5BVZA

Hk620 tail needle crystallized at ph 9 (crystal form ii)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
180
structure length
180
Chain Sequence
QGAYDAQVKNDEQDVELADHDARIAANTKAINILEVRLTTAEGKIVVLRSDVDYLLDEVIDIQAHLVTVDQRLDGVESDVSDIKSDYVSKTVTESQSLASPLDVKTSYSVDGIQVVGARQTGWTAATGTPLLGSFNANQSYTVGTTYTQSEVAALATGLEQARQRILALETALRLHGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Plasticity of the Protein Plug That Traps Newly Packaged Genomes in Podoviridae Virions.
pubmed doi rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords DNA stabilization protein
total genus 58
structure length 180
sequence length 180
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5bvzA01
3OJAB 4ZKPA 5BU5A 4N78D 4I1LA 3N7NA 3C9IA 1X79B 5KTBA 3U1AA 3VP8A 3U1CA 4ZKUA 2POHA 1IC2A 2JEEA 3HRNA 3BASA 3VP9A 4O9BA 1NKNA 1WT6A 3N4XA 3P8CD 5BU8B 4N3YB 3U59A 2FXMA 5BVZA 3BATA 4GIFA
chains in the Genus database with same CATH superfamily
1YQ3C 3VYIA 5BU5A 2QEXP 2WSEH 5AW6B 5APSA 3RK2C 3HE5B 2FKWB 2M3BA 1NTMG 3QH9A 3CPWO 5AW2B 3RK3D 1BCCE 4XA4A 3Q5RA 4PD4I 1HGZA 3GMAA 2LR2A 2YXRB 1PPJE 1K04A 2OYIA 1ZOYC 3HTKA 4PD4H 3MIWA 1VQ5P 4Z1MH 1N8RQ 1H8AA 5APTA 1NTZD 2K1AA 3V6IA 5KLVJ 1QX8A 3GLMA 1UIXA 4JF7A 2IBZI 2B87B 2IBZG 1ZRTD 2FYNB 5K5GB 4PD4E 1EDKA 3L35A 3AE6C 3NMDA 4UB6E 5CHXA 1T2KC 4O9BA 3PRJA 3P8MC 2E76B 2YO2A 4HKZH 3CCVP 2GM4A 5BU8B 4N3YB 3H25A 1DD3A 3A0BH 2ZT9B 3G6EP 1QL2A 4UB6H 5TJHA 1L0LD 1AVYA 3ZDMA 3CC4P 2BEQD 2HYNA 4CPGA 2N9YB 3H6PA 3RGUA 1KB9I 3EQ2A 3A7OA 3GHGB 1MUUA 3WUUA 3HD7D 3TGUJ 3B5ND 4GDOA 1RF1B 2O01H 4I7ZB 3CXHE 4H0LB 5M1BA 3CMEP 3MGNA 1FE6A 1NAYA 3Q5SA 1P84E 3HD7C 4W80A 4AUWA 1VQOP 4DZOA 3P8CE 1VQLP 2B87A 1BE3D 3CWBG 1W5CE 4D6TG 1S9KD 2IBZE 3EFFK 4C7NB 1NTKG 5KLVE 1OFCX 3JC22 2PFXA 1N73C 1WT6A 1LTGC 3L73D 2W8ZA 1BE3G 5H2FH 1Q2NA 4D6TD 1IFDA 3M9BA 2Q7CA 1NU1J 3FWNA 1M7LA 1EDIA 2Y9ZA 4IOIH 1QLED 1SQVK 3HUSC 1DEBA 2OQQA 3C8VA 5AW8B 3G3ZA 2C0XA 1YI2P 3H1HG 1KV4A 3RL0g 1EDLA 1K73Q 2IDBA 3JCUE 3CXHI 2G3AA 2QIWA 3KDPB 1ZN5A 4H44D 2N9BA 2R3CA 1FZBA 2KP8A 1LTJB 2FYZA 2OYOA 2W6BA 3WUVA 3I5CA 3NXSA 1ZR2A 3CCJP 2YNYA 5AVTB 1EZVG 1SQBD 2E43A 3D71A 2ZAEB 3GW6A 2PAJA 2OYHA 5CBNA 1FBMA 2M0BA 1YTZI 1GK6A 1VQPP 1QGKB 2CK3H 2K9JA 4BXLA 2Q6QA 3M91A 1S72P 1NJIQ 3N4XA 3VMXA 3H1IE 4H13C 3V5BA 1GU4A 2BCCE 2D2CB 5CCGA 3K5BA 4DJGA 5BVZA 1NU1K 2JDIH 2QVAA 3PJSK 4GIFA 1Q81Q 3IAOA 1BSHA 1PIXA 2E75B 3P7KA 3SWYA 1KC8Q 2FXPA 4EYYQ 3C9IA 5B5EH 1M57D 1BCCG 1FOSF 1JM0A 1FZAA 4HB1A 1NU1E 1L0NK 3CLQA 1SQPJ 2Z4EA 5AW7B 4OH8B 1KB9D 2O3JA 3BCCJ 3HE4A 1LTJA 1S3JA 1GW3A 3BRTB 3G9RA 3AE7C 2YKQA 3FWLA 3V4QA 1OX3A 2Q9IA 1NAFA 1SQBK 2G8YA 2JKVA 3RL0C 4GODA 3H1LJ 3SFDC 1H88A 1SFCA 5B66H 2NPSD 1KFNA 3SFEC 2OYIC 3S1KA 2PRRA 3H1JE 4EDFA 1IFIA 1L0LG 2IBZD 2C9LY 2OTKE 5E79E 5APYA 2HLOA 3WUTA 1BE3E 4ASVA 1H0TA 1NHLA 1ZLLA 4IL6X 2I8DA 3FXDA 5CJ4A 1KB9E 3PP5A 2H7HA 2IZ0A 2JWAA 3L73G 3TNUB 1HVVA 3USSA 2Q3IA 1YJWP 2FYUD 1L0NJ 2E75C 3RBZA 1YYCA 1LTJC 3CX5E 3VP8A 2FBWC 1MFTA 2YMYA 4N6JA 5GTHE 1NU1D 2WT7A 3HE4B 1MKMA 2ITAA 2J5UA 2K9YA 2KOGA 3H1LE 2E75D 2QJKB 3L73J 1M1JC 1L0NE 2LKMA 3E7KA 2FY8A 1AVOA 1KILE 1JCCA 1SFCC 3CXHD 1OW8A 5AW5B 3RK2B 4OVNF 4PV1B 2K88A 4HYTB 2M3EA 1G2CB 5H2FE 1J1DC 5KKZB 1VQMP 1M1JA 1OVVA 5AVWB 1BE3J 1UIIA 1ZMEC 1SLQA 1NKNA 3O6QB 1SQBE 3L72J 1HF9A 1AJYA 2J58A 3WU2H 1EXJA 1H0TB 4OGQD 5AVVB 2W90A 4W7YA 5L8RJ 2QM8A 2IZ1A 3JCUH 4TLFA 2M5AA 4JYCA 2O1JA 5KJ7D 5C39A 4N78D 5KLVK 2O1KA 3TGUD 4L76A 4H44B 3A0BE 3CCSP 3SSUA 2R5DA 1Q7YQ 1IFMA 2CPBA 1E79H 1L0LJ 1NH4A 2B88A 3AE2C 2WT7B 1FAVA 1SQQK 3TGUG 1KYOD 2GUSA 3VOPA 2JR8A 4D6TE 1GL2D 4L73A 3L74J 4XFJA 2LXBA 5GTHH 1SVFA 1USDA 3S4RA 4WBAA 3GHGC 2OYHC 1JMBA 1DEEG 5AVYB 2I1JA 1A02F 1BGYG 1PPJD 1JO5A 1FZCC 5KLIC 5AW4B 2Y0DA 1JUNA 2H8PD 1HJ0A 1IK7A 1NTKD 1ZXGA 3AEFC 3O6QA 5KLVD 3RK3E 1NTZJ 1EZVD 1N7SA 1SQBG 3EWKA 4YTPC 2JP3A 