1JB0J

Crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
41
structure length
41
Chain Sequence
MKHFLTYLSTAPVLAAIWMTITAGILIEFNRFYPDLLFHPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional Structure of Cyanobacterial Photosystem I at 2.5 A Resolution
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords PHOTOSYSTEM I P700 CHLOROPHYLL A APOPROTEIN A1
total genus 12
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2001-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1jb0J00
2WSCJ 1Q90D 2QJKC 2E75B 4I7ZB 2ZT9B 2D2CB 1VF5B 2E74B 4H44B 4IL6X 5KKZC 5KLIC 1ZRTE 2FYNC 2E76B 2YIUC 3LW5J 4H0LB 4OGQB 2WSFJ 1JB0J 1S5LX 4KT0J 2QJYC 2K9YA 2QIWA 3C8VA 4H13B 2WSEJ 4PV1B 2QSIA 2O01J 5L8RJ 2QJPC 4Y28J 4RKUJ 2WPVB
chains in the Genus database with same CATH superfamily
1PV3A 5KTBA 3P8CE 1JY3O 4U3FD 4W7ZA 3RL0D 3VMZA 1MKMA 1GZLA 1QL2A 3JC22 1BE3D 1AJYA 3G4SP 4L73A 5APTA 4OGQD 1MV8A 2V4HA 2QRXA 3AECC 2ZVNB 3RL0g 1ZLLA 3WU2H 1BDCA 3BCCG 3GLMA 1SQPK 3CWBE 4L76A 3HE5A 3O6QA 4D6TD 3RBXA 2V7QJ 3O8ZA 3LW5J 1SQXE 1T8ZA 1RE4A 1KYOD 1A02F 2QG4A 4A7PA 1PP9J 4Y99C 2GM4A 1IZNB 1FDOA 4XE5B 2HODA 3CC2P 1N2DC 1SQBG 1RF1C 1BGYE 2ZT9C 1SP4A 4GKGA 2B87B 4JBZA 1XTCC 1OFCX 1NTMK 2K37A 3VN0A 2YIUB 3L70J 3L71J 4H13D 5APSA 1NTZD 3EQ2A 2Y9ZA 3U1CA 1SQQJ 2K88A 5AW7B 3TF5A 4XFJA 2O01N 4DJGA 1M7LA 3A2AA 1G1IA 2R44A 1DD4A 1H8AA 2R32A 3MUDC 2IBZG 3V4WA 1YI2P 2H89C 2H88C 4WY4C 2C9NY 1QGKB 4WY4A 1L0ND 2KSJA 2Z5IA 3H1ID 1UIXA 3LIDA 1BE3G 2O3JA 4PD4H 5AW1B 1BCCD 4EOTA 1NTKK 2YXQB 1PP9D 3G71P 1IO4A 1WRGA 1VQ5P 3H1JG 1M1JC 1MZ9A 1NHLA 1OVVA 1X79B 2OARA 2WSFJ 1EC5A 5CCGC 2JO1A 1U7JA 1NVOA 2Y9YA 2M8RA 2QJKB 3CCQP 2BCCE 1MFTA 3A7OA 1A02J 1FZBA 1M1JA 4K3AA 3L73D 1KB9H 2E74C 3P7KA 1ZXGA 4LGDE 2E43A 5AVZB 2BEZF 2SPZA 2YNYA 3B71A 3CWBG 1SQBJ 5DJTB 2RN0A 1LTSC 1M8OB 3H1KJ 3LIEA 1KFMA 1OZHA 1H88A 1M1JB 1OXZA 1JTHB 1NAFA 3CXHD 1PPJG 3OAKA 2N1TC 1X9VA 3FX0A 1FOSF 1L0NJ 3MUDA 2YMYA 2W6AA 4OWFA 4N78D 3L70D 4PD4E 2FFDC 1FZAA 1JTHA 2Q6QA 1ZRTE 1RHZB 1GK4A 2IBZD 3HD7D 2H43A 2WT7B 3L75J 4EYYQ 2ZAEB 3O6QB 4PJ0E 2E75D 2A06D 3P8MC 2JDIH 1JY2N 1LT9B 1EZVD 4EDFA 5GTHE 1FZGA 2I1KA 3L74E 2E42A 1SQBK 1P84E 1VQ6P 5CCGD 2MKVA 3H1JD 1NO4A 1TU3F 1FE6A 3ABVC 3CXHH 3KYQA 1JOCA 1PIXA 2H8PD 3A3YB 4H44C 3JCUH 1SQBD 3HE4A 2N9BA 1UIIA 1WMKA 2JKVA 2ZJSE 3AEDC 3H1KD 3WUVA 3NFQA 2WT7A 1L0LK 2R5DA 1LT1A 1S2EA 4GOFA 5TJHA 4UB6H 2KUBA 3KXDA 1BDDA 1J2JB 1N7LA 3SFEC 1GL2A 1PZQA 1P84D 2AEFA 4AQRD 3TGUD 1KILE 1OMIA 2WSEH 1OX3A 2OTKE 3V2QA 3TGUE 2D2CB 2O1KA 4H44B 5KJ7C 1K9MQ 2UWJE 1GU4A 1ZMEC 2NPSA 3TGUJ 1URQB 5APQA 3IFMA 1XTGB 3KZIE 1KC8Q 5APXA 2FYUE 2ZT9D 4N78E 5CCHD 4N3YB 3D6YA 1FS0E 3EFFK 2R5BA 3EFGA 2E76D 1YQ3C 4UB8H 1IK9A 1M57D 3I56P 1Q86Q 4HJGH 3CXHE 4XA4A 1L4AD 1J1EC 1G1JA 5K5GB 1SQVK 5AVWB 3CX5I 1YJWP 1K73Q 4YPCA 2D2CC 2Q1KA 1H0TA 2P2UA 2E5TA 3H1LE 1URQC 2W8ZA 4C7NB 4PD4I 5GTIH 1IJDB 1IFJA 1QVGO 3H1LJ 1L2PA 1FAVA 1SFCA 1T3JA 2BCCD 3MGNA 5AW6B 1H0TB 4Y99B 1Y8AA 3IR9A 3V6IA 4PV1D 3CCRP 3VTPC 2LXCB 2ZVOB 2R3SA 4RO0A 3WU2E 5CCHC 1W2BO 1K8AQ 1DX7A 1YBKA 5AVTB 3A0BE 4WWIA 4I7ZB 2N1TA 1VF5B 1PP9E 