1JB0J

Crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
41
structure length
41
Chain Sequence
b'MKHFLTYLSTAPVLAAIWMTITAGILIEFNRFYPDLLFHPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM I P700 CHLOROPHYLL A APOPROTEIN A1
publication title Three-dimensional Structure of Cyanobacterial Photosystem I at 2.5 A Resolution
pubmed doi rcsb
molecule tags Photosynthesis
total genus 12
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2001-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1jb0J00
2E75B 4H0LB 1JB0J 2WSFJ 5KLIC 2QSIA 1VF5B 4H44B 4IL6X 5KKZC 2YIUC 1S5LX 4Y28J 1ZRTE 2QJYC 3C8VA 2E76B 3LW5J 4KT0J 1Q90D 2FYNC 4PV1B 5L8RJ 2WSEJ 2QJPC 2O01J 2E74B 2K9YA 2D2CB 2ZT9B 2WPVB 4H13B 2WSCJ 2QJKC 2QIWA 4I7ZB 4OGQB 4RKUJ
chains in the Genus database with same CATH superfamily
1BE3D 4H0LB 2OARA 1URQA 3PLNA 4DOJA 2IPPA 2G3AA 3IF4A 3D70A 3RK3E 1EZVD 1RF0A 1IFJA 2BCCJ 2BEQD 4WVZA 1URQB 1NJIQ 5B66H 4PD4H 3E7KA 1SQBK 1GD2E 3QH9A 3RK3B 2E74C 2FYUD 1VQLP 4JBZA 2N9YB 5AVXB 5AVTB 3HD7C 2J58A 1LTJC 5AVWB 1ZRTE 2H7HA 1L0NK 1U7MA 3CMAP 4PD4I 5AVYB 1NKZB 1SQXD 2WSEH 3M9QA 2O01H 3QWOC 3OA7A 2FYZA 1KC8Q 1KQLA 2WSCJ 1AVOA 4OGQC 3A0HE 4WY4A 3MZWB 1RF1A 3TNUA 1RE4C 3G4SP 5KLIC 1S4XA 4BRYA 1PIXA 1CI6A 3RL0g 4WY4B 2XNDH 3TNUB 2FYNC 4PV1C 1KORA 1NTMK 4BRYB 1CI6B 3H1IG 3JSVC 3H1HE 3TGUJ 1RQUA 3H1JE 1HH0A 2KSJA 3CD6P 2QSIA 3B5NC 1NTKJ 2M3BA 5CMZA 3GF3A 4BXLA 2QJYB 3U1AA 1AQTA 1T2KC 3KHUA 4ZMDA 1JY3N 3KXDA 1SQPK 4PJ0E 3TF5A 2KZIA 1PP9E 1GZLA 1Q2NA 1YQ3C 4NPDA 3Q5RA 2K3RA 1JUNA 1T3UA 4C7RA 3VTPC 2RH0A 1LGHB 2C9LY 3MGNA 3WUTA 3A3YB 3VMZA 3VOPA 1OVVA 5KTBA 1JY3P 1JO5A 1P84E 1JOCA 4Y28J 1HWTC 1K05A 1FDOA 1IC2A 5CBOA 4C7NA 1NU1E 3CCVP 3A7OA 1DX7A 2FXMA 1FZAA 3F5HA 3CX5H 1NKNA 4C7NB 3D6ZA 3TK1A 4UB6E 1NGMB 3AEAC 1NTKK 1HGVA 3SSUA 1H0TA 1KTMA 3L73E 2J59M 2QM7A 4IFDK 3RK2D 4RESB 5AVSB 3V4QA 1R8EA 2C0XA 1NTMD 2QA4P 3AE6C 3BATA 1SQVG 1H0TB 3PHLA 2YIUB 2YO3A 2XV5A 1EC5A 1DD4A 1LWUA 3L72D 1X22A 3LW5J 2JWAA 1Q86Q 5CCGC 2Y9ZA 2AEMA 3AEFC 1GMJA 1LWUB 2D2CC 2BCCD 2YXQB 4JYBA 1ZW0A 4Y99C 1YTZI 1ZR2A 4H13D 1KFMA 3H1HJ 1FZCC 3L70E 2WITA 3H1JJ 1ZXGA 2OQQA 3CXHD 1KILB 1LJ2A 4OVNF 1IFIA 4I7ZC 1S72P 1Q82Q 4R4LA 2AXCA 1N73C 1GK4A 1USDA 1PP9J 2P7JA 2KB7P 4K35A 3G9RA 2A06E 4IOIH 2KOGA 2HODA 1GU4A 2Q3EA 1X8YA 1VL2A 2HODB 3RL0B 2N9BA 3GG2A 1ZLLA 1N7SD 2O1KA 2W6JH 3R4YA 2Z4EA 1BSHA 3TGUD 1LT9C 5KLVE 1KB9D 4ZNCA 1NTKD 3TYYA 1EZVI 3SFDC 1NU1J 5CHXA 3H6PA 3L71J 1FC2C 4O9BA 1J1EC 1JNMA 2KP8A 4EIJA 4GODA 3NXSA 1OX3A 1VF5D 2KYVA 1ZMEC 2B9BA 2HR3A 3U59A 1GW3A 1L0LE 1NYHA 1L2PA 3L73J 2Q6QA 3RBZA 5KKZB 3K5BA 1IFDA 4H0LD 1VQOP 1VQMP 2Z5IA 4YPCA 3MUDA 1HJ0A 2QJKB 1URQD 1KN7A 2ZJSE 2WSFJ 3RK3D 2ZYDA 1JMMA 2WZ7A 1FZFA 3W68A 5APXA 1KD1Q 3L70J 4JQ0D 4IL6E 3CWBE 1H89A 1SLQA 2ZT9B 2MJZA 1BCCE 1NWQA 3BRVB 1L0NE 1KQFB 1FDMA 1ZRTD 3A0BE 2Q7CA 3VMXA 3PTZA 3AE2C 2R32A 4WY4D 4UB8E 1M90Q 1M56D 3TDKA 1KYOE 1SQQE 3RK2C 5KAIE 5TISE 1YTZT 3IN6A 3H1HD 5KLVJ 5AW2B 1DD3A 3H1JD 4GIFA 1X9VA 1L4AC 4HH2A 4OH8B 2M5AA 3MTUE 3L74J 4I2LC 1HGZA 3AEEC 1PGQA 2K9JA 4EI2A 1E5WA 2M5AB 1DH3A 5CJ0A 2ZXXA 3AEBC 1PP9D 