5BVZA

Hk620 tail needle crystallized at ph 9 (crystal form ii)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
180
structure length
180
Chain Sequence
QGAYDAQVKNDEQDVELADHDARIAANTKAINILEVRLTTAEGKIVVLRSDVDYLLDEVIDIQAHLVTVDQRLDGVESDVSDIKSDYVSKTVTESQSLASPLDVKTSYSVDGIQVVGARQTGWTAATGTPLLGSFNANQSYTVGTTYTQSEVAALATGLEQARQRILALETALRLHGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords DNA stabilization protein
publication title Structural Plasticity of the Protein Plug That Traps Newly Packaged Genomes in Podoviridae Virions.
pubmed doi rcsb
source organism Enterobacteria phage hk620
total genus 58
structure length 180
sequence length 180
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5bvzA01
3VP9A 3OJAB 5BU8B 1IC2A 2JEEA 2POHA 4N78D 4N3YB 3U1AA 4ZKPA 5BU5A 3BATA 3N4XA 5BVZA 2FXMA 3P8CD 4ZKUA 1NKNA 3C9IA 3HRNA 4O9BA 4I1LA 3U59A 1WT6A 3VP8A 3U1CA 3BASA 3N7NA 4GIFA 1X79B 5KTBA
chains in the Genus database with same CATH superfamily
1HJ0A 1HJBA 1EC5A 2GUVA 3NMDA 2JWAA 1NVOA 3A0HE 1Q7YQ 3OW2O 1PPJG 2YNYA 2KS1B 4LC1A 5APTA 2B87A 1GK4A 3GW6A 3R4YA 4Y28J 2O1JA 2R5BA 4JYCA 1JMBA 3H1HD 2FYNB 1IFDA 1FS0E 3AE7C 4DJGA 1G2CA 1VF5D 1BE3E 3PH0A 1Q2NA 1U7JA 1SS1A 5CBNA 1RF0C 1FDOA 1MFZA 2IBZE 3AE3C 4CPGA 3WU2H 1JM0A 3CXHE 1KILC 1RE4A 3RK2C 3AE6C 2FFDC 3LIEA 3M06A 1H88A 3CX5D 2MJZA 3H1IE 2CPBA 1NTZK 4U3FG 1GMJA 1IK7A 2KS1A 3VMXA 5B66H 1NWQA 1LT1A 1S5LX 3CWBD 2KUBA 1SQXG 1LWUC 4XFJA 4RKUJ 1OW6A 1JCCA 3RK3C 3HUSC 1SP4A 3JC22 3MTUE 2O01H 2Q7CA 2W8ZA 2NPSD 1BE3G 3L71E 3KHUA 4HJGH 2ZVOB 3MIWA 1LT9C 1T2KC 1IJDB 2WQYC 3S4RA 2KSJA 3L75G 2W6BA 3TGUD 3IF4A 3Q5RA 5AW5B 3CCSP 5AVXB 1Q82Q 4W7YA 1SQPD 3CX5H 2R3SA 1LTSC 2AEFA 1OW7A 1T8ZA 4EIJA 3CLQA 3H1LE 2W27A 1NHLA 1FC2C 2B89A 4N78E 4GODA 1PPJD 3NFQA 2ZVNB 3A2AA 4RO0A 3VMYA 3WUVA 3V6IA 1YTZI 3I5CA 1MZ9A 3M9BA 3H1KE 2QE7H 2E75D 3WUUA 2IDBA 3FGAD 3CMEP 1SFCB 2K9YA 3CL3D 4GOEA 2HODB 1KYOH 4YXWH 4GOFA 3Q2YA 4GDOA 5KLVE 4ZMDA 1PGQA 5GTIE 4TT3H 2OGUA 2K3RA 1PGPA 2WPSA 1GL2D 1HTLC 1RHZB 4Y99C 2D2CC 1K04A 1FJKA 2PRRA 2H8PD 2QJKC 2ZFCA 1BCCG 5GTHE 1ZW0A 2KSEA 4WB4A 1BDDA 2RMZA 1QVFO 2UWJE 1GW4A 1EZVG 3MGNA 4U3FD 4WY4C 1NO4A 1FZBA 1SQQE 1JB0J 1S72P 2WTYA 1DX7A 3B5ND 1JY2N 2PGDA 1LTBC 1AQTA 1SFCA 3P32A 5CHXA 5AW7B 4JPZB 2QJPB 1QL2A 4EOTA 4DZOA 2HODA 1FDMA 1JTHB 3V4QA 3G3ZA 3V4WA 1JY2O 5CCGA 1BE3D 5AW3B 2C0XA 5APUA 5TISH 4PD4D 1N7SD 4UB6H 3L74J 3L75D 2P67A 4L73A 2Q3EA 2C0WA 1EDJA 2LXCB 3WMM0 3NXSA 1M57D 3MHVA 2E74D 2XZRA 4D6TJ 3OAKA 1VF5B 1OIPA 3RGUA 1FOSF 4I1LA 2Q3IA 3V2PA 3HE5B 4L75A 2E5YA 1KQGB 1EXJA 1X0TA 2P10A 3USSA 1JTHA 3L74E 2E76C 4C7RA 4ZNCA 5CCHA 2RN0A 1KILE 3LW5J 3O8ZA 2R5DA 3B8EB 2QJYB 2CK3H 1AJYA 1MFTA 1AFOA 4DOJA 1RE3A 1JOCA 1VQNP 2A45H 2ZYAA 1J1EC 1ZOYC 2A06G 3Q5PA 4EYYQ 3TF5A 2C9LY 1L4AD 5CBOA 1BCCD 3H25A 3IAOA 1KFNA 1OXZA 1S1CX 2NPSB 3RK3E 1EQ7A 3HE5A 1EZVD 3D71A 2XV5A 3U1AA 1IK9A 3FWLA 1R5SA 1DEEG 2FYUG 1DD4A 2E5TA 4YPCA 1JCDA 1L0NE 4D6TG 2YKOA 1W2BO 3PTZA 5CJ0A 2Z4EA 1VQMP 1NU1G 1J1DC 3V2RA 2LXBA 3W67A 1YJ9P 1EDIA 2NPSA 1RQUA 1M7LA 1FAVA 3M91A 4PD4I 2KB7P 2E75B 4C7NB 1JY2P 1KB9D 1PV3A 2QM8A 1KMIZ 1H8AA 3V2QA 3RL0D 3BRVB 5KKZC 2Q5UA 1VQLP 2ZYDA 1KFMA 4UB8E 2ZXEB 2OYIC 1GL2B 1PP9E 4H0LC 1K73Q 3FWNA 2KLUA 1YJNP 1DEBA 3AEEC 5AW2B 2OYOA 1AA0A 3D6YA 2ZT9C 2KZJA 3U59A 1IFPA 1RF1B 3KYQA 1IFMA 5GTIH 3GF7A 1OVRA 1NTZJ 3HD7D 3B5NB 2HPCB 1KZUB 4C7NA 4DT0A 1RE4C 2A06D 2N9BA 3BCCE 5GTHH 2HLOA 2JP3A 2VRSA 1N8RQ 1SQVJ 3O6QB 5E79E 2R32A 1YI2P 4AUWA 1P84D 4N6JA 1N7SB 3CCJP 1QX8A 2FYNC 1WT6A 2L5GB 1VQOP 1RF1A 1R5LA 2JR8A 3KQGA 2E74B 2XNXA 4JYBA 3B5NA 1HGZA 4D6TD 1QVGO 1QGKB 1IFNA 1SQVE 3GHGB 3L70E 4KT0J 2PAJA 3KPEA 3RL0g 3O6QA 2KK7A 4I7ZB 2ZYGA 1RQVA 1N7SA 1NTMJ 3CCMP 1KB9I 1N2DC 2NZ2A 1T3UA 1NTZG 2WSEJ 1P84H 2M8RA 3P8MC 1L4AB 1GZLA 5APYA 2OYIA 3GHGA 5AW9B 2B9BA 2W6AA 3H1IJ 3L37A 4OGQD 1EDLA 2M3EA 3T97B 