3H1LJ

Chicken cytochrome bc1 complex with ascochlorin bound at qo and qi sites
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Ascochlorin is a novel, specific inhibitor of the mitochondrial cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 19
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3h1lJ00
1SQXJ 3L73J 1EZVI 4PD4I 1NTKJ 1NTZJ 3CX5I 1P84I 1SQQJ 3H1IJ 1NU1J 1L0NJ 2IBZI 3H1KJ 2FYUJ 1NTMJ 1PP9J 3CXHI 3H1JJ 3BCCJ 3H1LJ 4D6TJ 3CWBJ 1BGYJ 1BCCJ 4U3FJ 1KB9I 3L70J 1SQBJ 3L75J 1KYOI 3L72J 3TGUJ 1SQVJ 1L0LJ 3L71J 3H1HJ 5KLVJ 3L74J 2BCCJ 1BE3J 1SQPJ
chains in the Genus database with same CATH superfamily
3BRTB 1LGHB 4D6TD 5KLVG 4KT0J 2YO2A 2WSEJ 2HODA 1NU1K 3TGUD 3H1IE 1RE4C 5GTHH 3H1KG 3WMM0 4YPCA 5B66H 3L75J 2QVAA 2P7JA 1P84E 5KJ7D 4Y99C 5AW6B 3U1AA 1LWUB 1BSHA 3SFDC 3GW6A 1KYOH 3GF7A 1SQQE 1X22A 3Q2YA 3P32A 1LNQA 1S1CX 3VP8A 1KYOD 5APSA 2KUBA 3S1KA 1LWUC 1K05A 1JOCA 1SQPE 1FZFA 1JM0A 2E74B 2Q7CA 4D6TJ 5APWA 1LTTC 3H1JE 2QJPB 4DOJA 3TGUJ 1BCCG 2IBZE 1MFTA 3E7KA 1DH3A 3CX5I 2E74C 3SSUA 1NOHA 3RBZA 2QJPC 1SQXD 4EDFA 2V4HA 2O01J 2P10A 4H44D 1DX7A 2OQQA 1ZMEC 5DJTB 5AVQB 1GL2A 2IDBA 1PP9G 2WQYC 4HYTB 1L0LK 3CPWO 1ZR2A 2FYUD 5AVWB 2Z4EA 2P1JA 3RK2D 4L75A 1KMIZ 1VQNP 2DW3A 2V7QH 1OXZA 4GT1A 3FWLA 1P84H 3RK3D 2WPVB 3H1ID 1KQSO 1N7SD 2YKOA 3CXHE 3AE6C 1SQXJ 3VMXA 5DJUB 2OARA 5AVZB 4I6MC 2A45H 1Z56A 1NTKE 3SFEC 1SQBD 2ZYDA 1VQ8P 1KZUB 1LTAC 5AVSB 5BU8B 1RY3A 1EZVI 2R44A 2IFMA 4R4MA 3L70D 2FFDA 2FYUJ 1IK7A 5GTIE 1KD1Q 1GTWA 3L35A 1T3JA 3L72G 1YIJP 2B9BA 3H1JD 1G1IA 3L74G 3H1IJ 1RF0A 3KYQA 3B8EB 1YJNP 2IBZD 1YYCA 2FFDB 1SQBJ 3BCCG 3A0HH 1T2KC 4C46A 3I56P 1NTZD 3CCQP 3Q5SA 3RGUA 4B86A 2YXQB 2W8ZA 1L4AA 2Q9IA 3M06A 1PZQA 2OYIA 1NTMG 3FGAD 1XTCC 3L70J 1J1DB 1KYOI 1G1JA 1RQVA 2XNDH 5L8RJ 2WWWA 3O8ZA 1SQPJ 1ZN5A 2JP3A 1EC5A 1J2JB 3N7NA 3WU2E 3M0DA 1SLQA 3M9HA 1RF0C 1E5WA 1M56D 1QL1A 3H1JJ 4RO0A 3MGNA 1L4AB 3OJAB 1M1JA 1YQ4C 1J1DC 4WWIA 1R5LA 2OYIB 1BGYG 4C7NA 2Q6QA 4CPGA 3W68A 4WVZA 3CXHH 1FJKA 2W83C 1NTZJ 1CZQA 2WSCH 2JWAA 2LXBA 3TSIA 1YJWP 2PP6A 1M1JB 2NZ2A 1PV3A 1K04A 3HD7D 1AJYA 4C7NB 5KLIB 2R5BA 2W6AA 1RE3C 2W90A 2JO1A 1CSBA 1LJ2A 2ZYAA 1AVYA 2JEEA 1OW7A 3M0DC 5GTIH 5AVTB 2OYHB 1M1JC 2H88C 5KLIC 4N3YB 2J5UA 4GKGA 1AQTA 5APUA 3L73E 3CCRP 1QL2A 2FYUK 2OYHC 4I7ZC 1JMMA 3CWBG 3H1HE 1BDDA 2KZJA 2I1JA 4I2LC 1AV1A 1BE3G 2P67A 2YIUB 1P84I 2WSCJ 2Z5IA 4ASVA 1LT9A 2NPSA 3R2PA 2OTJP 2RKLA 3HUSA 1AA0A 1ZW0A 2E75D 4UB8E 5AVVB 2A06G 3VTPC 2QG4A 2IYPA 1FZCA 3WU2H 1JCDA 2WVRA 2E76D 4MN4C 1SQQK 1JTHA 1GW4A 1PGOA 2P58A 2BEQD 2NPSB 1HUCA 3HUSB 1X9VA 1SQPK 4WBAA 1TU3F 4ZKUA 1GL2D 1FOSF 1NH4A 4OGQB 3BATA 1LT1A 3CX5D 1W2BO 2IBZI 3T97A 1FZCB 2YMKA 5AVYB 3A0BE 2NPSC 1JTHB 3H1LE 1NWQA 2WPRA 3HUSC 1VPCA 2Q3EA 4IL6X 3AEBC 1QVFO 2K37A 1S9KD 1A02J 2PFXA 5KAIH 4OGQC 3W67A 5KLVE 