2ZXEB 1OW8A 1NTZG 2PAJA 3CX5D 3LIEA 4GKGA 4XA4A 4ASVA 3M06A 2E43A 2IBZE 4ASWA 2J5UA 1P84D 1EXIA 5AW6B 1CW5A 3CXHH 2E42A 1H8AA 3KYQA 1NU1D 3M0DA 3L71D 4KT0J 1GL2A 2BEZF 3P32A 1SQBJ 1PL5A 1VQNP 2WPQA 5APSA 1CZQA 3GHGC 2WSCH 3CCSP 1GL2B 5KLVK 1N7SC 3CXHI 3CWBJ 2POHA 1BCCJ 2O01N 2XKMA 1L0NJ 2QM8A 5GTHH 3KZIH 1PZQA 3L73D 2VRSA 5CJ4A 3FGAD 1Z56A 3L71G 2ZVNB 5AW7B 2P10A 1JCCA 2ZAEB 3AE9C 5AW0B 4W80A 1RH5B 1KB9H 2O3JA 1VF5C 1M57D 3CCUP 2Q3IA 2PP6A 1L0LK 3OAKA 2W8ZA 2L91A 1WRGA 2XNXA 1SQQJ 3PRJA 1R5SA 3L70D 4H0LC 3SWFA 1KB9I 3GMAA 1EDJA 4IL6X 1YJNP 1FJKA 4AYCA 2AXTE 1PPJG 2Y0EA 3ITKA 2JJLA 1SQPJ 1JTHA 1FJPA 2KIKA 1KV4A 1SP4A 3JCUH 5DJUB 4YTPC 1BGYE 1JTHB 2A06D 1BE3G 3RL0D 3NMDA 2NPSC 3HD7A 3H25A 2E74B 1CSBA 3H1LE 1LTJA 1EZVG 3H1KE 5AVVB 5BVZA 3L4FA 4TT3H 5TJHA 3HD7B 4HKZH 1HF9A 4XFJA 1YBKA 1LTJB 1SQVK 5KLVD 3V2QA 2FYUG 3BCCE 4WY4C 1RF1B 1RE4A 2KLVA 2RMZA 1KQSO 3L74D 1RE3C 1M1JA 1VPCA 3VP9A 1SQQK 2KLUA 5KLIB 2OYHC 1SQXG 5APTA 5APVA 3KPEA 4KJMA 1M1JB 4N78E 3CCQP 3A0HH 1M1KQ 4U3FE 2GA1A 3LW5H 2E76C 3B5NA 1VQ4P 1FDIA 4L76A 2WQYC 1XTGB 1SFCA 1MZ9A 3CPWO 2W6BA 3B5NB 3L74G 5GTIE 2KI7B 1SFCB 3R2PA 5E79E 3U1CA 3S1KA 1A02J 2HPCA 2IFMA 5AVQB 3VP8A 1Y8AA 3N4XA 1ZN5A 4ZKUA 5KJ7C 2HPCB 1SQBD 2H89C 2ZT9D 2GM4A 2P67A 4PJ0H 2DW3A 4JF7A 1Y9BA 2Y0CA 3CWBD 1Q90D 3I5CA 1T8ZA 1BCCD 3VYIA 3CC2P 1L0ND 5APQA 4D6TE 4W7YA 2HFED 2YKOA 1YHQP 1KQGB 1N86A 1BGYJ 4I1LA 1YJ9P 1P84H 5KAFE 5BU5A 3L75E 2KNCA 3CX5I 3AECC 2KK7A 2KSEA 4LLHA 1BDDA 3H1LJ 3P8CD 3H1KJ 2KNCB 2YIUC 2JR8A 1KYOD 1OVUA 1SQQD 3CLQA 3WMM0 3V4WA 4UB6H 1IJDB 3BCCJ 2K9YA 2QEXP 3AEDC 2R3CA 3VN0A 1LTSC 5CCGA 1KMIZ 4GOFA 1SQPD 1ZOYC 2XDJA 1S1CX 1NTMG 4YXDC 3BRTB 1KILC 1MKMA 2PGDA 4EYYQ 2WT7A 1FZCA 2D2CB 1K8AQ 4U3FJ 1D7MA 1SVFA 3L72G 2WT7B 2XZRA 1AV1A 1FZCB 2WSFH 4GOEA 1WMKA 2BCCG 2LXBA 2IBZD 1IFMA 1BSNA 1JCDA 2WMMA 5CBNA 1SQPG 1N73A 4OWFA 4I7ZB 2K1AA 2YKQA 3HE5A 1N73B 1GL2D 2ZFCA 3V2RA 1IK9A 3HUSA 3H1IE 3HE5B 4RO0A 3OJAB 2R44A 2WPRA 2ZYGA 2CPBA 1LT9A 3HUSB 2H88C 4D6TJ 4QMAA 3O6QA 1N2DC 1Y47A 1QVFO 4C46A 2KS1A 2B87A 3O6QB 1GTWA 3TGUG 4K3AA 1J1EB 3L75J 2B88A 1YJWP 1IK7A 2K88A 2KS1B 1NTKG 3MP7B 1IFPA 5KKZC 2YMYA 1GDTA 4I6MC 1OZHA 2H8PD 2M8RA 5APYA 3B8EB 3LIDA 3AE8C 2QJKC 1ZR4A 5B5EE 5C39A 1PGJA 4BWNA 4MN4C 1NO4A 4N6JA 2I1JA 1BGYD 1KFNA 2R5BA 1LP1A 1WT6A 1OW6A 2E74D 1FS0E 1M8OB 2R5DA 2WTYA 1G2CA 3E1IA 5B5EH 2IFNA 3CMEP 3HD7D 2YNYA 3W67A 1J1DB 1S9KE 2QJPB 3H1LD 3D6YA 3H1KD 5AW1B 1G2CB 1J2JB 2IYPA 3N7NA 3KDPB 4DZOA 1SQVE 3M9HA 4B86A 1FBMA 4IL6H 2NZ2A 3BCCD 1FE6A 3P8MC 1LTBC 1S5LX 3CCJP 2A45H 2UWJE 3USSA 1OMIA 3A0BH 4AQRD 4PV1D 3CCRP 3EFFK 3H1IJ 1USEA 4IFMA 5H2FE 4N78D 3HRNA 2A45I 4UB8H 4U3FD 1FZEA 1VQKP 4ZKPA 3B5ND 2FFDC 1L4AA 1MV8A 1T2KD 2OYIC 3V5BA 1SFCD 1JY2O 3M91A 2FY8A 2YO2A 4H13C 1KYOH 1L4AB 1PV3A 2K9JB 2SPZA 1QL1A 5KAIH 5TISH 3V2NA 1AA0A 3H1HG 3CI9A 3H1JG 1L0LJ 4XE5B 3L36A 3Q5PA 4DJGA 3PJSK 3FXDA 1OVRA 1HTLC 2LXCB 2JEEA 1G1IA 1PGPA 4R4MA 1W2BO 2E5YA 3EWKA 1PP9G 2FYUK 3B4SA 3WU2E 2N1TA 1HVVA 2Z5HA 2E5TA 2N1TB 2FKWB 1GL2C 3CCEP 2L5GB 4H44B 2IDBA 1AVYA 3GHGA 3M9BA 3C8VA 3G6EP 4HJGH 3L75D 1UIIA 5CCHA 3V2PA 4JYCA 5AW5B 1QL2A 1LTTC 1NU1G 2IBZI 1HBWA 2IZ0A 2E75B 2IYOA 1EDLA 2Q9IA 4KHXA 1SQVJ 3ABVC 1LT1A 1K73Q 2HYNA 5APUA 3BVHA 2V4HA 5CCGD 1NAFA 1VQ7P 1M7LA 3L73G 2D2CD 3G3ZA 5B66E 4PD4E 3WUVA 1RY3A 1URQC 1YQ4C 2RKLA 1RQVA 1JY3O 1RF0C 3RK3C 1HUCA 3L70G 3NTNA 3S4RA 3BASA 2KUBA 5AW3B 3SFEC 2AXTH 3CCMP 2YXRB 2NPSA 5EFWB 2PRRA 2IX7C 4WB4A 1OXZA 2JP3A 3H1ID 2XU6A 1MUUA 3V6IA 2NPSB 1RF1C 3PP5A 2P58A 3PH0A 3D71A 3CL3D 3F89A 3FXEA 3NFQA 4EOTA 2A06G 2LKMA 1KZUB 2P2UA 4OGQB 1LTAC 2Y0DA 1RE3A 1M1JC 5APWA 2QVAA 1QEXA 2QJYC 2FYNB 1Q81Q 2WWWA 4PV1B 2OYHA 1IZNB 3C1LA 1QGKB 2I8DA 3Q1MA 5KLVG 1T6AA 1L0LD 1NTZE 1DEBA 2OYHB 3EFGA 1SFCC 2E76B 3OW2O 2W27A 5L8RJ 1FU1A 1OWAA 5AW9B 2C0WA 1XTCC 4NPFX 2BASA 1L0LG 3CX5E 3II6A 3G71P 5KJ7A 2OTLP 4L74A 3FWLA 5GTIH 2FBWC 3Q3DA 5E79H 4GDOA 2B89A 1R5LA 1ZV8A 1S9KD 1YYCA 4IFFA 3HE4A 2OYOA 2WSEJ 1SQBG 3L71E 2O01J 2M0BA 1SQVD 5AW4B 1S3JA 3HE4B 3CWBG 1H88A 2ITAA 1BCCG 1VQ6P 2A45G 1JM0A 1L0NG 1P84I 2O1JA 4WWIA 3O8ZA 1NH4A 1YIJP 2OTKE 1GK6A 1QVGO 1S5LE 1ZP0C 3A2AA 5KAFH 1LWUC 1NAYA 3I56P 1AQ5A 2HLOA 1PPJE 1L4AD 2GUVA 2JDIH 5AVUB 4L75A 2Q5UA 1VDFA 1T3JA 2AEJA 3CCLP 1Q7YQ 2W6AA 2YMKA 1SQQG 2JWDA 1VQ9P 3GW6A 5BU8B 4Y99B 5AVRB 4GT1A 1KILE 1KILA 2LR2A 1W5CE 3JC22 1S5LH 1G1JA 1NTZJ 1BE3E 1DIPA 1VQ5P 3FWNA 2G8YA 4U7JA 1EZVE 2WVRA 3UIAA 1U57A 2I1KA 2JO1A 1U7JA 2JKVA 3TSIA 2OTJP 2AEFA 3L35A 2FYUE 2KXPB 1JMBA 3AE3C 2HG5D 2N1TD 3RL0C 1FAVA 5AW8B 3T97A 1FOSF 1IFNA 4H44D 1SS1A 3WUUA 1LTIC 2P1JA 1SQXE 1JEKA 3RGUA 3T97B 2IBZG 3HUSC 3IAOA 3SWKA 3KQGA 5CCHD 2E75D 3L37A 1LT9B 4A7PA 3AE1C 3C9IA 3AEGC 1VQPP 3L74E 4WBAA 2R3SA 1YITP 4W7ZA 1YI2P 3CC7P 1RHZB 1NTZK 2B87B 2CPSA 5M1BA 3S9OA 1HJBA 1GW4A 3EQ2A 1NOHA 2KZJA 3VMAA 4AUWA 3A5TA 3M0AA 2GUSA 4PD4D 3H32A 3B71A 3MUDC 1FOSE 1IO4A 3P7KA 2V7QH 1LTGC 3H32B 3FX0A 4RJTA 4JPZB 3MIWA 3GLMA 2ZT9C 1EXJA 2WPSA 2M3EA 1QX8A 1PGOA 2QG4A 1SQBE 4LGDE 1X0TA 1LP1B 2WSSH 1J1DC 1BE3J 3GF7A 2QJPC 2YKPA 4EDFA 5DJTB 2NPSD 1NU1K 3ZDMA 1FZBA 2K37A 1JB0J 3E1RA 4OGQD 4L73A 1BGYG 2FYUJ 1MFZA 1S2EA 3AE4C 4HYTB 5K5GB 2IZ1A 5AVZB 4TLFA 1W2EA 4M3LA 3SWYA 3H1LG 1SQXJ 3H1KG 2RN0A 1NTME 3P8CE 3HTKA 3RK2B 1VQ8P 3L72E 4HB1A 3BCCG 2QRXA 1NTZD 3HTKB 2OGUA 3VMYA 2W83C 2E76D 2FFDA 1K9MQ 2OYIA 2BCCE 1EDIA 2H43A 3IFMA 4N3YB 1SQPE 5H2FH 2FFDB 2V7QJ 2MKVA 3MD0A 1TU3F 1N8RQ 2OYIB 1QLED 1LNQA 4LC1A 3CXHE 4U3FG 4H13B 1KYOI 2C9NY 2QIWA 4CPGA 2PFXA 1UIXA 1NHLA 1N7LA 1K04A 4Z1MH 5KJ7D 1A02F 3MHVA 4YXWH 4D6TD 2Q1KA 3M0DC 2ZVOB 2N1TC 3IR9A 1PFIA 2FXOA 5GTHE 3KZIE 1SQXK 4H44C 3Q5SA 4NPEA 1AFOA 1N7SA 1DEEG 3TGUE 1AJYA 1FZGA 4DCKA 3GHGB 1KB9E 3AE5C 3WU2H 1N7SB 1NTKE 4RKUJ 5CCHC 2E75C 2W90A 4D6TG 1MFTA 3Q2YA 2Y9YA 1JY2N 1OW7A 3AE7C 2NRGA 1NVOA 3RBXA 1E79H 3L75G 1PPJD 1EQ7A 1BDCA 2CK3H 2QE7H 1VF5B 1OFCX 4DT0A 2FXPA 1GU5A 1X79B 1OIPA 3JCUE 1NTMJ 3CC4P 2ZYAA 2WPVB 1KILD 3I55P 3L72J 1EDKA 1JY2P
chains in the Genus database with same CATH topology
