5GTHE

Native xfel structure of photosystem ii (dark dataset)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
total genus 19
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5gthE00
5TISE 4UB8E 5GTIE 5H2FE 3WU2E 3KZIE 4UB6E 4IL6E 3A0HE 2AXTE 5GTHE 4PJ0E 5E79E 5B5EE 5B66E 5KAIE 3JCUE 1W5CE 3A0BE 1S5LE 5KAFE
chains in the Genus database with same CATH superfamily
1MKMA 1JY3N 1VF5C 3BCCJ 2IBZI 2OYIB 4IFDK 2XNDH 3CXHD 3V4QA 3N4XA 3CPWO 4CPGA 2P58A 1EDKA 2J5UA 4I1LA 1FDMA 4H13B 2QM8A 2Y9YA 3AE5C 3V6IA 5H2FE 5DJTB 3KPEA 3B71A 3HE4A 5AVTB 5AW9B 3CLQA 4W7ZA 1PGPA 4A7PA 1KZUB 1MV8A 5AVXB 2HPCA 2LR2A 3H1KE 2ZVNB 2CPSA 3FWNA 3HTKB 3CX5D 1EZVD 1JCDA 2O01N 4KHXA 2K9JB 3EFGA 2OARA 3Q1MA 2ITAA 2KSEA 1P84D 4IL6X 4H44D 1ZR4A 4M3LA 4WY4D 1HJBA 2ZAEB 1NTKJ 1PPJD 4UB8H 4UB6H 4HB1A 3A3YB 3AEEC 3H1HJ 1QL2A 2OYIC 4W80A 4BRYB 3B8EB 3SWYA 4DOJA 5AW7B 1GDTA 4YTPC 1YTZI 5CBNA 1PGOA 4H13C 4DT0A 3P8MC 1JY3P 3L71E 1KC8Q 3PLNA 2YKOA 5CCGD 2KZIA 4JF7A 1J1EC 1L0LD 1NTZE 5APUA 1N73B 3MTUE 2JWAA 2OTLP 3AE8C 5AW5B 1X9VA 1KFMA 4GDOA 1UIXA 2G8YA 4C46A 1XTGB 1M8OB 2KI7B 1KILD 1AA0A 1RE3C 3A0HE 1OX3A 1LWUA 1PL5A 2R5DA 1M1KQ 4HKZH 1SQVE 3W68A 1MZ9A 1Y8AA 2Y0CA 1LT1A 3JCUE 3FXDA 1OVVA 1FZFA 3QWOC 1SFCB 3IAOA 3ZDMA 2QEXP 1H8AA 3TYYA 5CMZA 2E5YA 3V2NA 1H89A 3VMXA 2YIUB 4N78D 1LTSC 1FZGA 3H1KJ 3VP9A 1KYOI 3E7KA 1PP9E 4U3FG 4U3FD 2N1TD 2D2CB 2NRGA 1JTHB 2K88A 4ZKPA 3V4WA 4R4LA 3M0DC 3L71G 2JDIH 3D70A 1EXIA 3TGUD 1JY2N 1RQVA 1R8EA 4XA4A 1GW3A 2XNXA 2I8DA 1ZMEC 2YMKA 3Q2YA 3AE7C 2K37A 1SQVG 2O3JA 2R3CA 1NGMB 4OH8B 5GTIE 2AXTH 3M9BA 1CZQA 1DX7A 1L0LK 1N86A 1S9KE 4OVNF 1NTZJ 2YIUC 2DW3A 5APWA 3USSA 1LTIC 1N7SB 5APXA 1HGZA 4EOTA 2GUVA 2J59M 2IFNA 1S3JA 1D7MA 2R5BA 3RL0B 1NTMD 3H32A 2LXBA 1SQVJ 2AEMA 1ZN5A 3TK1A 3A0BH 2KXPB 3CXHH 3CCJP 4C7RA 2W6BA 1CW5A 1L4AD 1JY3O 3MP7B 1JMBA 1SQBE 1GMJA 3M9HA 2XU6A 2NZ2A 1IC2A 1Q81Q 2KS1A 2M0BA 1NOHA 3M9QA 1PP9J 2R32A 1KORA 1GL2D 1DEBA 3RK3D 1RF1A 3W67A 1HJ0A 1SLQA 1HGVA 1Z56A 2H43A 3WUTA 1T8ZA 1HVVA 2BEZF 1JY2P 2NPSA 4DJGA 3HD7B 4L75A 2J58A 1LT9B 5CCHC 3D6YA 1BDDA 1OMIA 1N7SC 3MIWA 2IBZG 2ZJSE 4PD4E 2E43A 2QA4P 3RL0C 1LGHB 2ZYGA 1M1JB 2H8PD 2FXOA 1KMIZ 2WPVB 3ABVC 1OZHA 3PP5A 2KLUA 3WU2H 3O8ZA 2JO1A 3U1CA 1USEA 1JUNA 1K9MQ 2RKLA 5AW0B 4D6TJ 1JB0J 2ZYDA 1K73Q 3CCUP 2Y0EA 1SQQE 1NTMK 2OYHC 1URQA 2C0XA 2FXPA 3BVHA 3AE3C 1EDJA 3A2AA 3PHLA 1NKZB 5B66E 1QX8A 3F89A 2FYUE 1X79B 1SQBJ 2V7QJ 1FJPA 1M1JC 2QJYC 1SQPE 1JO5A 4EYYQ 2QG4A 3AEBC 1VQKP 1IJDB 2YXRB 1BE3D 2C0WA 2ZT9D 4NPEA 1FZAA 5AW1B 2Q7CA 3AEDC 1FOSE 5B5EH 1FZCB 5CJ0A 2BCCD 4ZMDA 2WSEH 3AEFC 2XKMA 2A45G 1RE4C 5EFWB 2GM4A 1BCCD 3LW5H 5KKZC 1DD4A 4GIFA 1VQ9P 1NH4A 3KZIE 2KNCB 3HTKA 1KV4A 4H44C 2K9YA 3H1LD 4WY4C 2K9JA 