2IX7C

Structure of apo-calmodulin bound to unconventional myosin v
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
58
structure length
58
Chain Sequence
ADKLRAACIRIQKTIRGWLLRKRYLCMQRAAITVQRYVRGYQARCYAKFLRRTKAATT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Contractile protein/metal binding
molecule keywords CALMODULIN
publication title Crystal Structure of Apo-Calmodulin Bound to the First Two Iq Motifs of Myosin V Reveals Essential Recognition Features.
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2006-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00612 IQ IQ calmodulin-binding motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ix7C00
1N2DC 3H6PA 1T8ZA 2GUSA 1KFMA 1JCDA 1JCCA 1EQ7A 2IX7C 2GUVA 1KFNA
chains in the Genus database with same CATH superfamily
1LP1B 3MZWB 4EIJA 3CWBJ 4UB6E 3PLNA 3TK1A 1EZVE 4OGQC 3L73E 1NOHA 2ZXXA 1URQD 3CWBG 4D6TJ 1LTBC 4IOIH 3VMYA 4HH2A 5CCHD 2FXMA 1Q2NA 5AVVB 1PPJG 2W83C 2IFMA 2YIUC 1URQB 2O3JA 2WWWA 3HUSA 1NTZK 4D6TG 4HKZH 1SQBK 3PH0A 4N3YB 1FE6A 3NXSA 2E74D 3O8ZA 1OMIA 2Z5HA 2AEMA 3PHLA 5AVUB 2OYIB 2WSCJ 1LTGC 1J1EB 2E74B 2JDIH 3BRTB 1N73B 2OYHC 4XA4A 2YKQA 3TGUJ 1HJBA 3L36A 3CCSP 2NPSC 3SWKA 1NU1E 4PV1C 4AQRD 3L71E 1FZAA 4HB1A 1HTLC 1M56D 1M1JB 1NTKG 3OJAB 1L0ND 1OZHA 3L73J 3MP7B 3TGUG 3FX0A 3C1LA 2POHA 1FS0E 1EZVG 3CCLP 2N9BA 2ZAEB 2FYUK 3L73G 1JCDA 3R4YA 5CJ4A 3V5BA 1BGYD 1J1DC 3B5ND 2ZVOB 2WSCH 5AVWB 1KQFB 1ZRTE 1KORA 1CI6B 2IBZE 1NTZE 1YQ4C 1SQBE 1KB9E 2OTLP 3QH9A 4UB6H 2J59M 4JBZA 4H13C 3MGNA 5KLVK 3L72E 2H88C 3Q5PA 1URQA 1NU1J 3L71J 1IFNA 4GOEA 3FWLA 4A7PA 3AE7C 1QX8A 3LW5J 3TYYA 5CCHA 3P8CE 1X9VA 3AE8C 5KLIC 1N2DC 2KSJA 2QG4A 1M8OB 3S1KA 1SVFA 2XU6A 3CLQA 2CK3H 4B86A 1NU1G 3L71G 1KILD 2OYIA 3T97A 1N73A 2PFXA 5BU5A 1VQ9P 1L4AC 1S3JA 5CCGD 1MFZA 3ITKA 5AVZB 4WY4A 1BSHA 1T3JA 1Q82Q 1UIIA 1Q7YQ 2GM4A 1NTZJ 1SQBJ 1BE3J 3Q5SA 2R3CA 1AVYA 2C0WA 4GOFA 2PGDA 3LW5H 4IFDK 2W6JH 2KNCB 4C46A 1G2CA 1CW5A 1NTZG 2P1JA 3L72J 1SQBG 3RK3B 2HLOA 1IFMA 4C7NB 3H1KD 2W6BA 4WB4A 2P67A 1A02J 1L2PA 1USDA 3L72G 3D70A 4BRYB 3B5NA 2R5BA 2XNXA 3CCUP 1OIPA 2KXPB 4I1LA 1JMMA 1DX7A 1KB9H 3TF5A 2P10A 2M3EA 2L5GB 2I1KA 5CBNA 3H1JJ 3HE4B 2FYUJ 2H89C 1NTMD 3MUDA 1M7LA 2XKMA 4GKGA 3VMAA 3H1LE 1YTZI 2HG5D 3U59A 2FKWB 5CCHC 2YMKA 3AE2C 5KAFE 1JY3N 2WSSH 4RKUJ 3Q2YA 3GF3A 1W5CE 2V7QJ 1VPCA 4WBAA 2OYIC 2E74C 1LWUB 3A3YB 1FZFA 5KLVJ 3A5TA 1P84D 5KJ7D 1YJ9P 1KILA 1EQ7A 1IFDA 2B87B 4BWNA 5DJTB 1G1IA 1FZGA 1BDCA 2BEZF 2KLVA 1RF1B 3BCCE 3H25A 5CCGA 1M1JC 5AW4B 1YYCA 4YTPC 1LT9A 3RK2D 2BASA 2E42A 2KNCA 1SQXD 2HODB 2OYOA 4L76A 3E1RA 2R5DA 4C7NA 4HJGH 1FJPA 4RO0A 3RK2B 2V7QH 1T3UA 2PP6A 3G6EP 1EDKA 1FDOA 2K9JB 4BRYA 1YTZT 2C9NY 1SQVK 3BASA 2KIKA 2NPSD 1U57A 5APXA 3H1LG 1Y8AA 1LTSC 2FYZA 2V4HA 1JO5A 2Q3EA 3HE4A 3VMXA 3PP5A 4L75A 2NPSB 3CX5E 1QGKB 3AEGC 3CCMP 2RN0A 1NTKD 1VQKP 1YIJP 1NH4A 1EZVI 3GHGB 3GMAA 2G3AA 1VF5B 4I2LC 3BCCG 2QE7H 1OVUA 1T8ZA 3F5HA 2WTYA 1J1DB 1JOCA 1JY3P 2B87A 4KJMA 3MD0A 3CXHD 4ZKUA 4YPCA 1RF1A 5GTHH 3CC2P 3CCRP 5APSA 5BVZA 2OQQA 1L0LK 5KJ7A 1GW3A 3S9OA 2JO1A 2QA4P 5APTA 1GK4A 1SQQG 3AEFC 2HODA 1GW4A 1SQVE 2ZFCA 4BXLA 1OFCX 1NYHA 3RK3C 2BCCJ 2Z4EA 2WPRA 4OH8B 3M9QA 1VL2A 2K9JA 1EXIA 1L4AD 2C9LY 2GUSA 1PP9E 3AE3C 3NMDA 2OYHA 3SSUA 2ITAA 3LIEA 2NPSA 2LR2A 1VQNP 1FU1A 1KV4A 2LXCB 2IZ0A 1S72P 1DD3A 2QVAA 5AW3B 3L75E 2IYPA 2QIWA 3VN0A 3CMAP 3UIAA 1OW8A 3CX5H 1WMKA 3M06A 3CI9A 3GF7A 2FBWC 3CC4P 3GHGA 2LXBA 1ZXGA 1BCCD 1SQVJ 3I5CA 2IBZI 2W6AA 3OAKA 2K1AA 1KB9I 1H89A 3H1ID 1LWUC 1LGHB 3B71A 4Z1MH 2FYNB 1PFIA 1SQVG 1H0TB 1NO4A 5L8RJ 2WMMA 4ASVA 1RF1C 4C7RA 1KC8Q 5GTIH 2WPQA 2C0XA 1RE3C 3L70E 3OW2O 1PP9J 1KFMA 4NPDA 5KJ7C 1ZW0A 4ZKPA 3H6PA 3FXEA 1SQPD 1LTJB 5AVSB 3PRJA 1OXZA 3L4FA 3S4RA 3RK2C 1KFNA 3L75J 1VQ5P 4PD4H 1HUCA 1PGQA 3KXDA 4GDOA 