD A;  3CCR P;  1ZLL A;  4HH2 A;  3H1K G;  3M06 A;  1LJ2 A;  1HJB A;  2GUV A;  2WPS A;  4UB8 H;  1MFT A;  4WVZ A;  4C46 A;  1JMM A;  1N73 C;  1L0N G;  1JMB A;  1NTM G;  4HKZ H;  1FZC C;  4XA4 A;  1QLE D;  4QMA A;  1QEX A;  1L0N E;  1RE4 C;  4PD4 E;  1KB9 I;  4KT0 J;  2OYI A;  1YHQ P;  1YBK A;  1S5L X;  1VQ5 P;  3Q2Y A;  3R2P A;  2R44 A;  2Y0D A;  3RL0 g;  4U3F G;  4JF7 A;  5CCG C;  2VRS A;  2W6A A;  1AV1 A;  1WMK A;  2C0W A;  2OYI B;  4U3F E;  3VTP C;  2WPQ A;  4HB1 A;  1MKM A;  2CK3 H;  1LTS C;  1NO4 A;  3L75 J;  1H89 A;  1N7S A;  2ZFC A;  3AE7 C;  1M1J A;  1L2P A;  5AVR B;  2W6B A;  4KHX A;  4D6T G;  3IF4 A;  5BVZ A;  1NTK J;  2NRG A;  2FYN B;  3H32 A;  3TGU D;  1VF5 C;  1PP9 D;  1CI6 A;  1JY2 N;  2FYZ A;  3GMA A;  1YQ4 C;  1AJY A;  3PRJ A;  3H1L J;  2FXO A;  1VQO P;  3B8E B;  3CXH E;  2JWA A;  3A0B E;  5AVS B;  1L0N K;  2ZJS E;  3H6P A;  4H44 B;  3LW5 J;  3P8C E;  1EZV G;  3HUS A;  1KQG B;  2E75 C;  3ZDM A;  5GTI H;  1EZV E;  3H1H E;  1PFI A;  1X22 A;  1VQM P;  2WSF H;  4JPZ B;  2WIT A;  1NGM B;  4IL6 X;  2BCC D;  1Y8A A;  1FE6 A;  4WY4 C;  3V2N A;  5AW7 B;  1NTZ D;  1X0T A;  2LXB A;  5K5G B;  1NH4 A;  1EDJ A;  3M9B A;  5EFW B;  1K9M Q;  3CC7 P;  3PH0 A;  3AEF C;  1PZQ A;  3L4F A;  1M56 D;  1L0L E;  2ZT9 D;  3WU2 H;  1M90 Q;  1S5L H;  1JY3 O;  1HTL C;  1H8A A;  1AA0 A;  3GHG B;  2A06 E;  2C9N Y;  2H43 A;  4JYC A;  5AW4 B;  3KZI H;  1Q90 D;  1IJD B;  2WMM A;  1LWU A;  5AVY B;  2Z4E A;  2P2U A;  5TJH A;  1KMI Z;  3BRT B;  2QJK B;  1LWU B;  4DZO A;  4TLF A;  1HH0 A;  3B5N C;  1HVV A;  4AYC A;  1IC2 A;  3L71 J;  1NU1 E;  2G8Y A;  4R4L A;  3A3Y B;  1SQQ J;  3M0A A;  2HPC A;  2WSE J;  2V7Q J;  3QWO C;  2LXC B;  4JBZ A;  3MZW B;  3L74 J;  1JCC A;  2E74 D;  4D6T D;  1LGH B;  1GK6 A;  3V4W A;  2OYI C;  3VP8 A;  1VQL P;  1L0L K;  3L70 J;  1KB9 E;  2E43 A;  3MGN A;  5CCG D;  2Y0C A;  2HOD A;  3RL0 B;  4UB6 H;  1Q7Y Q;  3L73 D;  1KFM A;  2B89 A;  2HR3 A;  2FYN C;  1NKZ B;  5E79 H;  2MJZ A;  5APQ A;  1HBW A;  1NVO A;  2YIU B;  4I1L A;  5KTB A;  1JY2 O;  1NU1 K;  2UWJ E;  1JTH A;  3HTK A;  1KIL A;  4W80 A;  3D70 A;  3S4R A;  1M8O B;  3BCC G;  3E1R A;  3LID A;  1HGV A;  3OAK A;  