3H1LJ

Chicken cytochrome bc1 complex with ascochlorin bound at qo and qi sites
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ascochlorin is a novel, specific inhibitor of the mitochondrial cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 19
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3h1lJ00
1NU1J 1EZVI 1SQQJ 3H1HJ 2FYUJ 3H1JJ 3L74J 1NTMJ 4U3FJ 3L71J 1PP9J 1KYOI 1BE3J 1SQXJ 3L70J 1SQPJ 1L0LJ 1BGYJ 2IBZI 3H1KJ 4PD4I 3TGUJ 1KB9I 3L72J 1BCCJ 2BCCJ 3H1LJ 3L75J 3H1IJ 1L0NJ 1SQBJ 1NTZJ 3BCCJ 3CWBJ 1SQVJ 4D6TJ 1NTKJ 3CX5I 5KLVJ 1P84I 3L73J 3CXHI
chains in the Genus database with same CATH superfamily
2XV5A 2OQQA 3L70D 5E79H 1IO4A 3L4FA 4HYTB 5AW4B 5H2FH 3CX5D 3FWNA 1NTMJ 2V4HA 4U3FJ 1NKZB 1PP9J 2E5YA 3RBXA 2HYNA 5TISH 1OX3A 2H89C 1YIJP 4HKZH 1LWUB 1SQQD 1BE3J 4HH2A 1JMBA 1L0LJ 2KP8A 2WWWA 1CI6A 2XZRA 4AUWA 4N78D 2IYPA 3MZWB 1KB9I 1S4XA 2JKVA 4U7JA 2PGDA 1AFOA 3CL3D 1T2KC 1LT9C 3VTPC 1YYCA 1NTZK 2J59M 2E75B 2KOGA 1L0NJ 3ITKA 4L74A 1SQBJ 1WMKA 1SQQK 2RMZA 4XE5B 4IL6E 1XTGB 2IBZG 1L0NE 4RO0A 3AE5C 4EDFA 1M90Q 1PGOA 1FZCA 3VP8A 3H1HE 3QH9A 2KSEA 3CC2P 1LGHB 3MUDA 3U1CA 3H1HD 4OGQB 2CK3H 3H6PA 1KFMA 5APQA 4BWNA 2HPCA 1OIPA 3CX5H 4NPFX 1SQVG 2WITA 2I1KA 2JWDA 4I6MC 4H13C 3CPWO 2VRSA 2G8YA 1VQPP 3O6QB 3L71J 1FU1A 1G1JA 1PIXA 1U57A 2M5AA 2CPBA 1HWTC 3BCCG 1GMJA 1PPJE 3B5NC 1LJ2A 3BASA 1HGZA 3VN0A 1T8ZA 1QEXA 2OYOA 1PL5A 1SQXE 4Z1MH 1OXZA 2J58A 1SQVD 1LP1A 4JF7A 1SFCB 3NXSA 1WRGA 3WU2H 2QE7H 2K37A 3M9BA 1FAVA 2WPRA 5AVVB 4H13B 4C7RA 1KB9D 1URQA 3H1KD 1JY3O 5BVZA 3D6ZA 2KNCA 5CJ4A 3CCSP 1LNQA 2YIUB 4I7ZC 4IL6X 4H44B 4B86A 3B5ND 4WY4A 2B88A 4BRYA 2OYIB 3OJAB 1JCCA 1FOSE 3T97B 1KILA 2IBZE 4NPEA 1H8AA 1AJYA 3H1HJ 3EFGA 2FXMA 3L74J 2IBZD 1EC5A 1L0LD 2IZ1A 5APTA 1J2JB 1URQC 3IF4A 4D6TD 1Q82Q 3U59A 4PJ0E 3WMM0 5KAIH 1MFZA 2DW3A 2QJKC 3H1JE 3P8CD 3TNUA 1LT9B 2P1JA 1RE4A 1FDOA 1Z56A 2K3RA 2M3BA 1OZHA 2LXBA 3TGUJ 2WT7A 1JTHA 2IFNA 3SSUA 2RH0A 2OARA 3LIDA 3HUSC 5GTHH 1K04A 3HE4A 1HBWA 5CCGD 1GTWA 3BVHA 1EZVG 1OMIA 2KNCB 1M7LA 5AVYB 3SWYA 4D6TE 2Y9YA 1Q7YQ 2E76B 1W5CE 5BU8B 2YO3A 1VQ4P 1SFCD 3P7KA 3M0DC 2O01N 2YNYA 4ZKPA 4N3YB 3CCVP 1NU1D 3A2AA 3JC22 5KLVK 1N73B 1ZR4A 2WQYC 1NTKE 3L73E 2WSFJ 3G9RA 3EWKA 3MHVA 3PHLA 3VP9A 4AYCA 2E5TA 3CCMP 3CCLP 3B71A 1DX7A 1H0TA 2FYZA 3FXEA 2B87B 3B4SA 3G3ZA 4I1LA 1SQQE 1KYOD 1NO4A 1NTKG 1UIIA 5KLVD 2A06D 2FBWC 2YMKA 4C46A 4YXDC 3L75J 5AW2B 1KQGB 1NU1G 2GUVA 1JTHB 2Y9ZA 4H44C 1IC2A 1NVOA 5AW6B 1EXJA 1FZEA 4GOFA 4PV1B 1QLED 2OYIC 3E1RA 1T3UA 2AXTH 3NMDA 1PP9E 5E79E 2E42A 1ZRTE 3HE5A 1BCCG 5KJ7C 3SWKA 3CCJP 1LT1A 2K1AA 2M3EA 2PFXA 3TDKA 1Q86Q 5AW3B 5AW7B 3NTNA 1FZFA 1IK7A 3L73D 3AEBC 2PRRA 2P7JA 3AEFC 1JUNA 1FJPA 3AE1C 4H44D 1JO5A 2I1JA 1FDMA 1Q90D 1JMMA 1J1DC 3FGAD 4PJ0H 5KAIE 3M0AA 2FY8A 2YKPA 2BCCE 3HUSA 3I55P 1KTMA 3N7NA 