2O01H 1L0NE 3OW2O 2WT7A 1E79H 1M7LA 1NU1D 1SVFA 1JY2O 2WSCH 4L76A 2FYUG 1H0TB 3JCUH 1BGYG 1BGYD 2B89A 3BCCG 3C8VA 4WB4A 2B9BA 4BRYA 1SQQJ 4N3YB 2IZ0A 2HLOA 3CWBE 1SQPG 4PJ0H 1CI6B 3H6PA 5CCGC 1MUUA 1M56D 1EZVE 2WPQA 2SPZA 2FYUJ 3M0DA 1NJIQ 3L73E 4NPDA 1N73A 4O9BA 1A02J 3II6A 4Y28J 1PPJE 2N9BA 1IO4A 1SQPJ 2PGDA 1AFOA 1SQXE 1S1CX 1K05A 3VMAA 4H0LB 2WTYA 1SFCA 4BXLA 1NTKG 1NTKD 2E76D 3C9IA 4OWFA 1HH0A 3LIEA 3SSUA 1J1EB 3H25A 2W6AA 2E75D 2WSSH 3H1HG 3H1HD 2IDBA 2N1TC 2JEEA 2IZ1A 5GTIH 4L73A 4XE5B 1AVYA 3FX0A 4EDFA 2Z4EA 2FYZA 5AVWB 2LXCB 2H88C 2QRXA 3IN6A 4GOEA 3CWBG 4PV1D 1DEEG 3SFEC 1M90Q 3O6QB 3LIDA 1L0NJ 1JTHA 1E5WA 1NU1K 2IX7C 3FGAD 5AVQB 2QE7H 3L36A 3RK2D 3WUUA 3CMEP 3VOPA 3L72E 3L73G 1KQLA 1N8RQ 2RH0A 3L70E 1U7JA 2KP8A 5APYA 3RK3B 1EC5A 1N2DC 2FFDC 1G1IA 1R5LA 5KTBA 3CWBJ 1VQNP 1S5LE 4OGQD 1W2EA 1RF0A 3HUSB 4H0LC 1SQXG 3T97B 1FC2C 1KB9E 1FDOA 4EI2A 1OVRA 1FS0E 1VQ4P 5CHXA 3HRNA 4GOFA 3L73J 2A45I 3H1JE 1Y47A 2NPSD 1FDIA 3H1KG 2WVRA 2Z5HA 1PFIA 1WT6A 2KYVA 3TGUE 3GF3A 2W27A 2QM7A 1WRGA 3PRJA 2W83C 1SQXJ 5KLVE 2W90A 1VPCA 3AE6C 1NTKK 5AVVB 3V2PA 1VF5D 1OW7A 4U7JA 3C1LA 3B4SA 1Q86Q 4I7ZC 2R3SA 5KAIE 1VQPP 1GL2C 3RK3C 4RJTA 4WWIA 3NXSA 3L4FA 4HJGH 3L70G 1L0LJ 5TISE 2W8ZA 2Q3EA 3HUSC 2A45H 3B5NB 1YJWP 2P2UA 1Q7YQ 4AUWA 1YJNP 3EQ2A 2E74D 1W2BO 1LNQA 1ZR2A 3L71D 3HD7A 1OIPA 4IFMA 1URQD 1LT9A 1G1JA 1NTZG 1QEXA 3ITKA 1IFJA 3L72J 3L74E 2HODB 1YITP 3L70J 3CCRP 3MHVA 3AE2C 3AE4C 3CCVP 4RESB 1PGJA 4NPFX 1SQVD 3QH9A 1KQSO 1KYOH 5KLVG 4YXWH 2YKPA 2JP3A 2KK7A 3RK3E 1KQFB 2PFXA 3L75E 1OXZA 1RHZB 1GK6A 4QMAA 4D6TE 3AE1C 3G6EP 5DJUB 3L35A 2B87A 2O1JA 3H1JJ 1RE4A 4H13D 5GTHH 3B5NC 1PP9G 1PP9D 3TGUJ 3V2RA 3AEGC 1KFNA 3F5HA 3N7NA 2VRSA 2QJPB 5KLVJ 1MFZA 1BSNA 1ZRTD 3KZIH 1UIIA 4UB8E 1M57D 1IFDA 3H1IE 3G9RA 2WSFJ 3L74G 4I6MC 2CK3H 5BU5A 1TU3F 3TF5A 2ZT9C 2OYHB 1HBWA 1VL2A 3OAKA 2H7HA 2OQQA 2AEJA 2Q3IA 2JR8A 1FZCA 2JWDA 5KJ7C 1S9KD 1OFCX 4D6TG 1VQMP 2IBZD 2WQYC 3L74J 2JKVA 3CCEP 5E79H 2P7JA 2QJYB 1SQVK 3E1IA 2QJPC 1LWUC 2GUSA 2UWJE 3HE5B 3D71A 3L75J 2G3AA 5L8RJ 1BDCA 1YYCA 5M1BA 3TDKA 2WZ7A 1SQBG 3CD6P 2YNYA 2PP6A 3CC7P 1OWAA 5KKZB 5H2FH 3RBXA 1SFCD 2OYOA 3CMAP 4H44B 3G4SP 1BCCE 4WY4B 1GK4A 4GT1A 1RY3A 1CI6A 3P8CE 1QGKB 2FXMA 5KAFE 1KB9I 3H1IJ 2IFMA 2A06E 2D2CD 5C39A 5APQA 1LTJB 1EXJA 2OYIA 3KHUA 1Q82Q 2POHA 3OJAB 1VDFA 2E42A 3FXEA 2IYPA 2KS1B 1QLED 1YQ3C 2E76C 1FAVA 2AXTE 1X8YA 5AVUB 1G2CB 1JMMA 1S5LH 2C9LY 2ZXEB 2K1AA 1KILB 5KLIC 1KB9H 3GHGB 3IFMA 1KN7A 1QVFO 4N6JA 1SQQG 2FBWC 1RE3A 1WMKA 5CCHD 2P10A 3A0BE 4IOIH 3O6QA 1JCCA 3CXHE 1EDIA 3RK2C 1VQLP 3VN0A 2M3EA 1HTLC 3VYIA 1Q2NA 3A0HH 1VQOP 3WMM0 3A5TA 2KLVA 1SQBK 2FYUD 1AJYA 2I1JA 4KT0J 3G3ZA 1NAYA 1LTJC 3BCCD 4OGQC 2N1TB 1KYOD 