5GTHE

Native xfel structure of photosystem ii (dark dataset)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 19
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5gthE00
3KZIE 1S5LE 3A0HE 3A0BE 3WU2E 1W5CE 4UB6E 5KAIE 4IL6E 5GTHE 5KAFE 5B5EE 5E79E 5H2FE 4UB8E 5TISE 4PJ0E 5GTIE 5B66E 2AXTE 3JCUE
chains in the Genus database with same CATH superfamily
2I8DA 4GIFA 2WT7A 1S5LH 1QVGO 1SQBJ 2QM7A 5APVA 4AQRD 5KLVJ 3RK3C 1EZVG 2WWWA 4I1LA 5AW1B 3MP7B 4BWNA 5CCGA 3PRJA 2WT7B 2Q9IA 1NTZE 1SQPG 1J2JB 1Y9BA 1UIIA 3S9OA 3H1LD 3CPWO 1NH4A 1NU1D 2HR3A 3A0HE 3BCCE 5AVXB 3KZIH 2G3AA 1BE3D 1LTAC 2FKWB 3CWBJ 5CCHA 2H43A 2WITA 4L76A 1L4AC 1KB9E 1KD1Q 2QJYC 1DEBA 4L73A 1M7LA 2H89C 3AE1C 2JEEA 3EWKA 1RF0C 1NTZG 3I5CA 1HH0A 2KLUA 4R4MA 2N9BA 3BCCG 1HBWA 2CK3H 2P58A 2KSJA 3PLNA 1BCCE 1EDIA 2YKQA 3RBXA 1S5LX 1FC2C 1YYCA 3VP8A 2W27A 5KTBA 1M1KQ 1BGYD 4H0LD 3L72J 3QH9A 2UWJE 5AVSB 1X0TA 2G8YA 2L5GB 2HG5D 1OXZA 2C0WA 1FZAA 1RE4A 3L71J 4N3YB 1SQVJ 1N7LA 1BCCG 4W7YA 2BCCE 3A3YB 3L74J 3WUUA 2OTLP 3WU2E 3M9HA 1M8OB 3CX5H 2QJKB 2FXOA 3TGUJ 2OYHC 2HLOA 5TISH 1P84E 5AVRB 3TYYA 4DJGA 1FZGA 1Q82Q 5KLIC 3R4YA 2BCCG 2E74B 4WVZA 2FFDA 5APTA 3V4QA 2WTYA 4WBAA 3PHLA 3SFEC 1PPJE 2FFDB 1FOSF 3FXEA 3H1ID 4XE5B 1PGOA 4WY4D 1NYHA 1NTMK 4JPZB 5E79E 1KORA 5B66E 4WB4A 1PPJG 5AW4B 2QSIA 5CCHC 1IO4A 2XDJA 3L70E 1L0NG 1LJ2A 1YJWP 3S4RA 2M3BA 2QEXP 1T2KD 1S4XA 1VL2A 4K3AA 3GW6A 1BSNA 3L75D 1IFJA 2RN0A 1JTHA 1EDLA 1FBMA 3KPEA 3L70G 1GMJA 2ZFCA 3PH0A 3CLQA 3IAOA 1VPCA 2KUBA 1JTHB 1Z56A 3CCRP 4BXLA 3CWBG 2FY8A 2ZT9C 4D6TE 1DD3A 4I7ZB 1VQ7P 4PV1D 1EDJA 2PRRA 4OVNF 3FWLA 3A0HH 3HRNA 1FZEA 1GK6A 1RE4C 3D6ZA 2N1TC 1LTSC 3M9BA 1K8AQ 1HGVA 4N78D 2A06G 1UIXA 2YKPA 3IN6A 3A0BE 2E75B 3L71E 5AW7B 1SQVE 2VRSA 3CX5D 1EZVI 1VQMP 1PP9E 5CCGD 1LT9A 2KNCA 1NTKK 1RQVA 3ZDMA 3IR9A 3P8CD 2M0BA 1S1CX 4NPFX 1NTZK 2FFDC 1LT9B 2KNCB 1LWUA 2JDIH 3H1HD 1MV8A 1FJPA 3L71G 3RK3E 3VOPA 1SQVG 3H1JJ 3W67A 3USSA 2P67A 1PP9G 3TSIA 3L74G 3TK1A 1K73Q 1LWUB 1SQXK 4U3FJ 1L0LD 3TGUG 2E43A 1YTZI 2M8RA 1E5WA 1HGZA 3CMAP 1X8YA 2YIUB 4EOTA 3WU2H 2KP8A 2YKOA 1KB9I 3C1LA 2FYUD 2GUSA 2W83C 3KDPB 2WPQA 5KJ7D 2K1AA 1H0TA 1P84H 2WVRA 1VQKP 4KT0J 2WZ7A 1OVVA 3MZWB 1SQQD 2KK7A 1N7SA 2ZXXA 1GTWA 3VN0A 2FXPA 5H2FE 1H0TB 4ASVA 5AVUB 1D7MA 3NMDA 1N7SB 2R3SA 1SLQA 3I56P 5GTHE 4I7ZC 4B86A 2E74D 4H44D 1QEXA 2QJPB 4WWIA 3O6QA 4YTPC 3SFDC 4AYCA 1SFCC 1IZNB 3H25A 5CMZA 1QL2A 2GA1A 2B9BA 5B66H 3L73J 1NJIQ 3O6QB 3BCCD 1XTCC 2E75C 1X9VA 1LTJA 1VQPP 4EIJA 1KB9D 2GM4A 1OX3A 2E76B 1P84I 2IX7C 1LTJB 3II6A 2OGUA 2O3JA 2R5DA 4HYTB 5KKZB 2Q3IA 1K05A 1SQXJ 3B5NC 1YHQP 3CCLP 2Y0CA 1L0NK 3RK3B 3H32A 4ZKUA 3U1AA 1RF1A 1VQOP 1GD2E 5APYA 3VP9A 4JYCA 1SQBK 1BCCD 1LWUC 5KLVK 3AECC 