4GODA

Crystal structure of the sgta homodimerization domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
47
structure length
47
Chain Sequence
MKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Sgt2/SGTA Dimerization Domain with the Get5/UBL4A UBL Domain Reveal an Interaction that Forms a Conserved Dynamic Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Small glutamine-rich tetratricopeptide repeat-containing pro
total genus 17
structure length 47
sequence length 47
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4godA00
4JBZA 4K3AA 2KZJA 2B89A 5EFWB 1BDDA 1ZW0A 5DJUB 1OVUA 2UWJE 1EDIA 3ZDMA 1MFTA 5CBNA 3QWOC 2QRXA 5DJTB 4GODA 4IOIH 2KS1B 4ZMDA 2KUBA 2ZAEB 1Y47A 4ASWA 3MHVA 2B88A 4NPDA 2OTKE 1X0TA 1ZXGA 4BXLA 1U7MA 2RKLA 2KI7B 2LXCB 4CPGA 4NPFX 2M0BA 2P58A 2B87B 2QVAA 2LR2A 3RGUA 4K35A 1LT1A 2M5AA 4HB1A 1H0TB 2M5AB 2KZIA 2R44A 3MZWB 1Q2NA 2K3RA 4GOFA 1BDCA 1FC2C 3PH0A 1EDKA 3FXDA 4HKZH 1EDJA 3S1KA 1S3JA 4ZNCA 1NVOA 1SS1A 2HR3A 1U7JA 2Q1KA 4MN4C 1DEEG 2B87A 1EC5A 5CBOA 1OVRA 2KIKA 3FXEA 4WWIA 2I8DA 1EDLA 2JWDA 5K5GB 1LP1A 2SPZA 2WMMA 1OVVA 4GOEA 2LXBA 4ASVA 5C39A 4KJMA 4EYYQ 4HJGH 4NPEA 1JMBA 1H0TA 1LP1B 1JM0A
chains in the Genus database with same CATH superfamily
3A5TA 1FZEA 3L73J 2J58A 3PHLA 3R4YA 2A06D 2KYVA 1GL2D 2KZJA 2KNCB 2N1TA 3G9RA 1JY2N 4D6TJ 1T2KC 2A06E 2IBZE 3Q5PA 3O8ZA 3JSVC 2ZVNB 1FOSE 3W68A 1LT9C 2QEXP 2NPSB 5CCHA 1GW4A 4L75A 1Q90D 2FYUJ 1GL2A 1EZVG 2ZT9B 1YTZT 3CMAP 2WSEH 1KQFB 3RK2C 4KT0J 1KD1Q 2A45I 3EFFK 1AFOA 4N6JA 1Q82Q 3RL0g 5KKZB 4UB8E 2ZXXA 1AJYA 3GF3A 1PGJA 1NJIQ 2K88A 3CXHE 2RH0A 1K73Q 3RBXA 3KZIE 1RE4C 1K9MQ 2NPSA 4W7ZA 2YKOA 2P1JA 5AW6B 2C0XA 2KUBA 3Q5SA 1VQPP 5APXA 1AA0A 2ZYGA 2I1JA 1NU1E 2W6JH 3I55P 4AUWA 3HE5A 4IFDK 1S5LH 3L70D 4IL6X 4C7NB 5GTHE 2KLUA 4ASWA 1HF9A 3GHGA 4OGQB 1M1JA 1PGOA 2JP3A 1SFCA 4KJMA 1LGHB 2OTKE 2JDIH 1EZVD 1KMIZ 3H1JG 1X0TA 3AEBC 1USDA 4WY4B 1GU5A 1SLQA 3L71J 1U7MA 4IFMA 1OX3A 4M3LA 4PV1B 4DJGA 3CCUP 1L2PA 1RQUA 1IFDA 2NRGA 1IK7A 3AEDC 1SQQK 5APYA 2CPBA 3VN0A 3L72G 3G3ZA 1CI6B 1FZGA 2YXRB 3H1HG 1HWTC 2A06G 3Q3DA 3NTNA 2WSEJ 2KSEA 3M06A 2B87B 2FYUE 4H44D 1Q86Q 2PP6A 2XV5A 2HFED 2P67A 1E79H 3CWBE 4Y28J 1KB9D 2IYPA 1KZUB 3FX0A 2WSFH 3E7KA 3WMM0 1VDFA 2W27A 1R5LA 2FFDA 1IJDB 2JO1A 3TYYA 1LTJB 1MZ9A 4BRYB 1OMIA 3B5ND 1CZQA 2O1KA 3H1IE 2V4HA 3VYIA 2PAJA 2FXMA 1AQTA 1BCCE 3D6ZA 1PIXA 1Q2NA 2M8RA 2YMKA 3EQ2A 1ZP0C 4H13C 3CX5H 1YQ3C 3TNUA 4AQRD 1NGMB 1SQBD 1VF5B 2W8ZA 1NAFA 1FC2C 2WPQA 4DZOA 1P84E 1QVFO 3PH0A 1EDKA 4N78D 1SQPE 1JCCA 3KPEA 3VP9A 2Z4EA 4JQ0D 1NU1J 1N73B 5KLIB 3V2RA 3GG2A 5KAIH 3H1JE 1RH5B 1KB9H 1SQVG 1SQPG 1GZLA 1QL1A 2YO3A 4PD4E 5H2FH 3H1JD 1SQVD 2RMZA 1H89A 2WPSA 1YI2P 1L0NK 3LIDA 2ZYDA 2YKPA 4N3YB 3S1KA 2XDJA 2G8YA 2P10A 1KYOI 3AE2C 4KHXA 3S9OA 2IFNA 1FZCC 1L4AC 1NTKJ 2E76B 5KAIE 2FFDB 2V7QJ 1U7JA 4A7PA 1IFNA 2Y0EA 3CPWO 2OYHC 2Q1KA 1M1KQ 5CJ0A 1M90Q 1DEEG 1JY2P 2WQYC 1YYCA 1EC5A 2YIUB 1RY3A 2R3CA 1RE3C 2IDBA 2Q3IA 1M1JB 1S4XA 1URQD 1G1IA 2E43A 1KILA 2FXPA 1EDLA 4GIFA 5AVXB 1PZQA 1SFCD 1BGYJ 3OA7A 4U7JA 3RL0B 