5AVSB 3RBZA 3M0DA 5B5EE 1KB9I 2XU6A 3H32A 2YXRB 2Q3EA 5B66H 3CCVP 1SQVJ 2Z5HA 1SFCD 3H1IE 1QEXA 2YO3A 4H0LB 1L0NE 1JCDA 3TYYA 1CI6A 3M0DC 2IZ0A 2I8DA 4QMAA 4KJMA 3GF3A 3RK2D 1QX8A 3Q1MA 1EZVG 4IFFA 1CSBA 1YJNP 1N73A 5KLVG 1KMIZ 1E5WA 2HODB 1L0LJ 5C39A 1L4AA 1VQ4P 2WSEJ 4GDOA 3H1LD 1SQQE 3HUSA 4I2LC 1ZN5A 1LTTC 2O1JA 2FY8A 3SWFA 2K3RA 1YITP 2B9BA 3TNUB 2GUVA 3B5ND 2OTJP 3USSA 3II6A 1PP9G 5E79H 1S9KE 1NTMJ 3GHGB 3QH9A 3OA7A 1KYOE 3JCUE 1D7MA 4OVNF 2ZT9B 1RF0A 1NTKG 1SQXD 2E74B 1JM0A 2FYUD 1SQVD 1ZV8A 3CXHI 4W7YA 2N1TD 1HGZA 2IPPA 1NU1E 4YXWH 1Q2NA 3A5TA 1J1DB 2OYOA 5BVZA 1OW6A 2J58A 1AA0A 1JB0J 3RK2C 1S5LX 3GHGC 2QIWA 2ZYAA 5AW3B 5AW5B 3C8VA 3L71E 3L70E 2E75C 2KNCA 1SQPE 5EFWB 3L35A 1IFDA 3AEAC 1QVFO 1U57A 3W67A 1QL1A 1LP1A 3MZWB 1ZR2A 2JP3A 4HKZH 3RK3C 2KZIA 1NTMD 1SS1A 2KLUA 5AVXB 3TGUG 4R4LA 1EXIA 1S4XA 1DD3A 1KILB 2FYUJ 2WMMA 1SQXJ 1EZVE 2BASA 1NTZG 2PRRA 3G3ZA 2A06E 2E75B 3JSVC 3H1HE 3Q2YA 2Q9IA 1PGPA 1NKNA 3CX5H 3L74J 1LTJB 2IBZE 4TT3H 3B5NA 1YQ4C 2E74D 5APYA 2KP8A 3B5NC 2KI7B 3A0HE 3RK3B 3CCSP 3IN6A 1JEKA 3KZIH 1YTZT 3V2NA 3L72E 1HWTC 2IDBA 1NU1J 2M3BA 3GMAA 4H44D 1OWAA 2IYPA 1LTBC 1AVYA 3D71A 1LTAC 3E1RA 3L73G 2K9JB 3CCMP 5GTHH 1LTJC 1RQUA 3PRJA 1HTLC 1M56D 2DW3A 3UIAA 4Z1MH 1X0TA 3ITKA 5KLIB 2Q5UA 4K35A 5AVYB 3CL3D 3L75G 1LT9C 4JQ0D 3HUSC 2A06G 2YKPA 2ZFCA 2WPVB 2N9YB 3H1HG 3HD7C 5TISH 2IBZI 4EIJA 1NTKJ 3U59A 1SQPD 3CLQA 1LTGC 1GTWA 4BRYA 1PPJE 1N73C 1MUUA 1EZVI 1BE3J 1L0NG 1LNQA 1LWUC 2WQYC 4HB1A 2IZ1A 3RL0C 3VP8A 5B5EH 1CZQA 2W6JH 3N7NA 5AVQB 4ASVA 2XV5A 1PGJA 4D6TJ 5B66E 1LP1B 3RGUA 2FFDA 2WPSA 5AVRB 5KLVD 3BCCE 1KFNA 2JJLA 1KQFB 3TK1A 1KN7A 3HD7B 1NU1D 1HJ0A 1FU1A 3FXDA 3KDPB 2OQQA 2QJYC 1IFIA 5BU8B 4HH2A 2O01H 4I7ZC 4JPZB 4M3LA 5CCHA 1Q81Q 4H13B 4WVZA 4ZKUA 2B89A 3AE9C 5KKZC 5KKZB 3CD6P 1SQVG 2XDJA 1KZUB 2J5UA 1S9KD 4JF7A 2QSIA 1CW5A 4H0LC 3V5BA 2KS1B 3D6ZA 1RQVA 2LKMA 2WZ7A 3IAOA 1EDKA 1YTZI 4O9BA 1FZCA 1VQ7P 1NTZK 1SQQD 2WSCJ 1SQPJ 4IOIH 2L5GB 1Q82Q 2QJYB 3L72G 1WT6A 1NJIQ 2KIKA 2WSSH 4IFMA 1G2CB 2G8YA 3AEFC 1GW4A 2Q7CA 3T97B 1IK7A 3AE6C 1L0LG 2YKQA 5AW0B 4ZKPA 1HJBA 3H1HJ 3I5CA 4BWNA 1N7SB 4U7JA 1HUCA 1HVVA 1SQQG 1R8EA 1BCCJ 3G9RA 4I6MC 1QLED 2FXMA 1DEEG 2KYVA 1BE3E 3L70G 3L71G 4OGQB 1SLQA 3B4SA 1ZR4A 1NYHA 1GD2E 3CCEP 2HPCA 2P1JA 1JMMA 3AEEC 1KTMA 4CPGA 2NPSD 3HRNA 3L37A 1VF5C 2XKMA 4IFDK 5KLVK 1E79H 5CCGA 2KOGA 3L73J 3H1IG 1JMBA 1N7SC 3CCLP 2ZYGA 1VQKP 1GL2D 2NZ2A 3CC7P 4WY4D 2L91A 2FYZA 1M1KQ 1RF0C 2KNCB 2OYHA 3CC4P 2C9LY 1KYOH 2OGUA 2XNDH 1AV1A 1RH5B 2AXTE 1RF1B 1JO5A 3P32A 3L72D 1YHQP 4W80A 3PJSK 1FZFA 4UB6E 2E76B 1U7MA 2K1AA 3SWKA 3RK3E 3B8EB 1IFPA 1VQOP 5APUA 1SQXK 2NPSC 1AVOA 2RH0A 2WVRA 3L75D 3MHVA 5CJ0A 3M91A 3NMDA 4MN4C 1URQD 2HYNA 1G2CA 1MFZA 5CJ4A 2FBWC 4KT0J 1KILC 2K9YA 1DEBA 2PFXA 2P58A 2D2CD 4WY4B 3CX5E 1N86A 4YXDC 3L74G 3VMAA 3CCJP 3F89A 3FWLA 1GU5A 3C9IA 1KILD 3Q3DA 3F5HA 2OYIB 1NTZJ 1EQ7A 2FYNB 2CPSA 1AFOA 1L0LE 2E76C 1L0NK 5H2FE 2O01J 2QM8A 1NTME 3PP5A 2Y0CA 1EXJA 2NPSB 2FXOA 4U3FG 3WUTA 1S1CX 4DZOA 2C0WA 2B87A 2W83C 4L74A 2WITA 2JWDA 3L36A 5TISE 2QJKC 3H1IJ 5CBNA 1VL2A 2WPRA 3L72J 1KILA 