1NTME 4BXLA 2P7JA 3H1JG 3I55P 3L36A 1TU3F 1VQ4P 2WVRA 3G9RA 5KAFH 1YHQP 2WPQA 2GA1A 2JDIH 3L35A 3LW5H 4LLHA 3P8CD 3L71J 1W2EA 3TYYA 1SFCC 1M1JB 2Q6QA 2D2CD 1PGOA 1HGVA 4GT1A 1E79H 1YJWP 5CCGC 1OVVA 2IFMA 1WRGA 2QM7A 3RL0B 2K1AA 1SQVK 1X9VA 2IX7C 1GD2E 3H1LJ 1KYOD 4MN4C 4M3LA 2Z5HA 1VQ7P 5AVRB 2Y0DA 1CI6B 2IBZG 2SPZA 4WBAA 2A45G 3ABVC 1HH0A 3TSIA 3TK1A 2OTKE 2BEZF 2YKQA 1FZGA 3H1KJ 3FXDA 2BCCE 3H1IG 2JWDA 1URQD 3HD7B 1M1JA 1KC8Q 4LGDE 2QJPC 4R4MA 1NTZD 3LIDA 5KLVJ 3Q5SA 1JMMA 3N4XA 3AE2C 5CCHC 3GG2A 3GLMA 2AXTH 1QEXA 1FE6A 3CCQP 1GW3A 3VYIA 4W7ZA 3ZDMA 2GM4A 2KXPB 2QEXP 3BVHA 1NTMK 1RE3C 3L71G 3JCUE 1SQQJ 3H1JD 2IYOA 3A3YB 2YXRB 1K9MQ 1L0LJ 1USEA 1VF5C 4BRYB 3VTPC 2FBWC 2WMMA 2P1JA 1KTMA 3HD7A 1S9KD 5E79H 2IZ1A 3QWOC 3AEGC 4OVNF 1BGYE 3CI9A 3H1LG 2YXQB 1FDIA 2WPVB 4NPFX 3CX5I 2Z5IA 1FJPA 3KDPB 2QJYC 1L0LE 2OTLP 1YQ3C 2IZ0A 1LTTC 4GKGA 3H1KG 1NTKE 1NTMD 1G1IA 1QLED 1OMIA 2V7QJ 2ZAEB 4BRYA 2O1KA 2NPSC 3AE8C 5KLVG 2HFED 3G4SP 3S9OA 2QG4A 1KQSO 3MUDA 2IBZD 4WVZA 1KYOI 2QIWA 1KD1Q 3CXHD 3N7NA 4OGQB 3BRTB 3H1ID 4H44D 3G71P 2L91A 1PIXA 3L72E 3BATA 4L74A 1SQQG 4JF7A 3A0HH 2XU6A 2AEMA 5B5EE 4Z1MH 1AQ5A 1Y47A 5BU5A 3I56P 1E5WA 1EDKA 2E75C 5KJ7D 2YIUB 4W80A 3L71D 2IPPA 2OQQA 2GUSA 2Y9ZA 2WSEH 2D2CB 1NAFA 2PP6A 1H0TB 5KLVK 2O3JA 1S4XA 5AVTB 2HR3A 1GL2C 4RESB 3CXHH 1L0NJ 3E7KA 4RJTA 2BASA 1ZLLA 4IFMA 2KNCB 2M0BA 4TLFA 1N7LA 1YTZT 3H1LD 5KTBA 1NGMB 4ASVA 1RF1C 1SQQK 1U57A 1XTGB 3HE4B 5EFWB 4PV1D 2B88A 4N78D 1X22A 1LTAC 1L0LK 2WSCH 2J58A 2N1TD 3AECC 1NKNA 3L74G 4L76A 3SFEC 3B5NC 2WSFJ 2Y0EA 2WZ7A 1URQB 1NTKK 2R3CA 3H1KD 3L73E 1ZRTE 3W68A 1YIJP 2XNDH 3PRJA 4QMAA 4OWFA 2AXCA 3M9HA 1ZXGA 2P58A 5KLVD 1PGJA 1PP9J 1M56D 1NJIQ 1SLQA 2OYHB 1N7SC 3NTNA 2KNCA 3L4FA 2H7HA 2IBZI 1FZCB 2A45I 5AVQB 4ZKPA 3HE4A 2LKMA 2E74C 3HRNA 2M5AB 1SQQD 3H1HE 3H6PA 1L0LD 5CMZA 1URQA 3GHGC 3E1IA 1USDA 3BCCJ 1KN7A 4KJMA 3CD6P 3B4SA 4IL6X 1L0NG 3CC7P 4I7ZC 3JCUH 4H13D 3A5TA 3CX5E 3VN0A 2OYHA 3AEBC 2IFNA 1FBMA 1BSHA 3V2NA 2W83C 1HVVA 1IC2A 1KORA 3PHLA 3VOPA 1FZCA 3CWBE 5L8RJ 1SVFA 1L4AC 5M1BA 3TNUB 2M5AA 1AVYA 2XKMA 3RBZA 3KXDA 1SQPJ 1A02J 3VP9A 1UIIA 1GU4A 1GL2A 5APWA 3L70J 1LTJB 2POHA 2N9YB 1HWTC 2HG5D 1LNQA 1M8OB 1PP9G 1EZVI 3A7OA 1LGHB 3L74D 3KZIE 3MZWB 3TGUE 4H44B 1X79B 1KILD 3RK2D 1VDFA 5K5GB 1L0NK 4YTPC 2Y9YA 2ZXXA 1N73B 2HPCA 1SQPE 1Z56A 3GMAA 1PFIA 2KP8A 4IFDK 4HB1A 2K88A 3TNUA 3BCCG 2KOGA 1M1JC 2RH0A 1PPJE 3RK3D 3AE1C 3AE4C 1OX3A 2V7QH 1FZEA 1K05A 3OA7A 3UIAA 3RL0C 2AEJA 4K3AA 1DH3A 1T2KD 1SQXJ 4IL6E 5B5EH 3PLNA 4UB6E 4EI2A 2J5UA 2DW3A 4O9BA 2W6JH 2Q9IA 1N73A 1L0ND 1SQBJ 1X8YA 4IFFA 3MP7B 1VL2A 3CCUP 1SQVG 4B86A 2ZJSE 2I1KA 3RBXA 1NKZB 4PV1B 3L70G 2JJLA 1Q90D 4A7PA 2N1TB 2QVAA 3HD7C 5CCHD 1FOSE 4U3FE 1VQ9P 1YBKA 3L75J 3CPWO 4JBZA 5KJ7A 3VMAA 2HYNA 2YMKA 1SQXE 2WSCJ 4PJ0E 1VQ6P 1CSBA 1VQ5P 1PZQA 3SWKA 3CCRP 5AVVB 1NOHA 1L2PA 1IFIA 3OJAB 3P7KA 5KLIB 3K5BA 1SQBE 4C46A 3HTKB 3IN6A 1L4AA 3EQ2A 3Q3DA 1PP9D 5AVSB 3U1CA 4HKZH 4PD4E 1P84I 2Y0CA 3L75E 2BCCJ 2N1TA 3T97A 1SQPK 3S1KA 1NTMG 3MUDC 4WY4D 2RKLA 1ZV8A 1JO5A 3H32B 2Q1KA 4I6MC 2KI7B 2YO3A 3PJSK 2LR2A 2KLVA 3FX0A 3BCCD 2WSSH 3CC4P 3AEAC 2NRGA 2KIKA 2WSFH 1BCCJ 3HTKA 3C9IA 1SQBG 3CCLP 4H13B 1U7MA 1H89A 3A0BE 3MD0A 3QH9A 4JQ0D 5TJHA 4UB8H 5AVUB 2WT7B 4AQRD 1LTGC 2KZIA 4ZKUA 3M9QA 3CC2P 3TDKA 4K35A 2QA4P 1BGYJ 1K8AQ 1BCCE 1R8EA 3H32A 1SQVD 4HYTB 1YITP 4OGQC 3L70D 1BSNA 1EZVE 1CI6A 1VQKP 1AVOA 1SQXK 2W90A 1KILB 3RK2B 2FFDB 2E76D 3CMAP 1ZP0C 2BCCG 3VMZA 2JEEA 4KHXA 1GK6A 1NTKJ 1SQBK 2WT7A 1VQPP 1LWUB 3FXEA 2WPRA 2YIUC 3KZIH 4ASWA 3RK3B 3R2PA 1EXIA 3HUSB 4BWNA 3GF3A 2V4HA 2JO1A 1JY3N 2KYVA 5APXA 1RF0A 1KB9E 2J59M 3L72J 1A02F 3M0DC 1S5LE 1M90Q 2OTJP 1LT9B 1JNMA 1KILA 1BDCA 1JY3O 2FFDA 2QSIA 1SQXD 4OH8B 1S2EA 3B71A 2M3BA 5KAIE 3CCVP 1N86A 1NH4A 2ITAA 1SQBD 1BGYG 1NAYA 1FZAA 1LWUA 1URQC 4IL6H 5H2FE 3HUSA 1L0LG 2FYUJ 