5KAFH

Rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Electron transport
total genus 16
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5kafH01
2AXTH 4IL6H 5B66H 5KAIH 3JCUH 1S5LH 4UB6H 3WU2H 4PJ0H 5GTHH 5TISH 3A0HH 5KAFH 5GTIH 5H2FH 3KZIH 3A0BH 4UB8H 5B5EH 5E79H
chains in the Genus database with same CATH superfamily
2YKPA 1Q82Q 1SQXD 1IFJA 2WWWA 1RH5B 3RK3B 1ZOYC 1N73C 1HBWA 3L75E 1N7SD 4UB8H 3M9HA 4ASWA 2P58A 1PP9D 2V7QH 2QVAA 3MD0A 5CMZA 3B71A 3F89A 1SQVK 1SQXG 3EFGA 4OH8B 5TISH 3CCUP 3CX5E 1WT6A 1KQGB 3CC2P 2JWDA 4JYCA 3FWLA 1VQ9P 2IBZI 1T6AA 5APTA 1PP9G 3V4WA 2OYHB 3I55P 1HUCA 4KHXA 3P7KA 1M90Q 1R5LA 1L0NE 3Q5PA 1KQLA 1OW6A 3M06A 1L2PA 4I7ZC 3TNUA 2YMYA 3AEAC 4ASVA 5APVA 1N7SA 4H13B 2PGDA 3AEEC 2XDJA 2Q9IA 2KZIA 1MV8A 1SQXK 2A06D 2NRGA 1NAYA 3BRTB 3M9BA 3L70E 3NXSA 1NJIQ 3CCVP 4IL6X 2C0XA 1ZR4A 2NPSB 1JB0J 2ZYDA 1G1JA 3U1AA 2VRSA 2AEMA 3AE8C 1WMKA 4KJMA 3C1LA 1Q81Q 3FXEA 4U7JA 1AQ5A 1FZAA 3H1JE 1LT9A 3EWKA 1NTKE 2IBZE 2WPRA 2YKOA 5KJ7C 2QG4A 1SFCD 1PZQA 1MZ9A 1P84H 1HF9A 5E79H 1KILD 3V5BA 1HTLC 2BEZF 3H6PA 2KZJA 1QL2A 5BU5A 3IFMA 5BU8B 4UB8E 1L0LE 2IX7C 2Y0DA 1Q86Q 1N8RQ 2O01J 1DX7A 5DJTB 3H1KJ 4L76A 2XKMA 3A7OA 1R8EA 1RF1B 5TISE 4DOJA 3RK3E 1HVVA 3FX0A 2ZT9B 5AVSB 2KUBA 5AVUB 4JYBA 1NTME 3ZDMA 1T3JA 3RK3C 1K8AQ 1FU1A 2OARA 1Q2NA 3NMDA 3B5ND 1P84I 5TJHA 3PH0A 4KT0J 4C46A 1SFCA 3B8EB 3PLNA 5AW8B 1Y47A 1RE4C 2M3EA 1GTWA 1KILA 3HD7D 4N78D 1YJ9P 3RL0B 3P8CE 4DJGA 2AEJA 2Q3IA 3II6A 2OYHC 5AVQB 2J59M 3HUSA 1BCCE 4WY4D 3L73J 2ZJSE 3O8ZA 1VF5B 4U3FJ 5KLVE 1S9KE 4UB6H 2OGUA 1SQQG 1GK6A 1NU1J 2KOGA 1CI6A 3GMAA 3H25A 1KB9I 2AXTE 5C39A 1KN7A 3B5NA 4H13C 1JUNA 2HLOA 3FXDA 3BVHA 2AXCA 1FZBA 5CBNA 3HTKA 3N4XA 1LP1A 3HD7A 2FBWC 1P84E 4EYYQ 1YQ4C 3TNUB 3OA7A 2JDIH 4D6TE 5E79E 1OWAA 3IN6A 1NOHA 1JCDA 4DZOA 5APXA 1H8AA 3AE2C 1N7SB 3OAKA 2FKWB 3CCEP 2NPSC 2KXPB 3H1IE 3OJAB 3EQ2A 1CW5A 3L71E 2FYUE 4WY4A 3SFDC 1BSNA 1YIJP 2GA1A 2POHA 5CCGC 3TYYA 3M9QA 2LR2A 3TGUD 1T2KC 4EIJA 2ZXEB 3L72E 1L0NJ 1LT9B 2QJPB 3W67A 1BGYG 1LTGC 4NPDA 1LTAC 2FYZA 1NH4A 2K37A 1VQ8P 3SSUA 1RF1C 4HH2A 2NPSD 3TGUG 3VMYA 2B89A 2Y0CA 1MFZA 3L74E 2ZT9C 1Y8AA 5EFWB 1VQ6P 4PJ0E 1S5LX 1OX3A 5KLIB 1GU4A 4W7YA 1X79B 1NTZG 3D6YA 1YYCA 3H1LE 1LTJA 3VN0A 1JY2N 1FC2C 3BCCJ 1SQVE 2Q7CA 2WSEH 4UB6E 1R5SA 3Q2YA 3PHLA 1SS1A 2BEQD 3RL0C 5AW1B 2C0WA 2FYNB 3A2AA 2WSCJ 3O6QA 5AVWB 1OIPA 1SFCB 3KZIH 1JMMA 2JWAA 1H0TB 4GODA 4XFJA 1PL5A 3KPEA 1KILB 4I6MC 1L0LJ 2NPSA 1ZXGA 1VF5C 2XZRA 2V7QJ 2MJZA 3TK1A 3G3ZA 2HYNA 3L37A 1NTZK 2HODA 1S5LH 4L75A 3HUSB 1SQXE 1M1JA 3FGAD 2Q5UA 1VQ5P 1YI2P 2O1JA 3AECC 3AE7C 3ABVC 2BASA 1YBKA 4I1LA 1PGQA 2LKMA 3CL3D 4HB1A 1IJDB 1VQNP 1PP9E 1CI6B 1URQD 3JCUE 3V4QA 3B5NB 1N7SC 