2KOGA

Lipid-bound synaptobrevin solution nmr structure
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Vesicle-associated membrane protein 2
publication title Dynamic structure of lipid-bound synaptobrevin suggests a nucleation-propagation mechanism for trans-SNARE complex formation.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 23
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00957 Synaptobrevin Synaptobrevin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2kogA00
3RL0C 3HD7C 2N1TB 5KJ7A 1KILA 1L4AD 2NPSB 4WY4C 5CCHD 1GL2C 1URQD 3B5NA 2N1TC 2PP6A 5KJ7D 1KILD 1SFCC 5CCGC 4WY4B 1GL2B 3RK3B 4OH8B 3HD7A 3B5ND 1JTHB 3RK2D 2H8PD 1L4AC 5CCHC 1N7SB 1SFCB 1URQC 3RK3C 2N1TA 2KOGA 3KYQA 3RL0D 3HD7D 5KJ7C 2M8RA 2NPSA 1L4AB 3RK2B 1N7SC 4W7ZA 1URQB 1T3JA 4W7YA 2N1TD 3RK2C 1NHLA 3TSIA 1KILB 4WY4A 1GL2A 3P8CE 2NPSD 5CCHA 4JF7A 4N78E 2HFED 4W80A 3B5NB 1JTHA 1XTGB 2HG5D 4LGDE 1KILC 2XDJA 1N7SA 1SFCA 5CCGA 2WZ7A 3PP5A 4WY4D 1GL2D 3B5NC 3RK3D 3HTKB 3RL0B 1HVVA 3HD7B 1L4AA 3VOPA 1URQA 2YMYA 2NPSC 3M0DC 1N7SD 1SFCD 5CCGD
chains in the Genus database with same CATH superfamily
5KAFE 1RQVA 1S2EA 1DD4A 4H0LD 1FU1A 1T8ZA 2IBZG 1SQPD 1R5SA 1M56D 4PD4H 2N9BA 4RKUJ 1L0LD 1X8YA 1HH0A 3MP7B 5E79E 4UB6E 3P32A 2ZYGA 1T6AA 2YNYA 4OH8B 1NTMJ 5AVZB 1ZR4A 3EWKA 1NWQA 3R4YA 3IF4A 3VMYA 3V2PA 1QVFO 1L4AC 5CCHC 1URQC 2IZ0A 3H1HG 3GLMA 1BGYD 1KYOH 1Q86Q 2Q6QA 1JCDA 4Y99B 1M1JC 3L72G 1SQPJ 2NPSA 1GK6A 1BDDA 5BU5A 2FYUK 1GW4A 4H44C 1J1EC 3H1ID 1VQ7P 2FXMA 1Q7YQ 2YXRB 1ZMEC 2WPSA 2B89A 3L74D 1GW3A 1KN7A 2Z4EA 4I1LA 2QSIA 1SQQK 2JWDA 4M3LA 1NU1D 3WUTA 1BE3D 1NTMG 1M57D 1S5LX 4OGQC 1U7JA 3RL0g 2E42A 1ZN5A 1OVRA 3AEDC 3SWFA 1K05A 1A02F 2HPCA 3AEAC 1KB9E 3H1KE 3H1IJ 3O8ZA 3GF7A 2QM8A 3LW5J 3PJSK 1SQPG 4U3FE 2A45I 3VMXA 4PJ0H 1H0TA 3AECC 1LTJA 3A0HH 2QG4A 2JWAA 3HUSA 1YTZI 1NU1J 4IFMA 1BE3J 1FAVA 3OJAB 2JDIH 1FBMA 2HR3A 3W67A 3VTPC 3M0AA 1JTHB 3RK2D 3N4XA 4C7NA 2PGDA 4PD4D 3VP9A 2FYUD 3CCEP 2QE7H 4BRYB 3KXDA 2QVAA 3NXSA 3RL0D 2E75C 2WT7B 1SQVG 2OGUA 3AE4C 1SLQA 2OYHB 1NKNA 1G2CA 1SQQD 2DW3A 4H13B 1P84H 1GD2E 2KIKA 2E5TA 1KYOD 1NU1G 4I2LC 4W80A 1NTKD 1BE3G 3B5NB 1U57A 1FJKA 3SSUA 5AW8B 4ZMDA 1RF0A 3L70D 2OYOA 1AA0A 1SQBK 2E76B 2M3BA 3FX0A 1HBWA 4B86A 3G71P 5CBOA 1PGOA 3L73D 3EFFK 5AVUB 3G9RA 4R4MA 3CPWO 3CX5H 1JM0A 3AE7C 1G1IA 1ZOYC 1NTKJ 2RMZA 1AJYA 5KKZB 1N8RQ 1EDIA 3BCCJ 2RKLA 1IK9A 3HTKA 3RK3B 3L73J 1UIXA 3NFQA 1M1KQ 1EXIA 2ZAEB 4I7ZB 1VF5B 3JCUE 1W5CE 2H7HA 3CD6P 1VQ4P 1VL2A 2HLOA 4ASWA 4R4LA 2BCCD 4RO0A 1ZXGA 2QJKC 4IFFA 1NTKG 2ZVNB 1HTLC 5KAIH 1LWUB 2E74B 2HFED 2ITAA 1SQBD 2GA1A 3BCCG 5APTA 2KB7P 3U1AA 5TISE 3A7OA 4TLFA 2C0XA 1ZV8A 2LXCB 2KLUA 4BXLA 2W6BA 1P84D 1X9VA 2NPSC 2POHA 5KLIB 2BCCJ 3WUUA 1FS0E 1S5LE 2J58A 1PGJA 3OW2O 2YIUB 3FXDA 2OTKE 4GODA 1TU3F 1SQBJ 2Z5HA 2YXQB 3USSA 3H1LD 3Q5SA 1FC2C 4AYCA 3CWBE 2FYNB 1EZVD 1FDMA 2D2CC 2IYPA 4H13D 3B5ND 3CC2P 2WSCJ 3L75E 1NOHA 4GOFA 3CMAP 1WT6A 2WSEH 2A06E 1KQLA 2E76D 1SQXK 2BCCG 2IYOA 5AVVB 2AXTH 3D71A 1KYOI 3TSIA 3O6QB 2O3JA 2V4HA 1JTHA 1YITP 1RHZB 4IL6X 3Q3DA 4BRYA 1NTZJ 3RK3D 4YPCA 2WT7A 4A7PA 1IFJA 2FBWC 2OYHA 1L2PA 1VF5D 3JSVC 5CJ4A 2FFDC 3HD7C 2I1KA 4L73A 1IFMA 3S4RA 5DJTB 3L71J 2JEEA 4EIJA 2R5DA 1A02J 3B5NA 4Y28J 1PPJG 2N1TC 2WSSH 2LXBA 4LC1A 1PFIA 2WWWA 1EXJA 3KHUA 5APUA 2JO1A 2R32A 2E74D 3TNUB 5AVWB 1NTMK 1SQXD 1H89A 5KLVD 1NTZG 3CXHH 1SFCB 1OWAA 2IBZD 1BCCJ 1OVVA 1PGPA 3IN6A 1N7LA 2ZFCA 4BWNA 1WRGA 3GF3A 2KYVA 4W7ZA 3P8MC 3GHGC 4W7YA 2WPQA 3L71G 2Y9ZA 1U7MA 3RK2C 3LW5H 1AVYA 3AE1C 2P58A 5KLVJ 3E7KA 3H1HD 1KILC 3A5TA 2AXTE 4D6TE 1EQ7A 1JCCA 4PV1C 1P84I 3L72D 4DCKA 3KDPB 1PIXA 1OX3A 5APXA 1KV4A 2K9JB 2XNXA 1N73C 3CCJP 1QL2A 3V2RA 2M0BA 1BCCG 5CCGD 1SQVK 2MJZA 3LIEA 4XFJA 1JUNA 1IO4A 2ZXEB 3L37A 1K8AQ 1PL5A 2IFNA 1NJIQ 2H43A 3MD0A 2QJYB 4N6JA 1RQUA 2PP6A 1NTMD 1QGKB 3CX5I 3H1JJ 5KJ7D 3TGUD 3L72J 2V7QJ 2H88C 1L0ND 3F89A 2Q7CA 3RGUA 5B66E 2C9LY 3CCRP 5KLVG 1KC8Q 3I55P 