3V5BA 1QLED 1FZCC 1L0LD 3H1KE 5CBOA 3T97B 1L2PA 2H89C 5KKZB 3JSVC 2YNYA 3FWNA 4PV1D 1GU4A 2KSEA 2L5GB 3A3YB 1LTJA 1URQA 2JKVA 1GU5A 4C7RA 3RK3C 1FZAA 1N7SC 2QM8A 3L71D 1KV4A 5KKZC 1JO5A 2AEMA 2JWDA 3MUDA 2LKMA 3D70A 3CCEP 1A02F 4WY4D 2LXCB 1RE4A 1T3UA 5CCHA 3CXHI 1URQB 2QM7A 3WUTA 4UB8H 2FYZA 1BCCE 2WT7B 2AXTH 4AQRD 1L0LJ 1YTZT 4OVNF 1KFNA 3CC4P 1PGJA 1NTKK 3TNUA 1EZVD 3O6QA 1X79B 1URQC 2N1TA 1T6AA 1HGVA 1Q2NA 2H43A 4HKZH 4D6TG 1H8AA 4XA4A 3L71J 4IFFA 4LLHA 1YI2P 3OW2O 2QJYB 3MUDC 1SQVG 3OA7A 1FZBA 3L73J 1EQ7A 2IZ0A 4HJGH 3KPEA 1ZXGA 2K3RA 3C8VA 3TNUB 4EIJA 3A0BH 3O6QB 5CCHC 1PP9E 1KILA 1ZOYC 2N1TB 1S4XA 1N73A 3CCLP 1JY3P 2QJYC 3JC22 1PPJD 3CMAP 1MV8A 3MHVA 2Z5HA 4RESB 3VMAA 3PTZA 1JY2P 3B5ND 5KLVD 2N1TC 1VDFA 1KILB 1N73B 3IFMA 1KORA 3A7OA 1N8RQ 1NKZB 3A2AA 2G8YA 2POHA 4H13D 1DEBA 1KILC 1FU1A 2Q5UA 1VF5B 4N78D 4NPEA 1N73C 3CMEP 1KN7A 1EDJA 1SQXG 1X8YA 1L0NE 5KAFE 3AE8C 3IR9A 1VL2A 3BVHA 5AVRB 2XU6A 1R5SA 3L72E 4W80A 2IZ1A 1VF5C 5KLVJ 1Y47A 3Q5RA 3AEAC 3L74E 1QGKB 2J59M 1JB0J 2JDIH 3TF5A 5AW2B 1X0TA 1IFMA 3BCCE 1NVOA 4H0LB 3RBXA 2KI7B 1ZR4A 1H88A 4AYCA 1LTSC 2O1KA 3CL3D 5APXA 1EDIA 3D6YA 1NTME 4WB4A 3BRVB 4H0LC 2Q1KA 4PD4E 3PJSK 5AW3B 1SQBG 1N2DC 3Q5PA 1FDIA 2L91A 1PP9D 1SFCD 2E75C 1N7LA 3HTKA 3PH0A 2A45G 1P84D 3RL0D 1AVOA 3HE5A 1BGYE 2ZT9B 3G71P 1HF9A 4JYBA 1FAVA 4K35A 2QA4P 2XZRA 5E79E 1SQQD 4JQ0D 1H0TA 2PRRA 2Y0CA 1CW5A 3M9BA 3S4RA 1M8OB 3HTKB 1L0NG 2D2CB 2ZT9C 1YTZI 1GK6A 1SQPD 3HE5B 2RN0A 5CCGD 1CI6A 1KB9E 1OVRA 2W27A 5AW5B 1IC2A 1H0TB 2V7QJ 1PP9J 1NTZG 5KAFH 2D2CC 4PV1B 1IO4A 1GZLA 1IFIA 1KFMA 2KOGA 2YKQA 4OWFA 1USEA 1ZRTE 2E5YA 3PP5A 4DCKA 1SQQJ 2SPZA 1CI6B 1VQ5P 4PV1C 2KB7P 2AEJA 3CWBE 3TYYA 2AXCA 1FE6A 1SQVK 4Y28J 1DD3A 2XDJA 1MUUA 5KLVK 1RE3A 2N9YB 4Z1MH 1BE3E 1USDA 3GLMA 2I1KA 1PGPA 2MJZA 5AW7B 5B5EE 4PD4H 1PGQA 2A06E 3C9IA 1S3JA 4W7ZA 3MZWB 1DIPA 1NGMB 5KJ7A 4PD4D 4A7PA 2QE7H 5AW8B 2OYHA 3CXHD 3JCUE 2GA1A 2G3AA 2LR2A 1NTKD 5E79H 2WZ7A 3L74J 1RF1A 1NAYA 2E43A 2BCCG 2HLOA 4TLFA 3AEFC 3V2RA 1E79H 1JY3O 1NU1G 4QMAA 3N4XA 5APQA 2E74D 4BRYB 1JNMA 5AVUB 4I7ZB 2HYNA 3B4SA 1JY2O 1NYHA 2QRXA 4O9BA 1RF1B 5KJ7C 5AW0B 2B88A 2C9NY 3AE1C 5APVA 2ZVOB 3AEGC 2WITA 2R3CA 2FY8A 2QIWA 3B5NC 1M90Q 2M3EA 3WUUA 1RF1C 1NTKJ 2GUSA 3NMDA 3ABVC 1LTGC 1IJDB 1HWTC 3UIAA 2O01N 5EFWB 2XNXA 1EDKA 3L75E 1MFZA 2KK7A 4RKUJ 3V2NA 2KXPB 1FC2C 1FZGA 3GF3A 3CC7P 4ZNCA 1BE3D 5B5EH 1S5LE 1M1KQ 4H44B 1BDCA 1K8AQ 1YQ3C 3AE4C 5AW9B 1N7SA 1PL5A 1W2EA 2IX7C 3JCUH 3MIWA 2JJLA 5AW1B 4D6TE 2ZYGA 3GHGC 1HJ0A 4H44C 3RK2B 1SVFA 3TGUE 4U3FG 1HTLC 3AE2C 1SQVE 1LTIC 3OAKA 1L0LG 2VRSA 5TISE 1L0NK 3KXDA 1Q7YQ 4L73A 3RK3B 1YHQP 1N7SB 1Q86Q 4EI2A 2ZVNB 2YO3A 3RK2C 2RH0A 3Q1MA 4DT0A 2FKWB 1FDOA 2C0XA 1BE3J 3L71G 3E1IA 5KTBA 3NXSA 2KS1A 2WT7A 2K9JA 2HFED 3L73D 2WMMA 3RL0C 3L75G 1GD2E 3KDPB 4PD4I 1NJIQ 