5GTIE

Native xfel structure of photosystem ii (two flash dataset)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem II D1 protein
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
total genus 21
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5gtiE00
4PJ0E 3A0BE 4UB8E 5TISE 5KAIE 5GTHE 4UB6E 5B66E 5GTIE 1W5CE 5E79E 2AXTE 5H2FE 5KAFE 4IL6E 5B5EE 3A0HE 3KZIE 1S5LE 3WU2E 3JCUE
chains in the Genus database with same CATH superfamily
1YJWP 2O01J 2FYUG 3L36A 2OYIC 5AVQB 5KLVE 2FYZA 3KQGA 4IL6E 3CCQP 1NTMK 3HE4A 3KYQA 1SQBJ 1JCDA 3A0HE 5AW8B 1W2BO 3C9IA 2FFDA 3TGUD 1BE3D 3R4YA 2P10A 4OWFA 2HODB 3H1ID 2ZYDA 1VQOP 3WUVA 1KC8Q 5TISH 5AVRB 3G3ZA 2K37A 3CC2P 2WSEH 2J58A 2K3RA 3KZIE 3NTNA 1JY3N 1N7LA 2R44A 4W7YA 1LP1B 1SFCB 4L73A 2XNXA 2QM7A 1H88A 1FDOA 5BVZA 2IBZD 5AW1B 3PHLA 1PV3A 1KILE 2JWDA 2OQQA 3L71J 3L71E 1NAYA 4ZNCA 1PP9G 3O6QA 1N86A 1SQQD 1L0LD 5BU8B 1H8AA 1JCCA 2BCCD 1SQXG 5CJ0A 1NTZK 1XTGB 3A7OA 4QMAA 1NKNA 1OFCX 2E75C 1JY3O 1JB0J 3NFQA 2HODA 3M9QA 3VYIA 3I5CA 3ZDMA 1VQLP 2ITAA 3OW2O 1KTMA 1N8RQ 3RK3D 1LTGC 1HGZA 2QSIA 2N9YB 4I2LC 1LP1A 1SFCA 1Q2NA 3M91A 4UB6H 1MZ9A 5CBOA 2YKPA 1LT9C 3PRJA 4N78E 3PTZA 2YMKA 2QJPB 3C8VA 1QVGO 1GMJA 1RQVA 1G1IA 1T2KC 2Y9ZA 3KDPB 3M0DC 1T3UA 5KKZC 2Z5IA 1YI2P 3L72J 3L72E 1N7SC 5AVXB 2A45I 2RMZA 4EYYQ 2QE7H 2D2CB 4GT1A 1OVRA 2JKVA 1IFDA 3CMEP 4DCKA 1YQ4C 2R3CA 1M56D 4PV1D 4NPDA 3A5TA 5KLIC 5KAIH 1NTKK 1L0NE 5H2FH 2E76C 1LTTC 2M3EA 4O9BA 1KFMA 3LW5J 4JPZB 1FU1A 1P84D 3FXEA 5GTHH 1RF1B 3CX5E 5CCHA 2WPQA 1URQC 1ZR4A 3T97A 3TGUJ 3TGUE 1BE3J 1BE3E 1SS1A 2A06E 2R5DA 4Z1MH 2WSEJ 3H1IJ 1GW4A 5AW6B 4DT0A 5KLVK 1FS0E 1YYCA 4HB1A 3B5NA 1JMMA 4AQRD 3GLMA 4D6TG 3PH0A 3BVHA 2ZT9D 1LTAC 4YXDC 1FJKA 3MTUE 2NPSD 2ZYAA 1U7JA 2PGDA 4OGQD 2ZVNB 2Y0CA 2IBZE 1M1JC 5CCGD 3I56P 1N73C 4IFMA 3U59A 4PD4I 2R32A 3GHGC 4OH8B 3G6EP 1SQQJ 1SQQE 4M3LA 3AEEC 1YJ9P 1PPJG 4KJMA 2P7JA 3U1AA 2BCCJ 2BCCE 1K04A 1KB9I 3MP7B 3CD6P 1T8ZA 1L2PA 3M9BA 1ZRTE 5B66H 5CBNA 2M0BA 2NPSB 4Y99C 4NPEA 4OGQB 3UIAA 4WY4C 2H7HA 1RF0C 1M57D 3HD7D 1NTMG 3KXDA 3RK3E 3IR9A 3A0BE 2FYUD 1IJDB 4GOFA 5APQA 2POHA 1OW7A 1IO4A 1JOCA 1BSHA 4L75A 1E79H 1QL2A 2CPBA 1GL2D 2OYHC 4LGDE 3S1KA 3ABVC 2E74C 2ZFCA 3EFGA 1OXZA 3RL0D 2K9JB 3CWBG 3GF7A 1SQVD 4RJTA 3USSA 3TK1A 1JO5A 3RK2D 1QL1A 1KILC 3MHVA 1FZCC 1AVOA 2KIKA 1QEXA 2PAJA 3HD7B 1KORA 1NO4A 4UB8H 3S4RA 1R8EA 2NPSA 5CHXA 1JY2N 2B89A 4XA4A 2C0XA 4ASWA 2P1JA 2FYNB 1NTZG 3WU2E 1GL2B 2K9YA 3CCRP 1AJYA 3L75G 3L70G 2JEEA 3P8CD 3V2PA 2FFDC 1EDLA 2G8YA 3AE1C 2H89C 3HTKB 2E5TA 1USEA 4PD4H 2SPZA 3RL0B 1P84E 1SQXD 1A02F 1FC2C 3F89A 3SWFA 1BSNA 1HF9A 5K5GB 1L0NK 1A02J 3EFFK 1KB9H 1ZN5A 4WWIA 3AEDC 3TSIA 1LWUA 3H1KG 3JSVC 4XE5B 2WSFJ 3LIEA 4IFFA 3OJAB 1OW6A 