1E79H 2YKPA 2QRXA 2WQYC 2H8PD 1YJWP 1VQNP 1AQ5A 3HRNA 4AUWA 1L0LE 2O01H 1QX8A 1IFNA 2M8RA 1Q2NA 2ZJSE 2JR8A 1HUCA 5B5EE 4K3AA 3TGUJ 3QH9A 2OTJP 5APSA 1L0NJ 1S9KD 3CXHD 3AE5C 3CCQP 1BGYE 3ITKA 3M06A 3Q5PA 5AVSB 3H1JG 1PZQA 1IFDA 1JY2O 1LTBC 5CCGA 2Y0DA 2KP8A 1YJNP 3H1IE 2GUVA 3I56P 1WMKA 1SQVD 5M1BA 2XNDH 5BVZA 3L74E 3WU2H 1MV8A 2YMYA 4IL6E 1SFCD 1NHLA 2LKMA 3C1LA 3L36A 5KJ7A 1OZHA 4JYBA 1PP9E 1NU1E 4GIFA 3O6QA 3Q1MA 2WMMA 2AEMA 1NTKK 3TGUG 3S1KA 1L0NG 3WMM0 2ZYAA 3B71A 2FXPA 4K35A 1SQVJ 1DEEG 3H32B 1IC2A 4C46A 2W6JH 3SWYA 2P10A 1M1JB 1SS1A 4N3YB 1T2KD 1RF1C 3M9BA 4N78D 1ZRTE 1J1EB 3KYQA 4HB1A 2P67A 2OQQA 1T3JA 1X22A 3VMZA 3A2AA 2AEFA 4PD4E 1AVOA 2FYUE 4OVNF 3TNUA 1JY2N 1CI6B 2WVRA 2ZT9C 5APVA 3KQGA 1MFTA 1J1DC 1XTGB 1IFIA 1KILE 5CBNA 1IJDB 2XDJA 4IOIH 2NRGA 1SFCA 3AEGC 5DJUB 1SQQE 4HYTB 1BSHA 5AVTB 2WSCH 3CCVP 1RE4A 1KYOE 5KKZC 3FGAD 2OYIC 4WB4A 3SFDC 2RN0A 1HGVA 3L70E 1EDJA 1VQPP 2O01J 2ZXXA 3BCCD 3M91A 2NZ2A 3L73E 3WU2E 2XU6A 3HE4B 3FWNA 1NH4A 2K9JA 3MUDC 3TF5A 3G4SP 3ABVC 4WBAA 3AE8C 1JY3O 1LTGC 2FYZA 2LR2A 4U3FG 5H2FH 2I8DA 1N7SC 1LWUC 2E74C 5AVXB 2Q1KA 1MFZA 4PJ0E 2L5GB 1LT9C 2MKVA 2PRRA 1YYCA 3A0HE 2JKVA 4O9BA 1K73Q 1LP1B 1PGQA 2HG5D 3V5BA 4TT3H 5APYA 1KTMA 2BCCE 1NTZK 1H8AA 3AEEC 2R44A 1GU4A 1SQBE 3JC22 4JBZA 3RBXA 3CCSP 1OXZA 5BU8B 3E1IA 5AW1B 2QJPC 1XTCC 1P84E 3H25A 4U7JA 1RE3A 5CCGC 1GL2B 3N7NA 3V4WA 1VQLP 4JQ0D 3KZIH 2WPRA 3P8CD 3NMDA 3H1LE 3T97B 5KJ7C 2QJKB 1EZVE 1PPJD 4NPFX 2BEZF 3CX5E 4PD4I 3W68A 1OW8A 3HE5B 1LTSC 3GW6A 5CJ0A 4H0LC 3GMAA 1BSNA 3H32A 5CCHA 4JF7A 1NAFA 1JB0J 1NTZD 5AW4B 1LJ2A 1SVFA 2FY8A 5AW7B 5KLVK 2WSFJ 1M1JA 4LGDE 1RY3A 1N86A 2XKMA 1LTJC 3L75D 2E5YA 2WTYA 2V7QH 1DX7A 3HUSC 2WPVB 2N9YB 2CPBA 3L71D 3MIWA 4MN4C 4DZOA 1HJBA 1DEBA 1T3UA 4WWIA 1Z56A 1YI2P 1CI6A 1E5WA 3BASA 5KAIE 3L75J 2VRSA 3A0BH 3AE6C 2W90A 4L76A 5GTHH 1SFCC 4WY4B 3II6A 2Q9IA 1M8OB 1BCCD 2M5AB 1GMJA 1AV1A 2B87B 3RBZA 4DOJA 3M0DA 1RF0C 1KQSO 1MUUA 5L8RJ 3CMEP 1KZUB 1K9MQ 1SQXE 3HE4A 1NYHA 3K5BA 1VQ5P 3D6YA 1L0NK 1VQ6P 2ZYDA 1VQMP 1T2KC 1RH5B 4UB6H 2IBZE 3L75G 3C9IA 3NTNA 1OW7A 1GK4A 2KLVA 1FJPA 2A06G 1GL2D 1OMIA 3V4QA 3U1CA 1NGMB 1VQ9P 2W6AA 1QVGO 2FFDB 3HD7B 2W27A 2P1JA 1MKMA 4WVZA 1DH3A 2KSJA 3S9OA 3RL0C 2JP3A 3H1HE 2N1TB 4ZKPA 2FKWB 3H1JD 1FZBA 3L72E 3CCLP 1R8EA 1LP1A 1OFCX 2QM7A 3CC4P 2Z5IA 1GU5A 3MZWB 3OA7A 2FXOA 2CPSA 1KORA 1S4XA 4RJTA 1M90Q 1D7MA 1EZVI 2K1AA 3CL3D 1KB9H 3GHGB 1NTME 3MHVA 1FOSE 3A0BE 3TGUE 4NPDA 3KPEA 3RK2B 5GTHE 3CC7P 1Q82Q 2KSEA 4KT0J 4GT1A 1USEA 4JYCA 1HJ0A 5C39A 4Y99C 5AVRB 3GG2A 1FZCB 2CK3H 1SQPE 1KILB 1GL2A 4D6TJ 3UIAA 3M9QA 1Y8AA 3IFMA 4PV1B 1LGHB 5AVQB 3PH0A 1DD3A 2W8ZA 2XZRA 1N73B 1JY2P 3EQ2A 2YMKA 1IFPA 2QA4P 3PP5A 4WY4D 2A45G 3L4FA 3T97A 1HVVA 2GUSA 4IFDK 1S9KE 3CXHE 1AQTA 3CI9A 2R5BA 3HE5A 2B88A 5APWA 1Y47A 2KS1B 2R3CA 2BASA 1YQ4C 4KJMA 4OWFA 1SQVE 3AE2C 2SPZA 1FDIA 2KZIA 4D6TG 4CPGA 1KFNA 1VDFA 1L0LJ 1Y9BA 1X0TA 5GTIH 1YHQP 1H88A 1BE3E 1LTAC 1FZFA 1OW6A 2Y0EA 5AW5B 2IX7C 5CMZA 3WUVA 1SQXG 4UB8H 3PLNA 2I1JA 3HD7D 1LT1A 4XE5B 1L4AB 1G1JA 1PP9D 1URQB 4GOEA 3G6EP 1BGYJ 1OIPA 4EDFA 5APQA 2IBZI 1YTZT 2N1TD 2Y0CA 4WY4A 3VN0A 2OYHC 3MTUE 1KB9D 3F5HA 3H1KD 4N78E 4H44B 3TDKA 2M5AA 1NKZB 1MZ9A 1YQ3C 1NVOA 2GM4A 3L74J 4H13C 3E1RA 4U3FD 1FZAA 3EFGA 5AW3B 2B87A 1L0LG 4ZKUA 3BVHA 3B5NC 3AE9C 2RH0A 3JCUH 2G8YA 1ZRTD 3VOPA 1CSBA 1PP9J 3M0DC 1YBKA 2OARA 3TK1A 2E76C 2Q3EA 4NPEA 4OGQB 2J5UA 1GZLA 2AEJA 5AVYB 2O1KA 4EYYQ 3H1KJ 5AW6B 1BGYG 4JPZB 3H6PA 1HF9A 1YIJP 1ZR2A 1KFMA 2KZJA 4U3FJ 3FWLA 3H1IG 4GDOA 1KILD 1NTKE 1JNMA 5TISH 1RF1B 4PV1D 2FFDA 3HD7A 3L74G 4ZNCA 1FZGA 4RESB 4KHXA 3BCCE 3R2PA 2WSFH 3RK3C 1ZW0A 1JY3P 1UIIA 3VP8A 2K3RA 2N1TA 1EDKA 2HODB 1PP9G 4AQRD 1W2EA 3ZDMA 1S5LH 1JOCA 4I7ZC 1VF5C 2FYUJ 3MGNA 4I6MC 3L35A 1PV3A 1LTTC 2UWJE 5GTIE 2ZT9B 3H1KG 1J1DB 2E75B 2XV5A 3I5CA 4YTPC 1SQQJ 4UB8E 2KNCB 2PAJA 1IK7A 1KD1Q 3CXHI 3GHGA 1R5LA 3PHLA 2OYIB 1CW5A 2KXPB 2YO2A 1LTIC 3L70J 2C9NY 1K04A 2YO3A 