5GTIE

Native xfel structure of photosystem ii (two flash dataset)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II D1 protein
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 21
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5gtiE00
5GTIE 1S5LE 5TISE 2AXTE 5KAFE 5GTHE 3JCUE 1W5CE 5H2FE 5E79E 3A0HE 5KAIE 3KZIE 4IL6E 5B5EE 4UB6E 5B66E 3A0BE 4UB8E 3WU2E 4PJ0E
chains in the Genus database with same CATH superfamily
2P10A 3B5NC 2GA1A 1J2JB 3V4WA 3B71A 1EDKA 1PFIA 1JY2O 1J1DB 3CXHI 1Q86Q 5AVXB 1L0NG 3V2PA 1J1EB 2SPZA 2R32A 1JOCA 1KQGB 1SQXD 1H89A 1JB0J 3VN0A 1VF5C 2KS1B 2HPCB 2KNCB 1SFCB 2ZXEB 2CK3H 1FZGA 2O1JA 1XTGB 2I1JA 2KZJA 1M1JB 2P67A 4EYYQ 3JC22 3H1HJ 1IFIA 2R3SA 4B86A 4OH8B 2PP6A 1FZCC 2Y9YA 1NTZD 3L74G 3LIEA 2W27A 1QX8A 2MJZA 1JCCA 2IPPA 4YXDC 2K9YA 1JTHB 3H1KE 3BVHA 3P7KA 1H0TA 2B88A 3A3YB 3KPEA 4ZNCA 3MZWB 4L75A 3V5BA 1ZMEC 1VQMP 2Q1KA 1U57A 3BCCG 1MZ9A 4UB6H 4Y99C 1X9VA 2A45H 2W90A 2OTKE 1SQVG 4JYCA 3RK3D 1T2KD 4N3YB 5B66E 5AW2B 1NGMB 3H1ID 1L0LD 4UB8E 5BU5A 1LT9A 3L71D 2GM4A 3O6QA 1KILC 5KLVE 1DEEG 1IK9A 2I1KA 1Q90D 1URQB 3II6A 3B5ND 3HE5B 1PV3A 3C9IA 2YIUC 2QG4A 3HTKA 2FFDC 3P32A 2FY8A 5E79H 2N9YB 2W6JH 1LWUC 4H44C 4PD4D 1BSHA 2E75D 1GU4A 3M9BA 3N4XA 1NTMG 3L70E 1FDOA 1IFMA 4N6JA 3T97A 5AVTB 1VF5D 2KK7A 1KQFB 3A0HH 3OA7A 4RO0A 3L70J 3WMM0 2Q5UA 1YQ3C 3CWBD 5AW9B 2D2CC 2XV5A 3OAKA 2WT7B 4JF7A 2WMMA 2BCCD 3AE9C 1LT1A 5GTHE 1SQXK 1M56D 1MV8A 1AA0A 1OFCX 5TJHA 1SQXE 3B5NB 5GTIH 4WB4A 2JDIH 5AW5B 2FYZA 1E5WA 3H1HG 4MN4C 2G8YA 1CSBA 2E74C 1PP9E 1JUNA 1SQXJ 1S5LE 4K35A 4PV1C 2E75B 2O1KA 1KYOI 5KJ7A 3AE4C 5CHXA 5EFWB 2QRXA 3E1RA 3VP9A 3CMEP 4NPEA 3L74D 1NTZE 1VF5B 2KSJA 2C9NY 2ITAA 3TF5A 3PH0A 1BSNA 1NTZJ 4BWNA 3SWYA 3H32A 1KILD 3C1LA 1LP1A 1NH4A 3L4FA 3CCMP 1SQPD 3IR9A 3CPWO 1NTKD 4IL6H 3PTZA 3GW6A 1AJYA 3R4YA 2JR8A 4H44D 4I6MC 1K8AQ 2M8RA 1YHQP 3LIDA 3F5HA 1L0LK 3RK3E 5DJTB 5BVZA 1N8RQ 3IN6A 1Q82Q 3QWOC 1L4AA 1QGKB 2WPQA 3H1IE 1OMIA 1EDLA 4YTPC 4EOTA 3AEDC 3L71E 1VQNP 1GD2E 3H1IJ 2D2CD 1L0LJ 3NFQA 2PGDA 3M9QA 3HD7B 3WU2E 3CCRP 1AFOA 1U7MA 2YO2A 5KLIC 4PD4E 4IOIH 3USSA 2FYNC 3L70G 3Q5RA 1JO5A 1YTZT 2KUBA 1LT9C 2J58A 2KYVA 1NOHA 1VDFA 3CC7P 5M1BA 1Y9BA 3VP8A 1GL2B 2R3CA 1KB9D 2E74D 2QJPC 3A5TA 3I5CA 1P84H 3Q3DA 3CWBE 2E5TA 4XFJA 3VMAA 1YBKA 2KSEA 3KZIE 3CCEP 4YPCA 2WSEH 4KHXA 1QL1A 1VQ4P 2BCCE 3AE2C 3CWBJ 1L0NE 4WVZA 4AQRD 1IK7A 3JCUE 1VQOP 3RK2B 3AEFC 2Q3IA 1DD3A 1G1JA 2BCCJ 1NKNA 4D6TD 1SQXG 3V4QA 1KMIZ 4DJGA 4XE5B 2YXQB 1U7JA 1GK4A 4ZKUA 3KXDA 5H2FE 1IFDA 1X79B 4K3AA 1FZFA 4OGQD 1ZN5A 1RQUA 1NTZG 1VQ9P 3L74E 1EZVI 4I7ZC 2JKVA 4PJ0E 5KAFE 4JQ0D 5CBOA 2ZAEB 1FJKA 2E74B 3L72D 1GDTA 2P7JA 3B4SA 2NZ2A 1SQPK 1KILE 2AXTH 1FDMA 1R8EA 1HUCA 2BEQD 3Q1MA 