3VTPC 3R2PA 1J2JB 1DD3A 3VP8A 2WPSA 1YTZT 1SQPD 2P1JA 3IR9A 1LJ2A 4WBAA 2I1KA 5AVYB 1BCCJ 2QIWA 2QSIA 3HUSA 4RO0A 2HR3A 5KAIH 3CX5E 2W6JH 1RF1C 1U7MA 2OGUA 2Z5IA 5TISH 1U57A 4TLFA 3NTNA 2YO3A 2FYNB 1P84E 4L74A 3CL3D 1IFPA 3VMZA 1KILC 1FBMA 1NAFA 3GHGC 1JNMA 4AQRD 3CC4P 1RQUA 4XFJA 3HD7D 4EIJA 2WPRA 3SWKA 2FFDB 1VQ7P 4R4MA 4JYBA 2OTJP 1L0NG 1L0ND 5BU8B 1AQTA 4K3AA 3WU2E 4IL6E 3TNUB 1S2EA 4JPZB 3Q5RA 1LP1B 1EQ7A 1NWQA 4B86A 1ZXGA 4KJMA 1NKNA 1H88A 1VQ5P 1T2KD 4ASVA 4DZOA 3D6ZA 1AV1A 1SQQK 1L0LE 3S4RA 3SWFA 2M5AB 2XZRA 1AQ5A 3NFQA 2R44A 2E74C 3GF7A 2CPBA 3CWBD 3B5NA 4C7NB 4HH2A 3WUVA 1W5CE 2KIKA 2QVAA 1URQC 1L4AB 1ZP0C 1KILE 2Y0DA 1EZVG 1FU1A 2FYNC 2ZXXA 2FYUK 2L5GB 2XDJA 3I5CA 2WT7B 3L73D 4Y99C 4I7ZB 2HODA 2O1KA 1GL2B 4PD4I 5AW8B 1SQPK 3IF4A 1PPJG 3BRVB 1HUCA 4N78E 3AEAC 2V7QH 1GU4A 4K35A 2KSJA 1SQXD 1PIXA 1LTBC 3I55P 1JOCA 3MUDC 4U3FE 2XV5A 5B5EE 4JYCA 1HWTC 2E5TA 1QL1A 5CCHA 5APSA 1XTCC 1R5SA 3Q3DA 5TJHA 1N7SA 3P32A 5KJ7A 1SP4A 3GG2A 1K8AQ 2YO2A 3H1KD 1L0LG 1IFIA 3AECC 3EFFK 1L4AC 1L0NK 1USDA 4PD4H 1QVGO 1VQ8P 1S5LX 1DIPA 1L2PA 1VQ6P 1J1DB 1JM0A 1GZLA 4ZKUA 3PH0A 1FJKA 1IK7A 3CCMP 2C9NY 1N7LA 3L72G 3L72D 2FY8A 3HE4B 3L70D 1YBKA 3R4YA 1YI2P 4GODA 1HF9A 1GTWA 2OYHA 4PJ0E 5AVRB 2HPCB 2ZYAA 1NTME 1KB9D 2WITA 4BWNA 1YJ9P 1NTZD 3CI9A 2ZFCA 2ZVOB 5AW4B 1AVOA 3SFDC 1SS1A 1IZNB 1ZRTE 5B66H 3H1JG 3H1JD 1N73C 2B88A 5KAFH 4MN4C 2IYOA 1JEKA 1M1JA 3PJSK 3TGUG 4IFFA 2Q1KA 5APTA 1X22A 2ZT9B 1SQXK 1EDLA 4GKGA 3BATA 2Q5UA 1ZV8A 2M3BA 5KLVD 1J1DC 4U3FJ 1LTAC 2MJZA 1Y9BA 3CXHI 3TSIA 1GW4A 3HE5A 4JBZA 2WSEJ 2AXCA 5AVZB 5AW3B 1PZQA 1SFCC 3LW5J 3L71J 1KD1Q 2PAJA 3M06A 3M91A 4H0LD 2HG5D 1NYHA 2Y9ZA 4AYCA 2IBZE 2O01J 3JC22 1KQGB 3FWLA 4WY4A 1PV3A 2YXQB 4ZNCA 2BEQD 3UIAA 5APVA 1LWUB 3GW6A 3CX5I 1EZVI 2D2CC 3MGNA 1DH3A 4UB6E 1NTMG 1FZEA 2WSCJ 1P84I 3L74D 1IFNA 1LTJA 5K5GB 3S1KA 3VMYA 3CCQP 3NMDA 5BVZA 1FZBA 5CCGA 4LGDE 1RF0C 1ZLLA 1NTMJ 3AE9C 1NTZK 3L75D 1G2CA 3L75G 1T3JA 1S72P 2HYNA 2Q9IA 3JSVC 4D6TD 1OW8A 2H89C 2KUBA 2YMYA 3CX5H 2L91A 4I2LC 4LLHA 1NHLA 2PRRA 3M0AA 1KILA 3A7OA 3GHGA 2KNCA 1P84H 4LC1A 2YKQA 1IFMA 1MFTA 5KLVK 5AVSB 3RGUA 2E76B 3RL0g 2E75B 1YHQP 1GU5A 2V4HA 3CCLP 1BE3E 1CSBA 4DCKA 3H1IG 3H1ID 1SQBD 1YIJP 1A02F 3PTZA 2FKWB 1H0TA 4IL6H 2BCCE 5KLIB 2N1TA 2K3RA 4PV1B 1NVOA 3CC2P 3KDPB 2B87B 3EWKA 2QJKB 2AEFA 3Q5PA 3L37A 2WMMA 2BASA 3U1AA 1FOSF 3RK2B 3H32B 3H1LE 1OW6A 3B5ND 3RBZA 3HD7C 2JJLA 2OTKE 2N9YB 1NU1E 1LT9C 4PD4D 3U59A 4OGQB 1BGYE 2RMZA 3CCSP 2FFDA 3BCCE 3OA7A 3V5BA 1KYOE 3GMAA 4TT3H 2KOGA 3E1RA 2E75C 1RF1B 1T2KC 1YQ4C 3MUDA 3TNUA 5AW6B 1KTMA 1LP1A 1T3UA 4ASWA 1T6AA 2NPSB 1BE3G 1OVUA 4PV1C 5GTHE 2RN0A 1S4XA 1SQQD 2BCCG 2M5AA 3S9OA 1PGQA 2QJKC 5CJ4A 4YPCA 5CBOA 4C7NA 