3PTZA 1QLED 1FZCA 1HGZA 3BATA 1KILA 2FYUG 3OAKA 3Q2YA 1L4AD 5KLIC 1FOSF 5CCHD 1GL2C 1URQD 1S72P 1Q81Q 2YIUC 3P7KA 1M7LA 1N73A 1ZP0C 1SQQG 4H44D 2H89C 3SWKA 1VQKP 2FYNC 1VPCA 5K5GB 1GDTA 3AEFC 1QEXA 2HYNA 1N7SB 2R3SA 3AE3C 2YKQA 2KS1A 4DT0A 1IZNB 2L91A 3L70G 1N2DC 1NO4A 1LT9B 1OVUA 1JMMA 2K9YA 2G3AA 3V2NA 3L73G 1KB9I 4OGQD 1JY3N 3P8CE 2ZVOB 5KTBA 2AXCA 2W83C 3G3ZA 1PPJE 2KK7A 3B8EB 1EC5A 4XA4A 1L4AA 2A45H 1DIPA 1URQA 3CWBD 2J59M 1KQGB 4DJGA 4HH2A 1NTZE 3Q5RA 3CX5D 5H2FE 2QJPB 4ASVA 2NPSB 4WY4C 2PFXA 1JEKA 2Q5UA 2A06D 2ZT9D 3CCMP 3BRVB 2E75D 3L71E 4QMAA 3VYIA 3M9HA 3H1LJ 2IDBA 1BDCA 3TYYA 3CWBJ 2O1JA 1J2JB 1SQBG 3RK3E 2BEQD 2D2CB 2IZ1A 1YJ9P 2B9BA 2KOGA 4H0LB 1AFOA 2HPCB 4EOTA 1VQOP 2JJLA 1KQFB 3B4SA 1BCCE 3PRJA 1X79B 1RE4C 1H0TB 3V2QA 1RF1A 1LTJB 3AEBC 5B66H 4L74A 5KAFH 4EI2A 2C0WA 2IPPA 3HUSB 2QIWA 4YXWH 3A3YB 2WZ7A 3H1LG 1EDLA 2HODA 3C8VA 3CWBG 5KLVE 1EZVG 5AW2B 2P7JA 3KZIE 3U59A 5E79H 3CLQA 2M3EA 1S1CX 2IFMA 1N7SD 4C7NB 3LIDA 1GTWA 1KMIZ 4HKZH 2KI7B 1NAYA 2YKOA 5B5EH 3SFEC 2KNCA 2WITA 5EFWB 1G2CB 3D6ZA 4GKGA 3VMAA 2OTLP 1SQPK 2P2UA 2QJYC 2OYIA 2O01N 5TJHA 1L0LK 1S3JA 3H1JE 3CCUP 1CZQA 1JMBA 1FZEA 1SQXJ 3BRTB 4IL6H 1FZCC 5AW0B 4Z1MH 2E43A 4D6TD 1LNQA 2K88A 3MUDA 4LLHA 3QWOC 3FXEA 1W2BO 5AW9B 1JO5A 1HWTC 2NPSD 3IAOA 2K37A 4L75A 1VQ8P 1ZLLA 1L0NE 4YXDC 2Q3IA 1Q90D 1N7SA 2WSEJ 3D70A 3IR9A 1LWUA 1FDOA 2KUBA 3V6IA 1QL1A 3HTKB 3H1HJ 1USDA 3RL0B 1LT9A 2QEXP 4C7RA 1NU1K 1FE6A 1RE3C 2Y9YA 5CHXA 4HJGH 1SP4A 2D2CD
chains in the Genus database with same CATH topology
5CJ4A 2FFDC 3HD7C 2I1KA 1GZLA 1IFMA 5AVYB 2O1KA 1OXZA 1FU1A 1T8ZA 2JEEA 5AW6B 4EIJA 2R5DA 3H6PA 1A02J 3B5NA 1ZR2A 1KFMA 2N1TC 5BU8B 2N9BA 3E1IA 5AW1B 4LC1A 1PFIA 1X8YA 1HH0A 1XTCC 2WWWA 5APUA 3P32A 1RE3A 1KILD 2R32A 5CCGC 1GL2B 1JNMA 3N7NA 2YNYA 3TNUB 4OH8B 5AVZB 3V4WA 1ZR4A 1RF1B 5AVWB 1NTMK 3HD7A 2FFDA 1NWQA 1H89A 3VMYA 4RESB 3V2PA 1FZGA 4KHXA 1L4AC 3R2PA 2WSFH 5CCHC 1SFCB 1URQC 3RK3C 2WPRA 3P8CD 1OWAA 1JY3P 3VP8A 3NMDA 2N1TA 2HODB 4AQRD 1W2EA 1JCDA 4Y99B 1M1JC 1N7LA 2ZFCA 5KJ7C 1WRGA 2NPSA 1GK6A 2KYVA 1JOCA 4W7ZA 5BU5A 3MGNA 2FYUK 3L35A 3P8MC 3GHGC 4I6MC 1GW4A 1LTTC 1J1EC 3HE5B 1LTSC 2FXMA 4W7YA 2WPQA 5CJ0A 3RK2C 2WPSA 1J1DB 3LW5H 2XV5A 3I5CA 3H32A 5CCHA 1GW3A 4JF7A 1NAFA 2Z4EA 4I1LA 1SQQK 4M3LA 5AW4B 2PAJA 1SVFA 5KLVK 5AW7B 1M1JA 4LGDE 1KILC 1RY3A 3A5TA 1N86A 2XKMA 1LTJC 1EQ7A 1JCCA 3GHGA 2WTYA 3KDPB 1DX7A 5APXA 2OYIB 2E42A 1ZN5A 1CW5A 3HUSC 3SWFA 2YO2A 1LTIC 2XNXA 1N73C 1A02F 2HPCA 1QL2A 2CPBA 3V2RA 2C9NY 3O8ZA 5CCGD 3MIWA 2YO3A 1SQVK 2QM8A 2MJZA 3LIEA 1JUNA 1FZCA 1HGZA 3BATA 4DZOA 1HJBA 1DEBA 1IO4A 1T3UA 2ZXEB 1KILA 3OAKA 3L37A 1L4AD 2A45I 3VMXA 1FOSF 2IFNA 1LTJA 1Z56A 1CI6A 1GL2C 5CCHD 1URQD 2H43A 1E5WA 3MD0A 4N6JA 2PP6A 3BASA 3HUSA 1YTZI 3P7KA 1M7LA 1N73A 4IFMA 2VRSA 1FAVA 5KJ7D 1SFCC 3OJAB 4WY4B 2Q7CA 3II6A 2C9LY 2Q9IA 1FBMA 2YKPA 3VTPC 3M0AA 1JTHB 3RK2D 1VPCA 2H8PD 1GDTA 3N4XA 3HRNA 2HYNA 1AQ5A 4C7NA 1N7SB 3VP9A 2YKQA 4AUWA 2O01H 3NXSA 3RL0D 1N2DC 1NO4A 1IFNA 2M8RA 4DOJA 1LT9B 3M0DA 2WT7B 1RF0C 1JMMA 1MUUA 3V2NA 1SLQA 2OYHB 1KZUB 1NKNA 1HUCA 1G2CA 1JY3N 3HE4A 5APSA 1L0NK 1S9KD 3P8CE 1T2KC 1GD2E 4I2LC 4W80A 3M06A 5KTBA 5AVSB 3B5NB 1IFDA 3G3ZA 3C9IA 1FJKA 1JY2O 3NTNA 1LTBC 5AW8B 5CCGA 1RF0A 1GK4A 2KP8A 2KLVA 1FJPA 3B8EB 1GL2D 2GUVA 3V4QA 3U1CA 2W6AA 1SQBK 2M3BA 1HBWA 4B86A 4XA4A 2FFDB 3HD7B 1L4AA 5BVZA 2W27A 2A45H 2P1JA 1MV8A 1URQA 2YMYA 2J59M 1DH3A 1SFCD 1NHLA 2LKMA 4HH2A 2KSJA 5AVUB 3RL0C 2N1TB 3L36A 5KJ7A 4ZKPA 4JYBA 4GIFA 2FKWB 1FZBA 2NPSB 1G1IA 4WY4C 1NTKK 3WMM0 2Q5UA 2QM7A 3BRVB 1IK9A 3VYIA 2Z5IA 3H32B 1GU5A 3HTKA 1IC2A 3M9HA 3OA7A 3RK3B 4C46A 2CPSA 3NFQA 3TYYA 3SWYA 2O1JA 1M1JB 1J2JB 4N3YB 1T2KD 1RF1C 3CL3D 3M9BA 4N78D 2H7HA 3GHGB 1FOSE 2KOGA 1J1EB 3KYQA 1AFOA 3KPEA 3RK2B 2P67A 2HPCB 4EOTA 2JJLA 2HLOA 4GT1A 4JYCA 1T3JA 4Y99C 5AVRB 1FZCB 3VMZA 3A2AA 4IFFA 1X79B 1HTLC 1KILB 1GL2A 3UIAA 3M9QA 1LWUB 1RE4C 3V2QA 3TNUA 3IFMA 1RF1A 1LTJB 1JY2N 