3AEGC 3HUSA 3KDPB 2LKMA 1SQPE 3MD0A 1NTKE 1FBMA 1NU1K 5K5GB 2WPSA 2ZYAA 2FFDA 2OTJP 3V2QA 1SQPJ 3AE8C 1FZEA 2MKVA 1NTKJ 1KYOD 1RF1A 4H13C 2B89A 1ZXGA 3ITKA 5CMZA 3H1IG 1L0LG 3G9RA 4NPFX 2OYOA 2KXPB 5APVA 1DX7A 2A45I 1NU1J 1BGYJ 5AW1B 3AE5C 4OWFA 2KOGA 3PJSK 1ZV8A 3WUUA 1YI2P 4OGQB 3BATA 2ZVOB 3RL0g 2WSCJ 3CLQA 5TISE 5APSA 3OJAB 1KQSO 2L91A 1L4AC 1NTME 2H89C 1DEBA 1XTCC 2OYIB 5APXA 2WZ7A 1CI6B 1KD1Q 2FKWB 1H8AA 2H43A 1OZHA 2O01J 2WPVB 1LJ2A 5B5EH 3S1KA 3CWBG 1KB9E 2XKMA 2GUSA 2A45G 1YITP 2QM7A 3L35A 2NRGA 1GW4A 1MUUA 2BCCG 3LW5J 2OARA 2JO1A 1DH3A 3O6QB 1N73A 1EDIA 1N7SB 3G71P 1USDA 5AW4B 3R2PA 4D6TE 1KN7A 3Q5PA 5APQA 3QH9A 1S3JA 3H1HE 4D6TJ 5C39A 5KJ7D 1VPCA 1K04A 1FJPA 2XNDH 3T97B 1RF0A 3RL0C 1EDJA 2XNXA 1FOSE 4H13D 4R4LA 1WT6A 3HE4A 1FAVA 3L72E 1G2CB 1KORA 1OIPA 1QVGO 2YKQA 3E1IA 1OW8A 2K3RA 3RBZA 1SS1A 5KKZB 5CCHA 1SQPG 5KAIH 3L72J 2QEXP 1NTKG 2C9LY 3GMAA 2KIKA 3L73J 3MTUE 3S4RA 4BXLA 1NU1G 1IFPA 3TSIA 5AW7B 4WY4A 1L4AD 3TK1A 1KYOE 1KB9I 4U3FD 2OGUA 1SQBD 1ZRTD 3NMDA 4GIFA 3G6EP 1EZVD 3HUSC 1OVRA 2Y0EA 1PPJD 1GTWA 4M3LA 4L73A 2PAJA 1EQ7A 1BCCD 3H1JD 1KTMA 3CCSP 2FBWC 2FYUK 3RBXA 4H13B 3S9OA 4BRYA 1RF1C 1NYHA 3H32B 4CPGA 2JWAA 1YTZI 1JNMA 2KS1A 1JMMA 4NPDA 2KNCA 1SFCA 4W80A 2Y0CA 2OYHB 4DCKA 2QJYC 5CJ4A 2R44A 1EXJA 2J59M 2M0BA 1GW3A 1UIIA 1R5LA 3RK3B 1L4AB 3CXHH 3RGUA 3CX5H 3RL0D 4LLHA 1PGJA 1JCDA 2QVAA 4LC1A 2K1AA 3FXEA 1P84I 4IFFA 4GOFA 1MFZA 2E76C 2IYPA 4D6TG 4L74A 2WSSH 1JTHA 3CCVP 5APYA 4AUWA 5CCGA 5AVVB 3BASA 3CCJP 2Z5HA 2W83C 5DJUB 1FDIA 3KYQA 2Y9ZA 2ZYDA 1PZQA 1YQ4C 1S2EA 5AVSB 4EDFA 1N73C 3FXDA 5KTBA 2ZT9C 2ZVNB 3A0BE 1LTTC 4GKGA 4ZMDA 1NAYA 3SSUA 5AW6B 5AW8B 1NAFA 2O01N 1S72P 5APUA 3M9HA 4GT1A 2CPSA 3L72G 5AVWB 1LTJC 3CD6P 1LGHB 5B5EE 1URQA 3HE5A 1FU1A 3L73G 3RL0B 1FZCB 1RF0C 2JWDA 3U59A 3FWLA 4RESB 2Q3EA 4OVNF 1M90Q 1S5LX 1NU1D 2QIWA 1BGYD 3MP7B 2G3AA 1SQBK 1OVUA 4DZOA 1L0LE 1T6AA 2O3JA 4RJTA 2JEEA 1A02J 1D7MA 1ZRTE 5CCHC 3CC4P 1PL5A 1EZVE 3PHLA 4Y99B 2IYOA 4U3FJ 3A2AA 2YKPA 1PPJE 1SQBJ 1BCCE 3G4SP 4WY4C 1GZLA 1BCCJ 3H1JJ 4C7NA 3SFDC 1N86A 2KLUA 1KILB 2P58A 2B87B 2E76D 2K9JB 3HUSB 3WUVA 1PGOA 2YNYA 5AVRB 5CJ0A 1FOSF 3IFMA 3BRTB 2HODB 4LGDE 2YIUB 2FFDB 3U1AA 1LWUB 4H44B 3AE6C 2IBZI 4PV1D 2OTLP 1EC5A 2FXOA 1J1EC 2IX7C 2KLVA 4UB6E 2WPRA 1HGZA 2XZRA 2NPSA 1HBWA 2ZT9D 2WVRA 1PGPA 2IFNA 3MUDA 3WUTA 2FXMA 2AEMA 3D71A 1RQVA 3O8ZA 3FWNA 1SFCC 4AYCA 3M06A 2YKOA 2D2CB 1AQTA 4O9BA 2XDJA 4TLFA 2IFMA 5B66H 2DW3A 1DD4A 5E79E 1X8YA 1IC2A 4UB8H 1USEA 1LTAC 1T3JA 3ABVC 4EI2A 3PLNA 1FZBA 1X0TA 3H1LD 2E76B 1RE3A 3L37A 1IJDB 3A7OA 1LTBC 1GMJA 4GDOA 3F89A 1JY3P 5CCGC 1HGVA 3EWKA 3A0HE 2YMKA 1FZAA 3H25A 4PV1B 1K73Q 5CCHD 3AEEC 4JYBA 1P84D 3AE1C 3L73D 1W2BO 1N73B 2ZT9B 1PGQA 