1JB0J

Crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
41
structure length
41
Chain Sequence
b'MKHFLTYLSTAPVLAAIWMTITAGILIEFNRFYPDLLFHPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM I P700 CHLOROPHYLL A APOPROTEIN A1
publication title Three-dimensional Structure of Cyanobacterial Photosystem I at 2.5 A Resolution
pubmed doi rcsb
molecule tags Photosynthesis
total genus 12
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2001-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1jb0J00
1Q90D 1ZRTE 4Y28J 1JB0J 2E74B 2E75B 4H0LB 2E76B 4RKUJ 2O01J 2FYNC 2YIUC 2QJKC 2WPVB 5KLIC 3C8VA 4PV1B 4KT0J 3LW5J 2QIWA 2D2CB 5L8RJ 2WSCJ 2WSEJ 4I7ZB 2ZT9B 5KKZC 1S5LX 2QSIA 2QJPC 4H44B 2K9YA 2QJYC 4IL6X 1VF5B 4OGQB 4H13B 2WSFJ
chains in the Genus database with same CATH superfamily
3IF4A 3S9OA 4WY4C 1W2BO 2ZXEB 2YKPA 2KXPB 4LLHA 3HD7D 1RF0C 3B5ND 1VF5C 1QVFO 2BCCD 4OH8B 3A0BE 3L70J 1QL1A 1YTZI 3GG2A 2BCCE 1U57A 1L0NK 1LT9B 4GKGA 4GDOA 4H44C 3USSA 1ZMEC 1JTHA 3G9RA 2K1AA 3CCSP 2FYZA 3AE9C 1YYCA 1FZEA 3B8EB 1HJ0A 1SQXK 4B86A 1RF1B 3CCJP 2JEEA 1EXJA 2HODB 1HGZA 1T8ZA 3AEGC 1M1JB 1NO4A 5KLIB 3G6EP 1MZ9A 2LXCB 4HH2A 3TDKA 3HE5B 1SVFA 1HTLC 2W8ZA 5AVRB 3H1LG 2Y0DA 2R5DA 3EWKA 3L72G 4ZMDA 1PGPA 2IBZG 2Q1KA 3H1IJ 1MFTA 1BSHA 3CCLP 1GDTA 2KNCB 2M8RA 2Z4EA 1VQ7P 3MP7B 1S4XA 3M9HA 1N73B 2A45G 3BCCJ 3MD0A 3H1HG 3MUDA 2QSIA 4IFFA 2K9YA 1YQ3C 2V4HA 1JOCA 1LNQA 3LIDA 4OGQB 5TJHA 4OVNF 3TNUB 2L5GB 1CZQA 2O01N 4XA4A 3AE2C 1KQSO 1NWQA 3VMAA 2FYUG 4H13D 3CCVP 1ZR2A 4I6MC 5AW1B 3EQ2A 3H1JJ 3I56P 1FBMA 1OWAA 4KT0J 2W6AA 5KAFH 3M0DA 3P8CD 1JMMA 1AQ5A 1MFZA 1FDMA 5APYA 1OFCX 1YI2P 2G8YA 1OIPA 3D70A 1LWUA 3P8CE 5H2FE 3A0HE 1S5LX 1PP9J 1X8YA 5DJUB 3RK2C 3CCRP 4ASVA 3GLMA 3RL0g 4GOFA 1Q86Q 1GW4A 1VF5B 2JJLA 3E1IA 4A7PA 5AVSB 1RH5B 2FYUK 3VOPA 3CCUP 2KOGA 3NFQA 5B66E 1N7SA 3KZIE 5APXA 3S4RA 3L75G 4H44B 1VQMP 3BCCD 4Y99C 4BRYB 1H0TA 2MKVA 1LTBC 3TGUD 2LXBA 1L0NJ 5KAIE 3BCCE 1PGJA 3AE8C 1IFPA 3AE3C 3TGUE 1VQOP 4OGQD 2IFNA 3Q5RA 3L73J 4JYCA 1SQXJ 1BE3G 1NH4A 3BATA 3H1JD 1EDJA 1DH3A 3CXHH 1GL2D 4NPDA 4EYYQ 3WUVA 3H1JE 2CK3H 1RY3A 1KYOI 2P58A 4N78E 2FFDC 3AE6C 1XTGB 3W68A 3Q5SA 4ZNCA 4DOJA 1MUUA 3GHGC 4OWFA 3F5HA 3RBXA 3AEFC 1ZP0C 2JWDA 5AVYB 2W6BA 2ZT9C 1VDFA 2R5BA 3AE7C 3CD6P 3T97A 2N1TA 5APTA 4EDFA 3SFEC 2K3RA 1KYOD 3M9QA 1FU1A 3A3YB 2Q6QA 2E75D 2IDBA 1X0TA 1NKNA 3V2PA 2J58A 4WWIA 4IOIH 1AJYA 1KYOE 1PZQA 1NTMK 4H44D 2FXOA 2ZXXA 3FGAD 2OYIA 1J1DC 2RKLA 3H1LJ 1RE4C 2W27A 2K9JA 5BVZA 2YNYA 1IC2A 3L72J 3M0AA 2I1JA 2M5AA 1FAVA 2AEMA 4YPCA 1KD1Q 1YITP 1KILC 3L73D 2QJPC 1SQXD 1NTKD 4W7YA 5CHXA 4PD4I 3RK2B 4C46A 3BRTB 2HR3A 3L73E 4H0LD 1SQXE 1NTKE 3H1HJ 3TGUG 2NPSA 3R2PA 3PH0A 3H1KG 2IYPA 3V4WA 4NPEA 2FBWC 2KK7A 1LTJB 1SQBD 1SFCC 1PGQA 3IN6A 3I5CA 4UB6E 1SQBE 2ZYDA 2FYUJ 3AEAC 4Y99B 1CW5A 3VP8A 2D2CD 5GTIH 1VQPP 3H1JG 1KC8Q 4JYBA 2YXQB 1H89A 1LTSC 1BGYD 5BU8B 2E43A 2OARA 5CCGA 2K37A 1OW8A 5AVTB 2E74C 4DT0A 4HKZH 3O8ZA 5APQA 3VTPC 1CSBA 1JM0A 1BGYE 3H32B 1FJKA 3HD7A 3B5NA 1H8AA 3AECC 2AEFA 2QJYC 1LTGC 1BCCJ 2FFDB 3HRNA 1K73Q 3QWOC 3GHGB 4I7ZC 3L75J 1IFIA 4RESB 