3H1LJ

Chicken cytochrome bc1 complex with ascochlorin bound at qo and qi sites
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Ascochlorin is a novel, specific inhibitor of the mitochondrial cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 19
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3h1lJ00
3TGUJ 1SQBJ 1SQXJ 3CXHI 3CWBJ 1KB9I 1SQQJ 1NTZJ 1BGYJ 3L75J 3H1HJ 3L74J 3H1JJ 4D6TJ 5KLVJ 3L72J 1NU1J 3L70J 3H1IJ 1EZVI 3L73J 1KYOI 1NTMJ 4PD4I 2IBZI 1NTKJ 3H1LJ 1L0LJ 1BCCJ 3CX5I 3L71J 1PP9J 1SQPJ 1BE3J 2FYUJ 4U3FJ 3H1KJ 3BCCJ 2BCCJ 1P84I 1L0NJ 1SQVJ
chains in the Genus database with same CATH superfamily
1M1KQ 2E75B 3QH9A 2IFNA 4W7ZA 3H32A 5KLVG 1KV4A 4XE5B 3RBXA 1J1DC 3B8EB 2LXBA 2Y9ZA 3B5ND 1Y8AA 2AXTH 4LGDE 2IBZG 2KIKA 3L70J 3CL3D 1YJWP 4WY4C 3AE4C 1NTKD 1M56D 4IOIH 1KB9E 3H1LG 1BCCE 2HPCA 1E79H 1VQOP 2KB7P 2K9JA 3WUVA 1BE3G 2V7QJ 2YO3A 2WSFJ 3LW5J 2AXTE 1SQXE 3MUDC 2BEQD 4D6TJ 2NPSC 2MKVA 3GMAA 3FXDA 1JMBA 1S5LH 3GF3A 2E5YA 2RH0A 1YQ3C 3PP5A 1J2JB 1T2KD 3L37A 2JEEA 3U59A 1AV1A 1Y47A 2NZ2A 2IDBA 2E43A 4L74A 2ZT9D 5BU5A 1NU1G 1R8EA 4GODA 1IFIA 2Q1KA 2FYZA 1JY2P 1X79B 1M90Q 1JY3N 3TSIA 1D7MA 2CK3H 2G8YA 2BCCG 2XZRA 2QEXP 1YJ9P 5KLIB 2QSIA 3FX0A 3M0DA 4YXDC 5AVSB 2LR2A 1FDIA 2KXPB 1FDOA 2O01J 4DCKA 1BCCJ 3T97A 2FYUK 3CX5D 2FYNC 3MGNA 1SQVK 2C0XA 5TISH 1PFIA 3A0BE 1H0TA 4C7NB 2WSEJ 3Q3DA 1HF9A 1BGYJ 3H1IE 4GKGA 5C39A 1LT9A 1A02F 5KTBA 2I1JA 1N7SA 1NVOA 2D2CB 3RL0B 1VQ6P 3QWOC 4HJGH 4IFDK 4PD4H 5L8RJ 1JTHA 4H0LB 1OW7A 2QIWA 2E74B 2HFED 1SQQK 1VQ7P 1H89A 1BCCD 2N9YB 1JCDA 2G3AA 2YNYA 3VYIA 1IZNB 1N73B 1LTBC 1JCCA 1L4AB 1WT6A 1BGYD 3L71E 3P8CE 1URQA 5AVYB 2N1TA 3ITKA 2QA4P 3V4QA 2HLOA 3OW2O 3S1KA 4OGQD 1N7SD 3C9IA 3TYYA 3H1IJ 4U7JA 4OVNF 3TGUE 3L4FA 1IK9A 4HB1A 3CWBG 1YQ4C 2C9NY 1USDA 1MUUA 5KLVE 1KILB 1DEBA 1JEKA 2WSCJ 4B86A 1LTIC 1VL2A 1LTAC 1IFJA 1YYCA 4H13D 3CXHD 1SVFA 1NHLA 3RK3C 3MUDA 3TF5A 1NTMK 2QM7A 1HUCA 2Y0DA 4EIJA 2OYIB 2CPSA 3H1LE 3B5NB 1Q81Q 2ZFCA 2HODA 4U3FE 1L0NG 1QGKB 3IAOA 3VMAA 3HUSC 4I7ZC 1VQKP 4H44C 3TNUA 3MP7B 3CMEP 4NPEA 5AW1B 5GTHE 1Q82Q 5KLVJ 4HYTB 1VF5C 3WMM0 1JO5A 1M1JC 5AW0B 3AE9C 1NTKK 1XTCC 2Y9YA 3L70G 1VQ4P 3H32B 4GDOA 3Q5RA 3RK2D 2H8PD 1EZVG 3CCLP 3CCQP 2GUVA 1BDCA 3CC2P 1X0TA 4XFJA 2KZIA 2I1KA 3MHVA 1GL2A 2H43A 4ASWA 2K37A 3H1LJ 2JP3A 3M9HA 4D6TG 3IR9A 1BE3J 4U3FJ 1L0LE 4UB8H 1USEA 1X9VA 1YTZI 3OAKA 1A02J 1PP9G 5KLVD 1KB9I 2WVRA 2HYNA 5H2FH 2K9JB 4HKZH 2RKLA 3VTPC 1JY2O 1AQ5A 1S9KE 3H6PA 5E79H 5APYA 2IBZD 2FXMA 1ZOYC 2AEJA 1LP1A 3M9QA 4TT3H 2QG4A 4Z1MH 3A0HH 2M8RA 4UB8E 4EDFA 4I6MC 2E76B 3H1LD 3V2QA 1GL2D 1IC2A 1BE3D 5E79E 1AJYA 2K1AA 1M8OB 2YMKA 3HD7C 2BCCJ 2H89C 1IFNA 4ZNCA 1KFMA 3HTKA 4GOFA 1RF1C 1SQXG 1YTZT 5CCGA 1HGVA 2OYHC 1L0LJ 1T2KC 2M3BA 2IZ1A 3V2RA 3T97B 3M91A 4L73A 1DIPA 1Q86Q 4BWNA 2ZT9C 3AE8C 1NU1D 