5GTHE

Native xfel structure of photosystem ii (dark dataset)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1
total genus 19
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5gthE00
5E79E 5B5EE 5GTIE 5TISE 5H2FE 3A0HE 5B66E 3WU2E 5KAIE 3JCUE 4PJ0E 2AXTE 1W5CE 4UB6E 5KAFE 3KZIE 1S5LE 3A0BE 4IL6E 5GTHE 4UB8E
chains in the Genus database with same CATH superfamily
1D7MA 1L0NE 4I7ZB 3B8EB 3S9OA 1YHQP 4RO0A 2PRRA 1AVYA 1S1CX 5B5EE 1YBKA 5GTIE 3CLQA 3CWBE 3FWLA 1RQUA 1G2CB 2ZFCA 3Q5SA 2GA1A 2IX7C 1NTMD 1QVGO 1PFIA 2E5TA 2HFED 5KAIE 2WSFH 3CCLP 2WQYC 3U59A 3L70J 2ZT9D 4PV1C 4YXWH 3L75E 1DEBA 2JJLA 3L74D 2FKWB 2PAJA 1VQLP 4I6MC 5AW6B 4ZKPA 3B5NC 5KLIB 4ZMDA 3L72G 3P8MC 1R8EA 2KP8A 1S72P 3ITKA 3L73J 4OH8B 2OGUA 5B5EH 5GTHE 2JEEA 2FYNB 2OARA 1CZQA 1BDDA 2P1JA 4WB4A 1LP1B 2WSSH 3GF3A 1NVOA 4W7YA 1Q81Q 4LGDE 3L71D 5AW1B 2V4HA 1SFCA 2R32A 3L71G 3PLNA 1SLQA 2FYZA 2QE7H 2W6JH 1FC2C 3CC2P 3VP8A 1Q86Q 1JM0A 1FZAA 1P84D 1GL2D 1HGZA 1YQ3C 2FYUE 3E1RA 3HE4B 3L73D 3D6ZA 1SFCD 5CCGA 3D70A 1XTGB 3WUVA 2Q5UA 2Y9ZA 3VTPC 2KS1A 2YO2A 2BASA 3BASA 3H1HD 3MP7B 2OYHA 3H1IE 1H0TB 3RGUA 2R5BA 3FX0A 5EFWB 1EZVI 3HD7D 2IZ1A 4D6TJ 3CI9A 5APQA 4C7NB 3L36A 1FZCA 2R44A 3PH0A 3JC22 3GHGA 3L70D 3TNUA 1M1JB 1LTJC 1AA0A 4L76A 1J1EB 3Q3DA 1SQVG 2Q7CA 2FYUK 3CL3D 4HJGH 2IBZE 3VMAA 1KTMA 2WZ7A 5GTIH 2KUBA 1UIIA 2W6AA 3H1IG 1EZVE 3VYIA 1NU1E 4QMAA 3WUTA 3P8CE 1T2KC 1RF0A 2H7HA 2WVRA 1BDCA 4PV1D 3UIAA 4H13C 1PZQA 1RF1A 1JCCA 4OGQB 2W8ZA 2FXPA 1N73C 1VPCA 2R5DA 4W80A 2FY8A 1SQVE 2N9BA 4Z1MH 2CPBA 2K37A 4Y28J 1GMJA 2PP6A 3H1LE 2RH0A 2G3AA 2ZYGA 1N7SB 5H2FE 1JY2N 1PGQA 1GL2B 1ZN5A 2LXBA 3A0HE 1EZVG 2W6BA 1SQBK 3AEEC 3H32B 3HTKA 3K5BA 3A7OA 2IFNA 4HKZH 2N1TD 1SQXJ 4BRYB 1QX8A 1RE3A 1DX7A 1HJBA 3CCSP 3AEFC 2FYUD 1JTHA 1PGOA 1VF5B 2RKLA 1SFCC 2WPSA 3HRNA 3SWYA 1N73B 5KJ7C 3CCUP 2KXPB 2A45I 1KQFB 1OFCX 1L0NK 2QSIA 3CXHD 1PP9D 2J59M 2XNDH 3H1KE 4D6TE 1SQXG 1G1JA 1NTKK 4EOTA 1LTSC 2KOGA 2OYHC 5L8RJ 1GU5A 5KAIH 3F89A 4I1LA 2HR3A 5CCGC 4IFMA 5C39A 5KLVK 2P7JA 3MGNA 2LKMA 3NTNA 4WBAA 3CD6P 1URQB 1KILE 1Y47A 1ZLLA 4W7ZA 1M7LA 3L72E 1S5LX 4DJGA 5CMZA 3KZIH 4BWNA 3A0BH 3CCMP 3PTZA 3D71A 1OX3A 1T3UA 2QJPB 1S4XA 3CCJP 3SWKA 3CC4P 3V5BA 1CW5A 3SFDC 2ZXXA 3JCUE 3L71E 1EXIA 2YMKA 3B5NA 4H44C 2FFDB 1IFIA 3BRVB 1LJ2A 3AEGC 1Q2NA 1JY2P 2KLVA 3L73E 2N9YB 3R2PA 3RL0B 3H1ID 1L4AD 3HUSB 2IYPA 3CWBJ 3B5ND 2E75B 1OWAA 2JP3A 2LR2A 3KHUA 4IL6E 2P2UA 4UB6H 4UB8H 3B71A 3TSIA 1W2BO 4AUWA 1T3JA 3FGAD 1R5LA 1KN7A 3HE4A 4R4MA 2FYNC 1MFZA 2A06G 4WY4A 3AE7C 4N78D 3TF5A 3AE1C 1JUNA 2E5YA 5AW4B 2KB7P 1KFMA 1EXJA 1EDKA 1DD3A 1L0LG 3G6EP 2OTJP 2KZIA 3L75D 4L74A 3CXHI 2IBZG 1WRGA 2E76C 5DJTB 1HUCA 2NPSA 1NU1G 2LXCB 4GOFA 3H1KJ 4JBZA 4N3YB 