5KAFH

Rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
total genus 16
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5kafH01
4UB8H 5TISH 5E79H 1S5LH 5KAIH 5GTIH 2AXTH 5GTHH 3A0BH 5KAFH 3WU2H 5B5EH 5H2FH 4PJ0H 5B66H 4IL6H 3KZIH 3A0HH 4UB6H 3JCUH
chains in the Genus database with same CATH superfamily
4LLHA 2MJZA 3OAKA 1PIXA 3Q3DA 1N7SC 1P84E 2E74C 5B66E 3L70J 2WSCH 3MTUE 1BE3D 1SQPJ 3CCEP 1GU4A 1JCDA 3LW5H 4ASWA 2K9JB 2QIWA 3QH9A 4HYTB 2M0BA 3CX5I 2NRGA 2RKLA 1KB9I 1E5WA 3BASA 3B5ND 4GIFA 2FFDA 1VQ6P 2BCCD 1NH4A 2KLVA 4U3FJ 4PJ0H 3T97B 1E79H 2GUSA 1LWUC 4HJGH 1KILE 1OVUA 1NTKK 1EZVI 3LIDA 2Q1KA 4WWIA 3GHGC 3CCSP 1Q90D 1LT9A 2LXCB 3F5HA 4EI2A 1LGHB 4WB4A 4XE5B 2ZT9B 3ABVC 5KLVD 2W6AA 2C0XA 1AQTA 2N1TB 1Q86Q 5GTHE 3RK3C 2J58A 3CC7P 3AEFC 4D6TJ 1X8YA 2K9JA 5AW3B 1L0LK 1SQBG 2XKMA 2E74B 2ZXXA 1R5LA 5TISE 1T6AA 1J1DB 1IK9A 5KAIE 2IBZD 3U1AA 1P84I 3L75E 2BASA 2K9YA 2O1KA 3T97A 3HE4B 1JM0A 1VQ5P 4IFFA 2KUBA 2W6BA 4IL6X 2E5TA 1ZRTE 1ZOYC 1YJ9P 1RH5B 1JB0J 1NOHA 2P67A 2N1TA 2R3SA 4KT0J 1NKZB 2G8YA 3GHGB 3PRJA 3L73J 3AE7C 1RQUA 1EXJA 2QE7H 3TF5A 2V7QH 3L72J 1KN7A 2NZ2A 1QGKB 1XTCC 4KHXA 3RK3B 1Y8AA 2ZYAA 2Q9IA 3CCMP 1AJYA 1SQBJ 1MFTA 2HLOA 4U7JA 2RN0A 4IL6H 3O6QB 4DT0A 3V4QA 4UB6H 2W6JH 3HE4A 1EQ7A 3H1JG 3MP7B 1Q7YQ 1SQVJ 1LTJB 2IX7C 2GM4A 4JYBA 1R5SA 1SQXD 1LJ2A 1GL2C 4PD4E 1GU5A 3CMAP 4EYYQ 4RKUJ 1LTGC 2IYOA 2E5YA 3KXDA 3NTNA 3GHGA 1QVFO 1UIIA 4Y99C 3H1KG 2Y0CA 5AVWB 2A06D 3EWKA 2WSFJ 1WRGA 4YTPC 3L71J 1VF5B 1S3JA 5KTBA 1JY2N 3KDPB 3H1IG 3M9HA 4K3AA 4MN4C 2W83C 1YHQP 3O6QA 3NMDA 4K35A 2Z5HA 1OFCX 4C7NB 5EFWB 1PZQA 1AVYA 1LTJA 3H1HD 1GMJA 1NU1D 2WSEJ 2J5UA 1KFMA 3AE5C 4JPZB 3TGUD 1SQQE 4RJTA 4H0LD 3H1JJ 3B8EB 2C9NY 1PGQA 3AE2C 2BCCG 2DW3A 5APVA 1FDMA 2M3BA 3SWYA 2E43A 1GL2B 4HKZH 2Y0EA 2FYUG 5AVUB 3HUSB 3TNUB 3VTPC 1H89A 4PD4I 4GDOA 1PP9D 2QM7A 3BCCJ 3TSIA 1YTZI 1NTZG 3G9RA 2J59M 1FZCC 2V4HA 1YJNP 1JY3P 2OTJP 2B89A 2IFNA 2P58A 4C7NA 5AVQB 2FXPA 2IYPA 1BE3J 3A0HE 2NPSD 1YBKA 2E76C 5CCGC 1U7JA 2KP8A 1AVOA 1FOSE 2P7JA 5APXA 1UIXA 3CXHE 1KYOE 1OVRA 1BGYD 1LTAC 1GW3A 1SFCD 1X22A 1BCCG 3A0BH 1GL2A 3L70E 2BCCJ 2A45H 1RE4C 3W67A 3HUSA 1SQPE 3TNUA 3RL0g 1Q2NA 2BEZF 4ZKPA 1SS1A 3IN6A 1G1JA 5APWA 4WY4C 3M0DA 1M1KQ 5H2FH 5KLVJ 1EDJA 1OMIA 4O9BA 4M3LA 4U3FE 4OWFA 5AVVB 3P8CD 3HD7D 3A7OA 2JWAA 3B71A 2QA4P 3CCVP 1SVFA 1AQ5A 3CX5H 1KB9H 4H13C 2GA1A 1NO4A 1KFNA 2QJPB 2E76B 4QMAA 1EDIA 1N8RQ 1ZR2A 2FFDC 3V2QA 3NXSA 2LR2A 1PGJA 4D6TE 2Q3EA 1KILC 1H88A 3ZDMA 2IZ0A 3CXHI 1IFMA 3TDKA 1KYOI 1EXIA 3PHLA 2PAJA 2D2CC 1OW8A 1HGVA 3CC4P 1SQQK 2A06G 1LT9C 1X0TA 1GTWA 5AVSB 3RGUA 1H0TB 2M8RA 2R3CA 4WY4B 2OTKE 3PH0A 2QJKB 4OH8B 2PRRA 2KSEA 5DJUB 1W5CE 3TK1A 1IFPA 1VQ9P 1S9KE 