3AE6C 1ZMEC 2Q3IA 1PZQA 2E5TA 3L74E 1L0LJ 4U3FE 3L75G 1IK7A 4N78D 2L91A 2KZJA 1FDIA 2FXPA 3IR9A 1L4AA 4ZMDA 1EC5A 1RQVA 1FC2C 1KD1Q 4W7ZA 3G9RA 1KQGB 4DCKA 2E5YA 3CPWO 1FZCC 1LTTC 4KHXA 2XV5A 1RHZB 3HE5B 3L70J 5APUA 3HD7C 4K35A 1PGOA 3PJSK 1HVVA 4LGDE 3GHGC 1VF5C 1S1CX 2XDJA 3L70G 5AVRB 1SP4A 1LP1A 3VOPA 2FXOA 1H0TA 3W67A 2ZT9C 1KYOH 1HH0A 2J5UA 2H43A 2YXRB 1JNMA 2HFED 4DJGA 1AV1A 1MZ9A 1BE3E 4RESB 3L74J 4U3FJ 3L35A 1JB0J 1SFCB 2OTJP 1PIXA 2Z5IA 1LTJA 1E79H 3I56P 5TISE 1FOSF 3L74G 4U3FG 1JEKA 3M9HA 3P32A 4ASWA 3C9IA 1L0NK 1CZQA 3AE9C 1MUUA 2KK7A 3KPEA 3D71A 1OX3A 1K73Q 1EDLA 3MIWA 2E75D 1Y9BA 3RBXA 4R4MA 1WT6A 5KKZB 3FGAD 2RH0A 2QEXP 2DW3A 3H1JE 1NAYA 2FYUE 3I55P 2E75B 1OWAA 1M1JA 3U1AA 4GODA 3HE5A 1N7LA 3RK3D 2NRGA 3EQ2A 3KYQA 2M5AB 1SS1A 1SQQD 2R44A 4LC1A 3RGUA 2IBZG 2P2UA 3E1IA 1BE3G 3H1IJ 1PGJA 3CC7P 1BDDA 5KLVE 1AJYA 2FYNC 2ZYAA 1RH5B 4L74A 1CI6A 4H44C 1KTMA 4JQ0D 3BVHA 3KZIE 1LTIC 1NWQA 3CX5I 1L0NE 3RL0D 3EFGA 2E43A 1JY2N 1NKZB 5AW5B 3WMM0 4NPFX 1X0TA 3V2RA 1JTHB 1S9KD 1LTJC 1FJKA 3SWFA 3RL0B 3CD6P 3AEAC 1GDTA 5TISH 3P7KA 3GG2A 4XFJA 1T2KD 4OWFA 2MJZA 4IFFA 3VP9A 3VP8A 3O6QB 5AW2B 4W7YA 3H1HD 1R8EA 1VQPP 3H1JG 3RBZA 1RQUA 2FYUG 1VQLP 2JWDA 1YJNP 4EYYQ 1YHQP 2E76C 3HTKB 2WPSA 1AQ5A 3V2PA 5GTHE 1GU5A 3M0AA 3B8EB 2WZ7A 1IFPA 2N1TC 4GIFA 4PD4I 5CMZA 2KS1B 5TJHA 2AXTH 5AVTB 1JY3O 1ZP0C 4EOTA 1L0NJ 5KLVG 2K37A 2O01N 3CWBD 1IFIA 2FFDB 1KILE 1FAVA 1Q90D 3VMZA 4JPZB 1NTMK 4DT0A 4O9BA 4YXDC 1PPJD 1BGYJ 3V4QA 2KB7P 1K9MQ 4D6TD 2B89A 3A0BE 5M1BA 2QJKB 1GL2B 2JKVA 2JJLA 2OTKE 1R5SA 2P58A 1DD4A 3KZIH 2YKPA 4DOJA 4KT0J 1SFCC 1JTHA 2XZRA 2IX7C 1HGVA 2YKOA 3HD7D 1G1JA 2RMZA 2XNDH 2M3BA 2BCCE 1FZCB 1JY2P 2IFNA 1KYOI 3H1KE 1DEBA 1K8AQ 1VF5D 4TT3H 4L73A 1HBWA 3HD7B 2Y0DA 3TGUD 3KHUA 2FY8A 1SQXK 2ZT9D 2WT7B 2KZIA 3HTKA 1EZVD 3CCQP 1LWUA 2HPCB 1DIPA 3L73D 1N86A 5KKZC 4WWIA 4I6MC 3IN6A 2ZT9B 5GTIE 2M0BA 1QVGO 1VQ7P 4OVNF 1NTME 2KS1A 1FDMA 2LKMA 3PTZA 3NFQA 2E75C 4ZNCA 2VRSA 2WVRA 1VDFA 1RE3A 2Y9YA 3OA7A 2QJYB 2Q7CA 2ZVNB 1WRGA 2I1JA 1VQ8P 2FFDA 1YQ3C 2IPPA 2H7HA 2QRXA 2Q6QA 5H2FE 4PD4E 5KTBA 3CL3D 3AE4C 3H1KJ 1P84E 1NTKK 1JCCA 3H32B 2QM8A 1VQ4P 1RF0A 1SLQA 2MKVA 1YBKA 2BCCG 3W68A 1NU1D 3A0BH 3L71D 2CPBA 2QSIA 3H1KG 1S2EA 4UB8E 5C39A 1AQTA 3HUSB 1SQXE 2Q9IA 2YO2A 2W8ZA 1GK6A 2QM7A 1R5LA 1FZCA 2ZYGA 3AEDC 2WITA 3RL0C 4GT1A 1NTMJ 3A2AA 1YITP 2A06E 3HD7A 1GU4A 5E79E 3P8MC 3A0HE 3H1HJ 2WT7A 3VTPC 3ZDMA 1NTMG 1ZRTD 1L0LE 1H8AA 3JC22 1VQ6P 1S5LE 4H44D 2HPCA 2IBZD 1QL1A 1NTZD 1KYOE 4QMAA 1SQBD 1T2KC 1KB9D 1M90Q 2ZJSE 3V2NA 3KQGA 3IFMA 3M9BA 3G71P 4H44B 2N9YB 1K05A 1JUNA 3L72D 4Y99B 1QL2A 4H0LB 2O01J 2AXCA 3M0DA 1JM0A 1PL5A 3E7KA 2FFDC 1SQXJ 3P8CD 4TLFA 2A45G 4IL6E 1PP9G 3TDKA 5APQA 1NKNA 3F89A 2E76D 3CXHE 1K04A 5CHXA 3H32A 5H2FH 1SQXG 1Z56A 1NGMB 2QJKC 1OVVA 1KQSO 3AEBC 3JCUE 1GL2C 3V4WA 1P84H 3SWYA 1NJIQ 3H1JD 1RF0C 2FYUD 1FZEA 2E76B 2A06G 2O1KA 2N1TD 2A45H 5AVXB 1Y47A 1DEEG 3CCEP 2O01H 2YO3A 4UB8H 5APWA 4IFMA 5B66E 1HGZA 1IC2A 1L0LG 2R3SA 2N1TB 1W2EA 2QJPB 4WY4D 2OARA 4R4LA 2WSFJ 1HJ0A 1GTWA 3B4SA 3T97B 1NTKJ 2CPSA 3R2PA 5CBOA 5KLVD 2PRRA 1NAFA 1SQPK 2JP3A 5E79H 1RE4A 2AEFA 4WY4B 1M57D 3BATA 3A0HH 1MFTA 4JYBA 1S5LH 1ZLLA 4NPEA 1SFCD 1T6AA 1QEXA 1G2CB 2YMYA 2QJYC 1GD2E 2OGUA 1Q81Q 1EDJA 3FWNA 2WSFH 3M0DC 1U7JA 3H1LD 5CJ0A 1BCCE 1VQOP 1JMBA 4Y28J 2WPVB 3H1IE 3B5NB 3WU2E 1ZOYC 4IL6H 3TNUB 2JEEA 3CXHH 4MN4C 2NZ2A 4XE5B 4AUWA 3JCUH 5AW9B 1IO4A 1KZUB 3BCCD 3HUSC 1Q86Q 1SQPE 3V2QA 1VQMP 1XTGB 2AXTE 2N1TA 2B88A 4EI2A 1BSNA 4U7JA 3Q1MA 1N7SD 5B66H 3CCVP 2IYOA 1HWTC 1HF9A 1OW7A 4HYTB 2ZXEB 5AW7B 1EDIA 1KILB 1BCCJ 2M8RA 1N7SB 2WQYC 1RE4C 4N78E 4I7ZB 1H88A 1EXJA 3LIDA 3K5BA 1YI2P 5BU8B 1LJ2A 3MHVA 5APVA 3MTUE 1LT9B 1BCCG 1QLED 1OW6A 2IZ1A 2IDBA 3FXDA 5AW0B 3H1IG 1W2BO 4Y99C 2BCCD 3CX5D 4H0LC 1J2JB 5B5EE 1SFCA 1AVOA 