5B66E

Crystal structure analysis of photosystem ii complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
78
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
total genus 21
structure length 78
sequence length 78
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5b66E00
5KAIE 3A0BE 3WU2E 5TISE 5H2FE 5E79E 5KAFE 5B5EE 3A0HE 4PJ0E 5GTHE 3KZIE 3JCUE 4UB8E 4UB6E 2AXTE 1W5CE 1S5LE 4IL6E 5GTIE 5B66E
chains in the Genus database with same CATH superfamily
5CCHD 3MD0A 4W7YA 1J1DC 3H25A 1T3JA 2GA1A 3L4FA 2RN0A 2Y9ZA 1K8AQ 2Q5UA 2QIWA 4R4LA 2R5BA 1QX8A 1N2DC 5GTHH 1FDMA 1KB9D 2WT7A 3Q5SA 2E76B 3L70E 2KSJA 3IF4A 3MHVA 2Z5HA 2ZT9D 3RBZA 2A45H 3LIDA 2I1KA 2Q3IA 1SQBE 1U7MA 3L74D 1GL2C 2IFNA 3H32B 3KZIH 2E75D 3H1KJ 5AVSB 1SFCD 4Z1MH 1KV4A 3RL0D 5AW1B 3CCUP 4IFMA 4XE5B 2QEXP 4DT0A 1L0LG 3CCEP 5TISH 2OYIA 3KZIE 1VQ7P 1RF0A 3HD7B 2OQQA 4JYBA 3CC4P 1NTKE 3SWFA 1JMMA 3VOPA 1LTAC 1YBKA 3AEGC 1M1JA 4UB6H 5KLIC 3MTUE 1L0NK 1LT9A 2KLUA 1PGOA 3IN6A 2K88A 1YTZT 3H1HE 4YPCA 1SVFA 5KKZB 2R32A 4KHXA 5TISE 1BSHA 3RL0g 1IC2A 4DCKA 1Q86Q 1L0ND 2QJKB 5E79E 5KJ7D 5AVTB 5B66H 3HUSC 1GK6A 3KHUA 4H13D 3EFGA 3RBXA 3Q3DA 1AA0A 2N1TC 3AE1C 3EFFK 4OVNF 2H43A 3CD6P 4UB8H 4PJ0H 1CI6A 4PD4H 1NU1K 1LT1A 5KLVE 2KP8A 3H1HD 5L8RJ 2J59M 2Y0EA 4H13B 1PL5A 3O6QB 3G6EP 3HUSA 1PGPA 4GOFA 3PH0A 3CCMP 1OW7A 1SQQE 1S5LX 3L74J 5AW6B 1ZV8A 1SQVK 2IFMA 1GTWA 1KQFB 3CLQA 2N9YB 3GHGB 5TJHA 1LT9C 1MFZA 2XNXA 3HD7C 4DJGA 5B5EH 1M1JC 5CCHA 3WUVA 2ZFCA 1CW5A 1NU1J 1URQD 3ITKA 2OYIB 1N7SA 2QVAA 3A0BE 2HPCA 3RL0B 5K5GB 2XU6A 3RK2C 3PP5A 1GK4A 1YJNP 1H0TB 3V4WA 4H0LC 5AW4B 1FOSF 1HF9A 4JQ0D 1RE4C 3CXHI 5CCGD 1N8RQ 3H1IG 3OW2O 2FYZA 1KORA 1PPJD 1T2KC 1SQXG 3II6A 1BCCJ 1EZVD 1SQVJ 3AE7C 1D7MA 1H89A 1BDCA 1FDIA 3ZDMA 5DJUB 1NTZK 3AE2C 4TLFA 1PZQA 