3L74G 3CXHD 1UIXA 1MFTA 3CCLP 1KYOD 1KQFB 1SQPD 3KQGA 2RKLA 4EDFA 2RH0A 1LP1B 3HD7B 3UIAA 1PGOA 3LW5J 3AE1C 2JO1A 2R5BA 4BXLA 4Y28J 1JEKA 1W2BO 1ZRTD 2W6AA 2QE7H 3V2QA 1J2JB 1LWUA 2R5DA 1BCCJ 1FJKA 5CJ4A 1LT9C 3H1KD 3H1HJ 5KLVJ 2QJPC 3U1CA 2QM8A 4GOEA 1KD1Q 2LXCB 3HE5A 3AE9C 2J58A 3VMAA 1SQBJ 2JKVA 4Z1MH 1ZLLA 1BE3J 2A45H 1URQA 2K1AA 2Y9ZA 2QA4P 2A06E 3VP9A 1GU5A 1DH3A 2ZFCA 3GG2A 3PRJA 5CJ0A 1LTBC 3H1KG 1W5CE 1AVOA 3KZIE 4Y99B 5KLIC 5AW2B 2N9BA 2HG5D 2IYPA 1JM0A 2N1TD 4K3AA 3H1IJ 2W83C 3R4YA 3MZWB 1DD4A 1FZEA 2ZXXA 2FXOA 4LGDE 1QGKB 3SWYA 1ZP0C 1T8ZA 1ZW0A 1S5LE 2KIKA 3FWNA 2YXQB 2OTLP 2FYNC 1HJ0A 2R32A 1NHLA 1SFCC 1JTHB 1LTJB 3L73D 5B66H 1G1IA 1VQMP 1NO4A 4L74A 4U3FD 4WVZA 1D7MA 1KILC 1YQ3C 2WVRA 2WZ7A 1NU1D 1FE6A 4N3YB 4IFMA 1KV4A 1KFMA 3G6EP 3OW2O 3O6QB 1T3UA 4OVNF 1OMIA 2ZYAA 3L73G 3B4SA 2FXMA 1ZMEC 1HGZA 3HUSC 2SPZA 2N1TA 1YTZT 1LT1A 4QMAA 4U3FG 2OYOA 3U59A 2QIWA 3P8MC 3L75D 2YMKA 2A06G 2HODB 2I8DA 5AVZB 1KMIZ 1AFOA 2OTKE 1SQPJ 3H1LJ 1IK9A 2IZ1A 1QVGO 3B5NC 1NYHA 3I56P 3D71A 1M1JB 3S1KA 5AW0B 3CX5D 2BCCJ 1IFPA 4BRYA 2NZ2A 3N7NA 2OTJP 3VMXA 1FAVA 1FOSE 2QSIA 3HD7C 1SQQE 3CMEP 2PFXA 4PV1D 1K9MQ 1OFCX 1GW3A 2JJLA 2ZAEB 5AW6B 1L0ND 3KYQA 1YHQP 2IZ0A 1YTZI 4YTPC 1NU1K 4WY4C 2MKVA 3S4RA 4H0LD 1LWUB 3WUUA 2HPCA 3CWBJ 2W6BA 5CBOA 2WSFJ 1CSBA 2YNYA 2M3BA 1AV1A 1H0TA 2K9YA 4YXDC 3Q1MA 3AE6C 3WUTA 1PFIA 5KAFH 2E74D 4Y99C 5B66E 1N2DC 3HE5B 3BCCD 1WRGA 1K73Q 2KB7P 1URQB 2YIUB 4PD4H 5APQA 5APUA 2FFDB 1BDDA 2K9JA 3H1JD 3TDKA 1NTKD 1HH0A 2IBZD 1IC2A 2G8YA 1BGYE 2H7HA 1Q7YQ 1SLQA 1Y9BA 2LXBA 3BCCG 1L0NK 4OGQD 3TGUE 2WITA 1LTJC 1L0LD 3CXHH 3QWOC 2A45G 2CPSA 3CPWO 2Z5IA 1KYOH 3PJSK 2ZVNB 4AQRD 2E5YA 2R44A 5M1BA 2D2CD 3GLMA 1VQ4P 1NTZE 4JF7A 1EXIA 1GK4A 3CC4P 4PD4I 2O1KA 1EDJA 3AE4C 3L75J 1OW7A 3L4FA 1GD2E 2E42A 1CZQA 3V2RA 2P7JA 1JNMA 2OQQA 5AVYB 3NFQA 1JMBA 1DIPA 2Z5HA 2V4HA 3Q5RA 2FXPA 2N1TB 1M1JC 3CXHI 3P8CD 3AEFC 3VOPA 3L36A 2H43A 1KYOI 2P1JA 1VQPP 1BSHA 2QEXP 3VP8A 4IFFA 5AVVB 1HJBA 2QRXA 3A0HH 5GTIH 3I5CA 1BCCD 1Q90D 3AEBC 1L0LK 1S4XA 3VMZA 2PRRA 5KAFE 3H1HD 5KLVD 4BRYB 4NPEA 2QJYB 2C9NY 3P32A 4PD4E 1SQBD 1FDIA 1S1CX 1A02F 1BE3D 3PTZA 4GT1A 3L70J 3V2NA 1KTMA 1H89A 1QLED 5APYA 3M0DA 1LWUC 1P84D 3H1HG 1RHZB 1XTGB 3MIWA 4H44D 1JTHA 2E76D 1J1DB 1YJNP 1RE3A 1GL2D 2M5AA 1BE3G 4JBZA 5CCHD 1EDLA 3H32A 3CXHE 3H1ID 3H1JJ 2XNXA 1NTKJ 1AA0A 1KYOE 1URQC 4DT0A 3IR9A 2YIUC 2HPCB 2FFDC 4GOFA 5BVZA 4XE5B 2IDBA 3Q5SA 1JY2P 1M8OB 3CCMP 3MTUE 2W6JH 4HJGH 4I2LC 1SQQJ 1HWTC 3Q3DA 1FDOA 1ZRTE 3CCJP 4PV1B 3A3YB 3TF5A 1JY3N 1A02J 4ZNCA 1FDMA 2WTYA 1BDCA 3QH9A 2QJKB 3L72D 4JPZB 4ZKPA 1USEA 2K9JB 5KLVK 3CLQA 1NWQA 2M0BA 1KB9D 3H1KE 2L5GB 1SQBK 2KK7A 2DW3A 1GL2A 2W27A 3M91A 3VTPC 1X9VA 