1JTH B;  3HTK B;  1KIL B;  1ZR2 A;  1SQQ E;  2WWW A;  3AE1 C;  1DEE G;  3B71 A;  1SQP G;  3W67 A;  3CCJ P;  1SQX G;  1N8R Q;  4H44 C;  1KYO E;  3HE5 B;  4RKU J;  1SQP E;  1QL1 A;  2NPS B;  1SQX E;  5KAF H;  2C0X A;  4JQ0 D;  2WQY C;  2ZT9 B;  3G9R A;  2FYU G;  1G2C A;  1FZF A;  2W8Z A;  2GUS A;  2IX7 C;  3LIE A;  3G4S P;  1J2J B;  1R5S A;  3C9I A;  3D6Y A;  4M3L A;  1AFO A;  3N7N A;  1NKN A;  1SFC A;  2YXR B;  5B66 E;  5GTH E;  2JDI H;  2WPR A;  2Y9Y A;  1BE3 D;  3GW6 A;  5KLV G;  1SFC B;  5KLV E;  1EQ7 A;  1NOH A;  3L72 E;  4WY4 D;  1G1I A;  3AE9 C;  1BCC D;  3GHG C;  1FOS E;  5B5E H;  3M0D A;  3VMX A;  3CMA P;  2C9L Y;  2HG5 D;  1QVF O;  2ZXE B;  2KXP B;  5AW8 B;  3HE4 B;  2YMY A;  4YXD C;  3KHU A;  3O8Z A;  3P32 A;  2R5B A;  2QJK C;  1LWU C;  5H2F E;  1SQQ K;  2L91 A;  2PFX A;  3V2R A;  5CJ4 A;  3H1J G;  3CCS P;  1SQP K;  2E5T A;  2E74 B;  1SQX K;  3PHL A;  3H1J E;  2Z5H A;  3MUD C;  4BRY A;  3S9O A;  3V6I A;  1LTI C;  2XND H;  2J5U A;  1S9K D;  5AVW B;  1A02 F;  2B87 A;  3II6 A;  2R3C A;  3FWL A;  2ZVN B;  3C1L A;  3NFQ A;  2WZ7 A;  5KJ7 A;  2YKO A;  2IYO A;  5APU A;  1OVR A;  1USD A;  4OWF A;  5KLV K;  3EFF K;  1FZE A;  1S72 P;  4GOD A;  3CWB J;  5TIS E;  2KLU A;  2M5A B;  1YI2 P;  2QVA A;  3FXE A;  3KZI E;  1SQB D;  2QIW A;  2QJY B;  2Q3I A;  3EWK A;  1JEK A;  2J59 M;  3EQ2 A;  3WMM 0;  3RL0 C;  1NTZ J;  1L4A A;  1DEB A;  3CCV P;  5APS A;  2P10 A;  2FFD A;  1ZN5 A;  1NWQ A;  1FS0 E;  2OGU A;  1KV4 A;  1L4A B;  1TU3 F;  4EYY Q;  3G71 P;  1ZW0 A;  2YIU C;  3H1K J;  3TGU G;  5KKZ B;  2KS1 A;  2FFD B;  1PP9 G;  1FZB A;  3TGU E;  2FYU D;  4R4M A;  1QL2 A;  1FDO A;  4I7Z B;  4L74 A;  1PP9 E;  2W83 C;  3CCU P;  3AE5 C;  4JYB A;  1QVG O;  1Y9B A;  1L0N J;  1Q86 Q;  1NTM J;  4NPE A;  1KIL C;  1HJ0 A;  2XZR A;  4H0L B;  2NPS C;  3WUV A;  1GTW A;  4DOJ A;  2ZT9 C;  4GOF A;  5AW5 B;  1YJW P;  2MKV A;  2R32 A;  3R4Y A;  4U3F J;  3LW5 H;  2QEX P;  2O3J A;  1GMJ A;  2WSC H;  1IFD A;  3Q5P A;  4ASW A;  2AXT E;  1JY3 N;  4OGQ D;  3D6Z A;  1JY2 P;  3NMD A;  3HRN A;  2BCC G;  1SFC C;  1P84 D;  2BCC E;  5AW6 B;  1NTZ E;  4D6T J;  5AW3 B;  2IZ1 A;  4AUW A;  1LT1 A;  4MN4 C;  