2KLUA 2LKMA 1QVGO 2QIWA 3Q3DA 5B5EH 2ZT9B 3H1HD 4ASWA 1LWUC 2W83C 1VQKP 4D6TD 4C7NA 2GM4A 3L71D 2MJZA 2RMZA 2O1JA 3H1HE 2WT7B 4XFJA 1Q82Q 2E42A 4D6TE 3L71E 3JCUE 1QL2A 1HWTC 5CJ4A 1NTKG 2FYUD 1H88A 3L74D 2I8DA 1HUCA 2IZ0A 1N7SC 3BASA 1BE3J 3V5BA 1J1DB 3RK3C 1T6AA 4DZOA 2FYUE 3CX5H 3L74E 2E5TA 1JNMA 1SQBG 4U7JA 5AW4B 4IL6X 1NTMJ 1GMJA 1KILB 1VQ4P 1K8AQ 2N9BA 2OTJP 1L4AC 3GF7A 3L37A 1URQA 1MKMA 2RH0A 4JBZA 3IAOA 1S5LH 4GOEA 2GUSA 1EC5A 1M8OB 1T3JA 2VRSA 4CPGA 2G3AA 3ABVC 1NHLA 1NTKK 1SFCB 3MZWB 1BCCD 3WMM0 5CBNA 5E79E 1BGYG 1PL5A 2H43A 3RL0C 3L75D 2JWAA 3Q5PA 4PJ0E 1BCCE 2AXTE 3C1LA 2KUBA 1SQBK 1X22A 1SQPD 1M7LA 2HFED 1LT9A 3L75E 4PD4H 2QM7A 1X9VA 2ZT9D 2KS1B 1SQPE 2KSJA 1P84D 1SS1A 1NJIQ 1CI6A 3AE5C 4EOTA 2ZVOB 1NYHA 2E74B 1P84E 1Q2NA 3LIEA 2XU6A 2PRRA 1BE3D 5KKZC 2ZVNB 1M1JA 2WZ7A 1NVOA 1GK6A 2WSCH 1FOSF 3TGUJ 4D6TG 1JY2O 3AEBC 3HE5A 1BE3E 3M06A 3H1KJ 3L71G 1NAYA 1BDDA 3AE1C 2QJYB 5AVWB 3PP5A 2OYIC 3RBZA 1IFMA 1K04A 1NTMD 2BEZF 1XTCC 3D6YA 4I7ZB 4EIJA 1NTME 3L74G 1KILD 1NGMB 1KFMA 3L4FA 4U3FD 3VMXA 1L0LK 5CCHD 3IFMA 1LWUB 2A45H 2KNCA 3L36A 2O01J 1KILE 4K35A 1EQ7A 4U3FE 3KXDA 3N4XA 4GT1A 2WWWA 2WSFJ 1SFCD 3VYIA 1OVRA 3VMYA 1FZCC 1N7SB 3MTUE 2L91A 3RK3B 2WSSH 3TSIA 4WY4B 1VQ6P 4WBAA 3CWBD 4YXWH 1G2CA 3CC7P 1DD3A 3A0BH 1GU5A 1H0TB 4PV1C 1ZR4A 2DW3A 5KJ7D 3P7KA 5C39A 3A2AA 1S3JA 3CWBE 1GL2A 3VN0A 1BCCG 1J1EC 3NXSA 1L4AB 1RE3A 4IL6E 1LTAC 5AVUB 1VQNP 2QE7H 3WU2E 2C9LY 1YQ4C 1U7JA 5KLVG 5GTHE 2M0BA 1SQPG 4TLFA 2GUVA 3AE4C 2C0XA 2Q9IA 2E5YA 1T2KD 3H1KD 4LC1A 1Z56A 2WSEJ 2LR2A 3O6QB 5APWA 3CL3D 1RF0A 3GW6A 3H1KE 1W5CE 3RL0B 2XDJA 1JB0J 2XNDH 1A02J 1FZFA 2HG5D 1NTKJ 4UB8E 5TISE 2R3SA 3D6ZA 3B4SA 5APSA 3VMZA 5CBOA 2OTKE 3M91A 1G1JA 4KHXA 2P67A 3HUSC 1KV4A 1S2EA 1KN7A 1NTMG 1SQBJ 5KLVK 2WPVB 4XE5B 2WPRA 2M3EA 4GIFA 1SQPK 5L8RJ 2C0WA 3G4SP 2M3BA 1QX8A 1X79B 4HB1A 2XZRA 1LP1B 4U3FG 3Q2YA 2IZ1A 2JP3A 1MV8A 1G1IA 2OGUA 1OXZA 1Q7YQ 3KDPB 5AW0B 2Y9YA 4WY4D 1R8EA 2Z5HA 1VF5D 4AUWA 1JEKA 2B88A 4WVZA 3U1CA 1E5WA 1SLQA 2IX7C 1BGYJ 1N86A 1L4AD 2ITAA 1JY2N 2C9NY 3CWBG 2OTLP 1URQC 4WB4A 3AEDC 3Q1MA 2R32A 1JCCA 4Y28J 2B87B 1GU4A 2XNXA 1L0LJ 5APVA 2KZIA 1R5SA 2I1KA 3P32A 1KQLA 4EI2A 3GF3A 5H2FH 1FZCB 1EXIA 5DJTB 2PGDA 3SWYA 2WMMA 3A0HH 2P1JA 1WMKA 3RL0D 2OYHA 2Y9ZA 1AV1A 1JCDA 2IYOA 1JY3O 1IZNB 4PV1B 3LW5J 2WVRA 4D6TJ 3A5TA 4M3LA 5B66H 3L71J 4H13C 3KZIH 2B9BA 1J1EB 1NU1D 1FC2C 3V2RA 1NU1E 3PTZA 1K05A 3L74J 2GA1A 5KAIH 3KHUA 3ZDMA 2YXRB 1IJDB 5AW9B 3KYQA 2QRXA 1YJNP 1YIJP 1KQFB 3II6A 1VQLP 3MUDC 3FWLA 4UB8H 1ZW0A 3HTKB 4W80A 1RQUA 1LTJA 1EDLA 4JF7A 2KSEA 2QM8A 4W7ZA 1SP4A 1LGHB 3NMDA 1KQGB 1FZBA 1JO5A 3HUSB 3D71A 1S9KD 3EFGA 1YHQP 1L0LD 3HE4B 3SWFA 5AW2B 1IK7A 1JUNA 1S9KE 2WQYC 3ITKA 2WITA 2WSFH 1L0LE 1VQ5P 3M0DC 3OJAB 4JPZB 3GMAA 1NOHA 3V6IA 3CPWO 3QH9A 4R4LA 5APUA 2SPZA 3VP9A 5KLVJ 1IO4A 1GK4A 2ZFCA 2YO3A 1SQPJ 2H8PD 1HJBA 4AYCA 3RK2D 5AVQB 1KFNA 3K5BA 4RKUJ 2O3JA 1VPCA 2QJKC 1OVUA 4LGDE 1Y8AA 1BDCA 1OW7A 1GL2C 5KTBA 1KYOH 1AVYA 2FXPA 4AQRD 1RE3C 1E79H 4QMAA 1URQB 2PAJA 2UWJE 5AVXB 4IFMA 3GHGA 1SQVD 1KTMA 1JTHB 4K3AA 1UIXA 1LT1A 2V7QJ 1M90Q 1NU1G 