1UIXA 3AE9C 4H0LB 1NYHA 2NZ2A 4H13D 2G3AA 3AE3C 1K04A 2IDBA 1VF5C 2YIUC 4H44B 4Z1MH 1S5LX 2JP3A 3D70A 1YQ3C 2H88C 3RK3E 3Q5RA 4H0LD 3AEEC 3C8VA 2BEQD 2OQQA 3O6QA 2WSEJ 2E76C 2QJPC 3GF7A 1OMIA 2O01J 4H44D 3D71A 2K9YA 1HJ0A 4PV1D 2E74C 1FDIA 3AEDC 3AEBC 2WQYC 4OGQB 3T97B 4I7ZC 2E75B 4H0LC 1JB0J 1OW8A 2WSFJ 3IAOA 1IK7A 1KMIZ 4R4LA 3GMAA 1ZOYC 3ABVC 4IL6X 5KKZC 4OGQD 4H44C 4Y28J 3Q5SA 1K05A 1FDOA 2E75D 1ZRTE 2QJYC 3AE4C 1S1CX 4PV1B 3G9RA 4YXDC 1MKMA 3AE1C 3Q1MA 1AJYA 2D2CB 2J5UA 2ZT9B 1ZP0C 3AE8C 2WSCJ 3AEGC 2QJKC 3AE5C 4H13C 1EXIA 1PV3A 4RKUJ 4OGQC 4YTPC 3D6ZA 1VL2A 2E75C 2H89C 1KQFB 2D2CD 5KLIC 2ZT9D 1NGMB 1PIXA 3AEAC 3RL0g 3R4YA 1WMKA 3Q2YA 1Y9BA 2E76B 4KT0J 1Q90D 2FYNC 5M1BA 3S9OA 5L8RJ 2BEZF 4PV1C 1KORA 3Q5PA 1OW7A 3AE2C 1YQ4C 1PL5A 3AE7C 3H25A 2YMKA 2E74B 1RQVA 1KTMA 2E76D 3SFDC 1R8EA 4I7ZB 1RQUA 4TT3H 1KILE 1OW6A 2E74D 3AE6C 1HF9A 4XFJA 1VF5B 2QSIA 4R4MA 1DIPA 3B71A 2FXPA 3GF3A 2G8YA 3EWKA 1KQGB 1DD4A 2V7QJ 2MKVA 4U7JA 3LW5J 1TU3F 1VF5D 3D6YA 1U57A 2JO1A 3AEFC 2FBWC 3IN6A 1GMJA 3FGAD 3Q3DA 1ZMEC 3SFEC 2WPVB 3AECC 1DD3A 3GLMA 4H13B 2D2CC 2ZT9C 2QIWA 1EXJA 4GDOA 2P10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E75 B;  4H0L B;  1JB0 J;  2WSF J;  5KLI C;  2QSI A;  1VF5 B;  4H44 B;  4IL6 X;  5KKZ C;  2YIU C;  1S5L X;  4Y28 J;  1ZRT E;  2QJY C;  3C8V A;  2E76 B;  3LW5 J;  4KT0 J;  1Q90 D;  2FYN C;  4PV1 B;  5L8R J;  2WSE J;  2QJP C;  2O01 J;  2E74 B;  2K9Y A;  2D2C B;  2ZT9 B;  2WPV B;  4H13 B;  2WSC J;  2QJK C;  2QIW A;  4I7Z B;  4OGQ B;  4RKU J; 
#chains in the Genus database with same CATH topology
 1BE3 D;  4H0L B;  2OAR A;  1URQ A;  3PLN A;  4DOJ A;  2IPP A;  2G3A A;  3IF4 A;  3D70 A;  3RK3 E;  1EZV D;  1RF0 A;  1IFJ A;  2BCC J;  2BEQ D;  4WVZ A;  1URQ B;  1NJI Q;  5B66 H;  4PD4 H;  3E7K A;  1SQB K;  1GD2 E;  3QH9 A;  3RK3 B;  2E74 C;  2FYU D;  1VQL P;  4JBZ A;  2N9Y B;  5AVX B;  5AVT B;  3HD7 C;  2J58 A;  1LTJ C;  5AVW B;  1ZRT E;  2H7H A;  1L0N K;  1U7M A;  3CMA P;  4PD4 I;  5AVY B;  1NKZ B;  1SQX D;  2WSE H;  3M9Q A;  2O01 H;  3QWO C;  3OA7 A;  2FYZ A;  1KC8 Q;  1KQL A;  2WSC J;  1AVO A;  4OGQ C;  3A0H E;  4WY4 A;  3MZW B;  1RF1 A;  3TNU A;  1RE4 C;  3G4S P;  5KLI C;  1S4X A;  4BRY A;  1PIX A;  1CI6 A;  3RL0 g;  4WY4 B;  2XND H;  3TNU B;  2FYN C;  4PV1 C;  1KOR A;  1NTM K;  4BRY B;  1CI6 B;  3H1I G;  3JSV C;  3H1H E;  3TGU J;  1RQU A;  3H1J E;  1HH0 A;  2KSJ A;  3CD6 P;  2QSI A;  3B5N C;  1NTK J;  2M3B A;  5CMZ A;  3GF3 A;  4BXL A;  2QJY B;  3U1A A;  1AQT A;  1T2K C;  3KHU A;  4ZMD A;  1JY3 N;  3KXD A;  1SQP K;  4PJ0 E;  3TF5 A;  2KZI A;  1PP9 E;  1GZL A;  1Q2N A;  1YQ3 C;  4NPD A;  3Q5R A;  2K3R A;  1JUN A;  1T3U A;  4C7R A;  3VTP C;  2RH0 A;  1LGH B;  2C9L Y;  3MGN A;  3WUT A;  3A3Y B;  3VMZ A;  3VOP A;  1OVV A;  5KTB A;  1JY3 P;  1JO5 A;  1P84 E;  1JOC A;  4Y28 J;  1HWT C;  1K05 A;  1FDO A;  1IC2 A;  5CBO A;  4C7N A;  1NU1 E;  3CCV P;  3A7O A;  1DX7 A;  2FXM A;  1FZA A;  3F5H A;  3CX5 H;  1NKN A;  4C7N B;  3D6Z A;  3TK1 A;  4UB6 E;  1NGM B;  3AEA C;  1NTK K;  1HGV A;  3SSU A;  1H0T A;  1KTM A;  3L73 E;  2J59 M;  2QM7 A;  4IFD K;  3RK2 D;  4RES B;  5AVS B;  3V4Q A;  1R8E A;  2C0X A;  1NTM D;  2QA4 P;  3AE6 C;  3BAT A;  1SQV G;  1H0T B;  3PHL A;  2YIU B;  2YO3 A;  2XV5 A;  1EC5 A;  1DD4 A;  1LWU A;  3L72 D;  