1VPC A;  1IK7 A;  1K04 A;  1ZRT D;  3H1K E;  4DT0 A;  3M0D C;  1RE3 C;  3B4S A;  5KAF E;  3H1I G;  1NYH A;  1NTM E;  2GM4 A;  3RBZ A;  3V2Q A;  2E74 C;  4YXW H;  2D2C D;  3H1H J;  3Q5S A;  1MZ9 A;  3NTN A;  3BRV B;  1DD3 A;  1PGJ A;  3SWY A;  1LT9 A;  2Y0E A;  4N6J A;  3Q3D A;  1HUC A;  5KLI B;  1LT9 B;  1H88 A;  3N4X A;  2WSE H;  3L37 A;  1LTJ A;  1RF1 A;  2A45 H;  1OX3 A;  2V7Q H;  1JCD A;  3TK1 A;  2CPB A;  3CL3 D;  2HYN A;  1L0L J;  2M3B A;  3AED C;  1GU5 A;  1NTZ K;  1XTC C;  2QM7 A;  1LTJ B;  1N7S B;  3U1C A;  5B5E E;  5KAI H;  4HJG H;  3S1K A;  4D6T E;  1M1J B;  2JWD A;  1M7L A;  2IBZ I;  2N9Y B;  2QJY C;  1ZP0 C;  1N7L A;  1YTZ T;  3H32 B;  2L5G B;  2LR2 A;  1S3J A;  3ABV C;  2Y9Z A;  5CMZ A;  1YJ9 P;  2KSE A;  3RBX A;  1CI6 B;  3L73 G;  5APY A;  1JO5 A;  4N78 D;  3RK3 D;  1L4A C;  3RL0 D;  3A0H H;  3CI9 A;  2PGD A;  1NU1 J;  1Y47 A;  1NTM K;  1P84 H;  1PGP A;  5KKZ C;  2FFD C;  3KXD A;  1ZOY C;  4I7Z C;  2E42 A;  4C7R A;  1ZR4 A;  3AE8 C;  4OGQ B;  2RKL A;  4GKG A;  3CME P;  1D7M A;  2CPS A;  1FAV A;  4H0L C;  1OVV A;  3HUS B;  3TYY A;  1M1K Q;  1ZXG A;  2KSJ A;  1KIL D;  2J58 A;  1HWT C;  4TT3 H;  4DJG A;  2H8P D;  2NPS D;  2ZYG A;  2Z5I A;  5AVV B;  2O01 H;  2W90 A;  1P84 I;  4PJ0 H;  1VDF A;  2H89 C;  1BE3 G;  3JCU E;  1BGY D;  3C8V A;  4OVN F;  1LTB C;  2D2C B;  3H1I D;  3CPW O;  3F5H A;  1T3J A;  1H0T A;  1SFC D;  2XV5 A;  1BCC G;  3PTZ A;  1G1J A;  3BCC J;  3H1L G;  4PD4 D;  4CPG A;  2PRR A;  2POH A;  3KQG A;  1WT6 A;  3CCM P;  1SQP J;  1SS1 A;  1SQX J;  4LC1 A;  3HD7 A;  2HPC B;  1RHZ B;  4Y99 B;  3UIA A;  2QA4 P;  2KZI A;  3CX5 H;  1BDD A;  2ZYD A;  3U1A A;  1KFN A;  4ZKU A;  2P7J A;  5KLI C;  1LT9 C;  3M91 A;  4U7J A;  5KLV J;  1NJI Q;  3RK3 B;  1JOC A;  3L72 J;  4W7Y A;  3F89 A;  4K35 A;  3G6E P;  1LTJ C;  1N7S C;  4IL6 H;  4GT1 A;  1YYC A;  2YO3 A;  1KD1 Q;  1PPJ G;  2HOD B;  3FX0 A;  1M1J C;  3VYI A;  2AXC A;  1SQB G;  1K05 A;  1PGQ A;  5KJ7 D;  1PIX A;  3Q5R A;  4UB8 E;  2FBW C;  1SQB E;  1XTG B;  3CX5 I;  2IBZ G;  2N1T A;  3P7K A;  3BCC E;  4K3A A;  3P8C D;  4WB4 A;  2FKW B;  2K9Y A;  1M57 D;  2Q1K A;  2SPZ A;  3H1J J;  2IYP A;  5CCH A;  3L71 