1K04A 1QL1A 1S72P 2GUSA 1NTMJ 5CCHA 1DEEG 3IF4A 3A0BH 4RO0A 4H0LB 1EZVD 1OXZA 1KC8Q 1IZNB 4RESB 3A0HE 1DEBA 5GTIE 1KFNA 1UIIA 2E43A 3EFFK 1YJWP 3M0AA 3W68A 3H1LD 3E1RA 2E74B 4EOTA 2ITAA 2BCCD 1NAFA 5AW3B 1PGPA 1FZCA 2M8RA 2KS1A 3K5BA 2N1TC 2B88A 1IFDA 1EZVG 2XV5A 1BGYJ 1N86A 4XA4A 1KQSO 3GF7A 1GMJA 1PPJD 2IYOA 3SWKA 4O9BA 1SQPG 3SWFA 1LTTC 3L73E 4LC1A 2HFED 4U3FE 1FS0E 4OGQB 4JQ0D 1OVRA 1L4AD 4RKUJ 4GIFA 1U57A 1RF0A 5AVTB 3USSA 1PPJG 4M3LA 2FFDA 2QJYC 1KZUB 5AW9B 2FY8A 1AVYA 1YITP 1RY3A 2D2CB 3WUVA 2WSCH 3CWBD 1X8YA 4D6TJ 4EI2A 2JEEA 3AE5C 3LIDA 3HE4A 4GKGA 3RBXA 1GW4A 2OYIA 5B5EH 1J1DC 1LNQA 1SQPK 2Q3EA 1NGMB 3L71J 1K05A 2FYUJ 5KAIH 3ITKA 2E75D 3NTNA 1VDFA 3CWBG 4TT3H 3V6IA 4W7ZA 4WB4A 1SVFA 1GDTA 4AYCA 1KILE 3T97B 2A45I 1L4AA 4CPGA 2J5UA 2RMZA 2AEFA 3A0BE 2M5AB 3RK2D 4A7PA 1U7JA 1EDKA 2K3RA 1MUUA 3H32B 3L72J 4PV1C 5GTHH 3D6ZA 4NPFX 4RJTA 2QJKC 1EXJA 2Q1KA 2XU6A 4MN4C 1GZLA 3LW5H 3WU2H 3GHGA 3AEDC 1FZGA 1RQVA 3GF3A 3L74J 1OZHA 1M56D 2N9YB 1NU1G 3V2PA 3L35A 5AW4B 3TSIA 3MUDA 2R3SA 4H0LC 2H88C 4L73A 2WPSA 4N78E 1SQVJ 5AVRB 3E1IA 4H44B 3JC22 2GM4A 2E76B 3BCCE 1GL2B 1NKNA 2AXTH 1PGJA 2IPPA 2E74C 2R3CA 4DCKA 2YXRB 3L75G 4IFDK 5APSA 2B87A 1NVOA 2WPQA 3C8VA 1LTSC 1EDIA 2K88A 1QEXA 2WMMA 4W80A 1N7LA 3AEGC 2PAJA 3RGUA 1N73A 4B86A 2P67A 3CCQP 1FZCB 5B5EE 2KS1B 3A5TA 4OGQC 3GW6A 2KNCA 5KAIE 1QX8A 2O01N 3CCSP 1SQXJ 4LLHA 3MHVA 4IL6H 1L0NG 2I1JA 2JR8A 3MGNA 3L70D 1JOCA 1LTIC 2KSJA 1E79H 1DD3A 3MP7B 2D2CC 1AJYA 1IO4A 1NKZB 2WT7A 4YPCA 1PP9J 1VQLP 2ZYGA 2Z4EA 2E5TA 3HRNA 5KJ7D 5GTHE 1KB9H 2YO3A 4K35A 2RN0A 1X22A 2I1KA 3L70G 1J1EB 2H8PD 3BASA 5DJUB 1H88A 2XNDH 3WU2E 3KDPB 3RBZA 1VQKP 1FBMA 3M0DC 1SQQD 1LGHB 3HE4B 4C7NA 2OYIB 1IFNA 4PJ0H 3G4SP 4R4MA 1KORA 2CK3H 2WPVB 1RE3C 2CPBA 3H1JG 3G9RA 1JO5A 1NTKG 1ZR2A 2IBZG 4ZMDA 2QM7A 2Q6QA 1MKMA 2KLUA 3G71P 1IFMA 3H1HE 2G3AA 2WSEJ 3JSVC 3RK3D 1L4AB 1G2CA 5KTBA 1SQBE 2PP6A 1BE3E 5KJ7A 4GDOA 5H2FH 1L0LG 1W2EA 1NTMD 2WSSH 2H89C 1OVVA 2O01H 3F5HA 5L8RJ 2GUVA 1RQUA 4IOIH 3SFEC 2HR3A 1AQTA 1M57D 1ZV8A 3GHGB 1EZVI 1NTKK 1Z56A 5KKZB 1HGVA 1NTMG 4H44C 2E76C 3VYIA 1GL2C 1SP4A 5CCHC 2E75B 3CCRP 1SQQK 1BGYD 2YKQA 4IL6E 2KP8A 2WSFH 4WBAA 4ZKUA 3BRVB 3CC7P 1S3JA 3JCUH 1S9KD 1FOSF 3R2PA 4H13D 4WWIA 5CHXA 3RK2B 1RE4A 2IFNA 1KB9E 1FZCC 1VPCA 2B87B 1E5WA 2KYVA 2YO2A 1M1KQ 1BCCG 1NTZD 1XTCC 2JP3A 1NTMK 1N73B 3BATA 5KLVG 3T97A 4D6TD 2WQYC 3KXDA 4AUWA 1JCCA 1VQ7P 1FJPA 2OYHA 1SQBG 1VL2A 1EZVE 2W8ZA 2B9BA 2KNCB 5AVXB 3L71D 1RF0C 2FYUD 3E7KA 3PP5A 4R4LA 1SQPE 5APWA 1FZFA 5CCGD 2BCCE 3AE3C 4OWFA 4D6TG 1J1EC 2WT7B 2UWJE 1IFIA 1T2KD 1USDA 1PIXA 5AW7B 2Y9YA 4TLFA 5H2FE 2O3JA 1EQ7A 4YXWH 1IK7A 3H1IG 1PPJE 1ZN5A 1JY2O 2KSEA 3L71G 4I7ZB 2FYUG 2OYIC 4N6JA 