5KAFH

Rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem II protein D1 1
total genus 16
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5kafH01
1S5LH 5KAFH 3JCUH 5E79H 4IL6H 3A0BH 5H2FH 5GTIH 3A0HH 3KZIH 5GTHH 5KAIH 4UB6H 5TISH 4UB8H 4PJ0H 5B66H 3WU2H 5B5EH 2AXTH
chains in the Genus database with same CATH superfamily
3O8ZA 1S5LH 1LT9A 2L5GB 1NYHA 3AEFC 2NPSA 2J58A 3IAOA 2BCCG 2B9BA 2KUBA 1PP9E 3EFFK 3G3ZA 1L0NG 3CC4P 2JR8A 1YJ9P 3L70E 1JTHA 1OWAA 5KKZC 1L0NE 2UWJE 1RF0A 2KYVA 1LTJA 1M1JC 2XDJA 1SFCA 2O01N 2WQYC 1R8EA 4YTPC 1SQPE 1SS1A 4Y28J 3A2AA 4D6TD 2Z4EA 2H7HA 2K9JB 3L74J 1RF1C 1ZV8A 5APQA 3RL0C 4B86A 2CK3H 4R4MA 4KJMA 2E74D 3AEDC 5KJ7A 1JOCA 3CMEP 4YXWH 5AW0B 1SQBK 1XTGB 4ZNCA 1FOSF 2ZYDA 3CPWO 1NHLA 2KSEA 1FAVA 2WSEH 4Y99B 2H88C 2K88A 3V5BA 1EZVE 1VQ4P 3QWOC 3P8CD 1HH0A 2KS1A 4CPGA 1HGVA 1NTZK 2W90A 1ZW0A 3L75J 1Q86Q 2E76D 2OARA 1SQXK 2NPSD 3C9IA 3N7NA 2ZVOB 2ZT9C 3M9HA 2HODA 1OVRA 3TF5A 1OMIA 3GMAA 3KZIE 2GA1A 1NTMJ 3FGAD 3L74G 2WSEJ 2FFDB 1HGZA 1RH5B 1PV3A 1L4AC 2RH0A 3SWYA 1Q90D 2HR3A 3H1ID 1KN7A 1RE4A 2A45H 3K5BA 1T3UA 1L0ND 4WY4A 2WZ7A 1LT1A 3H1JG 1ZP0C 4U3FD 2WPRA 2Q3IA 3HTKB 3L73J 1LTIC 4WY4B 5B5EE 1S72P 1NTKD 1SQBD 4JBZA 2Q7CA 5C39A 5AVSB 3RBZA 1W2BO 3C1LA 1N73A 2HODB 2KXPB 3RK3C 3KHUA 4XA4A 1BDCA 2KLUA 3CC2P 3HE5A 1Z56A 1KILE 1XTCC 2P2UA 2KI7B 2QE7H 5AVUB 2OYIA 3H1KJ 3RBXA 2KNCA 1RF1B 2A06E 2FYUG 4TLFA 3CX5I 3VN0A 1M8OB 2FYZA 2AEMA 1GL2D 2A06G 1YJNP 1SQXD 5CJ4A 3UIAA 3AE6C 1LGHB 3P8CE 4W7YA 3A0BE 4EIJA 2M5AB 4C7NB 1FC2C 2D2CD 3B71A 2IPPA 3CWBG 3L71J 4RESB 1VQPP 1HTLC 1VPCA 1KC8Q 2E43A 4NPFX 2J59M 4LGDE 2QJYC 1M56D 5KAIH 1VQ5P 2POHA 4OGQB 3PJSK 2Q6QA 1HBWA 1VF5B 1BE3G 3Q5SA 2E75B 4I7ZB 4H0LB 1YI2P 2WSCJ 1BE3E 1EZVI 1OIPA 1KB9I 1X79B 2FY8A 2PGDA 2I1KA 2OYOA 1KQSO 1KD1Q 2WITA 1DD3A 4N6JA 2Q9IA 1K05A 3FWLA 4HB1A 2RMZA 1P84I 3HUSC 4C46A 2C9LY 1L0LG 1J1EC 5CCHD 3CC7P 1M57D 1S1CX 2O01J 3HUSB 3FXEA 3H1JD 3RGUA 3TGUJ 4HKZH 1ZN5A 5CBNA 2QM7A 5M1BA 2XNXA 4H13D 3G6EP 3L37A 3V4WA 1K8AQ 2IX7C 5DJUB 1SFCD 3FX0A 4BRYA 2KLVA 2H8PD 3WU2E 1KTMA 3CXHD 1GU4A 2GM4A 1NU1E 2JP3A 1PL5A 1KILB 2A45G 3IFMA 3USSA 1A02J 1IFNA 1LJ2A 1VL2A 3BCCJ 3JSVC 3CCUP 1IFIA 2ZYGA 2Z5HA 1FZCA 2YIUC 3EWKA 1OX3A 1KQLA 4UB6E 3CCRP 1GTWA 4PD4E 1BGYE 2N9YB 1LP1A 2H43A 3V2NA 1DX7A 2Y0DA 4UB6H 2Q1KA 3I5CA 3IR9A 4PV1B 4I6MC 1JY2P 1KYOE 2OYIB 3G4SP 1AJYA 3A7OA 4H0LD 1MKMA 1RF1A 1VF5C 1EXJA 1VQ9P 1VQ6P 1BE3D 3AE1C 3AE5C 3MUDA 4IFFA 2KS1B 4OGQD 4OH8B 2QJKB 3SFEC 4DOJA 1JY2N 1SQPG 4R4LA 2V4HA 3H1LE 1LTJC 1M1JA 5CCHA 1LWUB 2D2CB 1JUNA 1Q2NA 2E76C 2YO2A 1G2CA 3L72E 1S4XA 1LP1B 1FS0E 1N2DC 1IK9A 3L73G 2NRGA 3L74D 3P7KA 1NAFA 1K73Q 3AE2C 3H1IG 1QL2A 2NPSC 1QGKB 4NPDA 1ZR4A 2HFED 