5BVZA

Hk620 tail needle crystallized at ph 9 (crystal form ii)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
180
structure length
180
Chain Sequence
QGAYDAQVKNDEQDVELADHDARIAANTKAINILEVRLTTAEGKIVVLRSDVDYLLDEVIDIQAHLVTVDQRLDGVESDVSDIKSDYVSKTVTESQSLASPLDVKTSYSVDGIQVVGARQTGWTAATGTPLLGSFNANQSYTVGTTYTQSEVAALATGLEQARQRILALETALRLHGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA stabilization protein
publication title Structural Plasticity of the Protein Plug That Traps Newly Packaged Genomes in Podoviridae Virions.
pubmed doi rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
total genus 58
structure length 180
sequence length 180
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5bvzA01
3N4XA 4GIFA 3U1CA 3HRNA 4O9BA 2POHA 5BVZA 4N78D 4N3YB 3BATA 5BU8B 1NKNA 3BASA 1IC2A 3P8CD 2FXMA 5KTBA 3N7NA 4I1LA 2JEEA 3C9IA 5BU5A 1X79B 3U59A 4ZKUA 3VP8A 3OJAB 1WT6A 3VP9A 4ZKPA 3U1AA
chains in the Genus database with same CATH superfamily
3IN6A 4HH2A 1GU5A 1J1EB 3CCSP 1IJDB 1VQ5P 4Y28J 1JY3N 1W5CE 3SSUA 1JO5A 4IL6E 2G3AA 5DJUB 4NPEA 1SQPK 1KTMA 3CC4P 1S5LE 3MTUE 2LR2A 2LXBA 5E79H 1MFTA 1JY2P 3NMDA 2P1JA 3L74D 2A06G 5CCGA 2R5DA 1W2EA 1CI6B 5AW2B 1DD3A 2ZVNB 3SWKA 2KZIA 1EDIA 2WSCH 3RK2D 1M7LA 3H1HG 2M3BA 5BVZA 2OYIC 1L4AB 1SQBD 1Y47A 3BVHA 3CWBD 2WPVB 3JCUE 1AA0A 2Y0EA 1MKMA 4BXLA 1MV8A 1EXJA 1ZMEC 1URQA 4U3FG 2H88C 1JY2O 3AEBC 3ITKA 3VOPA 3FXEA 1VQNP 1BCCG 1JTHA 2AXCA 2NPSA 3TGUD 2WPQA 1HGVA 5M1BA 1N8RQ 1N7SB 1VQKP 2FYZA 4UB8E 2R3SA 4OH8B 1L0LD 4IFDK 1YJWP 3EFGA 2SPZA 5APTA 3RK3E 1BGYD 3Q3DA 1H0TB 5KLIC 4IL6H 3V4QA 2M8RA 1S3JA 4AQRD 1S5LH 4I6MC 3RK2C 3F89A 3WMM0 1G2CA 3G9RA 3H1KJ 2N9BA 3BASA 4XE5B 1MUUA 1ZLLA 3HUSC 5KLVD 1OVVA 1M90Q 3H1LG 3VN0A 1X8YA 4D6TJ 4GIFA 3H1KE 2OARA 4UB6E 1VQ4P 3AE1C 1RQUA 3CXHE 3JCUH 1LTJA 1KZUB 2E74D 2YKQA 2BCCJ 3GF3A 4D6TE 4H44D 1JCDA 4HJGH 3HTKA 3HUSB 1SQXG 1NTMG 1KD1Q 3G3ZA 4HKZH 2O3JA 3H32A 4ASVA 3V2PA 3AE8C 3H25A 5AW0B 3JSVC 3H1ID 2BCCE 1PPJE 2IBZD 1OMIA 1JTHB 2XZRA 1GDTA 2GM4A 2KNCA 4L75A 3PTZA 1DEEG 1FJPA 3I55P 1SS1A 1Q81Q 5KTBA 1NU1D 4UB8H 3HD7D 1GW4A 2Z5IA 5AVSB 1HUCA 2HG5D 3T97B 1SQVD 4M3LA 4PV1D 1VQ8P 3CCEP 1P84D 2R32A 1RE4C 3L72G 1YQ4C 1S9KD 3MD0A 1VQPP 3MUDC 2QIWA 2AXTE 2W83C 2E42A 1FZGA 2O1JA 1FZCA 3D6YA 2Q3EA 3IFMA 2QJKC 1OW7A 3AECC 5AVWB 2PRRA 1NTZJ 1ZP0C 2E5YA 2ZT9D 4R4MA 1SQPG 3PJSK 1FE6A 2E74C 4GKGA 4H44C 1NVOA 2WWWA 3L70D 1CZQA 4UB6H 1ZRTD 1LT9C 1QX8A 3CXHH 1NTZE 4L73A 2I8DA 1LTJB 1M8OB 5KAFE 1XTCC 1NGMB 1IFPA 3E7KA 1NYHA 3HTKB 4YTPC 3TSIA 3A2AA 3H32B 3GW6A 3ZDMA 1BE3J 2CK3H 3V4WA 1NTZK 3HD7C 1NWQA 1VQOP 1LT9B 1LWUC 1FDIA 3RL0D 1K9MQ 3B5NA 3W68A 4PD4D 3CL3D 1BE3E 4PV1C 1U57A 3IAOA 2KOGA 2Q6QA 4ZNCA 2B87A 1GL2A 3WU2E 1EZVI 4KJMA 5APVA 1CSBA 3P7KA 1RE3C 2OTKE 2Y0DA 2A06D 3TYYA 1KMIZ 4BRYA 3IF4A 2FXMA 3B4SA 3A3YB 2M5AB 2L5GB 3H1HD 4OVNF 1KQSO 2AXTH 2ZT9C 2LKMA 4JYCA 1N73A 1QVFO 3Q5PA 2W90A 4C7RA 1KQGB 2E75D 1M1JA 3WUVA 4L74A 2ZYGA 3SWYA 4EDFA 4I7ZC 2OTLP 2JO1A 3A0HE 2RH0A 4U3FD 3CCJP 4WY4D 4DOJA 3AEGC 4JF7A 1E79H 1LGHB 3A5TA 5DJTB 1BCCD 1NH4A 2Y0CA 2ZFCA 4JYBA 5KAFH 2QJPC 1U7MA 1IFNA 2R44A 1U7JA 3E1RA 1CI6A 2NZ2A 3TF5A 3RL0C 3L74J 3FWNA 1VPCA 2KLVA 1BDCA 2ZVOB 1FDOA 1BDDA 5APWA 2P10A 1LNQA 2IYPA 1QEXA 1FOSE 3I5CA 3L74E 3B5NB 1SQBJ 2QJPB 4C46A 3RBZA 1R5LA 3H1KG 3CWBJ 2RKLA 3AE9C 2B87B 4H13B 3WU2H 3CCRP 2KIKA 1SQBE 1AV1A 2JWAA 3CPWO 2PAJA 2OYIA 3CWBE 4WVZA 1WRGA 2KXPB 1KQFB 3CCVP 2GUVA 2E75C 1FZAA 2I1JA 3H1LD 2FYUG 2B9BA 3S4RA 1OWAA 3TGUJ 1JMBA 2BCCG 1PPJG 4GDOA 1H88A 1FC2C 3CC2P 3Q2YA 1N73B 4WY4C 2Q1KA 4W80A 3CX5D 1LTGC 1TU3F 2AEFA 2WVRA 1SQBK 4WWIA 5GTHE 4PJ0E 3TGUE 5APUA 3A0HH 2CPBA 4H0LD 1H0TA 3P8MC 2QJYB 3BCCJ 1SQXD 2QM7A 2H7HA 1NTMD 2W6JH 2E75B 3HE4A 1JB0J 2OGUA 1SFCD 4I2LC 1RF0C 3KZIE 1AQTA 2WPSA 4WY4B 3BCCE 3R2PA 3KDPB 5CCGD 1BSNA 1FOSF 1RF1C 1S1CX 2K37A 1HBWA 1OVUA 5KLVJ 