1NO4A 1BCCG 5AW2B 1K04A 1LTGC 2KZJA 1N7SD 3KQGA 4WVZA 1VF5B 5KJ7D 2HFED 1L4AA 3P8CD 3K5BA 3H1LG 3RL0D 3BASA 1IK9A 1BE3J 2A06G 2A06D 2MKVA 4HYTB 1LTTC 1NTKE 1NU1G 2BCCJ 2LKMA 3GLMA 1GL2A 3Q5SA 1GD2E 1ZW0A 3H1HE 2E74B 4JQ0D 4Z1MH 3MZWB 1RH5B 1Q90D 2WSFH 1BSHA 3T97A 1ZOYC 3KXDA 1URQB 2WWWA 3I56P 2KB7P 4YXDC 3H1LJ 3BRTB 2NPSC 3MD0A 4RKUJ 2GA1A 2M8RA 3G71P 1X0TA 5E79E 4Y99B 2IPPA 1FZCC 1NU1J 3V2QA 2P67A 3KYQA 3P7KA 1FE6A 4W7YA 2Q6QA 1BGYJ
chains in the Genus database with same CATH topology
5TISE 4UB8E 5GTIE 5H2FE 3WU2E 3KZIE 4UB6E 4IL6E 3A0HE 2AXTE 5GTHE 4PJ0E 5E79E 5B5EE 5B66E 5KAIE 3JCUE 1W5CE 3A0BE 1S5LE 5KAFE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TIS E;  4UB8 E;  5GTI E;  5H2F E;  3WU2 E;  3KZI E;  4UB6 E;  4IL6 E;  3A0H E;  2AXT E;  5GTH E;  4PJ0 E;  5E79 E;  5B5E E;  5B66 E;  5KAI E;  3JCU E;  1W5C E;  3A0B E;  1S5L E;  5KAF E; 
#chains in the Genus database with same CATH topology
 1MKM A;  1JY3 N;  1VF5 C;  3BCC J;  2IBZ I;  2OYI B;  4IFD K;  2XND H;  3CXH D;  3V4Q A;  3N4X A;  3CPW O;  4CPG A;  2P58 A;  1EDK A;  2J5U A;  4I1L A;  1FDM A;  4H13 B;  2QM8 A;  2Y9Y A;  3AE5 C;  3V6I A;  5H2F E;  5DJT B;  3KPE A;  3B71 A;  3HE4 A;  5AVT B;  5AW9 B;  3CLQ A;  4W7Z A;  1PGP A;  4A7P A;  1KZU B;  1MV8 A;  5AVX B;  2HPC A;  2LR2 A;  3H1K E;  2ZVN B;  2CPS A;  3FWN A;  3HTK B;  3CX5 D;  1EZV D;  1JCD A;  2O01 N;  4KHX A;  2K9J B;  3EFG A;  2OAR A;  3Q1M A;  2ITA A;  2KSE A;  1P84 D;  4IL6 X;  4H44 D;  1ZR4 A;  4M3L A;  4WY4 D;  1HJB A;  2ZAE B;  1NTK J;  1PPJ D;  4UB8 H;  4UB6 H;  4HB1 A;  3A3Y B;  3AEE C;  3H1H J;  1QL2 A;  2OYI C;  4W80 A;  4BRY B;  3B8E B;  3SWY A;  4DOJ A;  5AW7 B;  1GDT A;  4YTP C;  1YTZ I;  5CBN A;  1PGO A;  4H13 C;  4DT0 A;  3P8M C;  1JY3 P;  3L71 E;  1KC8 Q;  3PLN A;  2YKO A;  5CCG D;  2KZI A;  4JF7 A;  1J1E C;  1L0L D;  1NTZ E;  5APU A;  1N73 B;  3MTU E;  2JWA A;  2OTL P;  3AE8 C;  5AW5 B;  1X9V A;  1KFM A;  4GDO A;  1UIX A;  2G8Y A;  4C46 A;  1XTG B;  1M8O B;  2KI7 B;  1KIL D;  1AA0 A;  1RE3 C;  3A0H E;  1OX3 A;  1LWU A;  1PL5 A;  2R5D A;  1M1K Q;  4HKZ H;  1SQV E;  3W68 A;  1MZ9 A;  1Y8A A;  2Y0C A;  1LT1 A;  3JCU E;  3FXD A;  1OVV A;  1FZF A;  3QWO C;  1SFC B;  3IAO A;  3ZDM A;  2QEX P;  1H8A A;  3TYY A;  5CMZ A;  2E5Y A;  3V2N A;  1H89 A;  3VMX A;  2YIU B;  4N78 D;  1LTS C;  1FZG A;  3H1K J;  3VP9 A;  1KYO I;  3E7K A;  1PP9 E;  4U3F G;  4U3F D;  2N1T D;  2D2C B;  2NRG A;  1JTH B;  2K88 A;  4ZKP A;  3V4W A;  4R4L A;  3M0D C;  3L71 G;  2JDI H;  3D70 A;  1EXI A;  3TGU D;  1JY2 N;  1RQV A;  1R8E A;  4XA4 A;  1GW3 A;  2XNX A;  2I8D A;  1ZME C;  2YMK A;  3Q2Y A;  3AE7 C;  2K37 A;  1SQV G;  2O3J A;  2R3C A;  1NGM B;  4OH8 B;  