3CPWO 1JMBA 3Q5PA 2NZ2A 2Q6QA 3H6PA 3L74E 2A06E 1GD2E 2Y0DA 3SSUA 5K5GB 3OW2O 2PGDA 3L74J 1H88A 1JOCA 1HGVA 1OVUA 4LLHA 4WVZA 1FZFA 4MN4C 2WTYA 2E43A 1LTJA 2M5AB 3CX5H 3LIDA 5KAFE 1G2CA 1KYOI 2M8RA 2Y9YA 2FFDC 2E76B 3G3ZA 3RK2D 1NKZB 1KB9E 2E74D 2XU6A 1KB9D 3CCEP 2YIUB 2AXTH 1K04A 2C0XA 4RJTA 3G4SP 1DH3A 1HH0A 1OVVA 2P58A 3I55P 1FU1A 2D2CD 1ZRTD 1PL5A 3G9RA 1AVOA 4C7RA 2ZT9C 4ZKUA 3GF7A 1JEKA 1GL2A 1SQBE 4GIFA 1E5WA 1MZ9A 2FXMA 2J58A 2QJKC 3L72J 2CPSA 3OJAB 4H0LC 5TISE 1SQXE 2YKQA 1IFPA 1PPJE 1BE3D 1YJNP 1NGMB 2B87B 1VQMP 1LTGC 3RL0C 3WMM0 2XDJA 2YKPA 2IDBA 3B5NB 4CPGA 2JWDA 3AEAC 4JF7A 2KNCA 3HUSC 3L72D 1SQQD 1NTKD 2FXOA 2ITAA 3RBXA 1YI2P 2BCCJ 1IZNB 1QEXA 3H1LG 4DZOA 3H1LJ 1J2JB 2BCCE 2G8YA 3ZDMA 1GK4A 2C9NY 2NRGA 4GKGA 1L4AC 2BCCD 3RK3E 2K88A 4KHXA 2NPSC 1VQKP 1M90Q 3MUDA 4WY4B 1VL2A 4DOJA 2CK3H 3TGUJ 3HD7B 5KJ7D 5AVZB 2Q3EA 1AV1A 2KSJA 3RK3B 1GU4A 2Z4EA 2HODB 1KC8Q 3U1CA 3GG2A 1Y9BA 3Q5RA 3H25A 5CJ0A 1NTMJ 3BVHA 1HWTC 1OVRA 2KIKA 3CXHE 1QL2A 2JDIH 3HE5A 4U3FD 5E79H 5AVXB 4D6TG 3H1IJ 3MHVA 3P7KA 5AVWB 2ZVOB 2FFDA 4OVNF 1NHLA 2WSCJ 3CCVP 1H8AA 4NPDA 1N73A 4RESB 1LNQA 2Y0CA 3A2AA 5BU5A 4EYYQ 1KV4A 1RE4C 3AE4C 4Y99B 2JO1A 3TK1A 1OMIA 4IOIH 2AXCA 2W83C 2XNXA 4HH2A 1S9KD 1SQBJ 1DIPA 1BGYJ 1BGYG 5APXA 4UB8E 2E75C 3R4YA 1Z56A 4TLFA 1N8RQ 4KT0J 1NO4A 3N7NA 3M0AA 3V2QA 4DCKA 1GDTA 1N2DC 1U7MA 1M1JC 1NTKE 3A3YB 3PHLA 4LC1A 3ABVC 2M0BA 1S3JA 3QWOC 1U57A 1PP9G 2P10A 2JWAA 1OW8A 3GW6A 3AECC 1G1IA 2NPSB 2GUVA 2QA4P 1SQPJ 1SQPG 2A45G 1KYOE 3HD7C 3M9BA 3CC7P 3O6QA 2YIUC 3AE5C 4WWIA 5AVQB 1JTHB 1T8ZA 5GTHH 5AW9B 1VQNP 3NFQA 3GMAA 4JQ0D 3KYQA 1KFNA 1CSBA 1X0TA 2Z5IA 3Q2YA 3KXDA 4NPEA 1LWUB 3HTKB 4H0LB 3BCCJ 4B86A 5CCGD 1EDJA 1N7SA 1SQBG 2IBZI 1L0LE 2W27A 1LTJB 2M5AA 1T2KD 1AJYA 2OYHB 5AVTB 1JO5A 1WT6A 2GM4A 1FBMA 1SVFA 4ZNCA 2QJKB 4I2LC 4U7JA 1LTTC 1VQ5P 1HVVA 3C1LA 5KKZB 3W67A 3CMEP 3CCQP 4PV1B 1SFCB 3RL0g 4C46A 1TU3F 1LTAC 2KK7A 1QLED 2M3EA 2J5UA 1GTWA 2AEJA 2WPVB 2MKVA 4IFFA 1VQ9P 1S5LH 5KLVG 1VQPP 4PD4I 2BEZF 2QVAA 3AE6C 1BCCE 1SQQK 1KB9H 2K9JA 2V7QJ 3EFGA 3OAKA 4NPFX 2B88A 1BCCD 1NTKJ 3A0HH 3AE2C 2E76D 1GL2C 1L4AB 2I8DA 4PJ0E 5APTA 1AQTA 1FZBA 1USEA 5AVYB 1P84H 3LIEA 3H1JJ 4H13D 1JY3N 1PP9J 5AW0B 3H1HG 3W68A 1KD1Q 1LGHB 2KS1B 3HUSA 5AW3B 3RK3C 1H0TA 2E74C 3SWFA 1NTMG 1ZXGA 3QH9A 3PP5A 3G71P 4K35A 1A02J 4XFJA 1PGPA 5AW5B 1VQ7P 1IC2A 3MUDC 1M57D 1VF5D 1IO4A 2QM7A 2DW3A 3USSA 1IJDB 2OTLP 4N78E 1ZOYC 1SQQJ 3V2RA 3O6QB 1XTCC 2QM8A 4YPCA 5BVZA 1VDFA 1NTZK 3NXSA 1M8OB 1S9KE 1KILA 2BCCG 3F5HA 3H1KG 1LT1A 2AEFA 3RK3D 2I1KA 1SP4A 2ZJSE 1K9MQ 3VN0A 2AEMA 2QJPC 1KILD 1NTKG 3TGUD 1W2EA 3VMZA 3IN6A 1IFJA 1FDOA 2H8PD 1LTIC 1OW6A 1ZMEC 1OXZA 2KZJA 1MV8A 1S5LE 3MIWA 1X22A 4PD4D 5AVVB 