5CBNA 1T6AA 2ZXXA 3L72E 4N3YB 1GU4A 1FC2C 2P2UA 1M8OB 2BEZF 2K9JA 2IZ0A 2OARA 3TNUA 2WTYA 2KS1B 3CCRP 2YMYA 4Y99C 5BU8B 1NTZD 5CBOA 1IFJA 3UIAA 1IFNA 3O8ZA 2NPSB 2PFXA 4MN4C 1KZUB 1KQLA 1KQGB 3AECC 4N78D 5AVVB 2D2CC 2E74B 2N1TA 3HE5B 3S1KA 1LTBC 2BCCJ 4H44B 4PV1C 3TGUJ 2ZVNB 4D6TE 2QA4P 1NU1D 1KTMA 1IZNB 3GG2A 4BRYA 1CZQA 3JSVC 2CPSA 3H1LD 2OTKE 1U7JA 1UIXA 1HJ0A 1GW4A 1NKNA 2Y9YA 2YIUC 3V5BA 2ZAEB 4H44D 2AEJA 3B5NA 1EDKA 4JYCA 3U1CA 3RK2B 1BGYG 1N7SC 1NTME 2KYVA 1MFTA 2J5UA 3L36A 3L37A 1ZOYC 4YTPC 3TSIA 1L0NG 1WRGA 1JMBA 1KFMA 3AE8C 3AE5C 2R3CA 2K3RA 3P7KA 4L76A 3HRNA 1YITP 1JM0A 3E7KA 4DOJA 2QJYC 3FGAD 1S9KE 3PLNA 3AEFC 3L35A 4N6JA 2QJYB 1AVYA 2HYNA 1GD2E 1L0NJ 5B66E 3EWKA 4RO0A 2K9JB 2M3EA 3N4XA 1HGZA 1ZRTD 3AEAC 1EZVI 1IK9A 2BCCE 2KNCA 2P58A 1K04A 1SQQG 3GW6A 1EQ7A 3GF7A 3BVHA 1S2EA 1YQ4C 3CCJP 4EIJA 2YIUB 2IBZD 4WY4D 2Q3EA 1NHLA 3HD7D 1Y47A 1OWAA 3O6QA 4LC1A 5AVZB 2XZRA 3AE4C 3WMM0 3PRJA 2W90A 1VQNP 1M1JB 1KB9I 4U3FG 4BRYB 3M9BA 2E43A 1BCCG 1SQVG 1YTZI 2KSEA 3KQGA 5E79H 1VQPP 1W2EA 2J58A 3AE6C 4C46A 5KLVK 1KILC 3Q5PA 4O9BA 3VP8A 2W6BA 2ZJSE 4ASWA 5BU5A 2KIKA 3B5NB 2I8DA 2AEFA 1FJKA 3G4SP 1GDTA 1JOCA 3H1HG 1KB9H 1FZCC 2N1TD 4IOIH 1VF5B 3WUUA 3CX5H 3CWBG 1VF5C 1QEXA 3L75D 1QGKB 3WU2E 3GMAA 1KYOH 3MUDA 4LGDE 3D70A 3HUSB 2NRGA 3L73E 3M9HA 1NWQA 1H8AA 1Q90D 1NTKD 1EXIA 3FXEA 3A0HE 3OA7A 1USEA 4HKZH 2YXQB 2Q9IA 1JCDA 1NO4A 2HLOA 2YXRB 3V2QA 1M90Q 4I2LC 3VP9A 1KILD 3CXHD 1NGMB 1X79B 3HTKA 3K5BA 1NTMK 4KT0J 1JCCA 1NTZJ 4ZNCA 1K73Q 3TF5A 2HPCB 1S4XA 3B8EB 3H32A 5CCGA 3RL0C 3VMYA 4XA4A 1RF1A 5APQA 2C9LY 2E75C 1Q2NA 4GODA 1EXJA 1OMIA 1IFIA 1AV1A 1T3UA 1W5CE 3JC22 4PD4I 5AW7B 3CCVP 1FJPA 1S5LE 1VPCA 3GHGC 3NFQA 5KLVD 3PHLA 2OGUA 1RE3C 3USSA 3BATA 1RHZB 3IAOA 1FU1A 1WMKA 1VF5D 3FXDA 1NTMJ 2Z4EA 2L5GB 