1JB0J

Crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
41
structure length
41
Chain Sequence
MKHFLTYLSTAPVLAAIWMTITAGILIEFNRFYPDLLFHPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords PHOTOSYSTEM I P700 CHLOROPHYLL A APOPROTEIN A1
publication title Three-dimensional Structure of Cyanobacterial Photosystem I at 2.5 A Resolution
pubmed doi rcsb
total genus 12
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2001-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1jb0J00
2K9YA 2QJPC 4RKUJ 2QIWA 4KT0J 5KLIC 2YIUC 2QJYC 1S5LX 2WSFJ 5L8RJ 2WSCJ 3LW5J 1Q90D 2E74B 2FYNC 2WSEJ 4H13B 1JB0J 2QJKC 1VF5B 2E75B 5KKZC 2D2CB 2QSIA 4IL6X 2WPVB 2E76B 4H44B 4I7ZB 4OGQB 4Y28J 1ZRTE 2ZT9B 2O01J 3C8VA 4H0LB 4PV1B
chains in the Genus database with same CATH superfamily
4H44D 2ITAA 1OVUA 1OWAA 5CJ0A 2OYHB 2IYOA 3I5CA 1FDOA 4YPCA 1YJNP 4BWNA 2Q6QA 2AEFA 5KAIE 4Z1MH 2BASA 2SPZA 1ZV8A 2CK3H 4Y99B 3PTZA 3LIDA 1J1DB 5AVZB 1OIPA 2I8DA 1U7MA 2GM4A 4WY4A 2JWAA 2NZ2A 2WSEJ 5KAFE 3SFEC 3H1IJ 5APSA 4N6JA 3RGUA 2J58A 2BCCE 1SQPJ 3C8VA 2OGUA 1GD2E 1PP9J 1MFTA 1NKNA 2ZAEB 3RL0g 2KS1B 1Z56A 3CLQA 1NTME 1E79H 3B5NB 1DD4A 2E5TA 5KJ7C 5CBNA 2UWJE 3VMZA 1BE3J 1UIXA 1SFCD 3RK3E 4U3FE 3RK3C 3MUDC 3A0BH 1YQ4C 1VQLP 3HTKA 1JB0J 1OW7A 3CMAP 5KTBA 3L71D 1QVFO 4PD4H 1PGPA 2FY8A 3H1JE 1NTKD 1JY2O 3RL0D 2WPQA 1AQ5A 3TDKA 1NO4A 3WU2E 2IYPA 2K9JA 1ZR2A 1LTJC 1P84E 1KYOH 3CX5E 2ZXEB 2O01N 3Q3DA 4N78D 1PGQA 4I1LA 3GHGC 3L37A 2N1TA 1NTZD 2A06D 3A3YB 3G3ZA 3O6QA 1L0NK 2H43A 1RE4C 2A45I 2LR2A 4BRYA 2ZVOB 2ZT9B 1DD3A 3CWBD 2E76D 3H1LJ 1EDIA 3FWNA 3CC7P 1KMIZ 1X8YA 3K5BA 2IFMA 1GL2A 1EZVI 2YNYA 5APTA 1PGOA 1ZN5A 1AA0A 1AFOA 5BU5A 3N7NA 3MUDA 1GMJA 3RK2B 2QJYB 1RE3A 1CSBA 2A45G 2QVAA 3V6IA 2WVRA 3H6PA 4JYCA 1MV8A 3T97A 1BDCA 3D71A 4KHXA 3L72J 1SQQK 4EI2A 4OVNF 4JBZA 1Y9BA 4L75A 4UB6H 5APUA 3KZIH 2L91A 4JYBA 3LIEA 5AW0B 2E42A 1PFIA 1PP9E 3GHGA 1OW8A 3H1HJ 4DT0A 1M1JC 1S4XA 2FYZA 2WSCH 3LW5H 3EWKA 1PPJE 1RE4A 2OYIC 4OGQC 1NTKK 2K3RA 1IO4A 3HUSA 4D6TJ 3HTKB 1GTWA 1VQMP 4H0LB 3L74G 4ZKPA 2H8PD 2GUVA 1NJIQ 2PFXA 3H1JD 1VQ5P 5APWA 2M8RA 4IL6X 2XZRA 3E7KA 3HE4B 4PV1B 1RF0A 1P84D 1L2PA 1VQ4P 2FXPA 1LTIC 1FU1A 2N1TB 1LT9A 2KSJA 5B5EE 2PAJA 5AW6B 3A0HH 4PJ0H 3O6QB 4Y99C 2HFED 1N7SD 5APXA 1J1DC 2XU6A 3FXEA 1KB9H 4BRYB 5CCGD 3PHLA 2L5GB 3WUTA 3HD7A 5KLIB 4AUWA 1KILC 3TNUA 3V5BA 3P7KA 2NPSA 1BCCJ 2V4HA 1M1JA 1GL2B 1M7LA 1JY3N 1H88A 1W2BO 1FOSF 2WWWA 3L70E 1T3UA 1KQLA 1ZP0C 1EQ7A 1N7LA 3SWYA 3B5NC 3L35A 1YBKA 3OAKA 3V2PA 3Q5RA 2J59M 2JEEA 3FX0A 3T97B 3CCUP 1BGYG 1IC2A 2KLVA 3M9HA 5AVYB 4ZMDA 1FC2C 1SQVE 3A7OA 1QL2A 1NTMK 2I1JA 1NHLA 3TGUE 1YYCA 1L0LE 1LTJB 3L72E 3H1ID 3FXDA 2OTKE 1SQPD 2FYUJ 3GHGB 4DCKA 2WTYA 2OTLP 1PP9D 1KFMA 2BEZF 3A2AA 1Q81Q 3N4XA 2M3BA 5CHXA 1KORA 2C0WA 1CW5A 1NGMB 3IR9A 2ZVNB 3MHVA 1IJDB 2JWDA 3HUSB 1W5CE 2QIWA 1YTZT 2BCCJ 3H32A 1LTBC 3H1KJ 1NTZG 3CCMP 2WSFJ 1KILA 1BE3D 1PV3A 2A06G 2E74B 4U7JA 1RH5B 1JY2P 3VOPA 3GMAA 4N3YB 1NTMJ 3GF3A 1VDFA 3CWBG 3WMM0 1T2KD 4I2LC 3AE2C 1VQ7P 1OFCX 4M3LA 4NPFX 1RF1C 1KQGB 4PD4E 4U3FJ 5CCHC 3P8MC 2IBZD 4I7ZB 1LT9B 1PGJA 