1QL1A 1YJWP 4PD4E 5CCHD 3M91A 3S1KA 2OTKE 3PRJA 1RE4A 2OYIA 4L73A 4EDFA 1RHZB 1UIXA 2QRXA 2ZYAA 1FAVA 1IFDA 4N6JA 4C7NA 3L37A 1T6AA 3L75G 1L0LD 3WUUA 3PJSK 3H1HJ 4GOEA 1NTZG 4EIJA 3IR9A 2IPPA 3V4WA 2N1TA 3H1KD 3BCCD 3II6A 1EDLA 1BGYD 1HF9A 3GLMA 3RL0D 1BGYE 3HD7A 1JNMA 5APUA 1SQQE 1X79B 2IFMA 3V2NA 2WSEH 1CI6B 1NWQA 1W5CE 2E74B 4I7ZC 3V6IA 1SQPD 3LW5J 3B4SA 2YXQB 1EC5A 3CX5I 3RK2C 3T97B 2WPRA 1SQPE 1KYOH 1IFNA 3KDPB 2QEXP 1IK7A 4RKUJ 2N1TB 1HTLC 1OZHA 2KNCB 2NPSD 2IZ0A 2K3RA 3GHGB 3TNUB 1JY3P 1IK9A 1KILC 2L5GB 1ZR4A 1L0LK 2JR8A 3I5CA 3L74G 4PJ0H 1N7SD 1A02F 2B87A 3L35A 1R5SA 1NTZJ 3MTUE 1BSNA 2Y0EA 4H44B 3SFEC 1Q82Q 3M9HA 3D6YA 2K1AA 4GT1A 2O3JA 5AVRB 1KQSO 1Y8AA 1QVFO 1BSHA 1NTME 2WT7A 4OGQC 5M1BA 1PPJD 3L4FA 2KYVA 2L91A 3WU2H 2KLUA 5APVA 1FZEA 3TYYA 1SQXD 1LT9B 1YQ4C 2WSFJ 3C9IA 5AVUB 4Y99C 5KTBA 1NU1D 2WSEJ 3NMDA 3A5TA 1SQVJ 1URQC 1QGKB 2IBZD 3KPEA 2D2CC 2M3BA 2R3SA 1DEEG 4TT3H 2OYIC 1ZW0A 5TISH 3AEDC 4HB1A 3CXHH 3FXDA 1VF5C 1MKMA 5KLVE 4H0LD 1SS1A 1BCCG 1PPJG 1BCCJ 3E7KA 2A06D 1EZVD 1FDIA 1P84E 2E42A 3BRTB 1FDMA 3TGUG 2QJYB 2RN0A 1N7LA 2FYUJ 4AQRD 3H1HE 5APYA 4WY4C 1J1DC 5TJHA 4EI2A 2HYNA 4IFDK 1FS0E 1OIPA 2YMYA 2RMZA 2O01H 3CMAP 3RK2B 1RH5B 4AYCA 1ZR2A 1FZCB 3O8ZA 5CCHC 1BE3G 3CWBD 1L4AA 3H1JD 1K73Q 3H1JG 3CCRP 1SQBD 5AW7B 3VOPA 5CHXA 1NTZE 1FJPA 2A45H 3AEBC 3JSVC 2WWWA 1LT9C 4XA4A 1GW4A 1L0LJ 5CBOA 2VRSA 2HPCA 2XKMA 4GODA 1SQPK 1YTZT 4L75A 1JMMA 2D2CB 5APSA 1OW7A 3M9QA 3L71J 1NAYA 4DT0A 2O1JA 4JYCA 1S2EA 1LWUC 2POHA 5CBNA 1URQD 1USDA 1NKNA 3IAOA 1FZGA 1M56D 1L0NJ 3L73G 2UWJE 4IL6H 5E79E 3VMYA 1YTZI 1L2PA 5KLVD 4IL6X 1URQA 3U1AA 3VP9A 1HJ0A 3M06A 4JYBA 4O9BA 1K05A 1Q7YQ 2YO3A 2N1TC 1HBWA 3C8VA 2V7QH 1KYOD 1FJKA 1SQVK 2ZXEB 3EQ2A 2WSCH 4OGQD 5B66E 5KLVJ 1ZP0C 1VQ8P 1PV3A 1FOSF 1KMIZ 2E75D 1LTBC 1RF0C 3S4RA 3M0DA 1L0NG 2QG4A 1AQ5A 2OYIB 3T97A 1PP9E 3AE8C 2Q9IA 3BCCG 3L75J 1NU1K 5DJUB 2QIWA 3KZIE 4R4LA 3VMXA 2IYOA 2OQQA 1IFMA 2WT7B 1VQ6P 1JB0J 2W90A 1KORA 5CCHA 1NAFA 1SQQG 1GZLA 3BATA 4GDOA 4D6TD 4BRYA 2PFXA 2Q1KA 3H32A 2Z5HA 2R3CA 2XZRA 1RE3C 2O01N 3MZWB 2C0WA 2FBWC 2C9LY 3MD0A 5KLIC 3BCCE 5AVSB 5KKZC 2YNYA 5APWA 1FOSE 1SQXK 1KQGB 4YXDC 3RBZA 1SQVD 5KJ7A 5BU8B 2B9BA 2KSEA 3E1IA 4ASVA 4ASWA 1VQ4P 1N86A 3IF4A 1NU1J 2BEQD 4PD4H 1WMKA 3V2PA 1KB9I 1YIJP 1RF1B 1FZCC 1H89A 1ZV8A 1NYHA 2K9YA 2SPZA 3V4QA 1LT9A 2B89A 4YTPC 4OWFA 1E79H 4A7PA 3H1LD 1P84I 2Q3IA 3JCUH 1J1DB 1X9VA 2FYUG 2QJYC 3I56P 5CJ4A 3P32A 2GUSA 2WMMA 5H2FH 1JCDA 3HE5B 1NJIQ 1U7JA 2H88C 2OYOA 3A0BE 2HPCB 1KQLA 1M1JA 2ZVNB 4H13B 4BXLA 2H43A 3IFMA 1RF1C 2HODA 1BE3J 4H44D 2KI7B 3AE3C 2WPQA 1NTZD 1BE3E 3FXEA 3H1JE 5AW8B 1YITP 2K9JB 3L70E 4M3LA 1Q90D 2ZYDA 1X8YA 1JY3O 1J1EC 3KQGA 1PIXA 2O1KA 4KJMA 3AE9C 