5L8RJ 1EDJA 1OX3A 3FX0A 3RBXA 3OJAB 3L72D 5KAIE 1NAYA 5KLVE 2YMKA 3U1CA 1URQD 1KILD 3HUSA 1HWTC 1QL1A 5B66E 1A02J 1RF1B 2XDJA 1R5SA 1HF9A 1X0TA 1G1IA 2OYIB 2YKPA 1QL2A 2Q9IA 3VMAA 1PP9G 1KYOI 5CJ0A 5KLVK 5CBNA 3VMZA 3M0DC 1LP1B 2QEXP 4H0LC 3H1JG 2G8YA 2Q7CA 3Q1MA 1NTKJ 2N1TD 2YO3A 1NU1J 5GTHH 4PJ0H 1YJ9P 2XKMA 1AVOA 1SFCC 3T97A 3CCMP 1Y8AA 1HVVA 1KORA 1J2JB 2KUBA 3CXHI 1KC8Q 1SQQJ 3S1KA 3C9IA 4CPGA 3HE4B 1L0NG 4JPZB 1NTKE 5CCGC 3RGUA 5AVTB 1NU1E 1JY3P 2HPCA 3KZIH 4Z1MH 4H0LB 1USDA 3R4YA 1SQQE 1M1KQ 1KYOE 1AJYA 1T3UA 1KN7A 5AW9B 3CCLP 2KLUA 1EDKA 2O01N 1OFCX 3P32A 5AVRB 2K9JB 1S9KE 1RE4A 2OTJP 1NTKK 1GW3A 4B86A 1EQ7A 5KLIB 1PGOA 1NU1K 2YIUC 1URQC 3M06A 4N3YB 1KILC 1IFIA 3MUDA 1PL5A 3P8CD 4A7PA 1PIXA 1MFZA 4EI2A 1SQQK 2WPRA 3RK2B 3L70J 1YBKA 1SQVK 5KAIH 1JY3O 3M91A 1EZVG 3L73J 3CCQP 4OWFA 3L71J 3UIAA 1YI2P 4O9BA 4DZOA 1MZ9A 2JJLA 1N86A 4WBAA 1LTBC 5B66H 3VYIA 3AE2C 3PHLA 3L70E 4LC1A 3L73E 3L71E 5AVQB 4IFMA 1LT9A 2ZYDA 3MP7B 1LTIC 2N1TC 1JOCA 4K35A 3B8EB 4GT1A 4L76A 3RK3D 3AE6C 2KSJA 3VP9A 1Z56A 1KFMA 4LGDE 3HRNA 2YXRB 2HLOA 3MIWA 2ZAEB 3AEAC 3HD7A 1QGKB 4TT3H 3B71A 5AW6B 1K05A 1LWUA 1FZEA 1J1DC 2M5AA 4YXWH 2HPCB 4HB1A 2FYNC 1H8AA 1KYOH 3H1HJ 3M9HA 2J5UA 3L35A 5AVVB 1BSHA 1RE3A 1HTLC 3GMAA 3H1KD 2WSSH 2H8PD 2V4HA 1PFIA 3LW5J 2M3EA 3CXHD 3H1HE 1J1DB 2GA1A 1IFDA 3VMXA 2P2UA 4IFFA 2W6BA 2YXQB 2FYNB 1X79B 1GK6A 2QJKB 2P7JA 4ZKPA 3KQGA 2FYUD 3AE7C 2W6AA 2BCCD 1PPJD 1LT1A 1YHQP 2RN0A 1OW8A 1JUNA 3GHGC 2E74B 2B89A 3BCCG 2WQYC 1VQ6P 2XNDH 1DH3A 4H44B 2DW3A 3RK3C 2J59M 1VF5D 3K5BA 1EC5A 5CCHD 1N7LA 2BASA 3L4FA 3AE3C 1JNMA 1AQ5A 1E5WA 2JWDA 2E76D 2WSFJ 3GHGB 2VRSA 1KB9E 1GU4A 5KJ7D 3HD7B 2K88A 4MN4C 1OIPA 2FBWC 2WSEJ 1LWUB 3L75J 2KP8A 1FZCC 3ABVC 2QG4A 1ZW0A 1NAFA 5BU5A 5AVXB 2OQQA 4TLFA 4PV1B 4N78E 2IYOA 1ZR4A 1ZV8A 3L75E 1HJ0A 5K5GB 3HE5A 3M9BA 2FXPA 1RQVA 4C7NA 2BEZF 1M57D 2M0BA 2HR3A 3FGAD 3LIEA 5CJ4A 1VDFA 3N4XA 3AEFC 4EIJA 4IOIH 2C9NY 4YXDC 2FFDC 2ZT9B 3OW2O 3II6A 2H43A 2IZ1A 3CX5E 1LTAC 4WY4A 5GTIE 1VQMP 3LW5H 1PP9D 1NHLA 4OGQD 1NTKG 1S72P 3NTNA 2W27A 1VF5C 3Q5RA 4I7ZB 4Y99C 5CCHC 2Q3IA 3H1JD 1PGPA 3G71P 3GLMA 1SQQG 1IC2A 1FDMA 2H89C 1L4AD 2XU6A 1Q82Q 2FFDB 3A0BE 1RF0A 2OYHC 1PGQA 3SFEC 5C39A 1RHZB 5KJ7C 1L0ND 1PV3A 2KZJA 3A7OA 1SQXK 3NXSA 2N9YB 1NTMK 4N6JA 2IPPA 3RL0B 2JR8A 2GUSA 2Z5HA 4Y99B 1RF1A 2Q5UA 1T2KD 1KB9H 4D6TG 1HGZA 2IZ0A 2E5TA 3TNUB 3L37A 1YTZI 4JBZA 1M1JC 2MKVA 2OYHB 2WSFH 4KT0J 1J1EC 1NOHA 2R5BA 2K1AA 3L73G 2IFNA 1N7SD 1X22A 1LP1A 3L71G 3SFDC 5AW8B 5EFWB 2ZYAA 2WSEH 1AVYA 3HE5B 3OA7A 4EOTA 1L0LJ 1PGJA 4C7NB 1S2EA 1SP4A 1EZVD 1JEKA 2HYNA 2L91A 1YTZT 3VP8A 2WITA 4OGQC 1BGYJ 1IK9A 1GD2E 1L0LE 4W7ZA 3M0DA 2IFMA 3CX5H 5GTIH 2O1KA 1DIPA 1RH5B 1BGYE 1LJ2A 1L4AC 3VMYA 1SFCA 2K9JA 2LXCB 3CC7P 5AVZB 2KS1B 2A45I 4OGQB 3GG2A 1FJKA 1S4XA 1YYCA 1L0LK 5TJHA 3U59A 3A0BH 2KSEA 4RESB 1T2KC 2Y9ZA 2IBZI 4DT0A 4RJTA 2O01J 2MJZA 1DEBA 4KHXA 1GTWA 1KV4A 2HODB 1NTZG 3O6QA 1R8EA 3C8VA 3WUTA 3P8CE 1PZQA 1N7SC 3U1AA 1KILA 4NPDA 2YNYA 2NPSD 2WMMA 3G6EP 3H1IJ 2QRXA 1SQPD 2C9LY 1VQ9P 2ITAA 1IK7A 1P84I 5CMZA 3F5HA 3M0AA 5AVUB 4R4LA 1NJIQ 3H1IE 2IBZE 3FWLA 1BE3G 2FKWB 2OYOA 3D70A 1YJNP 2CPSA 3AE4C 3CMEP 2RMZA 1SQVJ 1LTSC 3I56P 1L2PA 2FXOA 2N1TA 3BCCD 3D6ZA 5CBOA 3WUUA 1ZOYC 1QLED 1SQVE 1Q2NA 1P84E 3MHVA 1SFCB 1XTGB 2WZ7A 4GOEA 5APXA 2Y9YA 3QWOC 1LTTC 3KHUA 1NO4A 2POHA 1GK4A 3L75G 2C0XA 5AW7B 2NRGA 3CMAP 1X9VA 1CW5A 3V2NA 5AW4B 3V2QA 1JM0A 3TK1A 3PRJA 2FY8A 1OVRA 2NPSC 2AEMA 3O6QB 2JDIH 4PD4I 3FXDA 1FU1A 2FYUJ 2JP3A 1VL2A 1A02F 5AW5B 4W7YA 1EXIA 1D7MA 1ZRTE 1WT6A 2O01H 2YIUB 3SWFA 1URQB 1KILB 3BRVB 1VQLP 4YPCA 2A45H 2FYUE 3NFQA 3EQ2A 4XA4A 2K9YA 1T6AA 5APYA 3TDKA 2QVAA 2NPSB 1IFMA 2KI7B 3L74G 3USSA 3O8ZA 3GHGA 3PLNA 1K73Q 3C1LA 1NTKD 2PP6A 3N7NA 4ZMDA 4PD4E 2FYUK 2N1TB 3D71A 1SQBG 3PP5A 3MZWB 1SQQD 5B5EE 1KYOD 2I1KA 3CWBG 2KYVA 5AW1B 1P84H 