4GODA

Crystal structure of the sgta homodimerization domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
47
structure length
47
Chain Sequence
MKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Sgt2/SGTA Dimerization Domain with the Get5/UBL4A UBL Domain Reveal an Interaction that Forms a Conserved Dynamic Interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Small glutamine-rich tetratricopeptide repeat-containing pro
total genus 17
structure length 47
sequence length 47
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4godA00
4HJGH 4GOEA 3S1KA 1DEEG 4ASWA 1H0TB 2B89A 1S3JA 2M5AA 4KJMA 2QVAA 5CBNA 2RKLA 4MN4C 4NPEA 2M0BA 1LP1A 3MZWB 4IOIH 2M5AB 4BXLA 1BDDA 1OVVA 4K3AA 2SPZA 1Y47A 1BDCA 4GODA 4HKZH 2UWJE 1LT1A 1EC5A 2QRXA 2I8DA 2KS1B 2Q1KA 4NPDA 1EDJA 2ZAEB 1OVUA 2KIKA 1ZXGA 3ZDMA 5DJUB 4GOFA 1Q2NA 1U7MA 2JWDA 5DJTB 3RGUA 1JM0A 2LXBA 4ZMDA 3MHVA 2OTKE 2P58A 4ZNCA 2KZJA 1JMBA 1SS1A 1EDLA 1U7JA 4JBZA 1MFTA 2B87A 2B88A 1EDKA 4CPGA 2B87B 3FXEA 5EFWB 5C39A 4HB1A 1H0TA 4ASVA 2KUBA 2HR3A 1FC2C 3FXDA 1NVOA 2LR2A 1EDIA 3PH0A 4EYYQ 2KZIA 2K3RA 5CBOA 1ZW0A 2WMMA 4WWIA 3QWOC 1X0TA 1LP1B 4K35A 2R44A 4NPFX 5K5GB 2LXCB 2KI7B 1OVRA
chains in the Genus database with same CATH superfamily
2ZT9D 2PGDA 3ITKA 1SFCA 1BCCG 4GOEA 1SQXJ 1QL1A 5BU5A 1GW3A 1JB0J 3GHGC 4YPCA 3GLMA 2ZXXA 3S1KA 1UIIA 1NU1E 2I1KA 1Q82Q 1BSHA 2E75B 1OW8A 1JY3O 2OYHB 1YYCA 2FKWB 1KYOE 2QJPB 3H1HG 1SQQD 1SQPJ 5KAFH 5CBNA 1M1JC 1NH4A 2BCCD 1G2CB 5KKZB 1PGPA 2POHA 3RK2B 4DOJA 1IO4A 5AVSB 2M0BA 1GZLA 1GL2B 3AE8C 2R5BA 2BCCG 4Z1MH 1DIPA 1SQVG 2M5AB 3V2NA 1KMIZ 1G1JA 1D7MA 3CWBJ 1URQC 1BDDA 1JCDA 1OWAA 1SQBG 5KLVG 1N7SB 1NU1J 1KQFB 1HWTC 4UB8H 1KV4A 3BCCJ 5GTHH 3NXSA 4KHXA 5AVVB 2L5GB 4R4MA 1BDCA 4GODA 3BASA 4HKZH 3KZIE 1GTWA 1Q81Q 3L71D 1KFNA 3LW5H 1FDOA 3FGAD 1VF5D 3N4XA 4BRYB 2O01J 2ZFCA 3D71A 3H1HE 3A2AA 2QRXA 1CZQA 3TNUA 1K9MQ 1RE3A 2ZYGA 3FXDA 2Q1KA 1W2EA 3FWNA 5GTIE 4EOTA 1Y8AA 1BSNA 3W67A 2WSFJ 2GA1A 2YKOA 1EDJA 3AEGC 3RL0B 1QVGO 3N7NA 1L0NJ 1SQVE 2ZT9C 1GK6A 3M0DC 3ZDMA 1GU4A 3BVHA 1LWUB 1YBKA 1KB9D 3H1KE 3H1LJ 4PV1C 5DJUB 1PZQA 2N9YB 4GOFA 1FBMA 4GKGA 1YJWP 2K9JB 3O8ZA 4JYBA 3L70G 1U7MA 3CCQP 4OGQC 2H88C 3CXHI 2WQYC 2IFMA 5CCGC 3WU2H 3Q1MA 2A45I 2CPBA 3Q5SA 4YTPC 2JO1A 3AE9C 1NHLA 3CPWO 1M8OB 1NTZJ 4Y28J 2C0WA 3L73J 5KTBA 5TISH 1HBWA 2H8PD 1BCCD 4IL6X 3H1ID 3SWFA 1T8ZA 3L74G 1SQBE 1LGHB 3A0BH 1FOSE 1IFMA 1VQ6P 5CHXA 2J58A 2IBZI 3M0DA 3W68A 3H1KJ 4ZNCA 1PIXA 1X22A 2WSFH 3RK3D 5AVTB 4DCKA 1Q7YQ 1W5CE 1OW6A 1KB9E 1JY3P 1LT9A 2KZJA 3H1KD 1FZCA 2HG5D 3L75G 2O1JA 2PP6A 4H44C 3V4WA 1U7JA 4DT0A 1EDLA 1MFTA 1KYOI 3H1IJ 3CD6P 4D6TG 1YHQP 1LJ2A 2KP8A 4XA4A 1EZVD 1KILA 1FAVA 2BASA 1LTBC 1VQOP 2JR8A 1YJ9P 4DJGA 3TSIA 4WY4B 5EFWB 3L71G 4H0LD 1J1DC 1P84I 4YXWH 1SQVK 1KQLA 5AW5B 1BE3J 2XNDH 3NMDA 1L0NK 1SQPD 5APYA 5KAIH 1SQBJ 4OH8B 4RO0A 1PP9J 2HR3A 1FC2C 1HVVA 1NU1G 1S5LX 1LWUA 1RY3A 1VF5B 2C0XA 3RL0C 3WUUA 3KZIH 2YIUC 1K73Q 2N1TB 1KILE 1LT9C 3H6PA 3TGUJ 4HYTB 1FZCC 2NPSB 1BGYD 3B8EB 3PH0A 3HE4A 3SWYA 3H1IE 3G4SP 1FJPA 1L4AD 3HUSC 5GTHE 