1HF9A 2YMYA 2A06E 2E43A 1FU1A 5DJUB 1NTKG 2OYHC 1LT9A 3E1RA 5APQA 5AVYB 3CCEP 1YYCA 1FZCC 1CW5A 1NU1J 5AVWB 4Y99B 1P84E 1MUUA 4H0LD 4PJ0H 4XE5B 2QJKB 1J2JB 5BU8B 4IOIH 3L73J 4NPDA 2FYUE 5BVZA 2BCCD 2ZT9D 4HH2A 3D70A 5DJTB 3SSUA 3ITKA 4WY4B 3L72G 1LTIC 3F89A 1GDTA 4GIFA 4D6TE 3F5HA 3G6EP 4PD4H 3D6ZA 3EWKA 4N3YB 1NU1E 4EDFA 2H43A 2FY8A 5KAFE 4XA4A 2P2UA 2I1JA 3WU2E 4DCKA 2O01J 1M1KQ 1H0TA 3EFFK 3H1HJ 3SWYA 2R44A 5AVZB 2FXPA 1ZN5A 1AV1A 3II6A 2FXMA 2I8DA 2WITA 1LTJC 2FXOA 2JKVA 5B66E 3M0DA 4WY4A 1T6AA 3BASA 2E42A 3PP5A 3A0BH 5CJ4A 1BGYD 1JY3P 3C8VA 4H44C 3CXHI 1QL1A 1W5CE 1N73C 2E76B 4I2LC 3CWBJ 1LJ2A 1RY3A 2QRXA 4WWIA 2H89C 3L73G 1NTKD 3AEFC 1T3JA 5C39A 2IYPA 5KJ7C 1WMKA 3IR9A 3P8CE 1J1EB 1OWAA 1KQFB 2OARA 3EFGA 1GTWA 2YKPA 4YXDC 1UIXA 2FYUK 3TGUJ 2AXTE 2O01N 1IFJA 1VPCA 3L72D 3IFMA 3H1HG 1DD3A 2PFXA 5AW1B 2K9JB 1NU1K 1MKMA 1CZQA 1ZR2A 4PV1C 1KYOE 2MKVA 2C9NY 2FYZA 2N1TC 5APSA 1JUNA 1FZFA 2FKWB 3AE9C 3AEDC 3VP8A 1KB9H 3SFDC 1G1JA 5AW8B 1XTCC 3C1LA 1S5LH 1OFCX 4U7JA 1DIPA 1J1DB 3H1JJ 3JSVC 1OZHA 1VQ8P 5APVA 1JEKA 5KAIH 1SFCD 5KLIC 2YO2A 1NTZE 2G3AA 1ZMEC 1KQLA 1Y8AA 1RH5B 1ZR4A 3CWBG 1LP1B 2FYUD 1NYHA 2H88C 1HBWA 2WWWA 1MV8A 5CCGD 1IZNB 1Q86Q 1Q81Q 3AE5C 5AW0B 4AYCA 5KKZB 1LTJA 2K9JA 5H2FH 4R4LA 2OYIB 2B87B 2G8YA 4H0LB 1NU1D 5AW6B 4U3FJ 1YQ4C 1Y9BA 1HUCA 3H1JE 1IO4A 5AW4B 2ZT9B 5TISE 3TGUG 1OVUA 1G2CB 3L73D 2K37A 1S3JA 1KV4A 2CPSA 1ZRTD 4NPEA 3WUTA 1OW8A 3M0AA 1S9KE 2BEQD 3V5BA 1D7MA 2XDJA 1PL5A 3Q1MA 1SQPG 3SWFA 1GU5A 1LP1A 4H13C 1BE3J
chains in the Genus database with same CATH topology
3H32A 1HJBA 4HYTB 1AQ5A 2GUVA 3NMDA 5BU5A 1DEBA 5AW2B 1E5WA 5KJ7D 4W80A 1CI6A 2YNYA 2IPPA 4LC1A 5APTA 2GUSA 3U59A 2WSEH 1SQXK 1RF1B 1NAFA 2PP6A 3KYQA 1GK4A 1KILB 5KLVK 3RK2B 1IFMA 2FFDB 5AVTB 3HD7D 2O1JA 2R5BA 4JYCA 3VMZA 2JEEA 4KHXA 1GK6A 3B5NB 1IFDA 2HPCB 1KZUB 1GL2C 4RESB 1SQBK 4C7NA 2WT7A 1RE4C 1G2CA 2N9BA 2HLOA 2VRSA 2BASA 1ZLLA 4IFMA 1LWUB 1RF0C 1N7LA 2WPRA 1YTZT 1MFZA 5KTBA 3RK3B 2R32A 1SQQK 3HUSB 3R2PA 1RF1C 1XTGB 3HE4B 4N78D 4AUWA 1LTAC 1KILC 1RE4A 3RK2C 1L0LK 2FFDC 4N6JA 2WSCH 3LIEA 1N7SB 2J58A 2N1TD 3M06A 1H88A 1JY3N 2MJZA 2KYVA 1NKNA 2CPBA 5APXA 3B5NC 1NTZK 1RF0A 1WT6A 2J59M 2WZ7A 1URQB 1NTKK 2L5GB 2R3CA 3VMXA 1NWQA 3M0DC 1A02F 1LT9B 1JNMA 1RF1A 3KQGA 1KILA 1JY3O 2FFDA 1LWUC 2XNXA 3M9HA 4OH8B 2M3BA 4JYBA 1JCCA 3B5NA 1HGZA 3RK3C 3HUSC 1IFNA 1N86A 1SP4A 3GHGB 3MTUE 1NH4A 2O01H 2Q7CA 1SLQA 2OYHB 1N7SC 2NPSD 3NTNA 1FZAA 2PAJA 1LWUA 3KPEA 3L4FA 2H7HA 3MIWA 1URQC 1FZCB 2A45I 5AVQB 4ZKPA 1LT9C 3HUSA 1T2KC 1IJDB 3HE4A 2KSJA 2W6BA 2LKMA 3HRNA 5AW5B 1N7SA 3H6PA 1N2DC 1T3UA 5CMZA 5AVXB 2YMYA 1URQA 2E43A 3GHGC 1FU1A 2M8RA 3E1IA 4W7YA 2OYHC 1LT9A 1LTSC 3P8MC 1T8ZA 4EIJA 5APQA 5AVYB 1L4AB 3CLQA 2W27A 1YYCA 1FZCC 1NHLA 1CW5A 1GZLA 5APYA 4N78E 5AVWB 4Y99B 2OYIA 3NFQA 3GHGA 5AW9B 1MUUA 3A5TA 3VN0A 3A2AA 4XE5B 3VMYA 1J2JB 2OYHA 2IFNA 2W6AA 3L37A 1FBMA 1YTZI 3V2NA 3I5CA 5BU8B 1HVVA 1MZ9A 3M9BA 1IC2A 2P7JA 3VOPA 1FZCA 3L36A 5BVZA 1SFCB 4HH2A 3CL3D 4WY4B 2HODB 1SVFA 1L4AC 3TNUB 1LTIC 2WPQA 1GDTA 2XKMA 4GIFA 2WPSA 1A02J 3VP9A 1GL2D 1HTLC 3L35A 1GU4A 4Y99C 1GL2A 5APWA 3LW5H 1LTJB 1FJKA 2POHA 4N3YB 4LLHA 2H8PD 1HWTC 2ZFCA 2HG5D 3P8CD 2H43A 1W2EA 4WB4A 3A7OA 1LGHB 4XA4A 3TYYA 1SFCC 1GW4A 2P2UA 1M1JB 2I1JA 3MGNA 4WY4C 1NO4A 1FZBA 1X79B 1HGVA 1KILD 3RK2D 2WTYA 4GT1A 3SWYA 1VDFA 1DX7A 5AVZB 1L0NK 5CCGC 2IFMA 1WRGA 1ZN5A 3B5ND 2QM7A 1JY2N 3II6A 3RL0B 2FXMA 1N73B 2HPCA 1LTBC 1Z56A 2WITA 1SFCA 1LTJC 1SQVK 3P32A 5CHXA 1X9VA 2IX7C 5AW7B 1GD2E 1PFIA 2KP8A 3M0DA 1QL2A 4WY4A 4IFDK 4EOTA 4DZOA 2HODA 3BASA 1FDMA 2E42A 3PP5A 3TNUA 1JTHB 5CJ4A 3V4QA 3G3ZA 3V4WA 1JY2O 4M3LA 5CCGA 2KOGA 5AW3B 1M1JC 2Z5HA 1JY3P 5AVRB 3RK3D 2C0XA 1CI6B 5APUA 4WBAA 2A45G 1HH0A 1QL1A 3TSIA 1N7SD 3TK1A 2YKQA 1FZGA 2P67A 1FZEA 3OA7A 3UIAA 3RL0C 1N73C 2C0WA 4I2LC 1URQD 3HD7B 1RY3A 1DH3A 1M1JA 