1OIPA 3V2PA 3KHUA 3RBZA 2R32A 4EIJA 2KNCB 5B66H 2AEFA 2R44A 3VMYA 1ZV8A 4KJMA 3L73E 3TGUG 3KQGA 3V6IA 1SQXK 1NTMG 4H13B 3HE5B 2WT7B 2GUVA 1GD2E 1KTMA 3L72E 4BXLA 1M56D 1SQXJ 2FBWC 4YXDC 3TYYA 1HUCA 1OW7A 5AW1B 3D6YA 1SQBE 1YI2P 1KILB 1R8EA 2D2CD 1H0TA 4WY4A 3HRNA 1SQVE 3BRVB 1L4AC 5M1BA 1JY2O 1AA0A 2N1TC 3H1KD 4HB1A 3CI9A 1SLQA 1FC2C 4WBAA 1BSHA 1AV1A 2I1KA 1FE6A 1SQPK 1YJWP 2RMZA 2G3AA 2KNCA 3H1ID 1HJBA 1NTKG 2OYIC 3F89A 3L74G 1Z56A 1J1DC 2Y9ZA 3HE5A 3EFFK 2WT7A 2A45G 1VQ7P 2KB7P 3H1HJ 3P8MC 1TU3F 1NU1J 1BGYG 3VP9A 3TGUJ 5KJ7A 3L71E 5TISH 2QG4A 3R4YA 3A5TA 1KILA 3FWNA 5BU5A 1L0LG 1L0NK 3A3YB 1JNMA 2AEJA 2Z5IA 2O01H 1CSBA 2ZT9D 1M8OB 2FYUD 1L0NJ 1NGMB 1N73C 1YIJP 3H1JE 3C1LA 1PP9J 1LP1B 2OARA 3JSVC 4GKGA 3EFGA 5BU8B 2POHA 3IF4A 1NTZD 2YXQB 1L4AB 1GDTA 1N86A 2FYNB 1RF0A 3CCUP 1ZMEC 4I2LC 1N7SD 2E74D 2KSJA 5CCHA 2E42A 3VP8A 2AEMA 4I7ZB 4I1LA 5AVTB 3BCCE 5TJHA 1KMIZ 2OYIB 1VQKP 1W2BO 2LKMA 1LTJC 5APYA 3I56P 2PFXA 1KD1Q 2MKVA 2B87B 2UWJE 3UIAA 4ZKUA 1BGYJ 5CJ4A 1VQOP 2R5BA 1FJPA 1GW4A 3CWBG 1OVVA 1HGZA 1BCCD 1VQ8P 2L5GB 1BE3E 4AYCA 4A7PA 1ZXGA 1FZBA 4PD4H 2ZJSE 4PV1B 1LP1A 3G71P 1LT1A 1DEBA 1CI6B 1L4AA 1Q82Q 3Q1MA 1VF5C 3HTKB 3IFMA 2WQYC 3D70A 1U57A 3B4SA 2BCCE 1N73B 3SFDC 2OGUA 1QL1A 2HODB 5AVYB 3RK3D 3VN0A 1SQBK 4XA4A 2OYIA 2XNDH 3P7KA 1M1JB 1MZ9A 2VRSA 1WT6A 2B87A 1KQFB 1SQVK 3H25A 4R4MA 4N78D 5AW9B 1T3JA 3E1RA 5KLVE 1RF1C 3WUUA 1URQC 1YITP 2H8PD 3WUVA 3VOPA 1Q81Q 1GK4A 2QM8A 2Y9YA 1T2KC 2CPBA 2HYNA 1FDOA 1IFJA 3HUSC 1CI6A 3G4SP 2CK3H 2Q7CA 5B5EE 3GMAA 1LTIC 4OVNF 2IBZE 3HTKA 1NAFA 1N73A 2PGDA 2HODA 3M0DC 2KYVA 1VF5D 1NJIQ 4EOTA 3Q5SA 2QSIA 2H88C 1Y9BA 1X9VA 1IFIA 1J1EC 3AE1C 3MGNA 4L76A 3RK2C 3SSUA 1M1JA 1M90Q 3KZIE 1BSNA 3G3ZA 2I1JA 4DCKA 2K1AA 1FZFA 3FXEA 3L75G 1IJDB 1JY3N 3A0HH 5E79E 3MD0A 5AVXB 3BVHA 4IFMA 5CMZA 3OJAB 1QLED 3GW6A 1NTMD 4JBZA 5APSA 1G1IA 1JMMA 1RF1B 3Q5RA 1URQB 1KYOH 1GL2D 3PTZA 3JCUE 3V4WA 3II6A 2JP3A 3L4FA 3H1LD 3U59A 3Q5PA 1LTBC 1KZUB 3CPWO 3H1KJ 3V5BA 2WSCJ 1OXZA 1SQXE 2H7HA 2IBZI 2QVAA 3LW5J 1JY2P 3L35A 1J1EB 3OW2O 3H1IJ 3RK2B 2XU6A 2LXBA 1NTKD 3C9IA 2QJPC 3L74D 4OGQC 4UB8E 2A06E 1VPCA 3L36A 1RF1A 2HPCB 1URQA 1JCCA 3H32B 1HVVA 2E75C 3K5BA 1IFDA 3C8VA 2YKOA 3JC22 1BDCA 3AEDC 2N9YB 1NWQA 1PPJD 1L0LD 2YO3A 2AXTE 5KAFE 2FYZA 3H1HE 3EQ2A 2M3EA 5KLVK 1NU1E 2FYUJ 1NYHA 1T8ZA 4ASVA 2RH0A 3OA7A 2QJKC 1K04A 1MUUA 1SFCB 2QJYC 1JO5A 2KI7B 1NTZJ 3SFEC 3CX5D 1KB9D 1HF9A 1DD3A 1GZLA 1S5LX 4AUWA 2WPQA 1JOCA 2B88A 3G6EP 2JEEA 1JMBA 1L0NE 3KYQA 2E76D 5CCGD 2SPZA 2HPCA 3L73D 3H32A 1MKMA 2YMKA 1SQQG 1PP9E 2ZYGA 2JR8A 1RE3C 1EZVD 4OGQB 5KJ7C 2E75B 3HD7B 1W2EA 3CWBD 3CCQP 1BCCJ 3CD6P 2K3RA 2WITA 4L73A 1VQ4P 1KV4A 2ZYDA 1SFCA 3AEAC 2H89C 1S5LH 