1PPJG 1SQXD 4BWNA 2G8YA 5CBOA 1X8YA 2W90A 4UB8E 1IFJA 1L4AB 1T3UA 1FS0E 2KNCA 4C46A 1H8AA 3KQGA 2W6JH 3G3ZA 1N73A 1MZ9A 1SQQG 2R44A 1E79H 2FYNC 3CXHD 1SLQA 3L73D 1RF1B 3AEFC 2WPQA 3H1JE 5AW7B 3R2PA 1L4AA 3L75D 2J5UA 3CL3D 1S2EA 4UB6E 2GM4A 2AEMA 1TU3F 1SP4A 1XTCC 4M3LA 4OGQD 1KYOH 1NTKE 1VQ8P 3P8CE 3ABVC 1DEEG 2KB7P 2XNXA 4IFFA 3RK3E 1VL2A 3TDKA 4ASWA 3CMEP 1IFNA 1H0TB 2Q3EA 2M5AA 3AEDC 3IN6A 3MUDA 3RBXA 1M7LA 2WPRA 2IDBA 3NTNA 3VMXA 2JEEA 4U3FD 3D6ZA 4JPZB 4MN4C 1S72P 3Q2YA 2FFDC 3H1HD 3VN0A 3RBZA 2IPPA 4JQ0D 1AVOA 3MZWB 1CSBA 2P67A 4I6MC 4IOIH 2V7QH 1YITP 2QEXP 3T97A 5KLVJ 1RF0C 1VQPP 1BE3E 3F5HA 3I55P 4BXLA 2WSCH 3V2QA 1VQ4P 1VF5C 2H89C 3HD7D 2E75C 1AA0A 3C1LA 1CI6A 1P84D 3O6QA 1FDIA 4TT3H 3L72G 1QVFO 1JCCA 1BE3D 2SPZA 5H2FH 1IFPA 1AJYA 4D6TD 3AE5C 2N9BA 3HRNA 2Z4EA 3D6YA 1IFIA 4OVNF 3CX5I 1FZAA 2QSIA 1GL2A 1JO5A 3IR9A 4N78D 3HD7B 1VQ7P 3IAOA 1FU1A 1GMJA 1JY2N 2FYZA 4PD4H 2HODB 3G9RA 2HODA 2K9YA 2RMZA 1SQQK 5CJ0A 3KYQA 1ZMEC 2IZ0A 3M06A 2Z5HA 4N78E 4NPDA 1NKZB 1RF0A 2WT7B 1EZVE 1L0NG 3PTZA 2ZAEB 2ZXEB 1YQ3C 1KC8Q 1OVUA 1HH0A 4GIFA 2XU6A 5APUA 3B5NB 1DX7A 3C9IA 1WMKA 2E5YA 3L75E 1P84E 1VPCA 2A06G 2KK7A 3CLQA 3PJSK 3PLNA 3RK2D 4ZKUA 1NTMG 2WSCJ 3A0BE 3WUTA 5B66E 1GW4A 3EFGA 1GL2C 2M3EA 2AEFA 3SFDC 3O6QB 2BEQD 2QA4P 2WVRA 2FBWC 1EXJA 2R32A 2KYVA 3L73G 1JOCA 1OMIA 1G1IA 1MUUA 2WZ7A 1KQSO 3WU2E 1PPJE 1KB9I 1M1JA 4W80A 1SQXE 5AVRB 1VQMP 1J2JB 2Y0DA 4ZMDA 3MGNA 3MHVA 4GDOA 1YIJP 4L73A 2FXPA 5APQA 1ZLLA 3I5CA 4AQRD 3U1CA 3L75J 4IL6H 5AVYB 4WB4A 3B4SA 3SFEC 4IL6E 2PFXA 3GF7A 2PAJA 1SFCD 1PL5A 2R5DA 1NOHA 1VDFA 1NTKG 1PPJD 2B87A 2E75D 2IBZD 2NZ2A 4TLFA 3WMM0 3L71J 3BRTB 3V6IA 2ZVOB 1JEKA 3M9HA 3P32A 4RESB 1PGQA 2B87B 5B5EE 2E74C 4H0LB 3TK1A 4BRYA 3I56P 1OIPA 4N3YB 3U59A 5AVXB 2KUBA 3CC2P 1Z56A 3RK3C 4U3FE 3B5NC 2O3JA 2P2UA 1NTZK 3VYIA 3CCLP 4H44B 2QJYC 1KQGB 1SQPK 1L0ND 1NVOA 2LR2A 1EDIA 1HUCA 1IFDA 2QE7H 1N2DC 2NPSA 5AW3B 1SQPE 1N7SA 4A7PA 3P8CD 2K3RA 1Q90D 3L36A 2E76D 3TGUD 2D2CB 2WPSA 3SWKA 5BU8B 1ZOYC 3H1JJ 3L74D 3M9BA 1FDMA 1JUNA 2JDIH 4EI2A 4ZKPA 3HUSA 3A0HH 2A45H 2W8ZA 3OJAB 4LC1A 4WVZA 1ZRTE 1YI2P 4B86A 5AW8B 2E76C 3H1JD 1S5LH 1K8AQ 2K1AA 3H1HJ 1NU1K 4NPFX 4I7ZC 5K5GB 3VOPA 2LXCB 1EQ7A 2E5TA 4U3FJ 2KI7B 3AE7C 3L74E 1LT9B 1OVRA 4U7JA 5TJHA 1FZCB 2KLUA 1N7SD 4AUWA 1NYHA 1HTLC 2AXTE 4HJGH 3CX5H 5AVWB 1NAFA 1RQUA 3KXDA 3USSA 4C7NB 2OYHC 1BGYG 2ZYDA 1NTZG 3V2PA 3TGUE 1EZVG 1L0NE 1L4AC 1PV3A 1SQVJ 3A3YB 3VMAA 3G6EP 3LW5J 2OYIC 2E74D 1R5SA 3BATA 3CWBG 1S3JA 3L70E 3T97B 3RL0g 1NTZD 1NKNA 3GHGB 2AXCA 3JC22 4EIJA 3RL0D 3H1KG 1ZV8A 4PJ0H 5L8RJ 2RKLA 5AW9B 2OTJP 2IX7C 2KSEA 2DW3A 1LTJA 3C8VA 2E74B 2IZ1A 2FYUK 2IYOA 1X79B 3M91A 1QLED 4H0LC 3CCMP 3CCVP 1H89A 3LIDA 3H25A 3TF5A 1XTGB 1JMMA 5KLVE 4PD4D 2MJZA 1NTMK 2B9BA 2YMYA 4WY4D 1CI6B 2QJYB 3CCJP 2V4HA 3MP7B 2ZVNB 1MKMA 5AW2B 1LTGC 1L0LK 4JF7A 3CCEP 1RF1C 5CJ4A 3Q5PA 1QGKB 1RE4A 1YTZT 1S5LE 3L72D 3CXHE 3AEAC 4H13D 1LTTC 1RH5B 4UB6H 1ZR2A 2UWJE 3HE5B 1KN7A 2FY8A 2RN0A 1USDA 2OARA 1LT1A 1NWQA 1HJBA 1VQ9P 3H32A 1EC5A 1GDTA 2OYOA 1T6AA 2KS1A 4L75A 2KS1B 