4LGDE 3WMM0 1T2KD 3NXSA 3LIDA 2XZRA 1JMMA 3N4XA 1T3JA 3OAKA 5CCHC 1FOSF 4O9BA 2Q9IA 4I1LA 2Q3IA 1N73A 3V2PA 3HE5B 1X8YA 4IFFA 5KJ7C 1GW3A 3IR9A 3P8CE 1J1EB 1OWAA 4B86A 3VYIA 2I1KA 4W7ZA 1NKZB 2OARA 3EFGA 1GTWA 1JTHA 2JJLA 2GM4A 2YKPA 4C7RA 3BVHA 2N1TB 3HD7C 1NTMK 5CCHD 1RE3C 1FOSE 2FYUK 5CCHA 3O8ZA 3A3YB 1IFJA 5KJ7A 2HYNA 2R5DA 1VPCA 1CSBA 3B8EB 3VTPC 3IFMA 5AVVB 1NOHA 1AFOA 2P1JA 1IFIA 4DOJA 3OJAB 3HD7A 1RE3A 3P7KA 1JOCA 1S9KD 2A45H 1J1EC 5AW1B 4C46A 3HTKB 1NU1K 1CZQA 1ZR2A 2C9LY 1L4AD 3CI9A 1L4AA 2FYZA 3EQ2A 2C9NY 1KFNA 1OXZA 2N1TC 2NPSB 5APSA 1JUNA 5AVSB 1FZFA 1EQ7A 2FKWB 3VP8A 3U1CA 3HE5A 1G1JA 5AW8B 1XTCC 2Z5IA 2XV5A 1FJPA 3KDPB 3U1AA 1J1DB 1IK9A 2N1TA 5APVA 3T97A 1LTTC 1SFCD 4GKGA 2YO2A 1SQPK 1KQLA 4WY4D 1ZR4A 1G1IA 1ZV8A 1JO5A 3H32B 1HBWA 4I6MC 1JCDA 2WWWA 2O1KA 1MV8A 2NPSC 5CCGD 2YO3A 2KLVA 2HFED 5AW0B 2YKOA 4AYCA 2WSFH 5CJ0A 3MUDA 1LTJA 3HTKA 2Z4EA 3C9IA 2OYIB 1J1DC 1H89A 3V2RA 5AW6B 2NPSA 3N7NA 1M7LA 1FAVA 1HUCA 3M91A 3MD0A 1IO4A 2KB7P 3BRTB 5AVUB 4C7NB 1JY2P 5AW4B 2WT7B 3BATA 4AQRD 2QM8A 1G2CB 1LTGC 1H8AA 4JF7A 2CPSA 3V2QA 2XU6A 4ZKUA 3RL0D 3M9QA 3M0AA 1S9KE 3BRVB 3V5BA 2Q5UA 2XDJA 1KFMA 2ZXEB 2OYIC 1GL2B 3SWFA 1GU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VP9 A;  3OJA B;  5BU8 B;  1IC2 A;  2JEE A;  2POH A;  4N78 D;  4N3Y B;  3U1A A;  4ZKP A;  5BU5 A;  3BAT A;  3N4X A;  5BVZ A;  2FXM A;  3P8C D;  4ZKU A;  1NKN A;  3C9I A;  3HRN A;  4O9B A;  4I1L A;  3U59 A;  1WT6 A;  3VP8 A;  3U1C A;  3BAS A;  3N7N A;  4GIF A;  1X79 B;  5KTB A; 
#chains in the Genus database with same CATH topology
 1HJ0 A;  1HJB A;  1EC5 A;  2GUV A;  3NMD A;  2JWA A;  1NVO A;  3A0H E;  1Q7Y Q;  3OW2 O;  1PPJ G;  2YNY A;  2KS1 B;  4LC1 A;  5APT A;  2B87 A;  1GK4 A;  3GW6 A;  3R4Y A;  4Y28 J;  2O1J A;  2R5B A;  4JYC A;  1JMB A;  3H1H D;  2FYN B;  1IFD A;  1FS0 E;  3AE7 C;  4DJG A;  1G2C A;  1VF5 D;  1BE3 E;  3PH0 A;  1Q2N A;  1U7J A;  1SS1 A;  5CBN A;  1RF0 C;  1FDO A;  1MFZ A;  2IBZ E;  3AE3 C;  4CPG A;  3WU2 H;  1JM0 A;  3CXH E;  1KIL C;  1RE4 A;  3RK2 C;  3AE6 C;  2FFD C;  3LIE A;  3M06 A;  1H88 A;  3CX5 D;  2MJZ A;  3H1I E;  2CPB A;  1NTZ K;  4U3F G;  1GMJ A;  1IK7 A;  2KS1 A;  3VMX A;  5B66 H;  1NWQ A;  1LT1 A;  1S5L X;  3CWB D;  2KUB A;  1SQX G;  1LWU C;  4XFJ A;  4RKU J;  1OW6 A;  1JCC A;  3RK3 C;  3HUS C;  1SP4 A;  3JC2 2;  3MTU E;  2O01 H;  2Q7C A;  2W8Z A;  2NPS D;  1BE3 G;  3L71 E;  3KHU A;  4HJG H;  2ZVO B;  3MIW A;  1LT9 C;  1T2K C;  1IJD B;  2WQY C;  3S4R A;  2KSJ A;  3L75 G;  2W6B A;  3TGU D;  3IF4 A;  3Q5R A;  5AW5 B;  3CCS P;  5AVX B;  1Q82 Q;  4W7Y A;  1SQP D;  3CX5 H;  2R3S A;  1LTS C;  2AEF A;  1OW7 A;  1T8Z A;  4EIJ A;  3CLQ A;  3H1L E;  2W27 A;  1NHL A;  1FC2 C;  2B89 A;  4N78 E;  4GOD A;  1PPJ D;  3NFQ A;  2ZVN B;  3A2A A;  4RO0 A;  3VMY A;  3WUV A;  3V6I A;  1YTZ I;  3I5C A;  1MZ9 A;  3M9B A;  3H1K E;  2QE7 H;  2E75 D;  3WUU A;  2IDB A;  3FGA D;  3CME P;  1SFC B;  2K9Y A;  3CL3 D;  4GOE A;  2HOD B;  1KYO H;  4YXW H;  4GOF A;  3Q2Y A;  4GDO A;  5KLV E;  4ZMD A;  1PGQ A;  5GTI E;  4TT3 H;  2OGU A;  2K3R A;  1PGP A;  2WPS A;  1GL2 D;  1HTL C;  1RHZ B;  4Y99 C;  2D2C C;  1K04 A;  1FJK A;  2PRR A;  2H8P D;  2QJK C;  2ZFC A;  1BCC G;  5GTH E;  1ZW0 A;  2KSE A;  4WB4 A;  1BDD A;  2RMZ A;  1QVF O;  2UWJ E;  1GW4 A;  1EZV G;  3MGN A;  4U3F D;  4WY4 C;  1NO4 A;  1FZB A;  1SQQ E;  1JB0 J;  1S72 P;  2WTY A;  1DX7 A;  3B5N D;  1JY2 N;  2PGD A;  1LTB C;  1AQT A;  1SFC A;  3P32 A;  5CHX A;  5AW7 B;  4JPZ B;  2QJP B;  1QL2 A;  4EOT A;  4DZO A;  2HOD A;  1FDM A;  1JTH B;  3V4Q A;  3G3Z A;  3V4W A;  1JY2 O;  5CCG A;  1BE3 D;  5AW3 B;  2C0X A;  5APU A;  5TIS H;  4PD4 D;  1N7S D;  4UB6 H;  3L74 J;  3L75 D;  2P67 A;  4L73 A;  2Q3E A;  2C0W A;  1EDJ A;  2LXC B;  3WMM 0;  3NXS A;  1M57 D;  3MHV A;  2E74 D;  2XZR A;  4D6T J;  3OAK