2RH0A 3V2QA 5KLVG 4DZOA 2IDBA 2XKMA 3AEEC 3RK2C 4AQRD 1DH3A 4GODA 1KYOE 3HD7B 4WY4C 3AECC 1VF5B 1W2EA 2O01H 3E1RA 3TNUB 1PZQA 3L75E 2NPSB 3AEGC 1GU4A 2JJLA 1M1JB 1NYHA 4LGDE 2Q5UA 4RESB 3G4SP 1L4AA 2A45H 3H1LD 2KZIA 4LC1A 4K35A 3C1LA 3M0DC 1BCCE 3PRJA 1HJ0A 1OXZA 1IFNA 4TT3H 1IK9A 1K73Q 4OGQB 3BCCE 3U59A 3B5ND 4W7YA 2E75D 4DOJA 1WRGA 3SFDC 2YO2A 2OQQA 1P84I 2MJZA 2Q3IA 1VQOP 3EFFK 3S9OA 2KIKA 3KPEA 2P58A 1ZLLA 1EXIA 1FZEA 3L4FA 2KYVA 3G9RA 1T8ZA 5BU8B 1KD1Q 3L72D 1RF1A 2RKLA 3M9BA 5CCHA 2QG4A 1OZHA 1IFIA 1FJKA 1Q82Q 1YIJP 4PV1C 2FYUE 3CL3D 1GDTA 3H1HD 4H13C 4UB6E 2N1TC 3H32B 3AE4C 1SFCA 3BVHA 1KILB 3L73G 1HGVA 1CI6A 2PP6A 1DIPA 2AXTH 4D6TD 4L74A 3H1KE 1JCCA 1NU1G 4DJGA 1SLQA 2WSSH 2ZT9D 5KLIC 1JTHA 3KXDA 2ZYAA 1G1JA 3M0DA 3JC22 3AE6C 3B4SA 4WVZA 1EC5A 1SQQD 4CPGA 2P67A 1GL2C 4W7ZA 1NVOA 2W27A 1GK4A 1SQXG 1X9VA 1FZAA 2P7JA 4YXWH 3TF5A 1MUUA 1FZGA 3S4RA 1RE3C 3RK2D 1SQBG 3A5TA 1DEBA 3TSIA 1KQFB 5E79H 3WUUA 3S1KA 3VMXA 5CJ4A 1LWUA 1Q86Q 2O1KA 5TISH 1FZCA 1L4AB 2KNCA 5AW9B 2FBWC 2QJKB 2HLOA 1KB9E 3H1IG 1RHZB 3U1CA 2IFNA 3QWOC 2YMYA 1BCCD 1SQPG 4A7PA 1S3JA 1VPCA 2WMMA 4YXDC 5TJHA 1PP9G 1HH0A 1URQA 2KOGA 1UIIA 1HGZA 5CBOA 1SQVK 1FDMA 1LGHB 1IZNB 3HUSC 2IBZI 1VQKP 5C39A 1L0LK 3B8EB 1OMIA 2HG5D 4HJGH 4H0LD 1GU5A 2IZ1A 1BE3G 2YKQA 1K05A 2P10A 3KHUA 2E74C 4ASWA 3I55P 2OYOA 2O1JA 4HH2A 2N9YB 1RF1B 3L70J 3V2NA 2Y0DA 1KQSO 1S5LH 3MP7B 1FDIA 3VMAA 1VQ6P 1RF0C 3CCSP 1QLED 2FYUD 1S9KE 4IFMA 1SVFA 1SP4A 2FFDA 4I7ZC 1LT9C 3GLMA 3ITKA 1HTLC 1RQVA 2IBZG 3R2PA 4WY4B 1N8RQ 1SQVJ 2K1AA 1SFCB 2H88C 2C9NY 3W68A 5H2FH 2N9BA 4IL6E 3TGUJ 2Z4EA 1CI6B 1L0LJ 3CC4P 4UB8H 2BCCD 3H1KD 3HD7C 1VF5C 2W90A 3AEDC 4ZNCA 1EZVG 1JOCA 1QVGO 3MGNA 2NPSC 4Y28J 2V7QH 3CCLP 5KAIH 1KC8Q 1NTMD 3AE5C 2DW3A 4WBAA 1M8OB 3H1LG 3MD0A 2ZXXA 5KJ7D 2FXMA 5KAFH 1GW4A 3RK3D 5AW2B 4U3FD 3CXHE 1NKZB 3VP8A 1N7SA 2B9BA 2ZYDA 3AE1C 4NPEA 1LWUB 3CC2P 1L0NG 1FZCB 2K9JB 3AEBC 2KNCB 1AQTA 1YI2P 5AVQB 4AYCA 3CX5D 4EIJA 1XTCC 1OVRA 4H13B 4GDOA 1PIXA 1URQB 2H7HA 2P2UA 1BGYJ 1FBMA 2M5AA 1Y47A 3H1HG 3L75J 1JCDA 3RBXA 2LKMA 3IN6A 1FS0E 3WU2H 1KILE 1NWQA 3HE5A 2E74D 1P84H 3WUVA 4D6TG 3NMDA 1N73C 2FYUK 4RJTA 3BCCJ 2KZJA 1NH4A 3V4WA 1HJBA 1HF9A 3JCUE 2G8YA 1ZW0A 2XNXA 2Z5HA 1SQQG 3V4QA 1JM0A 2AEMA 3NTNA 4GT1A 2NRGA 3SWKA 2FFDB 1U7JA 4JF7A 5APYA 1MZ9A 2ZJSE 2E5YA 2YKPA 1S2EA 3BATA 2KXPB 3AE8C 3L74E 4GIFA 5GTIH 3GG2A 1R5SA 3L71G 1YJWP 3HD7D 1NTKG 3UIAA 3MTUE 4K3AA 4QMAA 3CCQP 5L8RJ 1AVYA 2JDIH 1L4AC 2QJKC 3OJAB 2AXTE 1X0TA 2MKVA 2LXCB 2Y9YA 1JEKA 2Q7CA 2OYHA 4IFDK 1LTTC 5KLVJ 3ABVC 1PPJD 2QM7A 4OGQD 1JMBA 5AW4B 3CXHD 2WSEH 2WSCJ 3LW5J 3V2RA 1N7SB 2C0XA 1N73A 3QH9A 3F5HA 3G6EP 4RKUJ 3A0BE 3D6YA 3B71A 2YO3A 1PL5A 2E43A 1H0TA 3ZDMA 1JY3O 3MZWB 1ZMEC 3OW2O 5EFWB 4XA4A 2M5AB 1EDLA 3NXSA 4EOTA 1NAYA 4JQ0D 5TISE 1BSNA 1NAFA 1BGYE 5KKZC 2K88A 1SFCC 1KILD 3CCRP 3AE3C 1YJ9P 3TYYA 3AEFC 2BCCG 1OW6A 2YXRB 4IOIH 3GW6A 1JUNA 1M57D 1YITP 5B5EH 4XE5B 3L70D 1ZRTE 1FZBA 3P8CE 1NTMG 1AVOA 4B86A 3VP9A 3CX5I 2JP3A 1G2CA 1KZUB 3L73J 3USSA 2VRSA 2D2CB 4U3FG 1NTZE 1NU1J 2A06E 1K9MQ 1SQVD 4HYTB 3O8ZA 2Y0CA 3TGUD 1L0LD 5AVTB 