1X22 A;  3LW5 J;  2JWA A;  1Q86 Q;  5CCG C;  2Y9Z A;  2AEM A;  3AEF C;  1GMJ A;  1LWU B;  2D2C C;  2BCC D;  2YXQ B;  4JYB A;  1ZW0 A;  4Y99 C;  1YTZ I;  1ZR2 A;  4H13 D;  1KFM A;  3H1H J;  1FZC C;  3L70 E;  2WIT A;  3H1J J;  1ZXG A;  2OQQ A;  3CXH D;  1KIL B;  1LJ2 A;  4OVN F;  1IFI A;  4I7Z C;  1S72 P;  1Q82 Q;  4R4L A;  2AXC A;  1N73 C;  1GK4 A;  1USD A;  1PP9 J;  2P7J A;  2KB7 P;  4K35 A;  3G9R A;  2A06 E;  4IOI H;  2KOG A;  2HOD A;  1GU4 A;  2Q3E A;  1X8Y A;  1VL2 A;  2HOD B;  3RL0 B;  2N9B A;  3GG2 A;  1ZLL A;  1N7S D;  2O1K A;  2W6J H;  3R4Y A;  2Z4E A;  1BSH A;  3TGU D;  1LT9 C;  5KLV E;  1KB9 D;  4ZNC A;  1NTK D;  3TYY A;  1EZV I;  3SFD C;  1NU1 J;  5CHX A;  3H6P A;  3L71 J;  1FC2 C;  4O9B A;  1J1E C;  1JNM A;  2KP8 A;  4EIJ A;  4GOD A;  3NXS A;  1OX3 A;  1VF5 D;  2KYV A;  1ZME C;  2B9B A;  2HR3 A;  3U59 A;  1GW3 A;  1L0L E;  1NYH A;  1L2P A;  3L73 J;  2Q6Q A;  3RBZ A;  5KKZ B;  3K5B A;  1IFD A;  4H0L D;  1VQO P;  1VQM P;  2Z5I A;  4YPC A;  3MUD A;  1HJ0 A;  2QJK B;  1URQ D;  1KN7 A;  2ZJS E;  2WSF J;  3RK3 D;  2ZYD A;  1JMM A;  2WZ7 A;  1FZF A;  3W68 A;  5APX A;  1KD1 Q;  3L70 J;  4JQ0 D;  4IL6 E;  3CWB E;  1H89 A;  1SLQ A;  2ZT9 B;  2MJZ A;  1BCC E;  1NWQ A;  3BRV B;  1L0N E;  1KQF B;  1FDM A;  1ZRT D;  3A0B E;  2Q7C A;  3VMX A;  3PTZ A;  3AE2 C;  2R32 A;  4WY4 D;  4UB8 E;  1M90 Q;  1M56 D;  3TDK A;  1KYO E;  1SQQ E;  3RK2 C;  5KAI E;  5TIS E;  1YTZ T;  3IN6 A;  3H1H D;  5KLV J;  5AW2 B;  1DD3 A;  3H1J D;  4GIF A;  1X9V A;  1L4A C;  4HH2 A;  4OH8 B;  2M5A A;  3MTU E;  3L74 J;  4I2L C;  1HGZ A;  3AEE C;  1PGQ A;  2K9J A;  4EI2 A;  1E5W A;  2M5A B;  1DH3 A;  5CJ0 A;  2ZXX A;  3AEB C;  1PP9 D;  2ZXE B;  1OW8 A;  1NTZ G;  2PAJ A;  3CX5 D;  3LIE A;  4GKG A;  4XA4 A;  4ASV A;  3M06 A;  2E43 A;  2IBZ E;  4ASW A;  2J5U A;  1P84 D;  1EXI A;  5AW6 B;  1CW5 A;  3CXH H;  2E42 A;  1H8A A;  3KYQ A;  1NU1 D;  3M0D A;  3L71 D;  4KT0 J;  1GL2 A;  2BEZ F;  3P32 A;  1SQB J;  1PL5 A;  1VQN P;  2WPQ A;  5APS A;  1CZQ A;  3GHG C;  2WSC H;  3CCS P;  1GL2 B;  5KLV K;  1N7S C;  3CXH I;  3CWB J;  2POH A;  1BCC J;  2O01 N;  2XKM A;  1L0N J;  2QM8 A;  5GTH H;  3KZI H;  1PZQ A;  3L73 D;  2VRS A;  5CJ4 A;  3FGA D;  1Z56 A;  3L71 G;  2ZVN B;  5AW7 B;  2P10 A;  1JCC A;  2ZAE B;  3AE9 C;  5AW0 B;  4W80 A;  1RH5 B;  1KB9 H;  2O3J A;  1VF5 C;  1M57 D;  3CCU P;  2Q3I A;  2PP6 A;  1L0L K;  3OAK A;  2W8Z A;  2L91 A;  1WRG A;  2XNX A;  1SQQ J;  3PRJ A;  1R5S A;  3L70 D;  4H0L C;  3SWF A;  1KB9 I;  3GMA A;  1EDJ A;  4IL6 X;  1YJN P;  1FJK A;  4AYC A;  2AXT E;  1PPJ G;  2Y0E A;  3ITK A;  2JJL A;  1SQP J;  1JTH A;  1FJP A;  2KIK A;  1KV4 A;  1SP4 A;  3JCU H;  5DJU B;  4YTP C;  1BGY E;  1JTH B;  2A06 D;  1BE3 G;  3RL0 D;  3NMD A;  2NPS C;  3HD7 A;  3H25 A;  2E74 B;  1CSB A;  3H1L E;  1LTJ A;  1EZV G;  3H1K E;  5AVV B;  5BVZ A;  3L4F A;  4TT3 H;  5TJH A;  3HD7 B;  4HKZ H;  1HF9 A;  4XFJ A;  1YBK A;  1LTJ B;  1SQV K;  5KLV D;  3V2Q A;  2FYU G;  3BCC E;  4WY4 C;  1RF1 B;  1RE4 A;  2KLV A;  2RMZ A;  1KQS O;  3L74 D;  1RE3 C;  1M1J A;  1VPC A;  3VP9 A;  1SQQ K;  2KLU A;  5KLI B;  2OYH C;  1SQX G;  5APT A;  5APV A;  3KPE A;  4KJM A;  1M1J B;  4N78 E;  3CCQ P;  3A0H H;  1M1K Q;  4U3F E;  2GA1 A;  3LW5 H;  2E76 C;  3B5N A;  1VQ4 P;  1FDI A;  4L76 A;  2WQY C;  1XTG B;  1SFC A;  1MZ9 A;  3CPW O;  2W6B A;  3B5N B;  3L74 G;  5GTI E;  2KI7 B;  1SFC B;  3R2P A;  5E79 E;  3U1C A;  3S1K A;  1A02 J;  2HPC A;  2IFM A;  5AVQ B;  3VP8 A;  1Y8A A;  3N4X A;  1ZN5 A;  4ZKU A;  5KJ7 C;  2HPC B;  1SQB D;  2H89 C;  2ZT9 D;  2GM4 A;  2P67 A;  4PJ0 H;  2DW3 A;  4JF7 A;  1Y9B A;  2Y0C A;  3CWB D;  1Q90 D;  3I5C A;  1T8Z A;  1BCC D;  3VYI A;  3CC2 P;  1L0N D;  5APQ A;  4D6T E;  4W7Y A;  2HFE D;  2YKO A;  1YHQ P;  1KQG B;  1N86 A;  1BGY J;  4I1L A;  1YJ9 P;  1P84 H;  5KAF E;  5BU5 A;  3L75 E;  2KNC A;  3CX5 I;  3AEC C;  2KK7 A;  2KSE A;  4LLH A;  1BDD A;  3H1L J;  3P8C D;  3H1K J;  2KNC B;  2YIU C;  2JR8 A;  1KYO D;  1OVU A;  1SQQ D;  3CLQ A;  3WMM 0;  3V4W A;  4UB6 H;  1IJD B;  3BCC J;  2K9Y A;  2QEX P;  3AED C;  2R3C A;  3VN0 A;  1LTS C;  5CCG A;  1KMI Z;  4GOF A;  1SQP D;  1ZOY C;  2XDJ A;  1S1C X;  1NTM G;  4YXD C;  3BRT B;  1KIL C;  1MKM A;  2PGD A;  4EYY Q;  2WT7 A;  1FZC A;  2D2C B;  1K8A Q;  4U3F J;  1D7M A;  1SVF A;  3L72 G;  2WT7 B;  2XZR A;  1AV1 A;  1FZC B;  2WSF H;  4GOE A;  1WMK A;  2BCC G;  2LXB A;  2IBZ D;  1IFM A;  1BSN A;  1JCD A;  2WMM A;  5CBN A;  1SQP G;  1N73 A;  4OWF A;  4I7Z B;  2K1A A;  2YKQ A;  3HE5 A;  1N73 B;  1GL2 D;  2ZFC A;  3V2R A;  1IK9 A;  3HUS A;  3H1I E;  3HE5 B;  4RO0 A;  3OJA B;  2R44 A;  2WPR A;  2ZYG A;  2CPB A;  1LT9 A;  3HUS B;  2H88 C;  4D6T J;  4QMA A;  3O6Q A;  1N2D C;  1Y47 A;  1QVF O;  4C46 A;  2KS1 A;  2B87 A;  3O6Q B;  1GTW A;  3TGU G;  4K3A A;  1J1E B;  3L75 J;  2B88 A;  1YJW P;  1IK7 A;  2K88 A;  2KS1 B;  1NTK G;  3MP7 B;  1IFP A;  5KKZ C;  2YMY A;  1GDT A;  4I6M C;  1OZH A;  2H8P D;  2M8R A;  5APY A;  3B8E B;  3LID A;  3AE8 C;  2QJK C;  1ZR4 A;  5B5E E;  5C39 A;  1PGJ A;  4BWN A;  4MN4 C;  1NO4 A;  4N6J A;  2I1J A;  1BGY D;  1KFN A;  2R5B A;  1LP1 A;  1WT6 A;  1OW6 A;  2E74 D;  1FS0 E;  1M8O B;  2R5D A;  2WTY A;  1G2C A;  3E1I A;  5B5E H;  2IFN A;  3CME P;  3HD7 D;  2YNY A;  3W67 A;  1J1D B;  1S9K E;  2QJP B;  3H1L D;  3D6Y A;  3H1K D;  5AW1 B;  1G2C B;  1J2J B;  2IYP A;  3N7N A;  3KDP B;  4DZO A;  1SQV E;  3M9H A;  4B86 A;  1FBM A;  4IL6 H;  2NZ2 A;  3BCC D;  1FE6 A;  3P8M C;  1LTB C;  1S5L X;  3CCJ P;  2A45 H;  2UWJ E;  3USS A;  1OMI A;  3A0B H;  4AQR D;  4PV1 D;  3CCR P;  3EFF K;  3H1I J;  1USE A;  4IFM A;  5H2F E;  4N78 D;  3HRN A;  2A45 I;  4UB8 H;  4U3F D;  1FZE A;  1VQK P;  4ZKP A;  3B5N D;  2FFD C;  1L4A A;  1MV8 A;  1T2K D;  2OYI C;  3V5B A;  1SFC D;  1JY2 O;  3M91 A;  2FY8 A;  2YO2 A;  4H13 C;  1KYO H;  1L4A B;  1PV3 A;  2K9J B;  2SPZ A;  1QL1 A;  5KAI H;  5TIS H;  3V2N A;  1AA0 A;  3H1H G;  3CI9 A;  3H1J G;  1L0L J;  4XE5 B;  3L36 A;  3Q5P A;  4DJG A;  3PJS K;  3FXD A;  1OVR A;  1HTL C;  2LXC B;  2JEE A;  1G1I A;  1PGP A;  4R4M A;  1W2B O;  2E5Y A;  3EWK A;  1PP9 G;  2FYU K;  3B4S A;  3WU2 E;  2N1T A;  1HVV A;  2Z5H A;  2E5T A;  2N1T B;  2FKW