4O9BA 5K5GB 1H0TB 3Q2YA 2XKMA 1LT9B 2OQQA 1GTWA 4OGQB 3G3ZA 4MN4C 3S9OA 2BCCD 1N7SB 1ZW0A 2Z5IA 2WZ7A 1SFCA 4A7PA 1K05A 2GUSA 3JC22 1JTHB 1NTZK 1HJ0A 2KZJA 4AQRD 1FZCB 1LNQA 3L74E 1S72P 5CCGD 1AVYA 3VMYA 1LWUC 2R32A 3SFEC 4N78E 4H0LD 3CCRP 2LKMA 2E74D 3USSA 3D70A 1J1EC 1RQUA 2QJYC 1AFOA 2QJPB 3H1IG 1QVGO 2B87A 3VMZA 4K3AA 1YI2P 2VRSA 1PGJA 4PD4I 1EDIA 1M1JA 3LIDA 5B66H 2RMZA 3GHGC 2N1TB 1GU5A 3IFMA 2NRGA 3SWFA 3AE7C 3CWBJ 3EWKA 2ZYAA 1N2DC 4IL6E 1SLQA 1S3JA 3KZIE 2W8ZA 5CCHC 5B66E 1IFDA 3WUTA 1EZVE 3L71G 3JCUH 5AVTB 4LLHA 4KT0J 1QVFO 1KD1Q 2I8DA 2KYVA 3A7OA 4PV1D 5AW2B 3KHUA 2JWDA 1KILD 1NOHA 3CD6P 3RK2B 2Y0EA 2P67A 3PHLA 3CWBD 2V4HA 3CPWO 1BSHA 1PP9E 1CSBA 2O01N 3TGUG 2HODB 2ZVOB 4PJ0E 5KAFE 2P1JA 2RN0A 2XV5A 3A2AA 3FGAD 3GG2A 2WSSH 1RE4C 3TNUB 1FZAA 3HD7A 3H1KE 1XTGB 1WMKA 1PL5A 3VMXA 2KP8A 2KS1A 3FXEA 2KSEA 1EDLA 1RF0C 3EQ2A 4RO0A 5KJ7D 1R5SA 1L0ND 2IPPA 2UWJE 5APWA 1GW3A 1FE6A 3CCMP 4U3FG 2J58A 4NPDA 2ZYDA 1KTMA 3OA7A 3TK1A 5APSA 5KKZB 1GL2B 1YJNP 1FBMA 2FXPA 1PP9J 3RL0g 1Y9BA 3HE4A 1UIXA 1PGPA 1JB0J 2R3CA 1Q2NA 3Q1MA 3L70D 3CC7P 2IYPA 1EZVD 1ZRTE 1YITP 1K04A 1FS0E 3R2PA 1PIXA 1KZUB 1S5LE 2E75C 1LP1B 2FYUG 3N7NA 1PPJE 3Q5SA 3NTNA 4D6TD 5AVVB 1SQBE 3PH0A 2LXCB 1PP9D 2B88A 1LGHB 5B5EH 1L0LG 1HWTC 1SQXJ 3PJSK 2GA1A 4TLFA 3U1CA 1OIPA 1GW4A 1W2EA 2E76D 1NU1K 1SQQG 2JKVA 3HTKB 5APXA 2XDJA 3H1HE 1IK7A 1JNMA 1IO4A 1KYOH 2K88A 1EXJA 4C46A 1KB9D 5TISE 1RH5B 4Y99B 3V2PA 3E7KA 1PZQA 2YIUB 2QVAA 3CC4P 1KQGB 1SQXD 4WVZA 3CCSP 3ZDMA 1KYOE 1SQBJ 1NJIQ 2WITA 3BCCE 4PD4E 4R4LA 2QE7H 2KSJA 1SFCB 2P7JA 4W7YA 2Z5HA 3AE5C 2SPZA 1M7LA 1AQTA 5KLIC 4ZKUA 3MZWB 4I7ZB 1ZRTD 4H44B 1DD3A 1ZR2A 4PV1B 2B87B 3L75E 3AE3C 2IX7C 3SFDC 2OYOA 4WY4A 1OVRA 3L36A 1X22A 1VF5B 2IYOA 1VQ5P 1RF0A 1M1JB 1GD2E 4OWFA 2MJZA 2A45I 2D2CC 1KORA 3RL0C 1URQD 1NH4A 1TU3F 3L74G 4H0LC 1UIIA 2NPSA 4RKUJ 2N1TD 3L71J 4R4MA 3H1ID 5AVQB 2KK7A 2WPRA 5DJTB 4Y28J 3AE1C 4JBZA 3KXDA 2XNXA 3G4SP 1EZVI 5BU8B 1N73C 1L4AC 2A45G 1VQ8P 1IFMA 1Q7YQ 1JM0A 1VQPP 2PGDA 1FZBA 3G9RA 3EFFK 3D71A 3BASA 3TGUJ 1SQPG 3P8MC 1ZXGA 3L75J 2FXOA 1SS1A 2FFDC 1R5LA 2ZXEB 1MZ9A 3L71D 1PGQA 3P8CD 2C0WA 5CJ4A 2NPSD 4PD4D 3O6QA 2WPSA 1DD4A 1JY2N 2R5BA 5CJ0A 5CBNA 1L0NK 1MKMA 2FYUE 5APUA 2R3SA 3RGUA 1SQVE 3HD7B 3GLMA 1YBKA 2KS1B 3N4XA 1LTJC 2JR8A 3TGUD 4WWIA 2PP6A 3CCJP 2OTLP 2W83C 2WPQA 1QEXA 2HPCB 3GF7A 1Q90D 2ITAA 1SQQE 3B5NC 1RHZB 2ZAEB 1ZV8A 1CI6A 4IFFA 5APQA 1FC2C 2YXQB 2Q3IA 3EFGA 1M57D 3HE4B 1KQFB 3H1KG 1SP4A 4N3YB 3RK3E 1OW6A 5KJ7C 3SSUA 4YXWH 5H2FE 2W27A 2JO1A 2L91A 4U3FD 3AEBC 1QL2A 3MIWA 2FYUJ 5GTIH 1SQVJ 1X8YA 1HGZA 3M0AA 3V6IA 1P84H 3A0HE 3O8ZA 3FWNA 2J5UA 1J1EB 3PRJA 3H25A 1NO4A 1L2PA 3I5CA 3L35A 2A06G 3AE6C 4JQ0D 1SQQJ 2WWWA 2WMMA 1NTZG 1U57A 1GMJA 1IJDB 1P84E 1CZQA 1FJKA 2FYUD 1NTME 2JDIH 2R5DA 1U7JA 1SQXK 1PPJG 1H8AA 1SQBG 