3H1JG 1FJPA 3H25A 2W8ZA 5AW5B 3CWBE 1LWUC 5APVA 2E76C 2QE7H 3L36A 2OTJP 1FZCC 3C9IA 2ZYGA 1SQXJ 1L4AD 5H2FE 1ZR4A 4UB8E 1IFPA 2JO1A 2QJPB 1M1KQ 4MN4C 3KZIE 3MIWA 2AXCA 1SQBJ 1URQC 3FWLA 1OVVA 5AW7B 1NOHA 5KLVE 2Q3EA 4XFJA 2QRXA 1Q2NA 4O9BA 1N73B 1S5LX 3VMYA 1A02J 1LTGC 1Q90D 1USEA 1H0TB 3PJSK 2QSIA 1FZFA 1DX7A 4PD4D 5CCHD 1BSHA 1M90Q 3TK1A 1CZQA 1EDJA 2CPBA 3U1AA 3FGAD 3M9QA 2E75B 2I1KA 2ZFCA 2FFDC 2IZ0A 1KYOD 4WY4D 1BGYD 2QA4P 5M1BA 2YIUC 3L75D 3SSUA 2QEXP 3CXHI 3A0HE 4PJ0E 2C9LY 5AVRB 4H44B 3NFQA 2O01J 2R44A 2Q9IA 1JMMA 1D7MA 4L76A 1FAVA 5GTHH 1VQ9P 1ZRTD 3BCCD 3P8CD 1LP1A 4ASVA 1LJ2A 2WPRA 4ZKUA 3HE4A 2FYNB 2Y9ZA 1WMKA 2HODA 1G2CB 4L73A 2GUSA 1KV4A 4YTPC 3GF7A 1VQ8P 1JNMA 1PPJG 1YQ3C 1MFZA 5B66H 3G71P 2R5DA 1J1EC 3L73E 4WB4A 1N7SC 3Q5PA 1NU1E 1XTGB 5CCGC 2GA1A 4OH8B 5AVSB 2G3AA 1HUCA 4PV1D 1BDDA 5GTIE 1SQXE 1FOSE 2M3EA 2H89C 2KI7B 5KJ7A 4H13D 3L74J 2N1TD 5KKZB 3PH0A 1KFNA 1URQD 2JKVA 1QX8A 2K9YA 3AEAC 1G1IA 5KLVD 1SQBE 4GOEA 4JPZB 1T3JA 2BEQD 1KTMA 1USDA 1JTHB 1L0NJ 2RN0A 3RL0B 2KB7P 3CPWO 3EFGA 2QM8A 2POHA 1S72P 1JY3P 2W6JH 1QGKB 2R3SA 1GL2D 3VYIA 3H1IE 1LTJA 1LT1A 1SQPE 4EDFA 5AVUB 2WZ7A 3PLNA 3OA7A 3L70G 4IFFA 4NPDA 3D6ZA 3F89A 1IK7A 4KJMA 4OWFA 2WSFH 2KUBA 1T6AA 3AE7C 5CCGA 2W6BA 4C7RA 2D2CC 3W67A 1K8AQ 3CCEP 2O3JA 1X22A 2E76B 1BE3E 1MKMA 1SQVG 2Q1KA 2W6AA 1WT6A 3TGUG 1YHQP 1KB9D 1L0LG 4C46A 1SQQJ 1VL2A 3L72G 2PRRA 4TLFA 1T2KC 1IFJA 1X79B 4W80A 1LP1B 4HKZH 2WQYC 1NTZK 2HODB 2OYHC 2QJPC 4C7NA 1EDKA 4PD4I 3CCVP 2IBZE 1TU3F 3BASA 1S1CX 3L71J 5AVWB 2PGDA 1NTKJ 3L73D 2WPVB 2B87A 3R4YA 3CX5H 1NU1D 3KQGA 1N86A 1IFDA 5AW8B 1AV1A 3M06A 5AW3B 1KYOI 1EZVE 5CMZA 2HYNA 3M0AA 1Y8AA 3SWFA 2HPCA 1ZXGA 2R5BA 1E5WA 2FXOA 2FKWB 3CCJP 3H1LE 1S9KD 3VN0A 5KLVK 1SQXD 1DEEG 1NTZJ 1R5LA 2Z5IA 2WT7A 2KSEA 3Q5SA 2KLUA 3IF4A 2OYIA 1QEXA 2YIUB 3RK3B 1IFMA 1Q7YQ 3RBZA 2E75C 2R3CA 4R4MA 2YMKA 1HVVA 1SQBD 3CWBJ 1VF5D 3PP5A 2NPSD 3L75G 1L0NE 1AJYA 1U57A 1ZOYC 2JR8A 3P32A 5APQA 1H89A 4H44C 1A02F 2IX7C 3BRTB 3AE9C 1R8EA 1BCCG 2V7QJ 2B89A 2J5UA 1LTAC 2YXQB 4IL6H 1HBWA 1M56D 3BCCG 4RO0A 5DJUB 1J1EB 2FYNC 3H1HE 1QL1A 1KN7A 4GOFA 2CPSA 4LLHA 3M91A 2D2CD 3EQ2A 5K5GB 4KT0J 4D6TE 4EYYQ 2IPPA 2ZT9C 1LNQA 1OX3A 1FE6A 3BRVB 1LTSC 1GZLA 5E79E 3IFMA 2XV5A 3D70A 1GK6A 2KS1A 5AW1B 1SQQE 2RMZA 3CXHH 2XNDH 3Q1MA 2P1JA 2FYUG 3B5NA 4C7NB 2M0BA 4BXLA 1H8AA 3I56P 4R4LA 2WITA 2HR3A 1NU1K 3CD6P 1RQUA 3HE5B 5GTHE 1J2JB 2B87B 2K37A 3H1JJ 2R32A 2QJYC 3KYQA 3L71E 1NTKE 3H1KG 5AVXB 3RL0C 2B88A 1EZVD 1SQXK 2HPCB 1JO5A 1SS1A 5B66E 2XDJA 3IAOA 4WWIA 3CI9A 5BVZA 1RY3A 4HB1A 2OARA 4GKGA 3II6A 1VQNP 5AVVB 1KB9I 4I6MC 2WT7B 4N78E 1SQBK 3JSVC 1S5LE 1K04A 2OYIB 1YTZI 3CMEP 2AEJA 2Y0EA 3HRNA 3E1IA 1N2DC 2W83C 3L74D 2YKOA 5DJTB 1EXJA 1VQPP 1HWTC 3VTPC 2KP8A 2LXBA 2WPSA 3JCUH 1JY2N 3Q2YA 4H0LC 1SQPK 1L0ND 1GW3A 3KDPB 2KK7A
chains in the Genus database with same CATH topology