1BCCE 4LGDE 3VP9A 2W6AA 3E1RA 2QM7A 1S9KE 4W7YA 2OTLP 1BGYE 1LWUC 5E79H 5APSA 1RE3C 1HJ0A 2KIKA 3HE4B 1DH3A 1ZXGA 2WTYA 1FZGA 4R4LA 2YKQA 3PRJA 3JCUE 2P10A 3L4FA 4HH2A 2HYNA 2H7HA 1J1EB 4PV1D 1LTAC 3UIAA 3AE6C 2P7JA 4I1LA 4AYCA 1JNMA 1VQ5P 1DD3A 4PV1B 1FZEA 1RQVA 1IC2A 2GUVA 3CWBD 3RGUA 1BCCJ 2BEZF 1G2CA 3II6A 3K5BA 5KAIE 3V5BA 3VP8A 5KLIC 3BRVB 1YJNP 1A02F 2KNCB 2JWAA 3GMAA 2LXBA 4U3FG 2OGUA 1PP9E 2MKVA 2BCCE 2O01H 3PHLA 4D6TJ 3H1LG 2OYHA 1Y9BA 3PP5A 3AEBC 3LIEA 3SSUA 2WWWA 1NO4A 2WPVB 3HD7C 3U1AA 4L76A 1SQPG 3HTKA 2ZJSE 5BVZA 3BCCE 3V2RA 3H1LD 1AQTA 3IFMA 2I1JA 1L0LG 3A7OA 2WSEJ 3MTUE 1JMBA 1SQBD 3M9QA 2NRGA 4PD4I 5KJ7C 3KHUA 5CCHC 1X9VA 1SQBK 1SFCB 4WY4C 1FOSF 2L91A 3TGUG 2HLOA 1EDKA 4CPGA 1N8RQ 1PGJA 5E79E 5KJ7A 4N6JA 2OYIA 1T2KC 3A5TA 1QX8A 2IFNA 2FYUD 4QMAA 5APXA 1GU5A 3MUDC 3AECC 5C39A 2IBZE 1K05A 4HB1A 1KILC 2C9LY 3D70A 3R4YA 1T2KD 1N73B 1P84H 4ASVA 3CC7P 2FXMA 1T3JA 2QJKB 5KKZC 1NAYA 5AW0B 2HPCB 1OW7A 3BCCD 5CCHD 2XKMA 1OXZA 3IF4A 3Q3DA 4EYYQ 1J1EC 1NU1D 2KZIA 2YKPA 3AE1C 5KJ7D 3FWLA 1KORA 1NTKD 1R8EA 2A06D 2H43A 2Q6QA 2N1TC 4YXDC 1KTMA 1PP9D 1URQB 2WMMA 2NPSC 2WSEH 4PD4E 1BE3G 1N7SC 1K04A 2K88A 3HUSB 1X0TA 2FYUG 3MIWA 1LP1B 2N1TD 3QH9A 2QJPC 4K35A 2C9NY 3RK3B 1M56D 3HE5A 1GL2D 1HF9A 1PGOA 2CPSA 5H2FE 5CCHA 1BGYJ 3RK2C 1QL2A 3L70J 3OW2O 3AEEC 2W83C 1NTZE 3L70D 2O01N 4IFDK 1KILD 4JYCA 2IYPA 1WT6A 1MV8A 2B89A 2N1TA 3L74J 4O9BA 5APVA 1ZP0C 4C7RA 3CCSP 4KJMA 2QVAA 1S9KD 1VQNP 5M1BA 2ITAA 1IK7A 1R5LA 2Q3IA 3B5ND 3CI9A 4I7ZB 2Q7CA 3TNUB 2R3SA 1JTHA 2JKVA 2AXTH 3CX5E 1NTMD 2ZT9B 4IFMA 4NPEA 5AVZB 4H44D 1GK4A 1L2PA 1HGVA 3P7KA 1LP1A 1KYOD 3MD0A 4I2LC 1KILB 1EZVI 2FXOA 2Y0CA 3CWBE 3AE3C 2Q9IA 2G3AA 2CK3H 2O1KA 1JY2O 2OQQA 2QIWA 4KT0J 5KAFE 2BCCJ 2KXPB 2QJKC 3A0HE 3B71A 3EFFK 4Y99C 2XZRA 1OVVA 4D6TE 4GT1A 1SQVD 3F89A 4W7ZA 4K3AA 3B5NA 1JY3N 1CW5A 4C7NA 1AQ5A 1IZNB 1Y47A 1FZBA 2W6BA 5KLVD 2Y9ZA 2XV5A 2Y0EA 2W27A 3BCCG 3FX0A 3E1IA 3EQ2A 1GD2E 3WUVA 5CCGD 1OZHA 1DEBA 4OGQB 3L71E 1LTJC 2I8DA 2PRRA 4RKUJ 3GF3A 3GHGA 5AW1B 2KSJA 2OYIB 1M90Q 1A02J 1AFOA 5B5EH 1DD4A 3H1JG 3G71P 2E43A 1M57D 1OX3A 4XFJA 2FFDA 2V7QJ 1KFMA 1SQXG 4OWFA 3JSVC 4L74A 2GUSA 5CCGA 2ZYAA 1KZUB 5KLVK 1J1DB 3L35A 3P8MC 1NGMB 1H88A 1HGZA 1NTKK 1AVYA 1L0LD 2J59M 2M8RA 1USEA 1Q2NA 1EXIA 2JWDA 2YNYA 5DJTB 2KOGA 1N86A 2M3BA 2IBZG 4WBAA 4H13C 4DZOA 1PFIA 2NPSD 1LTSC 3HD7A 4LLHA 3KDPB 1JM0A 1U57A 2A06E 2VRSA 3AE2C 1FE6A 1KB9H 3H32B 1NJIQ 1RE4C 1WRGA 1YQ4C 1ZN5A 2LKMA 1NTMJ 3CX5D 2Y9YA 2K37A 2OTKE 3H1LE 3JCUH 2P58A 1L0LJ 2QG4A 2K9JA 4Y99B 1URQD 3VMYA 1RHZB 4XE5B 3S9OA 2FYNB 1SQXK 1IK9A 3GW6A 4EDFA 1ZR4A 1AV1A 5TISE 1SS1A 4RJTA 3CMAP 5APTA 3AE4C 1S1CX 2FYUE 2YIUB 5B66H 5KLIB 2HPCA 1RF1A 3NFQA 4JBZA 2AEJA 2R3CA 1YTZI 1KD1Q 2YO2A 2B88A 1UIXA 1JTHB 1M1JB 2JP3A 2KLVA 3L37A 3TYYA 3CCUP 1JY2P 3KPEA 2Q5UA 3L72J 3H1IG 3CXHH 1LTJB 1URQA 3FXEA 2E42A 1VQLP 1ZRTD 1L0LE 2XDJA 1LNQA 3CCRP 5AW4B 1FJKA 1QEXA 1H0TA 5AW6B 1NTME 3VMZA 2A45G 2P1JA 1SQQE 5APWA 2QM8A 1M1KQ 2FFDB 3GG2A 3L72E 5AVQB 1NTKJ 1SFCC 1E5WA 3V4QA 2WSSH 1PP9G 2JJLA 2YXQB 3S4RA 5GTIH 2YO3A 3EWKA 1FZFA 2Z5IA 2D2CD 2WT7A 2E76B 2FYUJ 3E7KA 3M0AA 3OAKA 3HTKB 1ZW0A 4WY4A 5AVUB 1IJDB 1LTIC 2YXRB 4PJ0E 1W2BO 3L73E 3QWOC 4H13B 4WWIA 2RH0A 1OFCX 1N7LA 2WITA 1N73C 2D2CC 1MFZA 3OA7A 3Q5RA 1Q86Q 3CC4P 3VTPC 2HFED 1S4XA 1SVFA 1SQQJ 5CMZA 2YMKA 1VQKP