1L0LD 4M3LA 2L5GB 1L4AA 4W80A 4CPGA 1MV8A 3HUSA 2R44A 2W6JH 2WT7A 2PAJA 1SQQD 1S9KD 4EYYQ 5AVRB 4IFMA 1JY3P 3VOPA 1FZFA 1FU1A 2QJKC 1URQB 1KYOI 2FFDA 3H1HG 3CI9A 1W5CE 2M0BA 1H88A 1NTKE 3E1IA 3VN0A 1QX8A 4NPFX 3M0DC 1SQPE 1J1DB 1SFCD 4UB6H 1ZMEC 1NTMJ 2JWAA 1VQMP 1OX3A 4WY4B 4JF7A 1LTJA 1OMIA 2V7QH 2WSFH 3LW5H 1EDKA 4H44D 3BCCG 3Q5PA 2E42A 3L74J 4OGQC 1N7SC 1JUNA 4C7RA 3F89A 5M1BA 4KHXA 1K73Q 4UB6E 2CPBA 3B5NA 4RJTA 2FY8A 1VF5D 2O3JA 1RQVA 1WRGA 2NPSB 4HH2A 1CW5A 1FOSF 1FZCC 3CCUP 5AW9B 3CX5H 3M06A 2OTJP 4L75A 3TDKA 4BRYA 1HVVA 3JCUE 3IF4A 1JOCA 3L75G 4EI2A 1NTKJ 4N6JA 3R4YA 4GT1A 1EDJA 2QJPC 1SQPJ 5APVA 1T8ZA 2PRRA 4H13C 4WB4A 3L74D 4BXLA 3NFQA 3CLQA 2N1TC 1KFNA 3CX5E 2IFMA 1QL1A 1KB9H 1OW8A 4N78D 1RF1A 2O01H 3NMDA 3F5HA 1NWQA 2OYHA 2YKPA 3O6QB 2YXRB 2WSEH 3UIAA 1GK4A 2AEFA 2YO2A 1FAVA 2QRXA 5KLVK 2WTYA 2FYNB 1EC5A 1N7LA 2K9YA 1NGMB 2H88C 2ZVNB 5CMZA 2C9LY 1SQPD 1IFPA 5AVUB 4ZMDA 3G6EP 1G2CA 5CBOA 3ABVC 2A06E 2K3RA 1KQLA 5AW4B 2WQYC 1JMMA 3HD7D 2M3EA 3RK2C 1BGYE 1NTZE 1K9MQ 5TJHA 2BASA 1FZEA 3AEEC 4GOEA 3H1KJ 1LWUA 1CI6B 3NXSA 3KDPB 3SWYA 1RY3A 1SQVG 4DOJA 3CXHH 4EOTA 3CMAP 3FWLA 5AVZB 1VQLP 1OZHA 3A0BH 3C1LA 2H7HA 1FOSE 3GHGA 1AVOA 1KN7A 1KMIZ 1NAFA 3KYQA 2YMYA 3AECC 1RE3C 1HH0A 1N86A 3A3YB 3L72G 3CXHE 2IZ0A 1NYHA 3H1KD 2WSCH 4IL6X 1ZR4A 1OVUA 5CCHA 5B5EE 5KKZC 1GL2C 1NTZJ 1S4XA 1HJBA 2ZYGA 1NAYA 1NKZB 3D6YA 2N9BA 1YIJP 4DJGA 3MTUE 2Q7CA 1L0LK 1JY3O 2DW3A 3IN6A 3RK3B 5AW5B 1P84I 1DEEG 1FZCA 2KLUA 3VP8A 3PTZA 3H1JG 2A06D 2OGUA 1S1CX 4DZOA 2B89A 1AA0A 4JPZB 1E5WA 3VP9A 1HTLC 2W90A 1NTZD 4ZKPA 3HUSB 2WT7B 1FJPA 5CCHD 4K35A 1RE4A 3H1HJ 3HRNA 4I2LC 1MFTA 3I56P 3CCEP 2XU6A 2HR3A 1PV3A 1G1JA 2FKWB 3HE5A 2FFDB 3L73G 1PPJD 4YTPC 1NTMG 1SQBD 1MFZA 1QLED 3BRVB 3V5BA 5CCGC 2Q3EA 1PGOA 1GZLA 4DT0A 2KNCA 2E74C 3B71A 1N8RQ 5AW3B 4Y99C 3BCCJ 3WU2H 1FZGA 3M9BA 2M5AA 2YIUC 3H1HD 2Q5UA 2IBZE 1LTJB 2P10A 3RBZA 1HBWA 1FDMA 3CCVP 5GTHH 5AVWB 4WY4D 1SFCC 1NTKG 2KLVA 2FBWC 1BE3E 1S5LX 1VQ9P 4GIFA 3U1AA 3WU2E 4BRYB 3V2NA 1GU4A 1KYOD 3BCCD 4YPCA 2POHA 3P32A 3II6A 4PV1C 4ASVA 1KILC 1KQSO 2KI7B 3BVHA 1RE3A 3AE2C 1NU1E 1LT1A 1RF1B 3CX5I 1SQPK 2Y0CA 2OYHB 1W2BO 3L75D 2BCCE 2OYIC 2E75D 2PFXA 2P58A 2Q6QA 3D6ZA 2ZT9B 3L72E 3OJAB 2YKQA 3AEFC 5AVXB 3PLNA 1T6AA 1OXZA 3AEGC 2O1JA 4WBAA 1OVVA 4AYCA 1G2CB 1GK6A 3JSVC 2J59M 2Z4EA 4JYCA 2Q9IA 2HG5D 3GW6A 1LWUB 1ZLLA 1ZN5A 2OARA 1NU1J 1VDFA 2QM8A 3H1JE 2QJYB 2QJKB 1G1IA 1LTGC 1BCCG 2KUBA 4C7NA 3G71P 1ZP0C 3GHGB 4JYBA 5GTIE 3P7KA 1OWAA 1S2EA 4LC1A 5KAIH 3L72J 1U7MA 1BGYG 5APTA 3A5TA 3L73E 5AW8B 3W68A 2ZJSE 1SQVD 2W6BA 1VPCA 1KILE 2AXCA 3WUUA 2AEMA 3CXHI 3MD0A 3SWKA 4I1LA 5DJUB 3CWBE 1LJ2A 4OH8B 1KC8Q 2ZXXA 5KAIE 1BDDA 4KJMA 3BATA 1OFCX 1N73A 5BVZA 2E76C 4RESB 1BSNA 3I55P 3L72D 2A45H 3H1JJ 2XNDH 1EQ7A 2D2CD 1YHQP 3RL0D 5EFWB 3RK3D 1SQBK 1GDTA 2P2UA 4QMAA 3KQGA 4H13B 1L0NE 1T3JA 4IL6H 5AW7B 1KILA 2OTKE 3L73J 2B9BA 3KZIH 1DH3A 2JJLA 3C8VA 3V4WA 3HE5B 5AW6B 1L4AD 1LTTC 1LT9C 3B4SA 3H1JD 1LTSC 2KOGA 2OYIA 1Z56A 3LIEA 4AUWA 3L70E 5CHXA 2GM4A 3S4RA 3BRTB 2KNCB 3AEAC 4L76A 2BEZF 1P84D 4PJ0H 2W6AA 5KAFH 2O1KA 3E1RA 2M5AB 1K8AQ 1EXIA 3L73D 1NTMD 1DX7A 5KJ7A 3AEDC 2IBZI 4D6TE 1T3UA 2YKOA 1NKNA 3K5BA 2E5TA 3KPEA 4XA4A 2WPVB 1VQNP 1URQC 1L0NJ 3W67A