4WY4D 2V7QJ 1BGYE 4IOIH 3WU2H 3FGAD 1IZNB 2OTLP 1HJ0A 1FBMA 1P84D 2QJYB 3AEEC 1RF0C 3AE9C 2R5DA 3USSA 1AFOA 1FAVA 5GTIH 2WVRA 5CCHC 5APUA 3D71A 4H13D 1P84H 3BRTB 5CBOA 1IC2A 5KLIC 3HD7A 1MFZA 3L70G 5KJ7D 2WSFH 3M9QA 2YIUB 3AEGC 1SQPG 2YNYA 3P8CE 4C46A 2H43A 3V2NA 1KILD 1L2PA 2YO2A 2Q3IA 3H1LG 2YXRB 1S1CX 4DJGA 1EDKA 2WPSA 3CC2P 3RL0B 3B5NC 3N4XA 5AW6B 4H44B 3IR9A 2KS1B 3R2PA 5AW4B 2HFED 4U3FG 1U7MA 2YKPA 1YYCA 3I5CA 2WSEH 2FYNC 4N3YB 1CZQA 5CBNA 3M0AA 2OYHB 4GT1A 2KLUA 2Y0DA 1VQLP 4LC1A 4I7ZC 1S4XA 2OQQA 5GTHH 1NU1K 4RESB 5K5GB 4Z1MH 3SWKA 1NTMK 3M91A 3L75D 4ZMDA 1RE3A 2ZVNB 3WUTA 4D6TG 1NTMJ 3ITKA 5KLIB 5KAIH 1ZRTD 1USDA 1N2DC 3WMM0 1YQ3C 1PPJG 4PV1C 4W7ZA 3H1LJ 2WTYA 2KS1A 1YTZT 3AECC 1RY3A 2HG5D 2ITAA 2OYHA 1SP4A 2IPPA 1T3UA 1M57D 1L4AD 3S4RA 3S1KA 1DX7A 2N1TD 3N7NA 1GK6A 3AE4C 1OWAA 1JEKA 2JWDA 3B5NB 1VDFA 1HBWA 4DZOA 2W8ZA 1ZLLA 1S72P 1HH0A 1M1JC 2XNXA 3U1CA 3E7KA 3CCLP 1H8AA 3L73G 1NTKJ 3FWLA 2IZ1A 1G2CB 2KXPB 1EC5A 2M5AB 1OZHA 3L74J 3PP5A 1ZP0C 1NAYA 3H1KE 3L72G 1EZVG 2WWWA 1XTGB 2WPVB 2Q6QA 4PD4D 5CHXA 5APTA 3H1IE 2XZRA 1N7SB 1FS0E 4PV1D 2ZAEB 1WMKA 3GG2A 1SQVG 1L0LJ 2ZVOB 1KQSO 4YPCA 3B5NA 4PJ0E 1VQMP 5AW8B 4GODA 4HH2A 5B5EH 2WSSH 4BRYB 2P1JA 3A2AA 1LWUB 1G2CA 1IFNA 2M5AA 2HR3A 2WMMA 2JDIH 1HWTC 2FYUE 4YXWH 1DH3A 1ZR4A 3L71G 3I55P 1IO4A 3KZIH 1SQQD 2P2UA 1QEXA 1FZGA 1NTZE 1KQGB 3D6ZA 1ZN5A 4W7YA 1KORA 1PFIA 1N7SA 2YMYA 5E79H 1K9MQ 4B86A 5AW2B 3CWBJ 2QRXA 3P32A 5AW0B 3JCUH 4TT3H 4H0LC 4BRYA 2AXCA 5AVZB 5CJ0A 2YKQA 3Q2YA 1HTLC 1S2EA 4XFJA 1QVGO 1VQNP 2K88A 1LWUA 4NPFX 1BCCE 2O3JA 2O01N 4WVZA 3M9BA 2Z4EA 3FXDA 5KKZC 2W27A 1VQPP 2BEQD 3BCCG 4ZNCA 1DD4A 4Y28J 3CXHD 1KYOD 5AW5B 1IK7A 1URQD 1USEA 4CPGA 1MV8A 4UB8H 3MHVA 2JJLA 4IFDK 1BE3G 3RK3E 3L70D 2IFMA 4IL6E 3CXHH 1K05A 4GOFA 1SQPD 4UB6E 2NPSC 1T2KD 3NFQA 4C7RA 1YQ4C 1X79B 1EDLA 3PLNA 3LIEA 3VMXA 5APQA 3CLQA 3CMEP 4N78E 2C0WA 4NPDA 1SFCC 2AXTH 5KAFH 2IDBA 2W90A 4U3FD 4H0LB 3GF3A 2JKVA 4L74A 3V2RA 3GF7A 3S9OA 3RK2D 4JF7A 4JYCA 1L0ND 1QL2A 2KK7A 1A02F 3MZWB 5KLVG 1ZW0A 5KKZB 5AVRB 4Y99B 3KPEA 2FKWB 1N7LA 3L75J 1LNQA 4AQRD 1FJKA 2C9LY 3HD7C 2KZIA 1DIPA 4D6TD 1K73Q 1VL2A 5AW7B 2O01J 3PJSK 3VYIA 3O8ZA 4GOEA 3BATA 2I8DA 4TLFA 2FYUK 1QX8A 2IBZG 1JTHB 3MUDC 2NPSB 3CL3D 1NTZK 3TGUE 2KZJA 1NTME 1JUNA 3QWOC 1NKNA 3RBXA 3VMAA 5DJTB 1S9KD 4LGDE 4DOJA 1D7MA 3H1LE 1J2JB 3SWFA 1PGPA 3AE6C 2XDJA 2JO1A 4OGQD 3M06A 4L75A 2YIUC 2E75D 3L72D 1KQLA 1FZCB 1A02J 4JQ0D 1OW6A 3VMZA 5BVZA 1JTHA 1FDIA 2NPSA 1BDDA 1SQBD 1NTKE 2WZ7A 3E1IA 3L74E 3RL0C 1FZEA 4H44C 3A0BE 1SQVD 1KC8Q 2CPSA 2K37A 1PGOA 3CCJP 1SQXG 2OYHC 4W80A 1NVOA 2KOGA 4BWNA 1CW5A 1FOSF 1NHLA 2FY8A 3AEBC 1LTSC 2KIKA 1PPJE 1RHZB 1L0LE 5H2FE 3CCRP 3GLMA 5C39A 3IAOA 