3CX5H 3CI9A 3LIEA 2ZT9D 3CD6P 1JY3P 3S9OA 2W90A 2IFMA 4PD4D 4C7NB 2P2UA 1L4AC 3L74D 3KHUA 2Y0EA 3L72G 5AW5B 2C9LY 1JY3O 3CWBE 3C9IA 5CCGA 2L91A 2ZVOB 3D70A 1OW8A 3RL0D 1SQVD 2FYUK 4C7RA 1LJ2A 1S2EA 1G2CB 3GHGC 1TU3F 5KKZC 3CX5I 1U7MA 3HTKB 3WMM0 1OVUA 1RF1A 2P10A 2E75C 3RL0g 3H1LG 1VQOP 1VF5D 3MUDC 1SQVG 2BCCG 3CMAP 4BWNA 3TGUJ 1PV3A 2KI7B 1X0TA 5K5GB 1NU1E 2KLVA 1M7LA 3IAOA 3RK2C 4HYTB 1QVFO 4HKZH 4WY4B 1EC5A 1NTZJ
chains in the Genus database with same CATH topology
2AXTH 4IL6H 5B66H 5KAIH 3JCUH 1S5LH 4UB6H 3WU2H 4PJ0H 5GTHH 5TISH 3A0HH 5KAFH 5GTIH 5H2FH 3KZIH 3A0BH 4UB8H 5B5EH 5E79H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXT H;  4IL6 H;  5B66 H;  5KAI H;  3JCU H;  1S5L H;  4UB6 H;  3WU2 H;  4PJ0 H;  5GTH H;  5TIS H;  3A0H H;  5KAF H;  5GTI H;  5H2F H;  3KZI H;  3A0B H;  4UB8 H;  5B5E H;  5E79 H; 
#chains in the Genus database with same CATH topology
 2YKP A;  1Q82 Q;  1SQX D;  1IFJ A;  2WWW A;  1RH5 B;  3RK3 B;  1ZOY C;  1N73 C;  1HBW A;  3L75 E;  1N7S D;  4UB8 H;  3M9H A;  4ASW A;  2P58 A;  1PP9 D;  2V7Q H;  2QVA A;  3MD0 A;  5CMZ A;  3B71 A;  3F89 A;  1SQV K;  1SQX G;  3EFG A;  4OH8 B;  5TIS H;  3CCU P;  3CX5 E;  1WT6 A;  1KQG B;  3CC2 P;  2JWD A;  4JYC A;  3FWL A;  1VQ9 P;  2IBZ I;  1T6A A;  5APT A;  1PP9 G;  3V4W A;  2OYH B;  3I55 P;  1HUC A;  4KHX A;  3P7K A;  1M90 Q;  1R5L A;  1L0N E;  3Q5P A;  1KQL A;  1OW6 A;  3M06 A;  1L2P A;  4I7Z C;  3TNU A;  2YMY A;  3AEA C;  4ASV A;  5APV A;  1N7S A;  4H13 B;  2PGD A;  3AEE C;  2XDJ A;  2Q9I A;  2KZI A;  1MV8 A;  1SQX K;  2A06 D;  2NRG A;  1NAY A;  3BRT B;  3M9B A;  3L70 E;  3NXS A;  1NJI Q;  3CCV P;  4IL6 X;  2C0X A;  1ZR4 A;  2NPS B;  1JB0 J;  2ZYD A;  1G1J A;  3U1A A;  2VRS A;  2AEM A;  3AE8 C;  1WMK A;  4KJM A;  3C1L A;  1Q81 Q;  3FXE A;  4U7J A;  1AQ5 A;  1FZA A;  3H1J E;  1LT9 A;  3EWK A;  1NTK E;  2IBZ E;  2WPR A;  2YKO A;  5KJ7 C;  2QG4 A;  1SFC D;  1PZQ A;  1MZ9 A;  1P84 H;  1HF9 A;  5E79 H;  1KIL D;  3V5B A;  1HTL C;  2BEZ F;  3H6P A;  2KZJ A;  1QL2 A;  5BU5 A;  3IFM A;  5BU8 B;  4UB8 E;  1L0L E;  2IX7 C;  2Y0D A;  1Q86 Q;  1N8R Q;  2O01 J;  1DX7 A;  5DJT B;  3H1K J;  4L76 A;  2XKM A;  3A7O A;  1R8E A;  1RF1 B;  5TIS E;  4DOJ A;  3RK3 E;  1HVV A;  3FX0 A;  2ZT9 B;  5AVS B;  2KUB A;  5AVU B;  4JYB A;  1NTM E;  3ZDM A;  1T3J A;  3RK3 C;  1K8A Q;  1FU1 A;  2OAR A;  1Q2N A;  3NMD A;  3B5N D;  1P84 I;  5TJH A;  3PH0 A;  4KT0 J;  4C46 A;  1SFC A;  3B8E B;  3PLN A;  5AW8 B;  1Y47 A;  1RE4 C;  2M3E A;  1GTW A;  1KIL A;  3HD7 D;  4N78 D;  1YJ9 P;  3RL0 B;  3P8C E;  4DJG A;  2AEJ A;  2Q3I A;  3II6 A;  2OYH C;  5AVQ B;  2J59 M;  3HUS A;  1BCC E;  4WY4 D;  3L73 J;  2ZJS E;  3O8Z A;  1VF5 B;  