chains in the Genus database with same CATH topology
4HJGH 4GOEA 3S1KA 1DEEG 4ASWA 1H0TB 2B89A 1S3JA 2M5AA 4KJMA 2QVAA 5CBNA 2RKLA 4MN4C 4NPEA 2M0BA 1LP1A 3MZWB 4IOIH 2M5AB 4BXLA 1BDDA 1OVVA 4K3AA 2SPZA 1Y47A 1BDCA 4GODA 4HKZH 2UWJE 1LT1A 1EC5A 2QRXA 2I8DA 2KS1B 2Q1KA 4NPDA 1EDJA 2ZAEB 1OVUA 2KIKA 1ZXGA 3ZDMA 5DJUB 4GOFA 1Q2NA 1U7MA 2JWDA 5DJTB 3RGUA 1JM0A 2LXBA 4ZMDA 3MHVA 2OTKE 2P58A 4ZNCA 2KZJA 1JMBA 1SS1A 1EDLA 1U7JA 4JBZA 1MFTA 2B87A 2B88A 1EDKA 4CPGA 2B87B 3FXEA 5EFWB 5C39A 4HB1A 1H0TA 4ASVA 2KUBA 2HR3A 1FC2C 3FXDA 1NVOA 2LR2A 1EDIA 3PH0A 4EYYQ 2KZIA 2K3RA 5CBOA 1ZW0A 2WMMA 4WWIA 3QWOC 1X0TA 1LP1B 4K35A 2R44A 4NPFX 5K5GB 2LXCB 2KI7B 1OVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJG H;  4GOE A;  3S1K A;  1DEE G;  4ASW A;  1H0T B;  2B89 A;  1S3J A;  2M5A A;  4KJM A;  2QVA A;  5CBN A;  2RKL A;  4MN4 C;  4NPE A;  2M0B A;  1LP1 A;  3MZW B;  4IOI H;  2M5A B;  4BXL A;  1BDD A;  1OVV A;  4K3A A;  2SPZ A;  1Y47 A;  1BDC A;  4GOD A;  4HKZ H;  2UWJ E;  1LT1 A;  1EC5 A;  2QRX A;  2I8D A;  2KS1 B;  2Q1K A;  4NPD A;  1EDJ A;  2ZAE B;  1OVU A;  2KIK A;  1ZXG A;  3ZDM A;  5DJU B;  4GOF A;  1Q2N A;  1U7M A;  2JWD A;  5DJT B;  3RGU A;  1JM0 A;  2LXB A;  4ZMD A;  3MHV A;  2OTK E;  2P58 A;  4ZNC A;  2KZJ A;  1JMB A;  1SS1 A;  1EDL A;  1U7J A;  4JBZ A;  1MFT A;  2B87 A;  2B88 A;  1EDK A;  4CPG A;  2B87 B;  3FXE A;  5EFW B;  5C39 A;  4HB1 A;  1H0T A;  4ASV A;  2KUB A;  2HR3 A;  1FC2 C;  3FXD A;  1NVO A;  2LR2 A;  1EDI A;  3PH0 A;  4EYY Q;  2KZI A;  2K3R A;  5CBO A;  1ZW0 A;  2WMM A;  4WWI A;  3QWO C;  1X0T A;  1LP1 B;  4K35 A;  2R44 A;  4NPF X;  5K5G B;  2LXC B;  2KI7 B;  1OVR A; 
#chains in the Genus database with same CATH topology
 2ZT9 D;  2PGD A;  3ITK A;  1SFC A;  1BCC G;  4GOE A;  1SQX J;  1QL1 A;  5BU5 A;  1GW3 A;  1JB0 J;  3GHG C;  4YPC A;  3GLM A;  2ZXX A;  3S1K A;  1UII A;  1NU1 E;  2I1K A;  1Q82 Q;  1BSH A;  2E75 B;  1OW8 A;  1JY3 O;  2OYH B;  1YYC A;  2FKW B;  1KYO E;  2QJP B;  3H1H G;  1SQQ D;  1SQP J;  5KAF H;  5CBN A;  1M1J C;  1NH4 A;  2BCC D;  1G2C B;  5KKZ B;  1PGP A;  2POH A;  3RK2 B;  4DOJ A;  1IO4 A;  5AVS B;  2M0B A;  1GZL A;  1GL2 B;  3AE8 C;  2R5B A;  2BCC G;  4Z1M H;  1DIP A;  1SQV G;  2M5A B;  3V2N A;  1KMI Z;  1G1J A;  1D7M A;  3CWB J;  1URQ C;  1BDD A;  1JCD A;  1OWA A;  1SQB G;  5KLV G;  1N7S B;  1NU1 J;  1KQF B;  1HWT C;  4UB8 H;  1KV4 A;  3BCC J;  5GTH H;  3NXS A;  4KHX A;  5AVV B;  2L5G B;  4R4M A;  1BDC A;  4GOD A;  3BAS A;  4HKZ H;  3KZI E;  1GTW A;  1Q81 Q;  3L71 D;  1KFN A;  3LW5 H;  1FDO A;  3FGA D;  1VF5 D;  3N4X A;  4BRY B;  2O01 J;  2ZFC A;  3D71 A;  3H1H E;  3A2A A;  2QRX A;  1CZQ A;  3TNU A;  1K9M Q;  1RE3 A;  2ZYG A;  3FXD A;  2Q1K A;  1W2E A;  3FWN A;  5GTI E;  4EOT A;  1Y8A A;  1BSN A;  3W67 A;  2WSF J;  2GA1 