1LT9C 3A3YB 1PIXA 3GF3A 2FYUJ 1HJ0A 1URQB 1OW8A 3TNUA 4AYCA 1KILD 1FDOA 1CW5A 2XV5A 3H1KG 2IFNA 4KT0J 2A06D 2E74C 3WMM0 5B5EH 3CCMP 2QM8A 1PP9J 2WPVB 1N8RQ 3AEAC 3JCUH 4H13B 3CCEP 1AA0A 2KOGA 5KAIE 3D6YA 2P1JA 2RN0A 2WSFJ 4OVNF 1GK6A 5BVZA 4H13C 1FZEA 1PPJD 3GHGB 4H44B 4HH2A 4IFDK 3CXHI 3H1JJ 2BEZF 5CHXA 5CJ0A 3RL0D 1EDJA 2YKOA 4PV1C 3VMZA 1SQVG 2B89A 3B5NA 2Y9ZA 2B87A 4WB4A 1JY3O 1YQ3C 3FXDA 1Q82Q 1E79H 3E7KA 2OYHC 2OTLP 3H1IJ 4OWFA 1Q7YQ 2E75D 2R32A 2MJZA 2N1TA 5K5GB 1ZXGA 2OQQA 3KQGA 3CCJP 1ZR2A 2OYHB 3HD7C 3M9BA 2WSSH 3II6A 2ZAEB 1ZRTE 2YXQB 1HJBA 1GD2E 1DIPA 1JY3P 2W27A 3F89A 5KLVG 4QMAA 1IFDA 1D7MA 3NXSA 1NTZG 3Q1MA 5AVWB 1PGPA 3F5HA 3ZDMA 1LTAC 1LWUC 1AVYA 3M0DA 3L75E 4GODA 1H0TB 1K04A 3HE4A 3LW5J 1GU5A 2HPCA 3C8VA 1M1KQ 2K37A 2FXOA 4K3AA 1BCCJ 1J1DC 2BCCE 2N1TB 1KORA 1TU3F 3M0AA 3JCUE 1USEA 2ZYAA 3U1AA 1S9KD 2FYUK 3LIDA 1IJDB 1NTMK 1SP4A 5APSA 2FXMA 3B4SA 1T2KC 1ZOYC 2QJPC 4D6TJ 1X22A 3GLMA 1SQPK 1HWTC 1PGQA 3WUUA 1FJPA 2K1AA 5AW1B 2QJPB 2QVAA 3CCSP 4MN4C 1SQQJ 3SWKA 2E5TA 2K3RA 1FDIA 1IZNB 1QEXA 5KJ7D 1CI6B 3A0HE 4AQRD 1LTSC 1HVVA 1X8YA 2N1TD 2P7JA 1G1IA 5KAFE 1QVFO 1PZQA 1Y9BA 3P32A 5KLVJ 3L4FA 3Q5PA 5AVYB 1L0LK 1NVOA 1WMKA 3ABVC 1RE4C 3TDKA 3CCLP 3GHGA 1L4AA 5TJHA 4I7ZC 1S5LX 1LTJB 2IYPA 2ZXEB 2CPBA 1SQBE 3H1HE 3A5TA 1A02F 1IFMA 1EDIA 2FKWB 3L71E 3B5NC 1SQBG 3WUVA 3M06A 3A0HH 2O1JA 1JM0A 3CX5D 3VP9A 2V7QH 3IF4A 1NTMD 4RJTA 1LTBC 1J1EB 3L70D 1FZGA 1L0NJ 2YMKA 4N78D 1E5WA 1JY2O 4GKGA 3Q5RA 4L76A 2ZFCA 2C0WA 2M0BA 4JQ0D 1SQQG 3HE5B 2RKLA 3RL0B 3VMAA 1VQ7P 3MHVA 1NTKJ 3MP7B 2WT7B 1N7SA 3L74E 4RO0A 2KNCB 4L73A 1AQ5A 1JB0J 4EDFA 3V6IA 2QG4A 5H2FE 4DZOA 3TGUE 3VYIA 3SWFA 1KFNA 1RQUA 1OFCX 2VRSA 4W80A 4GOEA 4Y99C 2M5AA 4C7NA 3W68A 3V2RA 3VP8A 1VQMP 1P84D 3VMYA 3L72G 1L0LJ 2OTJP 2ITAA 2XZRA 3VOPA 1FDMA 1BCCD 1SFCC 1FZAA 1EZVD 1RF0C 1KZUB 3BCCE 5CMZA 1NTZJ 5AW6B 3KYQA 1ZRTD 3BCCG 2FYNC 3G9RA 3O6QB 1YHQP 1NJIQ 1FE6A 1N7SD 3CWBE 5KLIB 1BGYJ 2YO3A 3GW6A 3OAKA 5AVTB 1SQVK 2JKVA 3BRTB 2HLOA 3V4QA 2YKPA 1SQQD 2GUVA 4PD4H 4NPEA 1NTKG 2FYUD 4K35A 2WSFH 2QRXA 4N78E 1AV1A 1L4AB 3MD0A 2P58A 1YYCA 2PFXA 3I56P 1WRGA 3H1LJ 1FZCC 3O6QA 1PP9D 1N73C 3S1KA 1SQVE 2LXBA 3CI9A 1URQC 2E5YA 2WWWA 1FZCB 3H25A 3L72J 1S5LE 3SSUA 5GTHE 1NKNA 5KAFH 1SQPJ 1KFMA 4H44D 1U7JA 3R4YA 2KK7A 3AEGC 5GTHH 2W6AA 3CWBD 2W6JH 3BCCD 3KDPB 2IYOA 4JF7A 1RHZB 2BCCD 3NFQA 5AW4B 3SFDC 1RE3C 1VQKP 1OW7A 2IZ1A 2QSIA 1MFTA 2YXRB 3AECC 3GHGC 2HYNA 3CLQA 3LIEA 1SFCB 1U7MA 3PH0A 4H44C 2WTYA 1BCCG 1NO4A 1SQXE 3FWNA 5E79E 2BASA 1VDFA 1URQD 2DW3A 1OVVA 3HTKA 1KB9D 3N4XA 4YPCA 5AW3B 4IL6E 5KLVK 4I2LC 4DJGA 2L91A 1AVOA 2E75C 3PP5A 3OJAB 4I1LA 2KB7P 4TT3H 1W5CE 5B66E 3HD7D 3AE9C 2QA4P 5AW7B 1BE3J 3L70G 1DEBA 