1LTGC 2WPVB 2BEQD 4EYYQ 1KORA 2OYHB 1KQFB 1DD4A 3H1KJ 3L35A 2C0XA 2FYNB 2AEFA 1VF5D 4A7PA 2IZ0A 1LWUC 3A3YB 1BGYE 1YTZT 1HUCA 2H8PD 3VMXA 1KILB 2IX7C 1A02F 2E76C 2WSFH 1LTTC 3JCUE 1ZN5A 2D2CC 2P67A 2AXTE 2V7QH 4GOEA 1N8RQ 2ZYGA 3BCCJ 3CWBJ 4PV1D 3V6IA 5APVA 4IOIH 1GL2D 1RQUA 1NTKJ 2E75C 1G1IA 1S3JA 1T2KD 1EDKA 2NPSB 1SQVK 1VF5C 4PD4E 5B5EH 3KDPB 1E5WA 3AE6C 2WTYA 1BE3G 1NOHA 2QIWA 3JSVC 5GTIH 2FYUJ 3GHGB 1KD1Q 2OTKE 1A02J 2XKMA 2O1KA 4DOJA 1BCCE 1JY2P 1MV8A 1NH4A 4JBZA 2FYUG 5AW9B 3N4XA 1SQPG 2YO2A 3M9HA 3WUUA 5AVXB 4WBAA 4ZMDA 3Q5RA 1JNMA 2FYUD 1UIXA 1L0NG 3WUTA 5CCHD 1KQSO 2C9LY 2BCCJ 2A45I 4I2LC 2WSCJ 1FE6A 1CSBA 3RGUA 3TYYA 3P8CE 1VQMP 1GK6A 1ZXGA 3QWOC 2Y0DA 2R5BA 4CPGA 4YXWH 3CCEP 2Q3EA 5CJ0A 1FDIA 3CMAP 4YPCA 1NTZJ 1BE3D 1YJ9P 1SFCC 1SQVJ 3SWFA 3WU2E 1HJBA 3MD0A 3AEDC 3D70A 1NTZE 1M57D 1NTKK 2KS1A 4UB8H 3L74E 4N6JA 1ZR2A 2Z5HA 3CCUP 1J1DB 1PGQA 1X22A 3SFDC 1NWQA 1JEKA 1JY3P 2KK7A 2NRGA 3HTKB 2QEXP 5DJUB 1NGMB 2QM7A 2OYHC 3F5HA 5APYA 2FYNC 3KZIE 1NTMK 2CPSA 2JEEA 1L0LG 4UB6H 3GLMA 1YJWP 5AVSB 1H88A 1JB0J 3CCRP 1RQVA 1URQB 3EFFK 2IPPA 1VQOP 1HVVA 4WB4A 1QL2A 3TSIA 2W83C 1BCCJ 1M56D 2D2CB 3USSA 1OWAA 2QJKB 1KZUB 3H1LJ 1CI6B 1URQD 2KSJA 1KFNA 1GK4A 4GDOA 1PGJA 4WVZA 4RJTA 3L75E 3L72D 2E76D 3W67A 1SQBD 3H1KG 3L72E 2ZT9D 4HJGH 3Q1MA 3AECC 2XNXA 2I8DA 3L70G 3HUSB 1DH3A 1S5LH 1L4AD 1S1CX 3K5BA 3GHGC 2BASA 2N9YB 3CX5I 3L73G 1G2CA 4QMAA 4RKUJ 4Y99B 5KLIC 1IFNA 4R4LA 4C7NB 5B66H 1Y9BA 2QSIA 3II6A 3L73J 3CCQP 1VQKP 3FWLA 3KXDA 5CCHC 5CCGC 3HTKA 2OTJP 1CW5A 3RK3D 3D6YA 1Y47A 5KAFH 1RE3C 4TLFA 3RK3E 5CBNA 4KJMA 1KYOI 2R3SA 3Q3DA 2AEJA 1FJKA 2FXPA 2LKMA 3V2NA 5AW1B 3TGUE 2IBZI 2Q5UA 3MTUE 2P10A 4U3FG 1KB9H 1DEBA 1N7SB 3GMAA 2WMMA 3I5CA 5GTIE 2QRXA 2NPSA 5CCGA 2ZVOB 3H1LD 4UB8E 1IFDA 2NPSD 1VDFA 3TK1A 2ZFCA 3SFEC 1DEEG 1SS1A 1DD3A 2IFMA 3GW6A 4ASVA 2H7HA 2R3CA 1N73A 1N86A 3CXHD 1SFCA 1VQ8P 1EZVD 1PZQA 2A45G 4IL6H 5CCHA 5AVZB 2K9JB 1NU1E 2AXCA 2Z5IA 4EOTA 1KYOH 4PV1C 2PP6A 1FZCC 3LW5H 1G2CB 1MKMA 1IFMA 2WSCH 2UWJE 1RF1A 2WVRA 4JYBA 2OYIA 1VL2A 2FXOA 3IFMA 1M1JA 3MIWA 3V4QA 1NTZD 1PGPA 1SQXJ 3CWBG 3L75G 2E43A 3L74D 3O8ZA 2N9BA 2ZYAA 1GW3A 2W90A 2GUSA 4PD4I 2KI7B 1EDLA 2KS1B 2KLUA 3L37A 1RHZB 1OW6A 3A0BH 4JPZB 3H1IJ 1RF1C 4L73A 1SQPE 4LGDE 5B66E 3BCCE 2WT7B 1GL2B 1FS0E 4Y99C 2JDIH 1NTMG 4W7ZA 3S1KA 5KLIB 1LTIC 2QA4P 1USDA 1EDJA 1JY3N 1LTAC 4OWFA 3HE4B 1KILC 1MUUA 1OFCX 2H88C 5CHXA 4D6TJ 5KTBA 1QVGO 1M1KQ 1E79H 2Q9IA 5GTHE 1HH0A 3CC7P 3BRTB 3CWBE 1IFPA 3ABVC 3BRVB 3KQGA 2H43A 3PLNA 1EZVI 5DJTB 4H13D 2FFDC 1MZ9A 2JJLA 2R5DA 2NPSC 2P58A 3I56P 1VF5B 1M1JB 3BCCD 1OW7A 1IZNB 1KILD 3CXHE 2HODB 4OH8B 1VQNP 1YQ3C 5EFWB 3FXDA 1W2BO 3PTZA 5AVQB 3R4YA 5L8RJ 5C39A 3CC4P 3RBZA 1L2PA 3RL0B 1EDIA 3KZIH 2BEZF 1GL2A 1SQXK 3M0DA 3Q2YA 2W6AA 4DCKA 1KMIZ 2FFDA 3GHGA 1K05A 4XA4A 1RH5B 