1OMIA 4W7YA 1NTMK 1PIXA 1KQFB 2GUVA 3H1HD 3NFQA 4KJMA 2E42A 2KS1B 1EZVG 5M1BA 4KHXA 3IF4A 5APYA 2K9JB 1JY3N 4XFJA 2FXOA 2OYOA 1LP1A 1SQXE 1XTGB 3A5TA 1RQUA 2J58A 2BASA 1JY2N 1QX8A 1HGZA 1S5LH 1ZP0C 2ITAA 1L4AD 4GIFA 3TGUG 3SWFA 1FZEA 1UIXA 2KLUA 3M91A 4DZOA 1K73Q 3G9RA 1MZ9A 1LP1B 1D7MA 2ZFCA 2K88A 2KNCA 2O1JA 1KB9I 2IPPA 4RJTA 2OTKE 1ZV8A 3H1HJ 2IFNA 2IYOA 3P8CE 4I1LA 1K9MQ 3HE4A 2FYNC 3H1LD 5TISH 3V2PA 1QVGO 2Y0DA 3RK3E 3II6A 5APTA 3HD7A 1OX3A 1SQVD 2O3JA 3MP7B 3V4QA 4ZKPA 3VYIA 3CLQA 1SQBE 2KNCB 2O01H 1U7JA 1JUNA 3H1KD 2ZXXA 3CCUP 1NO4A 3K5BA 1KC8Q 3V2QA 2QJKB 3HE4B 1OW6A 3LIEA 2HODB 3TK1A 3HD7B 1OW8A 3L70E 2HG5D 2Y0EA 3AECC 3IAOA 2R3SA 2OGUA 3PRJA 3USSA 2JR8A 1Q90D 4K3AA 4L74A 2PAJA 2QJKC 2KLVA 2W6JH 1Q81Q 3CCVP 3H1LJ 3V6IA 1OWAA 3HD7C 4YXDC 1FBMA 2CPBA 1Y9BA 3AE7C 3L4FA 1SQVJ 3H25A 2YMYA 2C0WA 3P8MC 3H32A 1JCCA 4GDOA 5CHXA 1BCCD 2E5TA 1NTZE 3H1KJ 4YXWH 4LGDE 2FYUG 1H89A 4DJGA 3A0HE 1N86A 2I8DA 2NPSD 1ZLLA 3H32B 2WSSH 2E75B 1RHZB 3G6EP 3CCMP 3EWKA 3AE5C 3H1IG 3L36A 4OGQD 4IOIH 1GDTA 2E76B 3QWOC 1IK9A 1WMKA 1M7LA 4JPZB 1IZNB 2KZIA 3CCJP 2KIKA 1EXJA 1SQQG 3P8CD 3FXEA 1BCCJ 5CJ4A 2E76C 1GL2B 1KILE 2M3BA 1NHLA 3L70G 4U7JA 1FOSE 4PJ0E 2QSIA 3L37A 2R32A 2OTLP 5AW4B 1SQPG 1FJPA 3LW5H 1GK4A 1IFPA 3M9QA 1GL2C 3H1JG 3HRNA 1IFNA 1W5CE 1G2CA 2IBZG 1KTMA 2BCCE 3FXDA 2WTYA 1NU1E 2UWJE 4WY4A 1OFCX 2H8PD 4TT3H 1URQD 3KQGA 1L0ND 2CK3H 4HB1A 4LC1A 1G2CB 4N6JA 3CCSP 2W6BA 3MTUE 2Q3IA 1AFOA 3L72D 4EOTA 2ZAEB 2P2UA 1T8ZA 4GOEA 1FDMA 1HH0A 3L74D 3KZIE 2QEXP 4ZMDA 3G3ZA 4WY4B 4NPFX 1DEEG 2WPQA 3AEEC 4OH8B 4EYYQ 4AUWA 5CCHD 3BCCD 3LW5J 4IFMA 3NTNA 1HBWA 1JMBA 2N9BA 5AVXB 1LTBC 2FFDC 3M0AA 3PHLA 3ITKA 1OZHA 4WY4C 5K5GB 2FXMA 3I5CA 3EFFK 1NTMD 3IN6A 4UB6E 2N1TD 1Q82Q 2NRGA 1AQ5A 2B87A 1L0NJ 1NTKG 3V4WA 1DD4A 4BRYA 2KYVA 4YTPC 3L72J 2AEFA 3CX5E 1OVVA 3D71A 2M8RA 3S9OA 3B5NA 4PJ0H 1U57A 3VMYA 3CD6P 2H7HA 1BGYD 1QEXA 1KILD 1S9KE 1YJ9P 1L4AC 1HJBA 1NKNA 3BCCJ 1S72P 2B87B 3B71A 2OYIC 3FX0A 1YITP 5CMZA 3SWYA 4ASWA 4U3FE 1BSNA 2KP8A 1L0LE 4XE5B 5KAIE 3MD0A 1SQXK 3B5NB 1KB9H 5H2FE 3GG2A 2YKPA 1VF5D 1NTMJ 3AE3C 4IL6E 1MKMA 5CBNA 2BCCD 4M3LA 1KB9D 1IFDA 2YXRB 1NU1D 3L71E 3RL0g 1PFIA 3GMAA 3AEDC 4H13B 3BASA 3VN0A 1BGYJ 2ZXEB 3TDKA 3GHGA 1ZRTD 3KZIH 3CI9A 2CPSA 2K9YA 1KQGB 1VQPP 1VQ6P 4H0LD 4JYCA 3CWBD 4H13C 1S2EA 1GW3A 2A45I 1U7MA 3SWKA 1SQBK 1EZVE 3G4SP 3AE9C 2AXTE 1VQMP 3GHGB 1SP4A 4GODA 1UIIA 2BCCJ 2GM4A 1OIPA 2HPCA 4UB6H 2YIUC 1SS1A 3I55P 2RMZA 1NU1J 1WRGA 2A06D 1NAFA 1EXIA 1SFCA 3VOPA 2PGDA 4GOFA 1J1EB 1LT9B 2Y9YA 2MKVA 3R4YA 1R8EA 3CX5H 1RH5B 1VQ4P 2M5AA 1JEKA 2R5DA 2ZT9D 3QH9A 2C9LY 3ZDMA 1YBKA 4R4LA 2HPCB 1HVVA 2XV5A 1EDLA 4IFDK 3CC2P 1KQLA 1J1EC 1LT9C 1PPJE 3CWBJ 5GTHE 3VMZA 2HR3A 5B66E 1SFCB 2Y9ZA 2D2CD 5BU5A 2FXPA 4JBZA 3RL0B 5TJHA 2M5AB 1WT6A 2WSFH 1T2KD 1NTZK 5H2FH 2B89A 1KYOE 4U3FD 2KSJA 3F89A 3L73G 4JF7A 1VQ9P 4IL6H 5CCGA 2FBWC 1SFCC 3VP9A 3F5HA 5BVZA 3LIDA 1M57D 3KHUA 3H1HG 4HH2A 1VQ7P 3EFGA 3H6PA 4N78E 2WSEH 2BEZF 1VQLP 3Q3DA 3C1LA 1VQOP 2ZJSE 3P7KA 1S5LX 1FS0E 5C39A 4NPDA 4BWNA 5CJ0A 3L75D 1LTJB 4BXLA 3E1RA 4U3FJ 2M0BA 1GMJA 5CCGC 3WUVA 2WSFJ 4L76A 2FYNB 1LTJC 3EQ2A 2WPSA 2FYUE 3U1CA 1PPJG 1Y8AA 3H1LG 2XKMA 3PLNA 1OVUA 1VQKP 3D6ZA 2K1AA 1LWUA 3U59A 4Y99B 1IFJA