2A06E 2P67A 2ZJSE 1FZBA 2KK7A 1OZHA 1RY3A 4GOFA 1W2BO 3M9QA 3KYQA 1FS0E 1LTJC 1DD4A 2PGDA 3CI9A 1KQLA 3V2RA 1JMMA 1G2CB 4ASWA 4DJGA 1QVGO 2PFXA 4U3FJ 1H89A 5BU8B 3AE5C 4IL6X 5H2FE 3TGUG 4D6TD 1S5LX 1KB9I 1BCCJ 3G4SP 1NKZB 1T3JA 2IDBA 4U3FE 1L0LG 1PP9J 2D2CD 3L73D 3L71D 1OXZA 1WMKA 1BGYG 1BCCE 1FAVA 3H1JJ 1EDLA 2FFDA 2R3CA 1PP9E 1DX7A 3Q5SA 3B5ND 2V7QJ 2JEEA 1GMJA 1ZN5A 2XV5A 2AEJA 3H1JE 4H13D 3W67A 1GL2D 1L0NJ 1KFNA 3EWKA 1IFJA 2WT7A 4AYCA 5CCHA 2KNCB 2HFED 1ZR2A 5KLVG 1FBMA 3VTPC 4XFJA 3CX5I 3RK3B 1Q7YQ 1OW6A 3TNUA 4PD4H 1SVFA 2YMYA 3V6IA 2OYHA 3RL0g 1L0NE 4BWNA 4NPFX 4ZKUA 2KB7P 5B5EH 4DCKA 2B88A 5KJ7A 2YKOA 4EYYQ 3H1LJ 5CHXA 2ZXEB 3MGNA 1K04A 1K8AQ 4K3AA 3QH9A 1IO4A 1VQ7P 1Q86Q 2A45G 1GZLA 2IX7C 1SLQA 3H1LE 2J58A 1NTZD 1L0NK 1FZCB 1UIIA 5TISE 1YQ3C 3H1IG 2IBZG 5H2FH 1SQXJ 1G1JA 1NTMJ 1T8ZA 3BATA 2D2CC 3KPEA 4GODA 3V5BA 2WTYA 2K3RA 2JKVA 1EZVE 1JY2N 3AEDC 1NU1G 2ZXXA 1SQXE 4RKUJ 3BRTB 1NTME 1Q90D 2XNXA 3E1IA 4JQ0D 2E43A 3B5NC 1M56D 2KS1A 5E79E 2WSCJ 3GF7A 1SQVG 4U7JA 5AW3B 2UWJE 1ZXGA 1Y9BA 3JC22 1BE3D 4H13C 3KXDA 1YITP 2E76C 1JCCA 2D2CB 1GL2C 5APSA 3IR9A 3OAKA 2YO2A 4RO0A 2P58A 3LIDA 1NKNA 1HJBA 3L72J 4AUWA 1L4AA 1IZNB 1KB9D 1VF5B 2HODA 4QMAA 2QSIA 5KKZC 3L36A 2WT7B 4LLHA 3CD6P 4HYTB 1HH0A 2V7QH 1N73C 3EFFK 4WB4A 3L72E 4N78D 2Z4EA 2E76B 1GL2B 4I1LA 2C0WA 1AFOA 1FZFA 3L70G 1KILE 3CCUP 2QA4P 3L75D 1UIXA 1SQPJ 5AVYB 2QM8A 2QJYC 2QE7H 5APQA 5KKZB 4BRYB 3AEEC 3CLQA 3S9OA 1YIJP 1N7SA 3H6PA 1SQPE 2BEQD 1N2DC 1USEA 2W8ZA 3PH0A 5TISH 1M1JB
chains in the Genus database with same CATH topology
4C7RA 4HH2A 1H8AA 1M1JA 1GU5A 1J1EB 1IJDB 3M9HA 1JY3N 3L35A 3SWYA 5AVVB 1RE3A 1JO5A 4WY4D 1HTLC 4DOJA 1SFCB 1XTGB 2H8PD 2WZ7A 1PFIA 4JF7A 5APXA 1LGHB 1SQPK 3A5TA 1LTTC 3MTUE 1J1DB 1NO4A 2POHA 1NH4A 1GK4A 2ZFCA 1IFDA 3VMXA 1JY2P 2C0XA 2P1JA 3NMDA 4JYBA 5AW7B 5CCGA 2P2UA 4IFFA 2R5DA 2W6BA 1IFNA 1W2EA 1CI6B 1X79B 5AW2B 1X9VA 1CW5A 3V2NA 5AW4B 1CI6A 3V2QA 1GK6A 2P7JA 3TK1A 4ZKPA 3KQGA 3RL0C 2WSCH 3RK2D 1M7LA 2W6AA 1VPCA 2KLVA 2M3BA 5BVZA 2NPSC 2OYIC 1JUNA 1L4AB 3GHGC 5APWA 1FU1A 3BVHA 1A02F 1DH3A 5AW5B 4W7YA 3RK3C 1WT6A 2O01H 1FOSE 2J59M 3SWFA 3I5CA 1URQB 3B5NB 1KILB 3BRVB 1MV8A 4C46A 1URQA 5CCHD 1N7LA 2BASA 3L4FA 1JY2O 2A45H 3NFQA 3EQ2A 1JNMA 1AQ5A 4XA4A 3VOPA 1E5WA 5APYA 2NPSB 1IFMA 1JTHA 3GHGB 2VRSA 2PAJA 1GU4A 2OYIA 2NPSA 3O8ZA 3GHGA 5KJ7D 1WRGA 2WPQA 1HGVA 2GUVA 1FZAA 3HD7B 2I1JA 2PP6A 1LWUB 2KP8A 1FZCC 3N7NA 1N7SB 2FYZA 1OWAA 1NAFA 5BU5A 5AVXB 1H88A 4OH8B 2FYUK 2N1TB 1N73B 4IFDK 4N78E 4WY4C 3PP5A 3EFGA 4W80A 1ZR4A 2I1KA 1ZV8A 5APTA 1LTGC 1SQBK 2KYVA 3HE5A 3M9BA 5AW1B 5APUA 4C7NA 2P67A 1FZBA 2CPBA 3P8MC 2QM7A 2H7HA 1RY3A 3V4QA 2M8RA 3M9QA 3HE4A 3KYQA 4AQRD 3LIEA 1LTJC 5CJ4A 1VDFA 3N4XA 3CI9A 4I6MC 1KQLA 1SFCD 3V2RA 1JMMA 1G2CB 4EIJA 3RK2C 4I2LC 1RF0C 2C9NY 3WMM0 1H89A 2FFDC 1G2CA 2WPSA 4WY4B 5BU8B 2N9BA 3BASA 3II6A 2H43A 4XE5B 1LTAC 4WY4A 1MUUA 1ZLLA 3HUSC 3R2PA 3LW5H 3KDPB 5CCGD 1NHLA 3VN0A 3NTNA 1NKZB 2W27A 1X8YA 1FOSF 1T3JA 1RF1C 1HBWA 4GIFA 4Y99C 5CCHC 2Q3IA 2OARA 1IC2A 1OXZA 1FDMA 1L4AD 1FAVA 2XU6A 1LTJA 1KZUB 3OJAB 2YKQA 2FFDB 1RF0A 2OYHC 2FFDA 1JCDA 2R3CA 3HTKA 1DX7A 3HUSB 3U1CA 3G3ZA 1URQD 1KILD 3B5ND 5KJ7C 3H32A 3HUSA 3V2PA 3A7OA 1HWTC 1SQXK 1QL1A 3NXSA 1NTMK 4N6JA 5AW0B 1RF1B 1A02J 2JEEA 1ZN5A 2IPPA 2XDJA 2XV5A 3RL0B 2GUSA 2Z5HA 4Y99B 1RF1A 2Q5UA 1T2KD 1G1IA 1JTHB 1GL2D 1KFNA 1IFJA 2WT7A 2OYIB 4AYCA 5CCHA 2XZRA 2YKPA 2HFED 1QL2A 1ZR2A 2Q9IA 1GDTA 1HGZA 2GM4A 1FBMA 5CJ0A 3VTPC 1FJPA 3TNUB 3L37A 3RK3B 1YTZI 5KLVK 1M1JC 3TNUA 2OYHB 3VMZA 5KTBA 2WSFH 1SVFA 2YMYA 3M0DC 3HD7D 2OYHA 1GW4A 1J1EC 1NOHA 2R5BA 4ZKUA 2KB7P 2IFNA 1N7SD 2Z5IA 2Q7CA 5AVSB 5KJ7A 2YKOA 1HUCA 5AW8B 5CHXA 2HG5D 2N1TD 2ZXEB 2YO3A 3MGNA 4M3LA 2WSEH 2XKMA 1SFCC 3T97A 2R32A 1HVVA 1RE4C 3HE5B 1J2JB 3OA7A 4EOTA 1IO4A 4C7NB 1SP4A 1S9KD 3MD0A 2A45G 3C9IA 2HYNA 3HE4B 1YTZT 