1M7LA 1QLED 2FYNB 3M91A 1GL2A 1PP9G 4KHXA 4M3LA 2FFDC 1S2EA 5APWA 3Q3DA 2D2CC 4GOFA 5KLIC 3WU2H 1VQNP 1OVUA 3P8MC 3A0BH 4HJGH 2J5UA 3MGNA 2I8DA 3ITKA 4JYCA 1SLQA 2BEQD 5AW8B 2R3CA 2K9YA 3VMXA 1MV8A 2IZ0A 2G8YA 2XKMA 4YXDC 4DCKA 5KKZB 1PPJE 1NWQA 1M90Q 1LT9B 1JMBA 3D70A 1J1DB 3L73E 1GL2C 2Q5UA 4PV1D 2JWAA 3RK3B 1EDKA 1KILC 2ZXXA 1AFOA 4N3YB 1GL2B 1OZHA 2P67A 3L35A 1NU1J 4PD4I 2SPZA 5CCGC 1JNMA 1PGOA 1UIXA 2AEFA 2AXTE 2O3JA 5APVA 3TK1A 4U3FG 2IBZD 2MKVA 4C7RA 5KLVD 3Q2YA 1EZVG 4IOIH 4U3FE 2KZIA 3H1HG 3MTUE 5CCGD 1BSHA 2QEXP 3HD7A 4IFMA 1S3JA 3H1KE 1ZMEC 4BWNA 2KP8A 2WMMA 4ASWA 2KSJA 5GTIH 1DH3A 3TYYA 4AUWA 1RY3A 4UB8H 1YITP 1FBMA 5AVVB 5B66H 2OYHA 2C9NY 2QJYB 1NGMB 2PRRA 2E42A 2OTKE 4H0LC 1SQQE 4BRYB 2R5DA 3W67A 2V7QJ 1JMMA 1KB9H 3HE4B 5AW5B 1OW6A 1URQA 3L70J 2JO1A 2YMYA 2HPCB 4JYBA 1MZ9A 3U59A 1FJKA 1KQGB 2KZJA 1X9VA 4JPZB 1KQFB 3H6PA 1N86A 2NPSB 5APUA 1EXIA 1FZBA 1YIJP 2Y0EA 1FZFA 1VF5D 3AEBC 1JY3N 1N7LA 1UIIA 1YTZI 3R2PA 1GDTA 5KJ7C 1SQBJ 1LNQA 2AXTH 1L2PA 2FYUE 2M3BA 2W8ZA 3PHLA 3PLNA 5AW2B 4LLHA 5TISE 3PTZA 1JCDA 1GK4A 2XU6A 3B8EB 1L0LD 3CX5H 2O1KA 4EI2A 4WVZA 1KYOH 1LTTC 2JEEA 1H88A 2W83C 4ASVA 1JEKA 3QH9A 1IFJA 3L75G 3E1IA 3BRVB 4EYYQ 1T8ZA 2E74B 1WT6A 2Q3EA 3BASA 3H1HD 1YQ4C 3MIWA 2W6BA 4XFJA 3GF7A 5CCHC 3S9OA 2CPSA 2XNDH 1NAYA 1NTZD 1NKZB 4PD4D 3MUDC 2R5BA 1T2KD 1NTKE 3AEEC 3VTPC 2Z5IA 3CXHH 5DJTB 1Y8AA 3KZIH 2N9BA 1VQOP 3BATA 2OYIC 1VQLP 2KIKA 1BGYD 2WPQA 4ZMDA 2A45I 5BU8B 1G1JA 1NTME 4A7PA 3OA7A 3OW2O 2IDBA 3JC22 1NU1D 3GG2A 1NTMG 1P84H 3HD7B 1DEEG 1N7SC 1GW4A 3H1LD 1L0LE 3H32A 4RKUJ 2QJKC 1EQ7A 4XE5B 5KTBA 2R3SA 1FU1A 5APXA 5BU5A 3G71P 1H8AA 1CZQA 2NZ2A 2QIWA 1FOSE 1VQ8P 1X0TA 2E76B 1IC2A 5AW9B 3AE4C 2WT7A 1DD4A 4Z1MH 2ZJSE 3L75D 1KYOI 4ZKUA 3CWBJ 3L71G 4U7JA 2I1JA 3NMDA 1BCCE 1PGJA 1R5LA 2BCCJ 2PAJA 2OGUA 3IN6A 1YJWP 1SQQK 1H89A 4BXLA 2Y9YA 2YKQA 1M1JB 5E79H 3RK2C 1GMJA 2IFMA 2WVRA 1EC5A 1YTZT 3H32B 3NTNA 1JCCA 4PJ0E 4WBAA 3T97B 5AVZB 4IL6X 1G2CB 1N73B 3HUSA 3RK2B 4D6TE 1YBKA 4PJ0H 3RK3D 1BGYG 1RQVA 2PP6A 2JWDA 3S4RA 1U57A 3EFGA 1ZLLA 1L4AD 1GW3A 1SQVJ 3L73D 4EOTA 2P10A 1HUCA 3LW5H 2FXPA 2Y0CA 3H1LG 5CCGA 1IFPA 1L0NK 1KILA 2JDIH 1SVFA 2C0XA 2ZVNB 3CX5E 3H1JE 4GIFA 1H0TA 5GTIE 3CCVP 1MUUA 3E1RA 3TGUG 3TSIA 1PPJG 5APYA 1NU1K 3H1IE 3H1KD 4OGQC 1IK7A 3V2PA 3EQ2A 2HG5D 1BSNA 3L71D 3H1HJ 4W7ZA 3KPEA 1JTHB 1SQXJ 2YNYA 5AVQB 2FFDA 4L75A 2B88A 3RL0g 2ZT9D 3CXHE 2WSCH 3RK3E 3CD6P 3B5ND 3HRNA 2B87B 2LKMA 1KB9E 4HYTB 5APTA 1QX8A 1NH4A 2LXCB 3M0DC 1AQTA 3KXDA 1LWUA 2GUSA 4GDOA 4LC1A 1BDDA 5L8RJ 3CCQP 4IL6H 1CI6A 1P84E 4D6TG 1Q81Q 2JJLA 2R44A 4UB8E 1KV4A 1USDA 4WY4C 4ZKPA 3AE8C 1OXZA 3PRJA 2N1TC 1Y47A 1T6AA 3MZWB 3L72D 1J2JB 1R5SA 1QL1A 1RE3A 3I55P 3D6ZA 