A;  2YKO A;  1EDJ A;  3AEG C;  3RL0 B;  1QVG O;  3N7N A;  1L0N J;  1SQV E;  2ZT9 C;  1GK6 A;  3M0D C;  3ZDM A;  1GU4 A;  3BVH A;  1LWU B;  1YBK A;  1KB9 D;  3H1K E;  3H1L J;  4PV1 C;  5DJU B;  1PZQ A;  2N9Y B;  4GOF A;  1FBM A;  4GKG A;  1YJW P;  2K9J B;  3O8Z A;  4JYB A;  3L70 G;  1U7M A;  3CCQ P;  4OGQ C;  2H88 C;  3CXH I;  2WQY C;  2IFM A;  5CCG C;  3WU2 H;  3Q1M A;  2A45 I;  2CPB A;  3Q5S A;  4YTP C;  2JO1 A;  3AE9 C;  1NHL A;  3CPW O;  1M8O B;  1NTZ J;  4Y28 J;  2C0W A;  3L73 J;  5KTB A;  5TIS H;  1HBW A;  2H8P D;  1BCC D;  4IL6 X;  3H1I D;  3SWF A;  1T8Z A;  3L74 G;  1SQB E;  1LGH B;  3A0B H;  1FOS E;  1IFM A;  1VQ6 P;  5CHX A;  2J58 A;  2IBZ I;  3M0D A;  3W68 A;  3H1K J;  4ZNC A;  1PIX A;  1X22 A;  2WSF H;  3RK3 D;  5AVT B;  4DCK A;  1Q7Y Q;  1W5C E;  1OW6 A;  1KB9 E;  1JY3 P;  1LT9 A;  2KZJ A;  3H1K D;  1FZC A;  2HG5 D;  3L75 G;  2O1J A;  2PP6 A;  4H44 C;  3V4W A;  1U7J A;  4DT0 A;  1EDL A;  1MFT A;  1KYO I;  3H1I J;  3CD6 P;  4D6T G;  1YHQ P;  1LJ2 A;  2KP8 A;  4XA4 A;  1EZV D;  1KIL A;  1FAV A;  2BAS A;  1LTB C;  1VQO P;  2JR8 A;  1YJ9 P;  4DJG A;  3TSI A;  4WY4 B;  5EFW B;  3L71 G;  4H0L D;  1J1D C;  1P84 I;  4YXW H;  1SQV K;  1KQL A;  5AW5 B;  1BE3 J;  2XND H;  3NMD A;  1L0N K;  1SQP D;  5APY A;  5KAI H;  1SQB J;  4OH8 B;  4RO0 A;  1PP9 J;  2HR3 A;  1FC2 C;  1HVV A;  1NU1 G;  1S5L X;  1LWU A;  1RY3 A;  1VF5 B;  2C0X A;  3RL0 C;  3WUU A;  3KZI H;  2YIU C;  1K73 Q;  2N1T B;  1KIL E;  1LT9 C;  3H6P A;  3TGU J;  4HYT B;  1FZC C;  2NPS B;  1BGY D;  3B8E B;  3PH0 A;  3HE4 A;  3SWY A;  3H1I E;  3G4S P;  1FJP A;  1L4A D;  3HUS C;  5GTH E;  1PPJ G;  1SQX D;  4BWN A;  2G8Y A;  5CBO A;  1X8Y A;  2W90 A;  4UB8 E;  1IFJ A;  1L4A B;  1T3U A;  1FS0 E;  2KNC A;  4C46 A;  1H8A A;  3KQG A;  2W6J H;  3G3Z A;  1N73 A;  1MZ9 A;  1SQQ G;  2R44 A;  1E79 H;  2FYN C;  3CXH D;  1SLQ A;  3L73 D;  1RF1 B;  3AEF C;  2WPQ A;  3H1J E;  5AW7 B;  3R2P A;  1L4A A;  3L75 D;  2J5U A;  3CL3 D;  1S2E A;  4UB6 E;  2GM4 A;  2AEM A;  1TU3 F;  1SP4 A;  1XTC C;  4M3L A;  4OGQ D;  1KYO H;  1NTK E;  1VQ8 P;  3P8C E;  3ABV C;  1DEE G;  2KB7 P;  2XNX A;  4IFF A;  3RK3 E;  1VL2 A;  3TDK A;  4ASW A;  3CME P;  1IFN A;  1H0T B;  2Q3E A;  2M5A A;  3AED C;  3IN6 A;  3MUD A;  3RBX A;  1M7L A;  2WPR A;  2IDB A;  3NTN A;  3VMX A;  2JEE A;  4U3F D;  3D6Z A;  4JPZ B;  4MN4 C;  1S72 P;  3Q2Y A;  2FFD C;  3H1H D;  3VN0 A;  3RBZ A;  2IPP A;  4JQ0 D;  1AVO A;  3MZW B;  1CSB A;  2P67 A;  4I6M C;  4IOI H;  2V7Q H;  1YIT P;  2QEX P;  3T97 A;  5KLV J;  1RF0 C;  1VQP P;  1BE3 E;  3F5H A;  3I55 P;  4BXL A;  2WSC H;  3V2Q A;  1VQ4 P;  1VF5 C;  2H89 C;  3HD7 D;  2E75 C;  1AA0 A;  3C1L A;  1CI6 A;  1P84 D;  3O6Q A;  1FDI A;  4TT3 H;  3L72 G;  1QVF O;  1JCC A;  1BE3 D;  2SPZ A;  5H2F H;  1IFP A;  1AJY A;  4D6T D;  3AE5 C;  2N9B A;  3HRN A;  2Z4E A;  3D6Y A;  1IFI A;  4OVN F;  3CX5 I;  1FZA A;  2QSI A;  1GL2 A;  1JO5 A;  3IR9 A;  4N78 D;  3HD7 B;  1VQ7 P;  3IAO A;  1FU1 A;  1GMJ A;  1JY2 N;  2FYZ A;  4PD4 H;  2HOD B;  3G9R A;  2HOD A;  2K9Y A;  2RMZ A;  