4U3F J;  5KLV E;  1S9K E;  4UB6 H;  2OGU A;  1SQQ G;  1GK6 A;  1NU1 J;  2KOG A;  1CI6 A;  3GMA A;  3H25 A;  1KB9 I;  2AXT E;  5C39 A;  1KN7 A;  3B5N A;  4H13 C;  1JUN A;  2HLO A;  3FXD A;  3BVH A;  2AXC A;  1FZB A;  5CBN A;  3HTK A;  3N4X A;  1LP1 A;  3HD7 A;  2FBW C;  1P84 E;  4EYY Q;  1YQ4 C;  3TNU B;  3OA7 A;  2JDI H;  4D6T E;  5E79 E;  1OWA A;  3IN6 A;  1NOH A;  1JCD A;  4DZO A;  5APX A;  1H8A A;  3AE2 C;  1N7S B;  3OAK A;  2FKW B;  3CCE P;  2NPS C;  2KXP B;  3H1I E;  3OJA B;  3EQ2 A;  1CW5 A;  3L71 E;  2FYU E;  4WY4 A;  3SFD C;  1BSN A;  1YIJ P;  2GA1 A;  2POH A;  5CCG C;  3TYY A;  3M9Q A;  2LR2 A;  3TGU D;  1T2K C;  4EIJ A;  2ZXE B;  3L72 E;  1L0N J;  1LT9 B;  2QJP B;  3W67 A;  1BGY G;  1LTG C;  4NPD A;  1LTA C;  2FYZ A;  1NH4 A;  2K37 A;  1VQ8 P;  3SSU A;  1RF1 C;  4HH2 A;  2NPS D;  3TGU G;  3VMY A;  2B89 A;  2Y0C A;  1MFZ A;  3L74 E;  2ZT9 C;  1Y8A A;  5EFW B;  1VQ6 P;  4PJ0 E;  1S5L X;  1OX3 A;  5KLI B;  1GU4 A;  4W7Y A;  1X79 B;  1NTZ G;  3D6Y A;  1YYC A;  3H1L E;  1LTJ A;  3VN0 A;  1JY2 N;  1FC2 C;  3BCC J;  1SQV E;  2Q7C A;  2WSE H;  4UB6 E;  1R5S A;  3Q2Y A;  3PHL A;  1SS1 A;  2BEQ D;  3RL0 C;  5AW1 B;  2C0W A;  2FYN B;  3A2A A;  2WSC J;  3O6Q A;  5AVW B;  1OIP A;  1SFC B;  3KZI H;  1JMM A;  2JWA A;  1H0T B;  4GOD A;  4XFJ A;  1PL5 A;  3KPE A;  1KIL B;  4I6M C;  1L0L J;  2NPS A;  1ZXG A;  1VF5 C;  2XZR A;  2V7Q J;  2MJZ A;  3TK1 A;  3G3Z A;  2HYN A;  3L37 A;  1NTZ K;  2HOD A;  1S5L H;  4L75 A;  3HUS B;  1SQX E;  1M1J A;  3FGA D;  2Q5U A;  1VQ5 P;  1YI2 P;  2O1J A;  3AEC C;  3AE7 C;  3ABV C;  2BAS A;  1YBK A;  4I1L A;  1PGQ A;  2LKM A;  3CL3 D;  4HB1 A;  1IJD B;  1VQN P;  1PP9 E;  1CI6 B;  1URQ D;  3JCU E;  3V4Q A;  3B5N B;  1N7S C;  3L74 G;  3CXH D;  1UIX A;  1MFT A;  3CCL P;  1KYO D;  1KQF B;  1SQP D;  3KQG A;  2RKL A;  4EDF A;  2RH0 A;  1LP1 B;  3HD7 B;  3UIA A;  1PGO A;  3LW5 J;  3AE1 C;  2JO1 A;  2R5B A;  4BXL A;  4Y28 J;  1JEK A;  1W2B O;  1ZRT D;  2W6A A;  2QE7 H;  3V2Q A;  1J2J B;  1LWU A;  2R5D A;  1BCC J;  1FJK A;  5CJ4 A;  1LT9 C;  3H1K D;  3H1H J;  5KLV J;  2QJP C;  3U1C A;  2QM8 A;  4GOE A;  1KD1 Q;  2LXC B;  3HE5 A;  3AE9 C;  2J58 A;  3VMA A;  1SQB J;  2JKV A;  4Z1M H;  1ZLL A;  1BE3 J;  2A45 H;  1URQ A;  2K1A A;  2Y9Z A;  2QA4 P;  2A06 E;  3VP9 A;  1GU5 A;  1DH3 A;  2ZFC A;  3GG2 A;  3PRJ A;  5CJ0 A;  1LTB C;  3H1K G;  1W5C E;  1AVO A;  3KZI E;  4Y99 B;  5KLI C;  5AW2 B;  2N9B A;  2HG5 D;  2IYP A;  1JM0 A;  2N1T D;  4K3A A;  3H1I J;  2W83 C;  3R4Y A;  3MZW B;  1DD4 A;  1FZE A;  2ZXX A;  2FXO A;  4LGD E;  1QGK B;  3SWY A;  1ZP0 C;  1T8Z A;  1ZW0 A;  1S5L E;  2KIK A;  3FWN A;  2YXQ B;  2OTL P;  2FYN C;  1HJ0 A;  2R32 A;  1NHL