2P67A 2QEXP 3S9OA 1ZP0C 3H1KG 1SQQK 3H1JE 1R5SA 3V4QA 1HGVA 2FYUK 1CI6B 1RY3A 1SVFA 3I55P 2GUSA 1NTKE 3M0AA 5H2FH 2YMKA 1IC2A 1W5CE 3TSIA 3HE4B 3D70A 1RF1A 3MD0A 1ZRTD 1KB9E 1SQVE 2H7HA 4PD4D 1ZW0A 1EDLA 3BRTB 5AW8B 1AQ5A 3PTZA 2M5AA 2CK3H 3M9BA 4OH8B 1S5LE 3A0HH 2FFDB 2KLVA 2IFMA 3FWNA 1T2KC 1USEA 5KJ7D 5E79E 1H89A 2JWAA 1SQPG 3GW6A 1FJPA 1K05A 2ZYDA 2XNXA 1X22A 3AEGC 3IF4A 3VMXA 1USDA 1LWUA 4AUWA 1Q90D 3E1IA 3L73E 1PFIA 3Q5SA 2OYHB 5KAFE 1GL2C 1PGOA 3VYIA 3M06A 2FKWB 3SFDC 2WTYA 1OVRA 3EWKA 3CPWO 1YJ9P 3AE8C 2M3EA 2J59M 3SSUA 4DT0A 4LC1A 2YKOA 3HUSB 3H1JJ 4NPFX 3WMM0 2V7QH 1BSNA 3BRVB 3LW5H 2G3AA 1M90Q 2PGDA 3ZDMA 1FC2C 2NRGA 2OYHC 1KYOI 2AEMA 3MP7B 1LTIC 3H25A 1L0LD 3CMEP 3KQGA 2KS1A 1KV4A 2A45H 2AXCA 3M9HA 3PHLA 3R2PA 4GIFA 5L8RJ 1NH4A 2QJPC 1S72P 3CX5D 1JY2O 3AE1C 3V2PA 1JY3N 2POHA 2WWWA 5AVUB 4YTPC 5KAIH 3BASA 5CMZA 3L75E 3GF7A 1J1EB 3HD7A 1BGYD 2PP6A 1W2EA 1VQPP 2FYUG 3RK3D 5AW9B 3KHUA 1OIPA 1GMJA 3CCUP 4R4MA 2QJPB 5AW2B 3AE7C 3C1LA 4EI2A 2BCCG 2KSEA 1JCCA 1JNMA 1NU1G 4B86A 2QE7H 1FDIA 1JUNA 2QVAA 3AE2C 1OVUA 3CWBD 3HTKB 4L75A 4D6TE 3Q5PA 2WSCH 2PAJA 2HPCB 2IX7C 4C7RA 2JEEA 5CBOA 3QWOC 5KAFH 1PGQA 2R3CA 1HBWA 1ZOYC 1HH0A 1P84I 1SQXG 3P8CD 4U3FE 1PL5A 2BCCJ 3S1KA 3FXEA 1LJ2A 1YYCA 2MJZA 2WSFH 4HYTB 4IL6E 4WBAA 2KXPB 1NWQA 3HE5B 2LXBA 2M5AB 3A0BH 1NGMB 3H1KE 3PLNA 1BGYJ 4N6JA 1SQBE 2AXTH 1KQGB 1S5LH 2XZRA 2ZXXA 2WPQA 3MIWA 3TNUA 3M9QA 2KK7A 1Y47A 3R4YA 1N7SD 5APVA 2OYIC 1VQNP 2Q3IA 2E5YA 1NAYA 4DOJA 3L74D 1JY2P 2YIUC 1OW7A 2Z4EA 1DH3A 1RE3C 2HFED 4C7NA 1FDMA 3S4RA 1NTMG 4C46A 5KJ7A 3AE3C 3CWBJ 4GODA 1BSHA 4PJ0H 2HLOA 2W6BA 2N1TB 3VOPA 1T3UA 2IYOA 1NKZB 1Y9BA 3K5BA 2IFNA 3AEBC 5M1BA 4UB8E 4ZNCA 2QA4P 4KHXA 1EDIA 1BCCG 1SFCC 2B88A 4ZMDA 1IFNA 1N8RQ 1LT9A 2JR8A 4JYCA 1RE4C 1FZCB 1OW8A 1VQMP 5CHXA 2OYIA 1KORA 1J1DC 3B5NB 5APWA 2M0BA 3T97A 1LTJA 1X8YA 2LR2A 1KB9D 5GTIE 4RESB 1KQLA 5AVVB 3RK2B 3HTKA 3BCCD 3MTUE 4D6TG 5KLVE 3CMAP 1NTKD 1SFCB 4H0LD 4IL6X 2W27A 1R5LA 2FYNC 2GA1A 3AE5C 1FZCC 4DCKA 3H6PA 3N4XA 1T6AA 1NU1K 3H32B 1PPJD 2A45I 1AQTA 4GT1A 2K9JA 3NTNA 5DJUB 1FJKA 1L4AC 3W68A 3BVHA 1FOSE 5KLVJ 1BCCE 3FGAD 1VQ8P 2QM7A 3H1LG 4TLFA 2C0XA 1VF5D 2BEQD 4ASWA 3WUUA 1KD1Q 2FXPA 2KB7P 1N73B 1IFMA 1VQLP 3U1AA 2VRSA 2ITAA 1FBMA 4PV1B 1KQSO 5BU5A 1VQ9P 2A45G 1YIJP 3TDKA 4Y28J 2P10A 1NTZE 1L4AB 2HG5D 4BXLA 1K04A 2OTLP 4RJTA 3V2RA 3BCCJ 1DIPA 3GG2A 2RMZA 1LGHB 1EDJA 2ZXEB 4GOEA 2Y0DA 1VDFA 3KPEA 3L4FA 3GHGA 2KZJA 4I1LA 4U3FJ 3AE4C 3E7KA 3OJAB 1S3JA 2YO2A 4H13C 1T2KD 1GW3A 1NOHA 2W90A 4PV1C 4NPEA 5KLIC 4NPDA 4JYBA 1Q7YQ 1GDTA 1RE3A 1P84H 1VPCA 4IL6H 3H1HD 1HF9A 2CPBA 4LLHA 4WB4A 4BRYB 2Y0EA 5KAIE 3G6EP 4AYCA 3VMYA 1GK6A 2AEJA 2P7JA 2I1JA 1Z56A 1JY3P 3NXSA 2RKLA 1GL2B 3CI9A 4RKUJ 1LWUB 5AW4B 3VP9A 3OW2O 3RL0B 3SWYA 1N7SA 1BGYG 1FZEA 3BATA 3PH0A 4OGQC 3Q5RA 2HR3A 3L71D 1URQA
chains in the Genus database with same CATH topology