B;  1GL2 C;  3CCE P;  2L5G B;  4H44 B;  2IDB A;  1AVY A;  3GHG A;  3M9B A;  3C8V A;  3G6E P;  4HJG H;  3L75 D;  1UII A;  5CCH A;  3V2P A;  4JYC A;  5AW5 B;  1QL2 A;  1LTT C;  1NU1 G;  2IBZ I;  1HBW A;  2IZ0 A;  2E75 B;  2IYO A;  1EDL A;  2Q9I A;  4KHX A;  1SQV J;  3ABV C;  1LT1 A;  1K73 Q;  2HYN A;  5APU A;  3BVH A;  2V4H A;  5CCG D;  1NAF A;  1VQ7 P;  1M7L A;  3L73 G;  2D2C D;  3G3Z A;  5B66 E;  4PD4 E;  3WUV A;  1RY3 A;  1URQ C;  1YQ4 C;  2RKL A;  1RQV A;  1JY3 O;  1RF0 C;  3RK3 C;  1HUC A;  3L70 G;  3NTN A;  3S4R A;  3BAS A;  2KUB A;  5AW3 B;  3SFE C;  2AXT H;  3CCM P;  2YXR B;  2NPS A;  5EFW B;  2PRR A;  2IX7 C;  4WB4 A;  1OXZ A;  2JP3 A;  3H1I D;  2XU6 A;  1MUU A;  3V6I A;  2NPS B;  1RF1 C;  3PP5 A;  2P58 A;  3PH0 A;  3D71 A;  3CL3 D;  3F89 A;  3FXE A;  3NFQ A;  4EOT A;  2A06 G;  2LKM A;  1KZU B;  2P2U A;  4OGQ B;  1LTA C;  2Y0D A;  1RE3 A;  1M1J C;  5APW A;  2QVA A;  1QEX A;  2QJY C;  2FYN B;  1Q81 Q;  2WWW A;  4PV1 B;  2OYH A;  1IZN B;  3C1L A;  1QGK B;  2I8D A;  3Q1M A;  5KLV G;  1T6A A;  1L0L D;  1NTZ E;  1DEB A;  2OYH B;  3EFG A;  1SFC C;  2E76 B;  3OW2 O;  2W27 A;  5L8R J;  1FU1 A;  1OWA A;  5AW9 B;  2C0W A;  1XTC C;  4NPF X;  2BAS A;  1L0L G;  3CX5 E;  3II6 A;  3G71 P;  5KJ7 A;  2OTL P;  4L74 A;  3FWL A;  5GTI H;  2FBW C;  3Q3D A;  5E79 H;  4GDO A;  2B89 A;  1R5L A;  1ZV8 A;  1S9K D;  1YYC A;  4IFF A;  3HE4 A;  2OYO A;  2WSE J;  1SQB G;  3L71 E;  2O01 J;  2M0B A;  1SQV D;  5AW4 B;  1S3J A;  3HE4 B;  3CWB G;  1H88 A;  2ITA A;  1BCC G;  1VQ6 P;  2A45 G;  1JM0 A;  1L0N G;  1P84 I;  2O1J A;  4WWI A;  3O8Z A;  1NH4 A;  1YIJ P;  2OTK E;  1GK6 A;  1QVG O;  1S5L E;  1ZP0 C;  3A2A A;  5KAF H;  1LWU C;  1NAY A;  3I56 P;  1AQ5 A;  2HLO A;  1PPJ E;  1L4A D;  2GUV A;  2JDI H;  5AVU B;  4L75 A;  2Q5U A;  1VDF A;  1T3J A;  2AEJ A;  3CCL P;  1Q7Y Q;  2W6A A;  2YMK A;  1SQQ G;  2JWD A;  1VQ9 P;  3GW6 A;  5BU8 B;  4Y99 B;  5AVR B;  4GT1 A;  1KIL E;  1KIL A;  2LR2 A;  1W5C E;  3JC2 2;  1S5L H;  1G1J A;  1NTZ J;  1BE3 E;  1DIP A;  1VQ5 P;  3FWN A;  2G8Y A;  4U7J A;  1EZV E;  2WVR A;  3UIA A;  1U57 A;  2I1K A;  2JO1 A;  1U7J A;  2JKV A;  3TSI A;  2OTJ P;  2AEF A;  3L35 A;  2FYU E;  2KXP B;  1JMB A;  3AE3 C;  2HG5 D;  2N1T D;  3RL0 C;  1FAV A;  5AW8 B;  3T97 A;  1FOS F;  1IFN A;  4H44 D;  1SS1 A;  3WUU A;  1LTI C;  2P1J A;  1SQX E;  1JEK A;  3RGU A;  3T97 B;  2IBZ G;  3HUS C;  3IAO A;  3SWK A;  3KQG A;  5CCH D;  2E75 D;  3L37 A;  1LT9 B;  4A7P A;  3AE1 C;  3C9I A;  3AEG C;  1VQP P;  3L74 E;  4WBA A;  2R3S A;  1YIT P;  4W7Z A;  1YI2 P;  3CC7 P;  1RHZ B;  1NTZ K;  2B87 B;  2CPS A;  5M1B A;  3S9O A;  1HJB A;  1GW4 A;  3EQ2 A;  1NOH A;  2KZJ A;  3VMA A;  4AUW A;  3A5T A;  3M0A A;  2GUS A;  4PD4 D;  3H32 A;  3B71 A;  3MUD C;  1FOS E;  1IO4 A;  3P7K A;  2V7Q H;  1LTG C;  3H32 B;  3FX0 A;  4RJT A;  4JPZ B;  3MIW A;  3GLM A;  2ZT9 C;  1EXJ A;  2WPS A;  2M3E A;  1QX8 A;  1PGO A;  2QG4 A;  1SQB E;  4LGD E;  1X0T A;  1LP1 B;  2WSS H;  1J1D C;  1BE3 J;  3GF7 A;  2QJP C;  2YKP A;  4EDF A;  5DJT B;  2NPS D;  1NU1 K;  3ZDM A;  1FZB A;  2K37 A;  