5GTI E;  2AXT H;  3M9B A;  1CZQ A;  1DX7 A;  1L0L K;  1N86 A;  1S9K E;  4OVN F;  1NTZ J;  2YIU C;  2DW3 A;  5APW A;  3USS A;  1LTI C;  1N7S B;  5APX A;  1HGZ A;  4EOT A;  2GUV A;  2J59 M;  2IFN A;  1S3J A;  1D7M A;  2R5B A;  3RL0 B;  1NTM D;  3H32 A;  2LXB A;  1SQV J;  2AEM A;  1ZN5 A;  3TK1 A;  3A0B H;  2KXP B;  3CXH H;  3CCJ P;  4C7R A;  2W6B A;  1CW5 A;  1L4A D;  1JY3 O;  3MP7 B;  1JMB A;  1SQB E;  1GMJ A;  3M9H A;  2XU6 A;  2NZ2 A;  1IC2 A;  1Q81 Q;  2KS1 A;  2M0B A;  1NOH A;  3M9Q A;  1PP9 J;  2R32 A;  1KOR A;  1GL2 D;  1DEB A;  3RK3 D;  1RF1 A;  3W67 A;  1HJ0 A;  1SLQ A;  1HGV A;  1Z56 A;  2H43 A;  3WUT A;  1T8Z A;  1HVV A;  2BEZ F;  1JY2 P;  2NPS A;  4DJG A;  3HD7 B;  4L75 A;  2J58 A;  1LT9 B;  5CCH C;  3D6Y A;  1BDD A;  1OMI A;  1N7S C;  3MIW A;  2IBZ G;  2ZJS E;  4PD4 E;  2E43 A;  2QA4 P;  3RL0 C;  1LGH B;  2ZYG A;  1M1J B;  2H8P D;  2FXO A;  1KMI Z;  2WPV B;  3ABV C;  1OZH A;  3PP5 A;  2KLU A;  3WU2 H;  3O8Z A;  2JO1 A;  3U1C A;  1USE A;  1JUN A;  1K9M Q;  2RKL A;  5AW0 B;  4D6T J;  1JB0 J;  2ZYD A;  1K73 Q;  3CCU P;  2Y0E A;  1SQQ E;  1NTM K;  2OYH C;  1URQ A;  2C0X A;  2FXP A;  3BVH A;  3AE3 C;  1EDJ A;  3A2A A;  3PHL A;  1NKZ B;  5B66 E;  1QX8 A;  3F89 A;  2FYU E;  1X79 B;  1SQB J;  2V7Q J;  1FJP A;  1M1J C;  2QJY C;  1SQP E;  1JO5 A;  4EYY Q;  2QG4 A;  3AEB C;  1VQK P;  1IJD B;  2YXR B;  1BE3 D;  2C0W A;  2ZT9 D;  4NPE A;  1FZA A;  5AW1 B;  2Q7C A;  3AED C;  1FOS E;  5B5E H;  1FZC B;  5CJ0 A;  2BCC D;  4ZMD A;  2WSE H;  3AEF C;  2XKM A;  2A45 G;  1RE4 C;  5EFW B;  2GM4 A;  1BCC D;  3LW5 H;  5KKZ C;  1DD4 A;  4GIF A;  1VQ9 P;  1NH4 A;  3KZI E;  2KNC B;  3HTK A;  1KV4 A;  4H44 C;  2K9Y A;  3H1L D;  4WY4 C;  2K9J A;  2O01 H;  1L0N E;  3OW2 O;  2WT7 A;  1E79 H;  1M7L A;  1NU1 D;  1SVF A;  1JY2 O;  2WSC H;  4L76 A;  2FYU G;  1H0T B;  3JCU H;  1BGY G;  1BGY D;  2B89 A;  3BCC G;  3C8V A;  4WB4 A;  2B9B A;  4BRY A;  1SQQ J;  4N3Y B;  2IZ0 A;  2HLO A;  3CWB E;  1SQP G;  4PJ0 H;  1CI6 B;  3H6P A;  5CCG C;  1MUU A;  1M56 D;  1EZV E;  2WPQ A;  2SPZ A;  2FYU J;  3M0D A;  1NJI Q;  3L73 E;  4NPD A;  1N73 A;  4O9B A;  1A02 J;  3II6 A;  4Y28 J;  1PPJ E;  2N9B A;  1IO4 A;  1SQP J;  2PGD A;  1AFO A;  1SQX E;  1S1C X;  1K05 A;  3VMA A;  4H0L B;  2WTY A;  1SFC A;  4BXL A;  1NTK G;  1NTK D;  2E76 D;  3C9I A;  4OWF A;  1HH0 A;  3LIE A;  3SSU A;  1J1E B;  3H25 A;  2W6A A;  2E75 D;  2WSS H;  3H1H G;  3H1H D;  2IDB A;  2N1T C;  2JEE A;  2IZ1 A;  5GTI H;  4L73 A;  4XE5 B;  1AVY A;  3FX0 A;  4EDF A;  2Z4E A;  2FYZ A;  5AVW B;  2LXC B;  2H88 C;  2QRX A;  3IN6 A;  4GOE A;  3CWB G;  4PV1 D;  1DEE G;  3SFE C;  1M90 Q;  3O6Q B;  3LID A;  1L0N J;  1JTH A;  1E5W A;  1NU1 K;  2IX7 