2W27A 1KQSO 3VN0A 2IYOA 3L74G 5B5EH 1OW8A 1VPCA 2IDBA 2RKLA 1HBWA 3HD7A 5KJ7C 2YKOA 2WPRA 3HUSC 2Q3EA 1K9MQ 1N2DC 4W80A 2FBWC 2K88A 1S3JA 1DEBA 1GL2A 2PP6A 5AVSB 3HTKA 2KP8A 1EXIA 1EQ7A 2W8ZA 3CCLP 1UIXA 3RBZA 1YJNP 1EZVG 1IFPA 1BGYG 1SLQA 3Q3DA 3VTPC 2W90A 3CI9A 1EDIA 1NTKG 2LXCB 2Z5HA 2HLOA 3CXHH 4EOTA 1BDCA 1FDIA 1R5LA 2YXQB 3S9OA 5E79E 3QWOC 5DJUB 2GUVA 3MGNA 2XNDH 2WSCJ 4HKZH 1NGMB 5AVTB 1VF5D 1PGPA 4U3FD 1LJ2A 1SFCD 5APYA 3O6QB 2FYUJ 1KQGB 1S2EA 2V4HA 3NMDA 1Q7YQ 5KAFH 2RN0A 2FKWB 2K1AA 1OVUA 1SQBE 3SWKA 3JCUE 5KLVG 1HWTC 2Q5UA 1VDFA 3GW6A 3L73D 3Q5PA 1FZEA 1IFMA 3P7KA 1SQVJ 1SQVE 2KB7P 1HJBA 2C9NY 1SP4A 1RE3A 2YMYA 2W6AA 3CCMP 4UB8E 1VF5B 4R4LA 4D6TD 1LTJB 2OARA 1WRGA 4N3YB 4DZOA 2AXTH 1JNMA 1MKMA 1BCCD 2E43A 3E7KA 3MUDA 3PLNA 2V7QJ 3SFDC 1ZP0C 3H1LD 1GW3A 3TYYA 1X0TA 3P8CE 1FJPA 5CCHD 3L71G 3GG2A 4L74A 1JTHB 3RK3C 3P8MC 1X22A 3CCEP 4IOIH 1HJ0A 1G1JA 2OYIB 3BCCD 1UIIA 3E1IA 1HUCA 1AQTA 4GIFA 3VOPA 2D2CD 1JY2P 1S1CX 4WBAA 3B5ND 1CI6A 4RESB 1IC2A 2NZ2A 5APVA 1LTJA 2QJKC 3OAKA 2KS1A 5GTIE 2M8RA 1RF1C 1ZW0A 3VP8A 1FAVA 2E75D 5KTBA 1FOSF 2I1JA 2N1TC 1FOSE 2IZ0A 3TF5A 3AEFC 1YQ3C 2WITA 4BRYB 3T97B 3LIDA 2O01N 4PV1C 3CWBD 2I8DA 2LR2A 3H1JD 3B8EB 1JTHA 1FZFA 2Q9IA 1EZVI 1PFIA 5AVUB 3B5NB 2OYIA 3L72G 1MUUA 3K5BA 3RL0g 3D71A 3SFEC 5AW0B 5AW7B 2E75B 3BRTB 1JEKA 3A3YB 4AYCA 4I1LA 4A7PA 2L91A 1T2KD 1L0NG 3L75D 1IFJA 3L70D 3IAOA 1KYOI 4U3FJ 4U3FE 1GK4A 1PGQA 2QM8A 1FBMA 3TNUB 1J1EB 3ITKA 3N7NA 3D70A 3AE9C 4W7ZA 1OZHA 1LNQA 3OA7A 3IFMA 1BDDA 2QVAA 4EI2A 5AVWB 4BRYA 5TISE 2WTYA 1S9KD 1RE4C 3H1IE 1L4AD 3A2AA 3SWYA 2ZT9C 3L73J 3L73E 2NPSC 4KT0J 1QVFO 5AW3B 1GZLA 1LT9B 4OGQC 1BE3G 3TGUG 2A06G 3AE2C 3L74D 1RH5B 1QGKB 1SQBK 1YHQP 3R2PA 1Z56A 2Q3IA 1IZNB 5CCGC 4H44D 1PL5A 1SVFA 3V2RA 3H1HD 4D6TJ 1KMIZ 5KKZB 1VQ4P 1OWAA 5TJHA 4BXLA 3WUUA 4RO0A 1T3JA 1SQVK 1BCCJ 1BCCE 5EFWB 3Q5SA 2QRXA 3MZWB 4H0LC 1VQ7P 1TU3F 5KLIB 3H1LJ 3H1LE 1FDMA 3TNUA 3C1LA 2M5AB 1HVVA 2IBZG 1D7MA 2E76B 1L0LJ 1L0LE 3CMAP 1BGYD 1L4AB 2BEZF 1SQPD 2OTJP 1S5LH 1PGOA 2WT7B 1NU1D 1AQ5A 1Y47A 2BCCG 2JP3A 2W6BA 3PP5A 1EXJA 2JWAA 4H44B 1PGJA 1YIJP 4K3AA 2KLUA 1IK9A 3KPEA 4I7ZB 4CPGA 1LT9A 3BCCJ 3BCCE 1IFNA 1S72P 4H13D 2FYNC 1KYOD 1LGHB 5AVYB 3M9HA 4UB6E 1KYOH 3VMZA 3M0DA 3W68A 3W67A 3II6A 5AW5B 1N7SA 3I55P 3IF4A 2IX7C 5L8RJ 3AE3C 3JC22 1JM0A 3RK2C 2E42A 1H0TB 2LXBA 1W2EA 5KLVD 2XZRA 2R5BA 2O01H 2M5AA 4ZMDA 1U57A 1NYHA 1LWUB 3Q5RA 3CL3D 4WY4D 1L4AA 1RQUA 4IL6H 3CWBJ 3CWBE 2AEJA 3CC4P 1M1JB 1VL2A 1S5LX 3A0HH 4H13B 2WT7A 3H1JJ 3H1JE 3CXHI 1AVYA 5KAIE 1JMBA 4OVNF 4WVZA 3U1CA 1W5CE 2Y0EA 5H2FE 3AE5C 3VMXA 2FXOA 5BU5A 3V6IA 2E74D 4GDOA 4PD4D 3IN6A 3KZIH 4YXWH 4IFDK 4I6MC 5GTHE 1PP9D 3AE7C 2ZAEB 2J59M 3L75J 3L75E 3L70J 3L70E 1GK6A 