1FZCA 2L91A 2QEXP 1SQQJ 1Y47A 3L71D 2WPRA 1OX3A 4NPEA 3AE8C 2N9BA 3CX5E 2FXOA 1KB9E 2O1JA 4RO0A 5CCGA 2XV5A 1M7LA 2ZFCA 3L37A 3H1HG 1NU1G 3RL0D 1LTTC 3MUDA 4H44D 1DEEG 3FX0A 3AE3C 2OYOA 3H1JD 5L8RJ 1EZVE 2P10A 1FZAA 1PV3A 2PP6A 1RE4A 4I6MC 2FFDB 3H6PA 4N6JA 2ZXEB 1S5LE 2FXMA 3CWBE 3MIWA 2Q5UA 2A45I 1RQVA 3WU2E 4EDFA 1L0NG 2ZT9C 1PP9G 1JY3O 4R4LA 1K8AQ 3W68A 3BCCD 1PL5A 5CCHD 2D2CB 1LT9B 2B9BA 1FU1A 5GTIE
chains in the Genus database with same CATH topology
4UB8H 5TISH 5E79H 1S5LH 5KAIH 5GTIH 2AXTH 5GTHH 3A0BH 5KAFH 3WU2H 5B5EH 5H2FH 4PJ0H 5B66H 4IL6H 3KZIH 3A0HH 4UB6H 3JCUH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 H;  5TIS H;  5E79 H;  1S5L H;  5KAI H;  5GTI H;  2AXT H;  5GTH H;  3A0B H;  5KAF H;  3WU2 H;  5B5E H;  5H2F H;  4PJ0 H;  5B66 H;  4IL6 H;  3KZI H;  3A0H H;  4UB6 H;  3JCU H; 
#chains in the Genus database with same CATH topology
 4LLH A;  2MJZ A;  3OAK A;  1PIX A;  3Q3D A;  1N7S C;  1P84 E;  2E74 C;  5B66 E;  3L70 J;  2WSC H;  3MTU E;  1BE3 D;  1SQP J;  3CCE P;  1GU4 A;  1JCD A;  3LW5 H;  4ASW A;  2K9J B;  2QIW A;  3QH9 A;  4HYT B;  2M0B A;  3CX5 I;  2NRG A;  2RKL A;  1KB9 I;  1E5W A;  3BAS A;  3B5N D;  4GIF A;  2FFD A;  1VQ6 P;  2BCC D;  1NH4 A;  2KLV A;  4U3F J;  4PJ0 H;  3T97 B;  1E79 H;  2GUS A;  1LWU C;  4HJG H;  1KIL E;  1OVU A;  1NTK K;  1EZV I;  3LID A;  2Q1K A;  4WWI A;  3GHG C;  3CCS P;  1Q90 D;  1LT9 A;  2LXC B;  3F5H A;  4EI2 A;  1LGH B;  4WB4 A;  4XE5 B;  2ZT9 B;  3ABV C;  5KLV D;  2W6A A;  2C0X A;  1AQT A;  2N1T B;  1Q86 Q;  5GTH E;  3RK3 C;  2J58 A;  3CC7 P;  3AEF C;  4D6T J;  1X8Y A;  2K9J A;  5AW3 B;  1L0L K;  1SQB G;  2XKM A;  2E74 B;  2ZXX A;  1R5L A;  5TIS E;  1T6A A;  1J1D B;  1IK9 A;  5KAI E;  2IBZ D;  3U1A A;  1P84 I;  3L75 E;  2BAS A;  2K9Y A;  2O1K A;  3T97 A;  3HE4 B;  1JM0 A;  1VQ5 P;  4IFF A;  2KUB A;  2W6B A;  4IL6 X;  2E5T A;  1ZRT E;  1ZOY C;  1YJ9 P;  1RH5 B;  1JB0 J;  1NOH A;  2P67 A;  2N1T A;  2R3S A;  4KT0 J;  1NKZ B;  2G8Y A;  3GHG B;  3PRJ A;  3L73 J;  3AE7 C;  1RQU A;  1EXJ A;  2QE7 H;  3TF5 A;  2V7Q H;  3L72 J;  1KN7 A;  2NZ2 A;  1QGK B;  1XTC C;  4KHX A;  3RK3 B;  1Y8A A;  2ZYA A;  2Q9I A;  3CCM P;  1AJY A;  1SQB J;  1MFT A;  2HLO A;  4U7J A;  2RN0 A;  4IL6 H;  3O6Q B;  4DT0 A;  3V4Q A;  4UB6 H;  2W6J H;  3HE4 A;  1EQ7 A;  3H1J G;  3MP7 B;  1Q7Y Q;  1SQV J;  1LTJ B;  2IX7 C;  2GM4 A;  4JYB A;  1R5S A;  1SQX D;  1LJ2 A;  1GL2 C;  4PD4 E;  1GU5 A;  3CMA P;  4EYY Q;  4RKU J;  1LTG C;  2IYO A;  2E5Y A;  3KXD A;  3NTN A;  3GHG A;  1QVF O;  1UII A;  4Y99 C;  3H1K G;  2Y0C A;  5AVW B;  2A06 D;  3EWK A;  2WSF J;  1WRG A;  4YTP C;  3L71 J;  1VF5 B;  1S3J A;  5KTB A;  1JY2 N;  3KDP B;  3H1I G;  