C;  3FGA D;  5AVQ B;  2QE7 H;  3L36 A;  3RK2 D;  3WUU A;  3CME P;  3VOP A;  3L72 E;  3L73 G;  1KQL A;  1N8R Q;  2RH0 A;  3L70 E;  1U7J A;  2KP8 A;  5APY A;  3RK3 B;  1EC5 A;  1N2D C;  2FFD C;  1G1I A;  1R5L A;  5KTB A;  3CWB J;  1VQN P;  1S5L E;  4OGQ D;  1W2E A;  1RF0 A;  3HUS B;  4H0L C;  1SQX G;  3T97 B;  1FC2 C;  1KB9 E;  1FDO A;  4EI2 A;  1OVR A;  1FS0 E;  1VQ4 P;  5CHX A;  3HRN A;  4GOF A;  3L73 J;  2A45 I;  3H1J E;  1Y47 A;  2NPS D;  1FDI A;  3H1K G;  2WVR A;  2Z5H A;  1PFI A;  1WT6 A;  2KYV A;  3TGU E;  3GF3 A;  2W27 A;  2QM7 A;  1WRG A;  3PRJ A;  2W83 C;  1SQX J;  5KLV E;  2W90 A;  1VPC A;  3AE6 C;  1NTK K;  5AVV B;  3V2P A;  1VF5 D;  1OW7 A;  4U7J A;  3C1L A;  3B4S A;  1Q86 Q;  4I7Z C;  2R3S A;  5KAI E;  1VQP P;  1GL2 C;  3RK3 C;  4RJT A;  4WWI A;  3NXS A;  3L4F A;  4HJG H;  3L70 G;  1L0L J;  5TIS E;  2W8Z A;  2Q3E A;  3HUS C;  2A45 H;  3B5N B;  1YJW P;  2P2U A;  1Q7Y Q;  4AUW A;  1YJN P;  3EQ2 A;  2E74 D;  1W2B O;  1LNQ A;  1ZR2 A;  3L71 D;  3HD7 A;  1OIP A;  4IFM A;  1URQ D;  1LT9 A;  1G1J A;  1NTZ G;  1QEX A;  3ITK A;  1IFJ A;  3L72 J;  3L74 E;  2HOD B;  1YIT P;  3L70 J;  3CCR P;  3MHV A;  3AE2 C;  3AE4 C;  3CCV P;  4RES B;  1PGJ A;  4NPF X;  1SQV D;  3QH9 A;  1KQS O;  1KYO H;  5KLV G;  4YXW H;  2YKP A;  2JP3 A;  2KK7 A;  3RK3 E;  1KQF B;  2PFX A;  3L75 E;  1OXZ A;  1RHZ B;  1GK6 A;  4QMA A;  4D6T E;  3AE1 C;  3G6E P;  5DJU B;  3L35 A;  2B87 A;  2O1J A;  3H1J J;  1RE4 A;  4H13 D;  5GTH H;  3B5N C;  1PP9 G;  1PP9 D;  3TGU J;  3V2R A;  3AEG C;  1KFN A;  3F5H A;  3N7N A;  2VRS A;  2QJP B;  5KLV J;  1MFZ A;  1BSN A;  1ZRT D;  3KZI H;  1UII A;  4UB8 E;  1M57 D;  1IFD A;  3H1I E;  3G9R A;  2WSF J;  3L74 G;  4I6M C;  2CK3 H;  5BU5 A;  1TU3 F;  3TF5 A;  2ZT9 C;  2OYH B;  1HBW A;  1VL2 A;  3OAK A;  2H7H A;  2OQQ A;  2AEJ A;  2Q3I A;  2JR8 A;  1FZC A;  2JWD A;  5KJ7 C;  1S9K D;  1OFC X;  4D6T G;  1VQM P;  2IBZ D;  2WQY C;  3L74 J;  2JKV A;  3CCE P;  5E79 H;  2P7J A;  2QJY B;  1SQV K;  3E1I A;  2QJP C;  1LWU C;  2GUS A;  2UWJ E;  3HE5 B;  3D71 A;  3L75 J;  2G3A A;  5L8R J;  1BDC A;  1YYC A;  5M1B A;  3TDK A;  2WZ7 A;  1SQB G;  3CD6 P;  2YNY A;  2PP6 A;  3CC7 P;  1OWA A;  5KKZ B;  5H2F H;  3RBX A;  1SFC D;  2OYO A;  3CMA P;  4H44 B;  3G4S P;  1BCC E;  4WY4 B;  1GK4 A;  4GT1 A;  1RY3 A;  1CI6 A;  3P8C E;  1QGK B;  2FXM A;  5KAF E;  1KB9 I;  3H1I J;  2IFM A;  2A06 E;  2D2C D;  5C39 A;  5APQ A;  1LTJ B;  1EXJ A;  2OYI A;  3KHU A;  1Q82 Q;  2POH A;  3OJA B;  1VDF A;  2E42 A;  3FXE A;  2IYP A;  2KS1 B;  1QLE D;  1YQ3 C;  2E76 C;  1FAV A;  2AXT E;  1X8Y A;  5AVU B;  1G2C B;  1JMM A;  1S5L H;  2C9L Y;  2ZXE B;  2K1A A;  1KIL B;  5KLI C;  1KB9 H;  3GHG B;  3IFM A;  