1ZR2A 1SQPJ 1X79B 3A7OA 2W27A 1KQLA 4JF7A 1ZV8A 1BGYE 3AE1C 2ZYDA 1MKMA 3TNUA 5AW6B 2KYVA 1SQPG 3WU2H 2K88A 1JY2O 1SQQK 4K3AA 1URQC 1CSBA 3RL0g 2Y9ZA 2K3RA 3SFDC 2SPZA 3AE5C 4YXWH 1IJDB 3AECC 3USSA 2AEJA 2D2CD 1U7MA 3II6A 1SQVD 1GMJA 2QJPC 1X22A 1X8YA 4OGQD 2B9BA 3D6ZA 3V6IA 3D6YA 4EDFA 1J1EC 4PD4D 1P84I 2M5AA 2D2CB 1S4XA 1IZNB 1N73C 2W90A 1QVFO 2WSEJ 4WVZA 2Q5UA 3GW6A 3CCJP 1N7SA 2A45I 2KUBA 4WY4C 4OGQB 1GL2D 1L0NG 3BRVB 1PP9D 3ABVC 5AVYB 3TSIA 1KN7A 3VYIA 3N4XA 5K5GB 1GZLA 3NTNA 2UWJE 1ZN5A 3RK3E 1BGYG 4LLHA 2YIUB 2KP8A 3Q3DA 3M91A 1MV8A 3SFEC 3L75D 1PV3A 2A06D 1IK9A 4N6JA 1SQQE 3H1LJ 3IF4A 2BEQD 2WSEH 5B5EH 1DH3A 3WUVA 3B5NC 4PV1D 1L0LD 1UIXA 1KYOD 5AVQB 3O6QA 2OYHB 2YXQB 3EFFK 2JR8A 2KSEA 4PV1B 2G8YA 2P7JA 3BCCJ 4PJ0E 3MUDC 2HR3A 3WUUA 2YNYA 3L70D 1S9KE 3WUTA 4W80A 3JSVC 2PAJA 1A02F 4RJTA 2J58A 2Y0EA 5KAIE 4JYCA 5KAFH 2I8DA 1ZR4A 3HRNA 3G4SP 1XTCC 3CXHI 1YJWP 3H1HE 2GA1A 4H13D 1SQQJ 2GUVA 1KILC 1LT1A 1LTAC 1N7SC 2RKLA 3G3ZA 1FOSE 4DZOA 1NHLA 1S5LX 4I7ZC 2KI7B 3CMEP 1RY3A 5CCGC 3L74D 4U3FD 3N7NA 1USEA 3L37A 1FZBA 4H13B 1LT9C 1GL2A 1PGPA 1E5WA 2K9YA 3QWOC 5EFWB 1AA0A 3CWBE 3AEEC 5KLIB 4AYCA 2H8PD 3U1CA 3IAOA 5AW1B 1PPJE 4IL6X 5DJUB 1D7MA 4M3LA 1N8RQ 1FBMA 2R32A 4D6TE 2Y0CA 3C8VA 1NVOA 2KOGA 1L4AB 2KLUA 3GLMA 5AW8B 5APYA 2O1JA 1TU3F 2HYNA 3KDPB 1AFOA 1BE3D 4CPGA 2Q1KA 1OVRA 4H0LD 3H1HG 4PJ0H 3EWKA 3Q5RA 1KMIZ 1IFJA 1NU1K 2JWAA 1NTKE 2D2CC 1M1KQ 1LNQA 5KAIH 3TGUE
chains in the Genus database with same CATH topology
1T2KD 4I2LC 2MJZA 4IFFA 4EIJA 3B5NB 3VP9A 3VP8A 5AW2B 4W7YA 1T8ZA 3TK1A 2WTYA 1J1DB 1JOCA 1JY3P 3TNUB 3MD0A 2JEEA 4ZKUA 3HTKB 1NOHA 1URQD 2WPSA 1AQ5A 1RF1A 3V2PA 1LTBC 3VMYA 4XE5B 4AUWA 4HH2A 5APSA 5AW9B 5BVZA 1IO4A 1GU5A 1KZUB 1L0LK 3M0AA 5KJ7A 3B8EB 1GW3A 2WZ7A 5CCHD 3HUSC 2FXMA 2N1TC 5APTA 5AVVB 1GK4A 2HODA 2IFMA 4GIFA 5CMZA 1GW4A 1URQB 3V2QA 5AVTB 1JY3O 1XTGB 2WWWA 2ZFCA 3HUSA 1NTZK 4EOTA 1SQBK 2N1TA 4N3YB 3NXSA 3RK3C 3O8ZA 2Z4EA 1N7SD 2WPRA 1IFIA 2Z5HA 4OH8B 2FFDB 3M9QA 1FAVA 1HWTC 3VMZA 4HYTB 2ZXEB 5AW7B 1NTMK 5AVUB 4O9BA 2OYIB 3V4QA 2KB7P 1KILB 1LTGC 1J1EB 1L4AD 2M8RA 3BRTB 1N7SB 2C9LY 1N73B 1RE4C 2GUSA 2OYHC 4N78E 4XA4A 2YKQA 1H88A 1HJBA 3L36A 1GL2B 3LIDA 2NPSC 3NMDA 4AQRD 2JJLA 5BU8B 2OYHA 1FZAA 5APVA 3MTUE 1LT9B 3LIEA 1HTLC 2NPSA 1M1JB 3OJAB 5AW0B 2YKPA 4DOJA 1FU1A 1SFCC 1JTHA 2XZRA 4Y99C 5AW3B 2IX7C 1HGVA 2YKOA 1J2JB 3HD7D 3VN0A 3UIAA 1G1JA 2POHA 1SFCA 2M3BA 2N9BA 1ZR2A 3M06A 1FZCB 1JY2P 2FYUK 3CI9A 2IFNA 1JCDA 1X79B 1DEBA 3A7OA 5CJ4A 3GHGA 3V5BA 1J1DC 3B5ND 2W27A 3I5CA 1KQLA 4JF7A 1ZV8A 1HBWA 2W6AA 2WSCH 3OAKA 3HD7B 5AVWB 1H89A 1SQXK 3TNUA 2WT7B 1LWUC 1CI6B 3HTKA 5AW6B 2KYVA 1LGHB 1PFIA 2J59M 1JY2O 1NO4A 1LWUA 1SQQK 2HPCB 1N86A 3MGNA 1RF1C 4C7RA 1URQC 1CSBA 4I6MC 5KLVK 2WPQA 2C0XA 1RE3C 1KFMA 5KJ7C 1IJDB 1FDMA 1URQA 2LKMA 3NFQA 4ZKPA 3H6PA 2VRSA 1IFNA 1VDFA 1RE3A 3OA7A 2Q7CA 1WRGA 1LTJB 2I1JA 3II6A 3TYYA 5CCHA 5AVSB 3P8CE 1X9VA 2FFDA 1N2DC 2KSJA 1X8YA 1OXZA 3L4FA 1J1EC 1SVFA 2IPPA 2XU6A 3CLQA 3RK2C 1KFNA 2H7HA 4B86A 1N73C 1KILD 2OYIA 2Q5UA 1HUCA 5KTBA 1N7SA 3T97A 3CL3D 2A45I 1N73A 4WY4C 5BU5A 2Q3IA 1GL2D 1NTKK 1L4AC 5CCGD 1JCCA 3H32B 2QM8A 1MFZA 3BRVB 5AVZB 4WY4A 4N78D 1RF0A 1SLQA 1T3JA 3IR9A 1L4AA 5AVYB 3TSIA 2GM4A 3VYIA 2CPBA 3N4XA 1GZLA 3NTNA 3HUSB 2R3CA 2C0WA 4W7ZA 2Q9IA 1FZCC 1ZN5A 3LW5H 4IFDK 4LLHA 2YO2A 1LTTC 2KP8A 4KHXA 2XV5A 3M91A 1GK6A 1MV8A 4C46A 1G2CA 1CW5A 2QM7A 3HE5B 5APUA 1FZCA 1IK9A 3RL0C 2WITA 4GT1A 4N6JA 2P1JA 3HD7C 3RK3B 2HLOA 1IFMA 3A2AA 1HVVA 2WSEH 1DH3A 4LGDE 3HD7A 3GHGC 4C7NB 1GU4A 2W6BA 3B5NC 3P8MC 4WB4A 2P67A 2WT7A 2XDJA 1A02J 5AVRB 1SP4A 3VTPC 5AVQB 3VOPA 3B5NA 1H8AA 2R5BA 2XNXA 2HPCA 2OYHB 1HH0A 1QL1A 4I1LA 1T2KC 2H43A 1JMMA 1JNMA 2HFED 3V2NA 1DX7A 2P7JA 3KQGA 1MZ9A 3IFMA 4RESB 2L5GB 3M9BA 2I1KA 3L35A 2YNYA 3HE4B 1JUNA 1S9KE 1SFCB 