chains in the Genus database with same CATH topology
1SQXJ 3L73J 1EZVI 4PD4I 1NTKJ 1NTZJ 3CX5I 1P84I 1SQQJ 3H1IJ 1NU1J 1L0NJ 2IBZI 3H1KJ 2FYUJ 1NTMJ 1PP9J 3CXHI 3H1JJ 3BCCJ 3H1LJ 4D6TJ 3CWBJ 1BGYJ 1BCCJ 4U3FJ 1KB9I 3L70J 1SQBJ 3L75J 1KYOI 3L72J 3TGUJ 1SQVJ 1L0LJ 3L71J 3H1HJ 5KLVJ 3L74J 2BCCJ 1BE3J 1SQPJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQX J;  3L73 J;  1EZV I;  4PD4 I;  1NTK J;  1NTZ J;  3CX5 I;  1P84 I;  1SQQ J;  3H1I J;  1NU1 J;  1L0N J;  2IBZ I;  3H1K J;  2FYU J;  1NTM J;  1PP9 J;  3CXH I;  3H1J J;  3BCC J;  3H1L J;  4D6T J;  3CWB J;  1BGY J;  1BCC J;  4U3F J;  1KB9 I;  3L70 J;  1SQB J;  3L75 J;  1KYO I;  3L72 J;  3TGU J;  1SQV J;  1L0L J;  3L71 J;  3H1H J;  5KLV J;  3L74 J;  2BCC J;  1BE3 J;  1SQP J; 
#chains in the Genus database with same CATH topology
 3BRT B;  1LGH B;  4D6T D;  5KLV G;  4KT0 J;  2YO2 A;  2WSE J;  2HOD A;  1NU1 K;  3TGU D;  3H1I E;  1RE4 C;  5GTH H;  3H1K G;  3WMM 0;  4YPC A;  5B66 H;  3L75 J;  2QVA A;  2P7J A;  1P84 E;  5KJ7 D;  4Y99 C;  5AW6 B;  3U1A A;  1LWU B;  1BSH A;  3SFD C;  3GW6 A;  1KYO H;  3GF7 A;  1SQQ E;  1X22 A;  3Q2Y A;  3P32 A;  1LNQ A;  1S1C X;  3VP8 A;  1KYO D;  5APS A;  2KUB A;  3S1K A;  1LWU C;  1K05 A;  1JOC A;  1SQP E;  1FZF A;  1JM0 A;  2E74 B;  2Q7C A;  4D6T J;  5APW A;  1LTT C;  3H1J E;  2QJP B;  4DOJ A;  3TGU J;  1BCC G;  2IBZ E;  1MFT A;  3E7K A;  1DH3 A;  3CX5 I;  2E74 C;  3SSU A;  1NOH A;  3RBZ A;  2QJP C;  1SQX D;  4EDF A;  2V4H A;  2O01 J;  2P10 A;  4H44 D;  1DX7 A;  2OQQ A;  1ZME C;  5DJT B;  5AVQ B;  1GL2 A;  2IDB A;  1PP9 G;  2WQY C;  4HYT B;  1L0L K;  3CPW O;  1ZR2 A;  2FYU D;  5AVW B;  2Z4E A;  2P1J A;  3RK2 D;  4L75 A;  1KMI Z;  1VQN P;  2DW3 A;  2V7Q H;  1OXZ A;  4GT1 A;  3FWL A;  1P84 H;  3RK3 D;  2WPV B;  3H1I D;  1KQS O;  1N7S D;  2YKO A;  3CXH E;  3AE6 C;  1SQX J;  3VMX A;  5DJU B;  2OAR A;  5AVZ B;  4I6M C;  2A45 H;  1Z56 A;  1NTK E;  3SFE C;  1SQB D;  2ZYD A;  1VQ8 P;  1KZU B;  1LTA C;  5AVS B;  5BU8 B;  1RY3 A;  1EZV I;  2R44 A;  2IFM A;  4R4M A;  3L70 D;  2FFD A;  2FYU J;  1IK7 A;  5GTI E;  1KD1 Q;  1GTW A;  3L35 A;  1T3J A;  3L72 G;  1YIJ P;  2B9B A;  3H1J D;  1G1I A;  3L74 G;  3H1I J;  1RF0 A;  3KYQ A;  3B8E B;  1YJN P;  2IBZ D;  1YYC A;  2FFD B;  1SQB J;  3BCC G;  3A0H H;  1T2K C;  4C46 A;  3I56 P;  1NTZ D;  3CCQ P;  3Q5S A;  3RGU A;  4B86 A;  2YXQ B;  2W8Z A;  1L4A