1PV3A 2WSCJ 4YTPC 4PV1D 1MKMA 3GF7A 1AJYA 4I7ZB 4OGQD 3AECC 1VF5B 2G8YA 3AEFC 3RL0g 3T97B 1IK7A 1GMJA 3AE6C 3GLMA 5KKZC 3O6QA 2V7QJ 3LW5J 4U7JA 4H0LB 4R4MA 1R8EA 3G9RA 4OGQB 3AE7C 1NYHA 3GF3A 1FDOA 1FDIA 3Q1MA 3AE2C 3Q5PA 3AEEC 1KTMA 1KMIZ 2ZT9C 1VF5C 2WSEJ 4GDOA 1ZOYC 1PL5A 4H13D 2NZ2A 4XFJA 1NGMB 1DD4A 2H89C 2H88C 1KQGB 2ZT9B 1UIXA 2E74B 3R4YA 2E76B 2YIUC 1OW7A 3RK3E 1OW6A 3AE3C 2WSFJ 1JB0J 2JO1A 1S5LX 2FBWC 4KT0J 1Y9BA 2K9YA 2QIWA 3AEBC 5M1BA 2D2CD 3C8VA 4YXDC 2E75C 2E74C 3Q3DA 3AEAC 2BEZF 1U57A 3B71A 2E76C 1OW8A 2O01J 2JP3A 1KORA 1EXJA 4R4LA 1S1CX 1EXIA 1DD3A 2QJKC 1VL2A 2E75B 3Q2YA 4H0LD 4IL6X 1ZP0C 3S9OA 1ZRTE 2FYNC 3AE5C 4TT3H 1YQ4C 2E74D 2E75D 2YMKA 3D70A 3IN6A 3FGAD 2MKVA 1TU3F 2IDBA 4H44D 3GMAA 1VF5D 2BEQD 3D71A 3ABVC 2FXPA 1PIXA 4H44C 1RQUA 1WMKA 4PV1B 3AEDC 4Z1MH 4Y28J 2P10A 1K05A 1K04A 2WPVB 3AEGC 3SFEC 1DIPA 1KILE 1OMIA 1Q90D 3Q5SA 3AE4C 2D2CB 2WQYC 4H13C 4H44B 1ZMEC 3SFDC 5KLIC 4PV1C 3EWKA 3AE8C 2ZT9D 3D6YA 1HF9A 1KQFB 2E76D 1YQ3C 1HJ0A 2G3AA 2OQQA 2QJYC 4I7ZC 4RKUJ 2D2CC 4H13B 3H25A 3AE9C 2J5UA 2QSIA 5L8RJ 4H0LC 2QJPC 3D6ZA 1RQVA 4OGQC 3Q5RA 3IAOA 3AE1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSC J;  1Q90 D;  2QJK C;  2E75 B;  4I7Z B;  2ZT9 B;  2D2C B;  1VF5 B;  2E74 B;  4H44 B;  4IL6 X;  5KKZ C;  5KLI C;  1ZRT E;  2FYN C;  2E76 B;  2YIU C;  3LW5 J;  4H0L B;  4OGQ B;  2WSF J;  1JB0 J;  1S5L X;  4KT0 J;  2QJY C;  2K9Y A;  2QIW A;  3C8V A;  4H13 B;  2WSE J;  4PV1 B;  2QSI A;  2O01 J;  5L8R J;  2QJP C;  4Y28 J;  4RKU J;  2WPV B; 
#chains in the Genus database with same CATH topology
 1PV3 A;  5KTB A;  3P8C E;  1JY3 O;  4U3F D;  4W7Z A;  3RL0 D;  3VMZ A;  1MKM A;  1GZL A;  1QL2 A;  3JC2 2;  1BE3 D;  1AJY A;  3G4S P;  4L73 A;  5APT A;  4OGQ D;  1MV8 A;  2V4H A;  2QRX A;  3AEC C;  2ZVN B;  3RL0 g;  1ZLL A;  3WU2 H;  1BDC A;  3BCC G;  3GLM A;  1SQP K;  3CWB E;  4L76 A;  3HE5 A;  3O6Q A;  4D6T D;  3RBX A;  2V7Q J;  3O8Z A;  3LW5 J;  1SQX E;  1T8Z A;  1RE4 A;  1KYO D;  1A02 F;  2QG4 A;  4A7P A;  1PP9 J;  4Y99 C;  2GM4 A;  1IZN B;  1FDO A;  4XE5 B;  2HOD A;  3CC2 P;  1N2D C;  1SQB G;  1RF1 C;  1BGY E;  2ZT9 C;  1SP4 A;  4GKG A;  2B87 B;  4JBZ A;  1XTC C;  1OFC X;  1NTM K;  2K37 A;  3VN0 A;  2YIU B;  3L70 J;  3L71 J;  4H13 D;  5APS A;  1NTZ D;  3EQ2 A;  2Y9Z A;  3U1C A;  1SQQ J;  2K88 A;  5AW7 B;  3TF5 A;  4XFJ A;  2O01 N;  4DJG A;  1M7L A;  3A2A A;  1G1I A;  2R44 A;  1DD4 A;  1H8A A;  2R32 A;  3MUD C;  2IBZ G;  3V4W A;  1YI2 P;  2H89 C;  2H88 C;  4WY4 C;  2C9N Y;  1QGK B;  4WY4 A;  1L0N D;  2KSJ A;  2Z5I A;  3H1I D;  1UIX A;  3LID A;  1BE3 G;  2O3J A;  4PD4 H;  5AW1 B;  1BCC D;  4EOT A;  1NTK K;  2YXQ B;  1PP9 D;  3G71 P;  1IO4 A;  1WRG A;  1VQ5 P;  3H1J G;  1M1J C;  1MZ9 A;  1NHL A;  1OVV A;  1X79 B;  2OAR A;  2WSF J;  1EC5 A;  5CCG C;  2JO1 A;  1U7J A;  1NVO A;  2Y9Y A;  2M8R A;  2QJK B;  3CCQ P;  2BCC E;  1MFT A;  3A7O A;  1A02 J;  1FZB A;  1M1J A;  4K3A A;  3L73 D;  1KB9 H;  2E74 C;  3P7K A;  1ZXG A;  4LGD E;  2E43 A;  5AVZ B;  2BEZ F;  2SPZ A;  2YNY A;  3B71 A;  3CWB G;  1SQB J;  5DJT B;  2RN0 A;  1LTS C;  1M8O B;  3H1K J;  3LIE A;  1KFM A;  1OZH A;  1H88 A;  1M1J B;  1OXZ A;  1JTH B;  1NAF A;  3CXH D;  1PPJ G;  3OAK A;  2N1T C;  1X9V A;  3FX0 A;  1FOS F;  1L0N J;  3MUD A;  2YMY A;  2W6A A;  4OWF A;  4N78 