1SQVE 2NRGA 3BVHA 1VL2A 1KMIZ 2Q3EA 3AEEC 1Y9BA 2QJPB 1ZOYC 2YIUC 2WT7A 4U3FJ 4ZKUA 1A02F 3G71P 1HH0A 2HPCA 2E75C 3FXEA 4H13B 5M1BA 1P84I 3TK1A 3NTNA 1RE4A 2JO1A 1SQQG 1UIIA 2H7HA 4UB6H 4DCKA 2AEJA 4R4MA 3CC2P 3PHLA 1AFOA 1YTZT 3CXHI 1CI6B 1DIPA 1JY3P 1JY3N 1KILA 2Q5UA 5KLVD 5AVZB 1GTWA 4I1LA 5CCHA 1NU1K 3CWBJ 1N8RQ 1KORA 1QEXA 4KJMA 2K88A 1QLED 5KLVE 1ZLLA 3BRVB 1L0LG 1NTZG 4H0LC 2E76C 4I2LC 3FX0A 1LTTC 2H88C 2W6JH 1SFCA 4L76A 4IFDK 2N1TC 1RF1A 3CXHD 1OZHA 2ZAEB 2FXMA 3CLQA 2HODA 2Q7CA 3N7NA 2QA4P 1SQQK 1S1CX 3CXHE 3CCMP 1DD4A 3IR9A 3FWNA 3JSVC 1URQD 3V2QA 2D2CC 5KJ7A 3PRJA 3UIAA 3B71A 2R3CA 1W2EA 1FZAA 2KS1A 5AW8B 1PV3A 1K9MQ 3FXDA 3V4QA 2KI7B 2B89A 3TYYA 3L70D 1NTZK 5BU5A 1SQVG 1NKZB 4L73A 1N73A 3S1KA 4N3YB 2OYHC 3LW5H 2ZJSE 1G2CB 2BASA 3L70E 2QJKB 1GZLA 1WT6A 3JCUH 2NPSC 3V2NA 1EDKA 1GL2B 3TNUA 4L75A 2FYNC 5AW7B 3W67A 3M9BA 1VQ9P 1T3UA 2BCCG 2KYVA 2P2UA 1LJ2A 2AXCA 1ZV8A 2JR8A 2H89C 1OX3A 3H6PA 1PIXA 3L35A 2FY8A 1FDOA 3F89A 5AVVB 2KZJA 1FJPA 1N7LA 3E1RA 2YIUB 1JMBA 1SQVK 3H25A 3C9IA 1EDIA 3PLNA 4L74A 5K5GB 1Q90D 2W90A 2E74D 4DJGA 4ZKPA 4YXDC 2E75B 3PJSK 5CCGC 1LTJC 3H1ID 1GD2E 5CJ0A 1ZXGA 2O1KA 1QGKB 1M57D 1IFDA 4Z1MH 4WY4A 1KB9I 4O9BA 2CPSA 3H1IE 5E79H 2OQQA 1EZVI 4PJ0H 4RJTA 2AXTH 3MGNA 3CCQP 4BXLA 3HD7C 3B5NC 5GTIE 2XKMA 3C8VA 2XV5A 1L4AA 4HYTB 1ZN5A 3OAKA 3SSUA 1YJWP 1RHZB 5EFWB 2A06D 2POHA 3MIWA 4H0LB 2E76B 4BRYA 1KB9D 1NU1J 1P84H 2J5UA 2A06E 3T97B 2N1TB 1EZVD 2YKOA 3O6QA 1VQ8P 1KB9E 1OW6A 1HVVA 1M56D 4N78D 5KKZB 1EZVE 3EFFK 3L70G 2OYOA 1N7SD 1N2DC 1YJ9P 3RK3D 2D2CB 1OVVA 2OYIB 4MN4C 2KIKA 2V7QH 1WRGA 3CX5I 1SQQJ 3RK3E 2K9JB 2M5AB 2JDIH 1PP9D 3OW2O 2KLVA 2PP6A 5B5EE 1PFIA 1JY2P 1PP9E 5CMZA 2YKQA 4YTPC 4NPFX 1LP1A 2OYHB 1J2JB 2NPSB 4C7RA 3CC4P 1M1KQ 4BWNA 1R5LA 1NTZJ 2P7JA 1USEA 3CX5D 2WSCJ 2FYNB 2BEQD 2KP8A 1PGOA 2IPPA 1L0ND 3CCEP 1PPJD 4HJGH 2YO2A 3CX5E 1NAFA 3JC22 2WPQA 1L0NE 3H1IG 3CMEP 3CI9A 3U59A 1Q81Q 1PPJE 1HF9A 1DEEG 3P8MC 3SWKA 1FDIA 5CCHC 1AA0A 4IL6H 2RN0A 1LT9C 3BCCG 4TT3H 3OA7A 3WU2H 2QVAA 2B87A 2E76D 2WTYA 5GTHH 3R4YA 2P10A 3WUUA 1S5LE 3A7OA 2N1TD 2FKWB 2Y0EA 1FZCA 1U7MA 1IFNA 2ZYAA 1RF1C 1GW3A 2IFMA 1IFJA 2J59M 1SQVJ 1IK9A 2A06G 1AVOA 1M1JC 1USDA 5KLIC 1SQQD 1AQTA 3HD7B 1ZRTD 4PD4D 3WUTA 3B5NB 3KQGA 1EZVG 1HGVA 5TISH 4GODA 5KJ7C 1SQQE 2IBZI 1LTIC 1ZRTE 4PD4E 1HBWA 2BCCJ 5AW3B 2JKVA 2QEXP 3CMAP 1DX7A 2O01H 2Q3IA 1DEBA 3U1AA 1BSNA 2A45I 2Y0CA 2YMKA 4C7NB 1NTZD 3RGUA 3TF5A 1KB9H 2R44A 2NZ2A 2CPBA 1N73C 1PP9G 2NPSD 1D7MA 4RO0A 1T2KC 5AW6B 3H1LD 3KPEA 1S72P 1NTZE 1L2PA 1FOSE 3L72D 1KZUB 4OGQC 2IBZD 2KB7P 2N9YB 3HTKA 2WPSA 3H1LE 4JQ0D 1FZGA 2ZYGA 3L72E 2YMYA 4N6JA 2Z5IA 5AW5B 3E7KA 2IBZE 1OMIA 4PV1D 3HUSA 2HLOA 1YBKA 3H32A 3HE4A 1L0NG 3G3ZA 1FE6A 1RQVA 1PPJG 3SFDC 2FFDA 1FS0E 5KAFE 1TU3F 5CCGD 3L73G 1SQXG 1Y47A 2HPCB 3MHVA 3I55P 2WSEH 2HYNA 2PFXA 2QG4A
chains in the Genus database with same CATH topology