1L4AB 3U59A 2ZYGA 4DCKA 3AECC 3BATA 4OWFA 5CBOA 2WZ7A 3IR9A 4ZKPA 2XU6A 1CZQA 1PV3A 2BASA 3PH0A 5CMZA 5AW1B 1YIJP 3L75G 3L71E 3AEGC 2K3RA 3WU2E 3L70J 4B86A 5AW3B 3CCEP 1SQQG 2XNXA 3C1LA 4R4LA 3II6A 3KZIE 5AW0B 1T8ZA 1RF1A 3ABVC 2ZT9C 3T97B 4GT1A 1RHZB 3G71P 2YO3A 3LIEA 3TYYA 2BCCD 2YXQB 1YITP 2AXTE 3O8ZA 1LTSC 2WITA 3M0DC 3R4YA 4JQ0D 4AYCA 2ZT9D 3D70A 3L71J 1NTZK 1YBKA 5APVA 2LXCB 5E79H 4PD4D 1LWUC 4A7PA 2HFED 4AQRD 4C7NA 3B5NA 3G4SP 1LT9A 1RF0C 2KB7P 1LTTC 4H0LC 1KB9H 2Q3EA 3AE9C 2HODA 2VRSA 1L0LE 1N7SB 1JY2O 1NTZE 1SQVJ 2XKMA 4GOFA 2WSCJ 1L4AA 1GL2B 4I2LC 2QJYB 2FXMA 3H1KG 2HR3A 3UIAA 4DOJA 1KD1Q 1K05A 2V7QJ 2WSFJ 1N7SD 3AEAC 1DD4A 1LWUA 1BGYJ 1IK9A 1FU1A 1FOSE 1M8OB 2B9BA 2ZVOB 1X79B 3IFMA 3MHVA 4OGQC 4LLHA 3TDKA 1IFPA 1MZ9A 5KJ7C 4WY4A 3RK3B 1FDMA 1DIPA 3L74G 1SQXD 3B8EB 3T97A 1KTMA 4YXWH 2IYPA 4U3FD 5B5EE 4IFFA 5KJ7A 1GK4A 1URQC 2KNCA 1J1DB 2N1TC 3B71A 3E1RA 4JPZB 1IO4A 2ZXEB 1DX7A 1PP9G 1QEXA 2SPZA 2NRGA 4RESB 2E74D 4IFMA 4U3FJ 3BCCG 3V2NA 3VP9A 1SQQD 1GL2C 1A02J 2PP6A 1SQXJ 1NTMD 2K9JB 3B5NB 1L4AC 1NTKE 4R4MA 1SQVG 4BRYB 2HODB 2FFDC 2E42A 2E74C 3RK2D 2AEMA 2IPPA 3H1IG 1OXZA 1GL2A 1ZR4A 2KIKA 2IYOA 4JBZA 5B66E 1KILB 3CCUP 1L4AD 4ZMDA 1QVGO 1FZCB 1VQ8P 1KQGB 1LJ2A 3OJAB 2R3SA 5CCHC 4LGDE 2AEFA 1LWUB 2KSJA 4WWIA 4C46A 1DH3A 2QRXA 2ZJSE 4KHXA 1M56D 1SQQE 2W83C 3L71G 3H32B 2BEZF 4U3FE 5CJ0A 1JTHB 1IFJA 1SQVD 3AE3C 3EFGA 2A06E 3AEBC 3VMYA 1W2EA 1VPCA 2C0WA 3LW5H 1LP1A 1VQ9P 5APQA 4EI2A 1P84I 1AQTA 2W6AA 3M0AA 3RK3C 3H1KD 3L70E 4N78E 2M8RA 1WMKA 3CX5H 5CCGD 3CC7P 4IFDK 2PGDA 3L75J 1YQ4C 2W27A 2JJLA 1RE3C 3L70G 1KN7A 3BASA 1Y8AA 1L0NG 4H13D 1GMJA 5KKZC 1BGYE 3NTNA 5CCGC 1RE4C 2J59M 5DJUB 2D2CC 2P10A 3JSVC 2QJYC 3MUDC 2Q1KA 1AQ5A 1LT9C 1RF0A 3H1KE 1NTZG 1U57A 3L70D 3AEEC 2V4HA 1CSBA 4K3AA 4OGQB 3V2PA 4RJTA 3MUDA 1YTZT 1BCCJ 1FZCA 3KZIH 4W7ZA 1KYOI 5KAIH 2YKPA 2WQYC 4EOTA 1Q82Q 3I55P 3CCQP 2NPSA 2L91A 4HH2A 1JTHA 2QJKC 2AXTH 1M90Q 1URQB 2N1TB 2R32A 1NTKJ 2FYUG 2A45I 2W6JH 3H1IJ 4PV1D 5KAIE 1YJ9P 1JY3O 1FZFA 3CWBJ 1HTLC 1XTGB 3OAKA 5AW9B 3PTZA 3CL3D 4RKUJ 2WWWA 3B5NC 4UB8E 4PJ0E 1D7MA 1HH0A 5AVQB 2HPCA 1VQKP 3L74D 1LTAC 2QSIA 1KORA 3CX5D 1EQ7A 2YIUB 4XE5B 1FZEA 1Y47A 1L2PA 1VF5D 3FX0A 2R44A 3AE5C 1JY3N 1KQFB 3S9OA 2XNDH 1KILC 1JY2N 3M0DA 1EXIA 3L72E 3CCMP 3CCRP 1G1IA 2OGUA 1OVRA 1VF5C 2KS1B 3OA7A 1USEA 3V2RA 3H1HJ 3H1JD 2H88C 2WPRA 1NKZB 2M5AB 1SQPE 2WPSA 3B4SA 3L37A 4I6MC 2FYUK 1S5LE 3HUSB 3M06A 1KMIZ 3N7NA 4I1LA 3L73E 1JB0J 1NU1G 2E5TA 2NPSB 2QE7H 3KQGA 1VQNP 1NYHA 3L72D 5CCHD 1URQA 2N1TA 2IFNA 1PFIA 1SFCD 4GOEA 4ZKUA 3AE1C 3L4FA 5AVRB 1KYOE 1NO4A 2FXOA 2UWJE 3TGUE 1KQSO 1X0TA 4WY4C 3KYQA 1NTKK 1PGJA 3A0HH 4H44C 2JEEA 2KUBA 3I56P 1NWQA 1PGQA 3CWBE 1SQXG 1AA0A 3MP7B 2P1JA 4RO0A 4BWNA 3MZWB 2CPSA 2H43A 3F89A 2P7JA 3AE4C 2RH0A 1L0ND 3FGAD 2FYUJ 4QMAA 2KS1A 3Q1MA 3CCLP 3KXDA 1HGVA 1ZV8A 2D2CD 3LIDA 5DJTB 5APXA 2IFMA 2Z5HA 2MKVA 1FC2C 1GW4A 1L0LK 2GUVA 2OARA 4IL6E 5TISE 3TK1A 1RQVA 1OWAA 5KAFE 3H1HE 2KSEA 4WB4A 2KZJA 1VL2A 1CI6B 2FYUE 2KLVA 3A2AA 3V4WA 2JO1A 2POHA 2Q5UA 3U1CA 3H1LD 3CC2P 1OW6A 1RE4A 2KZIA 2Y9YA 1PL5A 2ZVNB 1NVOA 4PV1C 2E76D 4U7JA 2B89A 1Q90D 2XV5A 2OTJP 3NFQA 2Y0EA 1KFMA 1KYOH 3HD7A 3RL0B 5KLVG 3A5TA 3BCCD 1LT9B 1RY3A 3L72G 5KLIB 3Q5PA 1BDCA 2A06D 1SQPD 1J1EC 2E76C 3BCCE 3D6ZA 3Q2YA 3RL0D 2WMMA 1S2EA 1KQLA 1R5SA 2JWDA 2QG4A 5AVXB 4I7ZC 4NPDA 2NPSC 3R2PA 3WMM0 3L36A 1Q86Q 1N73A 2IX7C 3VN0A 1OVUA 1JMMA 1K9MQ 3PHLA 1P84D 1GZLA 2I1KA 2A06G 3E1IA 5GTIH 3CMAP 1GU5A 2KK7A 3GHGA 5AVSB 1GTWA 1S9KE 5EFWB 1JY3P 4WY4B 3TF5A 2R5BA 3H1HD 3H1JJ 2O01N 1CI6A 5GTIE 4IL6H 3GF7A 1IFNA 1N2DC 3RBXA 1R8EA 1HBWA 1NOHA 4ASWA 4K35A 4MN4C 1EC5A 2A45H 2E5YA 2KNCB 1SQBJ 4H0LD 1E5WA 1XTCC 4YPCA 2RN0A 1RE3A 4JYBA 2FYNC 3HD7B 3AEDC 2WTYA 4WY4D 1K8AQ 4TT3H 3CI9A 3VTPC 1FDIA 1X8YA 4BRYA 1EDJA 1GD2E 3H1JG 3CWBD 4YXDC 1S5LX 1AFOA 2BCCG 1J1EB 