2BCCD 5KAFE 5AVRB 1D7MA 4N78E 1NTME 1N7SA 3RK2C 2L5GB 3M91A 3M9QA 1N7SD 3C1LA 1LWUA 4LC1A 1GD2E 1PP9G 1SVFA 2M0BA 3HD7C 2YKQA 1S72P 1LTJA 3VMAA 1VQ9P 1PP9D 2QG4A 1SQPJ 1CZQA 4TT3H 3IR9A 1P84E 1X79B 2NZ2A 5CMZA 5KJ7D 4ZNCA 4ASWA 3AEEC 3L71E 3L70E 1LTSC 4O9BA 2SPZA 2MJZA 3B5NA 3L75D 4WY4D 1NTZG 2BCCG 3CWBD 2O1JA 2OYHA 1SQBE 4KT0J 3RL0g 1KYOE 1FBMA 1L4AB 2LR2A 2MKVA 2A06E 5KLVE 2Q1KA 1S2EA 1QVFO 2K9YA 1QGKB 4RESB 5APWA 1AQTA 4AQRD 5K5GB 2FFDB 5H2FE 5CBOA 4IFFA 1RF0A 1USEA 2KUBA 1NJIQ 2XNDH 2WPSA 1FZAA 5AW8B 5KKZC 3D71A 3OW2O 3W68A 1NU1J 2HR3A 2KYVA 2V7QJ 3V5BA 1SLQA 1SP4A 2AEMA 1VQ6P 1FZBA 2D2CD 3CI9A 3OA7A 1IJDB 1LTJB 1KC8Q 1NKNA 1K8AQ 1S9KE 1SQPK 3C8VA 4W7YA 1KQLA 1BE3E 1MFTA 1IFJA 3WUVA 1S9KD 4IFDK 1W2EA 1NAYA 3BATA 3L36A 3EQ2A 4H0LB 5TJHA 3VYIA 3U1AA 4DT0A 5APXA 2WPQA 1FZGA 2WSEH 2Z4EA 1N7SC 2KZIA 1Q2NA 4HB1A 1QX8A 1L4AA 4BRYB 1YI2P 4GODA 1SQPD 2GM4A 3RK2B 2POHA 3E7KA 3RK3B 3LW5J 1PV3A 2R32A 3AE2C 1AVYA 2ZYDA 1SQBG 3H1JD 5KLVJ 1VQLP 3HD7B 1XTCC 1ZP0C 4K35A 2PAJA 2ZVNB 4XFJA 1AA0A 1OVUA 1OVRA 3S9OA 3B8EB 4MN4C 1FC2C 1LT9A 2JP3A 1YBKA 3L71G 3PRJA 4PD4D 1GW4A 2Q3IA 2LXCB 1HTLC 3P8MC 1X8YA 1ZLLA 2B9BA 4IFMA 4W80A 1FOSF 2P2UA 4GT1A 4Y28J 1K73Q 1HJ0A 1EZVE 4D6TG 1IK9A 1ZOYC 4L76A 1BCCD 1NHLA 1YJNP 5AVTB 2M5AB 1R5LA 1K9MQ 1J1EC 2FKWB 2R44A 1BGYD 4UB6E 1AV1A 1BSNA 4OGQC 1ZRTD 4OVNF 2OGUA 1DIPA 3VOPA 1SQVE 3KPEA 1SQQG 3PP5A 1N2DC 3V2PA 3F89A 5KJ7A 1RF1B 1BDCA 1X9VA 1GU5A 2E75D 1R5SA 1GL2C 1LP1B 1RF0C 2N1TA 2QJYC 3AE4C 3AEAC 3L71D 2QJPB 5BU5A 5KLVG 1P84I 2ZT9B 3TGUD 1JM0A 1N7LA 1L0NK 2HG5D 1KB9E 2JR8A 3A0BE 1LTBC 3H1KE 1YTZI 4C7NA 3B5NB 3Q5PA 3CXHH 2Q6QA 3VMYA 3RK2D 1PFIA 4WY4B 2OTLP 1H0TB 2B87A 2XDJA 4H0LC 2QM8A 2W6JH 1YHQP 2J5UA 5APSA 5APUA 3Q5SA 1H89A 3HRNA 3OAKA 1BDDA 3M06A 5M1BA 3LIEA 1PPJD 1RY3A 1L0ND 2WSSH 1EXIA 2O01J 3FX0A 1M1JC 4BXLA 3A5TA 4NPDA 2W8ZA 1VPCA 2HFED 1X0TA 2E74C 1NTKD 2YIUC 4I7ZB 1GDTA 1OVVA 1RE3A 3RK3C 1S5LX 3TNUB 3IAOA 3TGUG 2FYUK 2N1TC 3HE5B 4JQ0D 1P84D 3AE9C 3MUDC 2KLVA 3PJSK 2KB7P 2W6BA 3KHUA 2Q7CA 1BSHA 5TISE 1AVOA 1ZW0A 2G3AA 3A0HH 2B89A 2IDBA 4KHXA 1U7MA 2ZXXA 3RL0C 1T3JA 4PD4H 1NTMD 5B5EE 3IN6A 3V2RA 3CXHI 1KILE 2WSEJ 3AE7C 3H32A 2K9JA 5AVUB 5AVWB 1ZMEC 3V2QA 2W27A 2ITAA 3P32A 3R2PA 1YQ4C 2YXRB 1WT6A 1NYHA 1P84H 3CLQA 3UIAA 4DJGA 1FZCB 4R4MA 1BGYG 3L74G 3NFQA 5AW5B 1GU4A 2C0WA 1Q81Q 1M8OB 2Y0CA 3AEGC 2A45H 3H25A 1SQBK 1BGYJ 1J1EB 2O01H 3G6EP 2KZJA 2Y0EA 1HGVA 3L72G 3CD6P 3KYQA 2QVAA 3HD7A 1IFIA 1TU3F 2ZJSE 3HD7D 3CX5E 3A7OA 1HF9A 3O6QA 2QJYB 2HLOA 1YITP 3G4SP 2YMYA 1S5LE 4LLHA 1L0LK 2QJPC 3A0HE 4M3LA 2ZT9C 3V4WA 4EI2A 2C9NY 1NAFA 3H1ID 1N73C 1L4AC 1KV4A 1KN7A 1JY2O 3ZDMA 2FYUE 4WY4C 5AW0B 2RKLA 1L0LE 4K3AA 4WWIA 1JCDA 3H1JG 1PPJG 3MP7B 2WZ7A 3GF7A 3E1IA 3GF3A 1SQXD 1VQ7P 1ZV8A 1SQQJ 3H32B 4U3FE 3H1JJ 3TF5A 3CMEP 1OW8A 1AQ5A 1QL1A 2E74D 4U3FD 1RE4C 5KKZB 4H0LD 1EQ7A 3VMZA 2YXQB 4DZOA 2N1TD 3L70J 3H1LG 3G71P 2E74B 2RN0A 1JOCA 2A06G 3JCUH 1Y8AA 4L75A 2K88A 2M8RA 3C9IA 3L72J 3T97A 2JO1A 2N1TB 3H1IE 1LTJC 3H1HG 3PH0A 4EIJA 2HODA 2IYOA 2KXPB 4GIFA 1GZLA 1NU1K 3H1LE 3AE8C 2ZXEB 2YKOA 4GKGA 3S4RA 1T6AA 2GA1A 1U7JA 4ZKUA 2KIKA 2JWAA 3H1IG 1SQXG 3MGNA 4OGQD 2ZAEB 2XU6A 3GG2A 1VQ5P 2L91A 3RL0D 2HPCB 4YTPC 1JY2N 3AE3C 2O3JA 4JYCA 1R8EA