3GMAA 4H0LB 1YJ9P 2XU6A 2SPZA 1AVYA 1YBKA 1BGYG 1JY3O 3NFQA 2WVRA 4GOEA 4YPCA 1T3UA 3BCCD 3N4XA 3RBZA 1YITP 2GUVA 2BCCE 1RF0A 3BCCJ 2W90A 3E1IA 3GHGB 4WBAA 1JEKA 5AW2B 1D7MA 1VQ6P 3RL0D 1NYHA 1GL2C 1SQXJ 2PFXA 3L72D 4EYYQ 3V4QA 1VQ5P 1GK4A 1HUCA 1PP9G 4NPEA 1NTZE 1YHQP 4U3FJ 3IR9A 1UIXA 3WU2E 2H89C 2OTJP 1NU1K 3SSUA 1JY2O 2QJPC 2J5UA 1J1EC 3L36A 3MD0A 3H6PA 2E76D 1OZHA 4L73A 4OH8B 3VMXA 3W67A 4I2LC 1BE3J 1W5CE 2QA4P 4GT1A 1K05A 4R4MA 2KK7A 1SQPK 1SQVJ 5DJUB 4Y99C 1OVUA 2UWJE 1NTMJ 1URQC 2D2CC 2HODB 5TJHA 4EIJA 1QL2A 2WPVB 1KYOE 3CC7P 1SQQE 1FAVA 2OYIC 4AYCA 1EDIA 1SFCC 2E74C 2K9YA 4IFFA 2QJYC 5CCGC 3ZDMA 1RF1C 1X79B 2KNCA 2N1TB 2W83C 1HVVA 3H1HE 1FE6A 1KILB 1NHLA 1YQ4C 2PGDA 1S5LX 2KLVA 2QRXA 3H1KG 4PD4I 1GDTA 3NXSA 1KFMA 1K04A 3AE5C 4GODA 1ZMEC 3UIAA 3VMAA 1DIPA 1XTGB 2N1TD 1VQ8P 2CPSA 1ZR2A 2Q6QA 4BRYA 4I6MC 2XNXA 3SWFA 1JY3N 4DT0A 3CX5D 3HUSA 3H1IJ 1N7SA 3B5NB 3M0DA 3O6QA 2QM7A 5AVQB 5AW1B 3A0HE 3PRJA 1BE3E 1VQLP 3GLMA 2BCCG 1URQA 1DH3A 1NO4A 1NTKK 5KLVK 2XZRA 3HTKB 3CCLP 1SQBG 2FXOA 1LTJA 3Q1MA 1TU3F 3V2NA 4C7RA 3EWKA 4Z1MH 1YTZI 3H1KD 5AVYB 4DOJA 2VRSA 1VQ9P 2WSFJ 3B5NC 5BU8B 2D2CD 2JWAA 3JCUH 5GTIE 3I5CA 3MUDA 3TNUB 1SQQD 3L4FA 4BWNA 5AW4B 3L71E 3OAKA 2IYOA 3D6YA 3V6IA 1OFCX 3CMEP 4H13D 3D70A 4EDFA 1SQPJ 1M57D 4XE5B 1L0NJ 1KILC 2WZ7A 3MIWA 3TDKA 2N1TC 2R44A 3MZWB 2A45G 1JOCA 2QJYB 5M1BA 2E74B 2FYUG 1SFCB 2O1JA 1PP9D 3BRVB 3CXHH 3H1LJ 2OYIB 1URQB 2D2CB 3BRTB 2BASA 2KOGA 3WUTA 4Y99B 5B66H 1VPCA 3LIEA 1RF1B 5TISE 2OTLP 3B71A 1XTCC 3SFDC 3KQGA 2WSCJ 2C0WA 2PRRA 3MUDC 2QSIA 1J1EB 3A2AA 1R5SA 1FBMA 2QJPB 5CCHD 2FY8A 3MGNA 1RQVA 2V7QH 3AEGC 4DCKA 1S3JA 3TK1A 3EFGA 1NVOA 1L0LD 1WRGA 2Z5HA 3H1IG 3H1LG 2HR3A 2K9JA 1ZRTE 3MTUE 4UB6E 1L0LG 2L5GB 1GL2B 2WWWA 2ZVOB 3HE5B 3S4RA 4C46A 3CXHD 1KYOH 3CC4P 3A3YB 3GHGC 2IPPA 3P8CD 1NTZG 1AVOA 1BSNA 1BCCD 2IBZI 1SQBK 3BASA 5KJ7A 1OVRA 3P8CE 2WSSH 4WWIA 3CC2P 3BATA 2YMYA 1BCCJ 1M56D 1CSBA 3L74J 4H0LC 4ZKPA 5K5GB 1N7SD 3RL0C 4LC1A 2ITAA 1N7LA 2ZXEB 4B86A 1KQSO 1M1JC 2WSCH 3V2QA 1L0LJ 3SWYA 1HBWA 4ASVA 2YIUC 1ZR4A 3AE3C 5AVVB 3VP8A 3CX5E 3T97B 2M3EA 4YXWH 2OYHB 2FFDC 1RE4A 1L4AB 2E76C 3RK3D 1FZCB 1JMBA 2E75D 4OVNF 1PL5A 3CD6P 2AEMA 3PJSK 3CWBD 2KSJA 2R5DA 4K3AA 1HTLC 1LTSC 1E5WA 3M0AA 3L37A 1ZLLA 3H1KE 2FKWB 3H1LE 2MKVA 4PV1D 1SQXE 5KLIC 4WY4D 1N73C 2E74D 4WVZA 2QG4A 5CCGD 1VQKP 2HYNA 4JPZB 4N78E 1SQBE 1VF5C 2J59M 2QE7H 3H1HJ 1WT6A 5CMZA 3P8MC 4H13B 2AXTE 1G1JA 3H1HD 1NTMD 1JCDA 1MFTA 1OXZA 2BCCD 2R3SA 4H0LD 2Y0DA 5CBNA 1NTME 1X8YA 4PD4D 1YJWP 1IK9A 3QWOC 1MV8A 1LNQA 3L75G 5APVA 5TISH 3TGUE 1H8AA 1LTJC 2YKQA 1ZOYC 2BEQD 1NTZK 3M91A 2KS1B 2OYOA 4GKGA 4LGDE 5L8RJ 1FZCA 1KB9E 2O3JA 2ZAEB 5H2FE 1Y47A 3L72E 5KLVD 3B5NA 2QIWA 2Y9ZA 3C8VA 1N73A 3MHVA 1BSHA 3AEFC 2WT7B 1RHZB 2ZT9D 3KZIH 3H32A 1GW3A 5CHXA 2K1AA 5APSA 1H88A 5KLVJ 3HTKA 1ZXGA 1L4AA 3TGUJ 1OWAA 2N9BA 2O01J 4BXLA 1MUUA 3U59A 2OYHA 1NH4A 4D6TE 1PPJD 2BEZF 3L75J 1JTHB 4PV1C 1NU1G 4WY4C 3L73G 1DX7A 4HH2A 3M9BA 4D6TG 4NPFX 1SQXG 1OW7A 2P58A 3CWBG 3IN6A 1NWQA 1A02F 4OGQC 1VF5D 2IZ1A 1FZFA 3SWKA 1MKMA 2H8PD 1IC2A 