1KILA 1N73B 2WSFH 3H1ID 3AE8C 2HG5D 1TU3F 1VQ6P 4ZNCA 1PGOA 1J2JB 2WSCH 1OMIA 2XDJA 4D6TJ 3H32A 3D6YA 1P84H 2P67A 1ZRTE 3MTUE 3P32A 2A45G 2P2UA 3A0HE 1BCCD 3CX5I 4DT0A 1LP1B 1WRGA 2DW3A 1LTBC 2RKLA 2WPQA 2WSSH 3W68A 1JY2P 2RMZA 3QWOC 1CW5A 1VQ7P 2C9NY 2P58A 3W67A 3GG2A 4Y28J 1OW7A 4LC1A 1JEKA 5AVUB 3ITKA 1Y9BA 1FDOA 1VDFA 3H1LG 1FS0E 1X22A 2YIUC 2OYHB 3M9QA 3OW2O 1S4XA 1QL1A 1SS1A 3IF4A 2QJPC 4NPEA 2ZXXA 4UB8H 4PJ0H 3L75D 5AVZB 1SQVE 2Y0CA 1NGMB 2AEJA 3H1KJ 5TISH 1LTIC 2ZYAA 5KAFH 2V7QH 1HWTC 1ZP0C 3BVHA 1GDTA 2Z5IA 1BDDA 1NTME 1RQUA 4NPFX 2QM7A 4KT0J 1VQ4P 3L75E 5APUA 3SWKA 2KLUA 3L74E 1SQPK 1T3UA 3A3YB 4WVZA 1S5LH 1AV1A 1JOCA 1T6AA 1FZGA 3KHUA 2H89C 2YMKA 2KXPB 1W2BO 1SQXE 1T2KD 2HPCB 1N7LA 1IC2A 3FXEA 1HJBA 1MV8A 1NTMJ 3CXHH 3HRNA 4HJGH 1EZVI 1SQQJ 5CCHA 3M9HA 1SFCB 2WVRA 1BSNA 1M1KQ 2NZ2A 1JNMA 1N86A 1SQXK 1JCDA 1X9VA 2GA1A 2ZYDA 2MJZA 3IN6A 2ZFCA 2WSEJ 3KPEA 1U7JA 3PLNA 4H13B 3VMAA 2QJPB 2QA4P 2FFDA 2OTLP 4C7RA 2YKOA 1T3JA 1FJPA 1HUCA 4U3FG 4Y99C 1G1JA 1R5LA 3V2QA 1LGHB 4KJMA 1QVFO 2O01J 1SQPG 3HUSA 3LW5J 3TNUA 3HE5A 1PP9J 1BGYD 1PPJG 3MD0A 1LNQA 5KTBA 3U1AA 1YJNP 1LT1A 1N7SC 1Z56A 3BRVB 4L74A 3GF3A 3CD6P 1VF5B 2WPVB 1U7MA 1NTMK 1IZNB 3SWFA 2OYIB 1OIPA 3HTKB 2L5GB 1PP9E 3VMZA 1RF1C 1ZW0A 2KYVA 1KILD 1KZUB 1S1CX 1FJKA 1G2CA 4M3LA 1EZVE 1M1JB 1MFZA 5APWA 1URQD 2N1TD 3L71D 3TSIA 1SP4A 1OZHA 4Y99B 1YHQP 3P8CD 2AXCA 2K37A 3F5HA 2E74B 4L75A 4EIJA 1IJDB 2BCCJ 3Q3DA 1PGPA 2FFDB 1PP9D 1PZQA 1RH5B 1H89A 2KI7B 4GKGA 2XZRA
chains in the Genus database with same CATH topology
3VYIA 5BU5A 2WSEH 5AW6B 5APSA 3RK2C 3HE5B 2FKWB 2M3BA 5AW2B 3RK3D 4XA4A 1HGZA 2OYIA 3HTKA 3MIWA 1H8AA 5APTA 4JF7A 3L35A 3NMDA 1T2KC 5CHXA 4O9BA 3P8MC 2YO2A 5BU8B 4N3YB 1QL2A 2HYNA 3H6PA 3EQ2A 3A7OA 3GHGB 1MUUA 3HD7D 3B5ND 1RF1B 2O01H 3MGNA 3HD7C 4W80A 4AUWA 4DZOA 3P8CE 1S9KD 4C7NB 1N73C 1WT6A 1LTGC 1IFDA 3M9BA 2Q7CA 1M7LA 3HUSC 1SQVK 5AW8B 1DEBA 3G3ZA 2C0XA 3KDPB 1ZN5A 2N9BA 2R3CA 1FZBA 2KP8A 1LTJB 2FYZA 2W6BA 3I5CA 3NXSA 1ZR2A 2YNYA 5AVTB 2E43A 2PAJA 2OYHA 1FBMA 1YTZI 1GK6A 3M91A 3N4XA 3VMXA 3V5BA 1GU4A 5CCGA 5BVZA 1NU1K 4GIFA 3P7KA 3SWYA 3C9IA 1FOSF 1FZAA 3CLQA 1L0NK 2Z4EA 5AW7B 4OH8B 3HE4A 1LTJA 3BRTB 1GW3A 2YKQA 3V4QA 1NAFA 1SQBK 3RL0C 1SFCA 2NPSD 1KFNA 2OYIC 1IFIA 2C9LY 5APYA 2HLOA 1NHLA 1ZLLA 5CJ4A 3PP5A 2H7HA 3TNUB 1HVVA 2Q3IA 1YYCA 1LTJC 3VP8A 2YMYA 4N6JA 2WT7A 3HE4B 2KOGA 1M1JC 2LKMA 5KLVK 3RK2B 1JCCA 1SFCC 5AW5B 4HYTB 1G2CB 1J1DC 1M1JA 5AVWB 1SLQA 1NKNA 2J58A 5AVVB 4W7YA 2QM8A 5KJ7D 4JYCA 2O1JA 4N78D 2O1KA 2R5DA 1IFMA 2CPBA 1NH4A 2WT7B 1FAVA 1SQQK 2GUSA 3VOPA 1GL2D 1SVFA 4WBAA 3GHGC 2OYHC 5AVYB 2I1JA 1A02F 1JUNA 1JO5A 1FZCC 5AW4B 2H8PD 1N7SA 1L4AB 3U59A 3BATA 2WZ7A 3IR9A 4ZKPA 2XU6A 1CZQA 2BASA 5AW1B 5CMZA 4B86A 5AW3B 2XNXA 3II6A 5AW0B 1T8ZA 1RF1A 4GT1A 2YO3A 3LIEA 3TYYA 3O8ZA 1LTSC 2WITA 3M0DC 4AYCA 1NTZK 5APVA 1LWUC 4C7NA 2HFED 4AQRD 3B5NA 1LT9A 1RF0C 2KB7P 1LTTC 2HODA 2VRSA 1N7SB 1JY2O 4I2LC 2XKMA 3UIAA 1L4AA 1GL2B 2FXMA 4DOJA 1N7SD 1LWUA 1FU1A 1IK9A 1FOSE 3IFMA 1X79B 4LLHA 1MZ9A 5KJ7C 4WY4A 3RK3B 1FDMA 3T97A 3B8EB 4IFFA 5KJ7A 1GK4A 1URQC 2N1TC 1J1DB 1IO4A 2ZXEB 1DX7A 4RESB 4IFMA 3V2NA 3VP9A 1A02J 1GL2C 2PP6A 3B5NB 1L4AC 2HODB 2FFDC 2E42A 3RK2D 2IPPA 1ZR4A 1OXZA 1GL2A 2GM4A 1FZCB 1KILB 1L4AD 3OJAB 5CCHC 4LGDE 4C46A 1LWUB 2KSJA 1DH3A 4KHXA 5CJ0A 3H32B 3VMYA 1JTHB 1IFJA 3EFGA 1W2EA 1VPCA 2C0WA 3LW5H 5APQA 2W6AA 3M0AA 3RK3C 4N78E 2M8RA 5CCGD 4IFDK 2W27A 2JJLA 1RE3C 3BASA 3NTNA 5CCGC 1RE4C 2J59M 1AQ5A 1LT9C 1RF0A 3V2PA 1FZCA 1CSBA 3MUDA 1YTZT 4W7ZA 2YKPA 4EOTA 2NPSA 4HH2A 1JTHA 1URQB 2N1TB 2R32A 2A45I 1JY3O 1FZFA 1HTLC 1XTGB 3OAKA 5AW9B 3CL3D 2WWWA 3B5NC 2HPCA 1HH0A 5AVQB 1LTAC 1EQ7A 4XE5B 1FZEA 1H88A 1JY3N 3M0DA 1KILC 1JY2N 1G1IA 3OA7A 3V2RA 2WPRA 4I6MC 1NKZB 2WPSA 3L37A 2FYUK 3HUSB 3M06A 4I1LA 3N7NA 2NPSB 3KQGA 5CCHD 1URQA 2N1TA 2IFNA 1PFIA 