1CI6B 1LGHB 2HFED 5APVA 5AVQB 3KQGA 1XTGB 1J1DC 5APTA 1IFIA 3HUSB 2C0WA 2IPPA 1IJDB 2XDJA 2KB7P 2XZRA 1N73B 3U1AA 1SFCA 3A3YB 1JY2P 3EQ2A 3A7OA 2WZ7A 3PP5A 4WY4D 2A45G 2C0XA 1ZV8A 2HODA 3L4FA 4HYTB 3T97A 2W6BA 1HVVA 2GUSA 5AW2B 4IFDK 2P7JA 1S9KE 1X9VA 3U59A 5AVTB 2NPSC 2WSCH 3CLQA 3CI9A 2IFMA 2POHA 1RE4A 1N7SD 2R5BA 4C7NB 3LIDA 3HE5A 1GTWA 2OYIC 4WB4A 5APWA 2R3CA 2J58A 2BASA 2YKOA 1HGVA 3M91A 2WITA 2Z5HA 1G2CB 2XU6A 3HE4B 4AYCA 4GKGA 1FDMA 1SQPK 2P2UA 1KFNA 1NH4A 2OYIA 1VDFA 3B5ND 1L0LK 4WBAA 1H88A 1LTAC 1NOHA 1FZFA 5AW5B 1JY3O 1WT6A 1CZQA 1FZEA 2IX7C 5CMZA 2WSEH 1LTGC 2FYZA 1KQLA 3BRTB 1SQXK 2I1JA 1FZCC 3HD7D 4XE5B 1L4AB 1N7SC 1G1JA 5AW0B 5AVVB 1LWUC 1URQB 2E43A 5AVXB 3MUDA 4LLHA 5APQA 1MFZA 1YTZT 2N1TD 2L5GB 1LT9C 5AW9B 3TSIA 1JO5A 1HWTC 1YYCA 4WY4A 3VN0A 2OYHC 2NPSD 3MTUE 4N78E 4O9BA 1JTHA 1NKZB 1MZ9A 2HG5D 1ZLLA 2Q3IA 2GM4A 1N7SA 3V5BA 1FZAA 3IR9A 1LWUA 3EFGA 5AW3B 5APYA 4ZKUA 3BVHA 3B5NC 1QL1A 1NTZK 3RK3D 3HTKB 3RL0B 1H8AA 1LT9A 3VOPA 1CSBA 2WT7A 4C7RA 1NU1K 1RE3C 1IFJA 5CHXA 2OYHA 3M0DC 2OARA 1SP4A 3TK1A 1GU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RL0 C;  3HD7 C;  2N1T B;  5KJ7 A;  1KIL A;  1L4A D;  2NPS B;  4WY4 C;  5CCH D;  1GL2 C;  1URQ D;  3B5N A;  2N1T C;  2PP6 A;  5KJ7 D;  1KIL D;  1SFC C;  5CCG C;  4WY4 B;  1GL2 B;  3RK3 B;  4OH8 B;  3HD7 A;  3B5N D;  1JTH B;  3RK2 D;  2H8P D;  1L4A C;  5CCH C;  1N7S B;  1SFC B;  1URQ C;  3RK3 C;  2N1T A;  2KOG A;  3KYQ A;  3RL0 D;  3HD7 D;  5KJ7 C;  2M8R A;  2NPS A;  1L4A B;  3RK2 B;  1N7S C;  4W7Z A;  1URQ B;  1T3J A;  4W7Y A;  2N1T D;  3RK2 C;  1NHL A;  3TSI A;  1KIL B;  4WY4 A;  1GL2 A;  3P8C E;  2NPS D;  5CCH A;  4JF7 A;  4N78 E;  2HFE D;  4W80 A;  3B5N B;  1JTH A;  1XTG B;  2HG5 D;  4LGD E;  1KIL C;  2XDJ A;  1N7S A;  1SFC A;  5CCG A;  2WZ7 A;  3PP5 A;  4WY4 D;  1GL2 D;  3B5N C;  3RK3 D;  3HTK B;  3RL0 B;  1HVV A;  3HD7 B;  1L4A A;  3VOP A;  1URQ A;  2YMY A;  2NPS C;  3M0D C;  1N7S D;  1SFC D;  5CCG D; 
#chains in the Genus database with same CATH topology
 5KAF E;  1RQV A;  1S2E A;  1DD4 A;  4H0L D;  1FU1 A;  1T8Z A;  2IBZ G;  1SQP D;  1R5S A;  1M56 D;  4PD4 H;  2N9B A;  4RKU J;  1L0L D;  1X8Y A;  1HH0 A;  3MP7 B;  5E79 E;  4UB6 E;  3P32 A;  2ZYG A;  1T6A A;  2YNY A;  4OH8 B;  1NTM J;  5AVZ B;  1ZR4 A;  3EWK A;  1NWQ A;  3R4Y A;  3IF4 A;  3VMY A;  3V2P A;  1QVF O;  1L4A C;  5CCH C;  1URQ C;  2IZ0 A;  3H1H G;  3GLM A;  1BGY D;  1KYO H;  1Q86 Q;  2Q6Q A;  1JCD A;  4Y99 B;  1M1J C;  3L72 G;  1SQP J;  2NPS A;  1GK6 A;  1BDD A;  5BU5 A;  2FYU K;  1GW4 A;  4H44 C;  1J1E C;  3H1I D;  1VQ7 P;  2FXM A;  1Q7Y Q;  2YXR B;  1ZME C;  2WPS A;  2B89 A;  3L74 D;  1GW3 A;  1KN7 A;  2Z4E A;  4I1L A;  2QSI A;  1SQQ K;  2JWD A;  4M3L A;  1NU1 D;  3WUT A;  1BE3 D;  1NTM G;  1M57 D;  1S5L X;  4OGQ C;  1U7J A;  3RL0 g;  2E42 A;  1ZN5 A;  1OVR A;  3AED C;  3SWF A;  1K05 A;  1A02 F;  2HPC A;  3AEA C;  1KB9 E;  3H1K E;  3H1I J;  3O8Z A;  3GF7 A;  2QM8 A;  3LW5 J;  3PJS K;  1SQP G;  4U3F E;  2A45 I;  3VMX A;  4PJ0 H;  1H0T A;  3AEC C;  1LTJ A;  3A0H H;  2QG4 A;  2JWA A;  3HUS A;  1YTZ I;  1NU1 J;  4IFM A;  1BE3 J;  1FAV A;  3OJA B;  2JDI H;  1FBM A;  2HR3 A;  3W67 A;  3VTP C;  3M0A A;  1JTH B;  3RK2 D;  3N4X A;  4C7N A;  2PGD A;  4PD4 D;  3VP9 A;  2FYU D;  3CCE P;  2QE7 H;  4BRY B;  3KXD A;  2QVA A;  3NXS A;  3RL0 D;  2E75 C;  2WT7 B;  1SQV G;  2OGU A;  3AE4 C;  1SLQ A;  2OYH B;  1NKN A;  1G2C A;  1SQQ D;  2DW3 A;  4H13 B;  1P84 H;  1GD2 E;  2KIK A;  2E5T A;  1KYO D;  1NU1 G;  4I2L C;  4W80 A;  1NTK D;  1BE3 G;  3B5N B;  1U57 A;  1FJK A;  3SSU A;  5AW8 B;  4ZMD A;  1RF0 A;  3L70 D;  2OYO A;  1AA0 A;  1SQB K;  2E76 B;  2M3B A;  3FX0 A;  1HBW A;  4B86 A;  3G71 P;  5CBO A;  1PGO A;  3L73 D;  3EFF K;  5AVU B;  3G9R A;  4R4M A;  3CPW O;  3CX5 H;  1JM0 A;  3AE7 C;  1G1I A;  1ZOY C;  1NTK J;  2RMZ A;  1AJY A;  5KKZ B;  1N8R Q;  1EDI A;  3BCC J;  2RKL A;  1IK9 A;  3HTK A;  