A;  1VF5 B;  1OIP A;  3RGU A;  1FOS F;  4I1L A;  2Q3I A;  3V2P A;  3HE5 B;  4L75 A;  2E5Y A;  1KQG B;  1EXJ A;  1X0T A;  2P10 A;  3USS A;  1JTH A;  3L74 E;  2E76 C;  4C7R A;  4ZNC A;  5CCH A;  2RN0 A;  1KIL E;  3LW5 J;  3O8Z A;  2R5D A;  3B8E B;  2QJY B;  2CK3 H;  1AJY A;  1MFT A;  1AFO A;  4DOJ A;  1RE3 A;  1JOC A;  1VQN P;  2A45 H;  2ZYA A;  1J1E C;  1ZOY C;  2A06 G;  3Q5P A;  4EYY Q;  3TF5 A;  2C9L Y;  1L4A D;  5CBO A;  1BCC D;  3H25 A;  3IAO A;  1KFN A;  1OXZ A;  1S1C X;  2NPS B;  3RK3 E;  1EQ7 A;  3HE5 A;  1EZV D;  3D71 A;  2XV5 A;  3U1A A;  1IK9 A;  3FWL A;  1R5S A;  1DEE G;  2FYU G;  1DD4 A;  2E5T A;  4YPC A;  1JCD A;  1L0N E;  4D6T G;  2YKO A;  1W2B O;  3PTZ A;  5CJ0 A;  2Z4E A;  1VQM P;  1NU1 G;  1J1D C;  3V2R A;  2LXB A;  3W67 A;  1YJ9 P;  1EDI A;  2NPS A;  1RQU A;  1M7L A;  1FAV A;  3M91 A;  4PD4 I;  2KB7 P;  2E75 B;  4C7N B;  1JY2 P;  1KB9 D;  1PV3 A;  2QM8 A;  1KMI Z;  1H8A A;  3V2Q A;  3RL0 D;  3BRV B;  5KKZ C;  2Q5U A;  1VQL P;  2ZYD A;  1KFM A;  4UB8 E;  2ZXE B;  2OYI C;  1GL2 B;  1PP9 E;  4H0L C;  1K73 Q;  3FWN A;  2KLU A;  1YJN P;  1DEB A;  3AEE C;  5AW2 B;  2OYO A;  1AA0 A;  3D6Y A;  2ZT9 C;  2KZJ A;  3U59 A;  1IFP A;  1RF1 B;  3KYQ A;  1IFM A;  5GTI H;  3GF7 A;  1OVR A;  1NTZ J;  3HD7 D;  3B5N B;  2HPC B;  1KZU B;  4C7N A;  4DT0 A;  1RE4 C;  2A06 D;  2N9B A;  3BCC E;  5GTH H;  2HLO A;  2JP3 A;  2VRS A;  1N8R Q;  1SQV J;  3O6Q B;  5E79 E;  2R32 A;  1YI2 P;  4AUW A;  1P84 D;  4N6J A;  1N7S B;  3CCJ P;  1QX8 A;  2FYN C;  1WT6 A;  2L5G B;  1VQO P;  1RF1 A;  1R5L A;  2JR8 A;  3KQG A;  2E74 B;  2XNX A;  4JYB A;  3B5N A;  1HGZ A;  4D6T D;  1QVG O;  1QGK B;  1IFN A;  1SQV E;  3GHG B;  3L70 E;  4KT0 J;  2PAJ A;  3KPE A;  3RL0 g;  3O6Q A;  2KK7 A;  4I7Z B;  2ZYG A;  1RQV A;  1N7S A;  1NTM J;  3CCM P;  1KB9 I;  1N2D C;  2NZ2 A;  1T3U A;  1NTZ G;  2WSE J;  1P84 H;  2M8R A;  3P8M C;  1L4A B;  1GZL A;  5APY A;  2OYI A;  3GHG A;  5AW9 B;  2B9B A;  2W6A A;  3H1I J;  3L37 A;  4OGQ D;  1EDL A;  2M3E A;  3T97 B;  1NTM E;  4BXL A;  2P7J A;  3H1J G;  3I55 P;  3L36 A;  1TU3 F;  1VQ4 P;  2WVR A;  3G9R A;  5KAF H;  1YHQ P;  2WPQ A;  2GA1 A;  2JDI H;  3L35 A;  3LW5 H;  4LLH A;  3P8C D;  3L71 J;  1W2E A;  3TYY A;  1SFC C;  1M1J B;  2Q6Q A;  2D2C D;  1PGO A;  1HGV A;  4GT1 A;  1E79 H;  1YJW P;  5CCG C;  1OVV A;  2IFM A;  1WRG A;  2QM7 A;  3RL0 B;  2K1A A;  1SQV K;  1X9V A;  2IX7 C;  1GD2 E;  3H1L J;  1KYO D;  4MN4 C;  4M3L A;  2Z5H A;  1VQ7 P;  5AVR B;  2Y0D A;  1CI6 B;  2IBZ G;  2SPZ A;  4WBA A;  2A45 G;  3ABV C;  1HH0 A;  3TSI A;  3TK1 A;  2OTK E;  2BEZ F;  2YKQ A;  1FZG A;  3H1K J;  3FXD A;  2BCC E;  3H1I G;  2JWD A;  1URQ D;  3HD7 B;  1M1J A;  1KC8 Q;  4LGD E;  2QJP C;  4R4M A;  1NTZ D;  3LID A;  5KLV J;  3Q5S A;  1JMM A;  3N4X A;  3AE2 C;  5CCH C;  3GG2 A;  3GLM A;  2AXT H;  1QEX A;  1FE6 A;  3CCQ P;  1GW3 A;  3VYI A;  4W7Z A;  3ZDM A;  2GM4 A;  2KXP B;  2QEX P;  3BVH A;  1NTM K;  1RE3 C;  3L71 G;  3JCU E;  1SQQ J;  3H1J D;  2IYO A;  3A3Y B;  2YXR B;  1K9M Q;  1L0L J;  1USE A;  1VF5 C;  4BRY B;  3VTP C;  2FBW C;  2WMM A;  2P1J A;  1KTM A;  3HD7 A;  1S9K D;  5E79 H;  2IZ1 A;  3QWO C;  3AEG C;  4OVN F;  1BGY E;  3CI9 A;  3H1L G;  2YXQ B;  1FDI A;  2WPV B;  4NPF X;  3CX5 I;  2Z5I A;  1FJP A;  3KDP B;  2QJY C;  1L0L E;  2OTL P;  1YQ3 C;  2IZ0 A;  1LTT C;  4GKG A;  3H1K G;  1NTK E;  1NTM D;  1G1I A;  1QLE D;  1OMI A;  2V7Q J;  2ZAE B;  4BRY A;  2O1K A;  2NPS C;  3AE8 C;  5KLV G;  2HFE D;  3G4S P;  3S9O A;  2QG4 A;  1KQS O;  3MUD A;  2IBZ D;  4WVZ A;  1KYO I;  2QIW A;  1KD1 Q;  3CXH D;  3N7N A;  4OGQ B;  3BRT B;  3H1I D;  4H44 D;  3G71 P;  2L91 A;  1PIX A;  3L72 E;  3BAT A;  4L74 A;  1SQQ G;  4JF7 A;  3A0H H;  2XU6 A;  2AEM A;  5B5E E;  4Z1M H;  1AQ5 A;  1Y47 A;  5BU5 A;  3I56 P;  1E5W A;  1EDK A;  2E75 C;  5KJ7 D;  2YIU B;  4W80 