1SFCD 4ZKUA 3L4FA 5AVRB 1NO4A 4WY4C 3KYQA 1NTKK 2JEEA 1NWQA 2P1JA 2CPSA 2H43A 2P7JA 1HGVA 1ZV8A 3LIDA 5APXA 2IFMA 2Z5HA 2OARA 1GW4A 1L0LK 2GUVA 3TK1A 1OWAA 4WB4A 1CI6B 2KLVA 3A2AA 3V4WA 3U1CA 2POHA 2Q5UA 1RE4A 2XV5A 3NFQA 3RL0B 1KFMA 3HD7A 3A5TA 1LT9B 1RY3A 1J1EC 3RL0D 1KQLA 5AVXB 2NPSC 3R2PA 3WMM0 3L36A 1N73A 2IX7C 3VN0A 1JMMA 2I1KA 1GZLA 3E1IA 1GU5A 3GHGA 5AVSB 1GTWA 1S9KE 1JY3P 4WY4B 2R5BA 1CI6A 1IFNA 1N2DC 1HBWA 1NOHA 2A45H 1E5WA 1XTCC 1RE3A 4JYBA 3HD7B 2WTYA 4WY4D 3CI9A 3VTPC 1X8YA 1GD2E 1AFOA 1J1EB 1KILA 1N73B 2WSFH 2HG5D 2WSCH 1J2JB 2XDJA 3H32A 2P67A 3MTUE 3P32A 2A45G 2P2UA 1WRGA 1LTBC 2WPQA 1CW5A 1JY2P 2C9NY 5AVUB 2Q9IA 4LC1A 1VDFA 2OYHB 3M9QA 1QL1A 5AVZB 1LTIC 1HWTC 3BVHA 1GDTA 2Z5IA 2QM7A 5APUA 1SQPK 1T3UA 3A3YB 1JOCA 1FZGA 1T2KD 2HPCB 1N7LA 1IC2A 1HJBA 1MV8A 3HRNA 5CCHA 3M9HA 1SFCB 1JNMA 1N86A 1SQXK 1JCDA 1X9VA 2MJZA 2ZFCA 3KPEA 2FFDA 4C7RA 2YKOA 1T3JA 1FJPA 1HUCA 4Y99C 3V2QA 1G1JA 1LGHB 3HUSA 3TNUA 3HE5A 3MD0A 5KTBA 3U1AA 3BRVB 1N7SC 1Z56A 1NTMK 3SWFA 2OYIB 3HTKB 2L5GB 3VMZA 1RF1C 2KYVA 1KILD 1KZUB 1FJKA 1G2CA 4M3LA 1M1JB 1MFZA 5APWA 1URQD 2N1TD 3TSIA 1SP4A 4Y99B 3P8CD 4EIJA 1IJDB 2FFDB 1H89A 4GKGA 2XZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OJA B;  4ZKP A;  5BU5 A;  4N78 D;  4I1L A;  3N7N A;  3C9I A;  1X79 B;  5KTB A;  3U1A A;  3VP8 A;  3U1C A;  4ZKU A;  2POH A;  1IC2 A;  2JEE A;  3HRN A;  3BAS A;  3VP9 A;  4O9B A;  1NKN A;  1WT6 A;  3N4X A;  3P8C D;  5BU8 B;  4N3Y B;  3U59 A;  2FXM A;  5BVZ A;  3BAT A;  4GIF A; 
#chains in the Genus database with same CATH topology
 1YQ3 C;  3VYI A;  5BU5 A;  2QEX P;  2WSE H;  5AW6 B;  5APS A;  3RK2 C;  3HE5 B;  2FKW B;  2M3B A;  1NTM G;  3QH9 A;  3CPW O;  5AW2 B;  3RK3 D;  1BCC E;  4XA4 A;  3Q5R A;  4PD4 I;  1HGZ A;  3GMA A;  2LR2 A;  2YXR B;  1PPJ E;  1K04 A;  2OYI A;  1ZOY C;  3HTK A;  4PD4 H;  3MIW A;  1VQ5 P;  4Z1M H;  1N8R Q;  1H8A A;  5APT A;  1NTZ D;  2K1A A;  3V6I A;  5KLV J;  1QX8 A;  3GLM A;  1UIX A;  4JF7 A;  2IBZ I;  2B87 B;  2IBZ G;  1ZRT D;  2FYN B;  5K5G B;  4PD4 E;  1EDK A;  3L35 A;  3AE6 C;  3NMD A;  4UB6 E;  5CHX A;  1T2K C;  4O9B A;  3PRJ A;  3P8M C;  2E76 B;  2YO2 A;  4HKZ H;  3CCV P;  2GM4 A;  5BU8 B;  4N3Y B;  3H25 A;  1DD3 A;  3A0B H;  2ZT9 B;  3G6E P;  1QL2 A;  4UB6 H;  5TJH A;  1L0L D;  1AVY A;  3ZDM A;  3CC4 P;  2BEQ D;  2HYN A;  4CPG A;  2N9Y B;  3H6P A;  3RGU A;  1KB9 I;  3EQ2 A;  3A7O A;  3GHG B;  1MUU A;  3WUU A;  3HD7 D;  3TGU J;  3B5N D;  4GDO A;  1RF1 B;  2O01 H;  4I7Z B;  3CXH E;  4H0L B;  5M1B A;  3CME P;  3MGN A;  1FE6 A;  1NAY A;  3Q5S A;  1P84 E;  3HD7 C;  4W80 A;  4AUW A;  1VQO P;  4DZO A;  3P8C E;  1VQL P;  2B87 A;  1BE3 D;  3CWB G;  1W5C E;  4D6T G;  1S9K D;  2IBZ E;  3EFF K;  4C7N B;  1NTK G;  5KLV E;  1OFC X;  3JC2 2;  2PFX A;  1N73 C;  1WT6 A;  1LTG C;  3L73 D;  2W8Z A;  1BE3 G;  5H2F H;  1Q2N A;  4D6T D;  1IFD A;  3M9B A;  2Q7C A;  1NU1 J;  3FWN A;  1M7L A;  1EDI A;  2Y9Z A;  4IOI H;  1QLE D;  1SQV K;  3HUS C;  1DEB A;  2OQQ A;  3C8V A;  5AW8 B;  3G3Z A;  2C0X A;  1YI2 P;  3H1H G;  1KV4 A;  3RL0 g;  1EDL A;  1K73 Q;  2IDB A;  3JCU E;  3CXH I;  2G3A A;  2QIW A;  3KDP B;  1ZN5 A;  4H44 D;  2N9B A;  2R3C A;  1FZB A;  2KP8 A;  1LTJ B;  2FYZ A;  2OYO A;  2W6B A;  3WUV A;  3I5C A;  3NXS A;  1ZR2 A;  3CCJ P;  2YNY A;  5AVT B;  1EZV G;  1SQB D;  2E43 A;  3D71 A;  2ZAE B;  3GW6 A;  2PAJ A;  2OYH A;  5CBN A;  1FBM A;  2M0B A;  1YTZ I;  1GK6 A;  1VQP P;  1QGK B;  2CK3 H;  2K9J A;  4BXL A;  2Q6Q A;  3M91 A;  1S72 P;  1NJI Q;  3N4X A;  3VMX A;  3H1I E;  4H13 C;  3V5B A;  1GU4 A;  2BCC E;  2D2C B;  5CCG A;  3K5B A;  4DJG A;  5BVZ A;  1NU1 K;  2JDI H;  2QVA A;  3PJS K;  4GIF A;  1Q81 Q;  3IAO A;  1BSH A;  1PIX A;  2E75 B;  3P7K A;  3SWY A;  1KC8 Q;  2FXP A;  4EYY Q;  3C9I A;  5B5E H;  1M57 D;  1BCC G;  1FOS F;  1JM0 A;  1FZA A;  