3Q1MA 3SFDC 4H44D 1IK7A 2OQQA 2QIWA 3Q5SA 1S5LX 2WSFJ 5L8RJ 3AEFC 1PV3A 1OW6A 3AE7C 3Q5PA 1FDOA 1Q90D 2E74B 4U7JA 1Y9BA 2E75C 4H13B 2D2CC 4R4LA 3S9OA 2QJKC 4GDOA 1PIXA 3GMAA 4R4MA 2YMKA 4I7ZC 3GLMA 2QSIA 2MKVA 1RQVA 2E76B 4Z1MH 1MKMA 3Q3DA 1RQUA 1ZRTE 1OW8A 1EXIA 2H88C 3GF3A 1VF5D 3ABVC 1KQFB 3AE2C 4OGQD 3G9RA 2G3AA 4XFJA 2QJYC 3IN6A 4PV1D 1VL2A 1AJYA 1U57A 3EWKA 2JP3A 1KILE 2WSCJ 1ZP0C 1ZOYC 3LW5J 2NZ2A 2WSEJ 3SFEC 1VF5C 1KQGB 3O6QA 2FBWC 3FGAD 4OGQC 2E75B 3AEDC 2D2CB 4H44C 3Q5RA 2H89C 2E74D 4H13D 4I7ZB 3AE9C 4Y28J 4PV1C 2ZT9B 3C8VA 1R8EA 4H0LB 2WQYC 1DD3A 2V7QJ 3AE5C 3IAOA 2K9YA 2QJPC 2E76D 3T97B 4RKUJ 3D6YA 2J5UA 3AEAC 5M1BA 3B71A 2YIUC 2IDBA 1PL5A 3AEEC 4YXDC 3RL0g 4H13C 3H25A 1HF9A 2BEQD 2G8YA 2FYNC 1TU3F 1KTMA 3AE4C 1KMIZ 1S1CX 2E76C 3AECC 1K04A 1VF5B 4IL6X 2WPVB 1DD4A 4H44B 1DIPA 3R4YA 2O01J 1ZMEC 2D2CD 4PV1B 3AEGC 1OMIA 3AE3C 1UIXA 2FXPA 2ZT9D 4KT0J 5KLIC 2JO1A 1NYHA 4H0LD 1EXJA 3RK3E 1GMJA 1YQ4C 1K05A 2P10A 3AE8C 2E74C 1YQ3C 3AE6C 2BEZF 1HJ0A 1KORA 1JB0J 1OW7A 1NGMB 3AE1C 5KKZC 4TT3H 3Q2YA 1WMKA 2ZT9C 4H0LC 4YTPC 3GF7A 3AEBC 4OGQB 3D6ZA 3D71A 3D70A 1FDIA 2E75D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9Y A;  2QJP C;  4RKU J;  2QIW A;  4KT0 J;  5KLI C;  2YIU C;  2QJY C;  1S5L X;  2WSF J;  5L8R J;  2WSC J;  3LW5 J;  1Q90 D;  2E74 B;  2FYN C;  2WSE J;  4H13 B;  1JB0 J;  2QJK C;  1VF5 B;  2E75 B;  5KKZ C;  2D2C B;  2QSI A;  4IL6 X;  2WPV B;  2E76 B;  4H44 B;  4I7Z B;  4OGQ B;  4Y28 J;  1ZRT E;  2ZT9 B;  2O01 J;  3C8V A;  4H0L B;  4PV1 B; 
#chains in the Genus database with same CATH topology
 4H44 D;  2ITA A;  1OVU A;  1OWA A;  5CJ0 A;  2OYH B;  2IYO A;  3I5C A;  1FDO A;  4YPC A;  1YJN P;  4BWN A;  2Q6Q A;  2AEF A;  5KAI E;  4Z1M H;  2BAS A;  2SPZ A;  1ZV8 A;  2CK3 H;  4Y99 B;  3PTZ A;  3LID A;  1J1D B;  5AVZ B;  1OIP A;  2I8D A;  1U7M A;  2GM4 A;  4WY4 A;  2JWA A;  2NZ2 A;  2WSE J;  5KAF E;  3SFE C;  3H1I J;  5APS A;  4N6J A;  3RGU A;  2J58 A;  2BCC E;  1SQP J;  3C8V A;  2OGU A;  1GD2 E;  1PP9 J;  1MFT A;  1NKN A;  2ZAE B;  3RL0 g;  2KS1 B;  1Z56 A;  3CLQ A;  1NTM E;  1E79 H;  3B5N B;  1DD4 A;  2E5T A;  5KJ7 C;  5CBN A;  2UWJ E;  3VMZ A;  1BE3 J;  1UIX A;  1SFC D;  3RK3 E;  4U3F E;  3RK3 C;  3MUD C;  3A0B H;  1YQ4 C;  1VQL P;  3HTK A;  1JB0 J;  1OW7 A;  3CMA P;  5KTB A;  3L71 D;  1QVF O;  4PD4 H;  1PGP A;  2FY8 A;  3H1J E;  1NTK D;  1JY2 O;  3RL0 D;  2WPQ A;  1AQ5 A;  3TDK A;  1NO4 A;  3WU2 E;  2IYP A;  2K9J A;  1ZR2 A;  1LTJ C;  1P84 E;  1KYO H;  3CX5 E;  2ZXE B;  2O01 N;  3Q3D A;  4N78 D;  1PGQ A;  4I1L A;  3GHG C;  3L37 A;  2N1T A;  1NTZ D;  2A06 D;  3A3Y B;  3G3Z A;  3O6Q A;  1L0N K;  2H43 A;  1RE4 C;  2A45 I;  2LR2 A;  4BRY A;  2ZVO B;  2ZT9 B;  1DD3 A;  3CWB D;  2E76 D;  3H1L J;  1EDI A;  3FWN A;  3CC7 P;  1KMI Z;  1X8Y A;  3K5B A;  2IFM A;  1GL2 A;  1EZV I;  2YNY A;  5APT A;  1PGO A;  1ZN5 A;  1AA0 A;  1AFO A;  5BU5 A;  3N7N A;  3MUD A;  1GMJ A;  3RK2 B;  2QJY B;  1RE3 A;  1CSB A;  2A45 G;  2QVA A;  3V6I A;  2WVR A;  3H6P A;  4JYC A;  1MV8 A;  3T97 A;  1BDC A;  3D71 A;  4KHX A;  3L72 J;  1SQQ K;  4EI2 A;  4OVN F;  4JBZ A;  1Y9B A;  4L75 A;  4UB6 H;  5APU A;  3KZI H;  2L91 A;  4JYB A;  3LIE A;  5AW0 B;  2E42 A;  1PFI A;  1PP9 E;  3GHG A;  1OW8 A;  3H1H J;  4DT0 A;  1M1J C;  1S4X A;  2FYZ A;  2WSC H;  3LW5 H;  