1R5SA 2Y9YA 3H32B 1RF0A 3RK2D 1NTME 1RF1B 2DW3A 2YIUC 5AW3B 2NPSA 2QJYB 4RJTA 2I1JA 4ZNCA 3TNUA 2JWDA 1QLED 1ZP0C 2KOGA 3FGAD 3OW2O 1KQLA 2NPSB 3GLMA 3TNUB 1JY3P 4GOEA 1R8EA 3A7OA 3AE3C 1GW3A 1HUCA 1MKMA 1FZBA 5APXA 3H1JG 1MFTA 1P84D 2P7JA 2WSCJ 3D6YA 2Z4EA 2O01J 2V7QJ 1URQD 4U3FG 2WSEJ 4PD4E 3V2QA 3N7NA 3VYIA 1KILD 1CW5A 1VQLP 1PPJD 4RO0A 1JMBA 2FXMA 5AVZB 4TLFA 1J1DC 5AW2B 4JF7A 1IFNA 3Q3DA 1VQNP 1JY2P 1EZVE 1YBKA 4C46A 2IYOA 4I2LC 2XNDH 3E1RA 4UB8E 3AE9C 3FWNA 5AW8B 4JYBA 5APQA 2AEMA 2D2CD 2E5TA 1LTJC 3L70D 3HUSC 5KKZC 3L73E 4C7NA 2M5AA 1KMIZ 1NTKE 4NPDA 1GDTA 4Z1MH 5H2FH 3CMEP 3AEDC 3BRTB 1DD4A 4IFMA 1ZW0A 3JCUE 4C7NB 2M5AB 3NFQA 1YJ9P 5GTHH 2N9YB 1RF1C 1USDA 5AVQB 3L73G 1SQXE 1NTKG 1FS0E 3Q1MA 2LKMA 5BU5A 2YO2A 2K9JA 4D6TD 5CBNA 2HYNA 2OARA 2IBZE 2V4HA 2NPSC 3P32A 3RL0B 3KYQA 2Q3EA 3H1LJ 2K9JB 5BVZA 1NU1J 1SQXG 2LXCB 1S9KE 1ZR2A 2C9LY 3L36A 1LTIC 3KHUA 1M90Q 5AW6B 1SQVD 4XFJA 2IBZG 1Q81Q 1PP9D 3CD6P 3V4WA 1DH3A 2YXRB 2E76D 2I1KA 2KB7P 3VMAA 2ZT9B 2N1TA 2LXBA 4NPEA 3MHVA 5K5GB 1RH5B 2N1TB 5AVWB 1OIPA 1BGYJ 1YTZT 1YITP 2R32A 1L4AD 4LGDE 5AVYB 5KAFH 3B4SA 2ZVOB 1OFCX 1FDOA 3A2AA 4KJMA 5AW9B 3TDKA 1YI2P 1Q90D 2AEFA 3H6PA 3F5HA 1ZXGA 1L0NE 1KZUB 4PD4H 1LT1A 3WUVA 2B87A 1SQBE 2RMZA 1FJKA 1GL2B 5KLVE 3MIWA 3KXDA 5BU8B 1NHLA 1KQFB 4K35A 3WUTA 1U7JA 2B87B 2IYPA 2KZJA 4HH2A 2XZRA 3GMAA 2OQQA 3RL0C 4W7ZA 2Q7CA 2POHA 3CWBE 4UB8H 1SQBG 3RGUA 1BDDA 5KLVG 1ZRTE 3WMM0 1YJNP 2YMYA 1LP1A 1OVUA 1EXIA 2PGDA 3KQGA 2JWAA 3CCEP 3AEBC 3U59A 5GTIE 2BASA 2A06E 1PFIA 1NAYA 1LP1B 1NO4A 2MJZA 2AXTE 4H13D 1SFCA 1FDIA 3OA7A 1S3JA 3SWKA 3CXHE 4PD4I 1VF5B 1PV3A 3L75J 2FYUK 1KB9H 1SFCB 4OGQB 3L72E 3V2NA 1H89A 3V6IA 1IK7A 2Q6QA 3H1LG 1N86A 3HD7A 1NTMD 2OYIA 3L74E 1JEKA 3B5NA 3AE7C 3C8VA 1H88A 3TGUE 1X22A 3HD7B 2WSFH 3L72G 5CCHD 3OAKA 1G1JA 1NKZB 5DJUB 2OYIB 1FAVA 2LR2A 3BATA 1VQ4P 3B5NB 1SVFA 3AE4C 3C9IA 4I6MC 1GL2C 2FYNB 1RE3C 3H1KJ 2K37A 3T97A 1U57A 2XNXA 4PD4D 1GU4A 1YQ3C 1M56D 1BGYG 3R2PA 3LW5H 3CCUP 4KHXA 3T97B 3H1HJ 4CPGA 1JMMA 2JO1A 2IBZI 3GF7A 2K88A 2JR8A 2YMKA 1AFOA 2R44A 1EZVD 3E1IA 1SQPD 3F89A 3HE5A 3CCMP 3EFGA 2FYUJ 2FBWC 3RK2C 4QMAA 1PZQA 4Y99C 3L73D 3RL0g 1VF5C 1QL1A 1NTKD 3Q2YA 3HE5B 5CHXA 2KXPB 5E79H 4OGQC 2JP3A 1SQQJ 2P2UA 3JC22 1NTZD 2W6AA 1J1DB 3K5BA 1GZLA 4GOFA 5KAIE 3CC4P 3AE6C 3AEFC 1VQ9P 3HUSA 4O9BA 2W8ZA 2Z5IA 3LIDA 3HD7C 1FZCC 2IBZD 2C0XA 2OYIC 3HUSB 1URQC 1PGJA 4C7RA 4H0LB 2OTKE 2B88A 1KQSO 1KILC 3BCCJ 3CCSP 2H88C 1S9KD 1JCDA 3L75G 2FYNC 2AXTH 1T3UA 2O01N 4IL6E 3CXHH 1N8RQ 1NGMB 3BRVB 2BEQD 1W2EA 3G71P 2WMMA 3MUDA 2HFED 1ZV8A 3H1JE 2BCCD 4U3FE 2D2CC 3CX5E 2FYZA 1RY3A 3IF4A 2Q5UA 2AXCA 3A0BH 1J1EB 2ITAA 2B89A 3H1KE 1BCCJ 3M0AA 1SFCD 2ZXEB 4PJ0E 2H8PD 3GHGC 