1JB0 J;  3E1R A;  4OGQ D;  4L73 A;  1BGY G;  2FYU J;  1MFZ A;  1S2E A;  3AE4 C;  4HYT B;  5K5G B;  2IZ1 A;  5AVZ B;  4TLF A;  1W2E A;  4M3L A;  3SWY A;  3H1L G;  1SQX J;  3H1K G;  2RN0 A;  1NTM E;  3P8C E;  3HTK A;  3RK2 B;  1VQ8 P;  3L72 E;  4HB1 A;  3BCC G;  2QRX A;  1NTZ D;  3HTK B;  2OGU A;  3VMY A;  2W83 C;  2E76 D;  2FFD A;  1K9M Q;  2OYI A;  2BCC E;  1EDI A;  2H43 A;  3IFM A;  4N3Y B;  1SQP E;  5H2F H;  2FFD B;  2V7Q J;  2MKV A;  3MD0 A;  1TU3 F;  1N8R Q;  2OYI B;  1QLE D;  1LNQ A;  4LC1 A;  3CXH E;  4U3F G;  4H13 B;  1KYO I;  2C9N Y;  2QIW A;  4CPG A;  2PFX A;  1UIX A;  1NHL A;  1N7L A;  1K04 A;  4Z1M H;  5KJ7 D;  1A02 F;  3MHV A;  4YXW H;  4D6T D;  2Q1K A;  3M0D C;  2ZVO B;  2N1T C;  3IR9 A;  1PFI A;  2FXO A;  5GTH E;  3KZI E;  1SQX K;  4H44 C;  3Q5S A;  4NPE A;  1AFO A;  1N7S A;  1DEE G;  3TGU E;  1AJY A;  1FZG A;  4DCK A;  3GHG B;  1KB9 E;  3AE5 C;  3WU2 H;  1N7S B;  1NTK E;  4RKU J;  5CCH C;  2E75 C;  2W90 A;  4D6T G;  1MFT A;  3Q2Y A;  2Y9Y A;  1JY2 N;  1OW7 A;  3AE7 C;  2NRG A;  1NVO A;  3RBX A;  1E79 H;  3L75 G;  1PPJ D;  1EQ7 A;  1BDC A;  2CK3 H;  2QE7 H;  1VF5 B;  1OFC X;  4DT0 A;  2FXP A;  1GU5 A;  1X79 B;  1OIP A;  3JCU E;  1NTM J;  3CC4 P;  2ZYA A;  2WPV B;  1KIL D;  3I55 P;  3L72 J;  1EDK A;  1JY2 P; 
#chains in the Genus database with same CATH homology
 1UIX A;  3AE9 C;  4H0L B;  1NYH A;  2NZ2 A;  4H13 D;  2G3A A;  3AE3 C;  1K04 A;  2IDB A;  1VF5 C;  2YIU C;  4H44 B;  4Z1M H;  1S5L X;  2JP3 A;  3D70 A;  1YQ3 C;  2H88 C;  3RK3 E;  3Q5R A;  4H0L D;  3AEE C;  3C8V A;  2BEQ D;  2OQQ A;  3O6Q A;  2WSE J;  2E76 C;  2QJP C;  3GF7 A;  1OMI A;  2O01 J;  4H44 D;  3D71 A;  2K9Y A;  1HJ0 A;  4PV1 D;  2E74 C;  1FDI A;  3AED C;  3AEB C;  2WQY C;  4OGQ B;  3T97 B;  4I7Z C;  2E75 B;  4H0L C;  1JB0 J;  1OW8 A;  2WSF J;  3IAO A;  1IK7 A;  1KMI Z;  4R4L A;  3GMA A;  1ZOY C;  3ABV C;  4IL6 X;  5KKZ C;  4OGQ D;  4H44 C;  4Y28 J;  3Q5S A;  1K05 A;  1FDO A;  2E75 D;  1ZRT E;  2QJY C;  3AE4 C;  1S1C X;  4PV1 B;  3G9R A;  4YXD C;  1MKM A;  3AE1 C;  3Q1M A;  1AJY A;  2D2C B;  2J5U A;  2ZT9 B;  1ZP0 C;  3AE8 C;  2WSC J;  3AEG C;  2QJK C;  3AE5 C;  4H13 C;  1EXI A;  1PV3 A;  4RKU J;  4OGQ C;  4YTP C;  3D6Z A;  1VL2 A;  2E75 C;  2H89 C;  1KQF B;  2D2C D;  5KLI C;  2ZT9 D;  1NGM B;  1PIX A;  3AEA C;  3RL0 g;  3R4Y A;  1WMK A;  3Q2Y A;  1Y9B A;  2E76 B;  4KT0 J;  1Q90 D;  2FYN C;  5M1B A;  3S9O A;  5L8R J;  2BEZ F;  4PV1 C;  1KOR A;  3Q5P A;  1OW7 A;  3AE2 C;  1YQ4 C;  1PL5 A;  3AE7 C;  3H25 A;  2YMK A;  2E74 B;  1RQV A;  1KTM A;  2E76 D;  3SFD C;  1R8E A;  4I7Z B;  1RQU A;  4TT3 H;  1KIL E;  1OW6 A;  2E74 D;  3AE6 C;  1HF9 A;  4XFJ A;  1VF5 B;  2QSI A;  4R4M A;  1DIP A;  3B71 A;  2FXP A;  3GF3 A;  2G8Y A;  3EWK A;  1KQG B;  1DD4 A;  2V7Q J;  2MKV A;  4U7J A;  3LW5 J;  1TU3 F;  1VF5 D;  3D6Y A;  1U57 A;  2JO1 A;  3AEF C;  2FBW C;  3IN6 A;  1GMJ A;  3FGA D;  3Q3D A;  1ZME C;  3SFE C;  2WPV B;  3AEC C;  1DD3 A;  3GLM A;  4H13 B;  2D2C C;  2ZT9 C;  2QIW A;  1EXJ A;  4GDO A;  2P10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...