3EWK A;  1PPJ E;  1RE4 A;  2OYI C;  4OGQ C;  1NTK K;  2K3R A;  1IO4 A;  3HUS A;  4D6T J;  3HTK B;  1GTW A;  1VQM P;  4H0L B;  3L74 G;  4ZKP A;  2H8P D;  2GUV A;  1NJI Q;  2PFX A;  3H1J D;  1VQ5 P;  5APW A;  2M8R A;  4IL6 X;  2XZR A;  3E7K A;  3HE4 B;  4PV1 B;  1RF0 A;  1P84 D;  1L2P A;  1VQ4 P;  2FXP A;  1LTI C;  1FU1 A;  2N1T B;  1LT9 A;  2KSJ A;  5B5E E;  2PAJ A;  5AW6 B;  3A0H H;  4PJ0 H;  3O6Q B;  4Y99 C;  2HFE D;  1N7S D;  5APX A;  1J1D C;  2XU6 A;  3FXE A;  1KB9 H;  4BRY B;  5CCG D;  3PHL A;  2L5G B;  3WUT A;  3HD7 A;  5KLI B;  4AUW A;  1KIL C;  3TNU A;  3V5B A;  3P7K A;  2NPS A;  1BCC J;  2V4H A;  1M1J A;  1GL2 B;  1M7L A;  1JY3 N;  1H88 A;  1W2B O;  1FOS F;  2WWW A;  3L70 E;  1T3U A;  1KQL A;  1ZP0 C;  1EQ7 A;  1N7L A;  3SWY A;  3B5N C;  3L35 A;  1YBK A;  3OAK A;  3V2P A;  3Q5R A;  2J59 M;  2JEE A;  3FX0 A;  3T97 B;  3CCU P;  1BGY G;  1IC2 A;  2KLV A;  3M9H A;  5AVY B;  4ZMD A;  1FC2 C;  1SQV E;  3A7O A;  1QL2 A;  1NTM K;  2I1J A;  1NHL A;  3TGU E;  1YYC A;  1L0L E;  1LTJ B;  3L72 E;  3H1I D;  3FXD A;  2OTK E;  1SQP D;  2FYU J;  3GHG B;  4DCK A;  2WTY A;  2OTL P;  1PP9 D;  1KFM A;  2BEZ F;  3A2A A;  1Q81 Q;  3N4X A;  2M3B A;  5CHX A;  1KOR A;  2C0W A;  1CW5 A;  1NGM B;  3IR9 A;  2ZVN B;  3MHV A;  1IJD B;  2JWD A;  3HUS B;  1W5C E;  2QIW A;  1YTZ T;  2BCC J;  3H32 A;  1LTB C;  3H1K J;  1NTZ G;  3CCM P;  2WSF J;  1KIL A;  1BE3 D;  1PV3 A;  2A06 G;  2E74 B;  4U7J A;  1RH5 B;  1JY2 P;  3VOP A;  3GMA A;  4N3Y B;  1NTM J;  3GF3 A;  1VDF A;  3CWB G;  3WMM 0;  1T2K D;  4I2L C;  3AE2 C;  1VQ7 P;  1OFC X;  4M3L A;  4NPF X;  1RF1 C;  1KQG B;  4PD4 E;  4U3F J;  5CCH C;  3P8M C;  2IBZ D;  4I7Z B;  1LT9 B;  1PGJ A;  2RH0 A;  3V2Q A;  5KLV G;  4DZO A;  2IDB A;  2XKM A;  3AEE C;  3RK2 C;  4AQR D;  1DH3 A;  4GOD A;  1KYO E;  3HD7 B;  4WY4 C;  3AEC C;  1VF5 B;  1W2E A;  2O01 H;  3E1R A;  3TNU B;  1PZQ A;  3L75 E;  2NPS B;  3AEG C;  1GU4 A;  2JJL A;  1M1J B;  1NYH A;  4LGD E;  2Q5U A;  4RES B;  3G4S P;  1L4A A;  2A45 H;  3H1L D;  2KZI A;  4LC1 A;  4K35 A;  3C1L A;  3M0D C;  1BCC E;  3PRJ A;  1HJ0 A;  1OXZ A;  1IFN A;  4TT3 H;  1IK9 A;  1K73 Q;  4OGQ B;  3BCC E;  3U59 A;  3B5N D;  4W7Y A;  2E75 D;  4DOJ A;  1WRG A;  3SFD C;  2YO2 A;  2OQQ A;  1P84 I;  2MJZ A;  2Q3I A;  1VQO P;  3EFF K;  3S9O A;  2KIK A;  3KPE A;  2P58 A;  1ZLL A;  1EXI A;  1FZE A;  3L4F A;  2KYV A;  3G9R A;  1T8Z A;  5BU8 B;  1KD1 Q;  3L72 D;  1RF1 A;  2RKL A;  3M9B A;  5CCH A;  2QG4 A;  1OZH A;  1IFI A;  1FJK A;  1Q82 Q;  1YIJ P;  4PV1 C;  2FYU E;  3CL3 D;  1GDT A;  3H1H D;  4H13 C;  4UB6 E;  2N1T C;  3H32 B;  3AE4 C;  1SFC A;  3BVH A;  1KIL B;  3L73 G;  1HGV A;  1CI6 A;  2PP6 A;  1DIP A;  2AXT H;  4D6T D;  4L74 A;  3H1K E;  1JCC A;  1NU1 G;  4DJG A;  1SLQ A;  2WSS H;  2ZT9 D;  5KLI C;  1JTH A;  3KXD A;  2ZYA A;  1G1J A;  3M0D A;  3JC2 2;  3AE6 C;  3B4S A;  4WVZ A;  1EC5 A;  1SQQ D;  4CPG A;  2P67 A;  1GL2 C;  4W7Z A;  1NVO A;  2W27 A;  1GK4 A;  1SQX G;  1X9V A;  1FZA A;  2P7J A;  4YXW H;  3TF5 A;  1MUU A;  1FZG A;  3S4R A;  1RE3 C;  3RK2 D;  1SQB G;  3A5T A;  1DEB