1HTLC 1NAFA 4U7JA 1KB9D 1ZMEC 1JUNA 5CMZA 1H0TA 1J1DC 4WY4B 1GD2E 1QLED 2KLVA 3F5HA 4EDFA 1EDJA 3AEAC 3WMM0 3CX5I 2YO3A 5DJTB 1JY2O 1S9KE 4IL6X 4JBZA 2OYHB 4YTPC 1M1JA 2QJYC 3MUDC 2E74B 4EIJA 1Q86Q 1ZLLA 1M7LA 3CC7P 2YXRB 2M3BA 3L74J 4GODA 3CCVP 4JF7A 1OVVA 3AE8C 3H1HJ 3H1HE 2B88A 1KQLA 4ASVA 4JQ0D 2E5YA 1GU4A 4XFJA 3VMAA 1Y9BA 2YIUB 1DIPA 1CW5A 2KXPB 4WY4A 3CXHD 3EQ2A 2CK3H 4DJGA 2GM4A 2IBZI 1BGYJ 1BGYE 5KJ7D 1SQPJ 1SQPE 1DD4A 1VF5C 4N6JA 4HYTB 2A45G 1LTJC 5B66E 1SFCC 2Q1KA 1NU1J 1NU1E 1OX3A 5CJ4A 1RY3A 2OYHA 1SQQK 3RBXA 1L0LK 2AXCA 1CSBA 2KZJA 1PIXA 4TT3H 1L0ND 3B71A 1M8OB 2FYUE 1LTIC 2DW3A 1Q90D 1FZCA 3CX5D 2C0WA 3LW5H 2YKQA 3HUSB 5AW2B 3HE5B 1WT6A 2WVRA 2VRSA 1SQBG 1NOHA 5KLVJ 2WPSA 3CX5H 1Y8AA 1NVOA 3VMYA 1K73Q 1YITP 3EWKA 3D6ZA 3L35A 2A06D 3FGAD 2KNCB 2JO1A 1Q82Q 4WB4A 1CI6B 2GA1A 1XTCC 2P67A 1SQVG 5M1BA 4HH2A 3RGUA 2KS1B 1GDTA 1ZXGA 3QH9A 1GTWA 2PFXA 5CCHC 2ZJSE 2JR8A 1KQFB 3Q2YA 2B87B 3D6YA 4PD4E 2QJPC 4PJ0H 1PP9J 1PP9E 3E1RA 3CLQA 2WPVB 1PPJD 2KUBA 4AUWA 1KB9E 1SQXJ 1SQXE 1ZOYC 2D2CC 1EDKA 1FZAA 5KJ7A 3HUSA 3B5NC 3HE5A 3P32A 1P84I 2KSEA 3HRNA 1VQ5P 2NRGA 1YTZT 5B5EE 1FZGA 4C46A 2ZVOB 2KNCA 1ZRTD 3V4WA 2KZIA 1RHZB 1U7MA 1NH4A 1NTMD 4LC1A 3V2NA 4ZKUA 1J1EC 4L76A 3CPWO 1USDA 3H6PA 2IFNA 1ZV8A 2B87A 3NXSA 2CPSA 1HH0A 2N9BA 3A0BH 2QA4P 1KD1Q 2IYPA 2QG4A 3FX0A 4HJGH 1DD3A 1VQPP 2W6JH 2KYVA 3CXHE 1KFNA 3GF3A 1EC5A 2H43A 2N1TD 1KV4A 3RK3B 3V2QA 1NTZD 3MIWA 1LTBC 2ZYGA 2HFED 2WMMA 1M1KQ 1SQPK 2HG5D 3FWLA 2FY8A 1L0NJ 1N7SD 5KAFE 1NU1K 1L4AC 3GMAA 2WZ7A 4U3FG 3FXDA 2AEMA 3WU2H 3SSUA 2QJKB 3AE6C 3AEBC 4B86A 2MKVA 3Q1MA 2E76D 4H44C 3H1KD 1DH3A 4I7ZC 1P84H 2YNYA 2IFMA 2QIWA 5C39A 2L5GB 2FYUK 2N1TB 1YTZI 3H1IG 1HGVA 4GKGA 3L73G 3PJSK 1NKZB 1R5SA 3M0AA 1OIPA 4PV1B 2AXTE 2WSFH 1LT1A 1GU5A 3N4XA 4D6TE 1URQD 1CZQA 1FZBA 1N7SB 1AA0A 2JDIH 3V5BA 1VQ8P 4PJ0E 2I1KA 3KHUA 1DEEG 3CCJP 3BRVB 1LWUC 4ZKPA 1WMKA 2J5UA 4MN4C 1BCCG 1VQ9P 1EZVD 4C7NB 2W83C 3O8ZA 3H1LG 1PPJE 4H13C 4Y28J 1NTKD 4RKUJ 1SQQG 1L0LG 1ZR2A 5AVVB 1RF1A 4GOEA 3HD7C 3AECC 1NHLA 3BASA 3WUTA 1G2CB 1Q81Q 3H32B 2N1TA 2G3AA 2A45H 1URQB 1X8YA 4H0LD 2OYOA 4K35A 1GL2C 3M06A 1SQXK 2BEQD 1JY3P 3BCCG 1KZUB 1NTMJ 1NTME 2ZT9B 3RL0C 3L4FA 5E79H 2P58A 2Q6QA 1YBKA 1LTSC 3BATA 2BASA 2WSCH 1E5WA 1IFIA 1VQKP 2Y9YA 2XV5A 2LKMA 1SQBD 2P2UA 2FXPA 3G4SP 4C7NA 1FE6A 2XU6A 4R4MA 3CCUP 4BWNA 2KI7B 1N73B 4H0LB 3JCUH 5APSA 2WWWA 2B9BA 3GHGB 2GUSA 3B4SA 1G2CA 1H89A 2OTKE 1AV1A 5APXA 1MFTA 3H32A 3H1JG 2O3JA 1URQA 2XDJA 4JYBA 3AEGC 3G9RA 5AW9B 1K05A 2Z4EA 1KN7A 1NTZJ 1NTZE 2FXMA 3H25A 1RE4A 3FWNA 2YIUC 4KHXA 2KOGA 1KILD 1X79B 2R3SA 2UWJE 4Y99B 3G71P 2HR3A 3L71D 5AVZB 2C9LY 1T6AA 1RE3C 2V7QH 5CCGA 3V4QA 2XKMA 1AFOA 2JJLA 2O1JA 5AW4B 4JYCA 2HPCB 