3CCVP 1KILD 2LR2A 2H88C 2XKMA 3PP5A 4WB4A 3VOPA 1IFIA 4JYBA 3WUVA 1LTBC 2Q7CA 4K35A 1CW5A 1LT1A 1FJKA 1YIJP 1JUNA 1H0TB 1QLED 3M9QA 1LTTC 1P84H 2M5AB 3JCUE 1EZVE 1RF0C 4L76A 1FDOA 2FYUD 2I1KA 3PTZA 5AW5B 5AW8B 1JMMA 1NTKD 2P2UA 3WUUA 4ZKUA 5KKZC 3FGAD 1NKZB 4GOFA 5KLVE 3CWBJ 3CLQA 3RK2B 4U3FD 1BCCG 1BDCA 3L71G 2Z5IA 2FBWC 4D6TD 2ZT9C 5CCHC 2Q3EA 3L73D 1L0LE 3OW2O 2Q9IA 2NPSC 1NTZJ 2ZJSE 4RKUJ 1LT9B 3CL3D 5APUA 3SFEC 1SQXD 3L72J 1GK6A 2JEEA 1M7LA 1SQQG 2YXQB 1FZAA 2WT7A 2HG5D 3OJAB 1FDMA 2E5YA 3L74G 1GU4A 3BCCE 1EDJA 3C1LA 5BU5A 5AW9B 3FWLA 3NMDA 1P84D 1VQNP 1PFIA 1SS1A 4PJ0H 4TT3H 4XA4A 3B4SA 3LW5J 4U3FG 5AVWB 1HH0A 3TGUD 2OGUA 1BGYE 1KC8Q 1N7SC 1Y8AA 3LW5H 1WMKA 2LKMA 2A45H 3M0DC 3IAOA 2QM8A 3N7NA 5CBOA 3CCRP 2C9LY 2I8DA 1DD3A 2G3AA 4UB6H 2JKVA 1SQPD 1R8EA 3KXDA 3Q2YA 2JWDA 2ZFCA 3IF4A 4OWFA 1LP1A 1LWUB 2W6BA 3RK3E 5KAFH 3ABVC 4C7NA 1X22A 1LWUA 1OVVA 2WPRA 1FU1A 3RK3C 1J2JB 2FYUK 3AEAC 1OIPA 2E75C 4QMAA 1S9KE 3CCJP 2WTYA 1RF1A 5APTA 3HUSB 1KTMA 2NPSD 2N9YB 5BVZA 3HD7C 2POHA 1IO4A 4I7ZC 5C39A 3VMZA 1NTMK 3H25A 1Z56A 1NU1D 1QGKB 1FDIA 3CI9A 3H1JJ 1L0NG 4I1LA 4HJGH 3MP7B 4HYTB 4YTPC 2QJKC 5KJ7D 2JJLA 2KS1A 1JNMA 3II6A 1LP1B 1PGPA 1L0NE 1NKNA 1KILE 2WITA 2YO2A 2GM4A 1IZNB 1USEA 1CI6A 4JBZA 2NZ2A 3AE4C 4TLFA 1RE3A 1VQMP 1SP4A 4EI2A 1A02J 5AVSB 5GTIH 4RJTA 3HRNA 5B5EE 2B89A 5EFWB 5KLVG 1BDDA 4WY4A 1QVGO 5E79H 4YXDC 1IFJA 1ZW0A 2ZYAA 3L74E 1S2EA 2CK3H 3B8EB 4L74A 3G4SP 3KHUA 2P7JA 2C9NY 1KV4A 1T8ZA 2FYNB 1VQOP 3A7OA 1T3JA 1ZN5A 5B5EH 2R32A 2KB7P 1K8AQ 1IFMA 3O6QB 3A0HH 1J1DC 2KP8A 3P7KA 3VMYA 3TSIA 3VTPC 2IBZG 4RO0A 1IFPA 3P32A 4W80A 3Q5RA 1NTZD 5DJTB 4H44B 1ZRTD 2E42A 4IOIH 3AE1C 4ZMDA 2AXTH 1LTAC 3HE4B 5KTBA 3HD7D 1AV1A 3HE4A 3KDPB 1G2CB 4JF7A 1QX8A 3H1LD 5KAFE 1HGVA 1KQLA 3KYQA 1U57A 5KJ7C 1MFZA 2B88A 3L74D 2OARA 4NPDA 1S1CX 4PD4H 4R4LA 5CJ4A 4IL6H 1SQVK 3H1ID 1FJPA 2DW3A 5AW7B 1EZVI 1VL2A 4XFJA 3V2PA 4OGQD 3G71P 2RKLA 5APQA 3AECC 3L70J 3K5BA 1M8OB 2KI7B 3CXHI 1NTKG 1ZV8A 1JTHA 3F89A 1SQQJ 2LXCB 1G2CA 1PGQA 2IBZD 4CPGA 1KORA 2M0BA 1VQ4P 3CCMP 2YNYA 2QVAA 1BE3G 1BGYD 3L75E 2O01N 4IL6E 3H32B 4LLHA 3USSA 1X9VA 2KXPB 2H43A 3A0BH 2K9JB 3BCCG 4JYCA 3I56P 3GW6A 1FS0E 3R2PA 3RGUA 2M5AA 2W6AA 4H44C 2XNDH 4HB1A 2B9BA 2Y9YA 5AW3B 1S72P 1W2BO 3AE8C 3AE6C 3M9HA 2KZIA 1PP9J 2FYZA 1J1DB 2H7HA 2OYIA 5CCGA 1S9KD 1PPJG 1KYOD 2FYNC 1L0ND 2K3RA 3A0BE 4EOTA 4W7YA 3L73E 5AVZB 1PPJE 2K37A 3U1CA 2AEFA 3FXDA 1JB0J 3AE9C 1N2DC 1PV3A 3E1RA 3C9IA 4HKZH 1JY3P 5AVRB 2IFMA 2O01H 1HJ0A 1N86A 4O9BA 4PJ0E 1YJNP 2IZ0A 3FWNA 5E79E 3V4WA 1EXIA 1S5LE 4RESB 1KN7A 1W2EA 2AEJA 1FZBA 1LTIC 1OW8A 3TF5A 1L0LK 1HJBA 1LJ2A 1OW6A 2HPCA 2Q5UA 1NAYA 2GA1A 1EQ7A 4ZNCA 2QJKB 2IX7C 1T2KD 1JO5A 5AW0B 3H1KJ 1DEBA 3ITKA 3V5BA 1SQXK 3PLNA 4GDOA 3CCSP 4I7ZB 1NTMG 1PP9E 3HD7B 4MN4C 4UB8H 2R5BA 3L75D 3TGUG 2B87A 3HUSC 1SQVE 2OQQA 1NTKE 2MJZA 3QH9A 5AVTB 3U1AA 2KIKA 2E75B 1EXJA 3T97A 3FXEA 1L4AD 3L70G 3RK3B 3G6EP 3RK2D 1KB9I 1HGZA 1DD4A 1GMJA 3AE7C 1GTWA 1N8RQ 1FOSF 1LWUC 1SVFA 2JR8A 1LTGC 2HLOA 2Y0CA 1VQ7P 1LT9A 2AXCA 1NOHA 2WMMA 4U3FE 1GD2E 1AQ5A 1KFNA 1KQGB 3HD7A 3CX5I 3BVHA 2LXBA 5GTHH 3CCEP 3AEEC 1QEXA 2GUSA 2L91A 3GF7A 1N7SB 2E5TA 3L70E 3F5HA 5APWA 3WU2H 3JC22 1Q7YQ 3IFMA 5AVUB 2HPCB 2M3BA 1P84I 2RN0A 3D71A 2BCCJ 1UIIA 2HODA 3L71D 3CCQP 1Y9BA 1H0TA 1T6AA 3L35A 1SQBJ 5B66E 1Q81Q 1BE3D 1JM0A