chains in the Genus database with same CATH topology
1NU1J 1EZVI 1SQQJ 3H1HJ 2FYUJ 3H1JJ 3L74J 1NTMJ 4U3FJ 3L71J 1PP9J 1KYOI 1BE3J 1SQXJ 3L70J 1SQPJ 1L0LJ 1BGYJ 2IBZI 3H1KJ 4PD4I 3TGUJ 1KB9I 3L72J 1BCCJ 2BCCJ 3H1LJ 3L75J 3H1IJ 1L0NJ 1SQBJ 1NTZJ 3BCCJ 3CWBJ 1SQVJ 4D6TJ 1NTKJ 3CX5I 5KLVJ 1P84I 3L73J 3CXHI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NU1 J;  1EZV I;  1SQQ J;  3H1H J;  2FYU J;  3H1J J;  3L74 J;  1NTM J;  4U3F J;  3L71 J;  1PP9 J;  1KYO I;  1BE3 J;  1SQX J;  3L70 J;  1SQP J;  1L0L J;  1BGY J;  2IBZ I;  3H1K J;  4PD4 I;  3TGU J;  1KB9 I;  3L72 J;  1BCC J;  2BCC J;  3H1L J;  3L75 J;  3H1I J;  1L0N J;  1SQB J;  1NTZ J;  3BCC J;  3CWB J;  1SQV J;  4D6T J;  1NTK J;  3CX5 I;  5KLV J;  1P84 I;  3L73 J;  3CXH I; 
#chains in the Genus database with same CATH topology
 2XV5 A;  2OQQ A;  3L70 D;  5E79 H;  1IO4 A;  3L4F A;  4HYT B;  5AW4 B;  5H2F H;  3CX5 D;  3FWN A;  1NTM J;  2V4H A;  4U3F J;  1NKZ B;  1PP9 J;  2E5Y A;  3RBX A;  2HYN A;  5TIS H;  1OX3 A;  2H89 C;  1YIJ P;  4HKZ H;  1LWU B;  1SQQ D;  1BE3 J;  4HH2 A;  1JMB A;  1L0L J;  2KP8 A;  2WWW A;  1CI6 A;  2XZR A;  4AUW A;  4N78 D;  2IYP A;  3MZW B;  1KB9 I;  1S4X A;  2JKV A;  4U7J A;  2PGD A;  1AFO A;  3CL3 D;  1T2K C;  1LT9 C;  3VTP C;  1YYC A;  1NTZ K;  2J59 M;  2E75 B;  2KOG A;  1L0N J;  3ITK A;  4L74 A;  1SQB J;  1WMK A;  1SQQ K;  2RMZ A;  4XE5 B;  4IL6 E;  1XTG B;  2IBZ G;  1L0N E;  4RO0 A;  3AE5 C;  4EDF A;  1M90 Q;  1PGO A;  1FZC A;  3VP8 A;  3H1H E;  3QH9 A;  2KSE A;  3CC2 P;  1LGH B;  3MUD A;  3U1C A;  3H1H D;  4OGQ B;  2CK3 H;  3H6P A;  1KFM A;  5APQ A;  4BWN A;  2HPC A;  1OIP A;  3CX5 H;  4NPF X;  1SQV G;  2WIT A;  2I1K A;  2JWD A;  4I6M C;  4H13 C;  3CPW O;  2VRS A;  2G8Y A;  1VQP P;  3O6Q B;  3L71 J;  1FU1 A;  1G1J A;  1PIX A;  1U57 A;  2M5A A;  2CPB A;  1HWT C;  3BCC G;  1GMJ A;  1PPJ E;  3B5N C;  1LJ2 A;  3BAS A;  1HGZ A;  3VN0 A;  1T8Z A;  1QEX A;  2OYO A;  1PL5 A;  1SQX E;  4Z1M H;  1OXZ A;  2J58 A;  1SQV D;  1LP1 A;  4JF7 A;  1SFC B;  3NXS A;  1WRG A;  3WU2 H;  2QE7 H;  2K37 A;  3M9B A;  1FAV A;  2WPR A;  5AVV B;  4H13 B;  4C7R A;  1KB9 D;  1URQ A;  3H1K D;  1JY3 O;  5BVZ A;  3D6Z A;  2KNC A;  5CJ4 A;  3CCS P;  1LNQ A;  2YIU B;  4I7Z C;  4IL6 X;  4H44 B;  4B86 A;  3B5N D;  4WY4 A;  2B88 A;  4BRY A;  2OYI B;  3OJA B;  1JCC A;  1FOS E;  3T97 B;  1KIL A;  2IBZ E;  4NPE A;  1H8A A;  1AJY A;  3H1H J;  3EFG A;  2FXM A;  3L74 J;  2IBZ D;  1EC5 A;  1L0L D;  2IZ1 A;  5APT A;  1J2J B;  1URQ C;  3IF4 A;  4D6T D;  1Q82 Q;  3U59 A;  4PJ0 E;  3WMM 0;  5KAI H;  1MFZ A;  2DW3 A;  2QJK C;  3H1J E;  3P8C D;  3TNU A;  1LT9 B;  2P1J A;  1RE4 A;  1FDO A;  1Z56 A;  2K3R A;  2M3B A;  1OZH A;  2LXB A;  3TGU J;  2WT7 A;  1JTH A;  2IFN A;  3SSU A;  2RH0 A;  2OAR A;  3LID A;  3HUS C;  5GTH H;  1K04 A;  3HE4 A;  1HBW A;  5CCG D;  1GTW A;  3BVH A;  1EZV G;  1OMI A;  2KNC B;  1M7L A;  5AVY B;  3SWY A;  4D6T E;  2Y9Y A;  1Q7Y Q;  2E76 B;  1W5C E;  5BU8 B;  2YO3 A;  1VQ4 P;  1SFC D;  3P7K A;  3M0D C;  2O01 N;  2YNY A;  4ZKP A;  4N3Y B;  3CCV P;  1NU1 D;  3A2A A;  3JC2 2;  5KLV K;  1N73 B;  1ZR4 A;  2WQY C;  1NTK E;  3L73 E;  2WSF J;  3G9R A;  3EWK A;  3MHV A;  3PHL A;  3VP9 A;  4AYC A;  2E5T A;  3CCM P;  3CCL P;  3B71 A;  1DX7 A;  1H0T A;  2FYZ A;  3FXE A;  2B87 B;  3B4S A;  3G3Z A;  4I1L A;  1SQQ E;  1KYO D;  1NO4 A;  1NTK G;  1UII A;  5KLV D;  2A06 D;  2FBW C;  2YMK A;  4C46 A;  4YXD C;  3L75 J;  5AW2 B;  1KQG B;  1NU1 G;  2GUV A;  1JTH B;  2Y9Z A;  4H44 C;  1IC2 A;  1NVO A;  5AW6 B;  1EXJ A;  1FZE A;  4GOF A;  4PV1 B;  1QLE D;  2OYI C;  3E1R A;  1T3U A;  2AXT H;  3NMD A;  1PP9 E;  5E79 E;  2E42 A;  1ZRT E;  3HE5 A;  1BCC G;  5KJ7 C;  3SWK A;  3CCJ P;  1LT1 A;  2K1A A;  2M3E A;  2PFX A;  3TDK A;  1Q86 Q;  5AW3 B;  5AW7 B;  3NTN A;  1FZF A;  1IK7 A;  3L73 D;  3AEB C;  2PRR A;  2P7J A;  3AEF C;  1JUN A;  1FJP A;  3AE1 C;  4H44 D;  1JO5 A;  2I1J A;  1FDM A;  1Q90 D;  1JMM A;  1J1D C;  3FGA D;  4PJ0 H;  5KAI E;  3M0A A;  2FY8 A;  2YKP A;  2BCC E;  3HUS A;  3I55 P;  1KTM A;  3N7N A;  1LTG C;  2WPV B;  2BEQ D;  4EYY Q;  1KOR A;  2OYH B;  1KQF B;  1DD4 A;  3H1K J;  3L35 A;  2C0X A;  2FYN B;  2AEF A;  1VF5 D;  4A7P A;  2IZ0 A;  1LWU C;  3A3Y B;  1BGY E;  1YTZ T;  1HUC A;  2H8P D;  3VMX A;  1KIL B;  2IX7 C;  1A02 F;  2E76 C;  2WSF H;  1LTT C;  3JCU E;  1ZN5 A;  2D2C C;  2P67 A;  2AXT E;  2V7Q H;  4GOE A;  1N8R Q;  2ZYG A;  3BCC J;  3CWB J;  4PV1 D;  3V6I A;  5APV A;  4IOI H;  1GL2 D;  1RQU A;  1NTK J;  2E75 C;  1G1I A;  1S3J A;  1T2K D;  1EDK A;  2NPS B;  1SQV K;  1VF5 C;  4PD4 E;  5B5E H;  3KDP B;  1E5W A;  3AE6 C;  2WTY A;  1BE3 G;  1NOH A;  2QIW A;  3JSV C;  5GTI H;  2FYU J;  3GHG B;  1KD1 Q;  2OTK E;  1A02 J;  2XKM A;  2O1K A;  4DOJ A;  1BCC E;  1JY2 P;  1MV8 A;  1NH4 A;  4JBZ A;  2FYU G;  5AW9 B;  3N4X A;  1SQP G;  2YO2 A;  3M9H A;  3WUU A;  5AVX B;  4WBA A;  4ZMD A;  3Q5R A;  1JNM A;  2FYU D;  1UIX A;  1L0N G;  3WUT A;  5CCH D;  1KQS O;  2C9L Y;  2BCC J;  2A45 I;  4I2L C;  2WSC J;  1FE6 A;  1CSB A;  3RGU A;  3TYY A;  3P8C E;  1VQM P;  1GK6 A;  1ZXG A;  3QWO C;  2Y0D A;  2R5B A;  4CPG A;  4YXW H;  3CCE P;  2Q3E A;  5CJ0 A;  1FDI A;  3CMA P;  4YPC A;  