1K8AQ 3H1KJ 3H1KE 4NPFX 2PRRA 5APTA 3RK2B 1MFZA 1M90Q 1N73A 1NWQA 1VQ6P 2IZ1A 4TLFA 2QEXP 2H8PD 1DX7A 2K9JA 2OTLP 2HYNA 3L74E 3GHGA 3MD0A 2YO2A 5APUA 1OMIA 1NJIQ 2IPPA 1X9VA 4DOJA 2KSJA 3AE4C 1KILB 1VQNP 1FZCB 5APWA 2ZXEB 2ZXXA 2RH0A 2H88C 3H1HG 2WSSH 5GTIH 2OGUA 3L37A 4YPCA 3HE4B 4N78D 1RF0A 1S5LE 1MV8A 1EZVE 1IK7A 2FFDB 1NTKJ 1NTKE 3L72D 3CCSP 2HPCA 3VP9A 1QX8A 2O1KA 1SQPG 4LLHA 1J2JB 1J1DB 1S4XA 1VQMP 1NU1G 1PZQA 2Q7CA 2KK7A 2WQYC 1KYOE 2MJZA 2AEFA 3TDKA 2Y0DA 4C7RA 2QJYB 1KILA
chains in the Genus database with same CATH topology
4PJ0E 3A0BE 4UB8E 5TISE 5KAIE 5GTHE 4UB6E 5B66E 5GTIE 1W5CE 5E79E 2AXTE 5H2FE 5KAFE 4IL6E 5B5EE 3A0HE 3KZIE 1S5LE 3WU2E 3JCUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJ0 E;  3A0B E;  4UB8 E;  5TIS E;  5KAI E;  5GTH E;  4UB6 E;  5B66 E;  5GTI E;  1W5C E;  5E79 E;  2AXT E;  5H2F E;  5KAF E;  4IL6 E;  5B5E E;  3A0H E;  3KZI E;  1S5L E;  3WU2 E;  3JCU E; 
#chains in the Genus database with same CATH topology
 1YJW P;  2O01 J;  2FYU G;  3L36 A;  2OYI C;  5AVQ B;  5KLV E;  2FYZ A;  3KQG A;  4IL6 E;  3CCQ P;  1NTM K;  3HE4 A;  3KYQ A;  1SQB J;  1JCD A;  3A0H E;  5AW8 B;  1W2B O;  3C9I A;  2FFD A;  3TGU D;  1BE3 D;  3R4Y A;  2P10 A;  4OWF A;  2HOD B;  3H1I D;  2ZYD A;  1VQO P;  3WUV A;  1KC8 Q;  5TIS H;  5AVR B;  3G3Z A;  2K37 A;  3CC2 P;  2WSE H;  2J58 A;  2K3R A;  3KZI E;  3NTN A;  1JY3 N;  1N7L A;  2R44 A;  4W7Y A;  1LP1 B;  1SFC B;  4L73 A;  2XNX A;  2QM7 A;  1H88 A;  1FDO A;  5BVZ A;  2IBZ D;  5AW1 B;  3PHL A;  1PV3 A;  1KIL E;  2JWD A;  2OQQ A;  3L71 J;  3L71 E;  1NAY A;  4ZNC A;  1PP9 G;  3O6Q A;  1N86 A;  1SQQ D;  1L0L D;  5BU8 B;  1H8A A;  1JCC A;  2BCC D;  1SQX G;  5CJ0 A;  1NTZ K;  1XTG B;  3A7O A;  4QMA A;  1NKN A;  1OFC X;  2E75 C;  1JY3 O;  1JB0 J;  3NFQ A;  2HOD A;  3M9Q A;  3VYI A;  3I5C A;  3ZDM A;  1VQL P;  2ITA A;  3OW2 O;  1KTM A;  1N8R Q;  3RK3 D;  1LTG C;  1HGZ A;  2QSI A;  2N9Y B;  4I2L C;  1LP1 A;  1SFC A;  1Q2N A;  3M91 A;  4UB6 H;  1MZ9 A;  5CBO A;  2YKP A;  1LT9 C;  3PRJ A;  4N78 E;  3PTZ A;  2YMK A;  2QJP B;  3C8V A;  1QVG O;  1GMJ A;  1RQV A;  1G1I A;  1T2K C;  2Y9Z A;  3KDP B;  3M0D C;  1T3U A;  5KKZ C;  2Z5I A;  1YI2 P;  3L72 J;  3L72 E;  1N7S C;  5AVX B;  2A45 I;  2RMZ A;  4EYY Q;  2QE7 H;  2D2C B;  4GT1 A;  1OVR A;  2JKV A;  1IFD A;  3CME P;  4DCK A;  1YQ4 C;  2R3C A;  1M56 D;  4PV1 D;  4NPD A;  3A5T A;  5KLI C;  5KAI H;  1NTK K;  1L0N E;  5H2F H;  2E76 C;  1LTT C;  2M3E A;  4O9B A;  1KFM A;  3LW5 J;  4JPZ B;  1FU1 A;  1P84 D;  3FXE A;  5GTH H;  1RF1 B;  3CX5 E;  5CCH A;  2WPQ A;  1URQ C;  1ZR4 A;  3T97 A;  3TGU J;  3TGU E;  1BE3 J;  1BE3 E;  1SS1 A;  2A06 E;  2R5D A;  4Z1M H;  2WSE J;  3H1I J;  1GW4 A;  