chains in the Genus database with same CATH topology
4JBZA 4K3AA 2KZJA 2B89A 5EFWB 1BDDA 1ZW0A 5DJUB 1OVUA 2UWJE 1EDIA 3ZDMA 1MFTA 5CBNA 3QWOC 2QRXA 5DJTB 4GODA 4IOIH 2KS1B 4ZMDA 2KUBA 2ZAEB 1Y47A 4ASWA 3MHVA 2B88A 4NPDA 2OTKE 1X0TA 1ZXGA 4BXLA 1U7MA 2RKLA 2KI7B 2LXCB 4CPGA 4NPFX 2M0BA 2P58A 2B87B 2QVAA 2LR2A 3RGUA 4K35A 1LT1A 2M5AA 4HB1A 1H0TB 2M5AB 2KZIA 2R44A 3MZWB 1Q2NA 2K3RA 4GOFA 1BDCA 1FC2C 3PH0A 1EDKA 3FXDA 4HKZH 1EDJA 3S1KA 1S3JA 4ZNCA 1NVOA 1SS1A 2HR3A 1U7JA 2Q1KA 4MN4C 1DEEG 2B87A 1EC5A 5CBOA 1OVRA 2KIKA 3FXEA 4WWIA 2I8DA 1EDLA 2JWDA 5K5GB 1LP1A 2SPZA 2WMMA 1OVVA 4GOEA 2LXBA 4ASVA 5C39A 4KJMA 4EYYQ 4HJGH 4NPEA 1JMBA 1H0TA 1LP1B 1JM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JBZ A;  4K3A A;  2KZJ A;  2B89 A;  5EFW B;  1BDD A;  1ZW0 A;  5DJU B;  1OVU A;  2UWJ E;  1EDI A;  3ZDM A;  1MFT A;  5CBN A;  3QWO C;  2QRX A;  5DJT B;  4GOD A;  4IOI H;  2KS1 B;  4ZMD A;  2KUB A;  2ZAE B;  1Y47 A;  4ASW A;  3MHV A;  2B88 A;  4NPD A;  2OTK E;  1X0T A;  1ZXG A;  4BXL A;  1U7M A;  2RKL A;  2KI7 B;  2LXC B;  4CPG A;  4NPF X;  2M0B A;  2P58 A;  2B87 B;  2QVA A;  2LR2 A;  3RGU A;  4K35 A;  1LT1 A;  2M5A A;  4HB1 A;  1H0T B;  2M5A B;  2KZI A;  2R44 A;  3MZW B;  1Q2N A;  2K3R A;  4GOF A;  1BDC A;  1FC2 C;  3PH0 A;  1EDK A;  3FXD A;  4HKZ H;  1EDJ A;  3S1K A;  1S3J A;  4ZNC A;  1NVO A;  1SS1 A;  2HR3 A;  1U7J A;  2Q1K A;  4MN4 C;  1DEE G;  2B87 A;  1EC5 A;  5CBO A;  1OVR A;  2KIK A;  3FXE A;  4WWI A;  2I8D A;  1EDL A;  2JWD A;  5K5G B;  1LP1 A;  2SPZ A;  2WMM A;  1OVV A;  4GOE A;  2LXB A;  4ASV A;  5C39 A;  4KJM A;  4EYY Q;  4HJG H;  4NPE A;  1JMB A;  1H0T A;  1LP1 B;  1JM0 A; 
#chains in the Genus database with same CATH topology
 3A5T A;  1FZE A;  3L73 J;  2J58 A;  3PHL A;  3R4Y A;  2A06 D;  2KYV A;  1GL2 D;  2KZJ A;  2KNC B;  2N1T A;  3G9R A;  1JY2 N;  4D6T J;  1T2K C;  2A06 E;  2IBZ E;  3Q5P A;  3O8Z A;  3JSV C;  2ZVN B;  1FOS E;  3W68 A;  1LT9 C;  2QEX P;  2NPS B;  5CCH A;  1GW4 A;  4L75 A;  1Q90 D;  2FYU J;  1GL2 A;  1EZV G;  2ZT9 B;  1YTZ T;  3CMA P;  2WSE H;  1KQF B;  3RK2 C;  4KT0 J;  1KD1 Q;  2A45 I;  3EFF K;  1AFO A;  4N6J A;  1Q82 Q;  3RL0 g;  5KKZ B;  4UB8 E;  2ZXX A;  1AJY A;  3GF3 A;  1PGJ A;  1NJI Q;  2K88 A;  3CXH E;  2RH0 A;  1K73 Q;  3RBX A;  3KZI E;  1RE4 C;  1K9M Q;  2NPS A;  4W7Z A;  2YKO A;  2P1J A;  5AW6 B;  2C0X A;  2KUB A;  3Q5S A;  1VQP P;  5APX A;  1AA0 A;  2ZYG A;  2I1J A;  1NU1 E;  2W6J H;  3I55 P;  4AUW A;  3HE5 A;  4IFD K;  1S5L H;  3L70 D;  4IL6 X;  4C7N B;  5GTH E;  2KLU A;  4ASW A;  1HF9 A;  3GHG A;  4OGQ B;  1M1J A;  1PGO A;  2JP3 A;  1SFC A;  4KJM A;  1LGH B;  2OTK E;  2JDI H;  1EZV D;  1KMI Z;  3H1J G;  1X0T A;  3AEB C;  1USD A;  4WY4 B;  1GU5 A;  1SLQ A;  3L71 J;  1U7M A;  4IFM A;  1OX3 A;  4M3L A;  4PV1 B;  4DJG A;  