3M9H A;  4K3A A;  4MN4 C;  2W83 C;  1YHQ P;  3O6Q A;  3NMD A;  4K35 A;  2Z5H A;  1OFC X;  4C7N B;  5EFW B;  1PZQ A;  1AVY A;  1LTJ A;  3H1H D;  1GMJ A;  1NU1 D;  2WSE J;  2J5U A;  1KFM A;  3AE5 C;  4JPZ B;  3TGU D;  1SQQ E;  4RJT A;  4H0L D;  3H1J J;  3B8E B;  2C9N Y;  1PGQ A;  3AE2 C;  2BCC G;  2DW3 A;  5APV A;  1FDM A;  2M3B A;  3SWY A;  2E43 A;  1GL2 B;  4HKZ H;  2Y0E A;  2FYU G;  5AVU B;  3HUS B;  3TNU B;  3VTP C;  1H89 A;  4PD4 I;  4GDO A;  1PP9 D;  2QM7 A;  3BCC J;  3TSI A;  1YTZ I;  1NTZ G;  3G9R A;  2J59 M;  1FZC C;  2V4H A;  1YJN P;  1JY3 P;  2OTJ P;  2B89 A;  2IFN A;  2P58 A;  4C7N A;  5AVQ B;  2FXP A;  2IYP A;  1BE3 J;  3A0H E;  2NPS D;  1YBK A;  2E76 C;  5CCG C;  1U7J A;  2KP8 A;  1AVO A;  1FOS E;  2P7J A;  5APX A;  1UIX A;  3CXH E;  1KYO E;  1OVR A;  1BGY D;  1LTA C;  1GW3 A;  1SFC D;  1X22 A;  1BCC G;  3A0B H;  1GL2 A;  3L70 E;  2BCC J;  2A45 H;  1RE4 C;  3W67 A;  3HUS A;  1SQP E;  3TNU A;  3RL0 g;  1Q2N A;  2BEZ F;  4ZKP A;  1SS1 A;  3IN6 A;  1G1J A;  5APW A;  4WY4 C;  3M0D A;  1M1K Q;  5H2F H;  5KLV J;  1EDJ A;  1OMI A;  4O9B A;  4M3L A;  4U3F E;  4OWF A;  5AVV B;  3P8C D;  3HD7 D;  3A7O A;  2JWA A;  3B71 A;  2QA4 P;  3CCV P;  1SVF A;  1AQ5 A;  3CX5 H;  1KB9 H;  4H13 C;  2GA1 A;  1NO4 A;  1KFN A;  2QJP B;  2E76 B;  4QMA A;  1EDI A;  1N8R Q;  1ZR2 A;  2FFD C;  3V2Q A;  3NXS A;  2LR2 A;  1PGJ A;  4D6T E;  2Q3E A;  1KIL C;  1H88 A;  3ZDM A;  2IZ0 A;  3CXH I;  1IFM A;  3TDK A;  1KYO I;  1EXI A;  3PHL A;  2PAJ A;  2D2C C;  1OW8 A;  1HGV A;  3CC4 P;  1SQQ K;  2A06 G;  1LT9 C;  1X0T A;  1GTW A;  5AVS B;  3RGU A;  1H0T B;  2M8R A;  2R3C A;  4WY4 B;  2OTK E;  3PH0 A;  2QJK B;  4OH8 B;  2PRR A;  2KSE A;  5DJU B;  1W5C E;  3TK1 A;  1IFP A;  1VQ9 P;  1S9K E;  1OIP A;  3V2P A;  3KHU A;  3RBZ A;  2R32 A;  4EIJ A;  2KNC B;  5B66 H;  2AEF A;  2R44 A;  3VMY A;  1ZV8 A;  4KJM A;  3L73 E;  3TGU G;  3KQG A;  3V6I A;  1SQX K;  1NTM G;  4H13 B;  3HE5 B;  2WT7 B;  2GUV A;  1GD2 E;  1KTM A;  3L72 E;  4BXL A;  1M56 D;  1SQX J;  2FBW C;  4YXD C;  3TYY A;  1HUC A;  1OW7 A;  5AW1 B;  3D6Y A;  1SQB E;  1YI2 P;  1KIL B;  1R8E A;  2D2C D;  1H0T A;  4WY4 A;  3HRN A;  1SQV E;  3BRV B;  1L4A C;  5M1B A;  1JY2 O;  1AA0 A;  2N1T C;  3H1K D;  4HB1 A;  3CI9 A;  1SLQ A;  1FC2 C;  4WBA A;  1BSH A;  1AV1 A;  2I1K A;  1FE6 A;  1SQP K;  1YJW P;  2RMZ A;  2G3A A;  2KNC A;  3H1I D;  1HJB A;  1NTK G;  2OYI C;  3F89 A;  3L74 G;  1Z56 A;  1J1D C;  2Y9Z A;  3HE5 A;  3EFF K;  2WT7 A;  2A45 G;  1VQ7 P;  2KB7 P;  3H1H J;  3P8M C;  1TU3 F;  1NU1 J;  1BGY G;  3VP9 A;  3TGU J;  5KJ7 A;  3L71 E;  5TIS H;  2QG4 A;  3R4Y A;  3A5T A;  1KIL A;  3FWN A;  5BU5 A;  1L0L G;  1L0N K;  3A3Y B;  1JNM