A;  1SFC C;  1JTH B;  1LTJ B;  3L73 D;  5B66 H;  1G1I A;  1VQM P;  1NO4 A;  4L74 A;  4U3F D;  4WVZ A;  1D7M A;  1KIL C;  1YQ3 C;  2WVR A;  2WZ7 A;  1NU1 D;  1FE6 A;  4N3Y B;  4IFM A;  1KV4 A;  1KFM A;  3G6E P;  3OW2 O;  3O6Q B;  1T3U A;  4OVN F;  1OMI A;  2ZYA A;  3L73 G;  3B4S A;  2FXM A;  1ZME C;  1HGZ A;  3HUS C;  2SPZ A;  2N1T A;  1YTZ T;  1LT1 A;  4QMA A;  4U3F G;  2OYO A;  3U59 A;  2QIW A;  3P8M C;  3L75 D;  2YMK A;  2A06 G;  2HOD B;  2I8D A;  5AVZ B;  1KMI Z;  1AFO A;  2OTK E;  1SQP J;  3H1L J;  1IK9 A;  2IZ1 A;  1QVG O;  3B5N C;  1NYH A;  3I56 P;  3D71 A;  1M1J B;  3S1K A;  5AW0 B;  3CX5 D;  2BCC J;  1IFP A;  4BRY A;  2NZ2 A;  3N7N A;  2OTJ P;  3VMX A;  1FAV A;  1FOS E;  2QSI A;  3HD7 C;  1SQQ E;  3CME P;  2PFX A;  4PV1 D;  1K9M Q;  1OFC X;  1GW3 A;  2JJL A;  2ZAE B;  5AW6 B;  1L0N D;  3KYQ A;  1YHQ P;  2IZ0 A;  1YTZ I;  4YTP C;  1NU1 K;  4WY4 C;  2MKV A;  3S4R A;  4H0L D;  1LWU B;  3WUU A;  2HPC A;  3CWB J;  2W6B A;  5CBO A;  2WSF J;  1CSB A;  2YNY A;  2M3B A;  1AV1 A;  1H0T A;  2K9Y A;  4YXD C;  3Q1M A;  3AE6 C;  3WUT A;  1PFI A;  5KAF H;  2E74 D;  4Y99 C;  5B66 E;  1N2D C;  3HE5 B;  3BCC D;  1WRG A;  1K73 Q;  2KB7 P;  1URQ B;  2YIU B;  4PD4 H;  5APQ A;  5APU A;  2FFD B;  1BDD A;  2K9J A;  3H1J D;  3TDK A;  1NTK D;  1HH0 A;  2IBZ D;  1IC2 A;  2G8Y A;  1BGY E;  2H7H A;  1Q7Y Q;  1SLQ A;  1Y9B A;  2LXB A;  3BCC G;  1L0N K;  4OGQ D;  3TGU E;  2WIT A;  1LTJ C;  1L0L D;  3CXH H;  3QWO C;  2A45 G;  2CPS A;  3CPW O;  2Z5I A;  1KYO H;  3PJS K;  2ZVN B;  4AQR D;  2E5Y A;  2R44 A;  5M1B A;  2D2C D;  3GLM A;  1VQ4 P;  1NTZ E;  4JF7 A;  1EXI A;  1GK4 A;  3CC4 P;  4PD4 I;  2O1K A;  1EDJ A;  3AE4 C;  3L75 J;  1OW7 A;  3L4F A;  1GD2 E;  2E42 A;  1CZQ A;  3V2R A;  2P7J A;  1JNM A;  2OQQ A;  5AVY B;  3NFQ A;  1JMB A;  1DIP A;  2Z5H A;  2V4H A;  3Q5R A;  2FXP A;  2N1T B;  1M1J C;  3CXH I;  3P8C D;  3AEF C;  3VOP A;  3L36 A;  2H43 A;  1KYO I;  2P1J A;  1VQP P;  1BSH A;  2QEX P;  3VP8 A;  4IFF A;  5AVV B;  1HJB A;  2QRX A;  3A0H H;  5GTI H;  3I5C A;  1BCC D;  1Q90 D;  3AEB C;  1L0L K;  1S4X A;  3VMZ A;  2PRR A;  5KAF E;  3H1H D;  5KLV D;  4BRY B;  4NPE A;  2QJY B;  2C9N Y;  3P32 A;  4PD4 E;  1SQB D;  1FDI A;  1S1C X;  1A02 F;  1BE3 D;  3PTZ A;  4GT1 A;  3L70 J;  3V2N A;  1KTM A;  1H89 A;  1QLE D;  5APY A;  3M0D A;  1LWU C;  1P84 D;  3H1H G;  1RHZ B;  1XTG B;  3MIW A;  4H44 D;  1JTH A;  2E76 D;  1J1D B;  1YJN P;  1RE3 A;  1GL2 D;  2M5A A;  1BE3 G;  4JBZ A;  5CCH D;  1EDL A;  3H32 A;  3CXH E;  3H1I D;  3H1J J;  2XNX A;  1NTK J;  1AA0 A;  1KYO E;  1URQ C;  4DT0 A;  3IR9 A;  2YIU C;  2HPC B;  2FFD C;  4GOF A;  5BVZ A;  4XE5 B;  2IDB A;  3Q5S A;  1JY2 P;  1M8O B;  