4HB1 A;  1NU1 E;  1L0N K;  3CLQ A;  1SQP J;  2Z4E A;  5AW7 B;  4OH8 B;  1KB9 D;  2O3J A;  3BCC J;  3HE4 A;  1LTJ A;  1S3J A;  1GW3 A;  3BRT B;  3G9R A;  3AE7 C;  2YKQ A;  3FWL A;  3V4Q A;  1OX3 A;  2Q9I A;  1NAF A;  1SQB K;  2G8Y A;  2JKV A;  3RL0 C;  4GOD A;  3H1L J;  3SFD C;  1H88 A;  1SFC A;  5B66 H;  2NPS D;  1KFN A;  3SFE C;  2OYI C;  3S1K A;  2PRR A;  3H1J E;  4EDF A;  1IFI A;  1L0L G;  2IBZ D;  2C9L Y;  2OTK E;  5E79 E;  5APY A;  2HLO A;  3WUT A;  1BE3 E;  4ASV A;  1H0T A;  1NHL A;  1ZLL A;  4IL6 X;  2I8D A;  3FXD A;  5CJ4 A;  1KB9 E;  3PP5 A;  2H7H A;  2IZ0 A;  2JWA A;  3L73 G;  3TNU B;  1HVV A;  3USS A;  2Q3I A;  1YJW P;  2FYU D;  1L0N J;  2E75 C;  3RBZ A;  1YYC A;  1LTJ C;  3CX5 E;  3VP8 A;  2FBW C;  1MFT A;  2YMY A;  4N6J A;  5GTH E;  1NU1 D;  2WT7 A;  3HE4 B;  1MKM A;  2ITA A;  2J5U A;  2K9Y A;  2KOG A;  3H1L E;  2E75 D;  2QJK B;  3L73 J;  1M1J C;  1L0N E;  2LKM A;  3E7K A;  2FY8 A;  1AVO A;  1KIL E;  1JCC A;  1SFC C;  3CXH D;  1OW8 A;  5AW5 B;  3RK2 B;  4OVN F;  4PV1 B;  2K88 A;  4HYT B;  2M3E A;  1G2C B;  5H2F E;  1J1D C;  5KKZ B;  1VQM P;  1M1J A;  1OVV A;  5AVW B;  1BE3 J;  1UII A;  1ZME C;  1SLQ A;  1NKN A;  3O6Q B;  1SQB E;  3L72 J;  1HF9 A;  1AJY A;  2J58 A;  3WU2 H;  1EXJ A;  1H0T B;  4OGQ D;  5AVV B;  2W90 A;  4W7Y A;  5L8R J;  2QM8 A;  2IZ1 A;  3JCU H;  4TLF A;  2M5A A;  4JYC A;  2O1J A;  5KJ7 D;  5C39 A;  4N78 D;  5KLV K;  2O1K A;  3TGU D;  4L76 A;  4H44 B;  3A0B E;  3CCS P;  3SSU A;  2R5D A;  1Q7Y Q;  1IFM A;  2CPB A;  1E79 H;  1L0L J;  1NH4 A;  2B88 A;  3AE2 C;  2WT7 B;  1FAV A;  1SQQ K;  3TGU G;  1KYO D;  2GUS A;  3VOP A;  2JR8 A;  4D6T E;  1GL2 D;  4L73 A;  3L74 J;  4XFJ A;  2LXB A;  5GTH H;  1SVF A;  1USD A;  3S4R A;  4WBA A;  3GHG C;  2OYH C;  1JMB A;  1DEE G;  5AVY B;  2I1J A;  1A02 F;  1BGY G;  1PPJ D;  1JO5 A;  1FZC C;  5KLI C;  5AW4 B;  2Y0D A;  1JUN A;  2H8P D;  1HJ0 A;  1IK7 A;  1NTK D;  1ZXG A;  3AEF C;  3O6Q A;  5KLV D;  3RK3 E;  1NTZ J;  1EZV D;  1N7S A;  1SQB G;  3EWK A;  4YTP C;  2JP3 A;  1L4A B;  3U59 A;  2ZYG A;  4DCK A;  3AEC C;  3BAT A;  4OWF A;  5CBO A;  2WZ7 A;  3IR9 A;  4ZKP A;  2XU6 A;  1CZQ A;  1PV3 A;  2BAS A;  3PH0 A;  5CMZ A;  5AW1 B;  1YIJ P;  3L75 G;  3L71 E;  3AEG C;  2K3R A;  3WU2 E;  3L70 J;  4B86 A;  5AW3 B;  3CCE P;  1SQQ G;  2XNX A;  3C1L A;  4R4L A;  3II6 A;  3KZI E;  5AW0 B;  1T8Z A;  1RF1 A;  3ABV C;  2ZT9 C;  3T97 B;  4GT1 A;  1RHZ B;  3G71 P;  2YO3 A;  3LIE A;  3TYY A;  2BCC D;  2YXQ B;  1YIT P;  2AXT E;  3O8Z A;  1LTS C;  2WIT A;  3M0D C;  3R4Y A;  4JQ0 D;  4AYC A;  2ZT9 D;  3D70 A;  3L71 J;  1NTZ K;  1YBK A;  5APV A;  2LXC B;  5E79 H;  4PD4 D;  1LWU C;  4A7P A;  2HFE D;  4AQR D;  4C7N A;  3B5N A;  3G4S P;  1LT9 A;  1RF0 C;  2KB7 P;  1LTT C;  4H0L C;  1KB9 H;  2Q3E A;  3AE9 C;  2HOD A;  2VRS A;  1L0L E;  1N7S B;  1JY2 O;  1NTZ E;  1SQV J;  2XKM A;  4GOF A;  2WSC J;  1L4A A;  1GL2 B;  4I2L C;  2QJY B;  2FXM A;  3H1K G;  2HR3 A;  3UIA A;  4DOJ A;  1KD1 Q;  1K05 A;  2V7Q J;  2WSF J;  1N7S D;  3AEA C;  1DD4 A;  1LWU A;  1BGY J;  1IK9 A;  1FU1 A;  1FOS E;  1M8O B;  2B9B A;  2ZVO B;  1X79 B;  3IFM A;  3MHV A;  4OGQ C;  4LLH A;  3TDK A;  1IFP A;  1MZ9 A;  5KJ7 C;  4WY4 A;  3RK3 B;  1FDM A;  1DIP A;  3L74 G;  1SQX D;  3B8E B;  3T97 A;  1KTM A;  4YXW H;  2IYP A;  4U3F D;  5B5E E;  4IFF A;  5KJ7 A;  1GK4 A;  1URQ C;  2KNC A;  1J1D B;  2N1T C;  3B71 A;  3E1R A;  4JPZ B;  1IO4 A;  2ZXE B;  1DX7 A;  1PP9 G;  1QEX A;  2SPZ A;  2NRG A;  4RES B;  2E74 D;  4IFM A;  4U3F J;  3BCC G;  3V2N A;  3VP9 A;  1SQQ D;  1GL2 C;  1A02 J;  2PP6 A;  1SQX J;  1NTM D;  2K9J B;  3B5N B;  1L4A C;  1NTK E;  4R4M A;  1SQV G;  4BRY B;  2HOD B;  2FFD C;  2E42 A;  2E74 C;  3RK2 D;  2AEM A;  2IPP A;  3H1I G;  1OXZ A;  1GL2 A;  1ZR4 A;  2KIK A;  2IYO A;  4JBZ A;  5B66 E;  1KIL B;  3CCU P;  1L4A