3AEBC 5APTA 1SQQD 3V2RA 1NVOA 3HD7A 1KC8Q 2Z4EA 3H1KD 3E7KA 1QVFO 1HTLC 4WY4D 1OVVA 4H0LC 1LTGC 2QJKC 1NU1E 4HH2A 2RKLA 1BGYE 3GF3A 2Q9IA 1KFNA 4U3FG 5GTIE 1URQC 1SQBG 1NKZB 1OW6A 1GL2A 2WWWA 1EZVG 4GOEA 1Y8AA 1PPJG 3TGUD 5GTHH 1KQLA 1BCCG 2W6BA 3H1JG 1M8OB 1JMBA 3VMXA 5AVYB 3HE4B 2FYUD 2UWJE 4TT3H 1S9KD 4C46A 1YJ9P 1IO4A 1H0TB 1VQ8P 2Z5IA 3AE7C 1ZP0C 1VQLP 1SFCD 2IDBA 4W7ZA 5AVZB 1TU3F 4WWIA 1W5CE 1QL2A 1T2KC 1IFNA 3TNUA 4I1LA 2A06G 4IL6E 5KLIB 2HR3A 1K9MQ 4U7JA 1YIJP 2FYNB 2ZYGA 1LT9B 4ZKPA 2M3BA 4W7YA 3V6IA 3CC2P 1HJ0A 2WSFH 2LXCB 4HJGH 1YJWP 1JY2P 2H8PD 5CCGD 3I56P 2QJPB 3EQ2A 3HTKB 1VQ5P 3FGAD 3CX5I 1A02F 2E75C 1LTJA 4BRYB 1M1KQ 4EIJA 4HYTB 1LTSC 2NPSC 2WQYC 5CBNA 3CCLP 1X22A 4KJMA 3MIWA 5AVQB 3MUDC 1HH0A 1JY3N 4H0LD 1PP9D 1WMKA 4IL6X 2IBZD 3H1LE 4C7RA 1IFJA 4ASWA 1QEXA 3M91A 2IZ1A 2N1TA 1URQD 3H1LJ 2Q6QA 3WU2H 1S1CX 2LXBA 2ZXXA 3MGNA 1Q81Q 3P8MC 4PD4H 1P84E 1SQQK 2GUVA 3GHGA 3L73E 2M5AA 3CI9A 1SQQE 4QMAA 2BEZF 1RE3C 4I7ZB 1SP4A 1NJIQ 1VL2A 2WSEJ 1SQQJ 2JJLA 1BGYG 3JSVC 1GK6A 2OYIA 1CI6A 2XU6A 3H1KJ 3KZIH 2V7QH 1OX3A 2OQQA 5AW0B 2R5BA 1RE4A 1MKMA 3HD7C 5BU8B 3JCUH 4H0LB 3SFEC 1NWQA 3TGUE 2H7HA 2E5YA 2QJKB 5KLVK 3IAOA 1KZUB 1VQ6P 3CMAP 1BE3D 2FYUE 1N7SA 2R5DA 3TGUJ 1S9KE 3VMYA 1LP1B 2HLOA 3I55P 4L76A 1GL2C 5KLVJ 2FYUJ 5H2FH 3ZDMA 2HPCA 1FC2C 3SWFA 1Q7YQ 4DT0A 2AXTE 1M7LA 2H88C 1VQPP 1M1JA 2NPSD 2A06D 4PJ0H 3GF7A 3D6ZA 5KAFH 2KI7B 2C0XA 3TYYA 3L75D 1JY2N 1L2PA 3RK2C 2Y0DA 3PP5A 1N2DC 3NTNA 1AQ5A 1FS0E 3M0DA 3VMZA 3D70A 1G2CA 4R4MA 1L0ND 1ZR4A 1BDDA 1YJNP 2M3EA 1LTIC 4C7NB 1VQKP 2AXCA 1RHZB 2YMYA 1CZQA 2C0WA 1KFMA 3C8VA 3H1LG 1E79H 3EFGA 2WSCH 2IBZE 1JEKA 3PRJA 1M57D 1OXZA 2ZFCA 4Y28J 4N78D 3GLMA 1PP9J 1NTZK 2NPSB 3Q2YA 2POHA 5TISH 1GU5A 3HD7D 1QLED 3CCQP 2O01H 1SQQG 3CXHD 3CX5D 1AV1A 2AEFA 3OW2O 2QM8A 3H1KG 1Q2NA 2RMZA 1R5SA 3SWKA 1W2EA 2N1TC 2PRRA 3LW5H 1KB9H 2V4HA 1GL2D 3BCCD 2K88A 4U3FE 2OYHA 1Z56A 2HFED 1SQBE 2WSFJ 3VOPA 1SQVD 3GHGC 4OGQC 3K5BA 2VRSA 3W67A 2QA4P 1HWTC 2AEJA 4IFMA 2WT7A 3TGUG 3H1JE 4XA4A 1CW5A 5KLVG 2FYUG 1SVFA 3RK2D 1BE3E 2HYNA 2W6AA 2OYIC 4GODA 1ZLLA 3HRNA 1VQ7P 1UIXA 3CCUP 3L71J 3V2NA 3B5NA 1NO4A 1EXIA 1BE3J 1RE4C 4IFDK 2JP3A 2N9BA 2FXPA 1WRGA 3P8CD 1HF9A 1NTMD 3W68A 4ASVA 1RH5B 2HG5D 5KAIE 3L36A 1J1DC 3U1CA 1RF1B 2A06E 3N7NA 1MFTA 1N7SC 3G3ZA 5AVUB 3MHVA 2QSIA 1KV4A 3L75E 2P1JA 4YXWH 4I2LC 3IF4A 1PIXA 2B9BA 2RN0A 2QJYB 1JM0A 3L75J 1L0NK 1LNQA 1IZNB 3KQGA 1T8ZA 1M1JC 2E43A 2KZIA 2J5UA 1OWAA 2V7QJ 1FZCA 2E42A 1KYOH 1L0NJ 2IZ0A 2RH0A 1SLQA 2L5GB 3H1HD 3M0DC 1RY3A 1PP9G 2IBZG 1Y47A 2N1TD 4Z1MH 1S4XA 1NHLA 3TNUB 1ZR2A 3VYIA 1AVYA 1JY3O 5KKZC 1H88A 4N78E 1ZOYC 3BRVB 4HKZH 1OW7A 2W8ZA 3M0AA 5AW3B 3EFFK 1FE6A 3GG2A 4JBZA 2QE7H 3CXHE 3CX5E 3VTPC 1T3UA 