5TISH 1SQPD 1S9KE 4O9BA 3TGUD 1CSBA 1KMIZ 3M9QA 4WWIA 1K9MQ 1KYOD 3AE7C 1NTKK 1NOHA 2O01H 2YIUB 5H2FH 2AEJA 2IBZI 1GZLA 4GT1A 5AVRB 3RK2D 3TNUB 3WUTA 1T3JA 3T97A 1LTGC 1MFZA 1EDLA 3L36A 2LR2A 2FBWC 3CL3D 4L74A 4DT0A 3U1CA 1NTZE 1QVGO 3V2QA 4WY4D 1W2EA 2G3AA 4U3FJ 2AXCA 3D71A 3AE3C 2M3EA 5KLVE 3CMAP 1N7SB 5EFWB 2H89C 1NU1G 1SQXG 2M8RA 5CBOA 1IO4A 1HF9A 2IBZG 2WPSA 3BVHA 1PFIA 3B5NB 1JO5A 5AVXB 2ZT9B 2IBZE 1SQVD 2K9JA
chains in the Genus database with same CATH topology
1S5LH 5KAFH 3JCUH 5E79H 4IL6H 3A0BH 5H2FH 5GTIH 3A0HH 3KZIH 5GTHH 5KAIH 4UB6H 5TISH 4UB8H 4PJ0H 5B66H 3WU2H 5B5EH 2AXTH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5L H;  5KAF H;  3JCU H;  5E79 H;  4IL6 H;  3A0B H;  5H2F H;  5GTI H;  3A0H H;  3KZI H;  5GTH H;  5KAI H;  4UB6 H;  5TIS H;  4UB8 H;  4PJ0 H;  5B66 H;  3WU2 H;  5B5E H;  2AXT H; 
#chains in the Genus database with same CATH topology
 3O8Z A;  1S5L H;  1LT9 A;  2L5G B;  1NYH A;  3AEF C;  2NPS A;  2J58 A;  3IAO A;  2BCC G;  2B9B A;  2KUB A;  1PP9 E;  3EFF K;  3G3Z A;  1L0N G;  3CC4 P;  2JR8 A;  1YJ9 P;  3L70 E;  1JTH A;  1OWA A;  5KKZ C;  1L0N E;  2UWJ E;  1RF0 A;  2KYV A;  1LTJ A;  1M1J C;  2XDJ A;  1SFC A;  2O01 N;  2WQY C;  1R8E A;  4YTP C;  1SQP E;  1SS1 A;  4Y28 J;  3A2A A;  4D6T D;  2Z4E A;  2H7H A;  2K9J B;  3L74 J;  1RF1 C;  1ZV8 A;  5APQ A;  3RL0 C;  4B86 A;  2CK3 H;  4R4M A;  4KJM A;  2E74 D;  3AED C;  5KJ7 A;  1JOC A;  3CME P;  4YXW H;  5AW0 B;  1SQB K;  1XTG B;  4ZNC A;  1FOS F;  2ZYD A;  3CPW O;  1NHL A;  2KSE A;  1FAV A;  2WSE H;  4Y99 B;  2H88 C;  2K88 A;  3V5B A;  1EZV E;  1VQ4 P;  3QWO C;  3P8C D;  1HH0 A;  2KS1 A;  4CPG A;  1HGV A;  1NTZ K;  2W90 A;  1ZW0 A;  3L75 J;  1Q86 Q;  2E76 D;  2OAR A;  1SQX K;  2NPS D;  3C9I A;  3N7N A;  2ZVO B;  2ZT9 C;  3M9H A;  2HOD A;  1OVR A;  3TF5 A;  1OMI A;  3GMA A;  3KZI E;  2GA1 A;  1NTM J;  3FGA D;  3L74 G;  2WSE J;  2FFD B;  1HGZ A;  1RH5 B;  1PV3 A;  1L4A C;  2RH0 A;  3SWY A;  1Q90 D;  2HR3 A;  3H1I D;  1KN7 A;  1RE4 A;  2A45 H;  3K5B A;  1T3U A;  1L0N D;  4WY4 A;  2WZ7 A;  1LT1 A;  3H1J G;  1ZP0 C;  4U3F D;  2WPR A;  2Q3I A;  3HTK B;  3L73 J;  1LTI C;  4WY4 B;  5B5E E;  1S72 P;  1NTK D;  1SQB D;  4JBZ A;  2Q7C A;  5C39 A;  5AVS B;  3RBZ A;  1W2B O;  3C1L A;  1N73 A;  2HOD B;  2KXP B;  3RK3 C;  3KHU A;  4XA4 A;  1BDC A;  2KLU A;  3CC2 P;  3HE5 A;  1Z56 A;  1KIL E;  1XTC C;  2P2U A;  2KI7 B;  2QE7 H;  5AVU B;  2OYI A;  3H1K J;  3RBX A;  2KNC A;  1RF1 B;  2A06 E;  2FYU G;  4TLF A;  3CX5 I;  3VN0 A;  1M8O B;  2FYZ A;  2AEM A;  1GL2 D;  2A06 G;  1YJN P;  1SQX D;  5CJ4 A;  3UIA A;  3AE6 C;  1LGH B;  3P8C E;  4W7Y A;  3A0B E;  4EIJ A;  2M5A B;  4C7N B;  1FC2 C;  2D2C D;  