3CCM P;  3MTU E;  2W6J H;  4HJG H;  4I2L C;  1SQQ J;  1HWT C;  3Q3D A;  1FDO A;  1ZRT E;  3CCJ P;  4PV1 B;  3A3Y B;  3TF5 A;  1JY3 N;  1A02 J;  4ZNC A;  1FDM A;  2WTY A;  1BDC A;  3QH9 A;  2QJK B;  3L72 D;  4JPZ B;  4ZKP A;  1USE A;  2K9J B;  5KLV K;  3CLQ A;  1NWQ A;  2M0B A;  1KB9 D;  3H1K E;  2L5G B;  1SQB K;  2KK7 A;  2DW3 A;  1GL2 A;  2W27 A;  3M91 A;  3VTP C;  1X9V A;  1K04 A;  1QL1 A;  1S72 P;  2GUS A;  1NTM J;  5CCH A;  1DEE G;  3IF4 A;  3A0B H;  4RO0 A;  4H0L B;  1EZV D;  1OXZ A;  1KC8 Q;  1IZN B;  4RES B;  3A0H E;  1DEB A;  5GTI E;  1KFN A;  1UII A;  2E43 A;  3EFF K;  1YJW P;  3M0A A;  3W68 A;  3H1L D;  3E1R A;  2E74 B;  4EOT A;  2ITA A;  2BCC D;  1NAF A;  5AW3 B;  1PGP A;  1FZC A;  2M8R A;  2KS1 A;  3K5B A;  2N1T C;  2B88 A;  1IFD A;  1EZV G;  2XV5 A;  1BGY J;  1N86 A;  4XA4 A;  1KQS O;  3GF7 A;  1GMJ A;  1PPJ D;  2IYO A;  3SWK A;  4O9B A;  1SQP G;  3SWF A;  1LTT C;  3L73 E;  4LC1 A;  2HFE D;  4U3F E;  1FS0 E;  4OGQ B;  4JQ0 D;  1OVR A;  1L4A D;  4RKU J;  4GIF A;  1U57 A;  1RF0 A;  5AVT B;  3USS A;  1PPJ G;  4M3L A;  2FFD A;  2QJY C;  1KZU B;  5AW9 B;  2FY8 A;  1AVY A;  1YIT P;  1RY3 A;  2D2C B;  3WUV A;  2WSC H;  3CWB D;  1X8Y A;  4D6T J;  4EI2 A;  2JEE A;  3AE5 C;  3LID A;  3HE4 A;  4GKG A;  3RBX A;  1GW4 A;  2OYI A;  5B5E H;  1J1D C;  1LNQ A;  1SQP K;  2Q3E A;  1NGM B;  3L71 J;  1K05 A;  2FYU J;  5KAI H;  3ITK A;  2E75 D;  3NTN A;  1VDF A;  3CWB G;  4TT3 H;  3V6I A;  4W7Z A;  4WB4 A;  1SVF A;  1GDT A;  4AYC A;  1KIL E;  3T97 B;  2A45 I;  1L4A A;  4CPG A;  2J5U A;  2RMZ A;  2AEF A;  3A0B E;  2M5A B;  3RK2 D;  4A7P A;  1U7J A;  1EDK A;  2K3R A;  1MUU A;  3H32 B;  3L72 J;  4PV1 C;  5GTH H;  3D6Z A;  4NPF X;  4RJT A;  2QJK C;  1EXJ A;  2Q1K A;  2XU6 A;  4MN4 C;  1GZL A;  3LW5 H;  3WU2 H;  3GHG A;  3AED C;  1FZG A;  1RQV A;  3GF3 A;  3L74 J;  1OZH A;  1M56 D;  2N9Y B;  1NU1 G;  3V2P A;  3L35 A;  5AW4 B;  3TSI A;  3MUD A;  2R3S A;  4H0L C;  2H88 C;  4L73 A;  2WPS A;  4N78 E;  1SQV J;  5AVR B;  3E1I A;  4H44 B;  3JC2 2;  2GM4 A;  2E76 B;  3BCC E;  1GL2 B;  1NKN A;  2AXT H;  1PGJ A;  2IPP A;  2E74 C;  2R3C A;  4DCK A;  2YXR B;  3L75 G;  4IFD K;  5APS A;  2B87 A;  1NVO A;  2WPQ A;  3C8V A;  1LTS C;  1EDI A;  2K88 A;  1QEX A;  2WMM A;  4W80 A;  1N7L A;  3AEG C;  2PAJ A;  3RGU A;  1N73 A;  4B86 A;  2P67 A;  3CCQ P;  1FZC B;  5B5E E;  2KS1 B;  3A5T A;  4OGQ C;  3GW6 A;  2KNC A;  5KAI E;  1QX8 A;  2O01 N;  3CCS P;  1SQX J;  4LLH A;  3MHV A;  4IL6 H;  1L0N G;  2I1J A;  2JR8 A;  3MGN A;  3L70 D;  1JOC A;  1LTI C;  2KSJ A;  1E79 H;  1DD3 A;  3MP7 B;  2D2C C;  1AJY A;  1IO4 A;  1NKZ B;  2WT7 A;  4YPC A;  1PP9 J;  1VQL P;  2ZYG A;  2Z4E A;  2E5T A;  3HRN