A;  2Q9I A;  3M06 A;  1PZQ A;  2OYI A;  1NTM G;  3FGA D;  1XTC C;  3L70 J;  1J1D B;  1KYO I;  1G1J A;  1RQV A;  2XND H;  5L8R J;  2WWW A;  3O8Z A;  1SQP J;  1ZN5 A;  2JP3 A;  1EC5 A;  1J2J B;  3N7N A;  3WU2 E;  3M0D A;  1SLQ A;  3M9H A;  1RF0 C;  1E5W A;  1M56 D;  1QL1 A;  3H1J J;  4RO0 A;  3MGN A;  1L4A B;  3OJA B;  1M1J A;  1YQ4 C;  1J1D C;  4WWI A;  1R5L A;  2OYI B;  1BGY G;  4C7N A;  2Q6Q A;  4CPG A;  3W68 A;  4WVZ A;  3CXH H;  1FJK A;  2W83 C;  1NTZ J;  1CZQ A;  2WSC H;  2JWA A;  2LXB A;  3TSI A;  1YJW P;  2PP6 A;  1M1J B;  2NZ2 A;  1PV3 A;  1K04 A;  3HD7 D;  1AJY A;  4C7N B;  5KLI B;  2R5B A;  2W6A A;  1RE3 C;  2W90 A;  2JO1 A;  1CSB A;  1LJ2 A;  2ZYA A;  1AVY A;  2JEE A;  1OW7 A;  3M0D C;  5GTI H;  5AVT B;  2OYH B;  1M1J C;  2H88 C;  5KLI C;  4N3Y B;  2J5U A;  4GKG A;  1AQT A;  5APU A;  3L73 E;  3CCR P;  1QL2 A;  2FYU K;  2OYH C;  4I7Z C;  1JMM A;  3CWB G;  3H1H E;  1BDD A;  2KZJ A;  2I1J A;  4I2L C;  1AV1 A;  1BE3 G;  2P67 A;  2YIU B;  1P84 I;  2WSC J;  2Z5I A;  4ASV A;  1LT9 A;  2NPS A;  3R2P A;  2OTJ P;  2RKL A;  3HUS A;  1AA0 A;  1ZW0 A;  2E75 D;  4UB8 E;  5AVV B;  2A06 G;  3VTP C;  2QG4 A;  2IYP A;  1FZC A;  3WU2 H;  1JCD A;  2WVR A;  2E76 D;  4MN4 C;  1SQQ K;  1JTH A;  1GW4 A;  1PGO A;  2P58 A;  2BEQ D;  2NPS B;  1HUC A;  3HUS B;  1X9V A;  1SQP K;  4WBA A;  1TU3 F;  4ZKU A;  1GL2 D;  1FOS F;  1NH4 A;  4OGQ B;  3BAT A;  1LT1 A;  3CX5 D;  1W2B O;  2IBZ I;  3T97 A;  1FZC B;  2YMK A;  5AVY B;  3A0B E;  2NPS C;  1JTH B;  3H1L E;  1NWQ A;  2WPR A;  3HUS C;  1VPC A;  2Q3E A;  4IL6 X;  3AEB C;  1QVF O;  2K37 A;  1S9K D;  1A02 J;  2PFX A;  5KAI H;  4OGQ C;  3W67 A;  5KLV E;  3V5B A;  1QLE D;  1FZC C;  1L0L D;  3H1K E;  5CBO A;  3T97 B;  1L2P A;  2H89 C;  5KKZ B;  3JSV C;  2YNY A;  3FWN A;  4PV1 D;  1GU4 A;  2KSE A;  2L5G B;  3A3Y B;  1LTJ A;  1URQ A;  2JKV A;  1GU5 A;  4C7R A;  3RK3 C;  1FZA A;  1N7S C;  2QM8 A;  3L71 D;  1KV4 A;  5KKZ C;  1JO5 A;  2AEM A;  2JWD A;  3MUD A;  2LKM A;  3D70 A;  3CCE P;  1A02 F;  4WY4 D;  2LXC B;  1RE4 A;  1T3U A;  5CCH A;  3CXH I;  1URQ B;  2QM7 A;  3WUT A;  4UB8 H;  2FYZ A;  1BCC E;  2WT7 B;  2AXT H;  4AQR D;  1L0L J;  1YTZ T;  4OVN F;  1KFN A;  3CC4 P;  1PGJ A;  1NTK K;  3TNU A;  1EZV D;  3O6Q A;  1X79 B;  1URQ C;  2N1T A;  1T6A A;  1HGV A;  1Q2N A;  2H43 A;  4HKZ H;  4D6T G;  1H8A A;  4XA4 A;  3L71 J;  4IFF A;  4LLH A;  1YI2 P;  3OW2 O;  2QJY B;  3MUD C;  1SQV G;  3OA7 A;  1FZB A;  3L73 J;  1EQ7 A;  2IZ0 A;  4HJG H;  3KPE A;  1ZXG A;  2K3R A;  3C8V A;  3TNU B;  4EIJ A;  3A0B H;  3O6Q B;  5CCH C;  1PP9 E;  1KIL A;  1ZOY C;  2N1T B;  1S4X A;  1N73 A;  3CCL P;  1JY3 P;  2QJY C;  3JC2 2;  1PPJ D;  3CMA P;  1MV8 A;  3MHV A;  2Z5H A;  4RES B;  3VMA A;  3PTZ A;  1JY2 P;  3B5N D;  5KLV D;  2N1T C;  1VDF A;  1KIL B;  1N73 