1SQQ K;  5CJ0 A;  3KYQ A;  1ZME C;  2IZ0 A;  3M06 A;  2Z5H A;  4N78 E;  4NPD A;  1NKZ B;  1RF0 A;  2WT7 B;  1EZV E;  1L0N G;  3PTZ A;  2ZAE B;  2ZXE B;  1YQ3 C;  1KC8 Q;  1OVU A;  1HH0 A;  4GIF A;  2XU6 A;  5APU A;  3B5N B;  1DX7 A;  3C9I A;  1WMK A;  2E5Y A;  3L75 E;  1P84 E;  1VPC A;  2A06 G;  2KK7 A;  3CLQ A;  3PJS K;  3PLN A;  3RK2 D;  4ZKU A;  1NTM G;  2WSC J;  3A0B E;  3WUT A;  5B66 E;  1GW4 A;  3EFG A;  1GL2 C;  2M3E A;  2AEF A;  3SFD C;  3O6Q B;  2BEQ D;  2QA4 P;  2WVR A;  2FBW C;  1EXJ A;  2R32 A;  2KYV A;  3L73 G;  1JOC A;  1OMI A;  1G1I A;  1MUU A;  2WZ7 A;  1KQS O;  3WU2 E;  1PPJ E;  1KB9 I;  1M1J A;  4W80 A;  1SQX E;  5AVR B;  1VQM P;  1J2J B;  2Y0D A;  4ZMD A;  3MGN A;  3MHV A;  4GDO A;  1YIJ P;  4L73 A;  2FXP A;  5APQ A;  1ZLL A;  3I5C A;  4AQR D;  3U1C A;  3L75 J;  4IL6 H;  5AVY B;  4WB4 A;  3B4S A;  3SFE C;  4IL6 E;  2PFX A;  3GF7 A;  2PAJ A;  1SFC D;  1PL5 A;  2R5D A;  1NOH A;  1VDF A;  1NTK G;  1PPJ D;  2B87 A;  2E75 D;  2IBZ D;  2NZ2 A;  4TLF A;  3WMM 0;  3L71 J;  3BRT B;  3V6I A;  2ZVO B;  1JEK A;  3M9H A;  3P32 A;  4RES B;  1PGQ A;  2B87 B;  5B5E E;  2E74 C;  4H0L B;  3TK1 A;  4BRY A;  3I56 P;  1OIP A;  4N3Y B;  3U59 A;  5AVX B;  2KUB A;  3CC2 P;  1Z56 A;  3RK3 C;  4U3F E;  3B5N C;  2O3J A;  2P2U A;  1NTZ K;  3VYI A;  3CCL P;  4H44 B;  2QJY C;  1KQG B;  1SQP K;  1L0N D;  1NVO A;  2LR2 A;  1EDI A;  1HUC A;  1IFD A;  2QE7 H;  1N2D C;  2NPS A;  5AW3 B;  1SQP E;  1N7S A;  4A7P A;  3P8C D;  2K3R A;  1Q90 D;  3L36 A;  2E76 D;  3TGU D;  2D2C B;  2WPS A;  3SWK A;  5BU8 B;  1ZOY C;  3H1J J;  3L74 D;  3M9B A;  1FDM A;  1JUN A;  2JDI H;  4EI2 A;  4ZKP A;  3HUS A;  3A0H H;  2A45 H;  2W8Z A;  3OJA B;  4LC1 A;  4WVZ A;  1ZRT E;  1YI2 P;  4B86 A;  5AW8 B;  2E76 C;  3H1J D;  1S5L H;  1K8A Q;  2K1A A;  3H1H J;  1NU1 K;  4NPF X;  4I7Z C;  5K5G B;  3VOP A;  2LXC B;  1EQ7 A;  2E5T A;  4U3F J;  2KI7 B;  3AE7 C;  3L74 E;  1LT9 B;  1OVR A;  4U7J A;  5TJH A;  1FZC B;  2KLU A;  1N7S D;  4AUW A;  1NYH A;  1HTL C;  2AXT E;  4HJG H;  3CX5 H;  5AVW B;  1NAF A;  1RQU A;  3KXD A;  3USS A;  4C7N B;  2OYH C;  1BGY G;  2ZYD A;  1NTZ G;  3V2P A;  3TGU E;  1EZV G;  1L0N E;  1L4A C;  1PV3 A;  1SQV J;  3A3Y B;  3VMA A;  3G6E P;  3LW5 J;  2OYI C;  2E74 D;  1R5S A;  3BAT A;  3CWB G;  1S3J A;  3L70 E;  3T97 B;  3RL0 g;  1NTZ D;  1NKN A;  3GHG B;  2AXC A;  3JC2 2;  4EIJ A;  3RL0 D;  3H1K G;  1ZV8 A;  4PJ0 H;  5L8R J;  2RKL A;  5AW9 B;  2OTJ P;  2IX7 C;  2KSE A;  2DW3 A;  1LTJ A;  3C8V A;  2E74 B;  2IZ1 A;  2FYU K;  2IYO A;  1X79 B;  3M91 A;  1QLE D;  4H0L C;  3CCM P;  3CCV P;  1H89 A;  3LID A;  3H25 A;  3TF5 A;  1XTG B;  1JMM A;  5KLV E;  4PD4 D;  2MJZ A;  1NTM K;  2B9B A;  2YMY A;  4WY4 D;  1CI6 B;  2QJY B;  3CCJ P;  2V4H A;  3MP7 B;  2ZVN B;  1MKM A;  5AW2 B;  1LTG C;  1L0L K;  4JF7 A;  3CCE P;  1RF1 C;  5CJ4 A;  3Q5P A;  1QGK B;  1RE4 A;  1YTZ T;  1S5L E;  3L72 D;  3CXH E;  3AEA C;  4H13 D;  1LTT C;  1RH5 B;  4UB6 H;  1ZR2 A;  2UWJ E;  3HE5 B;  1KN7 A;  2FY8 A;  2RN0 A;  1USD A;  2OAR A;  1LT1 A;  1NWQ A;  