A;  5KJ7 D;  5GTH E;  1KB9 H;  2YO3 A;  4K35 A;  2RN0 A;  1X22 A;  2I1K A;  3L70 G;  1J1E B;  2H8P D;  3BAS A;  5DJU B;  1H88 A;  2XND H;  3WU2 E;  3KDP B;  3RBZ A;  1VQK P;  1FBM A;  3M0D C;  1SQQ D;  1LGH B;  3HE4 B;  4C7N A;  2OYI B;  1IFN A;  4PJ0 H;  3G4S P;  4R4M A;  1KOR A;  2CK3 H;  2WPV B;  1RE3 C;  2CPB A;  3H1J G;  3G9R A;  1JO5 A;  1NTK G;  1ZR2 A;  2IBZ G;  4ZMD A;  2QM7 A;  2Q6Q A;  1MKM A;  2KLU A;  3G71 P;  1IFM A;  3H1H E;  2G3A A;  2WSE J;  3JSV C;  3RK3 D;  1L4A B;  1G2C A;  5KTB A;  1SQB E;  2PP6 A;  1BE3 E;  5KJ7 A;  4GDO A;  5H2F H;  1L0L G;  1W2E A;  1NTM D;  2WSS H;  2H89 C;  1OVV A;  2O01 H;  3F5H A;  5L8R J;  2GUV A;  1RQU A;  4IOI H;  3SFE C;  2HR3 A;  1AQT A;  1M57 D;  1ZV8 A;  3GHG B;  1EZV I;  1NTK K;  1Z56 A;  5KKZ B;  1HGV A;  1NTM G;  4H44 C;  2E76 C;  3VYI A;  1GL2 C;  1SP4 A;  5CCH C;  2E75 B;  3CCR P;  1SQQ K;  1BGY D;  2YKQ A;  4IL6 E;  2KP8 A;  2WSF H;  4WBA A;  4ZKU A;  3BRV B;  3CC7 P;  1S3J A;  3JCU H;  1S9K D;  1FOS F;  3R2P A;  4H13 D;  4WWI A;  5CHX A;  3RK2 B;  1RE4 A;  2IFN A;  1KB9 E;  1FZC C;  1VPC A;  2B87 B;  1E5W A;  2KYV A;  2YO2 A;  1M1K Q;  1BCC G;  1NTZ D;  1XTC C;  2JP3 A;  1NTM K;  1N73 B;  3BAT A;  5KLV G;  3T97 A;  4D6T D;  2WQY C;  3KXD A;  4AUW A;  1JCC A;  1VQ7 P;  1FJP A;  2OYH A;  1SQB G;  1VL2 A;  1EZV E;  2W8Z A;  2B9B A;  2KNC B;  5AVX B;  3L71 D;  1RF0 C;  2FYU D;  3E7K A;  3PP5 A;  4R4L A;  1SQP E;  5APW A;  1FZF A;  5CCG D;  2BCC E;  3AE3 C;  4OWF A;  4D6T G;  1J1E C;  2WT7 B;  2UWJ E;  1IFI A;  1T2K D;  1USD A;  1PIX A;  5AW7 B;  2Y9Y A;  4TLF A;  5H2F E;  2O3J A;  1EQ7 A;  4YXW H;  1IK7 A;  3H1I G;  1PPJ E;  1ZN5 A;  1JY2 O;  2KSE A;  3L71 G;  4I7Z B;  2FYU G;  2OYI C;  4N6J A;  3CX5 H;  3CI9 A;  3LIE A;  2ZT9 D;  3CD6 P;  1JY3 P;  3S9O A;  2W90 A;  2IFM A;  4PD4 D;  4C7N B;  2P2U A;  1L4A C;  3L74 D;  3KHU A;  2Y0E A;  3L72 G;  5AW5 B;  2C9L Y;  1JY3 O;  3CWB E;  3C9I A;  5CCG A;  2L91 A;  2ZVO B;  3D70 A;  1OW8 A;  3RL0 D;  1SQV D;  2FYU K;  4C7R A;  1LJ2 A;  1S2E A;  1G2C B;  3GHG C;  1TU3 F;  5KKZ C;  3CX5 I;  1U7M A;  3HTK B;  3WMM 0;  1OVU A;  1RF1 A;  2P10 A;  2E75 C;  3RL0 g;  3H1L G;  1VQO P;  1VF5 D;  3MUD C;  1SQV G;  2BCC G;  3CMA P;  4BWN A;  3TGU J;  1PV3 A;  2KI7 B;  1X0T A;  5K5G B;  1NU1 E;  2KLV A;  1M7L A;  3IAO A;  3RK2 C;  4HYT B;  1QVF O;  4HKZ H;  4WY4 B;  1EC5 A;  1NTZ J; 
#chains in the Genus database with same CATH homology
 2AXT H;  4IL6 H;  5B66 H;  5KAI H;  3JCU H;  1S5L H;  4UB6 H;  3WU2 H;  4PJ0 H;  5GTH H;  5TIS H;  3A0H H;  5KAF H;  5GTI H;  5H2F H;  3KZI H;  3A0B H;  4UB8 H;  5B5E H;  5E79 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...