3RK3 B;  3L73 J;  1UIX A;  3NFQ A;  1M1K Q;  1EXI A;  2ZAE B;  4I7Z B;  1VF5 B;  3JCU E;  1W5C E;  2H7H A;  3CD6 P;  1VQ4 P;  1VL2 A;  2HLO A;  4ASW A;  4R4L A;  2BCC D;  4RO0 A;  1ZXG A;  2QJK C;  4IFF A;  1NTK G;  2ZVN B;  1HTL C;  5KAI H;  1LWU B;  2E74 B;  2HFE D;  2ITA A;  1SQB D;  2GA1 A;  3BCC G;  5APT A;  2KB7 P;  3U1A A;  5TIS E;  3A7O A;  4TLF A;  2C0X A;  1ZV8 A;  2LXC B;  2KLU A;  4BXL A;  2W6B A;  1P84 D;  1X9V A;  2NPS C;  2POH A;  5KLI B;  2BCC J;  3WUU A;  1FS0 E;  1S5L E;  2J58 A;  1PGJ A;  3OW2 O;  2YIU B;  3FXD A;  2OTK E;  4GOD A;  1TU3 F;  1SQB J;  2Z5H A;  2YXQ B;  3USS A;  3H1L D;  3Q5S A;  1FC2 C;  4AYC A;  3CWB E;  2FYN B;  1EZV D;  1FDM A;  2D2C C;  2IYP A;  4H13 D;  3B5N D;  3CC2 P;  2WSC J;  3L75 E;  1NOH A;  4GOF A;  3CMA P;  1WT6 A;  2WSE H;  2A06 E;  1KQL A;  2E76 D;  1SQX K;  2BCC G;  2IYO A;  5AVV B;  2AXT H;  3D71 A;  1KYO I;  3TSI A;  3O6Q B;  2O3J A;  2V4H A;  1JTH A;  1YIT P;  1RHZ B;  4IL6 X;  3Q3D A;  4BRY A;  1NTZ J;  3RK3 D;  4YPC A;  2WT7 A;  4A7P A;  1IFJ A;  2FBW C;  2OYH A;  1L2P A;  1VF5 D;  3JSV C;  5CJ4 A;  2FFD C;  3HD7 C;  2I1K A;  4L73 A;  1IFM A;  3S4R A;  5DJT B;  3L71 J;  2JEE A;  4EIJ A;  2R5D A;  1A02 J;  3B5N A;  4Y28 J;  1PPJ G;  2N1T C;  2WSS H;  2LXB A;  4LC1 A;  1PFI A;  2WWW A;  1EXJ A;  3KHU A;  5APU A;  2JO1 A;  2R32 A;  2E74 D;  3TNU B;  5AVW B;  1NTM K;  1SQX D;  1H89 A;  5KLV D;  1NTZ G;  3CXH H;  1SFC B;  1OWA A;  2IBZ D;  1BCC J;  1OVV A;  1PGP A;  3IN6 A;  1N7L A;  2ZFC A;  4BWN A;  1WRG A;  3GF3 A;  2KYV A;  4W7Z A;  3P8M C;  3GHG C;  4W7Y A;  2WPQ A;  3L71 G;  2Y9Z A;  1U7M A;  3RK2 C;  3LW5 H;  1AVY A;  3AE1 C;  2P58 A;  5KLV J;  3E7K A;  3H1H D;  1KIL C;  3A5T A;  2AXT E;  4D6T E;  1EQ7 A;  1JCC A;  4PV1 C;  1P84 I;  3L72 D;  4DCK A;  3KDP B;  1PIX A;  1OX3 A;  5APX A;  1KV4 A;  2K9J B;  2XNX A;  1N73 C;  3CCJ P;  1QL2 A;  3V2R A;  2M0B A;  1BCC G;  5CCG D;  1SQV K;  2MJZ A;  3LIE A;  4XFJ A;  1JUN A;  1IO4 A;  2ZXE B;  3L37 A;  1K8A Q;  1PL5 A;  2IFN A;  1NJI Q;  2H43 A;  3MD0 A;  2QJY B;  4N6J A;  1RQU A;  2PP6 A;  1NTM D;  1QGK B;  3CX5 I;  3H1J J;  5KJ7 D;  3TGU D;  3L72 J;  2V7Q J;  2H88 C;  1L0N D;  3F89 A;  2Q7C A;  3RGU A;  5B66 E;  2C9L Y;  3CCR P;  5KLV G;  1KC8 Q;  3I55 P;  1E79 H;  2YKP A;  2QRX A;  2WQY C;  2H8P D;  1YJW P;  1VQN P;  1AQ5 A;  3HRN A;  4AUW A;  1L0L E;  2O01 H;  1QX8 A;  1IFN A;  2M8R A;  1Q2N A;  2ZJS E;  2JR8 A;  1HUC A;  5B5E E;  4K3A A;  3TGU J;  3QH9 A;  2OTJ P;  5APS A;  1L0N J;  1S9K D;  3CXH D;  3AE5 C;  3CCQ P;  1BGY E;  3ITK A;  3M06 A;  3Q5P A;  5AVS B;  3H1J G;  1PZQ A;  1IFD A;  1JY2 O;  1LTB C;  5CCG A;  2Y0D A;  2KP8 A;  1YJN P;  3H1I E;  2GUV A;  3I56 P;  1WMK A;  1SQV D;  5M1B A;  2XND H;  5BVZ A;  3L74 E;  3WU2 H;  1MV8 A;  2YMY A;  4IL6 E;  1SFC D;  1NHL A;  2LKM A;  3C1L A;  3L36 A;  5KJ7 A;  1OZH A;  4JYB A;  1PP9 E;  1NU1 E;  4GIF A;  3O6Q A;  3Q1M A;  2WMM A;  2AEM A;  1NTK K;  3TGU G;  3S1K A;  1L0N G;  3WMM 0;  2ZYA A;  3B71 A;  2FXP A;  4K35 A;  1SQV J;  1DEE G;  3H32 B;  1IC2 A;  4C46 A;  2W6J H;  3SWY A;  2P10 A;  1M1J B;  1SS1 A;  4N3Y B;  1T2K D;  1RF1 C;  3M9B A;  4N78 D;  1ZRT E;  1J1E B;  3KYQ A;  4HB1 A;  2P67 A;  2OQQ A;  1T3J A;  1X22 A;  3VMZ A;  3A2A A;  2AEF A;  4PD4 E;  1AVO A;  2FYU E;  4OVN F;  3TNU A;  1JY2 N;  1CI6 B;  2WVR A;  2ZT9 C;  5APV A;  3KQG A;  1MFT A;  1J1D C;  1XTG B;  1IFI A;  1KIL E;  5CBN A;  1IJD B;  2XDJ A;  4IOI H;  2NRG A;  1SFC A;  3AEG C;  5DJU B;  1SQQ E;  4HYT B;  1BSH A;  5AVT B;  2WSC H;  3CCV P;  1RE4 A;  1KYO E;  5KKZ C;  3FGA D;  2OYI C;  4WB4 A;  3SFD C;  2RN0 A;  1HGV A;  3L70 E;  1EDJ A;  1VQP P;  2O01 J;  2ZXX A;  3BCC D;  3M91 A;  2NZ2 A;  3L73 E;  3WU2 E;  2XU6 A;  3HE4 B;  3FWN A;  1NH4 A;  2K9J A;  3MUD C;  3TF5 A;  3G4S P;  3ABV C;  4WBA A;  3AE8 C;  1JY3 O;  1LTG C;  2FYZ A;  2LR2 A;  4U3F G;  5H2F H;  2I8D A;  1N7S C;  1LWU C;  2E74 C;  5AVX B;  2Q1K A;  1MFZ A;  4PJ0 E;  2L5G B;  1LT9 C;  2MKV A;  2PRR A;  1YYC A;  3A0H E;  2JKV A;  4O9B A;  1K73 Q;  1LP1 B;  1PGQ A;  2HG5 D;  3V5B A;  4TT3 H;  5APY A;  1KTM A;  2BCC E;  1NTZ K;  1H8A A;  3AEE C;  2R44 A;  1GU4 A;  1SQB E;  3JC2 2;  4JBZ A;  3RBX A;  3CCS P;  1OXZ A;  5BU8 B;  3E1I A;  5AW1 B;  2QJP C;  1XTC C;  1P84 E;  3H25 A;  4U7J A;  1RE3 A;  5CCG C;  1GL2 B;  3N7N A;  3V4W A;  1VQL P;  4JQ0 D;  3KZI H;  2WPR A;  3P8C D;  3NMD A;  3H1L E;  3T97 B;  5KJ7 C;  2QJK B;  1EZV E;  1PPJ D;  4NPF X;  2BEZ F;  3CX5 E;  4PD4 I;  3W68 A;  1OW8 A;  3HE5 B;  1LTS C;  3GW6 A;  5CJ0 A;  4H0L C;  3GMA A;  1BSN A;  3H32 A;  5CCH A;  4JF7 A;  1NAF A;  1JB0 J;  1NTZ D;  5AW4 B;  1LJ2 A;  1SVF A;  2FY8 A;  5AW7 B;  5KLV K;  2WSF J;  1M1J A;  4LGD E;  1RY3 A;  1N86 A;  2XKM A;  1LTJ C;  3L75 D;  2E5Y A;  2WTY A;  2V7Q H;  1DX7 A;  3HUS C;  2WPV B;  2N9Y B;  2CPB A;  3L71 D;  3MIW A;  4MN4 C;  4DZO A;  1HJB A;  1DEB A;  1T3U A;  4WWI A;  1Z56 A;  1YI2 P;  1CI6 A;  1E5W A;  3BAS A;  5KAI E;  3L75 J;  2VRS A;  3A0B H;  3AE6 C;  2W90 A;  4L76 A;  5GTH H;  1SFC C;  4WY4 B;  3II6 A;  2Q9I A;  1M8O B;  1BCC D;  2M5A B;  1GMJ A;  1AV1 A;  2B87 B;  3RBZ A;  4DOJ A;  3M0D A;  1RF0 C;  1KQS O;  1MUU A;  5L8R J;  3CME P;  1KZU B;  1K9M Q;  1SQX E;  3HE4 A;  1NYH A;  3K5B A;  1VQ5 P;  3D6Y A;  1L0N K;  1VQ6 P;  2ZYD A;  1VQM P;  1T2K C;  1RH5 B;  4UB6 H;  2IBZ E;  3L75 G;  3C9I A;  3NTN A;  1OW7 A;  1GK4 A;  2KLV A;  1FJP A;  2A06 G;  1GL2 D;  1OMI A;  3V4Q A;  3U1C A;  1NGM B;  1VQ9 P;  2W6A A;  1QVG O;  2FFD B;  3HD7 B;  2W27 A;  2P1J A;  1MKM A;  4WVZ A;  1DH3 A;  2KSJ A;  3S9O A;  3RL0 C;  2JP3 A;  3H1H E;  2N1T B;  4ZKP A;  2FKW B;  3H1J D;  1FZB A;  3L72 E;  3CCL P;  1R8E A;  1LP1 A;  1OFC X;  2QM7 A;  3CC4 P;  2Z5I A;  1GU5 A;  3MZW B;  3OA7 A;  2FXO A;  2CPS A;  1KOR A;  1S4X A;  4RJT A;  1M90 Q;  1D7M A;  1EZV I;  2K1A A;  3CL3 D;  1KB9 H;  3GHG B;  1NTM E;  3MHV A;  1FOS E;  3A0B E;  3TGU E;  4NPD A;  3KPE A;  3RK2 B;  5GTH E;  3CC7 P;  1Q82 Q;  2KSE A;  4KT0 J;  4GT1 A;  1USE A;  4JYC A;  1HJ0 A;  5C39 A;  4Y99 C;  5AVR B;  3GG2 A;  1FZC B;  2CK3 H;  1SQP E;  1KIL B;  1GL2 A;  4D6T J;  3UIA A;  3M9Q A;  1Y8A A;  3IFM A;  4PV1 B;  1LGH B;  5AVQ B;  3PH0 A;  1DD3 A;  2W8Z A;  2XZR A;  1N73 B;  1JY2 P;  3EQ2 A;  2YMK A;  1IFP A;  2QA4 P;  3PP5 A;  4WY4 D;  2A45 G;  3L4F A;  3T97 A;  1HVV A;  2GUS A;  4IFD K;  1S9K E;  3CXH E;  1AQT A;  3CI9 A;  2R5B A;  3HE5 A;  2B88 A;  5APW A;  1Y47 A;  2KS1 B;  2R3C A;  2BAS A;  1YQ4 C;  4KJM A;  4OWF A;  1SQV E;  3AE2 C;  2SPZ A;  1FDI A;  2KZI A;  4D6T G;  4CPG A;  1KFN A;  1VDF A;  1L0L J;  1Y9B A;  1X0T A;  5GTI H;  1YHQ P;  1H88 A;  1BE3 E;  1LTA C;  1FZF A;  1OW6 A;  2Y0E A;  5AW5 B;  2IX7 C;  5CMZ A;  3WUV A;  1SQX G;  4UB8 H;  3PLN A;  2I1J A;  3HD7 D;  1LT1 A;  4XE5 B;  1L4A B;  1G1J A;  1PP9 D;  1URQ B;  4GOE A;  3G6E P;  1BGY J;  1OIP A;  4EDF A;  5APQ A;  2IBZ I;  1YTZ T;  2N1T D;  2Y0C A;  4WY4 A;  3VN0 A;  2OYH C;  3MTU E;  1KB9 D;  3F5H A;  3H1K D;  4N78 E;  4H44 B;  3TDK A;  2M5A A;  1NKZ B;  1MZ9 A;  1YQ3 C;  1NVO A;  2GM4 A;  3L74 J;  4H13 C;  3E1R A;  4U3F D;  1FZA A;  3EFG A;  5AW3 B;  2B87 A;  1L0L G;  4ZKU A;  3BVH A;  3B5N C;  3AE9 C;  2RH0 A;  3JCU H;  2G8Y A;  1ZRT D;  3VOP A;  1CSB A;  1PP9 J;  3M0D C;  1YBK A;  2OAR A;  3TK1 A;  2E76 C;  2Q3E A;  4NPE A;  4OGQ B;  2J5U A;  1GZL A;  2AEJ A;  5AVY B;  2O1K A;  4EYY Q;  3H1K J;  5AW6 B;  1BGY G;  4JPZ B;  3H6P A;  1HF9 A;  1YIJ P;  1ZR2 A;  1KFM A;  2KZJ A;  4U3F J;  3FWL A;  3H1I G;  4GDO A;  1KIL D;  1NTK E;  1JNM A;  5TIS H;  1RF1 B;  4PV1 D;  2FFD A;  3HD7 A;  3L74 G;  4ZNC A;  1FZG A;  4RES B;  4KHX A;  3BCC E;  3R2P A;  2WSF H;  3RK3 C;  1ZW0 A;  1JY3 P;  1UII A;  3VP8 A;  2K3R A;  2N1T A;  1EDK A;  2HOD B;  1PP9 G;  4AQR D;  1W2E A;  3ZDM A;  1S5L H;  1JOC A;  4I7Z C;  