3CCU P;  1L2P A;  1RQU A;  1IFD A;  2NRG A;  1IK7 A;  3AED C;  1SQQ K;  5APY A;  2CPB A;  3VN0 A;  3L72 G;  3G3Z A;  1CI6 B;  1FZG A;  2YXR B;  3H1H G;  1HWT C;  2A06 G;  3Q3D A;  3NTN A;  2WSE J;  2KSE A;  3M06 A;  2B87 B;  2FYU E;  4H44 D;  1Q86 Q;  2PP6 A;  2XV5 A;  2HFE D;  2P67 A;  1E79 H;  3CWB E;  4Y28 J;  1KB9 D;  2IYP A;  1KZU B;  3FX0 A;  2WSF H;  3E7K A;  3WMM 0;  1VDF A;  2W27 A;  1R5L A;  2FFD A;  1IJD B;  2JO1 A;  3TYY A;  1LTJ B;  1MZ9 A;  4BRY B;  1OMI A;  3B5N D;  1CZQ A;  2O1K A;  3H1I E;  2V4H A;  3VYI A;  2PAJ A;  2FXM A;  1AQT A;  1BCC E;  3D6Z A;  1PIX A;  1Q2N A;  2M8R A;  2YMK A;  3EQ2 A;  1ZP0 C;  4H13 C;  3CX5 H;  1YQ3 C;  3TNU A;  4AQR D;  1NGM B;  1SQB D;  1VF5 B;  2W8Z A;  1NAF A;  1FC2 C;  2WPQ A;  4DZO A;  1P84 E;  1QVF O;  3PH0 A;  1EDK A;  4N78 D;  1SQP E;  1JCC A;  3KPE A;  3VP9 A;  2Z4E A;  4JQ0 D;  1NU1 J;  1N73 B;  5KLI B;  3V2R A;  3GG2 A;  5KAI H;  3H1J E;  1RH5 B;  1KB9 H;  1SQV G;  1SQP G;  1GZL A;  1QL1 A;  2YO3 A;  4PD4 E;  5H2F H;  3H1J D;  1SQV D;  2RMZ A;  1H89 A;  2WPS A;  1YI2 P;  1L0N K;  3LID A;  2ZYD A;  2YKP A;  4N3Y B;  3S1K A;  2XDJ A;  2G8Y A;  2P10 A;  1KYO I;  3AE2 C;  4KHX A;  3S9O A;  2IFN A;  1FZC C;  1L4A C;  1NTK J;  2E76 B;  5KAI E;  2FFD B;  2V7Q J;  1U7J A;  4A7P A;  1IFN A;  2Y0E A;  3CPW O;  2OYH C;  2Q1K A;  1M1K Q;  5CJ0 A;  1M90 Q;  1DEE G;  1JY2 P;  2WQY C;  1YYC A;  1EC5 A;  2YIU B;  1RY3 A;  2R3C A;  1RE3 C;  2IDB A;  2Q3I A;  1M1J B;  1S4X A;  1URQ D;  1G1I A;  2E43 A;  1KIL A;  2FXP A;  1EDL A;  4GIF A;  5AVX B;  1PZQ A;  1SFC D;  1BGY J;  3OA7 A;  4U7J A;  3RL0 B;  3GMA A;  4H0L B;  1YJ9 P;  2XU6 A;  2SPZ A;  1AVY A;  1YBK A;  1BGY G;  1JY3 O;  3NFQ A;  2WVR A;  4GOE A;  4YPC A;  1T3U A;  3BCC D;  3N4X A;  3RBZ A;  1YIT P;  2GUV A;  2BCC E;  1RF0 A;  3BCC J;  2W90 A;  3E1I A;  3GHG B;  4WBA A;  1JEK A;  5AW2 B;  1D7M A;  1VQ6 P;  3RL0 D;  1NYH A;  1GL2 C;  1SQX J;  2PFX A;  3L72 D;  4EYY Q;  3V4Q A;  1VQ5 P;  1GK4 A;  1HUC A;  1PP9 G;  4NPE A;  1NTZ E;  1YHQ P;  4U3F J;  3IR9 A;  1UIX A;  3WU2 E;  2H89 C;  2OTJ P;  1NU1 K;  3SSU A;  1JY2 O;  2QJP C;  2J5U A;  1J1E C;  3L36 A;  3MD0 A;  3H6P A;  2E76 D;  1OZH A;  4L73 A;  4OH8 B;  3VMX A;  3W67 A;  4I2L C;  1BE3 J;  1W5C E;  2QA4 P;  4GT1 A;  1K05 A;  4R4M A;  2KK7 A;  1SQP K;  1SQV J;  5DJU B;  4Y99 C;  1OVU A;  2UWJ E;  1NTM J;  1URQ C;  2D2C C;  2HOD B;  5TJH A;  4EIJ A;  1QL2 A;  2WPV B;  1KYO E;  3CC7 P;  1SQQ E;  1FAV A;  2OYI C;  4AYC A;  1EDI A;  1SFC C;  2E74 C;  2K9Y A;  4IFF A;  2QJY C;  5CCG C;  3ZDM A;  1RF1 C;  1X79 B;  2KNC A;  2N1T B;  2W83 C;  1HVV A;  3H1H E;  1FE6 A;  1KIL B;  1NHL A;  1YQ4 C;  2PGD A;  1S5L X;  2KLV A;  2QRX A;  3H1K G;  4PD4 I;  1GDT A;  3NXS A;  1KFM A;  1K04 A;  3AE5 C;  4GOD A;  1ZME C;  3UIA A;  3VMA A;  1DIP A;  1XTG B;  2N1T D;  1VQ8 P;  2CPS A;  1ZR2 A;  2Q6Q A;  4BRY A;  4I6M C;  2XNX A;  3SWF A;  1JY3 N;  4DT0 A;  3CX5 D;  3HUS A;  3H1I J;  1N7S A;  3B5N B;  3M0D A;  3O6Q A;  2QM7 A;  5AVQ B;  5AW1 B;  3A0H E;  3PRJ A;  