A;  2AEJ A;  2Z5I A;  2O01 H;  1CSB A;  2ZT9 D;  1M8O B;  2FYU D;  1L0N J;  1NGM B;  1N73 C;  1YIJ P;  3H1J E;  3C1L A;  1PP9 J;  1LP1 B;  2OAR A;  3JSV C;  4GKG A;  3EFG A;  5BU8 B;  2POH A;  3IF4 A;  1NTZ D;  2YXQ B;  1L4A B;  1GDT A;  1N86 A;  2FYN B;  1RF0 A;  3CCU P;  1ZME C;  4I2L C;  1N7S D;  2E74 D;  2KSJ A;  5CCH A;  2E42 A;  3VP8 A;  2AEM A;  4I7Z B;  4I1L A;  5AVT B;  3BCC E;  5TJH A;  1KMI Z;  2OYI B;  1VQK P;  1W2B O;  2LKM A;  1LTJ C;  5APY A;  3I56 P;  2PFX A;  1KD1 Q;  2MKV A;  2B87 B;  2UWJ E;  3UIA A;  4ZKU A;  1BGY J;  5CJ4 A;  1VQO P;  2R5B A;  1FJP A;  1GW4 A;  3CWB G;  1OVV A;  1HGZ A;  1BCC D;  1VQ8 P;  2L5G B;  1BE3 E;  4AYC A;  4A7P A;  1ZXG A;  1FZB A;  4PD4 H;  2ZJS E;  4PV1 B;  1LP1 A;  3G71 P;  1LT1 A;  1DEB A;  1CI6 B;  1L4A A;  1Q82 Q;  3Q1M A;  1VF5 C;  3HTK B;  3IFM A;  2WQY C;  3D70 A;  1U57 A;  3B4S A;  2BCC E;  1N73 B;  3SFD C;  2OGU A;  1QL1 A;  2HOD B;  5AVY B;  3RK3 D;  3VN0 A;  1SQB K;  4XA4 A;  2OYI A;  2XND H;  3P7K A;  1M1J B;  1MZ9 A;  2VRS A;  1WT6 A;  2B87 A;  1KQF B;  1SQV K;  3H25 A;  4R4M A;  4N78 D;  5AW9 B;  1T3J A;  3E1R A;  5KLV E;  1RF1 C;  3WUU A;  1URQ C;  1YIT P;  2H8P D;  3WUV A;  3VOP A;  1Q81 Q;  1GK4 A;  2QM8 A;  2Y9Y A;  1T2K C;  2CPB A;  2HYN A;  1FDO A;  1IFJ A;  3HUS C;  1CI6 A;  3G4S P;  2CK3 H;  2Q7C A;  5B5E E;  3GMA A;  1LTI C;  4OVN F;  2IBZ E;  3HTK A;  1NAF A;  1N73 A;  2PGD A;  2HOD A;  3M0D C;  2KYV A;  1VF5 D;  1NJI Q;  4EOT A;  3Q5S A;  2QSI A;  2H88 C;  1Y9B A;  1X9V A;  1IFI A;  1J1E C;  3AE1 C;  3MGN A;  4L76 A;  3RK2 C;  3SSU A;  1M1J A;  1M90 Q;  3KZI E;  1BSN A;  3G3Z A;  2I1J A;  4DCK A;  2K1A A;  1FZF A;  3FXE A;  3L75 G;  1IJD B;  1JY3 N;  3A0H H;  5E79 E;  3MD0 A;  5AVX B;  3BVH A;  4IFM A;  5CMZ A;  3OJA B;  1QLE D;  3GW6 A;  1NTM D;  4JBZ A;  5APS A;  1G1I A;  1JMM A;  1RF1 B;  3Q5R A;  1URQ B;  1KYO H;  1GL2 D;  3PTZ A;  3JCU E;  3V4W A;  3II6 A;  2JP3 A;  3L4F A;  3H1L D;  3U59 A;  3Q5P A;  1LTB C;  1KZU B;  3CPW O;  3H1K J;  3V5B A;  2WSC J;  1OXZ A;  1SQX E;  2H7H A;  2IBZ I;  2QVA A;  3LW5 J;  1JY2 P;  3L35 A;  1J1E B;  3OW2 O;  3H1I J;  3RK2 B;  2XU6 A;  2LXB A;  1NTK D;  3C9I A;  2QJP C;  3L74 D;  4OGQ C;  4UB8 E;  2A06 E;  1VPC A;  3L36 A;  1RF1 A;  2HPC B;  1URQ A;  1JCC A;  3H32 B;  1HVV A;  2E75 C;  3K5B A;  1IFD A;  3C8V A;  2YKO A;  3JC2 2;  1BDC A;  3AED C;  2N9Y B;  1NWQ A;  1PPJ D;  1L0L D;  2YO3 A;  2AXT E;  5KAF E;  2FYZ A;  3H1H E;  3EQ2 A;  2M3E A;  5KLV K;  1NU1 E;  2FYU J;  1NYH A;  1T8Z A;  4ASV A;  2RH0 A;  3OA7 A;  2QJK C;  1K04 A;  1MUU A;  1SFC B;  2QJY C;  1JO5 A;  2KI7 B;  1NTZ J;  3SFE C;  3CX5 D;  1KB9 D;  1HF9 A;  1DD3 A;  1GZL