1VF5 C;  2FYU J;  3MGN A;  4I6M C;  3L35 A;  1PV3 A;  1LTT C;  2UWJ E;  5GTI E;  2ZT9 B;  3H1K G;  1J1D B;  2E75 B;  2XV5 A;  3I5C A;  4YTP C;  1SQQ J;  4UB8 E;  2KNC B;  2PAJ A;  1IK7 A;  1KD1 Q;  3CXH I;  3GHG A;  1R5L A;  3PHL A;  2OYI B;  1CW5 A;  2KXP B;  2YO2 A;  1LTI C;  3L70 J;  2C9N Y;  1K04 A;  2YO3 A;  3PTZ A;  1QLE D;  1FZC A;  1HGZ A;  3BAT A;  1KIL A;  2FYU G;  3OAK A;  3Q2Y A;  1L4A D;  5KLI C;  1FOS F;  5CCH D;  1GL2 C;  1URQ D;  1S72 P;  1Q81 Q;  2YIU C;  3P7K A;  1M7L A;  1N73 A;  1ZP0 C;  1SQQ G;  4H44 D;  2H89 C;  3SWK A;  1VQK P;  2FYN C;  1VPC A;  5K5G B;  1GDT A;  3AEF C;  1QEX A;  2HYN A;  1N7S B;  2R3S A;  3AE3 C;  2YKQ A;  2KS1 A;  4DT0 A;  1IZN B;  2L91 A;  3L70 G;  1N2D C;  1NO4 A;  1LT9 B;  1OVU A;  1JMM A;  2K9Y A;  2G3A A;  3V2N A;  3L73 G;  1KB9 I;  4OGQ D;  1JY3 N;  3P8C E;  2ZVO B;  5KTB A;  2AXC A;  2W83 C;  3G3Z A;  1PPJ E;  2KK7 A;  3B8E B;  1EC5 A;  4XA4 A;  1L4A A;  2A45 H;  1DIP A;  1URQ A;  3CWB D;  2J59 M;  1KQG B;  4DJG A;  4HH2 A;  1NTZ E;  3Q5R A;  3CX5 D;  5H2F E;  2QJP B;  4ASV A;  2NPS B;  4WY4 C;  2PFX A;  1JEK A;  2Q5U A;  2A06 D;  2ZT9 D;  3CCM P;  3BRV B;  2E75 D;  3L71 E;  4QMA A;  3VYI A;  3M9H A;  3H1L J;  2IDB A;  1BDC A;  3TYY A;  3CWB J;  2O1J A;  1J2J B;  1SQB G;  3RK3 E;  2BEQ D;  2D2C B;  2IZ1 A;  1YJ9 P;  2B9B A;  2KOG A;  4H0L B;  1AFO A;  2HPC B;  4EOT A;  1VQO P;  2JJL A;  1KQF B;  3B4S A;  1BCC E;  3PRJ A;  1X79 B;  1RE4 C;  1H0T B;  3V2Q A;  1RF1 A;  1LTJ B;  3AEB C;  5B66 H;  4L74 A;  5KAF H;  4EI2 A;  2C0W A;  2IPP A;  3HUS B;  2QIW A;  4YXW H;  3A3Y B;  2WZ7 A;  3H1L G;  1EDL A;  2HOD A;  3C8V A;  3CWB G;  5KLV E;  1EZV G;  5AW2 B;  2P7J A;  3KZI E;  3U59 A;  5E79 H;  3CLQ A;  2M3E A;  1S1C X;  2IFM A;  1N7S D;  4C7N B;  3LID A;  1GTW A;  1KMI Z;  4HKZ H;  2KI7 B;  1NAY A;  2YKO A;  5B5E H;  3SFE C;  2KNC A;  2WIT A;  5EFW B;  1G2C B;  3D6Z A;  4GKG A;  3VMA A;  2OTL P;  1SQP K;  2P2U A;  2QJY C;  2OYI A;  2O01 N;  5TJH A;  1L0L K;  1S3J A;  3H1J E;  3CCU P;  1CZQ A;  1JMB A;  1FZE A;  1SQX J;  3BRT B;  4IL6 H;  1FZC C;  5AW0 B;  4Z1M H;  2E43 A;  4D6T D;  1LNQ A;  2K88 A;  3MUD A;  4LLH A;  3QWO C;  3FXE A;  1W2B O;  5AW9 B;  1JO5 A;  1HWT C;  2NPS D;  3IAO A;  2K37 A;  4L75 A;  1VQ8 P;  1ZLL A;  1L0N E;  4YXD C;  2Q3I A;  1Q90 D;  1N7S A;  2WSE J;  3D70 A;  3IR9 A;  1LWU A;  1FDO A;  2KUB A;  3V6I A;  1QL1 A;  3HTK B;  3H1H J;  1USD A;  3RL0 B;  1LT9 A;  2QEX P;  4C7R A;  1NU1 K;  1FE6 A;  1RE3 C;  2Y9Y A;  5CHX A;  4HJG H;  1SP4 A;  2D2C D; 
#chains in the Genus database with same CATH homology
 5CJ4 A;  2FFD C;  3HD7 C;  2I1K A;  1GZL A;  1IFM A;  5AVY B;  2O1K A;  1OXZ A;  1FU1 A;  1T8Z A;  2JEE A;  5AW6 B;  4EIJ A;  2R5D A;  3H6P A;  1A02 J;  3B5N A;  1ZR2 A;  1KFM A;  2N1T C;  5BU8 B;  2N9B A;  3E1I A;  5AW1 B;  4LC1 A;  1PFI A;  1X8Y A;  1HH0 A;  1XTC C;  2WWW A;  5APU A;  3P32 A;  1RE3 A;  1KIL D;  2R32 A;  5CCG C;  1GL2 B;  1JNM A;  3N7N A;  2YNY A;  3TNU B;  4OH8 B;  5AVZ B;  3V4W A;  1ZR4 A;  1RF1 B;  5AVW B;  1NTM K;  3HD7 A;  2FFD A;  1NWQ A;  1H89 A;  3VMY A;  4RES B;  3V2P A;  1FZG A;  4KHX A;  1L4A C;  3R2P A;  2WSF H;  5CCH C;  1SFC B;  1URQ C;  3RK3 C;  2WPR A;  3P8C D;  1OWA A;  1JY3 P;  3VP8 A;  3NMD A;  2N1T A;  2HOD B;  4AQR D;  1W2E A;  1JCD A;  4Y99 B;  1M1J C;  1N7L A;  2ZFC A;  5KJ7 C;  1WRG A;  2NPS A;  1GK6 A;  2KYV A;  1JOC A;  4W7Z A;  5BU5 A;  3MGN A;  2FYU K;  3L35 A;  3P8M C;  3GHG C;  4I6M C;  1GW4 A;  1LTT C;  1J1E C;  3HE5 B;  1LTS C;  2FXM A;  4W7Y A;  2WPQ A;  5CJ0 A;  3RK2 C;  2WPS A;  1J1D B;  3LW5 H;  2XV5 A;  3I5C A;  3H32 A;  5CCH A;  1GW3 A;  4JF7 A;  1NAF A;  2Z4E A;  4I1L A;  1SQQ K;  4M3L A;  5AW4 B;  2PAJ A;  1SVF A;  5KLV K;  5AW7 B;  1M1J A;  4LGD E;  1KIL C;  1RY3 A;  3A5T A;  1N86 A;  2XKM A;  1LTJ C;  1EQ7 A;  1JCC A;  3GHG A;  2WTY A;  3KDP B;  1DX7 A;  5APX A;  2OYI B;  2E42 A;  1ZN5 