3B71 A;  2IPP A;  3CWB G;  3L71 J;  4RES B;  1VQP P;  1HTL C;  1VPC A;  1KC8 Q;  2E43 A;  4NPF X;  2J59 M;  4LGD E;  2QJY C;  1M56 D;  5KAI H;  1VQ5 P;  2POH A;  4OGQ B;  3PJS K;  2Q6Q A;  1HBW A;  1VF5 B;  1BE3 G;  3Q5S A;  2E75 B;  4I7Z B;  4H0L B;  1YI2 P;  2WSC J;  1BE3 E;  1EZV I;  1OIP A;  1KB9 I;  1X79 B;  2FY8 A;  2PGD A;  2I1K A;  2OYO A;  1KQS O;  1KD1 Q;  2WIT A;  1DD3 A;  4N6J A;  2Q9I A;  1K05 A;  3FWL A;  4HB1 A;  2RMZ A;  1P84 I;  3HUS C;  4C46 A;  2C9L Y;  1L0L G;  1J1E C;  5CCH D;  3CC7 P;  1M57 D;  1S1C X;  2O01 J;  3HUS B;  3FXE A;  3H1J D;  3RGU A;  3TGU J;  4HKZ H;  1ZN5 A;  5CBN A;  2QM7 A;  5M1B A;  2XNX A;  4H13 D;  3G6E P;  3L37 A;  3V4W A;  1K8A Q;  2IX7 C;  5DJU B;  1SFC D;  3FX0 A;  4BRY A;  2KLV A;  2H8P D;  3WU2 E;  1KTM A;  3CXH D;  1GU4 A;  2GM4 A;  1NU1 E;  2JP3 A;  1PL5 A;  1KIL B;  2A45 G;  3IFM A;  3USS A;  1A02 J;  1IFN A;  1LJ2 A;  1VL2 A;  3BCC J;  3JSV C;  3CCU P;  1IFI A;  2ZYG A;  2Z5H A;  1FZC A;  2YIU C;  3EWK A;  1OX3 A;  1KQL A;  4UB6 E;  3CCR P;  1GTW A;  4PD4 E;  1BGY E;  2N9Y B;  1LP1 A;  2H43 A;  3V2N A;  1DX7 A;  2Y0D A;  4UB6 H;  2Q1K A;  3I5C A;  3IR9 A;  4PV1 B;  4I6M C;  1JY2 P;  1KYO E;  2OYI B;  3G4S P;  1AJY A;  3A7O A;  4H0L D;  1MKM A;  1RF1 A;  1VF5 C;  1EXJ A;  1VQ9 P;  1VQ6 P;  1BE3 D;  3AE1 C;  3AE5 C;  3MUD A;  4IFF A;  2KS1 B;  4OGQ D;  4OH8 B;  2QJK B;  3SFE C;  4DOJ A;  1JY2 N;  1SQP G;  4R4L A;  2V4H A;  3H1L E;  1LTJ C;  1M1J A;  5CCH A;  1LWU B;  2D2C B;  1JUN A;  1Q2N A;  2E76 C;  2YO2 A;  1G2C A;  3L72 E;  1S4X A;  1LP1 B;  1FS0 E;  1N2D C;  1IK9 A;  3L73 G;  2NRG A;  3L74 D;  3P7K A;  1NAF A;  1K73 Q;  3AE2 C;  3H1I G;  1QL2 A;  2NPS C;  1QGK B;  4NPD A;  1ZR4 A;  2HFE D;  1LT9 C;  3A3Y B;  1PIX A;  3GF3 A;  2FYU J;  1HJ0 A;  1URQ B;  1OW8 A;  3TNU A;  4AYC A;  1KIL D;  1FDO A;  1CW5 A;  2XV5 A;  3H1K G;  2IFN A;  4KT0 J;  2A06 D;  2E74 C;  3WMM 0;  5B5E H;  3CCM P;  2QM8 A;  1PP9 J;  2WPV B;  1N8R Q;  3AEA C;  3JCU H;  4H13 B;  3CCE P;  1AA0 A;  2KOG A;  5KAI E;  3D6Y A;  2P1J A;  2RN0 A;  2WSF J;  4OVN F;  1GK6 A;  5BVZ A;  4H13 C;  1FZE A;  1PPJ D;  3GHG B;  4H44 B;  4HH2 A;  4IFD K;  3CXH I;  3H1J J;  2BEZ F;  5CHX A;  5CJ0 A;  3RL0 D;  1EDJ A;  2YKO A;  4PV1 C;  3VMZ A;  1SQV G;  2B89 A;  3B5N A;  2Y9Z A;  2B87 A;  4WB4 A;  1JY3 O;  1YQ3 C;  3FXD A;  1Q82 Q;  1E79 H;  3E7K A;  2OYH C;  2OTL P;  3H1I J;  4OWF A;  1Q7Y Q;  2E75 D;  2R32 A;  2MJZ A;  2N1T A;  5K5G B;  1ZXG A;  2OQQ A;  3KQG A;  3CCJ P;  1ZR2 A;  2OYH B;  3HD7 C;  3M9B A;  2WSS H;  3II6 A;  2ZAE B;  1ZRT E;  2YXQ B;  1HJB A;  1GD2 E;  1DIP A;  1JY3 P;  2W27 A;  3F89 A;  5KLV G;  4QMA A;  1IFD A;  1D7M A;  3NXS A;  1NTZ G;  3Q1M A;  5AVW B;  1PGP A;  3F5H A;  3ZDM A;  1LTA C;  1LWU C;  1AVY A;  3M0D A;  3L75 E;  4GOD A;  1H0T B;  1K04 A;  3HE4 A;  3LW5 J;  1GU5 A;  2HPC A;  3C8V A;  1M1K Q;  2K37 A;  2FXO A;  4K3A A;  1BCC J;  1J1D C;  2BCC E;  2N1T B;  1KOR A;  1TU3 F;  3M0A A;  3JCU E;  1USE A;  2ZYA A;  3U1A A;  1S9K D;  2FYU K;  3LID A;  1IJD B;  1NTM K;  1SP4 A;  5APS A;  2FXM A;  3B4S A;  1T2K C;  1ZOY C;  2QJP C;  4D6T J;  1X22 A;  3GLM A;  1SQP K;  1HWT C;  1PGQ A;  3WUU A;  1FJP A;  2K1A A;  5AW1 B;  2QJP B;  2QVA A;  3CCS P;  4MN4 C;  1SQQ J;  3SWK A;  2E5T A;  2K3R A;  1FDI A;  1IZN B;  1QEX A;  5KJ7 D;  1CI6 B;  3A0H E;  4AQR D;  1LTS C;  1HVV A;  1X8Y A;  2N1T D;  2P7J A;  1G1I A;  5KAF E;  1QVF O;  1PZQ A;  1Y9B A;  3P32 A;  5KLV J;  3L4F A;  3Q5P A;  5AVY B;  1L0L K;  1NVO A;  1WMK A;  3ABV C;  1RE4 C;  3TDK A;  3CCL P;  3GHG A;  1L4A A;  5TJH A;  4I7Z C;  1S5L X;  1LTJ B;  2IYP A;  2ZXE B;  2CPB A;  1SQB E;  3H1H E;  3A5T A;  1A02 F;  1IFM A;  1EDI A;  2FKW B;  3L71 E;  3B5N C;  1SQB G;  3WUV A;  3M06 A;  3A0H H;  2O1J A;  1JM0 A;  3CX5 D;  3VP9 A;  2V7Q H;  3IF4 A;  1NTM D;  4RJT A;  1LTB C;  1J1E B;  3L70 D;  1FZG A;  1L0N J;  2YMK A;  4N78 D;  1E5W A;  1JY2 O;  4GKG A;  3Q5R A;  4L76 A;  2ZFC A;  2C0W A;  2M0B A;  4JQ0 D;  1SQQ G;  3HE5 B;  2RKL A;  3RL0 B;  3VMA A;  1VQ7 P;  3MHV A;  1NTK J;  3MP7 B;  2WT7 B;  1N7S A;  3L74 E;  4RO0 A;  2KNC B;  4L73 A;  1AQ5 A;  1JB0 J;  4EDF A;  3V6I A;  2QG4 A;  5H2F E;  4DZO A;  3TGU E;  3VYI A;  3SWF A;  1KFN A;  1RQU A;  1OFC X;  2VRS A;  4W80 A;  4GOE A;  4Y99 C;  2M5A A;  4C7N A;  3W68 A;  3V2R A;  3VP8 A;  1VQM P;  1P84 D;  3VMY A;  3L72 G;  1L0L J;  2OTJ P;  2ITA A;  2XZR A;  3VOP A;  1FDM A;  1BCC D;  1SFC C;  1FZA A;  1EZV D;  1RF0 C;  1KZU B;  3BCC E;  5CMZ A;  1NTZ J;  5AW6 B;  3KYQ A;  1ZRT D;  3BCC G;  2FYN C;  3G9R A;  3O6Q B;  1YHQ P;  1NJI Q;  1FE6 A;  1N7S D;  3CWB E;  5KLI B;  1BGY J;  2YO3 A;  3GW6 A;  3OAK A;  5AVT B;  1SQV K;  2JKV A;  3BRT B;  2HLO A;  3V4Q A;  2YKP A;  1SQQ D;  2GUV A;  4PD4 H;  4NPE A;  1NTK G;  2FYU D;  4K35 A;  2WSF H;  2QRX A;  4N78 E;  1AV1 A;  1L4A B;  3MD0 A;  2P58 A;  1YYC A;  2PFX A;  3I56 P;  1WRG A;  3H1L J;  1FZC C;  3O6Q A;  1PP9 D;  1N73 C;  3S1K A;  1SQV E;  2LXB A;  3CI9 A;  1URQ C;  2E5Y A;  2WWW A;  1FZC B;  3H25 A;  3L72 J;  1S5L E;  3SSU A;  5GTH E;  1NKN A;  5KAF H;  1SQP J;  1KFM A;  4H44 D;  1U7J A;  3R4Y A;  2KK7 A;  3AEG C;  5GTH H;  2W6A A;  3CWB D;  2W6J H;  3BCC D;  3KDP B;  2IYO A;  4JF7 A;  1RHZ B;  2BCC D;  3NFQ A;  5AW4 B;  3SFD C;  1RE3 C;  1VQK P;  1OW7 A;  2IZ1 A;  2QSI A;  1MFT A;  2YXR B;  3AEC C;  3GHG C;  2HYN A;  3CLQ A;  