3VP8A 1GZLA 2WITA 5CCGC 2IX7C 1SLQA 5AVTB 2E42A 2J58A 1JY3P 2HPCA 1L0NK 1IK9A 1GD2E 1FZCB 1FZGA 2O1JA 1FZCA 4W7ZA 3M0DA 3IFMA 2IFMA 1G1JA 1T8ZA 3BATA 3KPEA 2O1KA 5AVWB 1T3UA 3V5BA 2WTYA 5AW9B 5AVRB 3P32A 1L4AC 3VMYA 1JY2N 1S9KE 1SFCA 4GKGA 1RE4A 1NTKK 1GW3A 4B86A 2WWWA 3BRTB 5AVZB 1EQ7A 1CZQA 1NU1K 2XNXA 3E1IA 2E43A 1LT9C 2A45I 1URQC 1KILC 3B5NC 3M06A 4N3YB 1IFIA 3MUDA 3P8CD 1FJKA 1YYCA 1L0LK 1MFZA 1LTJB 5AW3B 1SQQK 3U59A 1XTCC 2WPRA 3RK2B 1SQVK 1JY3O 4RESB 3M91A 1T2KC 1JCCA 1GL2C 3HTKB 5APSA 3UIAA 3IR9A 3TSIA 3OAKA 3A2AA 2MJZA 3H32B 2YO2A 4O9BA 1DEBA 4DZOA 4KHXA 1MZ9A 2JJLA 1GTWA 1N86A 4WBAA 3LIDA 1LTBC 1NKNA 3VYIA 2HODB 1HJBA 4AUWA 1L4AA 2HODA 3V4WA 4LC1A 1NTZK 3HD7C 3L36A 1NWQA 2WT7B 4LLHA 1LT9B 3P8CE 1LWUC 5AVQB 3RL0D 1N7SC 4IFMA 1LT9A 3U1AA 3B5NA 1KILA 4HYTB 1HH0A 1LTIC 2YNYA 3CL3D 2N1TC 1N73C 2NPSD 1JOCA 4WB4A 4N78D 2Z4EA 2C9LY 2KOGA 1GL2B 4I1LA 2C0WA 5CMZA 3B8EB 4GT1A 1GL2A 3RK3D 1AFOA 1FZFA 3M0AA 5APVA 1CSBA 2KSJA 5AVUB 3VP9A 3P7KA 1RE3C 1Z56A 5AVYB 1KFMA 2QM8A 4LGDE 3HRNA 5APQA 2FKWB 2HLOA 3TYYA 3MIWA 3HD7A 2FXMA 3A3YB 5AW6B 2CPSA 1LWUA 3CLQA 1FZEA 1J1DC 1N7SA 2L5GB 3H6PA 1LTSC 2LKMA 4JYCA 1N2DC 2HPCB 2N1TA 1N73A 1M1JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4X A;  4GIF A;  3U1C A;  3HRN A;  4O9B A;  2POH A;  5BVZ A;  4N78 D;  4N3Y B;  3BAT A;  5BU8 B;  1NKN A;  3BAS A;  1IC2 A;  3P8C D;  2FXM A;  5KTB A;  3N7N A;  4I1L A;  2JEE A;  3C9I A;  5BU5 A;  1X79 B;  3U59 A;  4ZKU A;  3VP8 A;  3OJA B;  1WT6 A;  3VP9 A;  4ZKP A;  3U1A A; 
#chains in the Genus database with same CATH topology
 3IN6 A;  4HH2 A;  1GU5 A;  1J1E B;  3CCS P;  1IJD B;  1VQ5 P;  4Y28 J;  1JY3 N;  1W5C E;  3SSU A;  1JO5 A;  4IL6 E;  2G3A A;  5DJU B;  4NPE A;  1SQP K;  1KTM A;  3CC4 P;  1S5L E;  3MTU E;  2LR2 A;  2LXB A;  5E79 H;  1MFT A;  1JY2 P;  3NMD A;  2P1J A;  3L74 D;  2A06 G;  5CCG A;  2R5D A;  1W2E A;  1CI6 B;  5AW2 B;  1DD3 A;  2ZVN B;  3SWK A;  2KZI A;  1EDI A;  2WSC H;  3RK2 D;  1M7L A;  3H1H G;  2M3B A;  5BVZ A;  2OYI C;  1L4A B;  1SQB D;  1Y47 A;  3BVH A;  3CWB D;  2WPV B;  3JCU E;  1AA0 A;  2Y0E A;  1MKM A;  4BXL A;  1MV8 A;  1EXJ A;  1ZME C;  1URQ A;  4U3F G;  2H88 C;  1JY2 O;  3AEB C;  3ITK A;  3VOP A;  3FXE A;  1VQN P;  1BCC G;  1JTH A;  2AXC A;  2NPS A;  3TGU D;  2WPQ A;  1HGV A;  5M1B A;  1N8R Q;  1N7S B;  1VQK P;  2FYZ A;  4UB8 E;  2R3S A;  4OH8 B;  1L0L D;  4IFD K;  1YJW P;  3EFG A;  2SPZ A;  5APT A;  3RK3 E;  1BGY D;  3Q3D A;  1H0T B;  5KLI C;  4IL6 H;  3V4Q A;  2M8R A;  1S3J A;  4AQR D;  1S5L H;  4I6M C;  3RK2 C;  3F89 A;  3WMM 0;  1G2C A;  3G9R A;  3H1K J;  2N9B A;  3BAS A;  4XE5 B;  1MUU A;  1ZLL A;  3HUS C;  5KLV D;  1OVV A;  1M90 Q;  3H1L G;  3VN0 A;  1X8Y A;  4D6T J;  4GIF A;  3H1K E;  2OAR A;  4UB6 E;  1VQ4 P;  3AE1 C;  1RQU A;  3CXH E;  3JCU H;  1LTJ A;  1KZU B;  2E74 D;  2YKQ A;  2BCC J;  3GF3 A;  4D6T E;  4H44 D;  1JCD A;  4HJG H;  3HTK A;  3HUS B;  1SQX G;  1NTM G;  1KD1 Q;  3G3Z A;  4HKZ H;  2O3J A;  3H32 A;  4ASV A;  3V2P A;  3AE8 C;  3H25 A;  5AW0 B;  3JSV C;  3H1I D;  2BCC E;  1PPJ E;  2IBZ D;  1OMI A;  1JTH B;  2XZR A;  1GDT A;  2GM4 A;  2KNC A;  4L75 A;  3PTZ A;  1DEE G;  1FJP A;  3I55 P;  1SS1 A;  1Q81 Q;  5KTB A;  1NU1 D;  4UB8 H;  3HD7 D;  1GW4 A;  2Z5I A;  5AVS B;  1HUC A;  2HG5 D;  3T97 B;  1SQV D;  4M3L A;  4PV1 D;  1VQ8 P;  3CCE P;  1P84 D;  2R32 A;  1RE4 C;  3L72 G;  1YQ4 C;  1S9K D;  3MD0 A;  1VQP P;  3MUD C;  2QIW A;  2AXT E;  2W83 C;  2E42 A;  1FZG A;  2O1J A;  1FZC A;  3D6Y A;  2Q3E A;  3IFM A;  2QJK C;  1OW7 A;  3AEC C;  5AVW B;  2PRR A;  1NTZ J;  1ZP0 C;  2E5Y A;  2ZT9 D;  4R4M A;  1SQP G;  3PJS K;  1FE6 A;  2E74 C;  4GKG A;  4H44 C;  1NVO A;  2WWW A;  3L70 D;  1CZQ A;  4UB6 H;  1ZRT D;  1LT9 C;  1QX8 A;  3CXH H;  1NTZ E;  4L73 A;  2I8D A;  1LTJ B;  1M8O B;  5KAF E;  1XTC C;  1NGM B;  