3L74J 2KB7P 3CL3D 2CPBA 2KP8A 4PD4I 1KILA 1LTJB 1NTKK 2P2UA 2B87A 2K9JA 3UIAA 5KJ7C 3AEAC 5L8RJ 3BCCE 1SQVK 2HODA 4RKUJ 1LWUA 1K05A 1SQVE 4HB1A 3BCCJ 3AECC 4WBAA 1DIPA 3D6YA 1N7SD 1SQVJ 3FX0A 4A7PA 2N1TB 3Q5SA 1N7LA 2PFXA 2YO3A 3L71G 5KLVD 3KHUA 1ZW0A 1BE3G 2BASA 3TDKA 2LR2A 4DOJA 4KT0J 3B8EB 2OYHC 3GHGB 1S5LH 2M5AB 1HVVA 1G1IA 2Q7CA 2ZJSE 2WTYA 1HJBA 1NTMK 5APWA 3A0BH 3P8CE 3L70D 3RK3C 1YYCA 2YXRB 4WY4B 4JPZB 2K37A 1BDCA 3H6PA 1AVOA 2WITA 3AE3C 3NXSA 1NTMJ 2I8DA 3L75G
chains in the Genus database with same CATH topology
5GTIE 1S5LE 5TISE 2AXTE 5KAFE 5GTHE 3JCUE 1W5CE 5H2FE 5E79E 3A0HE 5KAIE 3KZIE 4IL6E 5B5EE 4UB6E 5B66E 3A0BE 4UB8E 3WU2E 4PJ0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTI E;  1S5L E;  5TIS E;  2AXT E;  5KAF E;  5GTH E;  3JCU E;  1W5C E;  5H2F E;  5E79 E;  3A0H E;  5KAI E;  3KZI E;  4IL6 E;  5B5E E;  4UB6 E;  5B66 E;  3A0B E;  4UB8 E;  3WU2 E;  4PJ0 E; 
#chains in the Genus database with same CATH topology
 2P10 A;  3B5N C;  2GA1 A;  1J2J B;  3V4W A;  3B71 A;  1EDK A;  1PFI A;  1JY2 O;  1J1D B;  3CXH I;  1Q86 Q;  5AVX B;  1L0N G;  3V2P A;  1J1E B;  2SPZ A;  2R32 A;  1JOC A;  1KQG B;  1SQX D;  1H89 A;  1JB0 J;  3VN0 A;  1VF5 C;  2KS1 B;  2HPC B;  2KNC B;  1SFC B;  2ZXE B;  2CK3 H;  1FZG A;  2O1J A;  1XTG B;  2I1J A;  2KZJ A;  1M1J B;  2P67 A;  4EYY Q;  3JC2 2;  3H1H J;  1IFI A;  2R3S A;  4B86 A;  4OH8 B;  2PP6 A;  1FZC C;  2Y9Y A;  1NTZ D;  3L74 G;  3LIE A;  2W27 A;  1QX8 A;  2MJZ A;  1JCC A;  2IPP A;  4YXD C;  2K9Y A;  1JTH B;  3H1K E;  3BVH A;  3P7K A;  1H0T A;  2B88 A;  3A3Y B;  3KPE A;  4ZNC A;  3MZW B;  4L75 A;  3V5B A;  1ZME C;  1VQM P;  2Q1K A;  1U57 A;  3BCC G;  1MZ9 A;  4UB6 H;  4Y99 C;  1X9V A;  2A45 H;  2W90 A;  2OTK E;  1SQV G;  4JYC A;  3RK3 D;  1T2K D;  4N3Y B;  5B66 E;  5AW2 B;  1NGM B;  3H1I D;  1L0L D;  4UB8 E;  5BU5 A;  1LT9 A;  3L71 D;  2GM4 A;  3O6Q A;  1KIL C;  5KLV E;  1DEE G;  1IK9 A;  2I1K A;  1Q90 D;  1URQ B;  3II6 A;  3B5N D;  3HE5 B;  1PV3 A;  3C9I A;  2YIU C;  2QG4 A;  3HTK A;  2FFD C;  3P32 A;  2FY8 A;  5E79 H;  2N9Y B;  2W6J H;  1LWU C;  4H44 C;  4PD4 D;  1BSH A;  2E75 D;  1GU4 A;  3M9B A;  3N4X A;  1NTM G;  3L70 E;  1FDO A;  1IFM A;  4N6J A;  3T97 A;  5AVT B;  1VF5 D;  2KK7 A;  1KQF B;  3A0H H;  3OA7 A;  4RO0 A;  3L70 J;  3WMM 0;  2Q5U A;  1YQ3 C;  3CWB D;  5AW9 B;  2D2C C;  2XV5 A;  3OAK A;  2WT7 B;  4JF7 A;  2WMM A;  2BCC D;  3AE9 C;  1LT1 A;  5GTH E;  1SQX K;  1M56 D;  1MV8 A;  1AA0 A;  1OFC X;  5TJH A;  1SQX E;  3B5N B;  5GTI H;  4WB4 A;  2JDI H;  5AW5 B;  2FYZ A;  1E5W A;  3H1H G;  4MN4 C;  2G8Y A;  1CSB A;  2E74 C;  1PP9 E;  1JUN A;  1SQX J;  1S5L E;  4K35 A;  4PV1 C;  2E75 B;  2O1K A;  1KYO I;  5KJ7 A;  