D;  4ZMD A;  1QVG O;  1FZC B;  1VQ8 P;  1KQG B;  1LJ2 A;  3OJA B;  2R3S A;  5CCH C;  4LGD E;  2AEF A;  1LWU B;  2KSJ A;  4WWI A;  4C46 A;  1DH3 A;  2QRX A;  2ZJS E;  4KHX A;  1M56 D;  1SQQ E;  2W83 C;  3L71 G;  3H32 B;  2BEZ F;  4U3F E;  5CJ0 A;  1JTH B;  1IFJ A;  1SQV D;  3AE3 C;  3EFG A;  2A06 E;  3AEB C;  3VMY A;  1W2E A;  1VPC A;  2C0W A;  3LW5 H;  1LP1 A;  1VQ9 P;  5APQ A;  4EI2 A;  1P84 I;  1AQT A;  2W6A A;  3M0A A;  3RK3 C;  3H1K D;  3L70 E;  4N78 E;  2M8R A;  1WMK A;  3CX5 H;  5CCG D;  3CC7 P;  4IFD K;  2PGD A;  3L75 J;  1YQ4 C;  2W27 A;  2JJL A;  1RE3 C;  3L70 G;  1KN7 A;  3BAS A;  1Y8A A;  1L0N G;  4H13 D;  1GMJ A;  5KKZ C;  1BGY E;  3NTN A;  5CCG C;  1RE4 C;  2J59 M;  5DJU B;  2D2C C;  2P10 A;  3JSV C;  2QJY C;  3MUD C;  2Q1K A;  1AQ5 A;  1LT9 C;  1RF0 A;  3H1K E;  1NTZ G;  1U57 A;  3L70 D;  3AEE C;  2V4H A;  1CSB A;  4K3A A;  4OGQ B;  3V2P A;  4RJT A;  3MUD A;  1YTZ T;  1BCC J;  1FZC A;  3KZI H;  4W7Z A;  1KYO I;  5KAI H;  2YKP A;  2WQY C;  4EOT A;  1Q82 Q;  3I55 P;  3CCQ P;  2NPS A;  2L91 A;  4HH2 A;  1JTH A;  2QJK C;  2AXT H;  1M90 Q;  1URQ B;  2N1T B;  2R32 A;  1NTK J;  2FYU G;  2A45 I;  2W6J H;  3H1I J;  4PV1 D;  5KAI E;  1YJ9 P;  1JY3 O;  1FZF A;  3CWB J;  1HTL C;  1XTG B;  3OAK A;  5AW9 B;  3PTZ A;  3CL3 D;  4RKU J;  2WWW A;  3B5N C;  4UB8 E;  4PJ0 E;  1D7M A;  1HH0 A;  5AVQ B;  2HPC A;  1VQK P;  3L74 D;  1LTA C;  2QSI A;  1KOR A;  3CX5 D;  1EQ7 A;  2YIU B;  4XE5 B;  1FZE A;  1Y47 A;  1L2P A;  1VF5 D;  3FX0 A;  2R44 A;  3AE5 C;  1JY3 N;  1KQF B;  3S9O A;  2XND H;  1KIL C;  1JY2 N;  3M0D A;  1EXI A;  3L72 E;  3CCM P;  3CCR P;  1G1I A;  2OGU A;  1OVR A;  1VF5 C;  2KS1 B;  3OA7 A;  1USE A;  3V2R A;  3H1H J;  3H1J D;  2H88 C;  2WPR A;  1NKZ B;  2M5A B;  1SQP E;  2WPS A;  3B4S A;  3L37 A;  4I6M C;  2FYU K;  1S5L E;  3HUS B;  3M06 A;  1KMI Z;  3N7N A;  4I1L A;  3L73 E;  1JB0 J;  1NU1 G;  2E5T A;  2NPS B;  2QE7 H;  3KQG A;  1VQN P;  1NYH A;  3L72 D;  5CCH D;  1URQ A;  2N1T A;  2IFN A;  1PFI A;  1SFC D;  4GOE A;  4ZKU A;  3AE1 C;  3L4F A;  5AVR B;  1KYO E;  1NO4 A;  2FXO A;  2UWJ E;  3TGU E;  1KQS O;  1X0T A;  4WY4 C;  3KYQ A;  1NTK K;  1PGJ A;  3A0H H;  4H44 C;  2JEE A;  2KUB A;  3I56 P;  1NWQ A;  1PGQ A;  3CWB E;  1SQX G;  1AA0 A;  3MP7 B;  2P1J A;  4RO0 A;  4BWN A;  3MZW B;  2CPS A;  2H43 A;  3F89 A;  2P7J A;  3AE4 C;  2RH0 A;  1L0N D;  3FGA D;  2FYU J;  4QMA A;  2KS1 A;  3Q1M A;  3CCL P;  3KXD A;  1HGV A;  1ZV8 A;  2D2C D;  3LID A;  5DJT B;  5APX A;  2IFM A;  2Z5H A;  2MKV A;  1FC2 C;  1GW4 A;  1L0L K;  2GUV A;  2OAR A;  4IL6 E;  5TIS E;  3TK1 A;  1RQV A;  1OWA A;  5KAF E;  3H1H E;  2KSE A;  4WB4 A;  2KZJ A;  1VL2 A;  1CI6 B;  2FYU E;  2KLV A;  3A2A A;  3V4W A;  2JO1 A;  2POH A;  2Q5U A;  3U1C A;  3H1L D;  3CC2 P;  1OW6 A;  1RE4 A;  2KZI A;  2Y9Y A;  1PL5 A;  2ZVN B;  1NVO A;  4PV1 C;  2E76 D;  4U7J A;  2B89 A;  1Q90 D;  2XV5 A;  2OTJ P;  3NFQ A;  2Y0E A;  1KFM A;  1KYO H;  3HD7 A;  3RL0 B;  5KLV G;  3A5T A;  3BCC D;  1LT9 B;  1RY3 A;  3L72 G;  5KLI B;  3Q5P A;  1BDC A;  2A06 D;  1SQP D;  1J1E C;  2E76 C;  3BCC E;  3D6Z A;  3Q2Y A;  3RL0 D;  2WMM A;  1S2E A;  1KQL A;  1R5S A;  2JWD A;  2QG4 A;  5AVX B;  4I7Z C;  4NPD A;  2NPS C;  3R2P A;  3WMM 0;  3L36 A;  1Q86 Q;  1N73 A;  2IX7 C;  3VN0 A;  1OVU A;  1JMM A;  1K9M Q;  3PHL A;  1P84 D;  1GZL A;  2I1K A;  2A06 G;  3E1I A;  5GTI H;  3CMA P;  1GU5 A;  2KK7 A;  3GHG A;  5AVS B;  1GTW A;  1S9K E;  5EFW B;  1JY3 P;  4WY4 B;  3TF5 A;  2R5B A;  3H1H D;  3H1J J;  2O01 N;  1CI6 A;  5GTI E;  4IL6 H;  3GF7 A;  1IFN A;  1N2D C;  3RBX A;  1R8E A;  1HBW A;  1NOH A;  4ASW A;  4K35 A;  4MN4 C;  1EC5 A;  2A45 H;  2E5Y A;  2KNC B;  1SQB J;  4H0L D;  1E5W A;  1XTC C;  4YPC A;  2RN0 A;  1RE3 A;  4JYB A;  2FYN C;  3HD7 B;  3AED C;  2WTY A;  4WY4 D;  1K8A Q;  4TT3 H;  3CI9 A;  