D;  3L70 D;  4PD4 E;  2FFD C;  1FZA A;  1JTH A;  2Q6Q A;  1ZRT E;  1RHZ B;  1GK4 A;  2IBZ D;  3HD7 D;  2H43 A;  2WT7 B;  3L75 J;  4EYY Q;  2ZAE B;  3O6Q B;  4PJ0 E;  2E75 D;  2A06 D;  3P8M C;  2JDI H;  1JY2 N;  1LT9 B;  1EZV D;  4EDF A;  5GTH E;  1FZG A;  2I1K A;  3L74 E;  2E42 A;  1SQB K;  1P84 E;  1VQ6 P;  5CCG D;  2MKV A;  3H1J D;  1NO4 A;  1TU3 F;  1FE6 A;  3ABV C;  3CXH H;  3KYQ A;  1JOC A;  1PIX A;  2H8P D;  3A3Y B;  4H44 C;  3JCU H;  1SQB D;  3HE4 A;  2N9B A;  1UII A;  1WMK A;  2JKV A;  2ZJS E;  3AED C;  3H1K D;  3WUV A;  3NFQ A;  2WT7 A;  1L0L K;  2R5D A;  1LT1 A;  1S2E A;  4GOF A;  5TJH A;  4UB6 H;  2KUB A;  3KXD A;  1BDD A;  1J2J B;  1N7L A;  3SFE C;  1GL2 A;  1PZQ A;  1P84 D;  2AEF A;  4AQR D;  3TGU D;  1KIL E;  1OMI A;  2WSE H;  1OX3 A;  2OTK E;  3V2Q A;  3TGU E;  2D2C B;  2O1K A;  4H44 B;  5KJ7 C;  1K9M Q;  2UWJ E;  1GU4 A;  1ZME C;  2NPS A;  3TGU J;  1URQ B;  5APQ A;  3IFM A;  1XTG B;  3KZI E;  1KC8 Q;  5APX A;  2FYU E;  2ZT9 D;  4N78 E;  5CCH D;  4N3Y B;  3D6Y A;  1FS0 E;  3EFF K;  2R5B A;  3EFG A;  2E76 D;  1YQ3 C;  4UB8 H;  1IK9 A;  1M57 D;  3I56 P;  1Q86 Q;  4HJG H;  3CXH E;  4XA4 A;  1L4A D;  1J1E C;  1G1J A;  5K5G B;  1SQV K;  5AVW B;  3CX5 I;  1YJW P;  1K73 Q;  4YPC A;  2D2C C;  2Q1K A;  1H0T A;  2P2U A;  2E5T A;  3H1L E;  1URQ C;  2W8Z A;  4C7N B;  4PD4 I;  5GTI H;  1IJD B;  1IFJ A;  1QVG O;  3H1L J;  1L2P A;  1FAV A;  1SFC A;  1T3J A;  2BCC D;  3MGN A;  5AW6 B;  1H0T B;  4Y99 B;  1Y8A A;  3IR9 A;  3V6I A;  4PV1 D;  3CCR P;  3VTP C;  2LXC B;  2ZVO B;  2R3S A;  4RO0 A;  3WU2 E;  5CCH C;  1W2B O;  1K8A Q;  1DX7 A;  1YBK A;  5AVT B;  3A0B E;  4WWI A;  4I7Z B;  2N1T A;  1VF5 B;  1PP9 E;  5AVS B;  3RBZ A;  3M0D A;  5B5E E;  1KB9 I;  2XU6 A;  3H32 A;  2YXR B;  2Q3E A;  5B66 H;  3CCV P;  1SQV J;  2Z5H A;  1SFC D;  3H1I E;  1QEX A;  2YO3 A;  4H0L B;  1L0N E;  1JCD A;  3TYY A;  1CI6 A;  3M0D C;  2IZ0 A;  2I8D A;  4QMA A;  4KJM A;  3GF3 A;  3RK2 D;  1QX8 A;  3Q1M A;  1EZV G;  4IFF A;  1CSB A;  1YJN P;  1N73 A;  5KLV G;  1KMI Z;  1E5W A;  2HOD B;  1L0L J;  5C39 A;  1L4A A;  1VQ4 P;  2WSE J;  4GDO A;  3H1L D;  1SQQ E;  3HUS A;  4I2L C;  1ZN5 A;  1LTT C;  2O1J A;  2FY8 A;  3SWF A;  2K3R A;  1YIT P;  2B9B A;  3TNU B;  2GUV A;  3B5N D;  2OTJ P;  3USS A;  3II6 A;  1PP9 G;  5E79 H;  1S9K E;  1NTM J;  3GHG B;  3QH9 A;  3OA7 A;  1KYO E;  3JCU E;  1D7M A;  4OVN F;  2ZT9 B;  1RF0 A;  1NTK G;  1SQX D;  2E74 B;  1JM0 A;  2FYU D;  1SQV D;  1ZV8 A;  3CXH I;  4W7Y A;  2N1T D;  1HGZ A;  2IPP A;  1NU1 E;  4YXW H;  1Q2N A;  3A5T A;  1J1D B;  2OYO A;  5BVZ A;  1OW6 A;  2J58 A;  1AA0 A;  1JB0 J;  3RK2 C;  1S5L X;  3GHG C;  2QIW A;  2ZYA A;  5AW3 B;  5AW5 B;  3C8V A;  3L71 E;  3L70 E;  2E75 C;  2KNC A;  1SQP E;  5EFW B;  3L35 A;  1IFD A;  3AEA C;  1QVF O;  1U57 A;  3W67 A;  1QL1 A;  1LP1 A;  3MZW B;  1ZR2 A;  2JP3 A;  4HKZ H;  3RK3 C;  2KZI A;  1NTM D;  1SS1 A;  2KLU A;  5AVX B;  3TGU G;  4R4L A;  1EXI A;  1S4X A;  1DD3 A;  1KIL B;  2FYU J;  2WMM A;  1SQX J;  1EZV E;  2BAS A;  1NTZ G;  2PRR A;  3G3Z A;  2A06 E;  2E75 B;  3JSV C;  