5AW6 B;  4DT0 A;  5KLV K;  1FS0 E;  1YYC A;  4HB1 A;  3B5N A;  1JMM A;  4AQR D;  3GLM A;  4D6T G;  3PH0 A;  3BVH A;  2ZT9 D;  1LTA C;  4YXD C;  1FJK A;  3MTU E;  2NPS D;  2ZYA A;  1U7J A;  2PGD A;  4OGQ D;  2ZVN B;  2Y0C A;  2IBZ E;  1M1J C;  5CCG D;  3I56 P;  1N73 C;  4IFM A;  3U59 A;  4PD4 I;  2R32 A;  3GHG C;  4OH8 B;  3G6E P;  1SQQ J;  1SQQ E;  4M3L A;  3AEE C;  1YJ9 P;  1PPJ G;  4KJM A;  2P7J A;  3U1A A;  2BCC J;  2BCC E;  1K04 A;  1KB9 I;  3MP7 B;  3CD6 P;  1T8Z A;  1L2P A;  3M9B A;  1ZRT E;  5B66 H;  5CBN A;  2M0B A;  2NPS B;  4Y99 C;  4NPE A;  4OGQ B;  3UIA A;  4WY4 C;  2H7H A;  1RF0 C;  1M57 D;  3HD7 D;  1NTM G;  3KXD A;  3RK3 E;  3IR9 A;  3A0B E;  2FYU D;  1IJD B;  4GOF A;  5APQ A;  2POH A;  1OW7 A;  1IO4 A;  1JOC A;  1BSH A;  4L75 A;  1E79 H;  1QL2 A;  2CPB A;  1GL2 D;  2OYH C;  4LGD E;  3S1K A;  3ABV C;  2E74 C;  2ZFC A;  3EFG A;  1OXZ A;  3RL0 D;  2K9J B;  3CWB G;  3GF7 A;  1SQV D;  4RJT A;  3USS A;  3TK1 A;  1JO5 A;  3RK2 D;  1QL1 A;  1KIL C;  3MHV A;  1FZC C;  1AVO A;  2KIK A;  1QEX A;  2PAJ A;  3HD7 B;  1KOR A;  1NO4 A;  4UB8 H;  3S4R A;  1R8E A;  2NPS A;  5CHX A;  1JY2 N;  2B89 A;  4XA4 A;  2C0X A;  4ASW A;  2P1J A;  2FYN B;  1NTZ G;  3WU2 E;  1GL2 B;  2K9Y A;  3CCR P;  1AJY A;  3L75 G;  3L70 G;  2JEE A;  3P8C D;  3V2P A;  2FFD C;  1EDL A;  2G8Y A;  3AE1 C;  2H89 C;  3HTK B;  2E5T A;  1USE A;  4PD4 H;  2SPZ A;  3RL0 B;  1P84 E;  1SQX D;  1A02 F;  1FC2 C;  3F89 A;  3SWF A;  1BSN A;  1HF9 A;  5K5G B;  1L0N K;  1A02 J;  3EFF K;  1KB9 H;  1ZN5 A;  4WWI A;  3AED C;  3TSI A;  1LWU A;  3H1K G;  3JSV C;  4XE5 B;  2WSF J;  3LIE A;  4IFF A;  3OJA B;  1OW6 A;  2W27 A;  1KQS O;  3VN0 A;  2IYO A;  3L74 G;  5B5E H;  1OW8 A;  1VPC A;  2IDB A;  2RKL A;  1HBW A;  3HD7 A;  5KJ7 C;  2YKO A;  2WPR A;  3HUS C;  2Q3E A;  1K9M Q;  1N2D C;  4W80 A;  2FBW C;  2K88 A;  1S3J A;  1DEB A;  1GL2 A;  2PP6 A;  5AVS B;  3HTK A;  2KP8 A;  1EXI A;  1EQ7 A;  2W8Z A;  3CCL P;  1UIX A;  3RBZ A;  1YJN P;  1EZV G;  1IFP A;  1BGY G;  1SLQ A;  3Q3D A;  3VTP C;  2W90 A;  3CI9 A;  1EDI A;  1NTK G;  2LXC B;  2Z5H A;  2HLO A;  3CXH H;  4EOT A;  1BDC A;  1FDI A;  1R5L A;  2YXQ B;  3S9O A;  5E79 E;  3QWO C;  5DJU B;  2GUV A;  3MGN A;  2XND H;  2WSC J;  4HKZ H;  1NGM B;  5AVT B;  1VF5 D;  1PGP A;  4U3F D;  1LJ2 A;  1SFC D;  5APY A;  3O6Q B;  2FYU J;  1KQG B;  1S2E A;  2V4H A;  3NMD A;  1Q7Y Q;  5KAF H;  2RN0 A;  2FKW B;  2K1A A;  1OVU A;  1SQB E;  3SWK A;  3JCU E;  5KLV G;  1HWT C;  2Q5U A;  1VDF A;  3GW6 A;  3L73 D;  3Q5P A;  1FZE A;  1IFM A;  3P7K A;  1SQV J;  1SQV E;  2KB7 P;  1HJB A;  2C9N Y;  1SP4 A;  1RE3 A;  2YMY A;  2W6A A;  3CCM P;  4UB8 E;  1VF5 B;  4R4L A;  4D6T D;  1LTJ B;  2OAR A;  1WRG