3T97B 3NTNA 2E5TA 3TK1A 2RKLA 1J1EB 3L75J 4I7ZB 1ZRTE 3V4QA 3HE4A 1SLQA 2FKWB 3W67A 2A06D 2UWJE 1N73A 1GL2B 1OX3A 1PP9J 3C1LA 1S9KD 3BRTB 1URQB 2CK3H 2R3SA 2M8RA 4GDOA 3H1KE 2WWWA 2HG5D 3A2AA 2PP6A 3TDKA 2Q6QA 3TGUG 2KXPB 3SFEC 2GUVA 1LJ2A 1X0TA 3FWLA 1EZVG 2JEEA 3KPEA 2AXCA 1SFCA 1SQQK 3L73J 1RE4A 3L74G 1Q7YQ 2Y0DA 2MJZA 1YQ3C 3MIWA 1NKZB 2JJLA 2KS1A 1HTLC 3CPWO 1L4AC 2M0BA 1FDOA 1L0LD 1N7SB 2LXBA 1YYCA 2D2CD 3A3YB 3AEEC 1LTJA 1EC5A 1JY3N 5AVWB 1KC8Q 3BCCG 1J1EC 1M56D 2WSFJ 1NAYA 2WPVB 3G3ZA 3MGNA 3CCQP 4JPZB 1M1KQ 1R5SA 4N78E 3N7NA 3H1JD 4D6TJ 1SQQJ 2JDIH 3CI9A 3LIEA 4HB1A 1N7SD 4PD4D 4WBAA 5KAIH 1G1JA 1NYHA 3SFDC 4H44C 2OYHC 2FXOA 2YO2A 3A7OA 3BASA 2FYNB 1OVVA 1QLED 4IL6X 5CJ4A 4UB8E 1JUNA 3KDPB 2ZT9B 1PGQA 3H1JE 3PJSK 1YIJP 2WSEJ 3H1JJ 2NPSC 3RK3D 4D6TD 3CC7P 1LTGC 2IYOA 3G71P 1YHQP 2HODB 2IYPA 1RF1C 2JP3A 4GOEA 2OYOA 4HYTB 2FYNC 5APWA 1NJIQ 2FBWC 1PPJE 2WPSA 2C0WA 1JY3P 4C7RA 3CL3D 4ZMDA 1A02F 1A02J 1DX7A 1Z56A 1SFCB 2IPPA 1DEBA 5M1BA 1BGYE 1NTMG 2GM4A 4PJ0E 2FFDB 4Y28J 1E79H 1NAFA 2YKPA 3H1IJ 3CWBD 1MV8A 2Y0CA 1OVRA 2Q7CA 3S9OA 3VTPC 3L71D 1K05A 1KQSO 1XTGB 3C9IA 1N73B 1EZVE 1KFNA 1LTJB 3TNUB 5AW2B 1SQBK 5GTIH 2W83C 1NTKG 1SQQD 3NMDA 1ZXGA 2IZ1A 2KI7B 2WSCJ 3H1ID 1RQUA 2NPSA 1LP1A 2ZYGA 1LGHB 4BXLA 3AEBC 3JCUH 5AW3B 1L0LK 1G2CB 1S3JA 4H0LD 1OXZA 2W6JH 3AE3C 2K37A 2Z5IA 3RK2D 3W68A 3OAKA 4L75A 3SWYA 1URQC 3R4YA 2O01J 1HUCA 3H1KG 2B87B 3I5CA 1DD3A 1LWUA 1RE3A 2FXPA 1SQBJ 3P8MC 2WVRA 4RESB 1X8YA 1HJBA 1IFPA 1GW3A 1IO4A 4U7JA 5KLVG 1NTZG 1JTHA 3L70J 1P84E 1BE3E 3L71J 1MUUA 1K9MQ 1GMJA 2FYUD 1JY2O 2O1KA 1ZMEC 1URQA 3CX5I 5EFWB 3A5TA 2VRSA 1HH0A 1FZCB 3I56P 3H6PA 1KYOI 4I1LA 2RMZA 1P84D 3WUTA 5KKZC 3M0DA 1G1IA 1SQPD 3HE5A 2E5YA 2QRXA 1W2BO 1NU1G 1SFCC 4AYCA 2IBZE 2IBZG 1AQTA 1GL2D 2R5DA 1SQXD 