3H1H E;  3Q2Y A;  2Q9I A;  1PGP A;  1NKN A;  3CX5 H;  3L74 J;  1LTJ B;  2IBZ E;  4TT3 H;  3B5N A;  1YQ4 C;  2E74 D;  5APY A;  2KP8 A;  3B5N C;  2KI7 B;  3A0H E;  3RK3 B;  3CCS P;  3IN6 A;  1JEK A;  3KZI H;  1YTZ T;  3V2N A;  3L72 E;  1HWT C;  2IDB A;  1NU1 J;  2M3B A;  3GMA A;  4H44 D;  1OWA A;  2IYP A;  1LTB C;  1AVY A;  3D71 A;  1LTA C;  3E1R A;  3L73 G;  2K9J B;  3CCM P;  5GTH H;  1LTJ C;  1RQU A;  3PRJ A;  1HTL C;  1M56 D;  2DW3 A;  3UIA A;  4Z1M H;  1X0T A;  3ITK A;  5KLI B;  2Q5U A;  4K35 A;  5AVY B;  3CL3 D;  3L75 G;  1LT9 C;  4JQ0 D;  3HUS C;  2A06 G;  2YKP A;  2ZFC A;  2WPV B;  2N9Y B;  3H1H G;  3HD7 C;  5TIS H;  2IBZ I;  4EIJ A;  1NTK J;  3U59 A;  1SQP D;  3CLQ A;  1LTG C;  1GTW A;  4BRY A;  1PPJ E;  1N73 C;  1MUU A;  1EZV I;  1BE3 J;  1L0N G;  1LNQ A;  1LWU C;  2WQY C;  4HB1 A;  2IZ1 A;  3RL0 C;  3VP8 A;  5B5E H;  1CZQ A;  2W6J H;  3N7N A;  5AVQ B;  4ASV A;  2XV5 A;  1PGJ A;  4D6T J;  5B66 E;  1LP1 B;  3RGU A;  2FFD A;  2WPS A;  5AVR B;  5KLV D;  3BCC E;  1KFN A;  2JJL A;  1KQF B;  3TK1 A;  1KN7 A;  3HD7 B;  1NU1 D;  1HJ0 A;  1FU1 A;  3FXD A;  3KDP B;  2OQQ A;  2QJY C;  1IFI A;  5BU8 B;  4HH2 A;  2O01 H;  4I7Z C;  4JPZ B;  4M3L A;  5CCH A;  1Q81 Q;  4H13 B;  4WVZ A;  4ZKU A;  2B89 A;  3AE9 C;  5KKZ C;  5KKZ B;  3CD6 P;  1SQV G;  2XDJ A;  1KZU B;  2J5U A;  1S9K D;  4JF7 A;  2QSI A;  1CW5 A;  4H0L C;  3V5B A;  2KS1 B;  3D6Z A;  1RQV A;  2LKM A;  2WZ7 A;  3IAO A;  1EDK A;  1YTZ I;  4O9B A;  1FZC A;  1VQ7 P;  1NTZ K;  1SQQ D;  2WSC J;  1SQP J;  4IOI H;  2L5G B;  1Q82 Q;  2QJY B;  3L72 G;  1WT6 A;  1NJI Q;  2KIK A;  2WSS H;  4IFM A;  1G2C B;  2G8Y A;  3AEF C;  1GW4 A;  2Q7C A;  3T97 B;  1IK7 A;  3AE6 C;  1L0L G;  2YKQ A;  5AW0 B;  4ZKP A;  1HJB A;  3H1H J;  3I5C A;  4BWN A;  1N7S B;  4U7J A;  1HUC A;  1HVV A;  1SQQ G;  1R8E A;  1BCC J;  3G9R A;  4I6M C;  1QLE D;  2FXM A;  1DEE G;  2KYV A;  1BE3 E;  3L70 G;  3L71 G;  4OGQ B;  1SLQ A;  3B4S A;  1ZR4 A;  1NYH A;  1GD2 E;  3CCE P;  2HPC A;  2P1J A;  1JMM A;  3AEE C;  1KTM A;  4CPG A;  2NPS D;  3HRN A;  3L37 A;  1VF5 C;  2XKM A;  4IFD K;  5KLV K;  1E79 H;  5CCG A;  2KOG A;  3L73 J;  3H1I G;  1JMB A;  1N7S C;  3CCL P;  2ZYG A;  1VQK P;  1GL2 D;  2NZ2 A;  3CC7 P;  4WY4 D;  2L91 A;  2FYZ A;  1M1K Q;  1RF0 C;  2KNC B;  2OYH A;  3CC4 P;  2C9L Y;  1KYO H;  2OGU A;  2XND H;  1AV1 A;  1RH5 B;  2AXT E;  1RF1 B;  1JO5 A;  3P32 A;  3L72 D;  1YHQ P;  4W80 A;  3PJS K;  1FZF A;  4UB6 E;  2E76 B;  1U7M A;  2K1A A;  3SWK A;  3RK3 E;  3B8E B;  1IFP A;  1VQO P;  5APU A;  1SQX K;  2NPS C;  1AVO A;  2RH0 A;  2WVR A;  3L75 D;  3MHV A;  5CJ0 A;  3M91 A;  3NMD A;  4MN4 C;  1URQ D;  2HYN A;  1G2C A;  1MFZ A;  5CJ4 A;  2FBW C;  4KT0 J;  1KIL C;  2K9Y A;  1DEB A;  2PFX A;  2P58 A;  2D2C D;  4WY4 B;  3CX5 E;  1N86 A;  4YXD C;  3L74 G;  3VMA A;  3CCJ P;  3F89 A;  3FWL A;  1GU5 A;  3C9I A;  1KIL D;  3Q3D A;  3F5H A;  2OYI B;  1NTZ J;  1EQ7 A;  2FYN B;  2CPS A;  1AFO A;  1L0L E;  2E76 C;  1L0N K;  5H2F E;  2O01 J;  2QM8 A;  1NTM E;  3PP5 A;  2Y0C A;  1EXJ A;  2NPS B;  2FXO A;  4U3F G;  3WUT A;  1S1C