3AE4 C;  5CHX A;  5EFW B;  2QRX A;  3E1R A;  3VP9 A;  3CME P;  4NPE A;  3L74 D;  1NTZ E;  1VF5 B;  2KSJ A;  2C9N Y;  2ITA A;  3TF5 A;  3PH0 A;  1BSN A;  1NTZ J;  4BWN A;  3SWY A;  3H32 A;  1KIL D;  3C1L A;  1LP1 A;  1NH4 A;  3L4F A;  3CCM P;  1SQP D;  3IR9 A;  3CPW O;  1NTK D;  4IL6 H;  3PTZ A;  3GW6 A;  1AJY A;  3R4Y A;  2JR8 A;  4H44 D;  4I6M C;  1K8A Q;  2M8R A;  1YHQ P;  3LID A;  3F5H A;  1L0L K;  3RK3 E;  5DJT B;  5BVZ A;  1N8R Q;  3IN6 A;  1Q82 Q;  3QWO C;  1L4A A;  1QGK B;  2WPQ A;  3H1I E;  1OMI A;  1EDL A;  4YTP C;  4EOT A;  3AED C;  3L71 E;  1VQN P;  1GD2 E;  3H1I J;  2D2C D;  1L0L J;  3NFQ A;  2PGD A;  3M9Q A;  3HD7 B;  3WU2 E;  3CCR P;  1AFO A;  1U7M A;  2YO2 A;  5KLI C;  4PD4 E;  4IOI H;  3USS A;  2FYN C;  3L70 G;  3Q5R A;  1JO5 A;  1YTZ T;  2KUB A;  1LT9 C;  2J58 A;  2KYV A;  1NOH A;  1VDF A;  3CC7 P;  5M1B A;  1Y9B A;  3VP8 A;  1GL2 B;  2R3C A;  1KB9 D;  2E74 D;  2QJP C;  3A5T A;  3I5C A;  1P84 H;  3Q3D A;  3CWB E;  2E5T A;  4XFJ A;  3VMA A;  1YBK A;  2KSE A;  3KZI E;  3CCE P;  4YPC A;  2WSE H;  4KHX A;  1QL1 A;  1VQ4 P;  2BCC E;  3AE2 C;  3CWB J;  1L0N E;  4WVZ A;  4AQR D;  1IK7 A;  3JCU E;  1VQO P;  3RK2 B;  3AEF C;  2Q3I A;  1DD3 A;  1G1J A;  2BCC J;  1NKN A;  4D6T D;  1SQX G;  3V4Q A;  1KMI Z;  4DJG A;  4XE5 B;  2YXQ B;  1U7J A;  1GK4 A;  4ZKU A;  3KXD A;  5H2F E;  1IFD A;  1X79 B;  4K3A A;  1FZF A;  4OGQ D;  1ZN5 A;  1RQU A;  1NTZ G;  1VQ9 P;  3L74 E;  1EZV I;  4I7Z C;  2JKV A;  4PJ0 E;  5KAF E;  4JQ0 D;  5CBO A;  2ZAE B;  1FJK A;  2E74 B;  3L72 D;  1GDT A;  2P7J A;  3B4S A;  2NZ2 A;  1SQP K;  1KIL E;  2AXT H;  1FDM A;  1R8E A;  1HUC A;  2BEQ D;  3Q1M A;  3AEG C;  3HUS A;  3KDP B;  2LKM A;  1SQP E;  3MD0 A;  1NTK E;  1FBM A;  1NU1 K;  5K5G B;  2WPS A;  2ZYA A;  2FFD A;  2OTJ P;  3V2Q A;  1SQP J;  3AE8 C;  1FZE A;  2MKV A;  1NTK J;  1KYO D;  1RF1 A;  4H13 C;  2B89 A;  1ZXG A;  3ITK A;  5CMZ A;  3H1I G;  1L0L G;  3G9R A;  4NPF X;  2OYO A;  2KXP B;  5APV A;  1DX7 A;  2A45 I;  1NU1 J;  1BGY J;  5AW1 B;  3AE5 C;  4OWF A;  2KOG A;  3PJS K;  1ZV8 A;  3WUU A;  1YI2 P;  4OGQ B;  3BAT A;  2ZVO B;  3RL0 g;  2WSC J;  3CLQ A;  5TIS E;  5APS A;  3OJA B;  1KQS O;  2L91 A;  1L4A C;  1NTM E;  2H89 C;  1DEB A;  1XTC C;  2OYI B;  5APX A;  2WZ7 A;  1CI6 B;  1KD1 Q;  2FKW B;  1H8A A;  2H43 A;  1OZH A;  2O01 J;  2WPV B;  1LJ2 A;  5B5E H;  3S1K A;  3CWB G;  1KB9 E;  2XKM A;  2GUS A;  2A45 G;  1YIT P;  2QM7 A;  3L35 A;  2NRG A;  1GW4 A;  1MUU A;  2BCC G;  3LW5 J;  2OAR A;  2JO1 A;  1DH3 A;  3O6Q B;  1N73 A;  1EDI A;  1N7S B;  3G71 P;  1USD A;  5AW4 B;  3R2P A;  4D6T E;  1KN7 A;  3Q5P A;  5APQ A;  3QH9 A;  1S3J A;  3H1H E;  4D6T J;  5C39 A;  5KJ7 D;  1VPC A;  1K04 A;  