3JCUE 5AVQB 1GU5A 4UB6E 1AQ5A 3VMZA 1JEKA 4H13C 4WY4A 1NH4A 4RKUJ 2BCCD 2I1JA 1J1DB 1H88A 1NTKJ 5KTBA 1OIPA 1SQVD 1BCCD 1LTJC 2YMKA 1FBMA 1GZLA 3H1JG 2RH0A 1T2KD 1BGYD 1KD1Q 1T8ZA 5APSA 1L4AA 1BE3G 2FY8A 3L73D 4HJGH 5H2FE 2V7QH 1LNQA 1PIXA 4AQRD 4NPDA 1N73C 1VQLP 5CCHC 1DD4A 3L75E 2KZJA 3PTZA 4JF7A 4OH8B 3SSUA 2W6AA 3QH9A 4GT1A 1JNMA 1RH5B 1USDA 1VL2A 4EI2A 2JWAA 2M5AB 1UIIA 4RJTA 3CWBE 5GTHE 2B87A 3VYIA 3VN0A 4PV1B 5KLIB 3IFMA 1EDLA 3RK3E 4EOTA 2JWDA 3L72J 2PAJA 3QWOC 1EDJA 2JR8A 1KB9E 3L73G 2KOGA 1IJDB 3H1HJ 1VQKP 1KMIZ 1FAVA 1DEEG 2E76D 2O1JA 2ZT9C 2ZYAA 4PD4E 4WY4C 5CHXA 5APXA 2AXTE 4ASVA 1LWUC 2B89A 3D6ZA 2C0XA 1DH3A 2FFDC 1X9VA 3BRVB 5H2FH 2OTLP 5KAIE 3S4RA 1KILA 2WQYC 2XDJA 1IFMA 3TGUE 1VQ8P 2OYHB 4GKGA 1X22A 3M9QA 1YI2P 1FZGA 2ZXEB 1S72P 3CX5D 1L0LE 3VMXA 5KJ7A 2FFDA 5B5EE 2LR2A 2P67A 4OWFA 5AVYB 1ZN5A 2YO3A 2BCCG 2D2CB 2E74C 4IFFA 1SQPK 2FXMA 5APVA 1SQBG 2KK7A 2M3BA 2SPZA 4OGQC 1CI6B 1PFIA 1VQ6P 1YJWP 1SQXK 1EDIA 3SWKA 4OGQB 3P8CD 3CCLP 3L75G 3MUDC 4YXDC 2B88A 1GL2A 3H1KD 1PGJA 1JB0J 1LT9B 3P8CE 1NTMD 5BVZA 2WITA 3NXSA 4KJMA 3BCCD 2XV5A 3A0HH 2YKOA 1R8EA 1ZP0C 1OW6A 2MKVA 4QMAA 5DJTB 3M0DC 4DZOA 3KXDA 2A06E 4GIFA 5GTIE 3GF3A 1L0LJ 2AEMA 3ABVC 3H1LE 4BWNA 1OZHA 4PV1D 4CPGA 3WU2H 2JKVA 2G8YA 2QJPC 2O01H 1NU1E 1JTHB 2Q1KA 3U1AA 4YXWH 1L4AB 1CSBA 1MKMA 5AW5B 1J2JB 2YKQA 5KAFE 1HVVA 2E75B 3RK3B 3TGUD 3D6YA 3FX0A 3HE4B 2N1TB 1BDDA 1BE3J 2WSFH 4WB4A 4D6TG 1JO5A 1LP1B 3B5ND 2P7JA 1OFCX 3Q2YA 3E1IA 1R5LA 4XFJA 1JY3O 1G2CA 1NTZE 5APTA 2E42A 1M7LA 1QL1A 1LTSC 2FYUJ 2FYUE 1RY3A 4NPEA 1OW8A 1BE3D 3GHGA 2QM8A 2NZ2A 1PP9E 1VDFA 1OVUA 2P1JA 3AE9C 2JO1A 4L74A 5AVRB 1FS0E 2O3JA 1S5LH 1FZFA 2H7HA 1KN7A 1VQ5P 2H89C 2FYUG 3KYQA 1FZAA 3T97A 3MZWB 3TYYA 4NPFX 5CCGC 1VQOP 1VQ4P 1KILE 3CXHE 1XTCC 1TU3F 