X;  4DZO A;  2C0W A;  2B87 A;  2W83 C;  4L74 A;  2WIT A;  2JWD A;  3L36 A;  5TIS E;  2QJK C;  3H1I J;  5CBN A;  1VL2 A;  2WPR A;  3L72 J;  1KIL A;  2P67 A;  2QEX P;  3S9O A;  1ZP0 C;  3H1K G;  1SQQ K;  3H1J E;  1R5S A;  3V4Q A;  1HGV A;  2FYU K;  1CI6 B;  1RY3 A;  1SVF A;  3I55 P;  2GUS A;  1NTK E;  3M0A A;  5H2F H;  2YMK A;  1IC2 A;  1W5C E;  3TSI A;  3HE4 B;  3D70 A;  1RF1 A;  3MD0 A;  1ZRT D;  1KB9 E;  1SQV E;  2H7H A;  4PD4 D;  1ZW0 A;  1EDL A;  3BRT B;  5AW8 B;  1AQ5 A;  3PTZ A;  2M5A A;  2CK3 H;  3M9B A;  4OH8 B;  1S5L E;  3A0H H;  2FFD B;  2KLV A;  2IFM A;  3FWN A;  1T2K C;  1USE A;  5KJ7 D;  5E79 E;  1H89 A;  2JWA A;  1SQP G;  3GW6 A;  1FJP A;  1K05 A;  2ZYD A;  2XNX A;  1X22 A;  3AEG C;  3IF4 A;  3VMX A;  1USD A;  1LWU A;  4AUW A;  1Q90 D;  3E1I A;  3L73 E;  1PFI A;  3Q5S A;  2OYH B;  5KAF E;  1GL2 C;  1PGO A;  3VYI A;  3M06 A;  2FKW B;  3SFD C;  2WTY A;  1OVR A;  3EWK A;  3CPW O;  1YJ9 P;  3AE8 C;  2M3E A;  2J59 M;  3SSU A;  4DT0 A;  4LC1 A;  2YKO A;  3HUS B;  3H1J J;  4NPF X;  3WMM 0;  2V7Q H;  1BSN A;  3BRV B;  3LW5 H;  2G3A A;  1M90 Q;  2PGD A;  3ZDM A;  1FC2 C;  2NRG A;  2OYH C;  1KYO I;  2AEM A;  3MP7 B;  1LTI C;  3H25 A;  1L0L D;  3CME P;  3KQG A;  2KS1 A;  1KV4 A;  2A45 H;  2AXC A;  3M9H A;  3PHL A;  3R2P A;  4GIF A;  5L8R J;  1NH4 A;  2QJP C;  1S72 P;  3CX5 D;  1JY2 O;  3AE1 C;  3V2P A;  1JY3 N;  2POH A;  2WWW A;  5AVU B;  4YTP C;  5KAI H;  3BAS A;  5CMZ A;  3L75 E;  3GF7 A;  1J1E B;  3HD7 A;  1BGY D;  2PP6 A;  1W2E A;  1VQP P;  2FYU G;  3RK3 D;  5AW9 B;  3KHU A;  1OIP A;  1GMJ A;  3CCU P;  4R4M A;  2QJP B;  5AW2 B;  3AE7 C;  3C1L A;  4EI2 A;  2BCC G;  2KSE A;  1JCC A;  1JNM A;  1NU1 G;  4B86 A;  2QE7 H;  1FDI A;  1JUN A;  2QVA A;  3AE2 C;  1OVU A;  3CWB D;  3HTK B;  4L75 A;  4D6T E;  3Q5P A;  2WSC H;  2PAJ A;  2HPC B;  2IX7 C;  4C7R A;  2JEE A;  5CBO A;  3QWO C;  5KAF H;  1PGQ A;  2R3C A;  1HBW A;  1ZOY C;  1HH0 A;  1P84 I;  1SQX G;  3P8C D;  4U3F E;  1PL5 A;  2BCC J;  3S1K A;  3FXE A;  1LJ2 A;  1YYC A;  2MJZ A;  2WSF H;  4HYT B;  4IL6 E;  4WBA A;  2KXP B;  1NWQ A;  3HE5 B;  2LXB A;  2M5A B;  3A0B H;  1NGM B;  3H1K E;  3PLN A;  1BGY J;  4N6J A;  1SQB E;  2AXT H;  1KQG B;  1S5L H;  2XZR A;  2ZXX A;  2WPQ A;  3MIW A;  3TNU A;  3M9Q A;  2KK7 A;  1Y47 A;  3R4Y A;  1N7S D;  5APV A;  2OYI C;  1VQN P;  2Q3I A;  2E5Y A;  1NAY A;  4DOJ A;  3L74 D;  1JY2 P;  2YIU C;  1OW7 A;  2Z4E A;  1DH3 A;  1RE3 C;  2HFE D;  4C7N A;  1FDM A;  3S4R A;  1NTM G;  4C46 A;  5KJ7 A;  3AE3 C;  3CWB J;  4GOD A;  1BSH A;  4PJ0 H;  2HLO A;  2W6B A;  2N1T B;  3VOP A;  1T3U A;  2IYO A;  1NKZ B;  1Y9B A;  3K5B A;  2IFN A;  3AEB C;  5M1B A;  4UB8 E;  4ZNC A;  2QA4 P;  4KHX A;  1EDI A;  1BCC G;  1SFC C;  2B88 A;  4ZMD A;  1IFN A;  1N8R Q;  1LT9 A;  2JR8 A;  4JYC A;  1RE4 C;  1FZC B;  1OW8 A;  1VQM P;  5CHX A;  2OYI A;  1KOR A;  1J1D C;  3B5N B;  5APW A;  2M0B A;  3T97 A;  1LTJ A;  1X8Y A;  2LR2 A;  1KB9 D;  5GTI E;  4RES B;  1KQL A;  5AVV B;  3RK2 B;  3HTK A;  3BCC D;  3MTU E;  4D6T G;  5KLV E;  3CMA P;  1NTK D;  1SFC B;  4H0L D;  4IL6 X;  