1BE3 E;  1VQL P;  3GLM A;  2BCC G;  1URQ A;  1DH3 A;  1NO4 A;  1NTK K;  5KLV K;  2XZR A;  3HTK B;  3CCL P;  1SQB G;  2FXO A;  1LTJ A;  3Q1M A;  1TU3 F;  3V2N A;  4C7R A;  3EWK A;  4Z1M H;  1YTZ I;  3H1K D;  5AVY B;  4DOJ A;  2VRS A;  1VQ9 P;  2WSF J;  3B5N C;  5BU8 B;  2D2C D;  2JWA A;  3JCU H;  5GTI E;  3I5C A;  3MUD A;  3TNU B;  1SQQ D;  3L4F A;  4BWN A;  5AW4 B;  3L71 E;  3OAK A;  2IYO A;  3D6Y A;  3V6I A;  1OFC X;  3CME P;  4H13 D;  3D70 A;  4EDF A;  1SQP J;  1M57 D;  4XE5 B;  1L0N J;  1KIL C;  2WZ7 A;  3MIW A;  3TDK A;  2N1T C;  2R44 A;  3MZW B;  2A45 G;  1JOC A;  2QJY B;  5M1B A;  2E74 B;  2FYU G;  1SFC B;  2O1J A;  1PP9 D;  3BRV B;  3CXH H;  3H1L J;  2OYI B;  1URQ B;  2D2C B;  3BRT B;  2BAS A;  2KOG A;  3WUT A;  4Y99 B;  5B66 H;  1VPC A;  3LIE A;  1RF1 B;  5TIS E;  2OTL P;  3B71 A;  1XTC C;  3SFD C;  3KQG A;  2WSC J;  2C0W A;  2PRR A;  3MUD C;  2QSI A;  1J1E B;  3A2A A;  1R5S A;  1FBM A;  2QJP B;  5CCH D;  2FY8 A;  3MGN A;  1RQV A;  2V7Q H;  3AEG C;  4DCK A;  1S3J A;  3TK1 A;  3EFG A;  1NVO A;  1L0L D;  1WRG A;  2Z5H A;  3H1I G;  3H1L G;  2HR3 A;  2K9J A;  1ZRT E;  3MTU E;  4UB6 E;  1L0L G;  2L5G B;  1GL2 B;  2WWW A;  2ZVO B;  3HE5 B;  3S4R A;  4C46 A;  3CXH D;  1KYO H;  3CC4 P;  3A3Y B;  3GHG C;  2IPP A;  3P8C D;  1NTZ G;  1AVO A;  1BSN A;  1BCC D;  2IBZ I;  1SQB K;  3BAS A;  5KJ7 A;  1OVR A;  3P8C E;  2WSS H;  4WWI A;  3CC2 P;  3BAT A;  2YMY A;  1BCC J;  1M56 D;  1CSB A;  3L74 J;  4H0L C;  4ZKP A;  5K5G B;  1N7S D;  3RL0 C;  4LC1 A;  2ITA A;  1N7L A;  2ZXE B;  4B86 A;  1KQS O;  1M1J C;  2WSC H;  3V2Q A;  1L0L J;  3SWY A;  1HBW A;  4ASV A;  2YIU C;  1ZR4 A;  3AE3 C;  5AVV B;  3VP8 A;  3CX5 E;  3T97 B;  2M3E A;  4YXW H;  2OYH B;  2FFD C;  1RE4 A;  1L4A B;  2E76 C;  3RK3 D;  1FZC B;  1JMB A;  2E75 D;  4OVN F;  1PL5 A;  3CD6 P;  2AEM A;  3PJS K;  3CWB D;  2KSJ A;  2R5D A;  4K3A A;  1HTL C;  1LTS C;  1E5W A;  3M0A A;  3L37 A;  1ZLL A;  3H1K E;  2FKW B;  3H1L E;  2MKV A;  4PV1 D;  1SQX E;  5KLI C;  4WY4 D;  1N73 C;  2E74 D;  4WVZ A;  2QG4 A;  5CCG D;  1VQK P;  2HYN A;  4JPZ B;  4N78 E;  1SQB E;  1VF5 C;  2J59 M;  2QE7 H;  3H1H J;  1WT6 A;  5CMZ A;  3P8M C;  4H13 B;  2AXT E;  1G1J A;  3H1H D;  1NTM D;  1JCD A;  1MFT A;  1OXZ A;  2BCC D;  2R3S A;  4H0L D;  2Y0D A;  5CBN A;  1NTM E;  1X8Y A;  4PD4 D;  1YJW P;  1IK9 A;  3QWO C;  1MV8 A;  1LNQ A;  3L75 G;  5APV A;  5TIS H;  3TGU E;  1H8A A;  1LTJ C;  2YKQ A;  1ZOY C;  2BEQ D;  1NTZ K;  3M91 A;  2KS1 B;  2OYO A;  4GKG A;  4LGD E;  5L8R J;  1FZC A;  1KB9 E;  2O3J A;  2ZAE B;  5H2F E;  1Y47 A;  3L72 E;  5KLV D;  3B5N A;  2QIW A;  2Y9Z A;  3C8V A;  1N73 A;  3MHV A;  1BSH A;  3AEF C;  2WT7 B;  1RHZ B;  2ZT9 D;  3KZI H;  3H32 A;  1GW3 A;  5CHX A;  2K1A A;  5APS A;  1H88 A;  5KLV J;  3HTK A;  1ZXG A;  1L4A A;  3TGU J;  1OWA A;  2N9B A;  2O01 J;  4BXL A;  1MUU A;  3U59 A;  2OYH A;  1NH4 A;  4D6T E;  1PPJ D;  2BEZ F;  3L75 J;  1JTH B;  4PV1 C;  1NU1 G;  4WY4 C;  3L73 G;  1DX7 A;  4HH2 A;  3M9B A;  4D6T G;  4NPF X;  1SQX G;  1OW7 A;  2P58 A;  3CWB G;  