chains in the Genus database with same CATH topology
3TGUJ 1SQBJ 1SQXJ 3CXHI 3CWBJ 1KB9I 1SQQJ 1NTZJ 1BGYJ 3L75J 3H1HJ 3L74J 3H1JJ 4D6TJ 5KLVJ 3L72J 1NU1J 3L70J 3H1IJ 1EZVI 3L73J 1KYOI 1NTMJ 4PD4I 2IBZI 1NTKJ 3H1LJ 1L0LJ 1BCCJ 3CX5I 3L71J 1PP9J 1SQPJ 1BE3J 2FYUJ 4U3FJ 3H1KJ 3BCCJ 2BCCJ 1P84I 1L0NJ 1SQVJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TGU J;  1SQB J;  1SQX J;  3CXH I;  3CWB J;  1KB9 I;  1SQQ J;  1NTZ J;  1BGY J;  3L75 J;  3H1H J;  3L74 J;  3H1J J;  4D6T J;  5KLV J;  3L72 J;  1NU1 J;  3L70 J;  3H1I J;  1EZV I;  3L73 J;  1KYO I;  1NTM J;  4PD4 I;  2IBZ I;  1NTK J;  3H1L J;  1L0L J;  1BCC J;  3CX5 I;  3L71 J;  1PP9 J;  1SQP J;  1BE3 J;  2FYU J;  4U3F J;  3H1K J;  3BCC J;  2BCC J;  1P84 I;  1L0N J;  1SQV J; 
#chains in the Genus database with same CATH topology
 1M1K Q;  2E75 B;  3QH9 A;  2IFN A;  4W7Z A;  3H32 A;  5KLV G;  1KV4 A;  4XE5 B;  3RBX A;  1J1D C;  3B8E B;  2LXB A;  2Y9Z A;  3B5N D;  1Y8A A;  2AXT H;  4LGD E;  2IBZ G;  2KIK A;  3L70 J;  3CL3 D;  1YJW P;  4WY4 C;  3AE4 C;  1NTK D;  1M56 D;  4IOI H;  1KB9 E;  3H1L G;  1BCC E;  2HPC A;  1E79 H;  1VQO P;  2KB7 P;  2K9J A;  3WUV A;  1BE3 G;  2V7Q J;  2YO3 A;  2WSF J;  3LW5 J;  2AXT E;  1SQX E;  3MUD C;  2BEQ D;  4D6T J;  2NPS C;  2MKV A;  3GMA A;  3FXD A;  1JMB A;  1S5L H;  3GF3 A;  2E5Y A;  2RH0 A;  1YQ3 C;  3PP5 A;  1J2J B;  1T2K D;  3L37 A;  2JEE A;  3U59 A;  1AV1 A;  1Y47 A;  2NZ2 A;  2IDB A;  2E43 A;  4L74 A;  2ZT9 D;  5BU5 A;  1NU1 G;  1R8E A;  4GOD A;  1IFI A;  2Q1K A;  2FYZ A;  1JY2 P;  1X79 B;  1M90 Q;  1JY3 N;  3TSI A;  1D7M A;  2CK3 H;  2G8Y A;  2BCC G;  2XZR A;  2QEX P;  1YJ9 P;  5KLI B;  2QSI A;  3FX0 A;  3M0D A;  4YXD C;  5AVS B;  2LR2 A;  1FDI A;  2KXP B;  1FDO A;  2O01 J;  4DCK A;  1BCC J;  3T97 A;  2FYU K;  3CX5 D;  2FYN C;  3MGN A;  1SQV K;  2C0X A;  5TIS H;  1PFI A;  3A0B E;  1H0T A;  4C7N B;  2WSE J;  3Q3D A;  1HF9 A;  1BGY J;  3H1I E;  4GKG A;  5C39 A;  1LT9 A;  1A02 F;  5KTB A;  2I1J A;  1N7S A;  1NVO A;  2D2C B;  3RL0 B;  1VQ6 P;  3QWO C;  4HJG H;  4IFD K;  4PD4 H;  5L8R J;  1JTH A;  4H0L B;  1OW7 A;  2QIW A;  2E74 B;  2HFE D;  1SQQ K;  1VQ7 P;  1H89 A;  1BCC D;  2N9Y B;  1JCD A;  2G3A A;  2YNY A;  3VYI A;  1IZN B;  1N73 B;  1LTB C;  1JCC A;  1L4A B;  1WT6 A;  1BGY D;  3L71 E;  3P8C E;  1URQ A;  5AVY B;  2N1T A;  3ITK A;  2QA4 P;  3V4Q A;  2HLO A;  3OW2 O;  3S1K