A;  3TSI A;  1KQF B;  5E79 H;  3WUU A;  3S1K A;  3VMX A;  5CJ4 A;  1LWU A;  1Q86 Q;  2O1K A;  5TIS H;  1FZC A;  1L4A B;  2KNC A;  5AW9 B;  2FBW C;  2QJK B;  2HLO A;  1KB9 E;  3H1I G;  1RHZ B;  3U1C A;  2IFN A;  3QWO C;  2YMY A;  1BCC D;  1SQP G;  4A7P A;  1S3J A;  1VPC A;  2WMM A;  4YXD C;  5TJH A;  1PP9 G;  1HH0 A;  1URQ A;  2KOG A;  1UII A;  1HGZ A;  5CBO A;  1SQV K;  1FDM A;  1LGH B;  1IZN B;  3HUS C;  2IBZ I;  1VQK P;  5C39 A;  1L0L K;  3B8E B;  1OMI A;  2HG5 D;  4HJG H;  4H0L D;  1GU5 A;  2IZ1 A;  1BE3 G;  2YKQ A;  1K05 A;  2P10 A;  3KHU A;  2E74 C;  4ASW A;  3I55 P;  2OYO A;  2O1J A;  4HH2 A;  2N9Y B;  1RF1 B;  3L70 J;  3V2N A;  2Y0D A;  1KQS O;  1S5L H;  3MP7 B;  1FDI A;  3VMA A;  1VQ6 P;  1RF0 C;  3CCS P;  1QLE D;  2FYU D;  1S9K E;  4IFM A;  1SVF A;  1SP4 A;  2FFD A;  4I7Z C;  1LT9 C;  3GLM A;  3ITK A;  1HTL C;  1RQV A;  2IBZ G;  3R2P A;  4WY4 B;  1N8R Q;  1SQV J;  2K1A A;  1SFC B;  2H88 C;  2C9N Y;  3W68 A;  5H2F H;  2N9B A;  4IL6 E;  3TGU J;  2Z4E A;  1CI6 B;  1L0L J;  3CC4 P;  4UB8 H;  2BCC D;  3H1K D;  3HD7 C;  1VF5 C;  2W90 A;  3AED C;  4ZNC A;  1EZV G;  1JOC A;  1QVG O;  3MGN A;  2NPS C;  4Y28 J;  2V7Q H;  3CCL P;  5KAI H;  1KC8 Q;  1NTM D;  3AE5 C;  2DW3 A;  4WBA A;  1M8O B;  3H1L G;  3MD0 A;  2ZXX A;  5KJ7 D;  2FXM A;  5KAF H;  1GW4 A;  3RK3 D;  5AW2 B;  4U3F D;  3CXH E;  1NKZ B;  3VP8 A;  1N7S A;  2B9B A;  2ZYD A;  3AE1 C;  4NPE A;  1LWU B;  3CC2 P;  1L0N G;  1FZC B;  2K9J B;  3AEB C;  2KNC B;  1AQT A;  1YI2 P;  5AVQ B;  4AYC A;  3CX5 D;  4EIJ A;  1XTC C;  1OVR A;  4H13 B;  4GDO A;  1PIX A;  1URQ B;  2H7H A;  2P2U A;  1BGY J;  1FBM A;  2M5A A;  1Y47 A;  3H1H G;  3L75 J;  1JCD A;  3RBX A;  2LKM A;  3IN6 A;  1FS0 E;  3WU2 H;  1KIL E;  1NWQ A;  3HE5 A;  2E74 D;  1P84 H;  3WUV A;  4D6T G;  3NMD A;  1N73 C;  2FYU K;  4RJT A;  3BCC J;  2KZJ A;  1NH4 A;  3V4W A;  1HJB A;  1HF9 A;  3JCU E;  2G8Y A;  1ZW0 A;  2XNX A;  2Z5H A;  1SQQ G;  3V4Q A;  1JM0 A;  2AEM A;  3NTN A;  4GT1 A;  2NRG A;  3SWK A;  2FFD B;  1U7J A;  4JF7 A;  5APY A;  1MZ9 A;  2ZJS E;  2E5Y A;  2YKP A;  1S2E A;  3BAT A;  2KXP B;  3AE8 C;  3L74 E;  4GIF A;  5GTI H;  3GG2 A;  1R5S A;  3L71 G;  1YJW P;  3HD7 D;  1NTK G;  3UIA A;  3MTU E;  4K3A A;  4QMA A;  3CCQ P;  5L8R J;  1AVY A;  2JDI H;  1L4A C;  2QJK C;  3OJA B;  2AXT E;  1X0T A;  2MKV A;  2LXC B;  2Y9Y A;  1JEK A;  2Q7C A;  2OYH A;  4IFD K;  1LTT C;  5KLV J;  3ABV C;  1PPJ D;  2QM7 A;  4OGQ D;  1JMB A;  5AW4 B;  3CXH D;  2WSE H;  2WSC J;  3LW5 J;  3V2R A;  1N7S B;  2C0X A;  1N73 A;  3QH9 A;  3F5H A;  3G6E P;  4RKU J;  3A0B E;  3D6Y A;  3B71 A;  2YO3 A;  1PL5 A;  2E43 A;  1H0T A;  3ZDM A;  1JY3 O;  3MZW B;  1ZME C;  3OW2 O;  5EFW B;  4XA4 A;  2M5A B;  1EDL A;  3NXS A;  4EOT A;  1NAY A;  4JQ0 D;  5TIS E;  1BSN A;  1NAF A;  1BGY E;  5KKZ C;  2K88 A;  1SFC C;  1KIL D;  3CCR P;  3AE3 C;  1YJ9 P;  3TYY A;  3AEF C;  2BCC G;  1OW6 A;  2YXR B;  4IOI H;  3GW6 A;  1JUN A;  1M57 D;  1YIT P;  5B5E H;  4XE5 B;  3L70 D;  1ZRT E;  1FZB A;  3P8C E;  1NTM G;  1AVO A;  4B86 A;  3VP9 A;  3CX5 I;  2JP3 A;  1G2C A;  