3VTP C;  1FDI A;  1X8Y A;  4BRY A;  1EDJ A;  1GD2 E;  3H1J G;  3CWB D;  4YXD C;  1S5L X;  1AFO A;  2BCC G;  1J1E B;  1KIL A;  1N73 B;  2WSF H;  3H1I D;  3AE8 C;  2HG5 D;  1TU3 F;  1VQ6 P;  4ZNC A;  1PGO A;  1J2J B;  2WSC H;  1OMI A;  2XDJ A;  4D6T J;  3H32 A;  3D6Y A;  1P84 H;  2P67 A;  1ZRT E;  3MTU E;  3P32 A;  2A45 G;  2P2U A;  3A0H E;  1BCC D;  3CX5 I;  4DT0 A;  1LP1 B;  1WRG A;  2DW3 A;  1LTB C;  2RKL A;  2WPQ A;  2WSS H;  3W68 A;  1JY2 P;  2RMZ A;  3QWO C;  1CW5 A;  1VQ7 P;  2C9N Y;  2P58 A;  3W67 A;  3GG2 A;  4Y28 J;  1OW7 A;  4LC1 A;  1JEK A;  5AVU B;  3ITK A;  1Y9B A;  1FDO A;  1VDF A;  3H1L G;  1FS0 E;  1X22 A;  2YIU C;  2OYH B;  3M9Q A;  3OW2 O;  1S4X A;  1QL1 A;  1SS1 A;  3IF4 A;  2QJP C;  4NPE A;  2ZXX A;  4UB8 H;  4PJ0 H;  3L75 D;  5AVZ B;  1SQV E;  2Y0C A;  1NGM B;  2AEJ A;  3H1K J;  5TIS H;  1LTI C;  2ZYA A;  5KAF H;  2V7Q H;  1HWT C;  1ZP0 C;  3BVH A;  1GDT A;  2Z5I A;  1BDD A;  1NTM E;  1RQU A;  4NPF X;  2QM7 A;  4KT0 J;  1VQ4 P;  3L75 E;  5APU A;  3SWK A;  2KLU A;  3L74 E;  1SQP K;  1T3U A;  3A3Y B;  4WVZ A;  1S5L H;  1AV1 A;  1JOC A;  1T6A A;  1FZG A;  3KHU A;  2H89 C;  2YMK A;  2KXP B;  1W2B O;  1SQX E;  1T2K D;  2HPC B;  1N7L A;  1IC2 A;  3FXE A;  1HJB A;  1MV8 A;  1NTM J;  3CXH H;  3HRN A;  4HJG H;  1EZV I;  1SQQ J;  5CCH A;  3M9H A;  1SFC B;  2WVR A;  1BSN A;  1M1K Q;  2NZ2 A;  1JNM A;  1N86 A;  1SQX K;  1JCD A;  1X9V A;  2GA1 A;  2ZYD A;  2MJZ A;  3IN6 A;  2ZFC A;  2WSE J;  3KPE A;  1U7J A;  3PLN A;  4H13 B;  3VMA A;  2QJP B;  2QA4 P;  2FFD A;  2OTL P;  4C7R A;  2YKO A;  1T3J A;  1FJP A;  1HUC A;  4U3F G;  4Y99 C;  1G1J A;  1R5L A;  3V2Q A;  1LGH B;  4KJM A;  1QVF O;  2O01 J;  1SQP G;  3HUS A;  3LW5 J;  3TNU A;  3HE5 A;  1PP9 J;  1BGY D;  1PPJ G;  3MD0 A;  1LNQ A;  5KTB A;  3U1A A;  1YJN P;  1LT1 A;  1N7S C;  1Z56 A;  3BRV B;  4L74 A;  3GF3 A;  3CD6 P;  1VF5 B;  2WPV B;  1U7M A;  1NTM K;  1IZN B;  3SWF A;  2OYI B;  1OIP A;  3HTK B;  2L5G B;  1PP9 E;  3VMZ A;  1RF1 C;  1ZW0 A;  2KYV A;  1KIL D;  1KZU B;  1S1C X;  1FJK A;  1G2C A;  4M3L A;  1EZV E;  1M1J B;  1MFZ A;  5APW A;  1URQ D;  2N1T D;  3L71 D;  3TSI A;  1SP4 A;  1OZH A;  4Y99 B;  1YHQ P;  3P8C D;  2AXC A;  2K37 A;  3F5H A;  2E74 B;  4L75 A;  4EIJ A;  1IJD B;  2BCC J;  3Q3D A;  1PGP A;  2FFD B;  1PP9 D;  1PZQ A;  1RH5 B;  1H89 A;  2KI7 B;  4GKG A;  2XZR A; 
#chains in the Genus database with same CATH homology
 3VYI A;  5BU5 A;  2WSE H;  5AW6 B;  5APS A;  3RK2 C;  3HE5 B;  2FKW B;  2M3B A;  5AW2 B;  3RK3 D;  4XA4 A;  1HGZ A;  2OYI A;  3HTK A;  3MIW A;  1H8A A;  5APT A;  4JF7 A;  3L35 A;  3NMD A;  1T2K C;  5CHX A;  4O9B A;  3P8M C;  2YO2 A;  5BU8 B;  4N3Y B;  1QL2 A;  2HYN A;  3H6P A;  3EQ2 A;  3A7O A;  3GHG B;  1MUU A;  3HD7 D;  3B5N D;  1RF1 B;  2O01 H;  3MGN A;  3HD7 C;  4W80 A;  4AUW A;  4DZO A;  3P8C E;  1S9K D;  4C7N B;  1N73 C;  1WT6 A;  1LTG C;  1IFD A;  3M9B A;  2Q7C A;  1M7L A;  3HUS C;  1SQV K;  5AW8 B;  1DEB A;  3G3Z A;  2C0X A;  3KDP B;  1ZN5 A;  2N9B A;  2R3C A;  1FZB A;  2KP8 A;  1LTJ B;  2FYZ A;  2W6B A;  3I5C A;  3NXS A;  1ZR2 A;  2YNY A;  5AVT B;  2E43 A;  2PAJ A;  2OYH A;  1FBM A;  1YTZ I;  1GK6 A;  3M91 A;  3N4X A;  3VMX A;  3V5B A;  1GU4 A;  5CCG A;  5BVZ A;  1NU1 K;  4GIF A;  3P7K A;  3SWY A;  3C9I A;  1FOS F;  1FZA A;  3CLQ A;  1L0N K;  2Z4E A;  5AW7 B;  4OH8 B;  3HE4 A;  1LTJ A;  3BRT B;  1GW3 A;  2YKQ A;  3V4Q A;  1NAF A;  1SQB K;  3RL0 C;  1SFC A;  2NPS D;  1KFN A;  2OYI C;  1IFI A;  2C9L Y;  5APY A;  2HLO A;  1NHL A;  1ZLL A;  5CJ4 A;  3PP5 A;  2H7H A;  3TNU B;  1HVV A;  2Q3I A;  1YYC A;  1LTJ C;  3VP8 A;  2YMY A;  4N6J A;  2WT7 A;  3HE4 B;  2KOG A;  1M1J C;  2LKM A;  5KLV K;  3RK2 B;  1JCC A;  1SFC C;  5AW5 B;  4HYT B;  1G2C B;  1J1D C;  1M1J A;  5AVW B;  1SLQ A;  1NKN A;  2J58 A;  5AVV B;  4W7Y A;  2QM8 A;  