A;  1S5L X;  4AUW A;  2WPQ A;  1JOC A;  2B88 A;  3G6E P;  2JEE A;  1JMB A;  1L0N E;  3KYQ A;  2E76 D;  5CCG D;  2SPZ A;  2HPC A;  3L73 D;  3H32 A;  1MKM A;  2YMK A;  1SQQ G;  1PP9 E;  2ZYG A;  2JR8 A;  1RE3 C;  1EZV D;  4OGQ B;  5KJ7 C;  2E75 B;  3HD7 B;  1W2E A;  3CWB D;  3CCQ P;  1BCC J;  3CD6 P;  2K3R A;  2WIT A;  4L73 A;  1VQ4 P;  1KV4 A;  2ZYD A;  1SFC A;  3AEA C;  2H89 C;  1S5L H;  4WY4 D;  2V7Q J;  1BGY E;  4IOI H;  3WU2 H;  3FGA D;  1IZN B;  2OTL P;  1HJ0 A;  1FBM A;  1P84 D;  2QJY B;  3AEE C;  1RF0 C;  3AE9 C;  2R5D A;  3USS A;  1AFO A;  1FAV A;  5GTI H;  2WVR A;  5CCH C;  5APU A;  3D71 A;  4H13 D;  1P84 H;  3BRT B;  5CBO A;  1IC2 A;  5KLI C;  3HD7 A;  1MFZ A;  3L70 G;  5KJ7 D;  2WSF H;  3M9Q A;  2YIU B;  3AEG C;  1SQP G;  2YNY A;  3P8C E;  4C46 A;  2H43 A;  3V2N A;  1KIL D;  1L2P A;  2YO2 A;  2Q3I A;  3H1L G;  2YXR B;  1S1C X;  4DJG A;  1EDK A;  2WPS A;  3CC2 P;  3RL0 B;  3B5N C;  3N4X A;  5AW6 B;  4H44 B;  3IR9 A;  2KS1 B;  3R2P A;  5AW4 B;  2HFE D;  4U3F G;  1U7M A;  2YKP A;  1YYC A;  3I5C A;  2WSE H;  2FYN C;  4N3Y B;  1CZQ A;  5CBN A;  3M0A A;  2OYH B;  4GT1 A;  2KLU A;  2Y0D A;  1VQL P;  4LC1 A;  4I7Z C;  1S4X A;  2OQQ A;  5GTH H;  1NU1 K;  4RES B;  5K5G B;  4Z1M H;  3SWK A;  1NTM K;  3M91 A;  3L75 D;  4ZMD A;  1RE3 A;  2ZVN B;  3WUT A;  4D6T G;  1NTM J;  3ITK A;  5KLI B;  5KAI H;  1ZRT D;  1USD A;  1N2D C;  3WMM 0;  1YQ3 C;  1PPJ G;  4PV1 C;  4W7Z A;  3H1L J;  2WTY A;  2KS1 A;  1YTZ T;  3AEC C;  1RY3 A;  2HG5 D;  2ITA A;  2OYH A;  1SP4 A;  2IPP A;  1T3U A;  1M57 D;  1L4A D;  3S4R A;  3S1K A;  1DX7 A;  2N1T D;  3N7N A;  1GK6 A;  3AE4 C;  1OWA A;  1JEK A;  2JWD A;  3B5N B;  1VDF A;  1HBW A;  4DZO A;  2W8Z A;  1ZLL A;  1S72 P;  1HH0 A;  1M1J C;  2XNX A;  3U1C A;  3E7K A;  3CCL P;  1H8A A;  3L73 G;  1NTK J;  3FWL A;  2IZ1 A;  1G2C B;  2KXP B;  1EC5 A;  2M5A B;  1OZH A;  3L74 J;  3PP5 A;  1ZP0 C;  1NAY A;  3H1K E;  3L72 G;  1EZV G;  2WWW A;  1XTG B;  2WPV B;  2Q6Q A;  4PD4 D;  5CHX A;  5APT A;  3H1I E;  2XZR A;  1N7S B;  1FS0 E;  4PV1 D;  2ZAE B;  1WMK A;  3GG2 A;  1SQV G;  1L0L J;  2ZVO B;  1KQS O;  4YPC A;  3B5N A;  4PJ0 E;  1VQM P;  5AW8 B;  4GOD A;  4HH2 A;  5B5E H;  2WSS H;  4BRY B;  2P1J A;  3A2A A;  1LWU B;  1G2C A;  1IFN A;  2M5A A;  2HR3 A;  2WMM A;  2JDI H;  1HWT C;  2FYU E;  4YXW H;  1DH3 A;  1ZR4 A;  3L71 G;  3I55 P;  1IO4 A;  3KZI H;  1SQQ D;  2P2U A;  1QEX A;  1FZG A;  1NTZ E;  1KQG B;  3D6Z A;  1ZN5 A;  4W7Y A;  1KOR A;  1PFI A;  1N7S A;  2YMY A;  5E79 H;  1K9M Q;  4B86 A;  5AW2 B;  3CWB J;  2QRX A;  3P32 A;  5AW0 B;  3JCU H;  4TT3 H;  4H0L C;  4BRY A;  2AXC A;  5AVZ B;  5CJ0 A;  2YKQ A;  3Q2Y A;  1HTL C;  1S2E A;  4XFJ A;  1QVG O;  1VQN P;  2K88 A;  1LWU A;  4NPF X;  1BCC E;  2O3J A;  2O01 N;  4WVZ A;  3M9B A;  2Z4E A;  3FXD A;  5KKZ C;  2W27 A;  1VQP P;  2BEQ D;  3BCC G;  4ZNC A;  1DD4 A;  4Y28 J;  3CXH D;  1KYO D;  5AW5 B;  1IK7 A;  1URQ D;  1USE A;  4CPG A;  1MV8 A;  4UB8 H;  3MHV A;  2JJL A;  4IFD K;  1BE3 G;  3RK3 E;  3L70 D;  2IFM A;  4IL6 E;  3CXH H;  1K05 A;  4GOF A;  1SQP D;  4UB6 E;  2NPS C;  1T2K D;  3NFQ A;  4C7R A;  1YQ4 C;  1X79 B;  1EDL A;  3PLN A;  3LIE A;  3VMX A;  5APQ A;  3CLQ A;  3CME P;  4N78 E;  2C0W A;  4NPD A;  1SFC C;  2AXT H;  5KAF H;  2IDB A;  2W90 A;  4U3F D;  4H0L B;  3GF3 A;  2JKV A;  4L74 A;  3V2R A;  3GF7 A;  3S9O A;  3RK2 D;  4JF7 A;  4JYC A;  1L0N D;  1QL2 A;  2KK7 A;  1A02 F;  3MZW B;  5KLV G;  1ZW0 A;  5KKZ B;  5AVR B;  4Y99 B;  3KPE A;  2FKW B;  1N7L A;  3L75 J;  1LNQ A;  4AQR D;  1FJK A;  2C9L Y;  3HD7 C;  2KZI A;  1DIP A;  4D6T D;  1K73 Q;  1VL2 A;  5AW7 B;  2O01 J;  3PJS K;  3VYI A;  3O8Z A;  4GOE A;  3BAT A;  2I8D A;  4TLF A;  2FYU K;  1QX8 A;  2IBZ G;  1JTH B;  3MUD C;  2NPS B;  3CL3 D;  1NTZ K;  3TGU E;  2KZJ A;  1NTM E;  1JUN A;  3QWO C;  1NKN A;  3RBX A;  3VMA A;  5DJT B;  1S9K D;  4LGD E;  4DOJ A;  1D7M A;  3H1L E;  1J2J B;  3SWF A;  1PGP A;  3AE6 C;  2XDJ A;  2JO1 A;  4OGQ D;  3M06 A;  4L75 A;  2YIU C;  2E75 D;  3L72 D;  1KQL A;  1FZC B;  1A02 J;  4JQ0 D;  1OW6 A;  3VMZ A;  5BVZ A;  1JTH A;  1FDI A;  2NPS A;  1BDD A;  1SQB D;  1NTK E;  2WZ7 A;  3E1I A;  3L74 E;  3RL0 C;  1FZE A;  4H44 C;  3A0B E;  1SQV D;  1KC8 Q;  2CPS A;  2K37 A;  1PGO A;  3CCJ P;  1SQX G;  2OYH C;  4W80 A;  1NVO A;  2KOG A;  4BWN A;  1CW5 A;  1FOS F;  1NHL A;  2FY8 A;  3AEB C;  1LTS C;  2KIK A;  1PPJ E;  1RHZ B;  1L0L E;  5H2F E;  3CCR P;  3GLM A;  5C39 A;  3IAO A;  1FZC A;  2L91 A;  2QEX P;  1SQQ J;  1Y47 A;  3L71 D;  2WPR A;  1OX3 A;  4NPE A;  3AE8 C;  2N9B A;  3CX5 E;  2FXO A;  1KB9 E;  2O1J A;  4RO0 A;  5CCG A;  2XV5 A;  1M7L A;  2ZFC A;  3L37 A;  3H1H G;  1NU1 G;  3RL0 D;  1LTT C;  3MUD A;  4H44 D;  1DEE G;  3FX0 A;  3AE3 C;  2OYO A;  3H1J D;  5L8R J;  1EZV E;  2P10 A;  1FZA A;  1PV3 A;  2PP6 A;  1RE4 A;  4I6M C;  2FFD B;  3H6P A;  4N6J A;  2ZXE B;  1S5L E;  2FXM A;  3CWB E;  3MIW A;  2Q5U A;  2A45 I;  1RQV A;  3WU2 E;  4EDF A;  1L0N G;  2ZT9 C;  1PP9 G;  1JY3 O;  4R4L A;  1K8A Q;  3W68 A;  3BCC D;  1PL5 A;  5CCH D;  2D2C B;  1LT9 B;  2B9B A;  1FU1 A;  5GTI E; 
#chains in the Genus database with same CATH homology
 4UB8 H;  5TIS H;  5E79 H;  1S5L H;  5KAI H;  5GTI H;  2AXT H;  5GTH H;  3A0B H;  5KAF H;  3WU2 H;  5B5E H;  5H2F H;  4PJ0 H;  5B66 H;  4IL6 H;  3KZI H;  3A0H H;  4UB6 H;  3JCU H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...