1IFP A;  3E7K A;  1NYH A;  3HTK B;  4YTP C;  3TSI A;  3A2A A;  3H32 B;  3GW6 A;  3ZDM A;  1BE3 J;  2CK3 H;  3V4W A;  1NTZ K;  3HD7 C;  1NWQ A;  1VQO P;  1LT9 B;  1LWU C;  1FDI A;  3RL0 D;  1K9M Q;  3B5N A;  3W68 A;  4PD4 D;  3CL3 D;  1BE3 E;  4PV1 C;  1U57 A;  3IAO A;  2KOG A;  2Q6Q A;  4ZNC A;  2B87 A;  1GL2 A;  3WU2 E;  1EZV I;  4KJM A;  5APV A;  1CSB A;  3P7K A;  1RE3 C;  2OTK E;  2Y0D A;  2A06 D;  3TYY A;  1KMI Z;  4BRY A;  3IF4 A;  2FXM A;  3B4S A;  3A3Y B;  2M5A B;  2L5G B;  3H1H D;  4OVN F;  1KQS O;  2AXT H;  2ZT9 C;  2LKM A;  4JYC A;  1N73 A;  1QVF O;  3Q5P A;  2W90 A;  4C7R A;  1KQG B;  2E75 D;  1M1J A;  3WUV A;  4L74 A;  2ZYG A;  3SWY A;  4EDF A;  4I7Z C;  2OTL P;  2JO1 A;  3A0H E;  2RH0 A;  4U3F D;  3CCJ P;  4WY4 D;  4DOJ A;  3AEG C;  4JF7 A;  1E79 H;  1LGH B;  3A5T A;  5DJT B;  1BCC D;  1NH4 A;  2Y0C A;  2ZFC A;  4JYB A;  5KAF H;  2QJP C;  1U7M A;  1IFN A;  2R44 A;  1U7J A;  3E1R A;  1CI6 A;  2NZ2 A;  3TF5 A;  3RL0 C;  3L74 J;  3FWN A;  1VPC A;  2KLV A;  1BDC A;  2ZVO B;  1FDO A;  1BDD A;  5APW A;  2P10 A;  1LNQ A;  2IYP A;  1QEX A;  1FOS E;  3I5C A;  3L74 E;  3B5N B;  1SQB J;  2QJP B;  4C46 A;  3RBZ A;  1R5L A;  3H1K G;  3CWB J;  2RKL A;  3AE9 C;  2B87 B;  4H13 B;  3WU2 H;  3CCR P;  2KIK A;  1SQB E;  1AV1 A;  2JWA A;  3CPW O;  2PAJ A;  2OYI A;  3CWB E;  4WVZ A;  1WRG A;  2KXP B;  1KQF B;  3CCV P;  2GUV A;  2E75 C;  1FZA A;  2I1J A;  3H1L D;  2FYU G;  2B9B A;  3S4R A;  1OWA A;  3TGU J;  1JMB A;  2BCC G;  1PPJ G;  4GDO A;  1H88 A;  1FC2 C;  3CC2 P;  3Q2Y A;  1N73 B;  4WY4 C;  2Q1K A;  4W80 A;  3CX5 D;  1LTG C;  1TU3 F;  2AEF A;  2WVR A;  1SQB K;  4WWI A;  5GTH E;  4PJ0 E;  3TGU E;  5APU A;  3A0H H;  2CPB A;  4H0L D;  1H0T A;  3P8M C;  2QJY B;  3BCC J;  1SQX D;  2QM7 A;  2H7H A;  1NTM D;  2W6J H;  2E75 B;  3HE4 A;  1JB0 J;  2OGU A;  1SFC D;  4I2L C;  1RF0 C;  3KZI E;  1AQT A;  2WPS A;  4WY4 B;  3BCC E;  3R2P A;  3KDP B;  5CCG D;  1BSN A;  1FOS F;  1RF1 C;  1S1C X;  2K37 A;  1HBW A;  1OVU A;  5KLV J;  5L8R J;  1EDJ A;  1OX3 A;  3FX0 A;  3RBX A;  3OJA B;  3L72 D;  5KAI E;  1NAY A;  5KLV E;  2YMK A;  3U1C A;  1URQ D;  1KIL D;  3HUS A;  1HWT C;  1QL1 A;  5B66 E;  1A02 J;  1RF1 B;  2XDJ A;  1R5S A;  1HF9 A;  1X0T A;  1G1I A;  2OYI B;  2YKP A;  1QL2 A;  2Q9I A;  3VMA A;  1PP9 G;  1KYO I;  5CJ0 A;  5KLV K;  5CBN A;  3VMZ A;  3M0D C;  1LP1 B;  2QEX P;  4H0L C;  3H1J G;  2G8Y A;  2Q7C A;  3Q1M A;  1NTK J;  2N1T D;  2YO3 A;  1NU1 J;  5GTH H;  4PJ0 H;  1YJ9 P;  2XKM A;  1AVO A;  1SFC C;  3T97 A;  3CCM P;  1Y8A A;  1HVV A;  1KOR A;  1J2J B;  2KUB A;  3CXH I;  1KC8 Q;  1SQQ J;  3S1K A;  3C9I A;  4CPG A;  3HE4 B;  1L0N G;  4JPZ B;  1NTK E;  5CCG C;  3RGU A;  5AVT B;  1NU1 E;  1JY3 P;  2HPC A;  3KZI H;  4Z1M H;  4H0L B;  1USD A;  3R4Y A;  1SQQ E;  1M1K Q;  1KYO E;  1AJY A;  1T3U A;  1KN7 A;  5AW9 B;  3CCL P;  2KLU A;  1EDK A;  2O01 N;  1OFC X;  3P32 A;  5AVR B;  2K9J B;  1S9K E;  1RE4 A;  2OTJ P;  1NTK K;  1GW3 A;  4B86 A;  1EQ7 A;  5KLI B;  1PGO A;  1NU1 K;  2YIU C;  1URQ C;  3M06 A;  4N3Y B;  1KIL C;  1IFI A;  3MUD A;  1PL5 A;  3P8C D;  4A7P A;  1PIX A;  1MFZ A;  4EI2 A;  1SQQ K;  2WPR A;  3RK2 B;  3L70 J;  1YBK A;  1SQV K;  5KAI H;  1JY3 O;  3M91 A;  1EZV G;  3L73 J;  3CCQ P;  4OWF A;  3L71 J;  3UIA A;  1YI2 P;  4O9B A;  4DZO A;  1MZ9 A;  2JJL A;  1N86 A;  4WBA A;  1LTB C;  5B66 H;  3VYI A;  3AE2 C;  3PHL A;  3L70 E;  4LC1 A;  3L73 E;  3L71 E;  5AVQ B;  4IFM A;  1LT9 A;  2ZYD A;  3MP7 B;  1LTI C;  2N1T C;  1JOC A;  4K35 A;  3B8E B;  4GT1 A;  4L76 A;  3RK3 D;  3AE6 C;  2KSJ A;  3VP9 A;  1Z56 A;  1KFM A;  4LGD E;  3HRN A;  2YXR B;  2HLO A;  3MIW A;  2ZAE B;  3AEA C;  3HD7 A;  1QGK B;  4TT3 H;  3B71 A;  5AW6 B;  1K05 A;  1LWU A;  1FZE A;  1J1D C;  2M5A A;  4YXW H;  2HPC B;  4HB1 A;  2FYN C;  1H8A A;  1KYO H;  3H1H J;  3M9H