A;  4OGQ D;  1N7S D;  3C9I A;  3TYY A;  3H1I J;  4U7J A;  4OVN F;  3TGU E;  3L4F A;  1IK9 A;  4HB1 A;  3CWB G;  1YQ4 C;  2C9N Y;  1USD A;  1MUU A;  5KLV E;  1KIL B;  1DEB A;  1JEK A;  2WSC J;  4B86 A;  1LTI C;  1VL2 A;  1LTA C;  1IFJ A;  1YYC A;  4H13 D;  3CXH D;  1SVF A;  1NHL A;  3RK3 C;  3MUD A;  3TF5 A;  1NTM K;  2QM7 A;  1HUC A;  2Y0D A;  4EIJ A;  2OYI B;  2CPS A;  3H1L E;  3B5N B;  1Q81 Q;  2ZFC A;  2HOD A;  4U3F E;  1L0N G;  1QGK B;  3IAO A;  3VMA A;  3HUS C;  4I7Z C;  1VQK P;  4H44 C;  3TNU A;  3MP7 B;  3CME P;  4NPE A;  5AW1 B;  5GTH E;  1Q82 Q;  5KLV J;  4HYT B;  1VF5 C;  3WMM 0;  1JO5 A;  1M1J C;  5AW0 B;  3AE9 C;  1NTK K;  1XTC C;  2Y9Y A;  3L70 G;  1VQ4 P;  3H32 B;  4GDO A;  3Q5R A;  3RK2 D;  2H8P D;  1EZV G;  3CCL P;  3CCQ P;  2GUV A;  1BDC A;  3CC2 P;  1X0T A;  4XFJ A;  2KZI A;  2I1K A;  3MHV A;  1GL2 A;  2H43 A;  4ASW A;  2K37 A;  3H1L J;  2JP3 A;  3M9H A;  4D6T G;  3IR9 A;  1BE3 J;  4U3F J;  1L0L E;  4UB8 H;  1USE A;  1X9V A;  1YTZ I;  3OAK A;  1A02 J;  1PP9 G;  5KLV D;  1KB9 I;  2WVR A;  2HYN A;  5H2F H;  2K9J B;  4HKZ H;  2RKL A;  3VTP C;  1JY2 O;  1AQ5 A;  1S9K E;  3H6P A;  5E79 H;  5APY A;  2IBZ D;  2FXM A;  1ZOY C;  2AEJ A;  1LP1 A;  3M9Q A;  4TT3 H;  2QG4 A;  4Z1M H;  3A0H H;  2M8R A;  4UB8 E;  4EDF A;  4I6M C;  2E76 B;  3H1L D;  3V2Q A;  1GL2 D;  1IC2 A;  1BE3 D;  5E79 E;  1AJY A;  2K1A A;  1M8O B;  2YMK A;  3HD7 C;  2BCC J;  2H89 C;  1IFN A;  4ZNC A;  1KFM A;  3HTK A;  4GOF A;  1RF1 C;  1SQX G;  1YTZ T;  5CCG A;  1HGV A;  2OYH C;  1L0L J;  1T2K C;  2M3B A;  2IZ1 A;  3V2R A;  3T97 B;  3M91 A;  4L73 A;  1DIP A;  1Q86 Q;  4BWN A;  2ZT9 C;  3AE8 C;  1NU1 D;  4O9B A;  5K5G B;  1H0T B;  3Q2Y A;  2XKM A;  1LT9 B;  2OQQ A;  1GTW A;  4OGQ B;  3G3Z A;  4MN4 C;  3S9O A;  2BCC D;  1N7S B;  1ZW0 A;  2Z5I A;  2WZ7 A;  1SFC A;  4A7P A;  1K05 A;  2GUS A;  3JC2 2;  1JTH B;  1NTZ K;  1HJ0 A;  2KZJ A;  4AQR D;  1FZC B;  1LNQ A;  3L74 E;  1S72 P;  5CCG D;  1AVY A;  3VMY A;  1LWU C;  2R32 A;  3SFE C;  4N78 E;  4H0L D;  3CCR P;  2LKM A;  2E74 D;  3USS A;  3D70 A;  1J1E C;  1RQU A;  2QJY C;  1AFO A;  2QJP B;  3H1I G;  1QVG O;  2B87 A;  3VMZ A;  4K3A A;  1YI2 P;  2VRS A;  1PGJ A;  4PD4 I;  1EDI A;  1M1J A;  3LID A;  5B66 H;  2RMZ A;  3GHG C;  2N1T B;  1GU5 A;  3IFM A;  2NRG A;  3SWF A;  3AE7 C;  3CWB J;  3EWK A;  2ZYA A;  1N2D C;  4IL6 E;  1SLQ A;  1S3J A;  3KZI E;  2W8Z A;  5CCH C;  5B66 E;  1IFD A;  3WUT A;  1EZV E;  3L71 G;  3JCU H;  5AVT B;  4LLH A;  4KT0 J;  1QVF O;  1KD1 Q;  2I8D A;  2KYV A;  3A7O A;  4PV1 D;  5AW2 B;  3KHU A;  2JWD A;  1KIL D;  1NOH A;  3CD6 P;  3RK2 B;  2Y0E A;  2P67 A;  3PHL A;  3CWB D;  2V4H A;  3CPW O;  1BSH A;  1PP9 E;  1CSB A;  2O01 N;  3TGU G;  2HOD B;  2ZVO B;  4PJ0 E;  5KAF E;  2P1J A;  2RN0 A;  2XV5 A;  3A2A A;  