3LIE A;  1SFC B;  1U7M A;  3PH0 A;  4H44 C;  2WTY A;  1BCC G;  1NO4 A;  1SQX E;  3FWN A;  5E79 E;  2BAS A;  1VDF A;  1URQ D;  2DW3 A;  1OVV A;  3HTK A;  1KB9 D;  3N4X A;  4YPC A;  5AW3 B;  4IL6 E;  5KLV K;  4I2L C;  4DJG A;  2L91 A;  1AVO A;  2E75 C;  3PP5 A;  3OJA B;  4I1L A;  2KB7 P;  4TT3 H;  1W5C E;  5B66 E;  3HD7 D;  3AE9 C;  2QA4 P;  5AW7 B;  1BE3 J;  3L70 G;  1DEB A;  1M7L A;  1QLE D;  2FYN B;  3M91 A;  1GL2 A;  1PP9 G;  4KHX A;  4M3L A;  2FFD C;  1S2E A;  5APW A;  3Q3D A;  2D2C C;  4GOF A;  5KLI C;  3WU2 H;  1VQN P;  1OVU A;  3P8M C;  3A0B H;  4HJG H;  2J5U A;  3MGN A;  2I8D A;  3ITK A;  4JYC A;  1SLQ A;  2BEQ D;  5AW8 B;  2R3C A;  2K9Y A;  3VMX A;  1MV8 A;  2IZ0 A;  2G8Y A;  2XKM A;  4YXD C;  4DCK A;  5KKZ B;  1PPJ E;  1NWQ A;  1M90 Q;  1LT9 B;  1JMB A;  3D70 A;  1J1D B;  3L73 E;  1GL2 C;  2Q5U A;  4PV1 D;  2JWA A;  3RK3 B;  1EDK A;  1KIL C;  2ZXX A;  1AFO A;  4N3Y B;  1GL2 B;  1OZH A;  2P67 A;  3L35 A;  1NU1 J;  4PD4 I;  2SPZ A;  5CCG C;  1JNM A;  1PGO A;  1UIX A;  2AEF A;  2AXT E;  2O3J A;  5APV A;  3TK1 A;  4U3F G;  2IBZ D;  2MKV A;  4C7R A;  5KLV D;  3Q2Y A;  1EZV G;  4IOI H;  4U3F E;  2KZI A;  3H1H G;  3MTU E;  5CCG D;  1BSH A;  2QEX P;  3HD7 A;  4IFM A;  1S3J A;  3H1K E;  1ZME C;  4BWN A;  2KP8 A;  2WMM A;  4ASW A;  2KSJ A;  5GTI H;  1DH3 A;  3TYY A;  4AUW A;  1RY3 A;  4UB8 H;  1YIT P;  1FBM A;  5AVV B;  5B66 H;  2OYH A;  2C9N Y;  2QJY B;  1NGM B;  2PRR A;  2E42 A;  2OTK E;  4H0L C;  1SQQ E;  4BRY B;  2R5D A;  3W67 A;  2V7Q J;  1JMM A;  1KB9 H;  3HE4 B;  5AW5 B;  1OW6 A;  1URQ A;  3L70 J;  2JO1 A;  2YMY A;  2HPC B;  4JYB A;  1MZ9 A;  3U59 A;  1FJK A;  1KQG B;  2KZJ A;  1X9V A;  4JPZ B;  1KQF B;  3H6P A;  1N86 A;  2NPS B;  5APU A;  1EXI A;  1FZB A;  1YIJ P;  2Y0E A;  1FZF A;  1VF5 D;  3AEB C;  1JY3 N;  1N7L A;  1UII A;  1YTZ I;  3R2P A;  1GDT A;  5KJ7 C;  1SQB J;  1LNQ A;  2AXT H;  1L2P A;  2FYU E;  2M3B A;  2W8Z A;  3PHL A;  3PLN A;  5AW2 B;  4LLH A;  5TIS E;  3PTZ A;  1JCD A;  1GK4 A;  2XU6 A;  3B8E B;  1L0L D;  3CX5 H;  2O1K A;  4EI2 A;  4WVZ A;  1KYO H;  1LTT C;  2JEE A;  1H88 A;  2W83 C;  4ASV A;  1JEK A;  3QH9 A;  1IFJ A;  3L75 G;  3E1I A;  3BRV B;  4EYY Q;  1T8Z A;  2E74 B;  1WT6 A;  2Q3E A;  3BAS A;  3H1H D;  1YQ4 C;  3MIW A;  2W6B A;  4XFJ A;  3GF7 A;  5CCH C;  3S9O A;  2CPS A;  2XND H;  1NAY A;  1NTZ D;  1NKZ B;  4PD4 D;  3MUD C;  2R5B A;  1T2K D;  1NTK E;  3AEE C;  3VTP C;  2Z5I A;  3CXH H;  5DJT B;  1Y8A A;  3KZI H;  2N9B A;  1VQO P;  3BAT A;  2OYI C;  1VQL P;  2KIK A;  1BGY D;  2WPQ A;  4ZMD A;  2A45 I;  5BU8 B;  1G1J A;  1NTM E;  4A7P A;  3OA7 A;  3OW2 O;  2IDB A;  3JC2 2;  1NU1 D;  3GG2 A;  1NTM G;  1P84 H;  3HD7 B;  1DEE