B;  3IFM A;  1KOR A;  3A7O A;  1N8R Q;  1NKZ B;  3A2A A;  2G8Y A;  2POH A;  4H13 D;  1DEB A;  1KIL C;  1FU1 A;  2Q5U A;  1VF5 B;  4N78 D;  4NPE A;  1N73 C;  3CME P;  1KN7 A;  1EDJ A;  1SQX G;  1X8Y A;  1L0N E;  5KAF E;  3AE8 C;  3IR9 A;  1VL2 A;  3BVH A;  5AVR B;  2XU6 A;  1R5S A;  3L72 E;  4W80 A;  2IZ1 A;  1VF5 C;  5KLV J;  1Y47 A;  3Q5R A;  3AEA C;  3L74 E;  1QGK B;  2J59 M;  1JB0 J;  2JDI H;  3TF5 A;  5AW2 B;  1X0T A;  1IFM A;  3BCC E;  1NVO A;  4H0L B;  3RBX A;  2KI7 B;  1ZR4 A;  1H88 A;  4AYC A;  1LTS C;  2O1K A;  3CL3 D;  5APX A;  1EDI A;  3D6Y A;  1NTM E;  4WB4 A;  3BRV B;  4H0L C;  2Q1K A;  4PD4 E;  3PJS K;  5AW3 B;  1SQB G;  1N2D C;  3Q5P A;  1FDI A;  2L91 A;  1PP9 D;  1SFC D;  2E75 C;  1N7L A;  3HTK A;  3PH0 A;  2A45 G;  1P84 D;  3RL0 D;  1AVO A;  3HE5 A;  1BGY E;  2ZT9 B;  3G71 P;  1HF9 A;  4JYB A;  1FAV A;  4K35 A;  2QA4 P;  2XZR A;  5E79 E;  1SQQ D;  4JQ0 D;  1H0T A;  2PRR A;  2Y0C A;  1CW5 A;  3M9B A;  3S4R A;  1M8O B;  3HTK B;  1L0N G;  2D2C B;  2ZT9 C;  1YTZ I;  1GK6 A;  1SQP D;  3HE5 B;  2RN0 A;  5CCG D;  1CI6 A;  1KB9 E;  1OVR A;  2W27 A;  5AW5 B;  1IC2 A;  1H0T B;  2V7Q J;  1PP9 J;  1NTZ G;  5KAF H;  2D2C C;  4PV1 B;  1IO4 A;  1GZL A;  1IFI A;  1KFM A;  2KOG A;  2YKQ A;  4OWF A;  1USE A;  1ZRT E;  2E5Y A;  3PP5 A;  4DCK A;  1SQQ J;  2SPZ A;  1CI6 B;  1VQ5 P;  4PV1 C;  2KB7 P;  2AEJ A;  3CWB E;  3TYY A;  2AXC A;  1FE6 A;  1SQV K;  4Y28 J;  1DD3 A;  2XDJ A;  1MUU A;  5KLV K;  1RE3 A;  2N9Y B;  4Z1M H;  1BE3 E;  1USD A;  3GLM A;  2I1K A;  1PGP A;  2MJZ A;  5AW7 B;  5B5E E;  4PD4 H;  1PGQ A;  2A06 E;  3C9I A;  1S3J A;  4W7Z A;  3MZW B;  1DIP A;  1NGM B;  5KJ7 A;  4PD4 D;  4A7P A;  2QE7 H;  5AW8 B;  2OYH A;  3CXH D;  3JCU E;  2GA1 A;  2G3A A;  2LR2 A;  1NTK D;  5E79 H;  2WZ7 A;  3L74 J;  1RF1 A;  1NAY A;  2E43 A;  2BCC G;  2HLO A;  4TLF A;  3AEF C;  3V2R A;  1E79 H;  1JY3 O;  1NU1 G;  4QMA A;  3N4X A;  5APQ A;  2E74 D;  4BRY B;  1JNM A;  5AVU B;  4I7Z B;  2HYN A;  3B4S A;  1JY2 O;  1NYH A;  2QRX A;  4O9B A;  1RF1 B;  5KJ7 C;  5AW0 B;  2B88 A;  2C9N Y;  3AE1 C;  5APV A;  2ZVO B;  3AEG C;  2WIT A;  2R3C A;  2FY8 A;  2QIW A;  3B5N C;  1M90 Q;  2M3E A;  3WUU A;  1RF1 C;  1NTK J;  2GUS A;  3NMD A;  3ABV C;  1LTG C;  1IJD B;  1HWT C;  3UIA A;  2O01 N;  5EFW B;  2XNX A;  1EDK A;  3L75 E;  1MFZ A;  2KK7 A;  4RKU J;  3V2N A;  2KXP B;  1FC2 C;  1FZG A;  3GF3 A;  3CC7 P;  4ZNC A;  1BE3 D;  5B5E H;  1S5L E;  1M1K Q;  4H44 B;  1BDC A;  1K8A Q;  1YQ3 C;  3AE4 C;  5AW9 B;  1N7S A;  1PL5 A;  1W2E A;  2IX7 C;  3JCU H;  3MIW A;  2JJL A;  5AW1 B;  4D6T E;  2ZYG A;  3GHG C;  1HJ0 A;  4H44 C;  3RK2 B;  1SVF A;  3TGU E;  4U3F G;  1HTL C;  3AE2 C;  1SQV E;  1LTI C;  3OAK A;  1L0L G;  2VRS A;  5TIS E;  1L0N K;  3KXD A;  1Q7Y Q;  4L73 A;  3RK3 B;  1YHQ P;  