1HJB A;  1VQ9 P;  3H32 A;  1EC5 A;  1GDT A;  2OYO A;  1T6A A;  2KS1 A;  4L75 A;  2KS1 B;  1BCC E;  4LGD E;  3VP9 A;  2W6A A;  3E1R A;  2QM7 A;  1S9K E;  4W7Y A;  2OTL P;  1BGY E;  1LWU C;  5E79 H;  5APS A;  1RE3 C;  1HJ0 A;  2KIK A;  3HE4 B;  1DH3 A;  1ZXG A;  2WTY A;  1FZG A;  4R4L A;  2YKQ A;  3PRJ A;  3JCU E;  2P10 A;  3L4F A;  4HH2 A;  2HYN A;  2H7H A;  1J1E B;  4PV1 D;  1LTA C;  3UIA A;  3AE6 C;  2P7J A;  4I1L A;  4AYC A;  1JNM A;  1VQ5 P;  1DD3 A;  4PV1 B;  1FZE A;  1RQV A;  1IC2 A;  2GUV A;  3CWB D;  3RGU A;  1BCC J;  2BEZ F;  1G2C A;  3II6 A;  3K5B A;  5KAI E;  3V5B A;  3VP8 A;  5KLI C;  3BRV B;  1YJN P;  1A02 F;  2KNC B;  2JWA A;  3GMA A;  2LXB A;  4U3F G;  2OGU A;  1PP9 E;  2MKV A;  2BCC E;  2O01 H;  3PHL A;  4D6T J;  3H1L G;  2OYH A;  1Y9B A;  3PP5 A;  3AEB C;  3LIE A;  3SSU A;  2WWW A;  1NO4 A;  2WPV B;  3HD7 C;  3U1A A;  4L76 A;  1SQP G;  3HTK A;  2ZJS E;  5BVZ A;  3BCC E;  3V2R A;  3H1L D;  1AQT A;  3IFM A;  2I1J A;  1L0L G;  3A7O A;  2WSE J;  3MTU E;  1JMB A;  1SQB D;  3M9Q A;  2NRG A;  4PD4 I;  5KJ7 C;  3KHU A;  5CCH C;  1X9V A;  1SQB K;  1SFC B;  4WY4 C;  1FOS F;  2L91 A;  3TGU G;  2HLO A;  1EDK A;  4CPG A;  1N8R Q;  1PGJ A;  5E79 E;  5KJ7 A;  4N6J A;  2OYI A;  1T2K C;  3A5T A;  1QX8 A;  2IFN A;  2FYU D;  4QMA A;  5APX A;  1GU5 A;  3MUD C;  3AEC C;  5C39 A;  2IBZ E;  1K05 A;  4HB1 A;  1KIL C;  2C9L Y;  3D70 A;  3R4Y A;  1T2K D;  1N73 B;  1P84 H;  4ASV A;  3CC7 P;  2FXM A;  1T3J A;  2QJK B;  5KKZ C;  1NAY A;  5AW0 B;  2HPC B;  1OW7 A;  3BCC D;  5CCH D;  2XKM A;  1OXZ A;  3IF4 A;  3Q3D A;  4EYY Q;  1J1E C;  1NU1 D;  2KZI A;  2YKP A;  3AE1 C;  5KJ7 D;  3FWL A;  1KOR A;  1NTK D;  1R8E A;  2A06 D;  2H43 A;  2Q6Q A;  2N1T C;  4YXD C;  1KTM A;  1PP9 D;  1URQ B;  2WMM A;  2NPS C;  2WSE H;  4PD4 E;  1BE3 G;  1N7S C;  1K04 A;  2K88 A;  3HUS B;  1X0T A;  2FYU G;  3MIW A;  1LP1 B;  2N1T D;  3QH9 A;  2QJP C;  4K35 A;  2C9N Y;  3RK3 B;  1M56 D;  3HE5 A;  1GL2 D;  1HF9 A;  1PGO A;  2CPS A;  5H2F E;  5CCH A;  1BGY J;  3RK2 C;  1QL2 A;  3L70 J;  3OW2 O;  3AEE C;  2W83 C;  1NTZ E;  3L70 D;  2O01 N;  4IFD K;  1KIL D;  4JYC A;  2IYP A;  1WT6 A;  1MV8 A;  2B89 A;  2N1T A;  3L74 J;  4O9B A;  5APV A;  1ZP0 C;  4C7R A;  3CCS P;  4KJM A;  2QVA A;  1S9K D;  1VQN P;  5M1B A;  2ITA A;  1IK7 A;  1R5L A;  2Q3I A;  3B5N D;  3CI9 A;  4I7Z B;  2Q7C A;  3TNU B;  2R3S A;  1JTH A;  2JKV A;  2AXT H;  3CX5 E;  1NTM D;  2ZT9 B;  4IFM A;  4NPE A;  5AVZ B;  4H44 D;  1GK4 A;  1L2P A;  1HGV A;  3P7K A;  1LP1 A;  1KYO D;  3MD0 A;  4I2L C;  1KIL B;  1EZV I;  2FXO A;  2Y0C A;  3CWB E;  3AE3 C;  2Q9I A;  2G3A A;  2CK3 H;  2O1K A;  1JY2 O;  2OQQ A;  2QIW A;  4KT0 J;  5KAF E;  2BCC J;  2KXP B;  2QJK C;  3A0H E;  3B71 A;  3EFF K;  4Y99 C;  2XZR A;  1OVV A;  4D6T E;  4GT1 A;  1SQV D;  3F89 A;  4W7Z A;  4K3A A;  3B5N A;  1JY3 N;  1CW5 A;  4C7N A;  1AQ5 A;  1IZN B;  1Y47 A;  1FZB A;  2W6B A;  5KLV D;  2Y9Z A;  2XV5 A;  2Y0E A;  2W27 A;  3BCC G;  3FX0 A;  3E1I A;  3EQ2 A;  1GD2 E;  3WUV A;  5CCG D;  1OZH A;  1DEB A;  4OGQ B;  3L71 