1KZU B;  3L73 J;  3USS A;  2VRS A;  2D2C B;  4U3F G;  1NTZ E;  1NU1 J;  2A06 E;  1K9M Q;  1SQV D;  4HYT B;  3O8Z A;  2Y0C A;  3TGU D;  1L0L D;  5AVT B;  3H1J G;  1FJP A;  3H25 A;  2W8Z A;  5AW5 B;  3CWB E;  1LWU C;  5APV A;  2E76 C;  2QE7 H;  3L36 A;  2OTJ P;  1FZC C;  3C9I A;  2ZYG A;  1SQX J;  1L4A D;  5H2F E;  1ZR4 A;  4UB8 E;  1IFP A;  2JO1 A;  2QJP B;  1M1K Q;  4MN4 C;  3KZI E;  3MIW A;  2AXC A;  1SQB J;  1URQ C;  3FWL A;  1OVV A;  5AW7 B;  1NOH A;  5KLV E;  2Q3E A;  4XFJ A;  2QRX A;  1Q2N A;  4O9B A;  1N73 B;  1S5L X;  3VMY A;  1A02 J;  1LTG C;  1Q90 D;  1USE A;  1H0T B;  3PJS K;  2QSI A;  1FZF A;  1DX7 A;  4PD4 D;  5CCH D;  1BSH A;  1M90 Q;  3TK1 A;  1CZQ A;  1EDJ A;  2CPB A;  3U1A A;  3FGA D;  3M9Q A;  2E75 B;  2I1K A;  2ZFC A;  2FFD C;  2IZ0 A;  1KYO D;  4WY4 D;  1BGY D;  2QA4 P;  5M1B A;  2YIU C;  3L75 D;  3SSU A;  2QEX P;  3CXH I;  3A0H E;  4PJ0 E;  2C9L Y;  5AVR B;  4H44 B;  3NFQ A;  2O01 J;  2R44 A;  2Q9I A;  1JMM A;  1D7M A;  4L76 A;  1FAV A;  5GTH H;  1VQ9 P;  1ZRT D;  3BCC D;  3P8C D;  1LP1 A;  4ASV A;  1LJ2 A;  2WPR A;  4ZKU A;  3HE4 A;  2FYN B;  2Y9Z A;  1WMK A;  2HOD A;  1G2C B;  4L73 A;  2GUS A;  1KV4 A;  4YTP C;  3GF7 A;  1VQ8 P;  1JNM A;  1PPJ G;  1YQ3 C;  1MFZ A;  5B66 H;  3G71 P;  2R5D A;  1J1E C;  3L73 E;  4WB4 A;  1N7S C;  3Q5P A;  1NU1 E;  1XTG B;  5CCG C;  2GA1 A;  4OH8 B;  5AVS B;  2G3A A;  1HUC A;  4PV1 D;  1BDD A;  5GTI E;  1SQX E;  1FOS E;  2M3E A;  2H89 C;  2KI7 B;  5KJ7 A;  4H13 D;  3L74 J;  2N1T D;  5KKZ B;  3PH0 A;  1KFN A;  1URQ D;  2JKV A;  1QX8 A;  2K9Y A;  3AEA C;  1G1I A;  5KLV D;  1SQB E;  4GOE A;  4JPZ B;  1T3J A;  2BEQ D;  1KTM A;  1USD A;  1JTH B;  1L0N J;  2RN0 A;  3RL0 B;  2KB7 P;  3CPW O;  3EFG A;  2QM8 A;  2POH A;  1S72 P;  1JY3 P;  2W6J H;  1QGK B;  2R3S A;  1GL2 D;  3VYI A;  3H1I E;  1LTJ A;  1LT1 A;  1SQP E;  4EDF A;  5AVU B;  2WZ7 A;  3PLN A;  3OA7 A;  3L70 G;  4IFF A;  4NPD A;  3D6Z A;  3F89 A;  1IK7 A;  4KJM A;  4OWF A;  2WSF H;  2KUB A;  1T6A A;  3AE7 C;  5CCG A;  2W6B A;  4C7R A;  2D2C C;  3W67 A;  1K8A Q;  3CCE P;  2O3J A;  1X22 A;  2E76 B;  1BE3 E;  1MKM A;  1SQV G;  2Q1K A;  2W6A A;  1WT6 A;  3TGU G;  1YHQ P;  1KB9 D;  1L0L G;  4C46 A;  1SQQ J;  1VL2 A;  3L72 G;  2PRR A;  4TLF A;  1T2K C;  1IFJ A;  1X79 B;  4W80 A;  1LP1 B;  4HKZ H;  2WQY C;  1NTZ K;  2HOD B;  2OYH C;  2QJP C;  4C7N A;  1EDK A;  4PD4 I;  3CCV P;  2IBZ E;  1TU3 F;  3BAS A;  1S1C X;  3L71 J;  5AVW B;  2PGD A;  1NTK J;  3L73 D;  2WPV B;  2B87 A;  3R4Y A;  3CX5 H;  1NU1 D;  3KQG A;  1N86 A;  1IFD A;  5AW8 B;  1AV1 A;  3M06 A;  5AW3 B;  1KYO I;  1EZV E;  5CMZ A;  2HYN A;  3M0A A;  1Y8A A;  3SWF A;  2HPC A;  1ZXG A;  2R5B A;  1E5W A;  2FXO A;  2FKW B;  3CCJ P;  3H1L E;  1S9K D;  3VN0 A;  5KLV K;  1SQX D;  1DEE G;  1NTZ J;  1R5L A;  2Z5I A;  2WT7 A;  2KSE A;  3Q5S A;  2KLU A;  3IF4 A;  2OYI A;  1QEX A;  2YIU B;  3RK3 B;  1IFM A;  1Q7Y Q;  3RBZ A;  2E75 C;  2R3C A;  4R4M A;  2YMK A;  1HVV A;  1SQB D;  3CWB J;  1VF5 D;  3PP5 A;  2NPS D;  3L75 G;  1L0N E;  1AJY A;  1U57 A;  1ZOY C;  2JR8 A;  3P32 A;  5APQ A;  1H89 A;  4H44 C;  1A02 F;  2IX7 C;  3BRT B;  3AE9 C;  1R8E A;  1BCC G;  2V7Q J;  2B89 A;  2J5U A;  1LTA C;  2YXQ B;  4IL6 H;  1HBW A;  1M56 D;  3BCC G;  4RO0 A;  5DJU B;  1J1E B;  2FYN C;  3H1H E;  1QL1 A;  1KN7 A;  4GOF A;  2CPS A;  4LLH A;  3M91 A;  2D2C D;  3EQ2 A;  5K5G B;  4KT0 J;  4D6T E;  4EYY Q;  2IPP A;  2ZT9 C;  1LNQ A;  1OX3 A;  1FE6 A;  3BRV B;  1LTS C;  1GZL A;  5E79 E;  3IFM A;  2XV5 A;  3D70 A;  1GK6 A;  2KS1 A;  5AW1 B;  1SQQ E;  2RMZ A;  3CXH H;  2XND H;  3Q1M A;  2P1J A;  2FYU G;  3B5N A;  4C7N B;  2M0B A;  4BXL A;  1H8A A;  3I56 P;  4R4L A;  2WIT A;  2HR3 A;  1NU1 K;  3CD6 P;  1RQU A;  3HE5 B;  5GTH E;  1J2J B;  2B87 B;  2K37 A;  3H1J J;  2R32 A;  2QJY C;  3KYQ A;  3L71 E;  1NTK E;  3H1K G;  5AVX B;  3RL0 C;  2B88 A;  1EZV D;  1SQX K;  2HPC B;  1JO5 A;  1SS1 A;  5B66 E;  2XDJ A;  3IAO A;  4WWI A;  3CI9 A;  5BVZ A;  1RY3 A;  4HB1 A;  2OAR A;  4GKG A;  3II6 A;  1VQN P;  5AVV B;  1KB9 I;  4I6M C;  2WT7 B;  4N78 E;  1SQB K;  3JSV C;  1S5L E;  1K04 A;  2OYI B;  1YTZ I;  3CME P;  2AEJ A;  2Y0E A;  3HRN A;  3E1I A;  1N2D C;  2W83 C;  3L74 D;  2YKO A;  5DJT B;  1EXJ A;  1VQP P;  1HWT C;  3VTP C;  2KP8 A;  2LXB A;  2WPS A;  3JCU H;  1JY2 N;  3Q2Y A;  4H0L C;  1SQP K;  1L0N D;  1GW3 A;  3KDP B;  2KK7 A; 
#chains in the Genus database with same CATH homology
 3Q1M A;  3SFD C;  4H44 D;  1IK7 A;  2OQQ A;  2QIW A;  3Q5S A;  1S5L X;  2WSF J;  5L8R J;  3AEF C;  1PV3 A;  1OW6 A;  3AE7 C;  3Q5P A;  1FDO A;  1Q90 D;  2E74 B;  4U7J A;  1Y9B A;  2E75 C;  4H13 B;  2D2C C;  4R4L A;  3S9O A;  2QJK C;  4GDO A;  1PIX A;  3GMA A;  4R4M A;  2YMK A;  4I7Z C;  3GLM A;  2QSI A;  2MKV A;  1RQV A;  2E76 B;  4Z1M H;  1MKM A;  3Q3D A;  1RQU A;  1ZRT E;  1OW8 A;  1EXI A;  2H88 C;  3GF3 A;  1VF5 D;  3ABV C;  1KQF B;  3AE2 C;  4OGQ D;  3G9R A;  2G3A A;  4XFJ A;  2QJY C;  3IN6 A;  4PV1 D;  1VL2 A;  1AJY A;  1U57 A;  3EWK A;  2JP3 A;  1KIL E;  2WSC J;  1ZP0 C;  1ZOY C;  3LW5 J;  2NZ2 A;  2WSE J;  3SFE C;  1VF5 C;  1KQG B;  3O6Q A;  2FBW C;  3FGA D;  4OGQ C;  2E75 B;  3AED C;  2D2C B;  4H44 C;  3Q5R A;  2H89 C;  2E74 D;  4H13 D;  4I7Z B;  3AE9 C;  4Y28 J;  4PV1 C;  2ZT9 B;  3C8V A;  1R8E A;  4H0L B;  2WQY C;  1DD3 A;  2V7Q J;  3AE5 C;  3IAO A;  2K9Y A;  2QJP C;  2E76 D;  3T97 B;  4RKU J;  3D6Y A;  2J5U A;  3AEA C;  5M1B A;  3B71 A;  2YIU C;  2IDB A;  1PL5 A;  3AEE C;  4YXD C;  3RL0 g;  4H13 C;  3H25 A;  1HF9 A;  2BEQ D;  2G8Y A;  2FYN C;  1TU3 F;  1KTM A;  3AE4 C;  1KMI Z;  1S1C X;  2E76 C;  3AEC C;  1K04 A;  1VF5 B;  4IL6 X;  2WPV B;  1DD4 A;  4H44 B;  1DIP A;  3R4Y A;  2O01 J;  1ZME C;  2D2C D;  4PV1 B;  3AEG C;  1OMI A;  3AE3 C;  1UIX A;  2FXP A;  2ZT9 D;  4KT0 J;  5KLI C;  2JO1 A;  1NYH A;  4H0L D;  1EXJ A;  3RK3 E;  1GMJ A;  1YQ4 C;  1K05 A;  2P10 A;  3AE8 C;  2E74 C;  1YQ3 C;  3AE6 C;  2BEZ F;  1HJ0 A;  1KOR A;  1JB0 J;  1OW7 A;  1NGM B;  3AE1 C;  5KKZ C;  4TT3 H;  3Q2Y A;  1WMK A;  2ZT9 C;  4H0L C;  4YTP C;  3GF7 A;  3AEB C;  4OGQ B;  3D6Z A;  3D71 A;  3D70 A;  1FDI A;  2E75 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...