G;  3TNU A;  5CHX A;  1L4A D;  2JJL A;  1PL5 A;  2JP3 A;  1GW4 A;  4OGQ C;  4EOT A;  3TNU B;  1GU4 A;  2FYU E;  2XU6 A;  2FXP A;  1BDC A;  1VQ8 P;  4EDF A;  3HUS C;  3KYQ A;  1G2C B;  3L75 D;  1U7M A;  2I1J A;  3A2A A;  4PD4 H;  2WT7 A;  1VQP P;  4H0L D;  1UII A;  1FDM A;  3ITK A;  2NZ2 A;  5AVX B;  2LKM A;  1NTK D;  1EDI A;  2A06 D;  2E76 B;  2V4H A;  3V4Q A;  2Q9I A;  1Q81 Q;  1EDL A;  1RF0 A;  3CD6 P;  1SQB K;  3H1L D;  1NAF A;  2QM8 A;  3GF3 A;  1S4X A;  1UIX A;  5AVZ B;  5DJU B;  2D2C C;  3FWN A;  1P84 E;  2WVR A;  1GZL A;  2IFN A;  4PD4 I;  1KQS O;  3TGU J;  5BU5 A;  5AVT B;  1PP9 J;  1R5L A;  3SWF A;  5GTI E;  1FZC A;  3AE4 C;  2K3R A;  1KZU B;  1ZRT E;  1LTA C;  2FYU K;  4Y28 J;  4BRY B;  3CXH H;  3VMA A;  1JY3 P;  3A0B H;  1J1D B;  4Y99 C;  3O6Q A;  3CCE P;  3I56 P;  1S2E A;  2IZ0 A;  1MFZ A;  5AW2 B;  2B87 B;  3WU2 E;  3KDP B;  3W68 A;  4NPD A;  5AW1 B;  1S5L E;  3MD0 A;  5CBN A;  1PPJ D;  2K9J A;  1SP4 A;  4AQR D;  1FZG A;  1EDK A;  4A7P A;  2IDB A;  1IO4 A;  2FY8 A;  3RK3 C;  2BCC J;  2IBZ D;  1IFI A;  1GK4 A;  2Q3E A;  4WWI A;  1RQV A;  1AVO A;  5APX A;  3L71 D;  1N7S D;  1SQV G;  3RK2 B;  4BWN A;  4IOI H;  1SQQ D;  5BU8 B;  3M9Q A;  2KS1 B;  2AEM A;  2YNY A;  2P67 A;  3MTU E;  1LNQ A;  4B86 A;  1USE A;  4N78 E;  2WSS H;  2ZXX A;  3L74 D;  2PP6 A;  1ZME C;  1DX7 A;  5CCH C;  1N86 A;  3L70 D;  5CBO A;  3V5B A;  1K73 Q;  1BSH A;  2HFE D;  3CLQ A;  4UB6 E;  2OQQ A;  1NAY A;  1SVF A;  1GDT A;  2QJP B;  5E79 E;  1KIL E;  2E76 C;  1FZA A;  3CWB G;  3T97 A;  4LGD E;  2HLO A;  2ITA A;  3U59 A;  3Q1M A;  1OW7 A;  1GD2 E;  1FJP A;  3VMY A;  2AEJ A;  2KZJ A;  1VQN P;  3PP5 A;  3B5N A;  4NPF X;  1BGY G;  2ZAE B;  1FOS F;  2YMK A;  2OYO A;  3L73 J;  2B9B A;  1RF0 C;  2JO1 A;  1QGK B;  2YXQ B;  2KB7 P;  3PLN A;  4Z1M H;  1AQ5 A;  1PGO A;  3JSV C;  3H1I E;  1JUN A;  1KQF B;  3E1I A;  1MV8 A;  3AE3 C;  2JR8 A;  2BEZ F;  2KOG A;  3SWK A;  2O1J A;  2O01 N;  4IFF A;  1EC5 A;  2I1K A;  1J1D C;  1KYO H;  4YPC A;  2P58 A;  1KTM A;  1LTG C;  2M3E A;  1CW5 A;  3IN6 A;  2IFM A;  3E7K A;  1YIJ P;  5KJ7 C;  2RMZ A;  3CCL P;  1RF1 B;  3D71 A;  2P1J A;  3MHV A;  3HD7 D;  2KI7 B;  