E;  1LTJ C;  2I8D A;  2PRR A;  4RKU J;  3GF3 A;  3GHG A;  5AW1 B;  2KSJ A;  2OYI B;  1M90 Q;  1A02 J;  1AFO A;  5B5E H;  1DD4 A;  3H1J G;  3G71 P;  2E43 A;  1M57 D;  1OX3 A;  4XFJ A;  2FFD A;  2V7Q J;  1KFM A;  1SQX G;  4OWF A;  3JSV C;  4L74 A;  2GUS A;  5CCG A;  2ZYA A;  1KZU B;  5KLV K;  1J1D B;  3L35 A;  3P8M C;  1NGM B;  1H88 A;  1HGZ A;  1NTK K;  1AVY A;  1L0L D;  2J59 M;  2M8R A;  1USE A;  1Q2N A;  1EXI A;  2JWD A;  2YNY A;  5DJT B;  2KOG A;  1N86 A;  2M3B A;  2IBZ G;  4WBA A;  4H13 C;  4DZO A;  1PFI A;  2NPS D;  1LTS C;  3HD7 A;  4LLH A;  3KDP B;  1JM0 A;  1U57 A;  2A06 E;  2VRS A;  3AE2 C;  1FE6 A;  1KB9 H;  3H32 B;  1NJI Q;  1RE4 C;  1WRG A;  1YQ4 C;  1ZN5 A;  2LKM A;  1NTM J;  3CX5 D;  2Y9Y A;  2K37 A;  2OTK E;  3H1L E;  3JCU H;  2P58 A;  1L0L J;  2QG4 A;  2K9J A;  4Y99 B;  1URQ D;  3VMY A;  1RHZ B;  4XE5 B;  3S9O A;  2FYN B;  1SQX K;  1IK9 A;  3GW6 A;  4EDF A;  1ZR4 A;  1AV1 A;  5TIS E;  1SS1 A;  4RJT A;  3CMA P;  5APT A;  3AE4 C;  1S1C X;  2FYU E;  2YIU B;  5B66 H;  5KLI B;  2HPC A;  1RF1 A;  3NFQ A;  4JBZ A;  2AEJ A;  2R3C A;  1YTZ I;  1KD1 Q;  2YO2 A;  2B88 A;  1UIX A;  1JTH B;  1M1J B;  2JP3 A;  2KLV A;  3L37 A;  3TYY A;  3CCU P;  1JY2 P;  3KPE A;  2Q5U A;  3L72 J;  3H1I G;  3CXH H;  1LTJ B;  1URQ A;  3FXE A;  2E42 A;  1VQL P;  1ZRT D;  1L0L E;  2XDJ A;  1LNQ A;  3CCR P;  5AW4 B;  1FJK A;  1QEX A;  1H0T A;  5AW6 B;  1NTM E;  3VMZ A;  2A45 G;  2P1J A;  1SQQ E;  5APW A;  2QM8 A;  1M1K Q;  2FFD B;  3GG2 A;  3L72 E;  5AVQ B;  1NTK J;  1SFC C;  1E5W A;  3V4Q A;  2WSS H;  1PP9 G;  2JJL A;  2YXQ B;  3S4R A;  5GTI H;  2YO3 A;  3EWK A;  1FZF A;  2Z5I A;  2D2C D;  2WT7 A;  2E76 B;  2FYU J;  3E7K A;  3M0A A;  3OAK A;  3HTK B;  1ZW0 A;  4WY4 A;  5AVU B;  1IJD B;  1LTI C;  2YXR B;  4PJ0 E;  1W2B O;  3L73 E;  3QWO C;  4H13 B;  4WWI A;  2RH0 A;  1OFC X;  1N7L A;  2WIT A;  1N73 C;  2D2C C;  1MFZ A;  3OA7 A;  3Q5R A;  1Q86 Q;  3CC4 P;  3VTP C;  2HFE D;  1S4X A;  1SVF A;  1SQQ J;  5CMZ A;  2YMK A;  1VQK P; 
#chains in the Genus database with same CATH homology
 4HJG H;  4GOE A;  3S1K A;  1DEE G;  4ASW A;  1H0T B;  2B89 A;  1S3J A;  2M5A A;  4KJM A;  2QVA A;  5CBN A;  2RKL A;  4MN4 C;  4NPE A;  2M0B A;  1LP1 A;  3MZW B;  4IOI H;  2M5A B;  4BXL A;  1BDD A;  1OVV A;  4K3A A;  2SPZ A;  1Y47 A;  1BDC A;  4GOD A;  4HKZ H;  2UWJ E;  1LT1 A;  1EC5 A;  2QRX A;  2I8D A;  2KS1 B;  2Q1K A;  4NPD A;  1EDJ A;  2ZAE B;  1OVU A;  2KIK A;  1ZXG A;  3ZDM A;  5DJU B;  4GOF A;  1Q2N A;  1U7M A;  2JWD A;  5DJT B;  3RGU A;  1JM0 A;  2LXB A;  4ZMD A;  3MHV A;  2OTK E;  2P58 A;  4ZNC A;  2KZJ A;  1JMB A;  1SS1 A;  1EDL A;  1U7J A;  4JBZ A;  1MFT A;  2B87 A;  2B88 A;  1EDK A;  4CPG A;  2B87 B;  3FXE A;  5EFW B;  5C39 A;  4HB1 A;  1H0T A;  4ASV A;  2KUB A;  2HR3 A;  1FC2 C;  3FXD A;  1NVO A;  2LR2 A;  1EDI A;  3PH0 A;  4EYY Q;  2KZI A;  2K3R A;  5CBO A;  1ZW0 A;  2WMM A;  4WWI A;  3QWO C;  1X0T A;  1LP1 B;  4K35 A;  2R44 A;  4NPF X;  5K5G B;  2LXC B;  2KI7 B;  1OVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...