A;  2J5U A;  3L35 A;  5AVV B;  1BSH A;  1RE3 A;  1HTL C;  3GMA A;  3H1K D;  2WSS H;  2H8P D;  2V4H A;  1PFI A;  3LW5 J;  2M3E A;  3CXH D;  3H1H E;  1J1D B;  2GA1 A;  1IFD A;  3VMX A;  2P2U A;  4IFF A;  2W6B A;  2YXQ B;  2FYN B;  1X79 B;  1GK6 A;  2QJK B;  2P7J A;  4ZKP A;  3KQG A;  2FYU D;  3AE7 C;  2W6A A;  2BCC D;  1PPJ D;  1LT1 A;  1YHQ P;  2RN0 A;  1OW8 A;  1JUN A;  3GHG C;  2E74 B;  2B89 A;  3BCC G;  2WQY C;  1VQ6 P;  2XND H;  1DH3 A;  4H44 B;  2DW3 A;  3RK3 C;  2J59 M;  1VF5 D;  3K5B A;  1EC5 A;  5CCH D;  1N7L A;  2BAS A;  3L4F A;  3AE3 C;  1JNM A;  1AQ5 A;  1E5W A;  2JWD A;  2E76 D;  2WSF J;  3GHG B;  2VRS A;  1KB9 E;  1GU4 A;  5KJ7 D;  3HD7 B;  2K88 A;  4MN4 C;  1OIP A;  2FBW C;  2WSE J;  1LWU B;  3L75 J;  2KP8 A;  1FZC C;  3ABV C;  2QG4 A;  1ZW0 A;  1NAF A;  5BU5 A;  5AVX B;  2OQQ A;  4TLF A;  4PV1 B;  4N78 E;  2IYO A;  1ZR4 A;  1ZV8 A;  3L75 E;  1HJ0 A;  5K5G B;  3HE5 A;  3M9B A;  2FXP A;  1RQV A;  4C7N A;  2BEZ F;  1M57 D;  2M0B A;  2HR3 A;  3FGA D;  3LIE A;  5CJ4 A;  1VDF A;  3N4X A;  3AEF C;  4EIJ A;  4IOI H;  2C9N Y;  4YXD C;  2FFD C;  2ZT9 B;  3OW2 O;  3II6 A;  2H43 A;  2IZ1 A;  3CX5 E;  1LTA C;  4WY4 A;  5GTI E;  1VQM P;  3LW5 H;  1PP9 D;  1NHL A;  4OGQ D;  1NTK G;  1S72 P;  3NTN A;  2W27 A;  1VF5 C;  3Q5R A;  4I7Z B;  4Y99 C;  5CCH C;  2Q3I A;  3H1J D;  1PGP A;  3G71 P;  3GLM A;  1SQQ G;  1IC2 A;  1FDM A;  2H89 C;  1L4A D;  2XU6 A;  1Q82 Q;  2FFD B;  3A0B E;  1RF0 A;  2OYH C;  1PGQ A;  3SFE C;  5C39 A;  1RHZ B;  5KJ7 C;  1L0N D;  1PV3 A;  2KZJ A;  3A7O A;  1SQX K;  3NXS A;  2N9Y B;  1NTM K;  4N6J A;  2IPP A;  3RL0 B;  2JR8 A;  2GUS A;  2Z5H A;  4Y99 B;  1RF1 A;  2Q5U A;  1T2K D;  1KB9 H;  4D6T G;  1HGZ A;  2IZ0 A;  2E5T A;  3TNU B;  3L37 A;  1YTZ I;  4JBZ A;  1M1J C;  2MKV A;  2OYH B;  2WSF H;  4KT0 J;  1J1E C;  1NOH A;  2R5B A;  2K1A A;  3L73 G;  2IFN A;  1N7S D;  1X22 A;  1LP1 A;  3L71 G;  3SFD C;  5AW8 B;  5EFW B;  2ZYA A;  2WSE H;  1AVY A;  3HE5 B;  3OA7 A;  4EOT A;  1L0L J;  1PGJ A;  4C7N B;  1S2E A;  1SP4 A;  1EZV D;  1JEK A;  2HYN A;  2L91 A;  1YTZ T;  3VP8 A;  2WIT A;  4OGQ C;  1BGY J;  1IK9 A;  1GD2 E;  1L0L E;  4W7Z A;  3M0D A;  2IFM A;  3CX5 H;  5GTI H;  2O1K A;  1DIP A;  1RH5 B;  1BGY E;  1LJ2 A;  1L4A C;  3VMY A;  1SFC A;  2K9J A;  2LXC B;  3CC7 P;  5AVZ B;  2KS1 B;  2A45 I;  4OGQ B;  3GG2 A;  1FJK A;  1S4X A;  1YYC A;  1L0L K;  5TJH A;  3U59 A;  3A0B H;  2KSE A;  4RES B;  1T2K C;  2Y9Z A;  2IBZ I;  4DT0 A;  4RJT A;  2O01 J;  2MJZ A;  1DEB A;  4KHX A;  1GTW A;  1KV4 A;  2HOD B;  1NTZ G;  3O6Q A;  1R8E A;  3C8V A;  3WUT A;  3P8C E;  1PZQ A;  1N7S C;  3U1A A;  1KIL A;  4NPD A;  2YNY A;  2NPS D;  2WMM A;  3G6E P;  3H1I J;  2QRX A;  1SQP D;  2C9L Y;  1VQ9 P;  2ITA A;  1IK7 A;  1P84 I;  5CMZ A;  3F5H A;  3M0A A;  5AVU B;  4R4L A;  1NJI Q;  3H1I E;  2IBZ E;  3FWL A;  1BE3 G;  2FKW B;  2OYO A;  3D70 A;  1YJN P;  2CPS A;  3AE4 C;  3CME P;  2RMZ A;  1SQV J;  1LTS C;  3I56 P;  1L2P A;  2FXO A;  2N1T A;  3BCC D;  3D6Z A;  5CBO A;  3WUU A;  1ZOY C;  1QLE D;  1SQV E;  1Q2N A;  1P84 E;  3MHV A;  1SFC B;  1XTG B;  2WZ7 A;  4GOE A;  5APX A;  2Y9Y A;  3QWO C;  1LTT C;  3KHU A;  1NO4 A;  2POH A;  1GK4 A;  3L75 G;  2C0X A;  5AW7 B;  2NRG A;  3CMA P;  1X9V A;  1CW5 A;  3V2N A;  5AW4 B;  3V2Q A;  1JM0 A;  3TK1 A;  3PRJ A;  2FY8 A;  1OVR A;  2NPS C;  2AEM A;  3O6Q B;  2JDI H;  4PD4 I;  3FXD A;  1FU1 A;  2FYU J;  2JP3 A;  1VL2 A;  1A02 F;  5AW5 B;  4W7Y A;  1EXI A;  1D7M A;  1ZRT E;  1WT6 A;  2O01 H;  2YIU B;  3SWF A;  1URQ B;  1KIL B;  3BRV B;  1VQL P;  4YPC A;  2A45 H;  2FYU E;  3NFQ A;  3EQ2 A;  4XA4 A;  2K9Y A;  1T6A A;  5APY A;  3TDK A;  2QVA A;  2NPS B;  1IFM A;  2KI7 B;  3L74 G;  3USS A;  3O8Z A;  3GHG A;  3PLN A;  1K73 Q;  3C1L A;  1NTK D;  2PP6 A;  3N7N A;  4ZMD A;  4PD4 E;  2FYU K;  2N1T B;  3D71 A;  1SQB