3N4XA 4R4LA 1L2PA 2M3EA 3B71A 3L35A 2KLVA 1NU1K 2E75D 1HWTC 3AEEC 2ZVNB 1FDMA 2W6JH 1FOSE 2RH0A 3H1KG 3P8MC 4LC1A 1A02F 3VMZA 1Q2NA 3BVHA 1BDCA 1KN7A 2PP6A 1GU5A 1JOCA 3AE8C 3CXHI 3H1HG 2YNYA 1L0ND 2CPSA 1T6AA 4HKZH 2Q1KA 2WPRA 2FYUE 1M57D 1SQBD 2OYOA 4N6JA 1RQUA 5KLVD 1DEEG 3MGNA 3CCJP 3FX0A 1AQTA 1JCCA 4H0LC 1JY3N 1LTGC 2FYUG 3CWBD 2IFMA 2QG4A 2SPZA 4PV1B 1ZRTD 2KSEA 1AQ5A 2WPSA 2QRXA 1G2CA 3LIEA 1SQQG 3AEGC 4JBZA 1XTGB 3V2PA 3MTUE 4RESB 2HPCA 3OJAB 4GDOA 3PJSK 2H7HA 2NZ2A 2A06D 3L70J 1N7SD 1G2CB 2YXQB 1PGPA 1OW6A 2WPVB 2HPCB 4UB6E 3CXHD 1MFZA 3GG2A 1ZOYC 1J1EC 1JY2N 5KAIH 3MUDC 2PFXA 1M1JA 1QVFO 3P7KA 2WQYC 1NOHA 5AW0B 1KYOE 1BE3J 3L72D 3SWFA 3BASA 3L71D 1M1JB 2ZAEB 1Q7YQ 4WY4C 1OVRA 1OMIA 1EQ7A 2K9YA 1CZQA 3L74D 1WMKA 4D6TJ 1SP4A 2JJLA 2YO3A 3TGUD 1SS1A 2CPBA 3VMYA 5AVTB 5KJ7A 1W5CE 1FU1A 3RK3D 3M9QA 4IL6H 5C39A 4AUWA 3W68A 3EQ2A 1T2KC 1W2BO 2KYVA 3M0DA 5APUA 2J58A 1PP9J 3O8ZA 1Q86Q 4MN4C 2J5UA 2PAJA 2IZ0A 1IC2A 2O1JA 1S2EA 1YQ4C 3CC7P 1IFPA 4PJ0H 1A02J 1FZFA 4YPCA 4H13C 1BSHA 4PV1C 5CBOA 4H44B 1GL2A 1KC8Q 2NPSD 1RE3A 4IOIH 1PIXA 1KILE 2KS1A 1ZMEC 2R3CA 3HTKA 1OWAA 2P10A 3Q5RA 2RKLA 1WRGA 2W6BA 3SWYA 2P1JA 4IL6X 2Y0DA 3PP5A 2Y0EA 1QGKB 2KS1B 3HTKB 1EDKA 5CCGC 5B5EE 3GF3A 5TJHA 5CJ0A 1N2DC 1IFIA 3H1IJ 4U7JA 2XU6A 1LTTC 4GT1A 1VQ6P 4L74A 3CX5I 2QVAA 1M1JC 1R5LA 3CCQP 3I55P 3V2RA 1IK9A 3EFFK 1HVVA 2NRGA 3CL3D 4OWFA 3H1LE 1JUNA 1NU1E 1L0LK 1BE3E 4BRYA 3JCUH 4A7PA 3CC2P 3RK2B 3G6EP 4Y99B 2L91A 3CI9A 1G1IA 1LGHB 2K3RA 1YIJP 2J59M 1Y8AA 3L37A 3AE2C 4BRYB 4IFDK 2IFNA 5L8RJ 1X79B 5KJ7C 1N73A 1AJYA 1NU1G 1SQQK 1BE3G 1KTMA 2QJKC 1FZCA 1HJ0A 4UB6H 2A45G 1URQA 3M0DC 1N73B 1JB0J 1SQPK 3H1JD 1KYOH 1KILA 4D6TG 1WT6A 1FZCB 2Y9ZA 4U3FD 1KFMA 2E74C 1URQB 4H44C 2KI7B 2XV5A 1BGYE 3H1KD 3RL0D 2XKMA 4LLHA 1KILB 1ZN5A 1NWQA 4ZMDA 1NTMJ 1MUUA 1E79H 5M1BA 4YXDC 4M3LA 3UIAA 2WSCH 1NVOA 5EFWB 3Q5PA 2O01H 2V7QH 1AVOA 2WSEH 1VQ5P 2ZT9D 3PTZA 3A5TA 1AVYA 1DX7A 3IFMA 3GHGA 3AEAC 2D2CB 1CSBA 2KIKA 1T8ZA 1OW7A 1EXJA 2IDBA 1L0LJ 2N1TD 3G4SP 3GHGB 4ZKPA 1RHZB 1HTLC 1KV4A 1KYOI 3Q5SA 3CCVP 1S72P 1Y47A 3H1IE 1S5LE 4OH8B 4YXWH 3V5BA 1H8AA 1NKNA 2MKVA 2O1KA 3L4FA 5CJ4A 1JY3O 2KZIA 3D70A 3KZIE 2ZYDA 3H1IG 3RBZA 3NXSA 3G3ZA 1HJBA 1USEA 1SQPJ 4IFFA 5B5EH 1K9MQ 1SQXD 4DZOA 1N73C 1GL2D 3L75E 3D71A 1ZR4A 1NTKJ 5DJTB 1IFDA 4DT0A 2GUVA 4Y28J 2E42A 4GKGA 2ZYGA 1DIPA 2R5BA 1NTZJ 1NAFA 3ABVC 1JY2O 3AE5C 1PGQA 1JM0A 1KYOD 5GTIH 1LT9C 3B8EB 1TU3F 2QM8A 1JO5A 5APWA 3HE4A 1JNMA 1IFMA 2A45H 3VMXA 1QX8A 2QIWA 1GK4A 1L4AA 4EYYQ 4EI2A 4N78E 1LNQA 4W80A 1HF9A 1VQ8P 3E7KA 3HE4B 1VDFA 2W90A 4L75A 4ASWA 4HJGH 1VF5D 1L4AB 3M91A 2AEJA 1MZ9A 2IPPA 2WSFJ 4JQ0D 4DOJA 4WY4A 3U1CA 5TISE 1PL5A 2OTJP 4RKUJ 4OGQD 3P8CE 2HODA 