1FJP A;  2XND H;  3T97 B;  1RF0 A;  3RL0 C;  1EDJ A;  2XNX A;  1FOS E;  4H13 D;  4R4L A;  1WT6 A;  3HE4 A;  1FAV A;  3L72 E;  1G2C B;  1KOR A;  1OIP A;  1QVG O;  2YKQ A;  3E1I A;  1OW8 A;  2K3R A;  3RBZ A;  1SS1 A;  5KKZ B;  5CCH A;  1SQP G;  5KAI H;  3L72 J;  2QEX P;  1NTK G;  2C9L Y;  3GMA A;  2KIK A;  3L73 J;  3MTU E;  3S4R A;  4BXL A;  1NU1 G;  1IFP A;  3TSI A;  5AW7 B;  4WY4 A;  1L4A D;  3TK1 A;  1KYO E;  1KB9 I;  4U3F D;  2OGU A;  1SQB D;  1ZRT D;  3NMD A;  4GIF A;  3G6E P;  1EZV D;  3HUS C;  1OVR A;  2Y0E A;  1PPJ D;  1GTW A;  4M3L A;  4L73 A;  2PAJ A;  1EQ7 A;  1BCC D;  3H1J D;  1KTM A;  3CCS P;  2FBW C;  2FYU K;  3RBX A;  4H13 B;  3S9O A;  4BRY A;  1RF1 C;  1NYH A;  3H32 B;  4CPG A;  2JWA A;  1YTZ I;  1JNM A;  2KS1 A;  1JMM A;  4NPD A;  2KNC A;  1SFC A;  4W80 A;  2Y0C A;  2OYH B;  4DCK A;  2QJY C;  5CJ4 A;  2R44 A;  1EXJ A;  2J59 M;  2M0B A;  1GW3 A;  1UII A;  1R5L A;  3RK3 B;  1L4A B;  3CXH H;  3RGU A;  3CX5 H;  3RL0 D;  4LLH A;  1PGJ A;  1JCD A;  2QVA A;  4LC1 A;  2K1A A;  3FXE A;  1P84 I;  4IFF A;  4GOF A;  1MFZ A;  2E76 C;  2IYP A;  4D6T G;  4L74 A;  2WSS H;  1JTH A;  3CCV P;  5APY A;  4AUW A;  5CCG A;  5AVV B;  3BAS A;  3CCJ P;  2Z5H A;  2W83 C;  5DJU B;  1FDI A;  3KYQ A;  2Y9Z A;  2ZYD A;  1PZQ A;  1YQ4 C;  1S2E A;  5AVS B;  4EDF A;  1N73 C;  3FXD A;  5KTB A;  2ZT9 C;  2ZVN B;  3A0B E;  1LTT C;  4GKG A;  4ZMD A;  1NAY A;  3SSU A;  5AW6 B;  5AW8 B;  1NAF A;  2O01 N;  1S72 P;  5APU A;  3M9H A;  4GT1 A;  2CPS A;  3L72 G;  5AVW B;  1LTJ C;  3CD6 P;  1LGH B;  5B5E E;  1URQ A;  3HE5 A;  1FU1 A;  3L73 G;  3RL0 B;  1FZC B;  1RF0 C;  2JWD A;  3U59 A;  3FWL A;  4RES B;  2Q3E A;  4OVN F;  1M90 Q;  1S5L X;  1NU1 D;  2QIW A;  1BGY D;  3MP7 B;  2G3A A;  1SQB K;  1OVU A;  4DZO A;  1L0L E;  1T6A A;  2O3J A;  4RJT A;  2JEE A;  1A02 J;  1D7M A;  1ZRT E;  5CCH C;  3CC4 P;  1PL5 A;  1EZV E;  3PHL A;  4Y99 B;  2IYO A;  4U3F J;  3A2A A;  2YKP A;  1PPJ E;  1SQB J;  1BCC E;  3G4S P;  4WY4 C;  1GZL A;  1BCC J;  3H1J J;  4C7N A;  3SFD C;  1N86 A;  2KLU A;  1KIL B;  2P58 A;  2B87 B;  2E76 D;  2K9J B;  3HUS B;  3WUV A;  1PGO A;  2YNY A;  5AVR B;  5CJ0 A;  1FOS F;  3IFM A;  3BRT B;  2HOD B;  4LGD E;  2YIU B;  2FFD B;  3U1A A;  1LWU B;  4H44 B;  3AE6 C;  2IBZ I;  4PV1 D;  2OTL P;  1EC5 A;  2FXO A;  1J1E C;  2IX7 C;  2KLV A;  4UB6 E;  2WPR A;  1HGZ A;  2XZR A;  2NPS A;  1HBW A;  2ZT9 D;  2WVR A;  1PGP A;  2IFN A;  3MUD A;  3WUT A;  2FXM A;  2AEM A;  3D71 A;  1RQV A;  3O8Z A;  3FWN A;  1SFC C;  4AYC A;  3M06 A;  2YKO A;  2D2C B;  1AQT A;  4O9B A;  2XDJ A;  4TLF A;  2IFM A;  5B66 H;  2DW3 A;  1DD4 A;  5E79 E;  1X8Y A;  1IC2 A;  4UB8 H;  1USE A;  1LTA C;  1T3J A;  3ABV C;  4EI2 A;  3PLN