1NTZ J;  1BE3 D;  1YJ9 P;  1SFC C;  1SQV J;  3SWF A;  3WU2 E;  1HJB A;  3MD0 A;  3AED C;  3D70 A;  1NTZ E;  1M57 D;  1NTK K;  2KS1 A;  4UB8 H;  3L74 E;  4N6J A;  1ZR2 A;  2Z5H A;  3CCU P;  1J1D B;  1PGQ A;  1X22 A;  3SFD C;  1NWQ A;  1JEK A;  1JY3 P;  2KK7 A;  2NRG A;  3HTK B;  2QEX P;  5DJU B;  1NGM B;  2QM7 A;  2OYH C;  3F5H A;  5APY A;  2FYN C;  3KZI E;  1NTM K;  2CPS A;  2JEE A;  1L0L G;  4UB6 H;  3GLM A;  1YJW P;  5AVS B;  1H88 A;  1JB0 J;  3CCR P;  1RQV A;  1URQ B;  3EFF K;  2IPP A;  1VQO P;  1HVV A;  4WB4 A;  1QL2 A;  3TSI A;  2W83 C;  1BCC J;  1M56 D;  2D2C B;  3USS A;  1OWA A;  2QJK B;  1KZU B;  3H1L J;  1CI6 B;  1URQ D;  2KSJ A;  1KFN A;  1GK4 A;  4GDO A;  1PGJ A;  4WVZ A;  4RJT A;  3L75 E;  3L72 D;  2E76 D;  3W67 A;  1SQB D;  3H1K G;  3L72 E;  2ZT9 D;  4HJG H;  3Q1M A;  3AEC C;  2XNX A;  2I8D A;  3L70 G;  3HUS B;  1DH3 A;  1S5L H;  1L4A D;  1S1C X;  3K5B A;  3GHG C;  2BAS A;  2N9Y B;  3CX5 I;  3L73 G;  1G2C A;  4QMA A;  4RKU J;  4Y99 B;  5KLI C;  1IFN A;  4R4L A;  4C7N B;  5B66 H;  1Y9B A;  2QSI A;  3II6 A;  3L73 J;  3CCQ P;  1VQK P;  3FWL A;  3KXD A;  5CCH C;  5CCG C;  3HTK A;  2OTJ P;  1CW5 A;  3RK3 D;  3D6Y A;  1Y47 A;  5KAF H;  1RE3 C;  4TLF A;  3RK3 E;  5CBN A;  4KJM A;  1KYO I;  2R3S A;  3Q3D A;  2AEJ A;  1FJK A;  2FXP A;  2LKM A;  3V2N A;  5AW1 B;  3TGU E;  2IBZ I;  2Q5U A;  3MTU E;  2P10 A;  4U3F G;  1KB9 H;  1DEB A;  1N7S B;  3GMA A;  2WMM A;  3I5C A;  5GTI E;  2QRX A;  2NPS A;  5CCG A;  2ZVO B;  3H1L D;  4UB8 E;  1IFD A;  2NPS D;  1VDF A;  3TK1 A;  2ZFC A;  3SFE C;  1DEE G;  1SS1 A;  1DD3 A;  2IFM A;  3GW6 A;  4ASV A;  2H7H A;  2R3C A;  1N73 A;  1N86 A;  3CXH D;  1SFC A;  1VQ8 P;  1EZV D;  1PZQ A;  2A45 G;  4IL6 H;  5CCH A;  5AVZ B;  2K9J B;  1NU1 E;  2AXC A;  2Z5I A;  4EOT A;  1KYO H;  4PV1 C;  2PP6 A;  1FZC C;  3LW5 H;  1G2C B;  1MKM A;  1IFM A;  2WSC H;  2UWJ E;  1RF1 A;  2WVR A;  4JYB A;  2OYI A;  1VL2 A;  2FXO A;  3IFM A;  1M1J A;  3MIW A;  3V4Q A;  1NTZ D;  1PGP A;  1SQX J;  3CWB G;  3L75 G;  2E43 A;  3L74 D;  3O8Z A;  2N9B A;  2ZYA A;  1GW3 A;  2W90 A;  2GUS A;  4PD4 I;  2KI7 B;  1EDL A;  2KS1 B;  2KLU A;  3L37 A;  1RHZ B;  1OW6 A;  3A0B H;  4JPZ B;  3H1I J;  1RF1 C;  4L73 A;  1SQP E;  4LGD E;  5B66 E;  3BCC E;  2WT7 B;  1GL2 B;  1FS0 E;  4Y99 C;  2JDI H;  1NTM G;  4W7Z A;  3S1K A;  5KLI B;  1LTI C;  2QA4 P;  1USD A;  1EDJ A;  1JY3 N;  1LTA C;  4OWF A;  3HE4 B;  1KIL C;  1MUU A;  1OFC X;  2H88 C;  5CHX A;  4D6T J;  5KTB A;  1QVG O;  1M1K Q;  1E79 H;  2Q9I A;  5GTH E;  1HH0 A;  3CC7 P;  3BRT B;  3CWB E;  1IFP A;  3ABV C;  3BRV B;  3KQG A;  2H43 A;  3PLN A;  1EZV I;  5DJT B;  4H13 D;  2FFD C;  1MZ9 A;  2JJL A;  2R5D A;  2NPS C;  2P58 A;  3I56 P;  1VF5 B;  1M1J B;  3BCC D;  1OW7 A;  1IZN B;  1KIL D;  3CXH E;  2HOD B;  4OH8 B;  