3IN6 A;  1NWQ A;  1A02 F;  4OGQ C;  1VF5 D;  2IZ1 A;  1FZF A;  3SWK A;  1MKM A;  2H8P D;  1IC2 A;  3CCV P;  1KIL D;  2LR2 A;  2H88 C;  2XKM A;  3PP5 A;  4WB4 A;  3VOP A;  1IFI A;  4JYB A;  3WUV A;  1LTB C;  2Q7C A;  4K35 A;  1CW5 A;  1LT1 A;  1FJK A;  1YIJ P;  1JUN A;  1H0T B;  1QLE D;  3M9Q A;  1LTT C;  1P84 H;  2M5A B;  3JCU E;  1EZV E;  1RF0 C;  4L76 A;  1FDO A;  2FYU D;  2I1K A;  3PTZ A;  5AW5 B;  5AW8 B;  1JMM A;  1NTK D;  2P2U A;  3WUU A;  4ZKU A;  5KKZ C;  3FGA D;  1NKZ B;  4GOF A;  5KLV E;  3CWB J;  3CLQ A;  3RK2 B;  4U3F D;  1BCC G;  1BDC A;  3L71 G;  2Z5I A;  2FBW C;  4D6T D;  2ZT9 C;  5CCH C;  2Q3E A;  3L73 D;  1L0L E;  3OW2 O;  2Q9I A;  2NPS C;  1NTZ J;  2ZJS E;  4RKU J;  1LT9 B;  3CL3 D;  5APU A;  3SFE C;  1SQX D;  3L72 J;  1GK6 A;  2JEE A;  1M7L A;  1SQQ G;  2YXQ B;  1FZA A;  2WT7 A;  2HG5 D;  3OJA B;  1FDM A;  2E5Y A;  3L74 G;  1GU4 A;  3BCC E;  1EDJ A;  3C1L A;  5BU5 A;  5AW9 B;  3FWL A;  3NMD A;  1P84 D;  1VQN P;  1PFI A;  1SS1 A;  4PJ0 H;  4TT3 H;  4XA4 A;  3B4S A;  3LW5 J;  4U3F G;  5AVW B;  1HH0 A;  3TGU D;  2OGU A;  1BGY E;  1KC8 Q;  1N7S C;  1Y8A A;  3LW5 H;  1WMK A;  2LKM A;  2A45 H;  3M0D C;  3IAO A;  2QM8 A;  3N7N A;  5CBO A;  3CCR P;  2C9L Y;  2I8D A;  1DD3 A;  2G3A A;  4UB6 H;  2JKV A;  1SQP D;  1R8E A;  3KXD A;  3Q2Y A;  2JWD A;  2ZFC A;  3IF4 A;  4OWF A;  1LP1 A;  1LWU B;  2W6B A;  3RK3 E;  5KAF H;  3ABV C;  4C7N A;  1X22 A;  1LWU A;  1OVV A;  2WPR A;  1FU1 A;  3RK3 C;  1J2J B;  2FYU K;  3AEA C;  1OIP A;  2E75 C;  4QMA A;  1S9K E;  3CCJ P;  2WTY A;  1RF1 A;  5APT A;  3HUS B;  1KTM A;  2NPS D;  2N9Y B;  5BVZ A;  3HD7 C;  2POH A;  1IO4 A;  4I7Z C;  5C39 A;  3VMZ A;  1NTM K;  3H25 A;  1Z56 A;  1NU1 D;  1QGK B;  1FDI A;  3CI9 A;  3H1J J;  1L0N G;  4I1L A;  4HJG H;  3MP7 B;  4HYT B;  4YTP C;  2QJK C;  5KJ7 D;  2JJL A;  2KS1 A;  1JNM A;  3II6 A;  1LP1 B;  1PGP A;  1L0N E;  1NKN A;  1KIL E;  2WIT A;  2YO2 A;  2GM4 A;  1IZN B;  1USE A;  1CI6 A;  4JBZ A;  2NZ2 A;  3AE4 C;  4TLF A;  1RE3 A;  1VQM P;  1SP4 A;  4EI2 A;  1A02 J;  5AVS B;  5GTI H;  4RJT A;  3HRN A;  5B5E E;  2B89 A;  5EFW B;  5KLV G;  1BDD A;  4WY4 A;  1QVG O;  5E79 H;  4YXD C;  1IFJ A;  1ZW0 A;  2ZYA A;  3L74 E;  1S2E A;  2CK3 H;  3B8E B;  4L74 A;  3G4S P;  3KHU A;  2P7J A;  2C9N Y;  1KV4 A;  1T8Z A;  2FYN B;  1VQO P;  3A7O A;  1T3J A;  1ZN5 A;  5B5E H;  2R32 A;  2KB7 P;  1K8A Q;  1IFM A;  3O6Q B;  3A0H H;  1J1D C;  2KP8 A;  3P7K A;  3VMY A;  3TSI A;  3VTP C;  2IBZ G;  4RO0 A;  1IFP A;  3P32 A;  4W80 A;  3Q5R A;  1NTZ D;  5DJT B;  4H44 B;  1ZRT D;  2E42 A;  4IOI H;  3AE1 C;  4ZMD A;  2AXT H;  1LTA C;  3HE4 B;  5KTB A;  3HD7 D;  1AV1 A;  3HE4 A;  3KDP B;  1G2C B;  4JF7 A;  1QX8 A;  3H1L D;  5KAF E;  1HGV A;  1KQL A;  3KYQ A;  1U57 A;  5KJ7 C;  1MFZ A;  2B88 A;  3L74 D;  2OAR A;  4NPD A;  1S1C X;  4PD4 H;  4R4L A;  5CJ4 A;  4IL6 H;  1SQV K;  3H1I D;  1FJP A;  2DW3 A;  5AW7 B;  1EZV I;  1VL2 A;  4XFJ A;  3V2P A;  4OGQ D;  3G71 P;  2RKL A;  5APQ A;  3AEC C;  3L70 J;  3K5B A;  1M8O B;  2KI7 B;  3CXH I;  1NTK G;  1ZV8 