A;  1FZB A;  1X0T A;  3H1L D;  2E76 B;  1RE3 A;  3L37 A;  1IJD B;  3A7O A;  1LTB C;  1GMJ A;  4GDO A;  3F89 A;  1JY3 P;  5CCG C;  1HGV A;  3EWK A;  3A0H E;  2YMK A;  1FZA A;  3H25 A;  4PV1 B;  1K73 Q;  5CCH D;  3AEE C;  4JYB A;  1P84 D;  3AE1 C;  3L73 D;  1W2B O;  1N73 B;  2ZT9 B;  1PGQ A;  3AEB C;  5APT A;  1SQQ D;  3V2R A;  1NVO A;  3HD7 A;  1KC8 Q;  2Z4E A;  3H1K D;  3E7K A;  1QVF O;  1HTL C;  4WY4 D;  1OVV A;  4H0L C;  1LTG C;  2QJK C;  1NU1 E;  4HH2 A;  2RKL A;  1BGY E;  3GF3 A;  2Q9I A;  1KFN A;  4U3F G;  5GTI E;  1URQ C;  1SQB G;  1NKZ B;  1OW6 A;  1GL2 A;  2WWW A;  1EZV G;  4GOE A;  1Y8A A;  1PPJ G;  3TGU D;  5GTH H;  1KQL A;  1BCC G;  2W6B A;  3H1J G;  1M8O B;  1JMB A;  3VMX A;  5AVY B;  3HE4 B;  2FYU D;  2UWJ E;  4TT3 H;  1S9K D;  4C46 A;  1YJ9 P;  1IO4 A;  1H0T B;  1VQ8 P;  2Z5I A;  3AE7 C;  1ZP0 C;  1VQL P;  1SFC D;  2IDB A;  4W7Z A;  5AVZ B;  1TU3 F;  4WWI A;  1W5C E;  1QL2 A;  1T2K C;  1IFN A;  3TNU A;  4I1L A;  2A06 G;  4IL6 E;  5KLI B;  2HR3 A;  1K9M Q;  4U7J A;  1YIJ P;  2FYN B;  2ZYG A;  1LT9 B;  4ZKP A;  2M3B A;  4W7Y A;  3V6I A;  3CC2 P;  1HJ0 A;  2WSF H;  2LXC B;  4HJG H;  1YJW P;  1JY2 P;  2H8P D;  5CCG D;  3I56 P;  2QJP B;  3EQ2 A;  3HTK B;  1VQ5 P;  3FGA D;  3CX5 I;  1A02 F;  2E75 C;  1LTJ A;  4BRY B;  1M1K Q;  4EIJ A;  4HYT B;  1LTS C;  2NPS C;  2WQY C;  5CBN A;  3CCL P;  1X22 A;  4KJM A;  3MIW A;  5AVQ B;  3MUD C;  1HH0 A;  1JY3 N;  4H0L D;  1PP9 D;  1WMK A;  4IL6 X;  2IBZ D;  3H1L E;  4C7R A;  1IFJ A;  4ASW A;  1QEX A;  3M91 A;  2IZ1 A;  2N1T A;  1URQ D;  3H1L J;  2Q6Q A;  3WU2 H;  1S1C X;  2LXB A;  2ZXX A;  3MGN A;  1Q81 Q;  3P8M C;  4PD4 H;  1P84 E;  1SQQ K;  2GUV A;  3GHG A;  3L73 E;  2M5A A;  3CI9 A;  1SQQ E;  4QMA A;  2BEZ F;  1RE3 C;  4I7Z B;  1SP4 A;  1NJI Q;  1VL2 A;  2WSE J;  1SQQ J;  2JJL A;  1BGY G;  3JSV C;  1GK6 A;  2OYI A;  1CI6 A;  2XU6 A;  3H1K J;  3KZI H;  2V7Q H;  1OX3 A;  2OQQ A;  5AW0 B;  2R5B A;  1RE4 A;  1MKM A;  3HD7 C;  5BU8 B;  3JCU H;  4H0L B;  3SFE C;  1NWQ A;  3TGU E;  2H7H A;  2E5Y A;  2QJK B;  5KLV K;  3IAO A;  1KZU B;  1VQ6 P;  3CMA P;  1BE3 D;  2FYU E;  1N7S A;  2R5D A;  3TGU J;  1S9K E;  3VMY A;  1LP1 B;  2HLO A;  3I55 P;  4L76 A;  1GL2 C;  5KLV J;  2FYU J;  5H2F H;  3ZDM A;  2HPC A;  1FC2 C;  3SWF A;  1Q7Y Q;  4DT0 A;  2AXT E;  1M7L A;  2H88 C;  1VQP P;  1M1J A;  2NPS D;  2A06 D;  4PJ0 H;  3GF7 A;  3D6Z A;  5KAF H;  2KI7 B;  2C0X A;  3TYY A;  3L75 D;  1JY2 N;  1L2P A;  3RK2 C;  2Y0D A;  3PP5 A;  1N2D C;  3NTN A;  1AQ5 A;  1FS0 E;  3M0D A;  3VMZ A;  3D70 A;  1G2C A;  4R4M A;  1L0N D;  1ZR4 A;  1BDD A;  1YJN P;  2M3E A;  1LTI C;  4C7N B;  1VQK P;  2AXC A;  1RHZ B;  2YMY A;  1CZQ A;  2C0W A;  1KFM A;  3C8V