3VTPC 2ZJSE 1ZLLA 4XA4A 2BEZF 3H1HE 1EC5A 4WY4B 1U7MA 3M06A 1OW8A 1NTMG 3TF5A 5KAFE 2HODB 3ITKA 1AA0A 2BCCJ 3G9RA 1L0LE 2WSSH 1N7SC 3HD7D 1AV1A 1KQGB 3MD0A 2E5YA 3LW5J 3B5ND 2JKVA 2QE7H 2A45I 3SSUA 4EDFA 2QJPC 1OZHA 2QA4P 1CI6A 5APSA 2Z5HA 2C9NY 5AVVB 2OYHA 3QWOC 4DCKA 5AW5B 2IZ1A 1L0LG 1CI6B 1SQQE 2ZYAA 1IJDB 3FXDA 1T3JA 1SQVK 4GODA 2OYHB 1GW4A 1FE6A 4TT3H 1SQPE 1LTBC 1KFNA 2E76C 1K04A 4HB1A 3NTNA 3JSVC 1L0NJ 5KLIB 4H13B 3S1KA
chains in the Genus database with same CATH topology
3KZIE 1S5LE 3A0HE 3A0BE 3WU2E 1W5CE 4UB6E 5KAIE 4IL6E 5GTHE 5KAFE 5B5EE 5E79E 5H2FE 4UB8E 5TISE 4PJ0E 5GTIE 5B66E 2AXTE 3JCUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI E;  1S5L E;  3A0H E;  3A0B E;  3WU2 E;  1W5C E;  4UB6 E;  5KAI E;  4IL6 E;  5GTH E;  5KAF E;  5B5E E;  5E79 E;  5H2F E;  4UB8 E;  5TIS E;  4PJ0 E;  5GTI E;  5B66 E;  2AXT E;  3JCU E; 
#chains in the Genus database with same CATH topology
 2I8D A;  4GIF A;  2WT7 A;  1S5L H;  1QVG O;  1SQB J;  2QM7 A;  5APV A;  4AQR D;  5KLV J;  3RK3 C;  1EZV G;  2WWW A;  4I1L A;  5AW1 B;  3MP7 B;  4BWN A;  5CCG A;  3PRJ A;  2WT7 B;  2Q9I A;  1NTZ E;  1SQP G;  1J2J B;  1Y9B A;  1UII A;  3S9O A;  3H1L D;  3CPW O;  1NH4 A;  1NU1 D;  2HR3 A;  3A0H E;  3BCC E;  5AVX B;  3KZI H;  2G3A A;  1BE3 D;  1LTA C;  2FKW B;  3CWB J;  5CCH A;  2H43 A;  2WIT A;  4L76 A;  1L4A C;  1KB9 E;  1KD1 Q;  2QJY C;  1DEB A;  4L73 A;  1M7L A;  2H89 C;  3AE1 C;  2JEE A;  3EWK A;  1RF0 C;  1NTZ G;  3I5C A;  1HH0 A;  2KLU A;  4R4M A;  2N9B A;  3BCC G;  1HBW A;  2CK3 H;  2P58 A;  2KSJ A;  3PLN A;  1BCC E;  1EDI A;  2YKQ A;  3RBX A;  1S5L X;  1FC2 C;  1YYC A;  3VP8 A;  2W27 A;  5KTB A;  1M1K Q;  1BGY D;  4H0L D;  3L72 J;  3QH9 A;  2UWJ E;  5AVS B;  1X0T A;  2G8Y A;  2L5G B;  2HG5 D;  1OXZ A;  2C0W A;  1FZA A;  1RE4 A;  3L71 J;  4N3Y B;  1SQV J;  1N7L A;  1BCC G;  4W7Y A;  2BCC E;  3A3Y B;  3L74 J;  3WUU A;  2OTL P;  3WU2 E;  3M9H A;  1M8O B;  3CX5 H;  2QJK B;  2FXO A;  3TGU J;  2OYH C;  2HLO A;  5TIS H;  1P84 E;  5AVR B;  3TYY A;  4DJG A;  1FZG A;  1Q82 Q;  5KLI C;  3R4Y A;  2BCC G;  2E74 B;  4WVZ A;  2FFD A;  5APT A;  3V4Q A;  2WTY A;  4WBA A;  3PHL A;  3SFE C;  1PPJ E;  2FFD B;  1FOS F;  3FXE A;  3H1I D;  4XE5 B;  1PGO A;  4WY4 D;  1NYH A;  1NTM K;  4JPZ B;  5E79 E;  1KOR A;  5B66 E;  4WB4 A;  1PPJ G;  5AW4 B;  2QSI A;  5CCH C;  1IO4 A;  2XDJ A;  3L70 E;  1L0N G;  1LJ2 A;  1YJW P;  3S4R A;  2M3B A;  2QEX P;  1T2K D;  1S4X A;  1VL2 A;  4K3A A;  3GW6 A;  1BSN A;  3L75 D;  1IFJ A;  2RN0 A;  1JTH A;  1EDL A;  1FBM A;  3KPE A;  3L70 G;  1GMJ A;  2ZFC A;  3PH0 A;  3CLQ A;  3IAO A;  1VPC A;  2KUB A;  1JTH B;  1Z56 A;  3CCR P;  4BXL A;  3CWB G;  2FY8 A;  2ZT9 C;  