1ZRTE 3S9OA 5M1BA 3AEFC 1ZP0C 3GMAA 4XFJA 2JO1A 2ZT9C 2WPVB 3AEAC 3C8VA 4PV1B 3LW5J 4R4LA 2D2CD 3AE7C 4R4MA 1VF5C 2ZT9D 5L8RJ 2WSCJ 2BEQD 4H13C 2QSIA 4H44B 2K9YA 2WSFJ 1YQ3C 1DIPA 1DD3A 3SFEC 3AE5C 2YMKA 4OGQB 3Q2YA 2NZ2A 4PV1C 2JP3A 1NYHA 1U57A 2E74B 2E75D 2MKVA 2IDBA 4H0LB 2E76B 4RKUJ 2FYNC 1KORA 2QJKC 4GDOA 4H44C 1K05A 3AE2C 2J5UA 1AJYA 1HF9A 1ZMEC 1OW7A 3T97B 4OGQC 4H44D 1R8EA 3FGAD 5KKZC 1FDIA 3O6QA 3AE8C 3G9RA 4U7JA 1OW8A 2H89C 3AE3C 4IL6X 2E74C 1VF5D 4OGQD 1OW6A 1YQ4C 4H0LC 1GMJA 2E76C 3AE9C 3AEBC 2FXPA 4H13D 4TT3H 1PIXA 1HJ0A 1KQFB 2H88C 3AE1C 1FDOA 3Q5RA 2E76D 3GF7A 3R4YA 2P10A 1EXJA 1K04A 1MKMA 3AE4C 1OMIA 4PV1D 2BEZF 4KT0J 1KTMA 3IAOA 2D2CB 3AEGC 1UIXA 3D6YA 2WSEJ 4I7ZB 2V7QJ 2QJPC 1RQUA 3AECC 1S1CX 3H25A 2QJYC 1NGMB 1DD4A 3AEDC 3RK3E 1RQVA 3Q1MA 1VL2A 1KMIZ 3AEEC 2G8YA 2G3AA 1Q90D 3ABVC 3SFDC 4Y28J 1Y9BA 3D70A 2E74D 1ZOYC 1JB0J 2D2CC 4H0LD 4YXDC 2E75B 2O01J 2YIUC 4I7ZC 1KQGB 1KILE 5KLIC 3D71A 1TU3F 3B71A 3EWKA 2QIWA 3GF3A 3Q3DA 3D6ZA 1PL5A 1EXIA 2ZT9B 4Z1MH 2FBWC 1S5LX 3AE6C 4YTPC 3Q5SA 3GLMA 1PV3A 3RL0g 3Q5PA 1IK7A 2E75C 1VF5B 3IN6A 2WQYC 2OQQA 4H13B 1WMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q90 D;  1ZRT E;  4Y28 J;  1JB0 J;  2E74 B;  2E75 B;  4H0L B;  2E76 B;  4RKU J;  2O01 J;  2FYN C;  2YIU C;  2QJK C;  2WPV B;  5KLI C;  3C8V A;  4PV1 B;  4KT0 J;  3LW5 J;  2QIW A;  2D2C B;  5L8R J;  2WSC J;  2WSE J;  4I7Z B;  2ZT9 B;  5KKZ C;  1S5L X;  2QSI A;  2QJP C;  4H44 B;  2K9Y A;  2QJY C;  4IL6 X;  1VF5 B;  4OGQ B;  4H13 B;  2WSF J; 
#chains in the Genus database with same CATH topology
 3IF4 A;  3S9O A;  4WY4 C;  1W2B O;  2ZXE B;  2YKP A;  2KXP B;  4LLH A;  3HD7 D;  1RF0 C;  3B5N D;  1VF5 C;  1QVF O;  2BCC D;  4OH8 B;  3A0B E;  3L70 J;  1QL1 A;  1YTZ I;  3GG2 A;  2BCC E;  1U57 A;  1L0N K;  1LT9 B;  4GKG A;  4GDO A;  4H44 C;  3USS A;  1ZME C;  1JTH A;  3G9R A;  2K1A A;  3CCS P;  2FYZ A;  3AE9 C;  1YYC A;  1FZE A;  3B8E B;  1HJ0 A;  1SQX K;  4B86 A;  1RF1 B;  3CCJ P;  2JEE A;  1EXJ A;  2HOD B;  1HGZ A;  1T8Z A;  3AEG C;  1M1J B;  1NO4 A;  5KLI B;  3G6E P;  1MZ9 A;  2LXC B;  4HH2 A;  3TDK A;  3HE5 B;  1SVF A;  1HTL C;  2W8Z A;  5AVR B;  3H1L G;  2Y0D A;  2R5D A;  3EWK A;  3L72 G;  4ZMD A;  1PGP A;  2IBZ G;  2Q1K A;  3H1I J;  1MFT A;  1BSH A;  3CCL P;  1GDT A;  2KNC B;  2M8R A;  2Z4E A;  1VQ7 P;  3MP7 B;  1S4X A;  3M9H A;  1N73 B;  2A45 G;  3BCC J;  3MD0 A;  3H1H G;  3MUD A;  2QSI A;  4IFF A;  2K9Y A;  1YQ3 C;  2V4H A;  1JOC A;  1LNQ A;  3LID A;  4OGQ B;  5TJH A;  4OVN F;  3TNU B;  2L5G B;  1CZQ A;  2O01 N;  4XA4 A;  3AE2 C;  1KQS O;  1NWQ A;  3VMA A;  2FYU G;  4H13 D;  3CCV P;  1ZR2 A;  4I6M C;  5AW1 B;  3EQ2 A;  3H1J J;  3I56 P;  1FBM A;  1OWA A;  4KT0 J;  2W6A A;  5KAF H;  3M0D A;  3P8C D;  1JMM A;  1AQ5 A;  1MFZ A;  1FDM A;  5APY A;  1OFC X;  1YI2 P;  2G8Y A;  1OIP A;  3D70 A;  1LWU A;  3P8C E;  5H2F E;  3A0H E;  1S5L X;  1PP9 J;  1X8Y A;  5DJU B;  3RK2 C;  3CCR P;  4ASV A;  3GLM A;  3RL0 g;  4GOF A;  1Q86 Q;  1GW4 A;  1VF5 B;  2JJL A;  3E1I A;  4A7P A;  5AVS B;  1RH5 B;  2FYU K;  3VOP A;  3CCU P;  2KOG A;  3NFQ A;  5B66 E;  1N7S A;  3KZI E;  5APX A;  3S4R A;  3L75 G;  4H44 B;  1VQM P;  3BCC D;  4Y99 C;  4BRY B;  1H0T A;  2MKV A;  1LTB C;  3TGU D;  2LXB A;  1L0N J;  5KAI E;  3BCC E;  1PGJ A;  3AE8 C;  