A;  3H1L G;  1E79 H;  3EFG A;  2WSC H;  2IBZ E;  1JEK A;  3PRJ A;  1M57 D;  1OXZ A;  2ZFC A;  4Y28 J;  4N78 D;  3GLM A;  1PP9 J;  1NTZ K;  2NPS B;  3Q2Y A;  2POH A;  5TIS H;  1GU5 A;  3HD7 D;  1QLE D;  3CCQ P;  2O01 H;  1SQQ G;  3CXH D;  3CX5 D;  1AV1 A;  2AEF A;  3OW2 O;  2QM8 A;  3H1K G;  1Q2N A;  2RMZ A;  1R5S A;  3SWK A;  1W2E A;  2N1T C;  2PRR A;  3LW5 H;  1KB9 H;  2V4H A;  1GL2 D;  3BCC D;  2K88 A;  4U3F E;  2OYH A;  1Z56 A;  2HFE D;  1SQB E;  2WSF J;  3VOP A;  1SQV D;  3GHG C;  4OGQ C;  3K5B A;  2VRS A;  3W67 A;  2QA4 P;  1HWT C;  2AEJ A;  4IFM A;  2WT7 A;  3TGU G;  3H1J E;  4XA4 A;  1CW5 A;  5KLV G;  2FYU G;  1SVF A;  3RK2 D;  1BE3 E;  2HYN A;  2W6A A;  2OYI C;  4GOD A;  1ZLL A;  3HRN A;  1VQ7 P;  1UIX A;  3CCU P;  3L71 J;  3V2N A;  3B5N A;  1NO4 A;  1EXI A;  1BE3 J;  1RE4 C;  4IFD K;  2JP3 A;  2N9B A;  2FXP A;  1WRG A;  3P8C D;  1HF9 A;  1NTM D;  3W68 A;  4ASV A;  1RH5 B;  2HG5 D;  5KAI E;  3L36 A;  1J1D C;  3U1C A;  1RF1 B;  2A06 E;  3N7N A;  1MFT A;  1N7S C;  3G3Z A;  5AVU B;  3MHV A;  2QSI A;  1KV4 A;  3L75 E;  2P1J A;  4YXW H;  4I2L C;  3IF4 A;  1PIX A;  2B9B A;  2RN0 A;  2QJY B;  1JM0 A;  3L75 J;  1L0N K;  1LNQ A;  1IZN B;  3KQG A;  1T8Z A;  1M1J C;  2E43 A;  2KZI A;  2J5U A;  1OWA A;  2V7Q J;  1FZC A;  2E42 A;  1KYO H;  1L0N J;  2IZ0 A;  2RH0 A;  1SLQ A;  2L5G B;  3H1H D;  3M0D C;  1RY3 A;  1PP9 G;  2IBZ G;  1Y47 A;  2N1T D;  4Z1M H;  1S4X A;  1NHL A;  3TNU B;  1ZR2 A;  3VYI A;  1AVY A;  1JY3 O;  5KKZ C;  1H88 A;  4N78 E;  1ZOY C;  3BRV B;  4HKZ H;  1OW7 A;  2W8Z A;  3M0A A;  5AW3 B;  3EFF K;  1FE6 A;  3GG2 A;  4JBZ A;  2QE7 H;  3CXH E;  3CX5 E;  3VTP C;  1T3U A;  3L74 J;  2KB7 P;  3CL3 D;  2CPB A;  2KP8 A;  4PD4 I;  1KIL A;  1LTJ B;  1NTK K;  2P2U A;  2B87 A;  2K9J A;  3UIA A;  5KJ7 C;  3AEA C;  5L8R J;  3BCC E;  1SQV K;  2HOD A;  4RKU J;  1LWU A;  1K05 A;  1SQV E;  4HB1 A;  3BCC J;  3AEC C;  4WBA A;  1DIP A;  3D6Y A;  1N7S D;  1SQV J;  3FX0 A;  4A7P A;  2N1T B;  3Q5S A;  1N7L A;  2PFX A;  2YO3 A;  3L71 G;  5KLV D;  3KHU A;  1ZW0 A;  1BE3 G;  2BAS A;  3TDK A;  2LR2 A;  4DOJ A;  4KT0 J;  3B8E B;  2OYH C;  3GHG B;  1S5L H;  2M5A B;  1HVV A;  1G1I A;  2Q7C A;  2ZJS E;  2WTY A;  1HJB A;  1NTM K;  5APW A;  3A0B H;  3P8C E;  3L70 D;  3RK3 C;  1YYC A;  2YXR B;  4WY4 B;  4JPZ B;  2K37 A;  1BDC A;  3H6P A;  1AVO A;  2WIT A;  3AE3 C;  3NXS A;  1NTM J;  2I8D A;  3L75 G; 
#chains in the Genus database with same CATH homology
 5GTI E;  1S5L E;  5TIS E;  2AXT E;  5KAF E;  5GTH E;  3JCU E;  1W5C E;  5H2F E;  5E79 E;  3A0H E;  5KAI E;  3KZI E;  4IL6 E;  5B5E E;  4UB6 E;  5B66 E;  3A0B E;  4UB8 E;  3WU2 E;  4PJ0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...