4D6T E;  1DD3 A;  4I7Z B;  1VQ7 P;  4PV1 D;  1EDJ A;  2PRR A;  4OVN F;  3FWL A;  3A0H H;  3HRN A;  1FZE A;  1GK6 A;  1RE4 C;  3D6Z A;  2N1T C;  1LTS C;  3M9B A;  1K8A Q;  1HGV A;  4N78 D;  2A06 G;  1UIX A;  2YKP A;  3IN6 A;  3A0B E;  2E75 B;  3L71 E;  5AW7 B;  1SQV E;  2VRS A;  3CX5 D;  1EZV I;  1VQM P;  1PP9 E;  5CCG D;  1LT9 A;  2KNC A;  1NTK K;  1RQV A;  3ZDM A;  3IR9 A;  3P8C D;  2M0B A;  1S1C X;  4NPF X;  1NTZ K;  2FFD C;  1LT9 B;  2KNC B;  1LWU A;  2JDI H;  3H1H D;  1MV8 A;  1FJP A;  3L71 G;  3RK3 E;  3VOP A;  1SQV G;  3H1J J;  3W67 A;  3USS A;  2P67 A;  1PP9 G;  3TSI A;  3L74 G;  3TK1 A;  1K73 Q;  1LWU B;  1SQX K;  4U3F J;  1L0L D;  3TGU G;  2E43 A;  1YTZ I;  2M8R A;  1E5W A;  1HGZ A;  3CMA P;  1X8Y A;  2YIU B;  4EOT A;  3WU2 H;  2KP8 A;  2YKO A;  1KB9 I;  3C1L A;  2FYU D;  2GUS A;  2W83 C;  3KDP B;  2WPQ A;  5KJ7 D;  2K1A A;  1H0T A;  1P84 H;  2WVR A;  1VQK P;  4KT0 J;  2WZ7 A;  1OVV A;  3MZW B;  1SQQ D;  2KK7 A;  1N7S A;  2ZXX A;  1GTW A;  3VN0 A;  2FXP A;  5H2F E;  1H0T B;  4ASV A;  5AVU B;  1D7M A;  3NMD A;  1N7S B;  2R3S A;  1SLQ A;  3I56 P;  5GTH E;  4I7Z C;  4B86 A;  2E74 D;  4H44 D;  1QEX A;  2QJP B;  4WWI A;  3O6Q A;  4YTP C;  3SFD C;  4AYC A;  1SFC C;  1IZN B;  3H25 A;  5CMZ A;  1QL2 A;  2GA1 A;  2B9B A;  5B66 H;  3L73 J;  1NJI Q;  3O6Q B;  3BCC D;  1XTC C;  2E75 C;  1X9V A;  1LTJ A;  1VQP P;  4EIJ A;  1KB9 D;  2GM4 A;  1OX3 A;  2E76 B;  1P84 I;  2IX7 C;  1LTJ B;  3II6 A;  2OGU A;  2O3J A;  2R5D A;  4HYT B;  5KKZ B;  2Q3I A;  1K05 A;  1SQX J;  3B5N C;  1YHQ P;  3CCL P;  2Y0C A;  1L0N K;  3RK3 B;  3H32 A;  4ZKU A;  3U1A A;  1RF1 A;  1VQO P;  1GD2 E;  5APY A;  3VP9 A;  4JYC A;  1SQB K;  1BCC D;  1LWU C;  5KLV K;  3AEC C;  1R5S A;  2Y9Y A;  3H32 B;  1RF0 A;  3RK2 D;  1NTM E;  1RF1 B;  2DW3 A;  2YIU C;  5AW3 B;  2NPS A;  2QJY B;  4RJT A;  2I1J A;  4ZNC A;  3TNU A;  2JWD A;  1QLE D;  1ZP0 C;  2KOG A;  3FGA D;  3OW2 O;  1KQL A;  2NPS B;  3GLM A;  3TNU B;  1JY3 P;  4GOE A;  1R8E A;  3A7O A;  3AE3 C;  1GW3 A;  1HUC A;  1MKM A;  1FZB A;  5APX A;  3H1J G;  1MFT A;  1P84 D;  2P7J A;  2WSC J;  3D6Y A;  2Z4E A;  2O01 J;  2V7Q J;  1URQ D;  4U3F G;  2WSE J;  4PD4 E;  3V2Q A;  3N7N A;  3VYI A;  1KIL D;  1CW5 A;  1VQL P;  1PPJ D;  4RO0 A;  1JMB A;  2FXM A;  5AVZ B;  4TLF A;  1J1D C;  5AW2 B;  4JF7 A;  1IFN A;  3Q3D A;  1VQN P;  1JY2 P;  1EZV E;  1YBK A;  4C46 A;  2IYO A;  4I2L C;  2XND H;  3E1R A;  4UB8 E;  3AE9 C;  3FWN A;  5AW8 B;  4JYB A;  5APQ A;  2AEM A;  2D2C D;  2E5T A;  1LTJ C;  3L70 D;  3HUS C;  5KKZ C;  3L73 E;  4C7N A;  2M5A A;  1KMI Z;  1NTK E;  4NPD A;  1GDT A;  4Z1M H;  5H2F H;  3CME P;  3AED C;  3BRT B;  1DD4 A;  4IFM A;  1ZW0 A;  3JCU E;  4C7N B;  2M5A B;  3NFQ A;  1YJ9 P;  5GTH H;  2N9Y B;  1RF1 C;  1USD A;  5AVQ B;  3L73 G;  1SQX E;  1NTK G;  1FS0 E;  3Q1M A;  2LKM A;  5BU5 A;  2YO2 A;  2K9J A;  4D6T D;  5CBN A;  2HYN A;  2OAR A;  2IBZ E;  2V4H A;  2NPS C;  3P32 A;  3RL0 B;  3KYQ A;  2Q3E A;  3H1L J;  2K9J B;  5BVZ A;  1NU1 J;  1SQX G;  2LXC B;  1S9K E;  1ZR2 A;  2C9L Y;  3L36 A;  1LTI C;  3KHU A;  1M90 Q;  5AW6 B;  1SQV D;  4XFJ A;  2IBZ G;  1Q81 Q;  1PP9 D;  3CD6 P;  3V4W A;  1DH3 A;  2YXR B;  2E76 D;  2I1K A;  2KB7 P;  3VMA A;  2ZT9 B;  2N1T A;  2LXB A;  4NPE A;  3MHV A;  5K5G B;  1RH5 B;  2N1T B;  5AVW B;  1OIP A;  1BGY J;  1YTZ T;  1YIT P;  2R32 A;  1L4A D;  4LGD E;  5AVY B;  5KAF H;  3B4S A;  2ZVO B;  1OFC X;  1FDO A;  3A2A A;  4KJM A;  5AW9 B;  3TDK A;  1YI2 P;  1Q90 D;  2AEF A;  3H6P A;  3F5H A;  1ZXG A;  1L0N E;  1KZU B;  4PD4 H;  1LT1 A;  3WUV A;  2B87 A;  1SQB E;  2RMZ A;  1FJK A;  1GL2 B;  5KLV E;  3MIW A;  3KXD A;  5BU8 B;  1NHL A;  1KQF B;  4K35 A;  3WUT A;  1U7J A;  2B87 B;  2IYP A;  2KZJ A;  4HH2 A;  2XZR A;  3GMA A;  2OQQ A;  3RL0 C;  4W7Z A;  2Q7C A;  2POH A;  3CWB E;  4UB8 H;  1SQB G;  3RGU A;  1BDD A;  5KLV G;  1ZRT E;  3WMM 0;  1YJN P;  2YMY A;  1LP1 A;  1OVU A;  1EXI A;  2PGD A;  3KQG A;  2JWA A;  3CCE P;  3AEB C;  3U59 A;  5GTI E;  2BAS A;  2A06 E;  1PFI A;  1NAY A;  1LP1 B;  1NO4 A;  2MJZ A;  2AXT E;  4H13 D;  1SFC A;  1FDI A;  3OA7 A;  1S3J A;  3SWK A;  3CXH E;  4PD4 I;  1VF5 B;  1PV3 A;  3L75 J;  2FYU K;  1KB9 H;  1SFC B;  4OGQ B;  3L72 E;  3V2N A;  1H89 A;  3V6I A;  1IK7 A;  2Q6Q A;  3H1L G;  1N86 A;  3HD7 A;  1NTM D;  2OYI A;  3L74 E;  1JEK A;  3B5N A;  3AE7 C;  3C8V A;  1H88 A;  3TGU E;  1X22 A;  3HD7 B;  2WSF H;  3L72 G;  5CCH D;  3OAK A;  1G1J A;  1NKZ B;  5DJU B;  2OYI B;  1FAV A;  2LR2 A;  3BAT A;  1VQ4 P;  3B5N B;  1SVF A;  3AE4 C;  3C9I A;  4I6M C;  1GL2 C;  2FYN B;  1RE3 C;  3H1K J;  2K37 A;  3T97 A;  1U57 A;  2XNX A;  4PD4 D;  1GU4 A;  1YQ3 C;  1M56 D;  1BGY G;  3R2P A;  3LW5 H;  3CCU P;  4KHX A;  3T97 B;  3H1H J;  4CPG A;  1JMM A;  2JO1 A;  2IBZ I;  3GF7 A;  2K88 A;  2JR8 A;  2YMK A;  1AFO A;  2R44 A;  1EZV D;  3E1I A;  1SQP D;  3F89 A;  3HE5 A;  3CCM P;  3EFG A;  2FYU J;  2FBW C;  3RK2 C;  4QMA A;  1PZQ A;  4Y99 C;  3L73 D;  3RL0 g;  1VF5 C;  1QL1 A;  1NTK D;  3Q2Y A;  3HE5 B;  5CHX A;  2KXP B;  5E79 H;  4OGQ C;  2JP3 A;  1SQQ J;  2P2U A;  3JC2 2;  1NTZ D;  2W6A A;  1J1D B;  3K5B A;  1GZL A;  4GOF A;  5KAI E;  3CC4 P;  3AE6 C;  3AEF C;  1VQ9 P;  3HUS A;  4O9B A;  2W8Z A;  2Z5I A;  3LID A;  3HD7 C;  1FZC C;  2IBZ D;  2C0X A;  2OYI C;  3HUS B;  1URQ C;  1PGJ A;  4C7R A;  4H0L B;  2OTK E;  2B88 A;  1KQS O;  1KIL C;  3BCC J;  3CCS P;  2H88 C;  1S9K D;  1JCD