1VQN P;  1YQ3 C;  5EFW B;  3FXD A;  1W2B O;  3PTZ A;  5AVQ B;  3R4Y A;  5L8R J;  5C39 A;  3CC4 P;  3RBZ A;  1L2P A;  3RL0 B;  1EDI A;  3KZI H;  2BEZ F;  1GL2 A;  1SQX K;  3M0D A;  3Q2Y A;  2W6A A;  4DCK A;  1KMI Z;  2FFD A;  3GHG A;  1K05 A;  4XA4 A;  1RH5 B;  2BCC D;  5KAF E;  5AVR B;  1D7M A;  4N78 E;  1NTM E;  1N7S A;  3RK2 C;  2L5G B;  3M91 A;  3M9Q A;  1N7S D;  3C1L A;  1LWU A;  4LC1 A;  1GD2 E;  1PP9 G;  1SVF A;  2M0B A;  3HD7 C;  2YKQ A;  1S72 P;  1LTJ A;  3VMA A;  1VQ9 P;  1PP9 D;  2QG4 A;  1SQP J;  1CZQ A;  4TT3 H;  3IR9 A;  1P84 E;  1X79 B;  2NZ2 A;  5CMZ A;  5KJ7 D;  4ZNC A;  4ASW A;  3AEE C;  3L71 E;  3L70 E;  1LTS C;  4O9B A;  2SPZ A;  2MJZ A;  3B5N A;  3L75 D;  4WY4 D;  1NTZ G;  2BCC G;  3CWB D;  2O1J A;  2OYH A;  1SQB E;  4KT0 J;  3RL0 g;  1KYO E;  1FBM A;  1L4A B;  2LR2 A;  2MKV A;  2A06 E;  5KLV E;  2Q1K A;  1S2E A;  1QVF O;  2K9Y A;  1QGK B;  4RES B;  5APW A;  1AQT A;  4AQR D;  5K5G B;  2FFD B;  5H2F E;  5CBO A;  4IFF A;  1RF0 A;  1USE A;  2KUB A;  1NJI Q;  2XND H;  2WPS A;  1FZA A;  5AW8 B;  5KKZ C;  3D71 A;  3OW2 O;  3W68 A;  1NU1 J;  2HR3 A;  2KYV A;  2V7Q J;  3V5B A;  1SLQ A;  1SP4 A;  2AEM A;  1VQ6 P;  1FZB A;  2D2C D;  3CI9 A;  3OA7 A;  1IJD B;  1LTJ B;  1KC8 Q;  1NKN A;  1K8A Q;  1S9K E;  1SQP K;  3C8V A;  4W7Y A;  1KQL A;  1BE3 E;  1MFT A;  1IFJ A;  3WUV A;  1S9K D;  4IFD K;  1W2E A;  1NAY A;  3BAT A;  3L36 A;  3EQ2 A;  4H0L B;  5TJH A;  3VYI A;  3U1A A;  4DT0 A;  5APX A;  2WPQ A;  1FZG A;  2WSE H;  2Z4E A;  1N7S C;  2KZI A;  1Q2N A;  4HB1 A;  1QX8 A;  1L4A A;  4BRY B;  1YI2 P;  4GOD A;  1SQP D;  2GM4 A;  3RK2 B;  2POH A;  3E7K A;  3RK3 B;  3LW5 J;  1PV3 A;  2R32 A;  3AE2 C;  1AVY A;  2ZYD A;  1SQB G;  3H1J D;  5KLV J;  1VQL P;  3HD7 B;  1XTC C;  1ZP0 C;  4K35 A;  2PAJ A;  2ZVN B;  4XFJ A;  1AA0 A;  1OVU A;  1OVR A;  3S9O A;  3B8E B;  4MN4 C;  1FC2 C;  1LT9 A;  2JP3 A;  1YBK A;  3L71 G;  3PRJ A;  4PD4 D;  1GW4 A;  2Q3I A;  2LXC B;  1HTL C;  3P8M C;  1X8Y A;  1ZLL A;  2B9B A;  4IFM A;  4W80 A;  1FOS F;  2P2U A;  4GT1 A;  4Y28 J;  1K73 Q;  1HJ0 A;  1EZV E;  4D6T G;  1IK9 A;  1ZOY C;  4L76 A;  1BCC D;  1NHL A;  1YJN P;  5AVT B;  2M5A B;  1R5L A;  1K9M Q;  1J1E C;  2FKW B;  2R44 A;  1BGY D;  4UB6 E;  1AV1 A;  1BSN A;  4OGQ C;  1ZRT D;  4OVN F;  2OGU A;  1DIP A;  3VOP A;  1SQV E;  3KPE A;  1SQQ G;  3PP5 A;  1N2D C;  3V2P A;  3F89 A;  5KJ7 A;  1RF1 B;  1BDC A;  1X9V A;  1GU5 A;  2E75 D;  1R5S A;  1GL2 C;  1LP1 B;  1RF0 C;  2N1T A;  2QJY C;  3AE4 C;  3AEA C;  3L71 D;  2QJP B;  5BU5 A;  5KLV G;  1P84 I;  2ZT9 B;  3TGU D;  1JM0 A;  1N7L A;  1L0N K;  2HG5 D;  1KB9 E;  2JR8 A;  3A0B E;  1LTB C;  3H1K E;  1YTZ I;  4C7N A;  3B5N B;  3Q5P A;  3CXH H;  2Q6Q A;  3VMY A;  3RK2 D;  1PFI A;  4WY4 B;  2OTL P;  1H0T B;  2B87 A;  2XDJ A;  4H0L C;  