4W80A 2PAJA 2Z5IA 1A02F 4Y99B 3MUDA 1LTJA 1QL2A 2J58A 1M7LA 2XKMA 4GKGA 1YTZI 3M0DA 2HG5D 1FOSF 3U59A 2FKWB 4JYCA 5CCHC 2FFDC 3M9HA 1ZR4A 3P8CD 3P32A 1JY3N 3HRNA 1XTCC 2A45G 3C9IA 1L0NK 1CZQA 1MUUA 1VPCA 4WBAA 2OYIC 2GUVA 1KILC 5APQA 1NKNA 1LTAC 3KPEA 1N7SC 5CHXA 3G3ZA 3H32A 1FOSE 1LWUB 3A3YB 1FZFA 1Z56A 4DZOA 3A5TA 1NHLA 5KJ7D 1KILA 1RY3A 3MIWA 1EQ7A 1IFDA 1GL2C 5CCGC 3V4WA 1G1IA 1FZGA 3N7NA 3L37A 3SWYA 1FZBA 1WT6A 2KLVA 1RF0C 1LT9C 1RF1B 1GL2A 1FZEA 5CCGA 2O1KA 1M1JC 2A45H 2N1TD 5AW4B 1E5WA 5AVXB 1YYCA 1LT9A 3RK2D 2BASA 2E42A 1OWAA 2O01H 2YO3A 1M1JA 3U1AA 3HE5A 1N7LA 2HODB 3RK3D 3EQ2A 5APWA 4IFMA 3KYQA 1HGZA 1IC2A 2N1TB 1W2EA 4WY4D 4AYCA 2R5DA 2H8PD 4C7NA 1FJPA 2OARA 3U1CA 3RK2B 4LC1A 1GTWA 1T3UA 5AW1B 2CPSA 2PP6A 3R2PA 2P2UA 3E1IA 4M3LA 1FBMA 2R32A 1NAFA 1SQPK 1YTZT 2C9NY 1RE4A 4WY4B 1SQVK 3BATA 2KOGA 3BASA 2NPSD 1L4AB 4JYBA 5APXA 1CI6A 5AW8B 3BVHA 1LTIC 5APYA 1LTSC 2O1JA 1NWQA 2FYZA 1ZLLA 2HYNA 3RL0D 3EFGA 1JO5A 1SFCD 3KDPB 1AFOA 3HE4A 2E43A 1JY2N 1NKZB 3VMXA 3PP5A 5AW5B 3WMM0 2NPSB 1G2CB 2YMYA 3V2RA 1JTHB 1S9KD 1GD2E 1LTJC 1FJKA 3SWFA 3RL0B 2WSFH 3M0DC 5CJ0A 1IFJA 1NU1K 1GDTA 3P7KA 1NH4A 3GHGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N2D C;  3H6P A;  1T8Z A;  2GUS A;  1KFM A;  1JCD A;  1JCC A;  1EQ7 A;  2IX7 C;  2GUV A;  1KFN A; 
#chains in the Genus database with same CATH topology
 1LP1 B;  3MZW B;  4EIJ A;  3CWB J;  4UB6 E;  3PLN A;  3TK1 A;  1EZV E;  4OGQ C;  3L73 E;  1NOH A;  2ZXX A;  1URQ D;  3CWB G;  4D6T J;  1LTB C;  4IOI H;  3VMY A;  4HH2 A;  5CCH D;  2FXM A;  1Q2N A;  5AVV B;  1PPJ G;  2W83 C;  2IFM A;  2YIU C;  1URQ B;  2O3J A;  2WWW A;  3HUS A;  1NTZ K;  4D6T G;  4HKZ H;  1SQB K;  3PH0 A;  4N3Y B;  1FE6 A;  3NXS A;  2E74 D;  3O8Z A;  1OMI A;  2Z5H A;  2AEM A;  3PHL A;  5AVU B;  2OYI B;  2WSC J;  1LTG C;  1J1E B;  2E74 B;  2JDI H;  3BRT B;  1N73 B;  2OYH C;  4XA4 A;  2YKQ A;  3TGU J;  1HJB A;  3L36 A;  3CCS P;  2NPS C;  3SWK A;  1NU1 E;  4PV1 C;  4AQR D;  3L71 E;  1FZA A;  4HB1 A;  1HTL C;  1M56 D;  1M1J B;  1NTK G;  3OJA B;  1L0N D;  1OZH A;  3L73 J;  3MP7 B;  3TGU G;  3FX0 A;  3C1L A;  2POH A;  1FS0 E;  1EZV G;  3CCL P;  2N9B A;  2ZAE B;  2FYU K;  3L73 G;  1JCD A;  3R4Y A;  5CJ4 A;  3V5B A;  1BGY D;  1J1D C;  3B5N D;  2ZVO B;  2WSC H;  5AVW B;  1KQF B;  1ZRT E;  1KOR A;  1CI6 B;  2IBZ E;  1NTZ E;  1YQ4 C;  1SQB E;  1KB9 E;  2OTL P;  3QH9 A;  4UB6 H;  2J59 M;  4JBZ A;  4H13 C;  3MGN A;  5KLV K;  3L72 E;  2H88 C;  3Q5P A;  1URQ A;  1NU1 J;  3L71 J;  1IFN A;  4GOE A;  3FWL A;  4A7P A;  3AE7 C;  1QX8 A;  3LW5 J;  3TYY A;  5CCH A;  3P8C E;  1X9V A;  3AE8 C;  5KLI C;  1N2D C;  2KSJ A;  2QG4 A;  1M8O B;  3S1K A;  1SVF A;  2XU6 A;  3CLQ A;  2CK3 H;  4B86 A;  1NU1 G;  3L71 G;  1KIL D;  2OYI A;  3T97 A;  1N73 A;  2PFX A;  5BU5 A;  1VQ9 P;  1L4A C;  1S3J A;  5CCG D;  1MFZ A;  3ITK A;  5AVZ B;  4WY4 A;  1BSH A;  1T3J A;  1Q82 Q;  1UII A;  1Q7Y Q;  2GM4 A;  1NTZ J;  1SQB J;  1BE3 J;  3Q5S A;  2R3C A;  1AVY A;  2C0W A;  4GOF A;  2PGD A;  3LW5 H;  4IFD K;  2W6J H;  2KNC B;  4C46 A;  1G2C A;  1CW5 A;  1NTZ G;  2P1J A;  3L72 J;  1SQB G;  3RK3 B;  2HLO A;  1IFM A;  4C7N B;  3H1K D;  2W6B A;  4WB4 A;  2P67 A;  1A02 J;  1L2P A;  1USD A;  3L72 G;  3D70 A;  4BRY B;  3B5N A;  2R5B A;  2XNX A;  3CCU P;  1OIP A;  2KXP B;  4I1L A;  1JMM A;  1DX7 A;  1KB9 H;  3TF5 A;  2P10 A;  2M3E A;  2L5G B;  2I1K A;  5CBN A;  3H1J J;  3HE4 B;  2FYU J;  2H89 C;  1NTM D;  3MUD A;  1M7L A;  2XKM A;  4GKG A;  3VMA A;  3H1L E;  1YTZ I;  2HG5 D;  3U59 A;  2FKW B;  5CCH C;  2YMK A;  3AE2 C;  5KAF E;  1JY3 N;  2WSS H;  4RKU J;  3Q2Y A;  3GF3 A;  1W5C E;  2V7Q J;  1VPC A;  4WBA A;  2OYI C;  2E74 C;  1LWU B;  3A3Y B;  1FZF A;  5KLV J;  3A5T A;  1P84 D;  5KJ7 D;  1YJ9 P;  1KIL A;  1EQ7 A;  1IFD A;  2B87 