G;  1N7S C;  1GW4 A;  3H1L D;  1L0L E;  3H32 A;  4RKU J;  2QJK C;  1EQ7 A;  4XE5 B;  5KTB A;  2R3S A;  1FU1 A;  5APX A;  5BU5 A;  3G71 P;  1H8A A;  1CZQ A;  2NZ2 A;  2QIW A;  1FOS E;  1VQ8 P;  1X0T A;  2E76 B;  1IC2 A;  5AW9 B;  3AE4 C;  2WT7 A;  1DD4 A;  4Z1M H;  2ZJS E;  3L75 D;  1KYO I;  4ZKU A;  3CWB J;  3L71 G;  4U7J A;  2I1J A;  3NMD A;  1BCC E;  1PGJ A;  1R5L A;  2BCC J;  2PAJ A;  2OGU A;  3IN6 A;  1YJW P;  1SQQ K;  1H89 A;  4BXL A;  2Y9Y A;  2YKQ A;  1M1J B;  5E79 H;  3RK2 C;  1GMJ A;  2IFM A;  2WVR A;  1EC5 A;  1YTZ T;  3H32 B;  3NTN A;  1JCC A;  4PJ0 E;  4WBA A;  3T97 B;  5AVZ B;  4IL6 X;  1G2C B;  1N73 B;  3HUS A;  3RK2 B;  4D6T E;  1YBK A;  4PJ0 H;  3RK3 D;  1BGY G;  1RQV A;  2PP6 A;  2JWD A;  3S4R A;  1U57 A;  3EFG A;  1ZLL A;  1L4A D;  1GW3 A;  1SQV J;  3L73 D;  4EOT A;  2P10 A;  1HUC A;  3LW5 H;  2FXP A;  2Y0C A;  3H1L G;  5CCG A;  1IFP A;  1L0N K;  1KIL A;  2JDI H;  1SVF A;  2C0X A;  2ZVN B;  3CX5 E;  3H1J E;  4GIF A;  1H0T A;  5GTI E;  3CCV P;  1MUU A;  3E1R A;  3TGU G;  3TSI A;  1PPJ G;  5APY A;  1NU1 K;  3H1I E;  3H1K D;  4OGQ C;  1IK7 A;  3V2P A;  3EQ2 A;  2HG5 D;  1BSN A;  3L71 D;  3H1H J;  4W7Z A;  3KPE A;  1JTH B;  1SQX J;  2YNY A;  5AVQ B;  2FFD A;  4L75 A;  2B88 A;  3RL0 g;  2ZT9 D;  3CXH E;  2WSC H;  3RK3 E;  3CD6 P;  3B5N D;  3HRN A;  2B87 B;  2LKM A;  1KB9 E;  4HYT B;  5APT A;  1QX8 A;  1NH4 A;  2LXC B;  3M0D C;  1AQT A;  3KXD A;  1LWU A;  2GUS A;  4GDO A;  4LC1 A;  1BDD A;  5L8R J;  3CCQ P;  4IL6 H;  1CI6 A;  1P84 E;  4D6T G;  1Q81 Q;  2JJL A;  2R44 A;  4UB8 E;  1KV4 A;  1USD A;  4WY4 C;  4ZKP A;  3AE8 C;  1OXZ A;  3PRJ A;  2N1T C;  1Y47 A;  1T6A A;  3MZW B;  3L72 D;  1J2J B;  1R5S A;  1QL1 A;  1RE3 A;  3I55 P;  3D6Z A;  5TIS H;  1SQP D;  1S9K E;  4O9B A;  3TGU D;  1CSB A;  1KMI Z;  3M9Q A;  4WWI A;  1K9M Q;  1KYO D;  3AE7 C;  1NTK K;  1NOH A;  2O01 H;  2YIU B;  5H2F H;  2AEJ A;  2IBZ I;  1GZL A;  4GT1 A;  5AVR B;  3RK2 D;  3TNU B;  3WUT A;  1T3J A;  3T97 A;  1LTG C;  1MFZ A;  1EDL A;  3L36 A;  2LR2 A;  2FBW C;  3CL3 D;  4L74 A;  4DT0 A;  3U1C A;  1NTZ E;  1QVG O;  3V2Q A;  4WY4 D;  1W2E A;  2G3A A;  4U3F J;  2AXC A;  3D71 A;  3AE3 C;  2M3E A;  5KLV E;  3CMA P;  1N7S B;  5EFW B;  2H89 C;  1NU1 G;  1SQX G;  2M8R A;  5CBO A;  1IO4 A;  1HF9 A;  2IBZ G;  2WPS A;  3BVH A;  1PFI A;  3B5N B;  1JO5 A;  5AVX B;  2ZT9 B;  2IBZ E;  1SQV D;  2K9J A; 
#chains in the Genus database with same CATH homology
 1S5L H;  5KAF H;  3JCU H;  5E79 H;  4IL6 H;  3A0B H;  5H2F H;  5GTI H;  3A0H H;  3KZI H;  5GTH H;  5KAI H;  4UB6 H;  5TIS H;  4UB8 H;  4PJ0 H;  5B66 H;  3WU2 H;  5B5E H;  2AXT H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...