A;  3L75 G;  2FYN C;  2AXT H;  1T3U A;  2O01 N;  4IL6 E;  3CXH H;  1N8R Q;  1NGM B;  3BRV B;  2BEQ D;  1W2E A;  3G71 P;  2WMM A;  3MUD A;  2HFE D;  1ZV8 A;  3H1J E;  2BCC D;  4U3F E;  2D2C C;  3CX5 E;  2FYZ A;  1RY3 A;  3IF4 A;  2Q5U A;  2AXC A;  3A0B H;  1J1E B;  2ITA A;  2B89 A;  3H1K E;  1BCC J;  3M0A A;  1SFC D;  2ZXE B;  4PJ0 E;  2H8P D;  3GHG C;  3N4X A;  4R4L A;  1L2P A;  2M3E A;  3B71 A;  3L35 A;  2KLV A;  1NU1 K;  2E75 D;  1HWT C;  3AEE C;  2ZVN B;  1FDM A;  2W6J H;  1FOS E;  2RH0 A;  3H1K G;  3P8M C;  4LC1 A;  1A02 F;  3VMZ A;  1Q2N A;  3BVH A;  1BDC A;  1KN7 A;  2PP6 A;  1GU5 A;  1JOC A;  3AE8 C;  3CXH I;  3H1H G;  2YNY A;  1L0N D;  2CPS A;  1T6A A;  4HKZ H;  2Q1K A;  2WPR A;  2FYU E;  1M57 D;  1SQB D;  2OYO A;  4N6J A;  1RQU A;  5KLV D;  1DEE G;  3MGN A;  3CCJ P;  3FX0 A;  1AQT A;  1JCC A;  4H0L C;  1JY3 N;  1LTG C;  2FYU G;  3CWB D;  2IFM A;  2QG4 A;  2SPZ A;  4PV1 B;  1ZRT D;  2KSE A;  1AQ5 A;  2WPS A;  2QRX A;  1G2C A;  3LIE A;  1SQQ G;  3AEG C;  4JBZ A;  1XTG B;  3V2P A;  3MTU E;  4RES B;  2HPC A;  3OJA B;  4GDO A;  3PJS K;  2H7H A;  2NZ2 A;  2A06 D;  3L70 J;  1N7S D;  1G2C B;  2YXQ B;  1PGP A;  1OW6 A;  2WPV B;  2HPC B;  4UB6 E;  3CXH D;  1MFZ A;  3GG2 A;  1ZOY C;  1J1E C;  1JY2 N;  5KAI H;  3MUD C;  2PFX A;  1M1J A;  1QVF O;  3P7K A;  2WQY C;  1NOH A;  5AW0 B;  1KYO E;  1BE3 J;  3L72 D;  3SWF A;  3BAS A;  3L71 D;  1M1J B;  2ZAE B;  1Q7Y Q;  4WY4 C;  1OVR A;  1OMI A;  1EQ7 A;  2K9Y A;  1CZQ A;  3L74 D;  1WMK A;  4D6T J;  1SP4 A;  2JJL A;  2YO3 A;  3TGU D;  1SS1 A;  2CPB A;  3VMY A;  5AVT B;  5KJ7 A;  1W5C E;  1FU1 A;  3RK3 D;  3M9Q A;  4IL6 H;  5C39 A;  4AUW A;  3W68 A;  3EQ2 A;  1T2K C;  1W2B O;  2KYV A;  3M0D A;  5APU A;  2J58 A;  1PP9 J;  3O8Z A;  1Q86 Q;  4MN4 C;  2J5U A;  2PAJ A;  2IZ0 A;  1IC2 A;  2O1J A;  1S2E A;  1YQ4 C;  3CC7 P;  1IFP A;  4PJ0 H;  1A02 J;  1FZF A;  4YPC A;  4H13 C;  1BSH A;  4PV1 C;  5CBO A;  4H44 B;  1GL2 A;  1KC8 Q;  2NPS D;  1RE3 A;  4IOI H;  1PIX A;  1KIL E;  2KS1 A;  1ZME C;  2R3C A;  3HTK A;  1OWA A;  2P10 A;  3Q5R A;  2RKL A;  1WRG A;  2W6B A;  3SWY A;  2P1J A;  4IL6 X;  2Y0D A;  3PP5 A;  2Y0E A;  1QGK B;  2KS1 B;  3HTK B;  1EDK A;  5CCG C;  5B5E E;  3GF3 A;  5TJH A;  5CJ0 A;  1N2D C;  1IFI A;  3H1I J;  4U7J A;  2XU6 A;  1LTT C;  4GT1 A;  1VQ6 P;  4L74 A;  3CX5 I;  2QVA A;  1M1J C;  1R5L A;  3CCQ P;  3I55 P;  3V2R A;  1IK9 A;  3EFF K;  1HVV A;  2NRG A;  3CL3 D;  4OWF A;  3H1L E;  1JUN A;  1NU1 E;  1L0L K;  1BE3 E;  4BRY A;  3JCU H;  4A7P A;  3CC2 P;  3RK2 B;  3G6E P;  4Y99 B;  2L91 A;  3CI9 A;  1G1I A;  1LGH B;  2K3R A;  1YIJ P;  2J59 M;  1Y8A A;  3L37 A;  3AE2 C;  4BRY B;  4IFD K;  2IFN A;  5L8R J;  1X79 