A;  4N3Y B;  4DZO A;  2AXT H;  1JNM A;  1MKM A;  1BCC D;  2E43 A;  3E7K A;  3MUD A;  3PLN A;  2V7Q J;  3SFD C;  1ZP0 C;  3H1L D;  1GW3 A;  3TYY A;  1X0T A;  3P8C E;  1FJP A;  5CCH D;  3L71 G;  3GG2 A;  4L74 A;  1JTH B;  3RK3 C;  3P8M C;  1X22 A;  3CCE P;  4IOI H;  1HJ0 A;  1G1J A;  2OYI B;  3BCC D;  1UII A;  3E1I A;  1HUC A;  1AQT A;  4GIF A;  3VOP A;  2D2C D;  1JY2 P;  1S1C X;  4WBA A;  3B5N D;  1CI6 A;  4RES B;  1IC2 A;  2NZ2 A;  5APV A;  1LTJ A;  2QJK C;  3OAK A;  2KS1 A;  5GTI E;  2M8R A;  1RF1 C;  1ZW0 A;  3VP8 A;  1FAV A;  2E75 D;  5KTB A;  1FOS F;  2I1J A;  2N1T C;  1FOS E;  2IZ0 A;  3TF5 A;  3AEF C;  1YQ3 C;  2WIT A;  4BRY B;  3T97 B;  3LID A;  2O01 N;  4PV1 C;  3CWB D;  2I8D A;  2LR2 A;  3H1J D;  3B8E B;  1JTH A;  1FZF A;  2Q9I A;  1EZV I;  1PFI A;  5AVU B;  3B5N B;  2OYI A;  3L72 G;  1MUU A;  3K5B A;  3RL0 g;  3D71 A;  3SFE C;  5AW0 B;  5AW7 B;  2E75 B;  3BRT B;  1JEK A;  3A3Y B;  4AYC A;  4I1L A;  4A7P A;  2L91 A;  1T2K D;  1L0N G;  3L75 D;  1IFJ A;  3L70 D;  3IAO A;  1KYO I;  4U3F J;  4U3F E;  1GK4 A;  1PGQ A;  2QM8 A;  1FBM A;  3TNU B;  1J1E B;  3ITK A;  3N7N A;  3D70 A;  3AE9 C;  4W7Z A;  1OZH A;  1LNQ A;  3OA7 A;  3IFM A;  1BDD A;  2QVA A;  4EI2 A;  5AVW B;  4BRY A;  5TIS E;  2WTY A;  1S9K D;  1RE4 C;  3H1I E;  1L4A D;  3A2A A;  3SWY A;  2ZT9 C;  3L73 J;  3L73 E;  2NPS C;  4KT0 J;  1QVF O;  5AW3 B;  1GZL A;  1LT9 B;  4OGQ C;  1BE3 G;  3TGU G;  2A06 G;  3AE2 C;  3L74 D;  1RH5 B;  1QGK B;  1SQB K;  1YHQ P;  3R2P A;  1Z56 A;  2Q3I A;  1IZN B;  5CCG C;  4H44 D;  1PL5 A;  1SVF A;  3V2R A;  3H1H D;  4D6T J;  1KMI Z;  5KKZ B;  1VQ4 P;  1OWA A;  5TJH A;  4BXL A;  3WUU A;  4RO0 A;  1T3J A;  1SQV K;  1BCC J;  1BCC E;  5EFW B;  3Q5S A;  2QRX A;  3MZW B;  4H0L C;  1VQ7 P;  1TU3 F;  5KLI B;  3H1L J;  3H1L E;  1FDM A;  3TNU A;  3C1L A;  2M5A B;  1HVV A;  2IBZ G;  1D7M A;  2E76 B;  1L0L J;  1L0L E;  3CMA P;  1BGY D;  1L4A B;  2BEZ F;  1SQP D;  2OTJ P;  1S5L H;  1PGO A;  2WT7 B;  1NU1 D;  1AQ5 A;  1Y47 A;  2BCC G;  2JP3 A;  2W6B A;  3PP5 A;  1EXJ A;  2JWA A;  4H44 B;  1PGJ A;  1YIJ P;  4K3A A;  2KLU A;  1IK9 A;  3KPE A;  4I7Z B;  4CPG A;  1LT9 A;  3BCC J;  3BCC E;  1IFN A;  1S72 P;  4H13 D;  2FYN C;  1KYO D;  1LGH B;  5AVY B;  3M9H A;  4UB6 E;  1KYO H;  3VMZ A;  3M0D A;  3W68 A;  3W67 A;  3II6 A;  5AW5 B;  1N7S A;  3I55 P;  3IF4 A;  2IX7 C;  5L8R J;  3AE3 C;  3JC2 2;  1JM0 A;  3RK2 C;  2E42 A;  1H0T B;  2LXB A;  1W2E A;  5KLV D;  2XZR A;  2R5B A;  2O01 H;  2M5A A;  4ZMD A;  1U57 A;  1NYH A;  1LWU B;  3Q5R A;  3CL3 D;  4WY4 D;  1L4A A;  1RQU A;  4IL6 H;  3CWB J;  3CWB E;  2AEJ A;  3CC4 P;  1M1J B;  1VL2 A;  1S5L X;  3A0H H;  4H13 B;  2WT7 A;  3H1J J;  3H1J E;  3CXH I;  