A;  1CW5 A;  3HUS C;  3SWF A;  2YO2 A;  1LTI C;  2XNX A;  1N73 C;  1A02 F;  2HPC A;  1QL2 A;  2CPB A;  3V2R A;  2C9N Y;  3O8Z A;  5CCG D;  3MIW A;  2YO3 A;  1SQV K;  2QM8 A;  2MJZ A;  3LIE A;  1JUN A;  1FZC A;  1HGZ A;  3BAT A;  4DZO A;  1HJB A;  1DEB A;  1IO4 A;  1T3U A;  2ZXE B;  1KIL A;  3OAK A;  3L37 A;  1L4A D;  2A45 I;  3VMX A;  1FOS F;  2IFN A;  1LTJ A;  1Z56 A;  1CI6 A;  1GL2 C;  5CCH D;  1URQ D;  2H43 A;  1E5W A;  3MD0 A;  4N6J A;  2PP6 A;  3BAS A;  3HUS A;  1YTZ I;  3P7K A;  1M7L A;  1N73 A;  4IFM A;  2VRS A;  1FAV A;  5KJ7 D;  1SFC C;  3OJA B;  4WY4 B;  2Q7C A;  3II6 A;  2C9L Y;  2Q9I A;  1FBM A;  2YKP A;  3VTP C;  3M0A A;  1JTH B;  3RK2 D;  1VPC A;  2H8P D;  1GDT A;  3N4X A;  3HRN A;  2HYN A;  1AQ5 A;  4C7N A;  1N7S B;  3VP9 A;  2YKQ A;  4AUW A;  2O01 H;  3NXS A;  3RL0 D;  1N2D C;  1NO4 A;  1IFN A;  2M8R A;  4DOJ A;  1LT9 B;  3M0D A;  2WT7 B;  1RF0 C;  1JMM A;  1MUU A;  3V2N A;  1SLQ A;  2OYH B;  1KZU B;  1NKN A;  1HUC A;  1G2C A;  1JY3 N;  3HE4 A;  5APS A;  1L0N K;  1S9K D;  3P8C E;  1T2K C;  1GD2 E;  4I2L C;  4W80 A;  3M06 A;  5KTB A;  5AVS B;  3B5N B;  1IFD A;  3G3Z A;  3C9I A;  1FJK A;  1JY2 O;  3NTN A;  1LTB C;  5AW8 B;  5CCG A;  1RF0 A;  1GK4 A;  2KP8 A;  2KLV A;  1FJP A;  3B8E B;  1GL2 D;  2GUV A;  3V4Q A;  3U1C A;  2W6A A;  1SQB K;  2M3B A;  1HBW A;  4B86 A;  4XA4 A;  2FFD B;  3HD7 B;  1L4A A;  5BVZ A;  2W27 A;  2A45 H;  2P1J A;  1MV8 A;  1URQ A;  2YMY A;  2J59 M;  1DH3 A;  1SFC D;  1NHL A;  2LKM A;  4HH2 A;  2KSJ A;  5AVU B;  3RL0 C;  2N1T B;  3L36 A;  5KJ7 A;  4ZKP A;  4JYB A;  4GIF A;  2FKW B;  1FZB A;  2NPS B;  1G1I A;  4WY4 C;  1NTK K;  3WMM 0;  2Q5U A;  2QM7 A;  3BRV B;  1IK9 A;  3VYI A;  2Z5I A;  3H32 B;  1GU5 A;  3HTK A;  1IC2 A;  3M9H A;  3OA7 A;  3RK3 B;  4C46 A;  2CPS A;  3NFQ A;  3TYY A;  3SWY A;  2O1J A;  1M1J B;  1J2J B;  4N3Y B;  1T2K D;  1RF1 C;  3CL3 D;  3M9B A;  4N78 D;  2H7H A;  3GHG B;  1FOS E;  2KOG A;  1J1E B;  3KYQ A;  1AFO A;  3KPE A;  3RK2 B;  2P67 A;  2HPC B;  4EOT A;  2JJL A;  2HLO A;  4GT1 A;  4JYC A;  1T3J A;  4Y99 C;  5AVR B;  1FZC B;  3VMZ A;  3A2A A;  4IFF A;  1X79 B;  1HTL C;  1KIL B;  1GL2 A;  3UIA A;  3M9Q A;  1LWU B;  1RE4 C;  3V2Q A;  3TNU A;  3IFM A;  1RF1 A;  1LTJ B;  1JY2 N;  1CI6 B;  1LGH B;  2HFE D;  5APV A;  5AVQ B;  3KQG A;  1XTG B;  1J1D C;  5APT A;  1IFI A;  3HUS B;  2C0W A;  2IPP A;  1IJD B;  2XDJ A;  2KB7 P;  2XZR A;  1N73 B;  3U1A A;  1SFC A;  3A3Y B;  1JY2 P;  3EQ2 A;  3A7O A;  2WZ7 A;  3PP5 A;  4WY4 D;  2A45 G;  2C0X A;  1ZV8 A;  2HOD A;  3L4F A;  4HYT B;  3T97 A;  2W6B A;  1HVV A;  2GUS A;  5AW2 B;  4IFD K;  2P7J A;  1S9K E;  1X9V A;  3U59 A;  5AVT B;  2NPS C;  2WSC H;  3CLQ A;  3CI9 A;  2IFM A;  2POH A;  1RE4 A;  1N7S D;  2R5B A;  4C7N B;  3LID A;  3HE5 A;  1GTW A;  2OYI C;  4WB4 A;  5APW A;  2R3C A;  2J58 A;  2BAS A;  2YKO A;  1HGV A;  3M91 A;  2WIT A;  2Z5H A;  1G2C B;  2XU6 A;  3HE4 B;  4AYC A;  4GKG A;  1FDM A;  1SQP K;  2P2U A;  1KFN A;  1NH4 A;  2OYI A;  1VDF A;  3B5N D;  1L0L K;  4WBA A;  1H88 A;  1LTA C;  1NOH A;  1FZF A;  5AW5 B;  1JY3 O;  1WT6 A;  1CZQ A;  1FZE A;  2IX7 C;  5CMZ A;  2WSE H;  1LTG C;  2FYZ A;  1KQL A;  3BRT B;  1SQX K;  2I1J A;  1FZC C;  3HD7 D;  4XE5 B;  1L4A B;  1N7S C;  1G1J A;  5AW0 B;  5AVV B;  1LWU C;  1URQ B;  2E43 A;  5AVX B;  3MUD A;  4LLH A;  5APQ A;  1MFZ A;  1YTZ T;  2N1T D;  2L5G B;  1LT9 C;  5AW9 B;  3TSI A;  1JO5 A;  1HWT C;  1YYC A;  4WY4 A;  3VN0 A;  2OYH C;  2NPS D;  3MTU E;  4N78 E;  4O9B A;  1JTH A;  1NKZ B;  1MZ9 A;  2HG5 D;  1ZLL A;  2Q3I A;  2GM4 A;  1N7S A;  3V5B A;  1FZA A;  3IR9 A;  1LWU A;  3EFG A;  5AW3 B;  5APY A;  4ZKU A;  3BVH A;  3B5N C;  1QL1 A;  1NTZ K;  3RK3 D;  3HTK B;  3RL0 B;  1H8A A;  1LT9 A;  3VOP A;  1CSB A;  2WT7 A;  4C7R A;  1NU1 K;  1RE3 C;  1IFJ A;  5CHX A;  2OYH A;  3M0D C;  2OAR A;  1SP4 A;  3TK1 A;  1GU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...