4U3FG 4WY4D 3FWNA 3N4XA 1JY2O 2H89C 3M0DC 2O01J 5AW2B 3WU2E 1CI6A 1FE6A 1EQ7A 1K8AQ 1GW3A 2HG5D 3TGUE 1MUUA 2AXTE 3P8CD 1KZUB 1LP1A 1PGJA 1EDIA 1NTMK 2XV5A 1M1KQ 1NOHA 2MJZA 1DD4A 2ZT9B 3L70G 3LW5H 4UB6E 2JKVA 4JPZB 2WITA 4U3FJ 2ZAEB 1MFTA 3CWBG 3GHGC 4XE5B 1KILB 1RQVA 2I1JA 2YXRB 2YKOA 3CX5E 4U3FE 2P67A 5KAFH 2HLOA 1YJ9P 1AFOA 5B66H 3CX5D 3EFFK 1N7SC 1LWUA 3OA7A 1YYCA 3EWKA 1RY3A 4HYTB 1GK6A 1NH4A 1ZRTE 4K3AA 3TDKA 3Q1MA 1L0ND 1VQOP
chains in the Genus database with same CATH topology
5E79E 5B5EE 5GTIE 5TISE 5H2FE 3A0HE 5B66E 3WU2E 5KAIE 3JCUE 4PJ0E 2AXTE 1W5CE 4UB6E 5KAFE 3KZIE 1S5LE 3A0BE 4IL6E 5GTHE 4UB8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E79 E;  5B5E E;  5GTI E;  5TIS E;  5H2F E;  3A0H E;  5B66 E;  3WU2 E;  5KAI E;  3JCU E;  4PJ0 E;  2AXT E;  1W5C E;  4UB6 E;  5KAF E;  3KZI E;  1S5L E;  3A0B E;  4IL6 E;  5GTH E;  4UB8 E; 
#chains in the Genus database with same CATH topology
 1D7M A;  1L0N E;  4I7Z B;  3B8E B;  3S9O A;  1YHQ P;  4RO0 A;  2PRR A;  1AVY A;  1S1C X;  5B5E E;  1YBK A;  5GTI E;  3CLQ A;  3CWB E;  3FWL A;  1RQU A;  1G2C B;  2ZFC A;  3Q5S A;  2GA1 A;  2IX7 C;  1NTM D;  1QVG O;  1PFI A;  2E5T A;  2HFE D;  5KAI E;  2WSF H;  3CCL P;  2WQY C;  3U59 A;  3L70 J;  2ZT9 D;  4PV1 C;  4YXW H;  3L75 E;  1DEB A;  2JJL A;  3L74 D;  2FKW B;  2PAJ A;  1VQL P;  4I6M C;  5AW6 B;  4ZKP A;  3B5N C;  5KLI B;  4ZMD A;  3L72 G;  3P8M C;  1R8E A;  2KP8 A;  1S72 P;  3ITK A;  3L73 J;  4OH8 B;  2OGU A;  5B5E H;  5GTH E;  2JEE A;  2FYN B;  2OAR A;  1CZQ A;  1BDD A;  2P1J A;  4WB4 A;  1LP1 B;  2WSS H;  3GF3 A;  1NVO A;  4W7Y A;  1Q81 Q;  4LGD E;  3L71 D;  5AW1 B;  2V4H A;  1SFC A;  2R32 A;  3L71 G;  3PLN A;  1SLQ A;  2FYZ A;  2QE7 H;  2W6J H;  1FC2 C;  3CC2 P;  3VP8 A;  1Q86 Q;  1JM0 A;  1FZA A;  1P84 D;  1GL2 D;  1HGZ A;  1YQ3 C;  2FYU E;  3E1R A;  3HE4 B;  3L73 D;  3D6Z A;  1SFC D;  5CCG A;  3D70 A;  1XTG B;  3WUV A;  2Q5U A;  2Y9Z A;  3VTP C;  2KS1 A;  2YO2 A;  2BAS A;  3BAS A;  3H1H D;  3MP7 B;  2OYH A;  3H1I E;  1H0T B;  3RGU A;  2R5B A;  3FX0 A;  5EFW B;  1EZV I;  3HD7 D;  2IZ1 A;  4D6T J;  3CI9 A;  5APQ A;  4C7N B;  3L36 A;  1FZC A;  2R44 A;  3PH0 A;  3JC2 2;  3GHG A;  3L70 D;  3TNU A;  1M1J B;  1LTJ C;  1AA0 A;  4L76 A;  1J1E B;  3Q3D A;  1SQV G;  2Q7C A;  2FYU K;  3CL3 D;  4HJG H;  2IBZ E;  3VMA A;  1KTM A;  2WZ7 A;  5GTI H;  2KUB A;  1UII A;  2W6A A;  3H1I G;  1EZV E;  3VYI A;  1NU1 E;  4QMA A;  3WUT A;  3P8C E;  1T2K C;  1RF0 A;  2H7H A;  2WVR A;  1BDC A;  4PV1 D;  3UIA A;  4H13 C;  1PZQ A;  1RF1 A;  1JCC A;  4OGQ B;  2W8Z A;  2FXP A;  1N73 C;  1VPC A;  2R5D A;  4W80 A;  2FY8 A;  1SQV E;  2N9B A;  4Z1M H;  2CPB A;  2K37 A;  4Y28 J;  1GMJ A;  