2QM8 A;  2W6J H;  1YHQ P;  2J5U A;  5APS A;  5APU A;  3Q5S A;  1H89 A;  3HRN A;  3OAK A;  1BDD A;  3M06 A;  5M1B A;  3LIE A;  1PPJ D;  1RY3 A;  1L0N D;  2WSS H;  1EXI A;  2O01 J;  3FX0 A;  1M1J C;  4BXL A;  3A5T A;  4NPD A;  2W8Z A;  1VPC A;  2HFE D;  1X0T A;  2E74 C;  1NTK D;  2YIU C;  4I7Z B;  1GDT A;  1OVV A;  1RE3 A;  3RK3 C;  1S5L X;  3TNU B;  3IAO A;  3TGU G;  2FYU K;  2N1T C;  3HE5 B;  4JQ0 D;  1P84 D;  3AE9 C;  3MUD C;  2KLV A;  3PJS K;  2KB7 P;  2W6B A;  3KHU A;  2Q7C A;  1BSH A;  5TIS E;  1AVO A;  1ZW0 A;  2G3A A;  3A0H H;  2B89 A;  2IDB A;  4KHX A;  1U7M A;  2ZXX A;  3RL0 C;  1T3J A;  4PD4 H;  1NTM D;  5B5E E;  3IN6 A;  3V2R A;  3CXH I;  1KIL E;  2WSE J;  3AE7 C;  3H32 A;  2K9J A;  5AVU B;  5AVW B;  1ZME C;  3V2Q A;  2W27 A;  2ITA A;  3P32 A;  3R2P A;  1YQ4 C;  2YXR B;  1WT6 A;  1NYH A;  1P84 H;  3CLQ A;  3UIA A;  4DJG A;  1FZC B;  4R4M A;  1BGY G;  3L74 G;  3NFQ A;  5AW5 B;  1GU4 A;  2C0W A;  1Q81 Q;  1M8O B;  2Y0C A;  3AEG C;  2A45 H;  3H25 A;  1SQB K;  1BGY J;  1J1E B;  2O01 H;  3G6E P;  2KZJ A;  2Y0E A;  1HGV A;  3L72 G;  3CD6 P;  3KYQ A;  2QVA A;  3HD7 A;  1IFI A;  1TU3 F;  2ZJS E;  3HD7 D;  3CX5 E;  3A7O A;  1HF9 A;  3O6Q A;  2QJY B;  2HLO A;  1YIT P;  3G4S P;  2YMY A;  1S5L E;  4LLH A;  1L0L K;  2QJP C;  3A0H E;  4M3L A;  2ZT9 C;  3V4W A;  4EI2 A;  2C9N Y;  1NAF A;  3H1I D;  1N73 C;  1L4A C;  1KV4 A;  1KN7 A;  1JY2 O;  3ZDM A;  2FYU E;  4WY4 C;  5AW0 B;  2RKL A;  1L0L E;  4K3A A;  4WWI A;  1JCD A;  3H1J G;  1PPJ G;  3MP7 B;  2WZ7 A;  3GF7 A;  3E1I A;  3GF3 A;  1SQX D;  1VQ7 P;  1ZV8 A;  1SQQ J;  3H32 B;  4U3F E;  3H1J J;  3TF5 A;  3CME P;  1OW8 A;  1AQ5 A;  1QL1 A;  2E74 D;  4U3F D;  1RE4 C;  5KKZ B;  4H0L D;  1EQ7 A;  3VMZ A;  2YXQ B;  4DZO A;  2N1T D;  3L70 J;  3H1L G;  3G71 P;  2E74 B;  2RN0 A;  1JOC A;  2A06 G;  3JCU H;  1Y8A A;  4L75 A;  2K88 A;  2M8R A;  3C9I A;  3L72 J;  3T97 A;  2JO1 A;  2N1T B;  3H1I E;  1LTJ C;  3H1H G;  3PH0 A;  4EIJ A;  2HOD A;  2IYO A;  2KXP B;  4GIF A;  1GZL A;  1NU1 K;  3H1L E;  3AE8 C;  2ZXE B;  2YKO A;  4GKG A;  3S4R A;  1T6A A;  2GA1 A;  1U7J A;  4ZKU A;  2KIK A;  2JWA A;  3H1I G;  1SQX G;  3MGN A;  4OGQ D;  2ZAE B;  2XU6 A;  3GG2 A;  1VQ5 P;  2L91 A;  3RL0 D;  2HPC B;  4YTP C;  1JY2 N;  3AE3 C;  2O3J A;  4JYC A;  1R8E A; 
#chains in the Genus database with same CATH homology
 1NU1 J;  1EZV I;  1SQQ J;  3H1H J;  2FYU J;  3H1J J;  3L74 J;  1NTM J;  4U3F J;  3L71 J;  1PP9 J;  1KYO I;  1BE3 J;  1SQX J;  3L70 J;  1SQP J;  1L0L J;  1BGY J;  2IBZ I;  3H1K J;  4PD4 I;  3TGU J;  1KB9 I;  3L72 J;  1BCC J;  2BCC J;  3H1L J;  3L75 J;  3H1I J;  1L0N J;  1SQB J;  1NTZ J;  3BCC J;  3CWB J;  1SQV J;  4D6T J;  1NTK J;  3CX5 I;  5KLV J;  1P84 I;  3L73 J;  3CXH I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...