1IFP A;  3AE3 C;  3TGU E;  1VQO P;  4OGQ D;  2IFN A;  3Q5R A;  3L73 J;  4JYC A;  1SQX J;  1BE3 G;  1NH4 A;  3BAT A;  3H1J D;  1EDJ A;  1DH3 A;  3CXH H;  1GL2 D;  4NPD A;  4EYY Q;  3WUV A;  3H1J E;  2CK3 H;  1RY3 A;  1KYO I;  2P58 A;  4N78 E;  2FFD C;  3AE6 C;  1XTG B;  3W68 A;  3Q5S A;  4ZNC A;  4DOJ A;  1MUU A;  3GHG C;  4OWF A;  3F5H A;  3RBX A;  3AEF C;  1ZP0 C;  2JWD A;  5AVY B;  2W6B A;  2ZT9 C;  1VDF A;  2R5B A;  3AE7 C;  3CD6 P;  3T97 A;  2N1T A;  5APT A;  4EDF A;  3SFE C;  2K3R A;  1KYO D;  3M9Q A;  1FU1 A;  3A3Y B;  2Q6Q A;  2E75 D;  2IDB A;  1X0T A;  1NKN A;  3V2P A;  2J58 A;  4WWI A;  4IOI H;  1AJY A;  1KYO E;  1PZQ A;  1NTM K;  4H44 D;  2FXO A;  2ZXX A;  3FGA D;  2OYI A;  1J1D C;  2RKL A;  3H1L J;  1RE4 C;  2W27 A;  2K9J A;  5BVZ A;  2YNY A;  1IC2 A;  3L72 J;  3M0A A;  2I1J A;  2M5A A;  1FAV A;  2AEM A;  4YPC A;  1KD1 Q;  1YIT P;  1KIL C;  3L73 D;  2QJP C;  1SQX D;  1NTK D;  4W7Y A;  5CHX A;  4PD4 I;  3RK2 B;  4C46 A;  3BRT B;  2HR3 A;  3L73 E;  4H0L D;  1SQX E;  1NTK E;  3H1H J;  3TGU G;  2NPS A;  3R2P A;  3PH0 A;  3H1K G;  2IYP A;  3V4W A;  4NPE A;  2FBW C;  2KK7 A;  1LTJ B;  1SQB D;  1SFC C;  1PGQ A;  3IN6 A;  3I5C A;  4UB6 E;  1SQB E;  2ZYD A;  2FYU J;  3AEA C;  4Y99 B;  1CW5 A;  3VP8 A;  2D2C D;  5GTI H;  1VQP P;  3H1J G;  1KC8 Q;  4JYB A;  2YXQ B;  1H89 A;  1LTS C;  1BGY D;  5BU8 B;  2E43 A;  2OAR A;  5CCG A;  2K37 A;  1OW8 A;  5AVT B;  2E74 C;  4DT0 A;  4HKZ H;  3O8Z A;  5APQ A;  3VTP C;  1CSB A;  1JM0 A;  1BGY E;  3H32 B;  1FJK A;  3HD7 A;  3B5N A;  1H8A A;  3AEC C;  2AEF A;  2QJY C;  1LTG C;  1BCC J;  2FFD B;  3HRN A;  1K73 Q;  3QWO C;  3GHG B;  4I7Z C;  3L75 J;  1IFI A;  4RES B;  2KLU A;  2LKM A;  1QVG O;  2QIW A;  3Q3D A;  5B5E H;  2ZT9 B;  3H1H D;  4ASW A;  1LWU C;  2W83 C;  1VQK P;  4D6T D;  4C7N A;  2GM4 A;  3L71 D;  2MJZ A;  2RMZ A;  2O1J A;  3H1H E;  2WT7 B;  4XFJ A;  1Q82 Q;  2E42 A;  4D6T E;  3L71 E;  3JCU E;  1QL2 A;  1HWT C;  5CJ4 A;  1NTK G;  2FYU D;  1H88 A;  3L74 D;  2I8D A;  1HUC A;  2IZ0 A;  1N7S C;  3BAS A;  1BE3 J;  3V5B A;  1J1D B;  3RK3 C;  1T6A A;  4DZO A;  2FYU E;  3CX5 H;  3L74 E;  2E5T A;  1JNM A;  1SQB G;  4U7J A;  5AW4 B;  4IL6 X;  1NTM J;  1GMJ A;  1KIL B;  1VQ4 P;  1K8A Q;  2N9B A;  2OTJ P;  1L4A C;  3GF7 A;  3L37 A;  1URQ A;  1MKM A;  2RH0 A;  4JBZ A;  3IAO A;  1S5L H;  4GOE A;  2GUS A;  1EC5 A;  1M8O B;  1T3J A;  2VRS A;  4CPG A;  2G3A A;  3ABV C;  1NHL A;  1NTK K;  1SFC B;  3MZW B;  1BCC D;  3WMM 0;  5CBN A;  5E79 E;  1BGY G;  1PL5 A;  2H43 A;  3RL0 C;  3L75 D;  2JWA A;  3Q5P A;  4PJ0 E;  1BCC E;  2AXT E;  3C1L A;  2KUB A;  1SQB K;  1X22 A;  1SQP D;  1M7L A;  2HFE D;  1LT9 A;  3L75 E;  4PD4 H;  2QM7 A;  1X9V A;  2ZT9 D;  2KS1 B;  1SQP E;  2KSJ A;  1P84 D;  1SS1 A;  1NJI Q;  1CI6 A;  3AE5 C;  4EOT A;  2ZVO B;  1NYH A;  2E74 B;  1P84 E;  1Q2N A;  3LIE A;  2XU6 A;  2PRR A;  1BE3 D;  5KKZ C;  2ZVN B;  1M1J A;  2WZ7 A;  1NVO A;  1GK6 A;  2WSC H;  1FOS F;  3TGU J;  4D6T G;  1JY2 O;  3AEB C;  3HE5 A;  1BE3 E;  3M06 A;  3H1K J;  3L71 G;  1NAY A;  1BDD A;  3AE1 C;  2QJY B;  5AVW