3FGA D;  3GG2 A;  2WSS H;  1RE4 C;  3TNU B;  1FZA A;  3HD7 A;  3H1K E;  1XTG B;  1WMK A;  1PL5 A;  3VMX A;  2KP8 A;  2KS1 A;  3FXE A;  2KSE A;  1EDL A;  1RF0 C;  3EQ2 A;  4RO0 A;  5KJ7 D;  1R5S A;  1L0N D;  2IPP A;  2UWJ E;  5APW A;  1GW3 A;  1FE6 A;  3CCM P;  4U3F G;  2J58 A;  4NPD A;  2ZYD A;  1KTM A;  3OA7 A;  3TK1 A;  5APS A;  5KKZ B;  1GL2 B;  1YJN P;  1FBM A;  2FXP A;  1PP9 J;  3RL0 g;  1Y9B A;  3HE4 A;  1UIX A;  1PGP A;  1JB0 J;  2R3C A;  1Q2N A;  3Q1M A;  3L70 D;  3CC7 P;  2IYP A;  1EZV D;  1ZRT E;  1YIT P;  1K04 A;  1FS0 E;  3R2P A;  1PIX A;  1KZU B;  1S5L E;  2E75 C;  1LP1 B;  2FYU G;  3N7N A;  1PPJ E;  3Q5S A;  3NTN A;  4D6T D;  5AVV B;  1SQB E;  3PH0 A;  2LXC B;  1PP9 D;  2B88 A;  1LGH B;  5B5E H;  1L0L G;  1HWT C;  1SQX J;  3PJS K;  2GA1 A;  4TLF A;  3U1C A;  1OIP A;  1GW4 A;  1W2E A;  2E76 D;  1NU1 K;  1SQQ G;  2JKV A;  3HTK B;  5APX A;  2XDJ A;  3H1H E;  1IK7 A;  1JNM A;  1IO4 A;  1KYO H;  2K88 A;  1EXJ A;  4C46 A;  1KB9 D;  5TIS E;  1RH5 B;  4Y99 B;  3V2P A;  3E7K A;  1PZQ A;  2YIU B;  2QVA A;  3CC4 P;  1KQG B;  1SQX D;  4WVZ A;  3CCS P;  3ZDM A;  1KYO E;  1SQB J;  1NJI Q;  2WIT A;  3BCC E;  4PD4 E;  4R4L A;  2QE7 H;  2KSJ A;  1SFC B;  2P7J A;  4W7Y A;  2Z5H A;  3AE5 C;  2SPZ A;  1M7L A;  1AQT A;  5KLI C;  4ZKU A;  3MZW B;  4I7Z B;  1ZRT D;  4H44 B;  1DD3 A;  1ZR2 A;  4PV1 B;  2B87 B;  3L75 E;  3AE3 C;  2IX7 C;  3SFD C;  2OYO A;  4WY4 A;  1OVR A;  3L36 A;  1X22 A;  1VF5 B;  2IYO A;  1VQ5 P;  1RF0 A;  1M1J B;  1GD2 E;  4OWF A;  2MJZ A;  2A45 I;  2D2C C;  1KOR A;  3RL0 C;  1URQ D;  1NH4 A;  1TU3 F;  3L74 G;  4H0L C;  1UII A;  2NPS A;  4RKU J;  2N1T D;  3L71 J;  4R4M A;  3H1I D;  5AVQ B;  2KK7 A;  2WPR A;  5DJT B;  4Y28 J;  3AE1 C;  4JBZ A;  3KXD A;  2XNX A;  3G4S P;  1EZV I;  5BU8 B;  1N73 C;  1L4A C;  2A45 G;  1VQ8 P;  1IFM A;  1Q7Y Q;  1JM0 A;  1VQP P;  2PGD A;  1FZB A;  3G9R A;  3EFF K;  3D71 A;  3BAS A;  3TGU J;  1SQP G;  3P8M C;  1ZXG A;  3L75 J;  2FXO A;  1SS1 A;  2FFD C;  1R5L A;  2ZXE B;  1MZ9 A;  3L71 D;  1PGQ A;  3P8C D;  2C0W A;  5CJ4 A;  2NPS D;  4PD4 D;  3O6Q A;  2WPS A;  1DD4 A;  1JY2 N;  2R5B A;  5CJ0 A;  5CBN A;  1L0N K;  1MKM A;  2FYU E;  5APU A;  2R3S A;  3RGU A;  1SQV E;  3HD7 B;  3GLM A;  1YBK A;  2KS1 B;  3N4X A;  1LTJ C;  2JR8 A;  3TGU D;  4WWI A;  2PP6 A;  3CCJ P;  2OTL P;  2W83 C;  2WPQ A;  1QEX A;  2HPC B;  3GF7 A;  1Q90 D;  2ITA A;  1SQQ E;  3B5N C;  1RHZ B;  2ZAE B;  1ZV8 A;  1CI6 A;  4IFF A;  5APQ A;  1FC2 C;  2YXQ B;  2Q3I A;  3EFG A;  1M57 D;  3HE4 B;  1KQF B;  3H1K G;  1SP4 A;  4N3Y B;  3RK3 E;  1OW6 A;  5KJ7 C;  3SSU A;  4YXW H;  5H2F E;  2W27 A;  2JO1 A;  2L91 A;  4U3F D;  3AEB C;  1QL2 A;  3MIW A;  2FYU J;  5GTI H;  1SQV J;  1X8Y A;  1HGZ A;  3M0A A;  3V6I A;  1P84 H;  3A0H E;  3O8Z A;  3FWN A;  2J5U A;  