1AVY A;  5KAI E;  1JMB A;  4OVN F;  4WVZ A;  3U1C A;  1W5C E;  2Y0E A;  5H2F E;  3AE5 C;  3VMX A;  2FXO A;  5BU5 A;  3V6I A;  2E74 D;  4GDO A;  4PD4 D;  3IN6 A;  3KZI H;  4YXW H;  4IFD K;  4I6M C;  5GTH E;  1PP9 D;  3AE7 C;  2ZAE B;  2J59 M;  3L75 J;  3L75 E;  3L70 J;  3L70 E;  1GK6 A;  1HTL C;  1NAF A;  4U7J A;  1KB9 D;  1ZME C;  1JUN A;  5CMZ A;  1H0T A;  1J1D C;  4WY4 B;  1GD2 E;  1QLE D;  2KLV A;  3F5H A;  4EDF A;  1EDJ A;  3AEA C;  3WMM 0;  3CX5 I;  2YO3 A;  5DJT B;  1JY2 O;  1S9K E;  4IL6 X;  4JBZ A;  2OYH B;  4YTP C;  1M1J A;  2QJY C;  3MUD C;  2E74 B;  4EIJ A;  1Q86 Q;  1ZLL A;  1M7L A;  3CC7 P;  2YXR B;  2M3B A;  3L74 J;  4GOD A;  3CCV P;  4JF7 A;  1OVV A;  3AE8 C;  3H1H J;  3H1H E;  2B88 A;  1KQL A;  4ASV A;  4JQ0 D;  2E5Y A;  1GU4 A;  4XFJ A;  3VMA A;  1Y9B A;  2YIU B;  1DIP A;  1CW5 A;  2KXP B;  4WY4 A;  3CXH D;  3EQ2 A;  2CK3 H;  4DJG A;  2GM4 A;  2IBZ I;  1BGY J;  1BGY E;  5KJ7 D;  1SQP J;  1SQP E;  1DD4 A;  1VF5 C;  4N6J A;  4HYT B;  2A45 G;  1LTJ C;  5B66 E;  1SFC C;  2Q1K A;  1NU1 J;  1NU1 E;  1OX3 A;  5CJ4 A;  1RY3 A;  2OYH A;  1SQQ K;  3RBX A;  1L0L K;  2AXC A;  1CSB A;  2KZJ A;  1PIX A;  4TT3 H;  1L0N D;  3B71 A;  1M8O B;  2FYU E;  1LTI C;  2DW3 A;  1Q90 D;  1FZC A;  3CX5 D;  2C0W A;  3LW5 H;  2YKQ A;  3HUS B;  5AW2 B;  3HE5 B;  1WT6 A;  2WVR A;  2VRS A;  1SQB G;  1NOH A;  5KLV J;  2WPS A;  3CX5 H;  1Y8A A;  1NVO A;  3VMY A;  1K73 Q;  1YIT P;  3EWK A;  3D6Z A;  3L35 A;  2A06 D;  3FGA D;  2KNC B;  2JO1 A;  1Q82 Q;  4WB4 A;  1CI6 B;  2GA1 A;  1XTC C;  2P67 A;  1SQV G;  5M1B A;  4HH2 A;  3RGU A;  2KS1 B;  1GDT A;  1ZXG A;  3QH9 A;  1GTW A;  2PFX A;  5CCH C;  2ZJS E;  2JR8 A;  1KQF B;  3Q2Y A;  2B87 B;  3D6Y A;  4PD4 E;  2QJP C;  4PJ0 H;  1PP9 J;  1PP9 E;  3E1R A;  3CLQ A;  2WPV B;  1PPJ D;  2KUB A;  4AUW A;  1KB9 E;  1SQX J;  1SQX E;  1ZOY C;  2D2C C;  1EDK A;  1FZA A;  5KJ7 A;  3HUS A;  3B5N C;  3HE5 A;  3P32 A;  1P84 I;  2KSE A;  3HRN A;  1VQ5 P;  2NRG A;  1YTZ T;  5B5E E;  1FZG A;  4C46 A;  2ZVO B;  2KNC A;  1ZRT D;  3V4W A;  2KZI A;  1RHZ B;  1U7M A;  1NH4 A;  1NTM D;  4LC1 A;  3V2N A;  4ZKU A;  1J1E C;  4L76 A;  3CPW O;  1USD A;  3H6P A;  2IFN A;  1ZV8 A;  2B87 A;  3NXS A;  2CPS A;  1HH0 A;  2N9B A;  3A0B H;  2QA4 P;  1KD1 Q;  2IYP A;  2QG4 A;  3FX0 A;  4HJG H;  1DD3 A;  1VQP P;  2W6J H;  2KYV A;  3CXH E;  1KFN A;  3GF3 A;  1EC5 A;  2H43 A;  2N1T D;  1KV4 A;  3RK3 B;  3V2Q A;  1NTZ D;  3MIW A;  1LTB C;  2ZYG A;  2HFE D;  2WMM A;  1M1K Q;  1SQP K;  2HG5 D;  3FWL A;  2FY8 A;  1L0N J;  1N7S D;  5KAF E;  1NU1 K;  1L4A C;  3GMA A;  2WZ7 A;  4U3F G;  3FXD A;  2AEM A;  3WU2 H;  3SSU A;  2QJK B;  3AE6 C;  3AEB C;  4B86 A;  2MKV A;  3Q1M A;  2E76 D;  4H44 