G;  3PP5 A;  3MZW B;  1SQQ D;  5B5E E;  1KYO D;  2I1K A;  3CWB G;  2KYV A;  5AW1 B;  1P84 H;  2A06 E;  2P67 A;  2ZJS E;  1FZB A;  2KK7 A;  1OZH A;  1RY3 A;  4GOF A;  1W2B O;  3M9Q A;  3KYQ A;  1FS0 E;  1LTJ C;  1DD4 A;  2PGD A;  3CI9 A;  1KQL A;  3V2R A;  1JMM A;  1G2C B;  4ASW A;  4DJG A;  1QVG O;  2PFX A;  4U3F J;  1H89 A;  5BU8 B;  3AE5 C;  4IL6 X;  5H2F E;  3TGU G;  4D6T D;  1S5L X;  1KB9 I;  1BCC J;  3G4S P;  1NKZ B;  1T3J A;  2IDB A;  4U3F E;  1L0L G;  1PP9 J;  2D2C D;  3L73 D;  3L71 D;  1OXZ A;  1WMK A;  1BGY G;  1BCC E;  1FAV A;  3H1J J;  1EDL A;  2FFD A;  2R3C A;  1PP9 E;  1DX7 A;  3Q5S A;  3B5N D;  2V7Q J;  2JEE A;  1GMJ A;  1ZN5 A;  2XV5 A;  2AEJ A;  3H1J E;  4H13 D;  3W67 A;  1GL2 D;  1L0N J;  1KFN A;  3EWK A;  1IFJ A;  2WT7 A;  4AYC A;  5CCH A;  2KNC B;  2HFE D;  1ZR2 A;  5KLV G;  1FBM A;  3VTP C;  4XFJ A;  3CX5 I;  3RK3 B;  1Q7Y Q;  1OW6 A;  3TNU A;  4PD4 H;  1SVF A;  2YMY A;  3V6I A;  2OYH A;  3RL0 g;  1L0N E;  4BWN A;  4NPF X;  4ZKU A;  2KB7 P;  5B5E H;  4DCK A;  2B88 A;  5KJ7 A;  2YKO A;  4EYY Q;  3H1L J;  5CHX A;  2ZXE B;  3MGN A;  1K04 A;  1K8A Q;  4K3A A;  3QH9 A;  1IO4 A;  1VQ7 P;  1Q86 Q;  2A45 G;  1GZL A;  2IX7 C;  1SLQ A;  3H1L E;  2J58 A;  1NTZ D;  1L0N K;  1FZC B;  1UII A;  5TIS E;  1YQ3 C;  3H1I G;  2IBZ G;  5H2F H;  1SQX J;  1G1J A;  1NTM J;  1T8Z A;  3BAT A;  2D2C C;  3KPE A;  4GOD A;  3V5B A;  2WTY A;  2K3R A;  2JKV A;  1EZV E;  1JY2 N;  3AED C;  1NU1 G;  2ZXX A;  1SQX E;  4RKU J;  3BRT B;  1NTM E;  1Q90 D;  2XNX A;  3E1I A;  4JQ0 D;  2E43 A;  3B5N C;  1M56 D;  2KS1 A;  5E79 E;  2WSC J;  3GF7 A;  1SQV G;  4U7J A;  5AW3 B;  2UWJ E;  1ZXG A;  1Y9B A;  3JC2 2;  1BE3 D;  4H13 C;  3KXD A;  1YIT P;  2E76 C;  1JCC A;  2D2C B;  1GL2 C;  5APS A;  3IR9 A;  3OAK A;  2YO2 A;  4RO0 A;  2P58 A;  3LID A;  1NKN A;  1HJB A;  3L72 J;  4AUW A;  1L4A A;  1IZN B;  1KB9 D;  1VF5 B;  2HOD A;  4QMA A;  2QSI A;  5KKZ C;  3L36 A;  2WT7 B;  4LLH A;  3CD6 P;  4HYT B;  1HH0 A;  2V7Q H;  1N73 C;  3EFF K;  4WB4 A;  3L72 E;  4N78 D;  2Z4E A;  2E76 B;  1GL2 B;  4I1L A;  2C0W A;  1AFO A;  1FZF A;  3L70 G;  1KIL E;  3CCU P;  2QA4 P;  3L75 D;  1UIX A;  1SQP J;  5AVY B;  2QM8 A;  2QJY C;  2QE7 H;  5APQ A;  5KKZ B;  4BRY B;  3AEE C;  3CLQ A;  3S9O A;  1YIJ P;  1N7S A;  3H6P A;  1SQP E;  2BEQ D;  1N2D C;  1USE A;  2W8Z A;  3PH0 A;  5TIS H;  1M1J B; 
#chains in the Genus database with same CATH homology
 4C7R A;  4HH2 A;  1H8A A;  1M1J A;  1GU5 A;  1J1E B;  1IJD B;  3M9H A;  1JY3 N;  3L35 A;  3SWY A;  5AVV B;  1RE3 A;  1JO5 A;  4WY4 D;  1HTL C;  4DOJ A;  1SFC B;  1XTG B;  2H8P D;  2WZ7 A;  1PFI A;  4JF7 A;  5APX A;  1LGH B;  1SQP K;  3A5T A;  1LTT C;  3MTU E;  1J1D B;  1NO4 A;  2POH A;  1NH4 A;  1GK4 A;  2ZFC A;  1IFD A;  3VMX A;  1JY2 P;  2C0X A;  2P1J A;  3NMD A;  4JYB A;  5AW7 B;  5CCG A;  2P2U A;  4IFF A;  2R5D A;  2W6B A;  1IFN A;  1W2E A;  1CI6 B;  1X79 B;  5AW2 B;  1X9V A;  1CW5 A;  3V2N A;  5AW4 B;  1CI6 A;  3V2Q A;  1GK6 A;  2P7J A;  3TK1 A;  4ZKP A;  3KQG A;  3RL0 C;  2WSC H;  3RK2 D;  1M7L A;  2W6A A;  1VPC A;  2KLV A;  2M3B A;  5BVZ A;  2NPS C;  2OYI C;  1JUN A;  1L4A B;  3GHG C;  5APW A;  1FU1 A;  3BVH A;  1A02 F;  1DH3 A;  5AW5 B;  4W7Y A;  3RK3 C;  1WT6 A;  2O01 H;  1FOS E;  2J59 M;  3SWF A;  3I5C A;  1URQ B;  3B5N B;  1KIL B;  3BRV B;  1MV8 A;  4C46 A;  1URQ A;  5CCH D;  1N7L A;  2BAS A;  3L4F A;  1JY2 O;  2A45 H;  3NFQ A;  3EQ2 A;  1JNM A;  1AQ5 A;  4XA4 A;  3VOP A;  1E5W A;  5APY A;  2NPS B;  1IFM A;  1JTH A;  3GHG B;  2VRS A;  2PAJ A;  1GU4 A;  2OYI A;  2NPS A;  3O8Z A;  3GHG A;  5KJ7 D;  1WRG A;  2WPQ A;  1HGV A;  2GUV A;  1FZA A;  3HD7 B;  2I1J A;  2PP6 A;  1LWU B;  2KP8 A;  1FZC C;  3N7N A;  1N7S B;  2FYZ A;  1OWA A;  1NAF A;  5BU5 A;  5AVX B;  1H88 A;  4OH8 B;  2FYU K;  2N1T B;  1N73 B;  4IFD K;  4N78 E;  