1NTKK 2H88C 2BEQD 2L91A 3V2RA 1Y8AA 2OYIC 3MP7B 4U3FD 1MZ9A 3L71G 1NOHA 2B9BA 2C9NY 4K3AA 4W7ZA 5AW0B 2HODA 3BCCJ 2POHA 5AW9B 3EQ2A 4EYYQ 3Q1MA 2QG4A 3H1IE 2ZVOB 5AVUB 5APYA 1Q81Q 1BCCE 1SQVE 1ZW0A 2WSSH 3B71A 2XKMA 3M06A 1BGYJ 2LKMA 4U3FE 4U3FJ 4C7NA 2OTJP 2IBZI 2WT7B 2QM7A 2KUBA 4M3LA 2PRRA 3B4SA 5CJ0A 3G9RA 3CMEP 1RQVA 4IFDK 1QL2A 1SQXE 1L2PA 3V6IA 2KB7P 4H0LB 1BSNA 1YJ9P 4K35A 4L73A 1SQPE 2GUSA 3CWBJ 1PP9D 4HH2A 1PPJG 3OJAB 2W27A 3CXHH 1JY2P 2WSCH 3B5NC 5CMZA 2ITAA 4TT3H 2V4HA 3V2NA 3V2PA 3IR9A 5C39A 1IFDA 3Q5RA 2OYHA 4EDFA 2W8ZA 1AFOA 5KJ7C 3CMAP 2PGDA 3LW5H 1LTIC 3R2PA 3VMAA 2CPBA 3C8VA 1SP4A 3RGUA 1S1CX 2DW3A 1L0NE 1ZLLA 2O01N 3FWNA 2KNCB 1SQPG 3GLMA 1HWTC 5AVXB 2A45G 1PV3A 2WMMA 3P32A 2LXCB 4B86A 2NPSD 3RK3C 4WWIA 4I6MC 1VQ9P 1N86A 1SQPJ 4W80A 2N9BA 2QJPB 1FOSE 2KZIA 1H0TA 3BCCE 1QVGO 1SQXJ 2KLVA 2QJKC 2QSIA 3H1LJ 1AVOA 3I55P 1KILB 1E5WA 1HGVA 1JY2N 1SS1A 2ZYDA 3AEDC 1FZBA 1FE6A 3F5HA 4JBZA 3L71E 5APUA 1AJYA 4ZKPA 1WT6A 4A7PA 2WSEH 2K1AA 1Q82Q 1SQBD 2AXTH 2BASA 2WPRA 1U57A 1KYOD 2YNYA 3L74E 3M91A 3LW5J 3L70D 1RF1B 1L4AD 3A0BH 1DIPA 3M0AA 1KYOE 1PP9G 2V7QJ 2XNDH 5KLVJ 2HFED 3CX5E 1NVOA 2R44A 4Y99B 1QVFO 3L72G 4WVZA 2G3AA 1P84I 4I7ZC 3U59A 4ZKUA 1M57D 4LLHA 1ZR4A 2IDBA 2H8PD 2WZ7A 3HD7A 5KAFH 1FZCA 1IK7A 1Y9BA 2E76C 4C7NB 1ZR2A 1HBWA 2P10A 3D71A 3L70G 2K9YA 3E1RA 3HTKB 2M5AA 2QE7H 2FYUK 1VQMP 1LTTC 3CC2P 4IL6H 4OGQD 1FZEA 4R4MA 3F89A 1P84H 2E74D 5AW8B 4WY4B 2IX7C 2WPQA 3L72D 1LWUB 3H1LG 4AUWA 3CCSP 2A06G 2HR3A 4IL6E 2A45I 1N7LA 1RF0C
chains in the Genus database with same CATH topology
5KAIE 3A0BE 3WU2E 5TISE 5H2FE 5E79E 5KAFE 5B5EE 3A0HE 4PJ0E 5GTHE 3KZIE 3JCUE 4UB8E 4UB6E 2AXTE 1W5CE 1S5LE 4IL6E 5GTIE 5B66E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAI E;  3A0B E;  3WU2 E;  5TIS E;  5H2F E;  5E79 E;  5KAF E;  5B5E E;  3A0H E;  4PJ0 E;  5GTH E;  3KZI E;  3JCU E;  4UB8 E;  4UB6 E;  2AXT E;  1W5C E;  1S5L E;  4IL6 E;  5GTI E;  5B66 E; 