C;  3H1K D;  1DH3 A;  4I7Z C;  1P84 H;  2YNY A;  2IFM A;  2QIW A;  5C39 A;  2L5G B;  2FYU K;  2N1T B;  1YTZ I;  3H1I G;  1HGV A;  4GKG A;  3L73 G;  3PJS K;  1NKZ B;  1R5S A;  3M0A A;  1OIP A;  4PV1 B;  2AXT E;  2WSF H;  1LT1 A;  1GU5 A;  3N4X A;  4D6T E;  1URQ D;  1CZQ A;  1FZB A;  1N7S B;  1AA0 A;  2JDI H;  3V5B A;  1VQ8 P;  4PJ0 E;  2I1K A;  3KHU A;  1DEE G;  3CCJ P;  3BRV B;  1LWU C;  4ZKP A;  1WMK A;  2J5U A;  4MN4 C;  1BCC G;  1VQ9 P;  1EZV D;  4C7N B;  2W83 C;  3O8Z A;  3H1L G;  1PPJ E;  4H13 C;  4Y28 J;  1NTK D;  4RKU J;  1SQQ G;  1L0L G;  1ZR2 A;  5AVV B;  1RF1 A;  4GOE A;  3HD7 C;  3AEC C;  1NHL A;  3BAS A;  3WUT A;  1G2C B;  1Q81 Q;  3H32 B;  2N1T A;  2G3A A;  2A45 H;  1URQ B;  1X8Y A;  4H0L D;  2OYO A;  4K35 A;  1GL2 C;  3M06 A;  1SQX K;  2BEQ D;  1JY3 P;  3BCC G;  1KZU B;  1NTM J;  1NTM E;  2ZT9 B;  3RL0 C;  3L4F A;  5E79 H;  2P58 A;  2Q6Q A;  1YBK A;  1LTS C;  3BAT A;  2BAS A;  2WSC H;  1E5W A;  1IFI A;  1VQK P;  2Y9Y A;  2XV5 A;  2LKM A;  1SQB D;  2P2U A;  2FXP A;  3G4S P;  4C7N A;  1FE6 A;  2XU6 A;  4R4M A;  3CCU P;  4BWN A;  2KI7 B;  1N73 B;  4H0L B;  3JCU H;  5APS A;  2WWW A;  2B9B A;  3GHG B;  2GUS A;  3B4S A;  1G2C A;  1H89 A;  2OTK E;  1AV1 A;  5APX A;  1MFT A;  3H32 A;  3H1J G;  2O3J A;  1URQ A;  2XDJ A;  4JYB A;  3AEG C;  3G9R A;  5AW9 B;  1K05 A;  2Z4E A;  1KN7 A;  1NTZ J;  1NTZ E;  2FXM A;  3H25 A;  1RE4 A;  3FWN A;  2YIU C;  4KHX A;  2KOG A;  1KIL D;  1X79 B;  2R3S A;  2UWJ E;  4Y99 B;  3G71 P;  2HR3 A;  3L71 D;  5AVZ B;  2C9L Y;  1T6A A;  1RE3 C;  2V7Q H;  5CCG A;  3V4Q A;  2XKM A;  1AFO A;  2JJL A;  2O1J A;  5AW4 B;  4JYC A;  2HPC B;  1K8A Q;  3H1K J;  3H1K E;  4NPF X;  2PRR A;  5APT A;  3RK2 B;  1MFZ A;  1M90 Q;  1N73 A;  1NWQ A;  1VQ6 P;  2IZ1 A;  4TLF A;  2QEX P;  2H8P D;  1DX7 A;  2K9J A;  2OTL P;  2HYN A;  3L74 E;  3GHG A;  3MD0 A;  2YO2 A;  5APU A;  1OMI A;  1NJI Q;  2IPP A;  1X9V A;  4DOJ A;  2KSJ A;  3AE4 C;  1KIL B;  1VQN P;  1FZC B;  5APW A;  2ZXE B;  2ZXX A;  2RH0 A;  2H88 C;  3H1H G;  2WSS H;  5GTI H;  2OGU A;  3L37 A;  4YPC A;  3HE4 B;  4N78 D;  1RF0 A;  1S5L E;  1MV8 A;  1EZV E;  1IK7 A;  2FFD B;  1NTK J;  1NTK E;  3L72 D;  3CCS P;  2HPC A;  3VP9 A;  1QX8 A;  2O1K A;  1SQP G;  4LLH A;  1J2J B;  1J1D B;  1S4X A;  1VQM P;  1NU1 G;  1PZQ A;  2Q7C A;  2KK7 A;  2WQY C;  1KYO E;  2MJZ A;  2AEF A;  3TDK A;  2Y0D A;  4C7R A;  2QJY B;  1KIL A; 
#chains in the Genus database with same CATH homology
 4PJ0 E;  3A0B E;  4UB8 E;  5TIS E;  5KAI E;  5GTH E;  4UB6 E;  5B66 E;  5GTI E;  1W5C E;  5E79 E;  2AXT E;  5H2F E;  5KAF E;  4IL6 E;  5B5E E;  3A0H E;  3KZI E;  1S5L E;  3WU2 E;  3JCU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...