1J1E B;  3PRJ A;  3H25 A;  1NO4 A;  1L2P A;  3I5C A;  3L35 A;  2A06 G;  3AE6 C;  4JQ0 D;  1SQQ J;  2WWW A;  2WMM A;  1NTZ G;  1U57 A;  1GMJ A;  1IJD B;  1P84 E;  1CZQ A;  1FJK A;  2FYU D;  1NTM E;  2JDI H;  2R5D A;  1U7J A;  1SQX K;  1PPJ G;  1H8A A;  1SQB G;  1L0L D;  4M3L A;  2L5G B;  1L4A A;  4W80 A;  4CPG A;  1MV8 A;  3HUS A;  2R44 A;  2W6J H;  2WT7 A;  2PAJ A;  1SQQ D;  1S9K D;  4EYY Q;  5AVR B;  4IFM A;  1JY3 P;  3VOP A;  1FZF A;  1FU1 A;  2QJK C;  1URQ B;  1KYO I;  2FFD A;  3H1H G;  3CI9 A;  1W5C E;  2M0B A;  1H88 A;  1NTK E;  3E1I A;  3VN0 A;  1QX8 A;  4NPF X;  3M0D C;  1SQP E;  1J1D B;  1SFC D;  4UB6 H;  1ZME C;  1NTM J;  2JWA A;  1VQM P;  1OX3 A;  4WY4 B;  4JF7 A;  1LTJ A;  1OMI A;  2V7Q H;  2WSF H;  3LW5 H;  1EDK A;  4H44 D;  3BCC G;  3Q5P A;  2E42 A;  3L74 J;  4OGQ C;  1N7S C;  1JUN A;  4C7R A;  3F89 A;  5M1B A;  4KHX A;  1K73 Q;  4UB6 E;  2CPB A;  3B5N A;  4RJT A;  2FY8 A;  1VF5 D;  2O3J A;  1RQV A;  1WRG A;  2NPS B;  4HH2 A;  1CW5 A;  1FOS F;  1FZC C;  3CCU P;  5AW9 B;  3CX5 H;  3M06 A;  2OTJ P;  4L75 A;  3TDK A;  4BRY A;  1HVV A;  3JCU E;  3IF4 A;  1JOC A;  3L75 G;  4EI2 A;  1NTK J;  4N6J A;  3R4Y A;  4GT1 A;  1EDJ A;  2QJP C;  1SQP J;  5APV A;  1T8Z A;  2PRR A;  4H13 C;  4WB4 A;  3L74 D;  4BXL A;  3NFQ A;  3CLQ A;  2N1T C;  1KFN A;  3CX5 E;  2IFM A;  1QL1 A;  1KB9 H;  1OW8 A;  4N78 D;  1RF1 A;  2O01 H;  3NMD A;  3F5H A;  1NWQ A;  2OYH A;  2YKP A;  3O6Q B;  2YXR B;  2WSE H;  3UIA A;  1GK4 A;  2AEF A;  2YO2 A;  1FAV A;  2QRX A;  5KLV K;  2WTY A;  2FYN B;  1EC5 A;  1N7L A;  2K9Y A;  1NGM B;  2H88 C;  2ZVN B;  5CMZ A;  2C9L Y;  1SQP D;  1IFP A;  5AVU B;  4ZMD A;  3G6E P;  1G2C A;  5CBO A;  3ABV C;  2A06 E;  2K3R A;  1KQL A;  5AW4 B;  2WQY C;  1JMM A;  3HD7 D;  2M3E A;  3RK2 C;  1BGY E;  1NTZ E;  1K9M Q;  5TJH A;  2BAS A;  1FZE A;  3AEE C;  4GOE A;  3H1K J;  1LWU A;  1CI6 B;  3NXS A;  3KDP B;  3SWY A;  1RY3 A;  1SQV G;  4DOJ A;  3CXH H;  4EOT A;  3CMA P;  3FWL A;  5AVZ B;  1VQL P;  1OZH A;  3A0B H;  3C1L A;  2H7H A;  1FOS E;  3GHG A;  1AVO A;  1KN7 A;  1KMI Z;  1NAF A;  3KYQ A;  2YMY A;  3AEC C;  1RE3 C;  1HH0 A;  1N86 A;  3A3Y B;  3L72 G;  3CXH E;  2IZ0 A;  1NYH A;  3H1K D;  2WSC H;  4IL6 X;  1ZR4 A;  1OVU A;  5CCH A;  5B5E E;  5KKZ C;  1GL2 C;  1NTZ J;  1S4X A;  1HJB A;  2ZYG A;  1NAY A;  1NKZ B;  3D6Y A;  2N9B A;  1YIJ P;  4DJG A;  3MTU E;  2Q7C A;  1L0L K;  1JY3 O;  2DW3 A;  3IN6 A;  3RK3 B;  5AW5 B;  1P84 I;  1DEE G;  1FZC A;  2KLU A;  3VP8 A;  3PTZ A;  3H1J G;  2A06 D;  2OGU A;  1S1C X;  4DZO A;  2B89 A;  1AA0 A;  4JPZ B;  1E5W A;  3VP9 A;  1HTL C;  2W90 A;  1NTZ D;  4ZKP A;  3HUS B;  2WT7 B;  1FJP A;  5CCH D;  4K35 A;  1RE4 A;  3H1H J;  3HRN A;  4I2L C;  1MFT A;  3I56 P;  3CCE P;  2XU6 A;  2HR3 A;  1PV3 A;  1G1J A;  2FKW B;  3HE5 A;  