1SQV D;  1KN7 A;  5AVQ B;  1BE3 J;  5B66 H;  3BVH A;  5GTH H;  2E5Y A;  3WUT A;  1DIP A;  1U57 A;  2M8R A;  4EIJ A;  2R3S A;  3OA7 A;  1IFN A;  1URQ A;  3L36 A;  1OW8 A;  3L73 E;  3I55 P;  1J1E B;  4RO0 A;  3CX5 D;  1BCC J;  1KYO I;  4HYT B;  2A45 I;  3RK2 C;  1ZV8 A;  1URQ B;  2KLV A;  1YIT P;  3AE2 C;  1NHL A;  3BAS A;  3KPE A;  2QRX A;  1K8A Q;  1IZN B;  3A7O A;  5C39 A;  1GL2 A;  1W5C E;  5H2F H;  1A02 J;  2JKV A;  2WSC J;  3H1H G;  3AEE C;  1GL2 B;  4L73 A;  2KIK A;  3M9H A;  2N1T D;  1OIP A;  3CWB D;  5AW9 B;  3IR9 A;  3K5B A;  4GIF A;  1CSB A;  1OWA A;  5CCH D;  1DH3 A;  3L75 G;  1KQL A;  3L75 E;  1Z56 A;  1X8Y A;  1FDI A;  4LLH A;  3GHG A;  1L0L G;  2QJP C;  2XKM A;  4GOE A;  1BE3 E;  3MIW A;  2B88 A;  1NTK G;  2A06 G;  3SFE C;  2BEQ D;  1NTK E;  1LP1 A;  3H1K D;  5TIS H;  1S1C X;  1FBM A;  1X79 B;  4WBA A;  1SQB J;  2R5D A;  1RY3 A;  1FJK A;  2E76 D;  4W7Z A;  3VMZ A;  1BCC E;  1LP1 B;  2XDJ A;  1H0T B;  2K37 A;  2RN0 A;  2BAS A;  1L0N D;  3PJS K;  1NTM D;  2G3A A;  4I2L C;  4PV1 D;  3H1L E;  2ZYA A;  3MUD A;  1VL2 A;  1LTT C;  1BSN A;  1NU1 G;  3OW2 O;  2YO2 A;  3CC2 P; 
#chains in the Genus database with same CATH homology
 1ZXG A;  2OTK E;  2ZAE B;  1NVO A;  4NPE A;  2WMM A;  2UWJ E;  1EDL A;  1OVU A;  2M0B A;  4K35 A;  1U7J A;  2QRX A;  1FC2 C;  3RGU A;  2I8D A;  2M5A A;  5C39 A;  4IOI H;  4KJM A;  4GOF A;  5DJU B;  4ZMD A;  4ASV A;  1DEE G;  2KS1 B;  2B87 A;  4ASW A;  2KIK A;  3FXD A;  4HJG H;  3S1K A;  1EC5 A;  2JWD A;  1OVR A;  5DJT B;  2K3R A;  1H0T A;  4K3A A;  3QWO C;  2P58 A;  2LXC B;  4JBZ A;  2Q1K A;  2SPZ A;  3MZW B;  4GOD A;  4ZNC A;  2LR2 A;  1S3J A;  1MFT A;  5CBO A;  1Q2N A;  2M5A B;  1JMB A;  2QVA A;  3FXE A;  3ZDM A;  4HKZ H;  1LT1 A;  4GOE A;  4BXL A;  4CPG A;  4MN4 C;  2B88 A;  3MHV A;  1Y47 A;  2B87 B;  1LP1 A;  1SS1 A;  2KI7 B;  1BDC A;  4NPD A;  5CBN A;  2KUB A;  2R44 A;  2LXB A;  1U7M A;  1X0T A;  5K5G B;  1EDJ A;  5EFW B;  1LP1 B;  4EYY Q;  1H0T B;  1EDK A;  3PH0 A;  1ZW0 A;  2RKL A;  2KZI A;  1BDD A;  4HB1 A;  1OVV A;  2B89 A;  1JM0 A;  2KZJ A;  2HR3 A;  1EDI A;  4NPF X;  4WWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...