#chains in the Genus database with same CATH topology
 5CCH D;  3MD0 A;  4W7Y A;  1J1D C;  3H25 A;  1T3J A;  2GA1 A;  3L4F A;  2RN0 A;  2Y9Z A;  1K8A Q;  2Q5U A;  2QIW A;  4R4L A;  2R5B A;  1QX8 A;  1N2D C;  5GTH H;  1FDM A;  1KB9 D;  2WT7 A;  3Q5S A;  2E76 B;  3L70 E;  2KSJ A;  3IF4 A;  3MHV A;  2Z5H A;  2ZT9 D;  3RBZ A;  2A45 H;  3LID A;  2I1K A;  2Q3I A;  1SQB E;  1U7M A;  3L74 D;  1GL2 C;  2IFN A;  3H32 B;  3KZI H;  2E75 D;  3H1K J;  5AVS B;  1SFC D;  4Z1M H;  1KV4 A;  3RL0 D;  5AW1 B;  3CCU P;  4IFM A;  4XE5 B;  2QEX P;  4DT0 A;  1L0L G;  3CCE P;  5TIS H;  2OYI A;  3KZI E;  1VQ7 P;  1RF0 A;  3HD7 B;  2OQQ A;  4JYB A;  3CC4 P;  1NTK E;  3SWF A;  1JMM A;  3VOP A;  1LTA C;  1YBK A;  3AEG C;  1M1J A;  4UB6 H;  5KLI C;  3MTU E;  1L0N K;  1LT9 A;  2KLU A;  1PGO A;  3IN6 A;  2K88 A;  1YTZ T;  3H1H E;  4YPC A;  1SVF A;  5KKZ B;  2R32 A;  4KHX A;  5TIS E;  1BSH A;  3RL0 g;  1IC2 A;  4DCK A;  1Q86 Q;  1L0N D;  2QJK B;  5E79 E;  5KJ7 D;  5AVT B;  5B66 H;  3HUS C;  1GK6 A;  3KHU A;  4H13 D;  3EFG A;  3RBX A;  3Q3D A;  1AA0 A;  2N1T C;  3AE1 C;  3EFF K;  4OVN F;  2H43 A;  3CD6 P;  4UB8 H;  4PJ0 H;  1CI6 A;  4PD4 H;  1NU1 K;  1LT1 A;  5KLV E;  2KP8 A;  3H1H D;  5L8R J;  2J59 M;  2Y0E A;  4H13 B;  1PL5 A;  3O6Q B;  3G6E P;  3HUS A;  1PGP A;  4GOF A;  3PH0 A;  3CCM P;  1OW7 A;  1SQQ E;  1S5L X;  3L74 J;  5AW6 B;  1ZV8 A;  1SQV K;  2IFM A;  1GTW A;  1KQF B;  3CLQ A;  2N9Y B;  3GHG B;  5TJH A;  1LT9 C;  1MFZ A;  2XNX A;  3HD7 C;  4DJG A;  5B5E H;  1M1J C;  5CCH A;  3WUV A;  2ZFC A;  1CW5 A;  1NU1 J;  1URQ D;  3ITK A;  2OYI B;  1N7S A;  2QVA A;  3A0B E;  2HPC A;  3RL0 B;  5K5G B;  2XU6 A;  3RK2 C;  3PP5 A;  1GK4 A;  1YJN P;  1H0T B;  3V4W A;  4H0L C;  5AW4 B;  1FOS F;  1HF9 A;  4JQ0 D;  1RE4 C;  3CXH I;  5CCG D;  1N8R Q;  3H1I G;  3OW2 O;  2FYZ A;  1KOR A;  1PPJ D;  1T2K C;  1SQX G;  3II6 A;  1BCC J;  1EZV D;  1SQV J;  3AE7 C;  1D7M A;  1H89 A;  1BDC A;  1FDI A;  3ZDM A;  5DJU B;  1NTZ K;  3AE2 C;  4TLF A;  1PZQ A;  5CBN A;  1T6A A;  2ZXX A;  3L72 E;  4N3Y B;  1GU4 A;  1FC2 C;  2P2U A;  1M8O B;  2BEZ F;  2K9J A;  2IZ0 A;  2OAR A;  3TNU A;  2WTY A;  2KS1 B;  3CCR P;  2YMY A;  4Y99 C;  5BU8 B;  1NTZ D;  5CBO A;  1IFJ A;  3UIA A;  1IFN A;  3O8Z A;  2NPS B;  2PFX A;  4MN4 C;  1KZU B;  1KQL A;  1KQG B;  3AEC C;  4N78 D;  5AVV B;  2D2C C;  2E74 B;  2N1T A;  3HE5 B;  3S1K A;  1LTB C;  2BCC J;  4H44 B;  4PV1 C;  3TGU J;  2ZVN B;  4D6T E;  2QA4 P;  1NU1 D;  1KTM A;  1IZN B;  3GG2 A;  4BRY A;  1CZQ A;  3JSV C;  2CPS A;  3H1L D;  2OTK E;  1U7J A;  1UIX A;  1HJ0 A;  1GW4 A;  1NKN A;  2Y9Y A;  2YIU C;  3V5B A;  2ZAE B;  4H44 D;  2AEJ A;  3B5N A;  1EDK A;  4JYC A;  3U1C A;  3RK2 B;  1BGY G;  1N7S C;  1NTM E;  2KYV A;  1MFT A;  2J5U A;  3L36 A;  3L37 A;  1ZOY C;  4YTP C;  3TSI A;  1L0N G;  1WRG A;  1JMB A;  1KFM A;  3AE8 C;  3AE5 C;  2R3C A;  2K3R A;  3P7K A;  4L76 A;  3HRN A;  1YIT P;  1JM0 A;  3E7K A;  4DOJ A;  2QJY C;  3FGA D;  1S9K E;  3PLN A;  3AEF C;  3L35 A;  4N6J A;  2QJY B;  1AVY A;  2HYN A;  1GD2 E;  1L0N J;  5B66 E;  3EWK A;  4RO0 A;  2K9J B;  2M3E A;  3N4X A;  1HGZ A;  1ZRT D;  3AEA C;  1EZV I;  1IK9 A;  2BCC E;  2KNC A;  2P58 A;  1K04 A;  1SQQ G;  3GW6 A;  1EQ7 A;  3GF7 A;  3BVH A;  1S2E A;  1YQ4 C;  3CCJ P;  4EIJ A;  2YIU B;  2IBZ D;  4WY4 D;  2Q3E A;  1NHL A;  3HD7 D;  1Y47 A;  1OWA A;  3O6Q A;  4LC1 A;  5AVZ B;  2XZR A;  3AE4 C;  3WMM 