2PP6 A;  3H1L E;  2RH0 A;  2G3A A;  2ZYG A;  1N7S B;  5H2F E;  1JY2 N;  1PGQ A;  1GL2 B;  1ZN5 A;  2LXB A;  3A0H E;  1EZV G;  2W6B A;  1SQB K;  3AEE C;  3H32 B;  3HTK A;  3K5B A;  3A7O A;  2IFN A;  4HKZ H;  2N1T D;  1SQX J;  4BRY B;  1QX8 A;  1RE3 A;  1DX7 A;  1HJB A;  3CCS P;  3AEF C;  2FYU D;  1JTH A;  1PGO A;  1VF5 B;  2RKL A;  1SFC C;  2WPS A;  3HRN A;  3SWY A;  1N73 B;  5KJ7 C;  3CCU P;  2KXP B;  2A45 I;  1KQF B;  1OFC X;  1L0N K;  2QSI A;  3CXH D;  1PP9 D;  2J59 M;  2XND H;  3H1K E;  4D6T E;  1SQX G;  1G1J A;  1NTK K;  4EOT A;  1LTS C;  2KOG A;  2OYH C;  5L8R J;  1GU5 A;  5KAI H;  3F89 A;  4I1L A;  2HR3 A;  5CCG C;  4IFM A;  5C39 A;  5KLV K;  2P7J A;  3MGN A;  2LKM A;  3NTN A;  4WBA A;  3CD6 P;  1URQ B;  1KIL E;  1Y47 A;  1ZLL A;  4W7Z A;  1M7L A;  3L72 E;  1S5L X;  4DJG A;  5CMZ A;  3KZI H;  4BWN A;  3A0B H;  3CCM P;  3PTZ A;  3D71 A;  1OX3 A;  1T3U A;  2QJP B;  1S4X A;  3CCJ P;  3SWK A;  3CC4 P;  3V5B A;  1CW5 A;  3SFD C;  2ZXX A;  3JCU E;  3L71 E;  1EXI A;  2YMK A;  3B5N A;  4H44 C;  2FFD B;  1IFI A;  3BRV B;  1LJ2 A;  3AEG C;  1Q2N A;  1JY2 P;  2KLV A;  3L73 E;  2N9Y B;  3R2P A;  3RL0 B;  3H1I D;  1L4A D;  3HUS B;  2IYP A;  3CWB J;  3B5N D;  2E75 B;  1OWA A;  2JP3 A;  2LR2 A;  3KHU A;  4IL6 E;  2P2U A;  4UB6 H;  4UB8 H;  3B71 A;  3TSI A;  1W2B O;  4AUW A;  1T3J A;  3FGA D;  1R5L A;  1KN7 A;  3HE4 A;  4R4M A;  2FYN C;  1MFZ A;  2A06 G;  4WY4 A;  3AE7 C;  4N78 D;  3TF5 A;  3AE1 C;  1JUN A;  2E5Y A;  5AW4 B;  2KB7 P;  1KFM A;  1EXJ A;  1EDK A;  1DD3 A;  1L0L G;  3G6E P;  2OTJ P;  2KZI A;  3L75 D;  4L74 A;  3CXH I;  2IBZ G;  1WRG A;  2E76 C;  5DJT B;  1HUC A;  2NPS A;  1NU1 G;  2LXC B;  4GOF A;  3H1K J;  4JBZ A;  4N3Y B;  3CPW O;  1JMB A;  3Q5P A;  2NZ2 A;  2Q6Q A;  3H6P A;  3L74 E;  2A06 E;  1GD2 E;  2Y0D A;  3SSU A;  5K5G B;  3OW2 O;  2PGD A;  3L74 J;  1H88 A;  1JOC A;  1HGV A;  1OVU A;  4LLH A;  4WVZ A;  1FZF A;  4MN4 C;  2WTY A;  2E43 A;  1LTJ A;  2M5A B;  3CX5 H;  3LID A;  5KAF E;  1G2C A;  1KYO I;  2M8R A;  2Y9Y A;  2FFD C;  2E76 B;  3G3Z A;  3RK2 D;  1NKZ B;  1KB9 E;  2E74 D;  2XU6 A;  1KB9 D;  3CCE P;  2YIU B;  2AXT H;  1K04 A;  2C0X A;  4RJT A;  3G4S P;  1DH3 A;  1HH0 A;  1OVV A;  2P58 A;  3I55 P;  1FU1 A;  2D2C D;  1ZRT D;  1PL5 A;  3G9R A;  1AVO A;  4C7R A;  2ZT9 C;  4ZKU A;  3GF7 A;  1JEK A;  1GL2 A;  1SQB E;  4GIF A;  1E5W A;  1MZ9 A;  2FXM A;  2J58 A;  2QJK C;  3L72 J;  2CPS A;  3OJA B;  4H0L C;  5TIS E;  1SQX E;  2YKQ A;  1IFP A;  1PPJ E;  1BE3 D;  1YJN P;  1NGM B;  2B87 B;  1VQM P;  1LTG C;  3RL0 C;  3WMM 0;  2XDJ A;  2YKP A;  2IDB A;  3B5N B;  4CPG A;  2JWD A;  3AEA C;  4JF7 A;  2KNC A;  3HUS C;  3L72 D;  1SQQ D;  1NTK D;  2FXO A;  2ITA