1N7S B;  1Q86 Q;  4EI2 A;  2ZVN B;  2YO3 A;  3RK2 C;  2RH0 A;  3Q1M A;  4DT0 A;  2FKW B;  1FDO A;  2C0X A;  1BE3 J;  3L71 G;  3E1I A;  5KTB A;  3NXS A;  2KS1 A;  2WT7 A;  2K9J A;  2HFE D;  3L73 D;  2WMM A;  3RL0 C;  3L75 G;  1GD2 E;  3KDP B;  4PD4 I;  1NJI Q;  1OMI A;  4W7Y A;  1NTM K;  1PIX A;  1KQF B;  2GUV A;  3H1H D;  3NFQ A;  4KJM A;  2E42 A;  2KS1 B;  1EZV G;  5M1B A;  4KHX A;  3IF4 A;  5APY A;  2K9J B;  1JY3 N;  4XFJ A;  2FXO A;  2OYO A;  1LP1 A;  1SQX E;  1XTG B;  3A5T A;  1RQU A;  2J58 A;  2BAS A;  1JY2 N;  1QX8 A;  1HGZ A;  1S5L H;  1ZP0 C;  2ITA A;  1L4A D;  4GIF A;  3TGU G;  3SWF A;  1FZE A;  1UIX A;  2KLU A;  3M91 A;  4DZO A;  1K73 Q;  3G9R A;  1MZ9 A;  1LP1 B;  1D7M A;  2ZFC A;  2K88 A;  2KNC A;  2O1J A;  1KB9 I;  2IPP A;  4RJT A;  2OTK E;  1ZV8 A;  3H1H J;  2IFN A;  2IYO A;  3P8C E;  4I1L A;  1K9M Q;  3HE4 A;  2FYN C;  3H1L D;  5TIS H;  3V2P A;  1QVG O;  2Y0D A;  3RK3 E;  3II6 A;  5APT A;  3HD7 A;  1OX3 A;  1SQV D;  2O3J A;  3MP7 B;  3V4Q A;  4ZKP A;  3VYI A;  3CLQ A;  1SQB E;  2KNC B;  2O01 H;  1U7J A;  1JUN A;  3H1K D;  2ZXX A;  3CCU P;  1NO4 A;  3K5B A;  1KC8 Q;  3V2Q A;  2QJK B;  3HE4 B;  1OW6 A;  3LIE A;  2HOD B;  3TK1 A;  3HD7 B;  1OW8 A;  3L70 E;  2HG5 D;  2Y0E A;  3AEC C;  3IAO A;  2R3S A;  2OGU A;  3PRJ A;  3USS A;  2JR8 A;  1Q90 D;  4K3A A;  4L74 A;  2PAJ A;  2QJK C;  2KLV A;  2W6J H;  1Q81 Q;  3CCV P;  3H1L J;  3V6I A;  1OWA A;  3HD7 C;  4YXD C;  1FBM A;  2CPB A;  1Y9B A;  3AE7 C;  3L4F A;  1SQV J;  3H25 A;  2YMY A;  2C0W A;  3P8M C;  3H32 A;  1JCC A;  4GDO A;  5CHX A;  1BCC D;  2E5T A;  1NTZ E;  3H1K J;  4YXW H;  4LGD E;  2FYU G;  1H89 A;  4DJG A;  3A0H E;  1N86 A;  2I8D A;  2NPS D;  1ZLL A;  3H32 B;  2WSS H;  2E75 B;  1RHZ B;  3G6E P;  3CCM P;  3EWK A;  3AE5 C;  3H1I G;  3L36 A;  4OGQ D;  4IOI H;  1GDT A;  2E76 B;  3QWO C;  1IK9 A;  1WMK A;  1M7L A;  4JPZ B;  1IZN B;  2KZI A;  3CCJ P;  2KIK A;  1EXJ A;  1SQQ G;  3P8C D;  3FXE A;  1BCC J;  5CJ4 A;  2E76 C;  1GL2 B;  1KIL E;  2M3B A;  1NHL A;  3L70 G;  4U7J A;  1FOS E;  4PJ0 E;  2QSI A;  3L37 A;  2R32 A;  2OTL P;  5AW4 B;  1SQP G;  1FJP A;  3LW5 H;  1GK4 A;  1IFP A;  3M9Q A;  1GL2 C;  3H1J G;  3HRN A;  1IFN A;  1W5C E;  1G2C A;  2IBZ G;  1KTM A;  2BCC E;  3FXD A;  2WTY A;  1NU1 E;  2UWJ E;  4WY4 A;  1OFC X;  2H8P D;  4TT3 H;  1URQ D;  3KQG A;  1L0N D;  2CK3 H;  4HB1 A;  4LC1 A;  1G2C B;  4N6J A;  3CCS P;  2W6B A;  3MTU E;  2Q3I A;  1AFO A;  3L72 D;  4EOT A;  2ZAE B;  2P2U A;  1T8Z A;  4GOE A;  1FDM A;  1HH0 A;  3L74 D;  3KZI E;  2QEX P;  4ZMD A;  3G3Z A;  4WY4 B;  4NPF X;  1DEE G;  2WPQ A;  3AEE C;  4OH8 B;  4EYY Q;  4AUW A;  5CCH D;  3BCC D;  3LW5 J;  4IFM A;  3NTN A;  1HBW A;  1JMB A;  2N9B A;  5AVX B;  1LTB C;  2FFD C;  3M0A A;  3PHL A;  3ITK A;  1OZH A;  4WY4 C;  5K5G B;  