B;  3PP5 A;  2OYI C;  3RBZ A;  1IFM A;  1K04 A;  1NTM D;  2BEZ F;  1XTC C;  3D6Y A;  4I7Z B;  4EIJ A;  1NTM E;  3L74 G;  1KIL D;  1NGM B;  1KFM A;  3L4F A;  4U3F D;  3VMX A;  1L0L K;  5CCH D;  3IFM A;  1LWU B;  2A45 H;  2KNC A;  3L36 A;  2O01 J;  1KIL E;  4K35 A;  1EQ7 A;  4U3F E;  3KXD A;  3N4X A;  4GT1 A;  2WWW A;  2WSF J;  1SFC D;  3VYI A;  1OVR A;  3VMY A;  1FZC C;  1N7S B;  3MTU E;  2L91 A;  3RK3 B;  2WSS H;  3TSI A;  4WY4 B;  1VQ6 P;  4WBA A;  3CWB D;  4YXW H;  1G2C A;  3CC7 P;  1DD3 A;  3A0B H;  1GU5 A;  1H0T B;  4PV1 C;  1ZR4 A;  2DW3 A;  5KJ7 D;  3P7K A;  5C39 A;  3A2A A;  1S3J A;  3CWB E;  1GL2 A;  3VN0 A;  1BCC G;  1J1E C;  3NXS A;  1L4A B;  1RE3 A;  4IL6 E;  1LTA C;  5AVU B;  1VQN P;  2QE7 H;  3WU2 E;  2C9L Y;  1YQ4 C;  1U7J A;  5KLV G;  5GTH E;  2M0B A;  1SQP G;  4TLF A;  2GUV A;  3AE4 C;  2C0X A;  2Q9I A;  2E5Y A;  1T2K D;  3H1K D;  4LC1 A;  1Z56 A;  2WSE J;  2LR2 A;  3O6Q B;  5APW A;  3CL3 D;  1RF0 A;  3GW6 A;  3H1K E;  1W5C E;  3RL0 B;  2XDJ A;  1JB0 J;  2XND H;  1A02 J;  1FZF A;  2HG5 D;  1NTK J;  4UB8 E;  5TIS E;  2R3S A;  3D6Z A;  3B4S A;  5APS A;  3VMZ A;  5CBO A;  2OTK E;  3M91 A;  1G1J A;  4KHX A;  2P67 A;  3HUS C;  1KV4 A;  1S2E A;  1KN7 A;  1NTM G;  1SQB J;  5KLV K;  2WPV B;  4XE5 B;  2WPR A;  2M3E A;  4GIF A;  1SQP K;  5L8R J;  2C0W A;  3G4S P;  2M3B A;  1QX8 A;  1X79 B;  4HB1 A;  2XZR A;  1LP1 B;  4U3F G;  3Q2Y A;  2IZ1 A;  2JP3 A;  1MV8 A;  1G1I A;  2OGU A;  1OXZ A;  1Q7Y Q;  3KDP B;  5AW0 B;  2Y9Y A;  4WY4 D;  1R8E A;  2Z5H A;  1VF5 D;  4AUW A;  1JEK A;  2B88 A;  4WVZ A;  3U1C A;  1E5W A;  1SLQ A;  2IX7 C;  1BGY J;  1N86 A;  1L4A D;  2ITA A;  1JY2 N;  2C9N Y;  3CWB G;  2OTL P;  1URQ C;  4WB4 A;  3AED C;  3Q1M A;  2R32 A;  1JCC A;  4Y28 J;  2B87 B;  1GU4 A;  2XNX A;  1L0L J;  5APV A;  2KZI A;  1R5S A;  2I1K A;  3P32 A;  1KQL A;  4EI2 A;  3GF3 A;  5H2F H;  1FZC B;  1EXI A;  5DJT B;  2PGD A;  3SWY A;  2WMM A;  3A0H H;  2P1J A;  1WMK A;  3RL0 D;  2OYH A;  2Y9Z A;  1AV1 A;  1JCD A;  2IYO A;  1JY3 O;  1IZN B;  4PV1 B;  3LW5 J;  2WVR A;  4D6T J;  3A5T A;  4M3L A;  5B66 H;  3L71 J;  4H13 C;  3KZI H;  2B9B A;  1J1E B;  1NU1 D;  1FC2 C;  3V2R A;  1NU1 E;  3PTZ A;  1K05 A;  3L74 J;  2GA1 A;  5KAI H;  3KHU A;  3ZDM A;  2YXR B;  1IJD B;  5AW9 B;  3KYQ A;  2QRX A;  1YJN P;  1YIJ P;  1KQF B;  3II6 A;  1VQL P;  3MUD C;  3FWL A;  4UB8 H;  1ZW0 A;  3HTK B;  4W80 A;  1RQU A;  1LTJ A;  1EDL A;  4JF7 A;  2KSE A;  2QM8 A;  4W7Z A;  1SP4 A;  1LGH B;  3NMD A;  1KQG B;  1FZB A;  1JO5 A;  3HUS B;  3D71 A;  1S9K D;  3EFG A;  1YHQ P;  1L0L D;  3HE4 B;  3SWF A;  5AW2 B;  1IK7 A;  1JUN A;  1S9K E;  2WQY C;  3ITK A;  2WIT A;  2WSF H;  1L0L E;  1VQ5 P;  3M0D C;  3OJA B;  4JPZ B;  3GMA A;  1NOH A;  3V6I A;  3CPW O;  3QH9 A;  4R4L A;  5APU A;  2SPZ A;  3VP9 A;  5KLV J;  1IO4 A;  1GK4 A;  2ZFC A;  2YO3 A;  1SQP J;  2H8P D;  1HJB A;  4AYC A;  3RK2 D;  5AVQ B;  1KFN A;  3K5B A;  4RKU J;  2O3J A;  1VPC A;  2QJK C;  1OVU A;  4LGD E;  1Y8A A;  1BDC A;  1OW7 A;  1GL2 C;  5KTB A;  1KYO H;  1AVY A;  2FXP A;  4AQR D;  1RE3 C;  1E79 H;  4QMA