A;  3RBX A;  1YI2 P;  2BCC J;  1IZN B;  1QEX A;  3H1L G;  4DZO A;  3H1L J;  1J2J B;  2BCC E;  2G8Y A;  3ZDM A;  1GK4 A;  2C9N Y;  2NRG A;  4GKG A;  1L4A C;  2BCC D;  3RK3 E;  2K88 A;  4KHX A;  2NPS C;  1VQK P;  1M90 Q;  3MUD A;  4WY4 B;  1VL2 A;  4DOJ A;  2CK3 H;  3TGU J;  3HD7 B;  5KJ7 D;  5AVZ B;  2Q3E A;  1AV1 A;  2KSJ A;  3RK3 B;  1GU4 A;  2Z4E A;  2HOD B;  1KC8 Q;  3U1C A;  3GG2 A;  1Y9B A;  3Q5R A;  3H25 A;  5CJ0 A;  1NTM J;  3BVH A;  1HWT C;  1OVR A;  2KIK A;  3CXH E;  1QL2 A;  2JDI H;  3HE5 A;  4U3F D;  5E79 H;  5AVX B;  4D6T G;  3H1I J;  3MHV A;  3P7K A;  5AVW B;  2ZVO B;  2FFD A;  4OVN F;  1NHL A;  2WSC J;  3CCV P;  1H8A A;  4NPD A;  1N73 A;  4RES B;  1LNQ A;  2Y0C A;  3A2A A;  5BU5 A;  4EYY Q;  1KV4 A;  1RE4 C;  3AE4 C;  4Y99 B;  2JO1 A;  3TK1 A;  1OMI A;  4IOI H;  2AXC A;  2W83 C;  2XNX A;  4HH2 A;  1S9K D;  1SQB J;  1DIP A;  1BGY J;  1BGY G;  5APX A;  4UB8 E;  2E75 C;  3R4Y A;  1Z56 A;  4TLF A;  1N8R Q;  4KT0 J;  1NO4 A;  3N7N A;  3M0A A;  3V2Q A;  4DCK A;  1GDT A;  1N2D C;  1U7M A;  1M1J C;  1NTK E;  3A3Y B;  3PHL A;  4LC1 A;  3ABV C;  2M0B A;  1S3J A;  3QWO C;  1U57 A;  1PP9 G;  2P10 A;  2JWA A;  1OW8 A;  3GW6 A;  3AEC C;  1G1I A;  2NPS B;  2GUV A;  2QA4 P;  1SQP J;  1SQP G;  2A45 G;  1KYO E;  3HD7 C;  3M9B A;  3CC7 P;  3O6Q A;  2YIU C;  3AE5 C;  4WWI A;  5AVQ B;  1JTH B;  1T8Z A;  5GTH H;  5AW9 B;  1VQN P;  3NFQ A;  3GMA A;  4JQ0 D;  3KYQ A;  1KFN A;  1CSB A;  1X0T A;  2Z5I A;  3Q2Y A;  3KXD A;  4NPE A;  1LWU B;  3HTK B;  4H0L B;  3BCC J;  4B86 A;  5CCG D;  1EDJ A;  1N7S A;  1SQB G;  2IBZ I;  1L0L E;  2W27 A;  1LTJ B;  2M5A A;  1T2K D;  1AJY A;  2OYH B;  5AVT B;  1JO5 A;  1WT6 A;  2GM4 A;  1FBM A;  1SVF A;  4ZNC A;  2QJK B;  4I2L C;  4U7J A;  1LTT C;  1VQ5 P;  1HVV A;  3C1L A;  5KKZ B;  3W67 A;  3CME P;  3CCQ P;  4PV1 B;  1SFC B;  3RL0 g;  4C46 A;  1TU3 F;  1LTA C;  2KK7 A;  1QLE D;  2M3E A;  2J5U A;  1GTW A;  2AEJ A;  2WPV B;  2MKV A;  4IFF A;  1VQ9 P;  1S5L H;  5KLV G;  1VQP P;  4PD4 I;  2BEZ F;  2QVA A;  3AE6 C;  1BCC E;  1SQQ K;  1KB9 H;  2K9J A;  2V7Q J;  3EFG A;  3OAK A;  4NPF X;  2B88 A;  1BCC D;  1NTK J;  3A0H H;  3AE2 C;  2E76 D;  1GL2 C;  1L4A B;  2I8D A;  4PJ0 E;  5APT A;  1AQT A;  1FZB A;  1USE A;  5AVY B;  1P84 H;  3LIE A;  3H1J J;  4H13 D;  1JY3 N;  1PP9 J;  5AW0 B;  3H1H G;  3W68 A;  1KD1 Q;  1LGH B;  2KS1 B;  3HUS A;  5AW3 B;  3RK3 C;  1H0T A;  2E74 C;  3SWF A;  1NTM G;  1ZXG A;  3QH9 A;  3PP5 A;  3G71 P;  4K35 A;  1A02 J;  4XFJ A;  1PGP A;  5AW5 B;  1VQ7 P;  1IC2 A;  3MUD C;  1M57 D;  1VF5 D;  1IO4 A;  2QM7 A;  2DW3 A;  3USS A;  1IJD B;  2OTL P;  4N78 E;  1ZOY C;  1SQQ J;  3V2R A;  3O6Q B;  1XTC C;  2QM8 A;  4YPC A;  5BVZ A;  