2FXM A;  3I5C A;  3EFF K;  1NTM D;  3IN6 A;  4UB6 E;  2N1T D;  1Q82 Q;  2NRG A;  1AQ5 A;  2B87 A;  1L0N J;  1NTK G;  3V4W A;  1DD4 A;  4BRY A;  2KYV A;  4YTP C;  3L72 J;  2AEF A;  3CX5 E;  1OVV A;  3D71 A;  2M8R A;  3S9O A;  3B5N A;  4PJ0 H;  1U57 A;  3VMY A;  3CD6 P;  2H7H A;  1BGY D;  1QEX A;  1KIL D;  1S9K E;  1YJ9 P;  1L4A C;  1HJB A;  1NKN A;  3BCC J;  1S72 P;  2B87 B;  3B71 A;  2OYI C;  3FX0 A;  1YIT P;  5CMZ A;  3SWY A;  4ASW A;  4U3F E;  1BSN A;  2KP8 A;  1L0L E;  4XE5 B;  5KAI E;  3MD0 A;  1SQX K;  3B5N B;  1KB9 H;  5H2F E;  3GG2 A;  2YKP A;  1VF5 D;  1NTM J;  3AE3 C;  4IL6 E;  1MKM A;  5CBN A;  2BCC D;  4M3L A;  1KB9 D;  1IFD A;  2YXR B;  1NU1 D;  3L71 E;  3RL0 g;  1PFI A;  3GMA A;  3AED C;  4H13 B;  3BAS A;  3VN0 A;  1BGY J;  2ZXE B;  3TDK A;  3GHG A;  1ZRT D;  3KZI H;  3CI9 A;  2CPS A;  2K9Y A;  1KQG B;  1VQP P;  1VQ6 P;  4H0L D;  4JYC A;  3CWB D;  4H13 C;  1S2E A;  1GW3 A;  2A45 I;  1U7M A;  3SWK A;  1SQB K;  1EZV E;  3G4S P;  3AE9 C;  2AXT E;  1VQM P;  3GHG B;  1SP4 A;  4GOD A;  1UII A;  2BCC J;  2GM4 A;  1OIP A;  2HPC A;  4UB6 H;  2YIU C;  1SS1 A;  3I55 P;  2RMZ A;  1NU1 J;  1WRG A;  2A06 D;  1NAF A;  1EXI A;  1SFC A;  3VOP A;  2PGD A;  4GOF A;  1J1E B;  1LT9 B;  2Y9Y A;  2MKV A;  3R4Y A;  1R8E A;  3CX5 H;  1RH5 B;  1VQ4 P;  2M5A A;  1JEK A;  2R5D A;  2ZT9 D;  3QH9 A;  2C9L Y;  3ZDM A;  1YBK A;  4R4L A;  2HPC B;  1HVV A;  2XV5 A;  1EDL A;  4IFD K;  3CC2 P;  1KQL A;  1J1E C;  1LT9 C;  1PPJ E;  3CWB J;  5GTH E;  3VMZ A;  2HR3 A;  5B66 E;  1SFC B;  2Y9Z A;  2D2C D;  5BU5 A;  2FXP A;  4JBZ A;  3RL0 B;  5TJH A;  2M5A B;  1WT6 A;  2WSF H;  1T2K D;  1NTZ K;  5H2F H;  2B89 A;  1KYO E;  4U3F D;  2KSJ A;  3F89 A;  3L73 G;  4JF7 A;  1VQ9 P;  4IL6 H;  5CCG A;  2FBW C;  1SFC C;  3VP9 A;  3F5H A;  5BVZ A;  3LID A;  1M57 D;  3KHU A;  3H1H G;  4HH2 A;  1VQ7 P;  3EFG A;  3H6P A;  4N78 E;  2WSE H;  2BEZ F;  1VQL P;  3Q3D A;  3C1L A;  1VQO P;  2ZJS E;  3P7K A;  1S5L X;  1FS0 E;  5C39 A;  4NPD A;  4BWN A;  5CJ0 A;  3L75 D;  1LTJ B;  4BXL A;  3E1R A;  4U3F J;  2M0B A;  1GMJ A;  5CCG C;  3WUV A;  2WSF J;  4L76 A;  2FYN B;  1LTJ C;  3EQ2 A;  2WPS A;  2FYU E;  3U1C A;  1PPJ G;  1Y8A A;  3H1L G;  2XKM A;  3PLN A;  1OVU A;  1VQK P;  3D6Z A;  2K1A A;  1LWU A;  3U59 A;  4Y99 B;  1IFJ A; 
#chains in the Genus database with same CATH homology
 1SQX J;  3L73 J;  1EZV I;  4PD4 I;  1NTK J;  1NTZ J;  3CX5 I;  1P84 I;  1SQQ J;  3H1I J;  1NU1 J;  1L0N J;  2IBZ I;  3H1K J;  2FYU J;  1NTM J;  1PP9 J;  3CXH I;  3H1J J;  3BCC J;  3H1L J;  4D6T J;  3CWB J;  1BGY J;  1BCC J;  4U3F J;  1KB9 I;  3L70 J;  1SQB J;  3L75 J;  1KYO I;  3L72 J;  3TGU J;  1SQV J;  1L0L J;  3L71 J;  3H1H J;  5KLV J;  3L74 J;  2BCC J;  1BE3 J;  1SQP J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...