B;  4BWN A;  5DJT B;  1G1I A;  1FZG A;  1BDC A;  2BEZ F;  2KLV A;  1RF1 B;  3BCC E;  3H25 A;  5CCG A;  1M1J C;  5AW4 B;  1YYC A;  4YTP C;  1LT9 A;  3RK2 D;  2BAS A;  2E42 A;  2KNC A;  1SQX D;  2HOD B;  2OYO A;  4L76 A;  3E1R A;  2R5D A;  4C7N A;  4HJG H;  1FJP A;  4RO0 A;  3RK2 B;  2V7Q H;  1T3U A;  2PP6 A;  3G6E P;  1EDK A;  1FDO A;  2K9J B;  4BRY A;  1YTZ T;  2C9N Y;  1SQV K;  3BAS A;  2KIK A;  2NPS D;  1U57 A;  5APX A;  3H1L G;  1Y8A A;  1LTS C;  2FYZ A;  2V4H A;  1JO5 A;  2Q3E A;  3HE4 A;  3VMX A;  3PP5 A;  4L75 A;  2NPS B;  3CX5 E;  1QGK B;  3AEG C;  3CCM P;  2RN0 A;  1NTK D;  1VQK P;  1YIJ P;  1NH4 A;  1EZV I;  3GHG B;  3GMA A;  2G3A A;  1VF5 B;  4I2L C;  3BCC G;  2QE7 H;  1OVU A;  1T8Z A;  3F5H A;  2WTY A;  1J1D B;  1JOC A;  1JY3 P;  2B87 A;  4KJM A;  3MD0 A;  3CXH D;  4ZKU A;  4YPC A;  1RF1 A;  5GTH H;  3CC2 P;  3CCR P;  5APS A;  5BVZ A;  2OQQ A;  1L0L K;  5KJ7 A;  1GW3 A;  3S9O A;  2JO1 A;  2QA4 P;  5APT A;  1GK4 A;  1SQQ G;  3AEF C;  2HOD A;  1GW4 A;  1SQV E;  2ZFC A;  4BXL A;  1OFC X;  1NYH A;  3RK3 C;  2BCC J;  2Z4E A;  2WPR A;  4OH8 B;  3M9Q A;  1VL2 A;  2K9J A;  1EXI A;  1L4A D;  2C9L Y;  2GUS A;  1PP9 E;  3AE3 C;  3NMD A;  2OYH A;  3SSU A;  2ITA A;  3LIE A;  2NPS A;  2LR2 A;  1VQN P;  1FU1 A;  1KV4 A;  2LXC B;  2IZ0 A;  1S72 P;  1DD3 A;  2QVA A;  5AW3 B;  3L75 E;  2IYP A;  2QIW A;  3VN0 A;  3CMA P;  3UIA A;  1OW8 A;  3CX5 H;  1WMK A;  3M06 A;  3CI9 A;  3GF7 A;  2FBW C;  3CC4 P;  3GHG A;  2LXB A;  1ZXG A;  1BCC D;  1SQV J;  3I5C A;  2IBZ I;  2W6A A;  3OAK A;  2K1A A;  1KB9 I;  1H89 A;  3H1I D;  1LWU C;  1LGH B;  3B71 A;  4Z1M H;  2FYN B;  1PFI A;  1SQV G;  1H0T B;  1NO4 A;  5L8R J;  2WMM A;  4ASV A;  1RF1 C;  4C7R A;  1KC8 Q;  5GTI H;  2WPQ A;  2C0X A;  1RE3 C;  3L70 E;  3OW2 O;  1PP9 J;  1KFM A;  4NPD A;  5KJ7 C;  1ZW0 A;  4ZKP A;  3H6P A;  3FXE A;  1SQP D;  1LTJ B;  5AVS B;  3PRJ A;  1OXZ A;  3L4F A;  3S4R A;  3RK2 C;  1KFN A;  3L75 J;  1VQ5 P;  4PD4 H;  1HUC A;  1PGQ A;  3KXD A;  4GDO A;  3AE6 C;  1ZME C;  2Q3I A;  1PZQ A;  2E5T A;  3L74 E;  1L0L J;  4U3F E;  3L75 G;  1IK7 A;  4N78 D;  2L91 A;  2KZJ A;  1FDI A;  2FXP A;  3IR9 A;  1L4A A;  4ZMD A;  1EC5 A;  1RQV A;  1FC2 C;  1KD1 Q;  4W7Z A;  3G9R A;  1KQG B;  4DCK A;  2E5Y A;  3CPW O;  1FZC C;  1LTT C;  4KHX A;  2XV5 A;  1RHZ B;  3HE5 B;  3L70 J;  5APU A;  3HD7 C;  4K35 A;  1PGO A;  3PJS K;  1HVV A;  4LGD E;  3GHG C;  1VF5 C;  1S1C X;  2XDJ A;  3L70 G;  5AVR B;  1SP4 A;  1LP1 A;  3VOP A;  2FXO A;  1H0T A;  3W67 A;  2ZT9 C;  1KYO H;  1HH0 A;  2J5U A;  2H43 A;  2YXR B;  1JNM A;  2HFE D;  4DJG A;  1AV1 A;  1MZ9 A;  1BE3 E;  4RES B;  3L74 J;  4U3F J;  3L35 A;  1JB0 J;  1SFC B;  2OTJ P;  1PIX A;  2Z5I A;  1LTJ A;  1E79 H;  3I56 P;  5TIS E;  1FOS F;  3L74 G;  4U3F G;  1JEK A;  3M9H A;  3P32 A;  4ASW A;  3C9I A;  1L0N K;  1CZQ A;  3AE9 C;  1MUU A;  2KK7 A;  3KPE A;  3D71 A;  1OX3 A;  1K73 Q;  1EDL A;  3MIW A;  2E75 D;  1Y9B A;  3RBX A;  4R4M A;  1WT6 A;  5KKZ B;  3FGA D;  2RH0 A;  2QEX P;  2DW3 A;  3H1J E;  1NAY A;  2FYU E;  3I55 P;  2E75 B;  1OWA A;  1M1J A;  3U1A A;  4GOD A;  3HE5 A;  1N7L A;  3RK3 D;  2NRG A;  3EQ2 A;  3KYQ A;  2M5A B;  1SS1 A;  1SQQ D;  2R44 A;  4LC1 A;  3RGU A;  2IBZ G;  2P2U A;  3E1I A;  1BE3 G;  3H1I J;  1PGJ A;  3CC7 P;  1BDD A;  5KLV E;  1AJY A;  2FYN C;  2ZYA A;  1RH5 B;  4L74 A;  1CI6 A;  4H44 C;  1KTM A;  4JQ0 D;  3BVH A;  3KZI E;  1LTI C;  1NWQ A;  3CX5 I;  1L0N E;  3RL0 D;  3EFG A;  2E43 A;  1JY2 N;  1NKZ B;  5AW5 B;  3WMM 0;  4NPF X;  1X0T A;  3V2R A;  1JTH B;  1S9K D;  1LTJ C;  1FJK A;  3SWF A;  3RL0 B;  3CD6 P;  3AEA C;  1GDT A;  5TIS H;  3P7K A;  3GG2 A;  4XFJ A;  1T2K D;  4OWF A;  2MJZ A;  4IFF A;  3VP9 A;  3VP8 A;  3O6Q B;  5AW2 B;  4W7Y A;  3H1H D;  1R8E A;  1VQP P;  3H1J G;  3RBZ A;  1RQU A;  2FYU G;  1VQL P;  2JWD A;  1YJN P;  4EYY Q;  1YHQ P;  2E76 C;  3HTK B;  2WPS A;  1AQ5 A;  3V2P A;  5GTH E;  1GU5 A;  3M0A A;  3B8E B;  2WZ7 A;  1IFP A;  2N1T C;  4GIF A;  4PD4 I;  5CMZ A;  2KS1 B;  5TJH A;  2AXT H;  5AVT B;  1JY3 O;  1ZP0 C;  4EOT A;  1L0N J;  5KLV G;  2K37 A;  2O01 N;  3CWB D;  1IFI A;  2FFD B;  1KIL E;  1FAV A;  1Q90 D;  3VMZ A;  4JPZ B;  1NTM K;  4DT0 A;  4O9B A;  4YXD C;  1PPJ D;  1BGY J;  3V4Q A;  2KB7 P;  1K9M Q;  4D6T D;  2B89 A;  3A0B E;  5M1B A;  2QJK B;  1GL2 B;  2JKV A;  2JJL A;  2OTK E;  1R5S A;  2P58 A;  1DD4 A;  3KZI H;  2YKP A;  4DOJ A;  4KT0 J;  1SFC C;  1JTH A;  2XZR A;  2IX7 C;  1HGV A;  2YKO A;  3HD7 D;  1G1J A;  2RMZ A;  2XND H;  2M3B A;  2BCC E;  1FZC B;  1JY2 P;  2IFN A;  1KYO I;  3H1K E;  1DEB A;  1K8A Q;  1VF5 D;  4TT3 H;  4L73 A;  1HBW A;  3HD7 B;  2Y0D A;  3TGU D;  3KHU A;  2FY8 A;  1SQX K;  2ZT9 D;  2WT7 B;  2KZI A;  3HTK A;  1EZV D;  3CCQ P;  1LWU A;  2HPC B;  1DIP A;  3L73 D;  1N86 A;  5KKZ C;  4WWI A;  4I6M C;  3IN6 A;  2ZT9 B;  5GTI E;  2M0B A;  1QVG O;  1VQ7 P;  4OVN F;  1NTM E;  2KS1 A;  1FDM A;  2LKM A;  3PTZ A;  3NFQ A;  2E75 C;  4ZNC A;  2VRS A;  2WVR A;  1VDF A;  1RE3 A;  2Y9Y A;  3OA7 A;  2QJY B;  2Q7C A;  2ZVN B;  1WRG A;  2I1J A;  1VQ8 P;  2FFD A;  1YQ3 C;  2IPP A;  2H7H A;  2QRX A;  2Q6Q A;  5H2F E;  4PD4 E;  5KTB A;  3CL3 D;  3AE4 C;  3H1K J;  1P84 E;  1NTK K;  1JCC A;  3H32 B;  2QM8 A;  1VQ4 P;  1RF0 A;  1SLQ A;  2MKV A;  1YBK A;  2BCC G;  3W68 A;  1NU1 D;  3A0B H;  3L71 D;  2CPB A;  2QSI A;  3H1K G;  1S2E A;  4UB8 E;  5C39 A;  1AQT A;  3HUS B;  1SQX E;  2Q9I A;  2YO2 A;  2W8Z A;  1GK6 A;  2QM7 A;  1R5L A;  1FZC A;  2ZYG A;  3AED C;  2WIT A;  3RL0 C;  4GT1 A;  1NTM J;  3A2A A;  1YIT P;  2A06 E;  3HD7 A;  1GU4 A;  5E79 E;  3P8M C;  3A0H E;  3H1H J;  2WT7 A;  3VTP C;  3ZDM A;  1NTM G;  1ZRT D;  1L0L E;  1H8A A;  3JC2 2;  1VQ6 P;  1S5L E;  4H44 D;  2HPC A;  2IBZ D;  1QL1 A;  1NTZ D;  1KYO E;  4QMA A;  1SQB D;  1T2K C;  1KB9 D;  1M90 Q;  2ZJS E;  3V2N A;  3KQG A;  3IFM A;  3M9B A;  3G71 P;  4H44 B;  2N9Y B;  1K05 A;  1JUN A;  3L72 D;  4Y99 B;  1QL2 A;  4H0L B;  2O01 J;  2AXC A;  3M0D A;  1JM0 A;  1PL5 A;  3E7K A;  2FFD C;  1SQX J;  3P8C D;  4TLF A;  2A45 G;  4IL6 E;  1PP9 G;  3TDK A;  5APQ A;  1NKN A;  3F89 A;  2E76 D;  3CXH E;  1K04 A;  5CHX A;  3H32 A;  5H2F H;  1SQX G;  1Z56 A;  1NGM B;  2QJK C;  1OVV A;  1KQS O;  3AEB C;  3JCU E;  1GL2 C;  3V4W A;  1P84 H;  3SWY A;  1NJI Q;  3H1J D;  1RF0 C;  2FYU D;  1FZE A;  2E76 B;  2A06 G;  2O1K A;  2N1T D;  2A45 H;  5AVX B;  1Y47 A;  1DEE G;  3CCE P;  2O01 H;  2YO3 A;  4UB8 H;  5APW A;  4IFM A;  5B66 E;  1HGZ A;  1IC2 A;  1L0L G;  2R3S A;  2N1T B;  1W2E A;  2QJP B;  4WY4 D;  2OAR A;  4R4L A;  2WSF J;  1HJ0 A;  1GTW A;  3B4S A;  3T97 B;  1NTK J;  2CPS A;  3R2P A;  5CBO A;  5KLV D;  2PRR A;  1NAF A;  1SQP K;  2JP3 A;  5E79 H;  1RE4 A;  2AEF A;  4WY4 B;  1M57 D;  3BAT A;  3A0H H;  1MFT A;  4JYB A;  1S5L H;  1ZLL A;  4NPE A;  1SFC D;  1T6A A;  1QEX A;  1G2C B;  2YMY A;  2QJY C;  1GD2 E;  2OGU A;  1Q81 Q;  1EDJ A;  3FWN A;  2WSF H;  3M0D C;  1U7J A;  3H1L D;  5CJ0 A;  1BCC E;  1VQO P;  1JMB A;  4Y28 J;  2WPV B;  3H1I E;  3B5N B;  3WU2 E;  1ZOY C;  4IL6 H;  3TNU B;  2JEE A;  3CXH H;  4MN4 C;  2NZ2 A;  4XE5 B;  4AUW A;  3JCU H;  5AW9 B;  1IO4 A;  1KZU B;  3BCC D;  3HUS C;  1Q86 Q;  1SQP E;  3V2Q A;  1VQM P;  1XTG B;  2AXT E;  2N1T A;  2B88 A;  4EI2 A;  1BSN A;  4U7J A;  3Q1M A;  1N7S D;  5B66 H;  3CCV P;  2IYO A;  1HWT C;  1HF9 A;  1OW7 A;  4HYT B;  2ZXE B;  5AW7 B;  1EDI A;  1KIL B;  1BCC J;  2M8R A;  1N7S B;  2WQY C;  1RE4 C;  4N78 E;  4I7Z B;  1H88 A;  1EXJ A;  3LID A;  3K5B A;  1YI2 P;  5BU8 B;  1LJ2 A;  3MHV A;  5APV A;  3MTU E;  1LT9 B;  1BCC G;  1QLE D;  1OW6 A;  2IZ1 