1VDF A;  1NTZ K;  3NXS A;  1M8O B;  1S9K E;  1KIL A;  2BCC G;  3F5H A;  3H1K G;  1LT1 A;  2AEF A;  3RK3 D;  2I1K A;  1SP4 A;  2ZJS E;  1K9M Q;  3VN0 A;  2AEM A;  2QJP C;  1KIL D;  1NTK G;  3TGU D;  1W2E A;  3VMZ A;  3IN6 A;  1IFJ A;  1FDO A;  2H8P D;  1LTI C;  1OW6 A;  1ZME C;  1OXZ A;  2KZJ A;  1MV8 A;  1S5L E;  3MIW A;  1X22 A;  4PD4 D;  5AVV B;  1QL1 A;  1YJW P;  4PD4 E;  5CCH D;  3M91 A;  3S1K A;  2OTK E;  3PRJ A;  1RE4 A;  2OYI A;  4L73 A;  4EDF A;  1RHZ B;  1UIX A;  2QRX A;  2ZYA A;  1FAV A;  1IFD A;  4N6J A;  4C7N A;  3L37 A;  1T6A A;  3L75 G;  1L0L D;  3WUU A;  3PJS K;  3H1H J;  4GOE A;  1NTZ G;  4EIJ A;  3IR9 A;  2IPP A;  3V4W A;  2N1T A;  3H1K D;  3BCC D;  3II6 A;  1EDL A;  1BGY D;  1HF9 A;  3GLM A;  3RL0 D;  1BGY E;  3HD7 A;  1JNM A;  5APU A;  1SQQ E;  1X79 B;  2IFM A;  3V2N A;  2WSE H;  1CI6 B;  1NWQ A;  1W5C E;  2E74 B;  4I7Z C;  3V6I A;  1SQP D;  3LW5 J;  3B4S A;  2YXQ B;  1EC5 A;  3CX5 I;  3RK2 C;  3T97 B;  2WPR A;  1SQP E;  1KYO H;  1IFN A;  3KDP B;  2QEX P;  1IK7 A;  4RKU J;  2N1T B;  1HTL C;  1OZH A;  2KNC B;  2NPS D;  2IZ0 A;  2K3R A;  3GHG B;  3TNU B;  1JY3 P;  1IK9 A;  1KIL C;  2L5G B;  1ZR4 A;  1L0L K;  2JR8 A;  3I5C A;  3L74 G;  4PJ0 H;  1N7S D;  1A02 F;  2B87 A;  3L35 A;  1R5S A;  1NTZ J;  3MTU E;  1BSN A;  2Y0E A;  4H44 B;  3SFE C;  1Q82 Q;  3M9H A;  3D6Y A;  2K1A A;  4GT1 A;  2O3J A;  5AVR B;  1KQS O;  1Y8A A;  1QVF O;  1BSH A;  1NTM E;  2WT7 A;  4OGQ C;  5M1B A;  1PPJ D;  3L4F A;  2KYV A;  2L91 A;  3WU2 H;  2KLU A;  5APV A;  1FZE A;  3TYY A;  1SQX D;  1LT9 B;  1YQ4 C;  2WSF J;  3C9I A;  5AVU B;  4Y99 C;  5KTB A;  1NU1 D;  2WSE J;  3NMD A;  3A5T A;  1SQV J;  1URQ C;  1QGK B;  2IBZ D;  3KPE A;  2D2C C;  2M3B A;  2R3S A;  1DEE G;  4TT3 H;  2OYI C;  1ZW0 A;  5TIS H;  3AED C;  4HB1 A;  3CXH H;  3FXD A;  1VF5 C;  1MKM A;  5KLV E;  4H0L D;  1SS1 A;  1BCC G;  1PPJ G;  1BCC J;  3E7K A;  2A06 D;  1EZV D;  1FDI A;  1P84 E;  2E42 A;  3BRT B;  1FDM A;  3TGU G;  2QJY B;  2RN0 A;  1N7L A;  2FYU J;  4AQR D;  3H1H E;  5APY A;  4WY4 C;  1J1D C;  5TJH A;  4EI2 A;  2HYN A;  4IFD K;  1FS0 E;  1OIP A;  2YMY A;  2RMZ A;  2O01 H;  3CMA P;  3RK2 B;  1RH5 B;  4AYC A;  1ZR2 A;  1FZC B;  3O8Z A;  5CCH C;  1BE3 G;  3CWB D;  1L4A A;  3H1J D;  1K73 Q;  3H1J G;  3CCR P;  1SQB D;  5AW7 B;  3VOP A;  5CHX A;  1NTZ E;  1FJP A;  2A45 H;  3AEB C;  3JSV C;  2WWW A;  1LT9 C;  4XA4 A;  1GW4 A;  1L0L J;  5CBO A;  2VRS A;  2HPC A;  2XKM A;  4GOD A;  1SQP K;  1YTZ T;  4L75 A;  1JMM A;  2D2C B;  5APS A;  1OW7 A;  3M9Q A;  3L71 J;  1NAY A;  4DT0 A;  2O1J A;  4JYC A;  1S2E A;  1LWU C;  2POH A;  5CBN A;  1URQ D;  1USD A;  1NKN A;  3IAO A;  1FZG A;  1M56 D;  1L0N J;  3L73 G;  2UWJ E;  4IL6 H;  5E79 E;  3VMY A;  1YTZ I;  1L2P A;  5KLV D;  4IL6 X;  1URQ A;  3U1A A;  3VP9 A;  1HJ0 A;  3M06 A;  4JYB A;  4O9B A;  1K05 A;  1Q7Y Q;  2YO3 A;  2N1T C;  1HBW A;  3C8V A;  2V7Q H;  1KYO D;  1FJK A;  1SQV K;  2ZXE B;  3EQ2 A;  2WSC H;  4OGQ D;  5B66 E;  5KLV J;  1ZP0 C;  1VQ8 P;  1PV3 A;  1FOS F;  1KMI Z;  2E75 D;  1LTB C;  1RF0 C;  3S4R A;  3M0D A;  1L0N G;  2QG4 A;  1AQ5 A;  2OYI B;  3T97 A;  1PP9 E;  3AE8 C;  2Q9I A;  3BCC G;  3L75 J;  1NU1 K;  5DJU B;  2QIW A;  3KZI E;  4R4L A;  3VMX A;  2IYO A;  2OQQ A;  1IFM A;  2WT7 B;  1VQ6 P;  1JB0 J;  2W90 A;  1KOR A;  5CCH A;  1NAF A;  1SQQ G;  1GZL A;  3BAT A;  4GDO A;  4D6T D;  4BRY A;  2PFX A;  2Q1K A;  3H32 A;  2Z5H A;  2R3C A;  2XZR A;  1RE3 C;  2O01 N;  3MZW B;  2C0W A;  2FBW C;  2C9L Y;  3MD0 A;  5KLI C;  3BCC E;  5AVS B;  5KKZ C;  2YNY A;  5APW A;  1FOS E;  1SQX K;  1KQG B;  4YXD C;  3RBZ A;  1SQV D;  5KJ7 A;  5BU8 B;  2B9B A;  2KSE A;  3E1I A;  4ASV A;  4ASW A;  1VQ4 P;  1N86 A;  3IF4 A;  1NU1 J;  2BEQ D;  4PD4 H;  1WMK A;  3V2P A;  1KB9 I;  1YIJ P;  1RF1 B;  1FZC C;  1H89 A;  1ZV8 A;  1NYH A;  2K9Y A;  2SPZ A;  3V4Q A;  1LT9 A;  2B89 A;  4YTP C;  4OWF A;  1E79 H;  4A7P A;  3H1L D;  1P84 I;  2Q3I A;  3JCU H;  1J1D B;  1X9V A;  2FYU G;  2QJY C;  3I56 P;  5CJ4 A;  3P32 A;  2GUS A;  2WMM A;  5H2F H;  1JCD A;  3HE5 B;  1NJI Q;  1U7J A;  2H88 C;  2OYO A;  3A0B E;  2HPC B;  1KQL A;  1M1J A;  2ZVN B;  4H13 B;  4BXL A;  2H43 A;  3IFM A;  1RF1 C;  2HOD A;  1BE3 J;  4H44 D;  2KI7 B;  3AE3 C;  2WPQ A;  1NTZ D;  1BE3 E;  3FXE A;  3H1J E;  5AW8 B;  1YIT P;  2K9J B;  3L70 E;  4M3L A;  1Q90 D;  2ZYD A;  1X8Y A;  1JY3 O;  1J1E C;  3KQG A;  1PIX A;  2O1K A;  4KJM A;  3AE9 C;  4U3F G;  4WY4 D;  3FWN A;  3N4X A;  1JY2 O;  2H89 C;  3M0D C;  2O01 J;  5AW2 B;  3WU2 E;  1CI6 A;  1FE6 A;  1EQ7 A;  1K8A Q;  1GW3 A;  2HG5 D;  3TGU E;  1MUU A;  2AXT E;  3P8C D;  1KZU B;  1LP1 A;  1PGJ A;  1EDI A;  1NTM K;  2XV5 A;  1M1K Q;  1NOH A;  2MJZ A;  1DD4 A;  2ZT9 B;  3L70 G;  3LW5 H;  4UB6 E;  2JKV A;  4JPZ B;  2WIT A;  4U3F J;  2ZAE B;  1MFT A;  3CWB G;  3GHG C;  4XE5 B;  1KIL B;  1RQV A;  2I1J A;  2YXR B;  2YKO A;  3CX5 E;  4U3F E;  2P67 A;  5KAF H;  2HLO A;  1YJ9 P;  1AFO A;  5B66 H;  3CX5 D;  3EFF K;  1N7S C;  1LWU A;  3OA7 A;  1YYC A;  3EWK A;  1RY3 A;  4HYT B;  1GK6 A;  1NH4 A;  1ZRT E;  4K3A A;  3TDK A;  3Q1M A;  1L0N D;  1VQO P; 
#chains in the Genus database with same CATH homology
 5E79 E;  5B5E E;  5GTI E;  5TIS E;  5H2F E;  3A0H E;  5B66 E;  3WU2 E;  5KAI E;  3JCU E;  4PJ0 E;  2AXT E;  1W5C E;  4UB6 E;  5KAF E;  3KZI E;  1S5L E;  3A0B E;  4IL6 E;  5GTH E;  4UB8 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...