A;  3L71 D;  2IPP A;  2OQQ A;  2GUS A;  2Y9Z A;  2WSE H;  2D2C B;  1NAF A;  2PP6 A;  1H0T B;  5KLV K;  2O3J A;  1S4X A;  5AVT B;  2HR3 A;  1GL2 C;  4RES B;  3CXH H;  1L0N J;  3E7K A;  4RJT A;  2BAS A;  1ZLL A;  4IFM A;  2KNC B;  2M0B A;  4TLF A;  1N7L A;  1YTZ T;  3H1L D;  5KTB A;  1NGM B;  4ASV A;  1RF1 C;  1SQQ K;  1U57 A;  1XTG B;  3HE4 B;  5EFW B;  4PV1 D;  2B88 A;  4N78 D;  1X22 A;  1LTA C;  1L0L K;  2WSC H;  2J58 A;  2N1T D;  3AEC C;  1NKN A;  3L74 G;  4L76 A;  3SFE C;  3B5N C;  2WSF J;  2Y0E A;  2WZ7 A;  1URQ B;  1NTK K;  2R3C A;  3H1K D;  3L73 E;  1ZRT E;  3W68 A;  1YIJ P;  2XND H;  3PRJ A;  4QMA A;  4OWF A;  2AXC A;  3M9H A;  1ZXG A;  2P58 A;  5KLV D;  1PGJ A;  1PP9 J;  1M56 D;  1NJI Q;  1SLQ A;  2OYH B;  1N7S C;  3NTN A;  2KNC A;  3L4F A;  2H7H A;  2IBZ I;  1FZC B;  2A45 I;  5AVQ B;  4ZKP A;  3HE4 A;  2LKM A;  2E74 C;  3HRN A;  2M5A B;  1SQQ D;  3H1H E;  3H6P A;  1L0L D;  5CMZ A;  1URQ A;  3GHG C;  3E1I A;  1USD A;  3BCC J;  1KN7 A;  4KJM A;  3CD6 P;  3B4S A;  4IL6 X;  1L0N G;  3CC7 P;  4I7Z C;  3JCU H;  4H13 D;  3A5T A;  3CX5 E;  3VN0 A;  2OYH A;  3AEB C;  2IFN A;  1FBM A;  1BSH A;  3V2N A;  2W83 C;  1HVV A;  1IC2 A;  1KOR A;  3PHL A;  3VOP A;  1FZC A;  3CWB E;  5L8R J;  1SVF A;  1L4A C;  5M1B A;  3TNU B;  2M5A A;  1AVY A;  2XKM A;  3RBZ A;  3KXD A;  1SQP J;  1A02 J;  3VP9 A;  1UII A;  1GU4 A;  1GL2 A;  5APW A;  3L70 J;  1LTJ B;  2POH A;  2N9Y B;  1HWT C;  2HG5 D;  1LNQ A;  1M8O B;  1PP9 G;  1EZV I;  3A7O A;  1LGH B;  3L74 D;  3KZI E;  3MZW B;  3TGU E;  4H44 B;  1X79 B;  1KIL D;  3RK2 D;  1VDF A;  5K5G B;  1L0N K;  4YTP C;  2Y9Y A;  2ZXX A;  1N73 B;  2HPC A;  1SQP E;  1Z56 A;  3GMA A;  1PFI A;  2KP8 A;  4IFD K;  4HB1 A;  2K88 A;  3TNU A;  3BCC G;  2KOG A;  1M1J C;  2RH0 A;  1PPJ E;  3RK3 D;  3AE1 C;  3AE4 C;  1OX3 A;  2V7Q H;  1FZE A;  1K05 A;  3OA7 A;  3UIA A;  3RL0 C;  2AEJ A;  4K3A A;  1DH3 A;  1T2K D;  1SQX J;  4IL6 E;  5B5E H;  3PLN A;  4UB6 E;  4EI2 A;  2J5U A;  2DW3 A;  4O9B A;  2W6J H;  2Q9I A;  1N73 A;  1L0N D;  1SQB J;  1X8Y A;  4IFF A;  3MP7 B;  1VL2 A;  3CCU P;  1SQV G;  4B86 A;  2ZJS E;  2I1K A;  3RBX A;  1NKZ B;  4PV1 B;  3L70 G;  2JJL A;  1Q90 D;  4A7P A;  2N1T B;  2QVA A;  3HD7 C;  5CCH D;  1FOS E;  4U3F E;  1VQ9 P;  1YBK A;  3L75 J;  3CPW O;  4JBZ A;  5KJ7 A;  3VMA A;  2HYN A;  2YMK A;  1SQX E;  2WSC J;  4PJ0 E;  1VQ6 P;  1CSB A;  1VQ5 P;  1PZQ A;  3SWK A;  3CCR P;  5AVV B;  1NOH A;  1L2P A;  1IFI A;  3OJA B;  3P7K A;  5KLI B;  3K5B A;  1SQB E;  4C46 A;  3HTK B;  3IN6 A;  1L4A A;  3EQ2 A;  3Q3D A;  1PP9 D;  5AVS B;  3U1C A;  4HKZ H;  4PD4 E;  1P84 I;  2Y0C A;  3L75 E;  2BCC J;  2N1T A;  3T97 A;  1SQP K;  3S1K A;  1NTM G;  3MUD C;  4WY4 D;  2RKL A;  1ZV8 A;  1JO5 A;  3H32 B;  2Q1K A;  4I6M C;  2KI7 B;  2YO3 A;  3PJS K;  2LR2 A;  2KLV A;  3FX0 A;  3BCC D;  2WSS H;  3CC4 P;  3AEA C;  2NRG A;  2KIK A;  2WSF H;  1BCC J;  3HTK A;  3C9I A;  1SQB G;  3CCL P;  4H13 B;  1U7M A;  1H89 A;  3A0B E;  3MD0 A;  3QH9 A;  4JQ0 D;  5TJH A;  4UB8 H;  5AVU B;  2WT7 B;  4AQR D;  1LTG C;  2KZI A;  4ZKU A;  3M9Q A;  3CC2 P;  3TDK A;  4K35 A;  2QA4 P;  1BGY J;  1K8A Q;  1BCC E;  1R8E A;  3H32 A;  1SQV D;  4HYT B;  1YIT P;  4OGQ C;  3L70 D;  1BSN A;  1EZV E;  1CI6 A;  1VQK P;  1AVO A;  1SQX K;  2W90 A;  1KIL B;  3RK2 B;  2FFD B;  2E76 D;  3CMA P;  1ZP0 C;  2BCC G;  3VMZ A;  2JEE A;  4KHX A;  1GK6 A;  1NTK J;  1SQB K;  2WT7 A;  1VQP P;  1LWU B;  3FXE A;  2WPR A;  2YIU C;  3KZI H;  4ASW A;  3RK3 B;  3R2P A;  1EXI A;  3HUS B;  4BWN A;  3GF3 A;  2V4H A;  2JO1 A;  1JY3 N;  2KYV A;  5APX A;  1RF0 A;  1KB9 E;  2J59 M;  3L72 J;  1A02 F;  3M0D C;  1S5L E;  1M90 Q;  2OTJ P;  1LT9 B;  1JNM A;  1KIL A;  1BDC A;  1JY3 O;  2FFD A;  2QSI A;  1SQX D;  4OH8 B;  1S2E A;  3B71 A;  2M3B A;  5KAI E;  3CCV P;  1N86 A;  1NH4 A;  2ITA A;  