2FFD B;  3L73 G;  1PPJ D;  4YTP C;  1NTM G;  1SQB D;  1MFZ A;  1QLE D;  3BRV B;  3V5B A;  5CCG C;  2Q3E A;  1PGO A;  1GZL A;  4DT0 A;  2KNC A;  2E74 C;  3B71 A;  1N8R Q;  5AW3 B;  4Y99 C;  3BCC J;  3WU2 H;  1FZG A;  3M9B A;  2M5A A;  2YIU C;  3H1H D;  2Q5U A;  2IBZ E;  1LTJ B;  2P10 A;  3RBZ A;  1HBW A;  1FDM A;  3CCV P;  5GTH H;  5AVW B;  4WY4 D;  1SFC C;  1NTK G;  2KLV A;  2FBW C;  1BE3 E;  1S5L X;  1VQ9 P;  4GIF A;  3U1A A;  3WU2 E;  4BRY B;  3V2N A;  1GU4 A;  1KYO D;  3BCC D;  4YPC A;  2POH A;  3P32 A;  3II6 A;  4PV1 C;  4ASV A;  1KIL C;  1KQS O;  2KI7 B;  3BVH A;  1RE3 A;  3AE2 C;  1NU1 E;  1LT1 A;  1RF1 B;  3CX5 I;  1SQP K;  2Y0C A;  2OYH B;  1W2B O;  3L75 D;  2BCC E;  2OYI C;  2E75 D;  2PFX A;  2P58 A;  2Q6Q A;  3D6Z A;  2ZT9 B;  3L72 E;  3OJA B;  2YKQ A;  3AEF C;  5AVX B;  3PLN A;  1T6A A;  1OXZ A;  3AEG C;  2O1J A;  4WBA A;  1OVV A;  4AYC A;  1G2C B;  1GK6 A;  3JSV C;  2J59 M;  2Z4E A;  4JYC A;  2Q9I A;  2HG5 D;  3GW6 A;  1LWU B;  1ZLL A;  1ZN5 A;  2OAR A;  1NU1 J;  1VDF A;  2QM8 A;  3H1J E;  2QJY B;  2QJK B;  1G1I A;  1LTG C;  1BCC G;  2KUB A;  4C7N A;  3G71 P;  1ZP0 C;  3GHG B;  4JYB A;  5GTI E;  3P7K A;  1OWA A;  1S2E A;  4LC1 A;  5KAI H;  3L72 J;  1U7M A;  1BGY G;  5APT A;  3A5T A;  3L73 E;  5AW8 B;  3W68 A;  2ZJS E;  1SQV D;  2W6B A;  1VPC A;  1KIL E;  2AXC A;  3WUU A;  2AEM A;  3CXH I;  3MD0 A;  3SWK A;  4I1L A;  5DJU B;  3CWB E;  1LJ2 A;  4OH8 B;  1KC8 Q;  2ZXX A;  5KAI E;  1BDD A;  4KJM A;  3BAT A;  1OFC X;  1N73 A;  5BVZ A;  2E76 C;  4RES B;  1BSN A;  3I55 P;  3L72 D;  2A45 H;  3H1J J;  2XND H;  1EQ7 A;  2D2C D;  1YHQ P;  3RL0 D;  5EFW B;  3RK3 D;  1SQB K;  1GDT A;  2P2U A;  4QMA A;  3KQG A;  4H13 B;  1L0N E;  1T3J A;  4IL6 H;  5AW7 B;  1KIL A;  2OTK E;  3L73 J;  2B9B A;  3KZI H;  1DH3 A;  2JJL A;  3C8V A;  3V4W A;  3HE5 B;  5AW6 B;  1L4A D;  1LTT C;  1LT9 C;  3B4S A;  3H1J D;  1LTS C;  2KOG A;  2OYI A;  1Z56 A;  3LIE A;  4AUW A;  3L70 E;  5CHX A;  2GM4 A;  3S4R A;  3BRT B;  2KNC B;  3AEA C;  4L76 A;  2BEZ F;  1P84 D;  4PJ0 H;  2W6A A;  5KAF H;  2O1K A;  3E1R A;  2M5A B;  1K8A Q;  1EXI A;  3L73 D;  1NTM D;  1DX7 A;  5KJ7 A;  3AED C;  2IBZ I;  4D6T E;  1T3U A;  2YKO A;  1NKN A;  3K5B A;  2E5T A;  3KPE A;  4XA4 A;  2WPV B;  1VQN P;  1URQ C;  1L0N J;  3W67 A; 
#chains in the Genus database with same CATH homology
 3TGU J;  1SQB J;  1SQX J;  3CXH I;  3CWB J;  1KB9 I;  1SQQ J;  1NTZ J;  1BGY J;  3L75 J;  3H1H J;  3L74 J;  3H1J J;  4D6T J;  5KLV J;  3L72 J;  1NU1 J;  3L70 J;  3H1I J;  1EZV I;  3L73 J;  1KYO I;  1NTM J;  4PD4 I;  2IBZ I;  1NTK J;  3H1L J;  1L0L J;  1BCC J;  3CX5 I;  3L71 J;  1PP9 J;  1SQP J;  1BE3 J;  2FYU J;  4U3F J;  3H1K J;  3BCC J;  2BCC J;  1P84 I;  1L0N J;  1SQV J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...