5KJ7 D;  4JYC A;  2O1J A;  4N78 D;  2O1K A;  2R5D A;  1IFM A;  2CPB A;  1NH4 A;  2WT7 B;  1FAV A;  1SQQ K;  2GUS A;  3VOP A;  1GL2 D;  1SVF A;  4WBA A;  3GHG C;  2OYH C;  5AVY B;  2I1J A;  1A02 F;  1JUN A;  1JO5 A;  1FZC C;  5AW4 B;  2H8P D;  1N7S A;  1L4A B;  3U59 A;  3BAT A;  2WZ7 A;  3IR9 A;  4ZKP A;  2XU6 A;  1CZQ A;  2BAS A;  5AW1 B;  5CMZ A;  4B86 A;  5AW3 B;  2XNX A;  3II6 A;  5AW0 B;  1T8Z A;  1RF1 A;  4GT1 A;  2YO3 A;  3LIE A;  3TYY A;  3O8Z A;  1LTS C;  2WIT A;  3M0D C;  4AYC A;  1NTZ K;  5APV A;  1LWU C;  4C7N A;  2HFE D;  4AQR D;  3B5N A;  1LT9 A;  1RF0 C;  2KB7 P;  1LTT C;  2HOD A;  2VRS A;  1N7S B;  1JY2 O;  4I2L C;  2XKM A;  3UIA A;  1L4A A;  1GL2 B;  2FXM A;  4DOJ A;  1N7S D;  1LWU A;  1FU1 A;  1IK9 A;  1FOS E;  3IFM A;  1X79 B;  4LLH A;  1MZ9 A;  5KJ7 C;  4WY4 A;  3RK3 B;  1FDM A;  3T97 A;  3B8E B;  4IFF A;  5KJ7 A;  1GK4 A;  1URQ C;  2N1T C;  1J1D B;  1IO4 A;  2ZXE B;  1DX7 A;  4RES B;  4IFM A;  3V2N A;  3VP9 A;  1A02 J;  1GL2 C;  2PP6 A;  3B5N B;  1L4A C;  2HOD B;  2FFD C;  2E42 A;  3RK2 D;  2IPP A;  1ZR4 A;  1OXZ A;  1GL2 A;  2GM4 A;  1FZC B;  1KIL B;  1L4A D;  3OJA B;  5CCH C;  4LGD E;  4C46 A;  1LWU B;  2KSJ A;  1DH3 A;  4KHX A;  5CJ0 A;  3H32 B;  3VMY A;  1JTH B;  1IFJ A;  3EFG A;  1W2E A;  1VPC A;  2C0W A;  3LW5 H;  5APQ A;  2W6A A;  3M0A A;  3RK3 C;  4N78 E;  2M8R A;  5CCG D;  4IFD K;  2W27 A;  2JJL A;  1RE3 C;  3BAS A;  3NTN A;  5CCG C;  1RE4 C;  2J59 M;  1AQ5 A;  1LT9 C;  1RF0 A;  3V2P A;  1FZC A;  1CSB A;  3MUD A;  1YTZ T;  4W7Z A;  2YKP A;  4EOT A;  2NPS A;  4HH2 A;  1JTH A;  1URQ B;  2N1T B;  2R32 A;  2A45 I;  1JY3 O;  1FZF A;  1HTL C;  1XTG B;  3OAK A;  5AW9 B;  3CL3 D;  2WWW A;  3B5N C;  2HPC A;  1HH0 A;  5AVQ B;  1LTA C;  1EQ7 A;  4XE5 B;  1FZE A;  1H88 A;  1JY3 N;  3M0D A;  1KIL C;  1JY2 N;  1G1I A;  3OA7 A;  3V2R A;  2WPR A;  4I6M C;  1NKZ B;  2WPS A;  3L37 A;  2FYU K;  3HUS B;  3M06 A;  4I1L A;  3N7N A;  2NPS B;  3KQG A;  5CCH D;  1URQ A;  2N1T A;  2IFN A;  1PFI A;  1SFC D;  4ZKU A;  3L4F A;  5AVR B;  1NO4 A;  4WY4 C;  3KYQ A;  1NTK K;  2JEE A;  1NWQ A;  2P1J A;  2CPS A;  2H43 A;  2P7J A;  1HGV A;  1ZV8 A;  3LID A;  5APX A;  2IFM A;  2Z5H A;  2OAR A;  1GW4 A;  1L0L K;  2GUV A;  3TK1 A;  1OWA A;  4WB4 A;  1CI6 B;  2KLV A;  3A2A A;  3V4W A;  3U1C A;  2POH A;  2Q5U A;  1RE4 A;  2XV5 A;  3NFQ A;  3RL0 B;  1KFM A;  3HD7 A;  3A5T A;  1LT9 B;  1RY3 A;  1J1E C;  3RL0 D;  1KQL A;  5AVX B;  2NPS C;  3R2P A;  3WMM 0;  3L36 A;  1N73 A;  2IX7 C;  3VN0 A;  1JMM A;  2I1K A;  1GZL A;  3E1I A;  1GU5 A;  3GHG A;  5AVS B;  1GTW A;  1S9K E;  1JY3 P;  4WY4 B;  2R5B A;  1CI6 A;  1IFN A;  1N2D C;  1HBW A;  1NOH A;  2A45 H;  1E5W A;  1XTC C;  1RE3 A;  4JYB A;  3HD7 B;  2WTY A;  4WY4 D;  3CI9 A;  3VTP C;  1X8Y A;  1GD2 E;  1AFO A;  1J1E B;  1KIL A;  1N73 B;  2WSF H;  2HG5 D;  2WSC H;  1J2J B;  2XDJ A;  3H32 A;  2P67 A;  3MTU E;  3P32 A;  2A45 G;  2P2U A;  1WRG A;  1LTB C;  2WPQ A;  1CW5 A;  1JY2 P;  2C9N Y;  5AVU B;  2Q9I A;  4LC1 A;  1VDF A;  2OYH B;  3M9Q A;  1QL1 A;  5AVZ B;  1LTI C;  1HWT C;  3BVH A;  1GDT A;  2Z5I A;  2QM7 A;  5APU A;  1SQP K;  1T3U A;  3A3Y B;  1JOC A;  1FZG A;  1T2K D;  2HPC B;  1N7L A;  1IC2 A;  1HJB A;  1MV8 A;  3HRN A;  5CCH A;  3M9H A;  1SFC B;  1JNM A;  1N86 A;  1SQX K;  1JCD A;  1X9V A;  2MJZ A;  2ZFC A;  3KPE A;  2FFD A;  4C7R A;  2YKO A;  1T3J A;  1FJP A;  1HUC A;  4Y99 C;  3V2Q A;  1G1J A;  1LGH B;  3HUS A;  3TNU A;  3HE5 A;  3MD0 A;  5KTB A;  3U1A A;  3BRV B;  1N7S C;  1Z56 A;  1NTM K;  3SWF A;  2OYI B;  3HTK B;  2L5G B;  3VMZ A;  1RF1 C;  2KYV A;  1KIL D;  1KZU B;  1FJK A;  1G2C A;  4M3L A;  1M1J B;  1MFZ A;  5APW A;  1URQ D;  2N1T D;  3TSI A;  1SP4 A;  4Y99 B;  3P8C D;  4EIJ A;  1IJD B;  2FFD B;  1H89 A;  4GKG A;  2XZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...