1SQB D;  1BGY G;  1NAY A;  1FZA A;  1LWU A;  1URQ C;  4IL6 H;  5H2F E;  3HUS A;  1L0L G;  2FYU J;  1HF9 A;  2YMY A;  2A06 E;  2E43 A;  1FU1 A;  5DJU B;  1NTK G;  2OYH C;  1LT9 A;  3E1R A;  5APQ A;  5AVY B;  3CCE P;  1YYC A;  1FZC C;  1CW5 A;  1NU1 J;  5AVW B;  4Y99 B;  1P84 E;  1MUU A;  4H0L D;  4PJ0 H;  4XE5 B;  2QJK B;  1J2J B;  5BU8 B;  4IOI H;  3L73 J;  4NPD A;  2FYU E;  5BVZ A;  2BCC D;  2ZT9 D;  4HH2 A;  3D70 A;  5DJT B;  3SSU A;  3ITK A;  4WY4 B;  3L72 G;  1LTI C;  3F89 A;  1GDT A;  4GIF A;  4D6T E;  3F5H A;  3G6E P;  4PD4 H;  3D6Z A;  3EWK A;  4N3Y B;  1NU1 E;  4EDF A;  2H43 A;  2FY8 A;  5KAF E;  4XA4 A;  2P2U A;  2I1J A;  3WU2 E;  4DCK A;  2O01 J;  1M1K Q;  1H0T A;  3EFF K;  3H1H J;  3SWY A;  2R44 A;  5AVZ B;  2FXP A;  1ZN5 A;  1AV1 A;  3II6 A;  2FXM A;  2I8D A;  2WIT A;  1LTJ C;  2FXO A;  2JKV A;  5B66 E;  3M0D A;  4WY4 A;  1T6A A;  3BAS A;  2E42 A;  3PP5 A;  3A0B H;  5CJ4 A;  1BGY D;  1JY3 P;  3C8V A;  4H44 C;  3CXH I;  1QL1 A;  1W5C E;  1N73 C;  2E76 B;  4I2L C;  3CWB J;  1LJ2 A;  1RY3 A;  2QRX A;  4WWI A;  2H89 C;  3L73 G;  1NTK D;  3AEF C;  1T3J A;  5C39 A;  2IYP A;  5KJ7 C;  1WMK A;  3IR9 A;  3P8C E;  1J1E B;  1OWA A;  1KQF B;  2OAR A;  3EFG A;  1GTW A;  2YKP A;  4YXD C;  1UIX A;  2FYU K;  3TGU J;  2AXT E;  2O01 N;  1IFJ A;  1VPC A;  3L72 D;  3IFM A;  3H1H G;  1DD3 A;  2PFX A;  5AW1 B;  2K9J B;  1NU1 K;  1MKM A;  1CZQ A;  1ZR2 A;  4PV1 C;  1KYO E;  2MKV A;  2C9N Y;  2FYZ A;  2N1T C;  5APS A;  1JUN A;  1FZF A;  2FKW B;  3AE9 C;  3AED C;  3VP8 A;  1KB9 H;  3SFD C;  1G1J A;  5AW8 B;  1XTC C;  3C1L A;  1S5L H;  1OFC X;  4U7J A;  1DIP A;  1J1D B;  3H1J J;  3JSV C;  1OZH A;  1VQ8 P;  5APV A;  1JEK A;  5KAI H;  1SFC D;  5KLI C;  2YO2 A;  1NTZ E;  2G3A A;  1ZME C;  1KQL A;  1Y8A A;  1RH5 B;  1ZR4 A;  3CWB G;  1LP1 B;  2FYU D;  1NYH A;  2H88 C;  1HBW A;  2WWW A;  1MV8 A;  5CCG D;  1IZN B;  1Q86 Q;  1Q81 Q;  3AE5 C;  5AW0 B;  4AYC A;  5KKZ B;  1LTJ A;  2K9J A;  5H2F H;  4R4L A;  2OYI B;  2B87 B;  2G8Y A;  4H0L B;  1NU1 D;  5AW6 B;  4U3F J;  1YQ4 C;  1Y9B A;  1HUC A;  3H1J E;  1IO4 A;  5AW4 B;  2ZT9 B;  5TIS E;  3TGU G;  1OVU A;  1G2C B;  3L73 D;  2K37 A;  1S3J A;  1KV4 A;  2CPS A;  1ZRT D;  4NPE A;  3WUT A;  1OW8 A;  3M0A A;  1S9K E;  2BEQ D;  3V5B A;  1D7M A;  2XDJ A;  1PL5 A;  3Q1M A;  1SQP G;  3SWF A;  1GU5 A;  1LP1 A;  4H13 C;  1BE3 J; 
#chains in the Genus database with same CATH homology
 3H32 A;  1HJB A;  4HYT B;  1AQ5 A;  2GUV A;  3NMD A;  5BU5 A;  1DEB A;  5AW2 B;  1E5W A;  5KJ7 D;  4W80 A;  1CI6 A;  2YNY A;  2IPP A;  4LC1 A;  5APT A;  2GUS A;  3U59 A;  2WSE H;  1SQX K;  1RF1 B;  1NAF A;  2PP6 A;  3KYQ A;  1GK4 A;  1KIL B;  5KLV K;  3RK2 B;  1IFM A;  2FFD B;  5AVT B;  3HD7 D;  2O1J A;  2R5B A;  4JYC A;  3VMZ A;  2JEE A;  4KHX A;  1GK6 A;  3B5N B;  1IFD A;  2HPC B;  1KZU B;  1GL2 C;  4RES B;  1SQB K;  4C7N A;  2WT7 A;  1RE4 C;  1G2C A;  2N9B A;  2HLO A;  2VRS A;  2BAS A;  1ZLL A;  4IFM A;  1LWU B;  1RF0 C;  1N7L A;  2WPR A;  1YTZ T;  1MFZ A;  5KTB A;  3RK3 B;  2R32 A;  1SQQ K;  3HUS B;  3R2P A;  1RF1 C;  1XTG B;  3HE4 B;  4N78 D;  4AUW A;  1LTA C;  1KIL C;  1RE4 A;  3RK2 C;  1L0L K;  2FFD C;  4N6J A;  2WSC H;  3LIE A;  1N7S B;  2J58 A;  2N1T D;  3M06 A;  1H88 A;  1JY3 N;  2MJZ A;  2KYV A;  1NKN A;  2CPB A;  5APX A;  3B5N C;  1NTZ K;  1RF0 A;  1WT6 A;  2J59 M;  2WZ7 A;  1URQ B;  1NTK K;  2L5G B;  2R3C A;  3VMX A;  1NWQ A;  3M0D C;  1A02 F;  1LT9 B;  1JNM A;  1RF1 A;  3KQG A;  1KIL A;  1JY3 O;  2FFD A;  1LWU C;  2XNX A;  3M9H A;  4OH8 B;  2M3B A;  4JYB A;  1JCC A;  3B5N A;  1HGZ A;  3RK3 C;  3HUS C;  1IFN A;  1N86 A;  1SP4 A;  3GHG B;  3MTU E;  1NH4 A;  2O01 H;  2Q7C A;  1SLQ A;  2OYH B;  1N7S C;  2NPS D;  3NTN A;  1FZA A;  2PAJ A;  1LWU A;  3KPE A;  3L4F A;  2H7H A;  3MIW A;  1URQ C;  1FZC B;  2A45 I;  5AVQ B;  