A;  2IDB A;  3FXD A;  5AW0 B;  3H1I G;  1W2B O;  4Y99 C;  2BCC D;  3CX5 D;  4H0L C;  1J2J B;  5B5E E;  1SFC A;  1AVO A;  1ZR2 A;  1SQP J;  1X79 B;  3A7O A;  2W27 A;  1KQL A;  4JF7 A;  1ZV8 A;  1BGY E;  3AE1 C;  2ZYD A;  1MKM A;  3TNU A;  5AW6 B;  2KYV A;  1SQP G;  3WU2 H;  2K88 A;  1JY2 O;  1SQQ K;  4K3A A;  1URQ C;  1CSB A;  3RL0 g;  2Y9Z A;  2K3R A;  3SFD C;  2SPZ A;  3AE5 C;  4YXW H;  1IJD B;  3AEC C;  3USS A;  2AEJ A;  2D2C D;  1U7M A;  3II6 A;  1SQV D;  1GMJ A;  2QJP C;  1X22 A;  1X8Y A;  4OGQ D;  2B9B A;  3D6Z A;  3V6I A;  3D6Y A;  4EDF A;  1J1E C;  4PD4 D;  1P84 I;  2M5A A;  2D2C B;  1S4X A;  1IZN B;  1N73 C;  2W90 A;  1QVF O;  2WSE J;  4WVZ A;  2Q5U A;  3GW6 A;  3CCJ P;  1N7S A;  2A45 I;  2KUB A;  4WY4 C;  4OGQ B;  1GL2 D;  1L0N G;  3BRV B;  1PP9 D;  3ABV C;  5AVY B;  3TSI A;  1KN7 A;  3VYI A;  3N4X A;  5K5G B;  1GZL A;  3NTN A;  2UWJ E;  1ZN5 A;  3RK3 E;  1BGY G;  4LLH A;  2YIU B;  2KP8 A;  3Q3D A;  3M91 A;  1MV8 A;  3SFE C;  3L75 D;  1PV3 A;  2A06 D;  1IK9 A;  4N6J A;  1SQQ E;  3H1L J;  3IF4 A;  2BEQ D;  2WSE H;  5B5E H;  1DH3 A;  3WUV A;  3B5N C;  4PV1 D;  1L0L D;  1UIX A;  1KYO D;  5AVQ B;  3O6Q A;  2OYH B;  2YXQ B;  3EFF K;  2JR8 A;  2KSE A;  4PV1 B;  2G8Y A;  2P7J A;  3BCC J;  4PJ0 E;  3MUD C;  2HR3 A;  3WUU A;  2YNY A;  3L70 D;  1S9K E;  3WUT A;  4W80 A;  3JSV C;  2PAJ A;  1A02 F;  4RJT A;  2J58 A;  2Y0E A;  5KAI E;  4JYC A;  5KAF H;  2I8D A;  1ZR4 A;  3HRN A;  3G4S P;  1XTC C;  3CXH I;  1YJW P;  3H1H E;  2GA1 A;  4H13 D;  1SQQ J;  2GUV A;  1KIL C;  1LT1 A;  1LTA C;  1N7S C;  2RKL A;  3G3Z A;  1FOS E;  4DZO A;  1NHL A;  1S5L X;  4I7Z C;  2KI7 B;  3CME P;  1RY3 A;  5CCG C;  3L74 D;  4U3F D;  3N7N A;  1USE A;  3L37 A;  1FZB A;  4H13 B;  1LT9 C;  1GL2 A;  1PGP A;  1E5W A;  2K9Y A;  3QWO C;  5EFW B;  1AA0 A;  3CWB E;  3AEE C;  5KLI B;  4AYC A;  2H8P D;  3U1C A;  3IAO A;  5AW1 B;  1PPJ E;  4IL6 X;  5DJU B;  1D7M A;  4M3L A;  1N8R Q;  1FBM A;  2R32 A;  4D6T E;  2Y0C A;  3C8V A;  1NVO A;  2KOG A;  1L4A B;  2KLU A;  3GLM A;  5AW8 B;  5APY A;  2O1J A;  1TU3 F;  2HYN A;  3KDP B;  1AFO A;  1BE3 D;  4CPG A;  2Q1K A;  1OVR A;  4H0L D;  3H1H G;  4PJ0 H;  3EWK A;  3Q5R A;  1KMI Z;  1IFJ A;  1NU1 K;  2JWA A;  1NTK E;  2D2C C;  1M1K Q;  1LNQ A;  5KAI H;  3TGU E; 
#chains in the Genus database with same CATH homology
 1T2K D;  4I2L C;  2MJZ A;  4IFF A;  4EIJ A;  3B5N B;  3VP9 A;  3VP8 A;  5AW2 B;  4W7Y A;  1T8Z A;  3TK1 A;  2WTY A;  1J1D B;  1JOC A;  1JY3 P;  3TNU B;  3MD0 A;  2JEE A;  4ZKU A;  3HTK B;  1NOH A;  1URQ D;  2WPS A;  1AQ5 A;  1RF1 A;  3V2P A;  1LTB C;  3VMY A;  4XE5 B;  4AUW A;  4HH2 A;  5APS A;  5AW9 B;  5BVZ A;  1IO4 A;  1GU5 A;  1KZU B;  1L0L K;  3M0A A;  5KJ7 A;  3B8E B;  1GW3 A;  2WZ7 A;  5CCH D;  3HUS C;  2FXM A;  2N1T C;  5APT A;  5AVV B;  1GK4 A;  2HOD A;  2IFM A;  4GIF A;  5CMZ A;  1GW4 A;  1URQ B;  3V2Q A;  5AVT B;  1JY3 O;  1XTG B;  2WWW A;  2ZFC A;  3HUS A;  1NTZ K;  4EOT A;  1SQB K;  2N1T A;  4N3Y B;  3NXS A;  3RK3 C;  3O8Z A;  2Z4E A;  1N7S D;  2WPR A;  1IFI A;  2Z5H A;  4OH8 B;  2FFD B;  3M9Q A;  1FAV A;  1HWT C;  3VMZ A;  4HYT B;  2ZXE B;  5AW7 B;  1NTM K;  5AVU B;  4O9B A;  2OYI B;  3V4Q A;  2KB7 P;  1KIL B;  1LTG C;  1J1E B;  1L4A D;  2M8R A;  3BRT B;  1N7S B;  2C9L Y;  1N73 B;  1RE4 C;  2GUS A;  2OYH C;  4N78 E;  4XA4 A;  2YKQ A;  1H88 A;  1HJB A;  3L36 A;  1GL2 B;  3LID A;  2NPS C;  3NMD A;  4AQR D;  2JJL A;  5BU8 B;  2OYH A;  1FZA A;  5APV A;  3MTU E;  1LT9 B;  3LIE A;  1HTL C;  2NPS A;  1M1J B;  3OJA B;  5AW0 B;  2YKP A;  4DOJ A;  1FU1 A;  1SFC C;  1JTH A;  2XZR A;  4Y99 C;  5AW3 B;  2IX7 C;  1HGV A;  2YKO A;  1J2J B;  3HD7 D;  3VN0 A;  3UIA A;  1G1J A;  2POH A;  1SFC A;  2M3B A;  2N9B A;  1ZR2 A;  3M06 A;  1FZC B;  1JY2 P;  2FYU K;  3CI9 A;  2IFN