1KN7 A;  1QVF O;  4N6J A;  1SQQ G;  2FBW C;  1RE3 A;  1WMK A;  5CCH D;  2P10 A;  3A0B E;  4IOI H;  3O6Q A;  1JCC A;  3CXH E;  1EDI A;  3RK2 C;  1VQL P;  3VN0 A;  2M3E A;  1HTL C;  3VYI A;  1Q2N A;  3A0H H;  1VQO P;  3WMM 0;  3A5T A;  2KLV A;  1SQB K;  2FYU D;  1AJY A;  2I1J A;  4KT0 J;  3G3Z A;  1NAY A;  1LTJ C;  3BCC D;  4OGQ C;  2N1T B;  1KYO D;  3VTP C;  3R2P A;  1J2J B;  1DD3 A;  3VP8 A;  2WPS A;  1YTZ T;  1SQP D;  2P1J A;  3IR9 A;  1LJ2 A;  4WBA A;  2I1K A;  5AVY B;  1BCC J;  2QIW A;  2QSI A;  3HUS A;  4RO0 A;  2HR3 A;  5KAI H;  3CX5 E;  2W6J H;  1RF1 C;  1U7M A;  2OGU A;  2Z5I A;  5TIS H;  1U57 A;  4TLF A;  3NTN A;  2YO3 A;  2FYN B;  1P84 E;  4L74 A;  3CL3 D;  1IFP A;  3VMZ A;  1KIL C;  1FBM A;  1NAF A;  3GHG C;  1JNM A;  4AQR D;  3CC4 P;  1RQU A;  4XFJ A;  3HD7 D;  4EIJ A;  2WPR A;  3SWK A;  2FFD B;  1VQ7 P;  4R4M A;  4JYB A;  2OTJ P;  1L0N G;  1L0N D;  5BU8 B;  1AQT A;  4K3A A;  3WU2 E;  4IL6 E;  3TNU B;  1S2E A;  4JPZ B;  3Q5R A;  1LP1 B;  1EQ7 A;  1NWQ A;  4B86 A;  1ZXG A;  4KJM A;  1NKN A;  1H88 A;  1VQ5 P;  1T2K D;  4ASV A;  4DZO A;  3D6Z A;  1AV1 A;  1SQQ K;  1L0L E;  3S4R A;  3SWF A;  2M5A B;  2XZR A;  1AQ5 A;  3NFQ A;  2R44 A;  2E74 C;  3GF7 A;  2CPB A;  3CWB D;  3B5N A;  4C7N B;  4HH2 A;  3WUV A;  1W5C E;  2KIK A;  2QVA A;  1URQ C;  1L4A B;  1ZP0 C;  1KIL E;  2Y0D A;  1EZV G;  1FU1 A;  2FYN C;  2ZXX A;  2FYU K;  2L5G B;  2XDJ A;  3I5C A;  2WT7 B;  3L73 D;  4Y99 C;  4I7Z B;  2HOD A;  2O1K A;  1GL2 B;  4PD4 I;  5AW8 B;  1SQP K;  3IF4 A;  1PPJ G;  3BRV B;  1HUC A;  4N78 E;  3AEA C;  2V7Q H;  1GU4 A;  4K35 A;  2KSJ A;  1SQX D;  1PIX A;  1LTB C;  3I55 P;  1JOC A;  3MUD C;  4U3F E;  2XV5 A;  5B5E E;  4JYC A;  1HWT C;  2E5T A;  1QL1 A;  5CCH A;  5APS A;  1XTC C;  1R5S A;  3Q3D A;  5TJH A;  1N7S A;  3P32 A;  5KJ7 A;  1SP4 A;  3GG2 A;  1K8A Q;  2YO2 A;  3H1K D;  1L0L G;  1IFI A;  3AEC C;  3EFF K;  1L4A C;  1L0N K;  1USD A;  4PD4 H;  1QVG O;  1VQ8 P;  1S5L X;  1DIP A;  1L2P A;  1VQ6 P;  1J1D B;  1JM0 A;  1GZL A;  4ZKU A;  3PH0 A;  1FJK A;  1IK7 A;  3CCM P;  2C9N Y;  1N7L A;  3L72 G;  3L72 D;  2FY8 A;  3HE4 B;  3L70 D;  1YBK A;  3R4Y A;  1YI2 P;  4GOD A;  1HF9 A;  1GTW A;  2OYH A;  4PJ0 E;  5AVR B;  2HPC B;  2ZYA A;  1NTM E;  1KB9 D;  2WIT A;  4BWN A;  1YJ9 P;  1NTZ D;  3CI9 A;  2ZFC A;  2ZVO B;  5AW4 B;  1AVO A;  3SFD C;  1SS1 A;  1IZN B;  1ZRT E;  5B66 H;  3H1J G;  3H1J D;  1N73 C;  2B88 A;  5KAF H;  4MN4 C;  2IYO A;  1JEK A;  1M1J A;  3PJS K;  3TGU G;  4IFF A;  2Q1K A;  5APT A;  1X22 A;  2ZT9 B;  1SQX K;  1EDL A;  4GKG A;  3BAT A;  2Q5U A;  1ZV8 A;  2M3B A;  5KLV D;  1J1D C;  4U3F J;  1LTA C;  2MJZ A;  1Y9B A;  3CXH I;  3TSI A;  1GW4 A;  3HE5 A;  4JBZ A;  2WSE J;  2AXC A;  5AVZ B;  5AW3 B;  1PZQ A;  1SFC C;  3LW5 J;  3L71 J;  1KD1 Q;  2PAJ A;  3M06 A;  3M91 A;  4H0L D;  2HG5 D;  1NYH A;  2Y9Z A;  4AYC A;  2IBZ E;  2O01 J;  3JC2 2;  1KQG B;  3FWL A;  4WY4 A;  1PV3 A;  2YXQ B;  4ZNC A;  2BEQ D;  3UIA A;  5APV A;  1LWU B;  3GW6 A;  3CX5 I;  1EZV I;  2D2C C;  3MGN A;  1DH3 A;  4UB6 E;  1NTM G;  1FZE A;  2WSC J;  1P84 I;  3L74 D;  1IFN A;  1LTJ A;  5K5G B;  3S1K A;  3VMY A;  3CCQ P;  3NMD A;  5BVZ A;  1FZB A;  5CCG A;  4LGD E;  1RF0 C;  1ZLL A;  1NTM J;  3AE9 C;  1NTZ K;  3L75 D;  1G2C A;  3L75 G;  1T3J A;  1S72 P;  2HYN A;  2Q9I A;  3JSV C;  4D6T D;  1OW8 A;  2H89 C;  2KUB A;  2YMY A;  3CX5 H;  2L91 A;  4I2L C;  4LLH A;  1NHL A;  2PRR A;  3M0A A;  1KIL A;  3A7O A;  3GHG A;  2KNC A;  1P84 H;  4LC1 A;  2YKQ A;  1IFM A;  1MFT A;  5KLV K;  5AVS B;  3RGU A;  2E76 B;  3RL0 g;  2E75 B;  1YHQ P;  1GU5 A;  2V4H A;  3CCL P;  1BE3 E;  1CSB A;  4DCK A;  3H1I G;  3H1I D;  1SQB D;  1YIJ P;  1A02 F;  3PTZ A;  2FKW B;  1H0T A;  4IL6 H;  2BCC E;  5KLI B;  2N1T A;  2K3R A;  4PV1 B;  1NVO A;  3CC2 P;  3KDP B;  2B87 B;  3EWK A;  2QJK B;  2AEF A;  3Q5P A;  3L37 A;  2WMM A;  2BAS A;  3U1A A;  1FOS F;  3RK2 B;  3H32 B;  3H1L E;  1OW6 A;  3B5N D;  3RBZ A;  3HD7 C;  2JJL A;  2OTK E;  2N9Y B;  1NU1 E;  1LT9 C;  4PD4 D;  3U59 A;  4OGQ B;  1BGY E;  2RMZ A;  3CCS P;  2FFD A;  3BCC E;  3OA7 A;  3V5B A;  1KYO E;  3GMA A;  4TT3 H;  2KOG A;  3E1R A;  2E75 C;  1RF1 B;  1T2K C;  1YQ4 C;  3MUD A;  3TNU A;  5AW6 B;  1KTM A;  1LP1 A;  1T3U A;  4ASW A;  1T6A A;  2NPS B;  1BE3 G;  1OVU A;  4PV1 C;  5GTH E;  2RN0 A;  1S4X A;  1SQQ D;  2BCC G;  2M5A A;  3S9O A;  1PGQ A;  2QJK C;  5CJ4 A;  4YPC A;  5CBO A;  4C7N A;  1NO4 A;  1BCC G;  5AW2 B;  1K04 A;  1LTG C;  2KZJ A;  1N7S D;  3KQG A;  4WVZ A;  1VF5 B;  5KJ7 D;  2HFE D;  1L4A A;  3P8C D;  3K5B A;  3H1L G;  3RL0 D;  3BAS A;  1IK9 A;  1BE3 J;  2A06 G;  2A06 D;  2MKV A;  4HYT B;  1LTT C;  1NTK E;  1NU1 G;  2BCC J;  2LKM A;  3GLM A;  1GL2 A;  3Q5S A;  1GD2 E;  1ZW0 A;  3H1H E;  2E74 B;  4JQ0 D;  4Z1M H;  3MZW B;  1RH5 B;  1Q90 D;  2WSF H;  1BSH A;  3T97 A;  1ZOY C;  3KXD A;  1URQ B;  2WWW A;  3I56 P;  2KB7 P;  4YXD C;  3H1L J;  3BRT B;  2NPS C;  3MD0 A;  4RKU J;  2GA1 A;  2M8R A;  3G71 P;  1X0T A;  5E79 E;  4Y99 B;  2IPP A;  1FZC C;  1NU1 J;  3V2Q A;  2P67 A;  3KYQ A;  3P7K A;  1FE6 A;  4W7Y A;  2Q6Q A;  1BGY J; 
#chains in the Genus database with same CATH homology
 5TIS E;  4UB8 E;  5GTI E;  5H2F E;  3WU2 E;  3KZI E;  4UB6 E;  4IL6 E;  3A0H E;  2AXT E;  5GTH E;  4PJ0 E;  5E79 E;  5B5E E;  5B66 E;  5KAI E;  3JCU E;  1W5C E;  3A0B E;  1S5L E;  5KAF E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...