4WY4 C;  3PP5 A;  3EFG A;  4W80 A;  1ZR4 A;  2I1K A;  1ZV8 A;  5APT A;  1LTG C;  1SQB K;  2KYV A;  3HE5 A;  3M9B A;  5AW1 B;  5APU A;  4C7N A;  2P67 A;  1FZB A;  2CPB A;  3P8M C;  2QM7 A;  2H7H A;  1RY3 A;  3V4Q A;  2M8R A;  3M9Q A;  3HE4 A;  3KYQ A;  4AQR D;  3LIE A;  1LTJ C;  5CJ4 A;  1VDF A;  3N4X A;  3CI9 A;  4I6M C;  1KQL A;  1SFC D;  3V2R A;  1JMM A;  1G2C B;  4EIJ A;  3RK2 C;  4I2L C;  1RF0 C;  2C9N Y;  3WMM 0;  1H89 A;  2FFD C;  1G2C A;  2WPS A;  4WY4 B;  5BU8 B;  2N9B A;  3BAS A;  3II6 A;  2H43 A;  4XE5 B;  1LTA C;  4WY4 A;  1MUU A;  1ZLL A;  3HUS C;  3R2P A;  3LW5 H;  3KDP B;  5CCG D;  1NHL A;  3VN0 A;  3NTN A;  1NKZ B;  2W27 A;  1X8Y A;  1FOS F;  1T3J A;  1RF1 C;  1HBW A;  4GIF A;  4Y99 C;  5CCH C;  2Q3I A;  2OAR A;  1IC2 A;  1OXZ A;  1FDM A;  1L4A D;  1FAV A;  2XU6 A;  1LTJ A;  1KZU B;  3OJA B;  2YKQ A;  2FFD B;  1RF0 A;  2OYH C;  2FFD A;  1JCD A;  2R3C A;  3HTK A;  1DX7 A;  3HUS B;  3U1C A;  3G3Z A;  1URQ D;  1KIL D;  3B5N D;  5KJ7 C;  3H32 A;  3HUS A;  3V2P A;  3A7O A;  1HWT C;  1SQX K;  1QL1 A;  3NXS A;  1NTM K;  4N6J A;  5AW0 B;  1RF1 B;  1A02 J;  2JEE A;  1ZN5 A;  2IPP A;  2XDJ A;  2XV5 A;  3RL0 B;  2GUS A;  2Z5H A;  4Y99 B;  1RF1 A;  2Q5U A;  1T2K D;  1G1I A;  1JTH B;  1GL2 D;  1KFN A;  1IFJ A;  2WT7 A;  2OYI B;  4AYC A;  5CCH A;  2XZR A;  2YKP A;  2HFE D;  1QL2 A;  1ZR2 A;  2Q9I A;  1GDT A;  1HGZ A;  2GM4 A;  1FBM A;  5CJ0 A;  3VTP C;  1FJP A;  3TNU B;  3L37 A;  3RK3 B;  1YTZ I;  5KLV K;  1M1J C;  3TNU A;  2OYH B;  3VMZ A;  5KTB A;  2WSF H;  1SVF A;  2YMY A;  3M0D C;  3HD7 D;  2OYH A;  1GW4 A;  1J1E C;  1NOH A;  2R5B A;  4ZKU A;  2KB7 P;  2IFN A;  1N7S D;  2Z5I A;  2Q7C A;  5AVS B;  5KJ7 A;  2YKO A;  1HUC A;  5AW8 B;  5CHX A;  2HG5 D;  2N1T D;  2ZXE B;  2YO3 A;  3MGN A;  4M3L A;  2WSE H;  2XKM A;  1SFC C;  3T97 A;  2R32 A;  1HVV A;  1RE4 C;  3HE5 B;  1J2J B;  3OA7 A;  4EOT A;  1IO4 A;  4C7N B;  1SP4 A;  1S9K D;  3MD0 A;  2A45 G;  3C9I A;  2HYN A;  3HE4 B;  1YTZ T;  3VP8 A;  1GZL A;  2WIT A;  5CCG C;  2IX7 C;  1SLQ A;  5AVT B;  2E42 A;  2J58 A;  1JY3 P;  2HPC A;  1L0N K;  1IK9 A;  1GD2 E;  1FZC B;  1FZG A;  2O1J A;  1FZC A;  4W7Z A;  3M0D A;  3IFM A;  2IFM A;  1G1J A;  1T8Z A;  3BAT A;  3KPE A;  2O1K A;  5AVW B;  1T3U A;  3V5B A;  2WTY A;  5AW9 B;  5AVR B;  3P32 A;  1L4A C;  3VMY A;  1JY2 N;  1S9K E;  1SFC A;  4GKG A;  1RE4 A;  1NTK K;  1GW3 A;  4B86 A;  2WWW A;  3BRT B;  5AVZ B;  1EQ7 A;  1CZQ A;  1NU1 K;  2XNX A;  3E1I A;  2E43 A;  1LT9 C;  2A45 I;  1URQ C;  1KIL C;  3B5N C;  3M06 A;  4N3Y B;  1IFI A;  3MUD A;  3P8C D;  1FJK A;  1YYC A;  1L0L K;  1MFZ A;  1LTJ B;  5AW3 B;  1SQQ K;  3U59 A;  1XTC C;  2WPR A;  3RK2 B;  1SQV K;  1JY3 O;  4RES B;  3M91 A;  1T2K C;  1JCC A;  1GL2 C;  3HTK B;  5APS A;  3UIA A;  3IR9 A;  3TSI A;  3OAK A;  3A2A A;  2MJZ A;  3H32 B;  2YO2 A;  4O9B A;  1DEB A;  4DZO A;  4KHX A;  1MZ9 A;  2JJL A;  1GTW A;  1N86 A;  4WBA A;  3LID A;  1LTB C;  1NKN A;  3VYI A;  2HOD B;  1HJB A;  4AUW A;  1L4A A;  2HOD A;  3V4W A;  4LC1 A;  1NTZ K;  3HD7 C;  3L36 A;  1NWQ A;  2WT7 B;  4LLH A;  1LT9 B;  3P8C E;  1LWU C;  5AVQ B;  3RL0 D;  1N7S C;  4IFM A;  1LT9 A;  3U1A A;  3B5N A;  1KIL A;  4HYT B;  1HH0 A;  1LTI C;  2YNY A;  3CL3 D;  2N1T C;  1N73 C;  2NPS D;  1JOC A;  4WB4 A;  4N78 D;  2Z4E A;  2C9L Y;  2KOG A;  1GL2 B;  4I1L A;  2C0W A;  5CMZ A;  3B8E B;  4GT1 A;  1GL2 A;  3RK3 D;  1AFO A;  1FZF A;  3M0A A;  5APV A;  1CSB A;  2KSJ A;  5AVU B;  3VP9 A;  3P7K A;  1RE3 C;  1Z56 A;  5AVY B;  1KFM A;  2QM8 A;  4LGD E;  3HRN A;  5APQ A;  2FKW B;  2HLO A;  3TYY A;  3MIW A;  3HD7 A;  2FXM A;  3A3Y B;  5AW6 B;  2CPS A;  1LWU A;  3CLQ A;  1FZE A;  1J1D C;  1N7S A;  2L5G B;  3H6P A;  1LTS C;  2LKM A;  4JYC A;  1N2D C;  2HPC B;  2N1T A;  1N73 A;  1M1J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...