B;  5KJ7 C;  1N73 A;  1AJY A;  1NU1 G;  1SQQ K;  1BE3 G;  1KTM A;  2QJK C;  1FZC A;  1HJ0 A;  4UB6 H;  2A45 G;  1URQ A;  3M0D C;  1N73 B;  1JB0 J;  1SQP K;  3H1J D;  1KYO H;  1KIL A;  4D6T G;  1WT6 A;  1FZC B;  2Y9Z A;  4U3F D;  1KFM A;  2E74 C;  1URQ B;  4H44 C;  2KI7 B;  2XV5 A;  1BGY E;  3H1K D;  3RL0 D;  2XKM A;  4LLH A;  1KIL B;  1ZN5 A;  1NWQ A;  4ZMD A;  1NTM J;  1MUU A;  1E79 H;  5M1B A;  4YXD C;  4M3L A;  3UIA A;  2WSC H;  1NVO A;  5EFW B;  3Q5P A;  2O01 H;  2V7Q H;  1AVO A;  2WSE H;  1VQ5 P;  2ZT9 D;  3PTZ A;  3A5T A;  1AVY A;  1DX7 A;  3IFM A;  3GHG A;  3AEA C;  2D2C B;  1CSB A;  2KIK A;  1T8Z A;  1OW7 A;  1EXJ A;  2IDB A;  1L0L J;  2N1T D;  3G4S P;  3GHG B;  4ZKP A;  1RHZ B;  1HTL C;  1KV4 A;  1KYO I;  3Q5S A;  3CCV P;  1S72 P;  1Y47 A;  3H1I E;  1S5L E;  4OH8 B;  4YXW H;  3V5B A;  1H8A A;  1NKN A;  2MKV A;  2O1K A;  3L4F A;  5CJ4 A;  1JY3 O;  2KZI A;  3D70 A;  3KZI E;  2ZYD A;  3H1I G;  3RBZ A;  3NXS A;  3G3Z A;  1HJB A;  1USE A;  1SQP J;  4IFF A;  5B5E H;  1K9M Q;  1SQX D;  4DZO A;  1N73 C;  1GL2 D;  3L75 E;  3D71 A;  1ZR4 A;  1NTK J;  5DJT B;  1IFD A;  4DT0 A;  2GUV A;  4Y28 J;  2E42 A;  4GKG A;  2ZYG A;  1DIP A;  2R5B A;  1NTZ J;  1NAF A;  3ABV C;  1JY2 O;  3AE5 C;  1PGQ A;  1JM0 A;  1KYO D;  5GTI H;  1LT9 C;  3B8E B;  1TU3 F;  2QM8 A;  1JO5 A;  5APW A;  3HE4 A;  1JNM A;  1IFM A;  2A45 H;  3VMX A;  1QX8 A;  2QIW A;  1GK4 A;  1L4A A;  4EYY Q;  4EI2 A;  4N78 E;  1LNQ A;  4W80 A;  1HF9 A;  1VQ8 P;  3E7K A;  3HE4 B;  1VDF A;  2W90 A;  4L75 A;  4ASW A;  4HJG H;  1VF5 D;  1L4A B;  3M91 A;  2AEJ A;  1MZ9 A;  2IPP A;  2WSF J;  4JQ0 D;  4DOJ A;  4WY4 A;  3U1C A;  5TIS E;  1PL5 A;  2OTJ P;  4RKU J;  4OGQ D;  3P8C E;  2HOD A;  3VTP C;  2ZJS E;  1ZLL A;  4XA4 A;  2BEZ F;  3H1H E;  1EC5 A;  4WY4 B;  1U7M A;  3M06 A;  1OW8 A;  1NTM G;  3TF5 A;  5KAF E;  2HOD B;  3ITK A;  1AA0 A;  2BCC J;  3G9R A;  1L0L E;  2WSS H;  1N7S C;  3HD7 D;  1AV1 A;  1KQG B;  3MD0 A;  2E5Y A;  3LW5 J;  3B5N D;  2JKV A;  2QE7 H;  2A45 I;  3SSU A;  4EDF A;  2QJP C;  1OZH A;  2QA4 P;  1CI6 A;  5APS A;  2Z5H A;  2C9N Y;  5AVV B;  2OYH A;  3QWO C;  4DCK A;  5AW5 B;  2IZ1 A;  1L0L G;  1CI6 B;  1SQQ E;  2ZYA A;  1IJD B;  3FXD A;  1T3J A;  1SQV K;  4GOD A;  2OYH B;  1GW4 A;  1FE6 A;  4TT3 H;  1SQP E;  1LTB C;  1KFN A;  2E76 C;  1K04 A;  4HB1 A;  3NTN A;  3JSV C;  1L0N J;  5KLI B;  4H13 B;  3S1K A; 
#chains in the Genus database with same CATH homology
 3KZI E;  1S5L E;  3A0H E;  3A0B E;  3WU2 E;  1W5C E;  4UB6 E;  5KAI E;  4IL6 E;  5GTH E;  5KAF E;  5B5E E;  5E79 E;  5H2F E;  4UB8 E;  5TIS E;  4PJ0 E;  5GTI E;  5B66 E;  2AXT E;  3JCU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...