A;  1JTH A;  3F89 A;  1SQQ J;  2LXC B;  1G2C A;  1PGQ A;  2IBZ D;  4CPG A;  1KOR A;  2M0B A;  1VQ4 P;  3CCM P;  2YNY A;  2QVA A;  1BE3 G;  1BGY D;  3L75 E;  2O01 N;  4IL6 E;  3H32 B;  4LLH A;  3USS A;  1X9V A;  2KXP B;  2H43 A;  3A0B H;  2K9J B;  3BCC G;  4JYC A;  3I56 P;  3GW6 A;  1FS0 E;  3R2P A;  3RGU A;  2M5A A;  2W6A A;  4H44 C;  2XND H;  4HB1 A;  2B9B A;  2Y9Y A;  5AW3 B;  1S72 P;  1W2B O;  3AE8 C;  3AE6 C;  3M9H A;  2KZI A;  1PP9 J;  2FYZ A;  1J1D B;  2H7H A;  2OYI A;  5CCG A;  1S9K D;  1PPJ G;  1KYO D;  2FYN C;  1L0N D;  2K3R A;  3A0B E;  4EOT A;  4W7Y A;  3L73 E;  5AVZ B;  1PPJ E;  2K37 A;  3U1C A;  2AEF A;  3FXD A;  1JB0 J;  3AE9 C;  1N2D C;  1PV3 A;  3E1R A;  3C9I A;  4HKZ H;  1JY3 P;  5AVR B;  2IFM A;  2O01 H;  1HJ0 A;  1N86 A;  4O9B A;  4PJ0 E;  1YJN P;  2IZ0 A;  3FWN A;  5E79 E;  3V4W A;  1EXI A;  1S5L E;  4RES B;  1KN7 A;  1W2E A;  2AEJ A;  1FZB A;  1LTI C;  1OW8 A;  3TF5 A;  1L0L K;  1HJB A;  1LJ2 A;  1OW6 A;  2HPC A;  2Q5U A;  1NAY A;  2GA1 A;  1EQ7 A;  4ZNC A;  2QJK B;  2IX7 C;  1T2K D;  1JO5 A;  5AW0 B;  3H1K J;  1DEB A;  3ITK A;  3V5B A;  1SQX K;  3PLN A;  4GDO A;  3CCS P;  4I7Z B;  1NTM G;  1PP9 E;  3HD7 B;  4MN4 C;  4UB8 H;  2R5B A;  3L75 D;  3TGU G;  2B87 A;  3HUS C;  1SQV E;  2OQQ A;  1NTK E;  2MJZ A;  3QH9 A;  5AVT B;  3U1A A;  2KIK A;  2E75 B;  1EXJ A;  3T97 A;  3FXE A;  1L4A D;  3L70 G;  3RK3 B;  3G6E P;  3RK2 D;  1KB9 I;  1HGZ A;  1DD4 A;  1GMJ A;  3AE7 C;  1GTW A;  1N8R Q;  1FOS F;  1LWU C;  1SVF A;  2JR8 A;  1LTG C;  2HLO A;  2Y0C A;  1VQ7 P;  1LT9 A;  2AXC A;  1NOH A;  2WMM A;  4U3F E;  1GD2 E;  1AQ5 A;  1KFN A;  1KQG B;  3HD7 A;  3CX5 I;  3BVH A;  2LXB A;  5GTH H;  3CCE P;  3AEE C;  1QEX A;  2GUS A;  2L91 A;  3GF7 A;  1N7S B;  2E5T A;  3L70 E;  3F5H A;  5APW A;  3WU2 H;  3JC2 2;  1Q7Y Q;  3IFM A;  5AVU B;  2HPC B;  2M3B A;  1P84 I;  2RN0 A;  3D71 A;  2BCC J;  1UII A;  2HOD A;  3L71 D;  3CCQ P;  1Y9B A;  1H0T A;  1T6A A;  3L35 A;  1SQB J;  5B66 E;  1Q81 Q;  1BE3 D;  1JM0 A; 
#chains in the Genus database with same CATH homology
 4JBZ A;  4K3A A;  2KZJ A;  2B89 A;  5EFW B;  1BDD A;  1ZW0 A;  5DJU B;  1OVU A;  2UWJ E;  1EDI A;  3ZDM A;  1MFT A;  5CBN A;  3QWO C;  2QRX A;  5DJT B;  4GOD A;  4IOI H;  2KS1 B;  4ZMD A;  2KUB A;  2ZAE B;  1Y47 A;  4ASW A;  3MHV A;  2B88 A;  4NPD A;  2OTK E;  1X0T A;  1ZXG A;  4BXL A;  1U7M A;  2RKL A;  2KI7 B;  2LXC B;  4CPG A;  4NPF X;  2M0B A;  2P58 A;  2B87 B;  2QVA A;  2LR2 A;  3RGU A;  4K35 A;  1LT1 A;  2M5A A;  4HB1 A;  1H0T B;  2M5A B;  2KZI A;  2R44 A;  3MZW B;  1Q2N A;  2K3R A;  4GOF A;  1BDC A;  1FC2 C;  3PH0 A;  1EDK A;  3FXD A;  4HKZ H;  1EDJ A;  3S1K A;  1S3J A;  4ZNC A;  1NVO A;  1SS1 A;  2HR3 A;  1U7J A;  2Q1K A;  4MN4 C;  1DEE G;  2B87 A;  1EC5 A;  5CBO A;  1OVR A;  2KIK A;  3FXE A;  4WWI A;  2I8D A;  1EDL A;  2JWD A;  5K5G B;  1LP1 A;  2SPZ A;  2WMM A;  1OVV A;  4GOE A;  2LXB A;  4ASV A;  5C39 A;  4KJM A;  4EYY Q;  4HJG H;  4NPE A;  1JMB A;  1H0T A;  1LP1 B;  1JM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...