A;  1URQ B;  2PAJ A;  2UWJ E;  5AVX B;  4IFM A;  3GHG A;  1SQV D;  1KTM A;  1JTH B;  4K3A A;  1UIX A;  1LT1 A;  2V7Q J;  1M90 Q;  1NU1 G;  1SQV E;  2NRG A;  3BVH A;  1VL2 A;  1KMI Z;  2Q3E A;  3AEE C;  1Y9B A;  2QJP B;  1ZOY C;  2YIU C;  2WT7 A;  4U3F J;  4ZKU A;  1A02 F;  3G71 P;  1HH0 A;  2HPC A;  2E75 C;  3FXE A;  4H13 B;  5M1B A;  1P84 I;  3TK1 A;  3NTN A;  1RE4 A;  2JO1 A;  1SQQ G;  1UII A;  2H7H A;  4UB6 H;  4DCK A;  2AEJ A;  4R4M A;  3CC2 P;  3PHL A;  1AFO A;  1YTZ T;  3CXH I;  1CI6 B;  1DIP A;  1JY3 P;  1JY3 N;  1KIL A;  2Q5U A;  5KLV D;  5AVZ B;  1GTW A;  4I1L A;  5CCH A;  1NU1 K;  3CWB J;  1N8R Q;  1KOR A;  1QEX A;  4KJM A;  2K88 A;  1QLE D;  5KLV E;  1ZLL A;  3BRV B;  1L0L G;  1NTZ G;  4H0L C;  2E76 C;  4I2L C;  3FX0 A;  1LTT C;  2H88 C;  2W6J H;  1SFC A;  4L76 A;  4IFD K;  2N1T C;  1RF1 A;  3CXH D;  1OZH A;  2ZAE B;  2FXM A;  3CLQ A;  2HOD A;  2Q7C A;  3N7N A;  2QA4 P;  1SQQ K;  1S1C X;  3CXH E;  3CCM P;  1DD4 A;  3IR9 A;  3FWN A;  3JSV C;  1URQ D;  3V2Q A;  2D2C C;  5KJ7 A;  3PRJ A;  3UIA A;  3B71 A;  2R3C A;  1W2E A;  1FZA A;  2KS1 A;  5AW8 B;  1PV3 A;  1K9M Q;  3FXD A;  3V4Q A;  2KI7 B;  2B89 A;  3TYY A;  3L70 D;  1NTZ K;  5BU5 A;  1SQV G;  1NKZ B;  4L73 A;  1N73 A;  3S1K A;  4N3Y B;  2OYH C;  3LW5 H;  2ZJS E;  1G2C B;  2BAS A;  3L70 E;  2QJK B;  1GZL A;  1WT6 A;  3JCU H;  2NPS C;  3V2N A;  1EDK A;  1GL2 B;  3TNU A;  4L75 A;  2FYN C;  5AW7 B;  3W67 A;  3M9B A;  1VQ9 P;  1T3U A;  2BCC G;  2KYV A;  2P2U A;  1LJ2 A;  2AXC A;  1ZV8 A;  2JR8 A;  2H89 C;  1OX3 A;  3H6P A;  1PIX A;  3L35 A;  2FY8 A;  1FDO A;  3F89 A;  5AVV B;  2KZJ A;  1FJP A;  1N7L A;  3E1R A;  2YIU B;  1JMB A;  1SQV K;  3H25 A;  3C9I A;  1EDI A;  3PLN A;  4L74 A;  5K5G B;  1Q90 D;  2W90 A;  2E74 D;  4DJG A;  4ZKP A;  4YXD C;  2E75 B;  3PJS K;  5CCG C;  1LTJ C;  3H1I D;  1GD2 E;  5CJ0 A;  1ZXG A;  2O1K A;  1QGK B;  1M57 D;  1IFD A;  4Z1M H;  4WY4 A;  1KB9 I;  4O9B A;  2CPS A;  3H1I E;  5E79 H;  2OQQ A;  1EZV I;  4PJ0 H;  4RJT A;  2AXT H;  3MGN A;  3CCQ P;  4BXL A;  3HD7 C;  3B5N C;  5GTI E;  2XKM A;  3C8V A;  2XV5 A;  1L4A A;  4HYT B;  1ZN5 A;  3OAK A;  3SSU A;  1YJW P;  1RHZ B;  5EFW B;  2A06 D;  2POH A;  3MIW A;  4H0L B;  2E76 B;  4BRY A;  1KB9 D;  1NU1 J;  1P84 H;  2J5U A;  2A06 E;  3T97 B;  2N1T B;  1EZV D;  2YKO A;  3O6Q A;  1VQ8 P;  1KB9 E;  1OW6 A;  1HVV A;  1M56 D;  4N78 D;  5KKZ B;  1EZV E;  3EFF K;  3L70 G;  2OYO A;  1N7S D;  1N2D C;  1YJ9 P;  3RK3 D;  2D2C B;  1OVV A;  2OYI B;  4MN4 C;  2KIK A;  2V7Q H;  1WRG A;  3CX5 I;  1SQQ J;  3RK3 E;  2K9J B;  2M5A B;  2JDI H;  1PP9 D;  3OW2 O;  2KLV A;  2PP6 A;  5B5E E;  1PFI A;  1JY2 P;  1PP9 E;  5CMZ A;  2YKQ A;  4YTP C;  4NPF X;  1LP1 A;  2OYH B;  1J2J B;  2NPS B;  4C7R A;  3CC4 P;  1M1K Q;  4BWN A;  1R5L A;  1NTZ J;  2P7J A;  1USE A;  3CX5 D;  2WSC J;  2FYN B;  2BEQ D;  2KP8 A;  1PGO A;  2IPP A;  1L0N D;  3CCE P;  1PPJ D;  4HJG H;  2YO2 A;  3CX5 E;  1NAF A;  3JC2 2;  2WPQ A;  1L0N E;  3H1I G;  3CME P;  3CI9 A;  3U59 A;  1Q81 Q;  1PPJ E;  1HF9 A;  1DEE G;  3P8M C;  3SWK A;  1FDI A;  5CCH C;  