4ZKP A;  1LT9 C;  3HUS A;  1T2K C;  1IJD B;  3HE4 A;  2KSJ A;  2W6B A;  2LKM A;  3HRN A;  5AW5 B;  1N7S A;  3H6P A;  1N2D C;  1T3U A;  5CMZ A;  5AVX B;  2YMY A;  1URQ A;  2E43 A;  3GHG C;  1FU1 A;  2M8R A;  3E1I A;  4W7Y A;  2OYH C;  1LT9 A;  1LTS C;  3P8M C;  1T8Z A;  4EIJ A;  5APQ A;  5AVY B;  1L4A B;  3CLQ A;  2W27 A;  1YYC A;  1FZC C;  1NHL A;  1CW5 A;  1GZL A;  5APY A;  4N78 E;  5AVW B;  4Y99 B;  2OYI A;  3NFQ A;  3GHG A;  5AW9 B;  1MUU A;  3A5T A;  3VN0 A;  3A2A A;  4XE5 B;  3VMY A;  1J2J B;  2OYH A;  2IFN A;  2W6A A;  3L37 A;  1FBM A;  1YTZ I;  3V2N A;  3I5C A;  5BU8 B;  1HVV A;  1MZ9 A;  3M9B A;  1IC2 A;  2P7J A;  3VOP A;  1FZC A;  3L36 A;  5BVZ A;  1SFC B;  4HH2 A;  3CL3 D;  4WY4 B;  2HOD B;  1SVF A;  1L4A C;  3TNU B;  1LTI C;  2WPQ A;  1GDT A;  2XKM A;  4GIF A;  2WPS A;  1A02 J;  3VP9 A;  1GL2 D;  1HTL C;  3L35 A;  1GU4 A;  4Y99 C;  1GL2 A;  5APW A;  3LW5 H;  1LTJ B;  1FJK A;  2POH A;  4N3Y B;  4LLH A;  2H8P D;  1HWT C;  2ZFC A;  2HG5 D;  3P8C D;  2H43 A;  1W2E A;  4WB4 A;  3A7O A;  1LGH B;  4XA4 A;  3TYY A;  1SFC C;  1GW4 A;  2P2U A;  1M1J B;  2I1J A;  3MGN A;  4WY4 C;  1NO4 A;  1FZB A;  1X79 B;  1HGV A;  1KIL D;  3RK2 D;  2WTY A;  4GT1 A;  3SWY A;  1VDF A;  1DX7 A;  5AVZ B;  1L0N K;  5CCG C;  2IFM A;  1WRG A;  1ZN5 A;  3B5N D;  2QM7 A;  1JY2 N;  3II6 A;  3RL0 B;  2FXM A;  1N73 B;  2HPC A;  1LTB C;  1Z56 A;  2WIT A;  1SFC A;  1LTJ C;  1SQV K;  3P32 A;  5CHX A;  1X9V A;  2IX7 C;  5AW7 B;  1GD2 E;  1PFI A;  2KP8 A;  3M0D A;  1QL2 A;  4WY4 A;  4IFD K;  4EOT A;  4DZO A;  2HOD A;  3BAS A;  1FDM A;  2E42 A;  3PP5 A;  3TNU A;  1JTH B;  5CJ4 A;  3V4Q A;  3G3Z A;  3V4W A;  1JY2 O;  4M3L A;  5CCG A;  2KOG A;  5AW3 B;  1M1J C;  2Z5H A;  1JY3 P;  5AVR B;  3RK3 D;  2C0X A;  1CI6 B;  5APU A;  4WBA A;  2A45 G;  1HH0 A;  1QL1 A;  3TSI A;  1N7S D;  3TK1 A;  2YKQ A;  1FZG A;  2P67 A;  1FZE A;  3OA7 A;  3UIA A;  3RL0 C;  1N73 C;  2C0W A;  4I2L C;  1URQ D;  3HD7 B;  1RY3 A;  1DH3 A;  1M1J A;  4LGD E;  3WMM 0;  1T2K D;  3NXS A;  3LID A;  2XZR A;  1JMM A;  3N4X A;  1T3J A;  3OAK A;  5CCH C;  1FOS F;  4O9B A;  2Q9I A;  4I1L A;  2Q3I A;  1N73 A;  3V2P A;  3HE5 B;  1X8Y A;  4IFF A;  5KJ7 C;  1GW3 A;  3IR9 A;  3P8C E;  1J1E B;  1OWA A;  4B86 A;  3VYI A;  2I1K A;  4W7Z A;  1NKZ B;  2OAR A;  3EFG A;  1GTW A;  1JTH A;  2JJL A;  2GM4 A;  2YKP A;  4C7R A;  3BVH A;  2N1T B;  3HD7 C;  1NTM K;  5CCH D;  1RE3 C;  1FOS E;  2FYU K;  5CCH A;  3O8Z A;  3A3Y B;  1IFJ A;  5KJ7 A;  2HYN A;  2R5D A;  1VPC A;  1CSB A;  3B8E B;  3VTP C;  3IFM A;  5AVV B;  1NOH A;  1AFO A;  2P1J A;  1IFI A;  4DOJ A;  3OJA B;  3HD7 A;  1RE3 A;  3P7K A;  1JOC A;  1S9K D;  2A45 H;  1J1E C;  5AW1 B;  4C46 A;  3HTK B;  1NU1 K;  1CZQ A;  1ZR2 A;  2C9L Y;  1L4A D;  3CI9 A;  1L4A A;  2FYZ A;  3EQ2 A;  2C9N Y;  1KFN A;  1OXZ A;  2N1T C;  2NPS B;  5APS A;  1JUN A;  5AVS B;  1FZF A;  1EQ7 A;  2FKW B;  3VP8 A;  3U1C A;  3HE5 A;  1G1J A;  5AW8 B;  1XTC C;  2Z5I A;  2XV5 A;  1FJP A;  3KDP B;  3U1A A;  1J1D B;  1IK9 A;  2N1T A;  5APV A;  3T97 A;  1LTT C;  1SFC D;  4GKG A;  2YO2 A;  1SQP K;  1KQL A;  4WY4 D;  1ZR4 A;  1G1I A;  1ZV8 A;  1JO5 A;  3H32 B;  1HBW A;  4I6M C;  1JCD A;  2WWW A;  2O1K A;  1MV8 A;  2NPS C;  5CCG D;  2YO3 A;  2KLV A;  2HFE D;  5AW0 B;  2YKO A;  4AYC A;  2WSF H;  5CJ0 A;  3MUD A;  1LTJ A;  3HTK A;  2Z4E A;  3C9I A;  2OYI B;  1J1D C;  1H89 A;  3V2R A;  5AW6 B;  2NPS A;  3N7N A;  1M7L A;  1FAV A;  1HUC A;  3M91 A;  3MD0 A;  1IO4 A;  2KB7 P;  3BRT B;  5AVU B;  4C7N B;  1JY2 P;  5AW4 B;  2WT7 B;  3BAT A;  4AQR D;  2QM8 A;  1G2C B;  1LTG C;  1H8A A;  4JF7 A;  2CPS A;  3V2Q A;  2XU6 A;  4ZKU A;  3RL0 D;  3M9Q A;  3M0A A;  1S9K E;  3BRV B;  3V5B A;  2Q5U A;  2XDJ A;  1KFM A;  2ZXE B;  2OYI C;  1GL2 B;  3SWF A;  1GU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...