2W27 A;  1R5L A;  2FYN C;  2GA1 A;  3AE5 C;  1FZC C;  4DCK A;  3H6P A;  3N4X A;  1T6A A;  1NU1 K;  3H32 B;  1PPJ D;  2A45 I;  1AQT A;  4GT1 A;  2K9J A;  3NTN A;  5DJU B;  1FJK A;  1L4A C;  3W68 A;  3BVH A;  1FOS E;  5KLV J;  1BCC E;  3FGA D;  1VQ8 P;  2QM7 A;  3H1L G;  4TLF A;  2C0X A;  1VF5 D;  2BEQ D;  4ASW A;  3WUU A;  1KD1 Q;  2FXP A;  2KB7 P;  1N73 B;  1IFM A;  1VQL P;  3U1A A;  2VRS A;  2ITA A;  1FBM A;  4PV1 B;  1KQS O;  5BU5 A;  1VQ9 P;  2A45 G;  1YIJ P;  3TDK A;  4Y28 J;  2P10 A;  1NTZ E;  1L4A B;  2HG5 D;  4BXL A;  1K04 A;  2OTL P;  4RJT A;  3V2R A;  3BCC J;  1DIP A;  3GG2 A;  2RMZ A;  1LGH B;  1EDJ A;  2ZXE B;  4GOE A;  2Y0D A;  1VDF A;  3KPE A;  3L4F A;  3GHG A;  2KZJ A;  4I1L A;  4U3F J;  3AE4 C;  3E7K A;  3OJA B;  1S3J A;  2YO2 A;  4H13 C;  1T2K D;  1GW3 A;  1NOH A;  2W90 A;  4PV1 C;  4NPE A;  5KLI C;  4NPD A;  4JYB A;  1Q7Y Q;  1GDT A;  1RE3 A;  1P84 H;  1VPC A;  4IL6 H;  3H1H D;  1HF9 A;  2CPB A;  4LLH A;  4WB4 A;  4BRY B;  2Y0E A;  5KAI E;  3G6E P;  4AYC A;  3VMY A;  1GK6 A;  2AEJ A;  2P7J A;  2I1J A;  1Z56 A;  1JY3 P;  3NXS A;  2RKL A;  1GL2 B;  3CI9 A;  4RKU J;  1LWU B;  5AW4 B;  3VP9 A;  3OW2 O;  3RL0 B;  3SWY A;  1N7S A;  1BGY G;  1FZE A;  3BAT A;  3PH0 A;  4OGQ C;  3Q5R A;  2HR3 A;  3L71 D;  1URQ A; 
#chains in the Genus database with same CATH homology
 1PV3 A;  2WSC J;  4YTP C;  4PV1 D;  1MKM A;  3GF7 A;  1AJY A;  4I7Z B;  4OGQ D;  3AEC C;  1VF5 B;  2G8Y A;  3AEF C;  3RL0 g;  3T97 B;  1IK7 A;  1GMJ A;  3AE6 C;  3GLM A;  5KKZ C;  3O6Q A;  2V7Q J;  3LW5 J;  4U7J A;  4H0L B;  4R4M A;  1R8E A;  3G9R A;  4OGQ B;  3AE7 C;  1NYH A;  3GF3 A;  1FDO A;  1FDI A;  3Q1M A;  3AE2 C;  3Q5P A;  3AEE C;  1KTM A;  1KMI Z;  2ZT9 C;  1VF5 C;  2WSE J;  4GDO A;  1ZOY C;  1PL5 A;  4H13 D;  2NZ2 A;  4XFJ A;  1NGM B;  1DD4 A;  2H89 C;  2H88 C;  1KQG B;  2ZT9 B;  1UIX A;  2E74 B;  3R4Y A;  2E76 B;  2YIU C;  1OW7 A;  3RK3 E;  1OW6 A;  3AE3 C;  2WSF J;  1JB0 J;  2JO1 A;  1S5L X;  2FBW C;  4KT0 J;  1Y9B A;  2K9Y A;  2QIW A;  3AEB C;  5M1B A;  2D2C D;  3C8V A;  4YXD C;  2E75 C;  2E74 C;  3Q3D A;  3AEA C;  2BEZ F;  1U57 A;  3B71 A;  2E76 C;  1OW8 A;  2O01 J;  2JP3 A;  1KOR A;  1EXJ A;  4R4L A;  1S1C X;  1EXI A;  1DD3 A;  2QJK C;  1VL2 A;  2E75 B;  3Q2Y A;  4H0L D;  4IL6 X;  1ZP0 C;  3S9O A;  1ZRT E;  2FYN C;  3AE5 C;  4TT3 H;  1YQ4 C;  2E74 D;  2E75 D;  2YMK A;  3D70 A;  3IN6 A;  3FGA D;  2MKV A;  1TU3 F;  2IDB A;  4H44 D;  3GMA A;  1VF5 D;  2BEQ D;  3D71 A;  3ABV C;  2FXP A;  1PIX A;  4H44 C;  1RQU A;  1WMK A;  4PV1 B;  3AED C;  4Z1M H;  4Y28 J;  2P10 A;  1K05 A;  1K04 A;  2WPV B;  3AEG C;  3SFE C;  1DIP A;  1KIL E;  1OMI A;  1Q90 D;  3Q5S A;  3AE4 C;  2D2C B;  2WQY C;  4H13 C;  4H44 B;  1ZME C;  3SFD C;  5KLI C;  4PV1 C;  3EWK A;  3AE8 C;  2ZT9 D;  3D6Y A;  1HF9 A;  1KQF B;  2E76 D;  1YQ3 C;  1HJ0 A;  2G3A A;  2OQQ A;  2QJY C;  4I7Z C;  4RKU J;  2D2C C;  4H13 B;  3H25 A;  3AE9 C;  2J5U A;  2QSI A;  5L8R J;  4H0L C;  2QJP C;  3D6Z A;  1RQV A;  4OGQ C;  3Q5R A;  3IAO A;  3AE1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...