A;  1JCD A;  1X79 B;  1DEB A;  3A7O A;  5CJ4 A;  3GHG A;  3V5B A;  1J1D C;  3B5N D;  2W27 A;  3I5C A;  1KQL A;  4JF7 A;  1ZV8 A;  1HBW A;  2W6A A;  2WSC H;  3OAK A;  3HD7 B;  5AVW B;  1H89 A;  1SQX K;  3TNU A;  2WT7 B;  1LWU C;  1CI6 B;  3HTK A;  5AW6 B;  2KYV A;  1LGH B;  1PFI A;  2J59 M;  1JY2 O;  1NO4 A;  1LWU A;  1SQQ K;  2HPC B;  1N86 A;  3MGN A;  1RF1 C;  4C7R A;  1URQ C;  1CSB A;  4I6M C;  5KLV K;  2WPQ A;  2C0X A;  1RE3 C;  1KFM A;  5KJ7 C;  1IJD B;  1FDM A;  1URQ A;  2LKM A;  3NFQ A;  4ZKP A;  3H6P A;  2VRS A;  1IFN A;  1VDF A;  1RE3 A;  3OA7 A;  2Q7C A;  1WRG A;  1LTJ B;  2I1J A;  3II6 A;  3TYY A;  5CCH A;  5AVS B;  3P8C E;  1X9V A;  2FFD A;  1N2D C;  2KSJ A;  1X8Y A;  1OXZ A;  3L4F A;  1J1E C;  1SVF A;  2IPP A;  2XU6 A;  3CLQ A;  3RK2 C;  1KFN A;  2H7H A;  4B86 A;  1N73 C;  1KIL D;  2OYI A;  2Q5U A;  1HUC A;  5KTB A;  1N7S A;  3T97 A;  3CL3 D;  2A45 I;  1N73 A;  4WY4 C;  5BU5 A;  2Q3I A;  1GL2 D;  1NTK K;  1L4A C;  5CCG D;  1JCC A;  3H32 B;  2QM8 A;  1MFZ A;  3BRV B;  5AVZ B;  4WY4 A;  4N78 D;  1RF0 A;  1SLQ A;  1T3J A;  3IR9 A;  1L4A A;  5AVY B;  3TSI A;  2GM4 A;  3VYI A;  2CPB A;  3N4X A;  1GZL A;  3NTN A;  3HUS B;  2R3C A;  2C0W A;  4W7Z A;  2Q9I A;  1FZC C;  1ZN5 A;  3LW5 H;  4IFD K;  4LLH A;  2YO2 A;  1LTT C;  2KP8 A;  4KHX A;  2XV5 A;  3M91 A;  1GK6 A;  1MV8 A;  4C46 A;  1G2C A;  1CW5 A;  2QM7 A;  3HE5 B;  5APU A;  1FZC A;  1IK9 A;  3RL0 C;  2WIT A;  4GT1 A;  4N6J A;  2P1J A;  3HD7 C;  3RK3 B;  2HLO A;  1IFM A;  3A2A A;  1HVV A;  2WSE H;  1DH3 A;  4LGD E;  3HD7 A;  3GHG C;  4C7N B;  1GU4 A;  2W6B A;  3B5N C;  3P8M C;  4WB4 A;  2P67 A;  2WT7 A;  2XDJ A;  1A02 J;  5AVR B;  1SP4 A;  3VTP C;  5AVQ B;  3VOP A;  3B5N A;  1H8A A;  2R5B A;  2XNX A;  2HPC A;  2OYH B;  1HH0 A;  1QL1 A;  4I1L A;  1T2K C;  2H43 A;  1JMM A;  1JNM A;  2HFE D;  3V2N A;  1DX7 A;  2P7J A;  3KQG A;  1MZ9 A;  3IFM A;  4RES B;  2L5G B;  3M9B A;  2I1K A;  3L35 A;  2YNY A;  3HE4 B;  1JUN A;  1S9K E;  1SFC B;  4W80 A;  2PAJ A;  2Z5I A;  1A02 F;  4Y99 B;  3MUD A;  1LTJ A;  1QL2 A;  2J58 A;  1M7L A;  2XKM A;  4GKG A;  1YTZ I;  3M0D A;  2HG5 D;  1FOS F;  3U59 A;  2FKW B;  4JYC A;  5CCH C;  2FFD C;  3M9H A;  1ZR4 A;  3P8C D;  3P32 A;  1JY3 N;  3HRN A;  1XTC C;  2A45 G;  3C9I A;  1L0N K;  1CZQ A;  1MUU A;  1VPC A;  4WBA A;  2OYI C;  2GUV A;  1KIL C;  5APQ A;  1NKN A;  1LTA C;  3KPE A;  1N7S C;  5CHX A;  3G3Z A;  3H32 A;  1FOS E;  1LWU B;  3A3Y B;  1FZF A;  1Z56 A;  4DZO A;  3A5T A;  1NHL A;  5KJ7 D;  1KIL A;  1RY3 A;  3MIW A;  1EQ7 A;  1IFD A;  1GL2 C;  5CCG C;  3V4W A;  1G1I A;  1FZG A;  3N7N A;  3L37 A;  3SWY A;  1FZB A;  1WT6 A;  2KLV A;  1RF0 C;  1LT9 C;  1RF1 B;  1GL2 A;  1FZE A;  5CCG A;  2O1K A;  1M1J C;  2A45 H;  2N1T D;  5AW4 B;  1E5W A;  5AVX B;  1YYC A;  1LT9 A;  3RK2 D;  2BAS A;  2E42 A;  1OWA A;  2O01 H;  2YO3 A;  1M1J A;  3U1A A;  3HE5 A;  1N7L A;  2HOD B;  3RK3 D;  3EQ2 A;  5APW A;  4IFM A;  3KYQ A;  1HGZ A;  1IC2 A;  2N1T B;  1W2E A;  4WY4 D;  4AYC A;  2R5D A;  2H8P D;  4C7N A;  1FJP A;  2OAR A;  3U1C A;  3RK2 B;  4LC1 A;  1GTW A;  1T3U A;  5AW1 B;  2CPS A;  2PP6 A;  3R2P A;  2P2U A;  3E1I A;  4M3L A;  1FBM A;  2R32 A;  1NAF A;  1SQP K;  1YTZ T;  2C9N Y;  1RE4 A;  4WY4 B;  1SQV K;  3BAT A;  2KOG A;  3BAS A;  2NPS D;  1L4A B;  4JYB A;  5APX A;  1CI6 A;  5AW8 B;  3BVH A;  1LTI C;  5APY A;  1LTS C;  2O1J A;  1NWQ A;  2FYZ A;  1ZLL A;  2HYN A;  3RL0 D;  3EFG A;  1JO5 A;  1SFC D;  3KDP B;  1AFO A;  3HE4 A;  2E43 A;  1JY2 N;  1NKZ B;  3VMX A;  3PP5 A;  5AW5 B;  3WMM 0;  2NPS B;  1G2C B;  2YMY A;  3V2R A;  1JTH B;  1S9K D;  1GD2 E;  1LTJ C;  1FJK A;  3SWF A;  3RL0 B;  2WSF H;  3M0D C;  5CJ0 A;  1IFJ A;  1NU1 K;  1GDT A;  3P7K A;  1NH4 A;  3GHG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...