1AA0 A;  4IL6 H;  2RN0 A;  1LT9 C;  3BCC G;  4TT3 H;  3OA7 A;  3WU2 H;  2QVA A;  2B87 A;  2E76 D;  2WTY A;  5GTH H;  3R4Y A;  2P10 A;  3WUU A;  1S5L E;  3A7O A;  2N1T D;  2FKW B;  2Y0E A;  1FZC A;  1U7M A;  1IFN A;  2ZYA A;  1RF1 C;  1GW3 A;  2IFM A;  1IFJ A;  2J59 M;  1SQV J;  1IK9 A;  2A06 G;  1AVO A;  1M1J C;  1USD A;  5KLI C;  1SQQ D;  1AQT A;  3HD7 B;  1ZRT D;  4PD4 D;  3WUT A;  3B5N B;  3KQG A;  1EZV G;  1HGV A;  5TIS H;  4GOD A;  5KJ7 C;  1SQQ E;  2IBZ I;  1LTI C;  1ZRT E;  4PD4 E;  1HBW A;  2BCC J;  5AW3 B;  2JKV A;  2QEX P;  3CMA P;  1DX7 A;  2O01 H;  2Q3I A;  1DEB A;  3U1A A;  1BSN A;  2A45 I;  2Y0C A;  2YMK A;  4C7N B;  1NTZ D;  3RGU A;  3TF5 A;  1KB9 H;  2R44 A;  2NZ2 A;  2CPB A;  1N73 C;  1PP9 G;  2NPS D;  1D7M A;  4RO0 A;  1T2K C;  5AW6 B;  3H1L D;  3KPE A;  1S72 P;  1NTZ E;  1L2P A;  1FOS E;  3L72 D;  1KZU B;  4OGQ C;  2IBZ D;  2KB7 P;  2N9Y B;  3HTK A;  2WPS A;  3H1L E;  4JQ0 D;  1FZG A;  2ZYG A;  3L72 E;  2YMY A;  4N6J A;  2Z5I A;  5AW5 B;  3E7K A;  2IBZ E;  1OMI A;  4PV1 D;  3HUS A;  2HLO A;  1YBK A;  3H32 A;  3HE4 A;  1L0N G;  3G3Z A;  1FE6 A;  1RQV A;  1PPJ G;  3SFD C;  2FFD A;  1FS0 E;  5KAF E;  1TU3 F;  5CCG D;  3L73 G;  1SQX G;  1Y47 A;  2HPC B;  3MHV A;  3I55 P;  2WSE H;  2HYN A;  2PFX A;  2QG4 A; 
#chains in the Genus database with same CATH homology
 1ZRT E;  3S9O A;  5M1B A;  3AEF C;  1ZP0 C;  3GMA A;  4XFJ A;  2JO1 A;  2ZT9 C;  2WPV B;  3AEA C;  3C8V A;  4PV1 B;  3LW5 J;  4R4L A;  2D2C D;  3AE7 C;  4R4M A;  1VF5 C;  2ZT9 D;  5L8R J;  2WSC J;  2BEQ D;  4H13 C;  2QSI A;  4H44 B;  2K9Y A;  2WSF J;  1YQ3 C;  1DIP A;  1DD3 A;  3SFE C;  3AE5 C;  2YMK A;  4OGQ B;  3Q2Y A;  2NZ2 A;  4PV1 C;  2JP3 A;  1NYH A;  1U57 A;  2E74 B;  2E75 D;  2MKV A;  2IDB A;  4H0L B;  2E76 B;  4RKU J;  2FYN C;  1KOR A;  2QJK C;  4GDO A;  4H44 C;  1K05 A;  3AE2 C;  2J5U A;  1AJY A;  1HF9 A;  1ZME C;  1OW7 A;  3T97 B;  4OGQ C;  4H44 D;  1R8E A;  3FGA D;  5KKZ C;  1FDI A;  3O6Q A;  3AE8 C;  3G9R A;  4U7J A;  1OW8 A;  2H89 C;  3AE3 C;  4IL6 X;  2E74 C;  1VF5 D;  4OGQ D;  1OW6 A;  1YQ4 C;  4H0L C;  1GMJ A;  2E76 C;  3AE9 C;  3AEB C;  2FXP A;  4H13 D;  4TT3 H;  1PIX A;  1HJ0 A;  1KQF B;  2H88 C;  3AE1 C;  1FDO A;  3Q5R A;  2E76 D;  3GF7 A;  3R4Y A;  2P10 A;  1EXJ A;  1K04 A;  1MKM A;  3AE4 C;  1OMI A;  4PV1 D;  2BEZ F;  4KT0 J;  1KTM A;  3IAO A;  2D2C B;  3AEG C;  1UIX A;  3D6Y A;  2WSE J;  4I7Z B;  2V7Q J;  2QJP C;  1RQU A;  3AEC C;  1S1C X;  3H25 A;  2QJY C;  1NGM B;  1DD4 A;  3AED C;  3RK3 E;  1RQV A;  3Q1M A;  1VL2 A;  1KMI Z;  3AEE C;  2G8Y A;  2G3A A;  1Q90 D;  3ABV C;  3SFD C;  4Y28 J;  1Y9B A;  3D70 A;  2E74 D;  1ZOY C;  1JB0 J;  2D2C C;  4H0L D;  4YXD C;  2E75 B;  2O01 J;  2YIU C;  4I7Z C;  1KQG B;  1KIL E;  5KLI C;  3D71 A;  1TU3 F;  3B71 A;  3EWK A;  2QIW A;  3GF3 A;  3Q3D A;  3D6Z A;  1PL5 A;  1EXI A;  2ZT9 B;  4Z1M H;  2FBW C;  1S5L X;  3AE6 C;  4YTP C;  3Q5S A;  3GLM A;  1PV3 A;  3RL0 g;  3Q5P A;  1IK7 A;  2E75 C;  1VF5 B;  3IN6 A;  2WQY C;  2OQQ A;  4H13 B;  1WMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...