0;  3PRJ A;  2W90 A;  1VQN P;  1M1J B;  1KB9 I;  4U3F G;  4BRY B;  3M9B A;  2E43 A;  1BCC G;  1SQV G;  1YTZ I;  2KSE A;  3KQG A;  5E79 H;  1VQP P;  1W2E A;  2J58 A;  3AE6 C;  4C46 A;  5KLV K;  1KIL C;  3Q5P A;  4O9B A;  3VP8 A;  2W6B A;  2ZJS E;  4ASW A;  5BU5 A;  2KIK A;  3B5N B;  2I8D A;  2AEF A;  1FJK A;  3G4S P;  1GDT A;  1JOC A;  3H1H G;  1KB9 H;  1FZC C;  2N1T D;  4IOI H;  1VF5 B;  3WUU A;  3CX5 H;  3CWB G;  1VF5 C;  1QEX A;  3L75 D;  1QGK B;  3WU2 E;  3GMA A;  1KYO H;  3MUD A;  4LGD E;  3D70 A;  3HUS B;  2NRG A;  3L73 E;  3M9H A;  1NWQ A;  1H8A A;  1Q90 D;  1NTK D;  1EXI A;  3FXE A;  3A0H E;  3OA7 A;  1USE A;  4HKZ H;  2YXQ B;  2Q9I A;  1JCD A;  1NO4 A;  2HLO A;  2YXR B;  3V2Q A;  1M90 Q;  4I2L C;  3VP9 A;  1KIL D;  3CXH D;  1NGM B;  1X79 B;  3HTK A;  3K5B A;  1NTM K;  4KT0 J;  1JCC A;  1NTZ J;  4ZNC A;  1K73 Q;  3TF5 A;  2HPC B;  1S4X A;  3B8E B;  3H32 A;  5CCG A;  3RL0 C;  3VMY A;  4XA4 A;  1RF1 A;  5APQ A;  2C9L Y;  2E75 C;  1Q2N A;  4GOD A;  1EXJ A;  1OMI A;  1IFI A;  1AV1 A;  1T3U A;  1W5C E;  3JC2 2;  4PD4 I;  5AW7 B;  3CCV P;  1FJP A;  1S5L E;  1VPC A;  3GHG C;  3NFQ A;  5KLV D;  3PHL A;  2OGU A;  1RE3 C;  3USS A;  3BAT A;  1RHZ B;  3IAO A;  1FU1 A;  1WMK A;  1VF5 D;  3FXD A;  1NTM J;  2Z4E A;  2L5G B;  3T97 B;  3NTN A;  2E5T A;  3TK1 A;  2RKL A;  1J1E B;  3L75 J;  4I7Z B;  1ZRT E;  3V4Q A;  3HE4 A;  1SLQ A;  2FKW B;  3W67 A;  2A06 D;  2UWJ E;  1N73 A;  1GL2 B;  1OX3 A;  1PP9 J;  3C1L A;  1S9K D;  3BRT B;  1URQ B;  2CK3 H;  2R3S A;  2M8R A;  4GDO A;  3H1K E;  2WWW A;  2HG5 D;  3A2A A;  2PP6 A;  3TDK A;  2Q6Q A;  3TGU G;  2KXP B;  3SFE C;  2GUV A;  1LJ2 A;  1X0T A;  3FWL A;  1EZV G;  2JEE A;  3KPE A;  2AXC A;  1SFC A;  1SQQ K;  3L73 J;  1RE4 A;  3L74 G;  1Q7Y Q;  2Y0D A;  2MJZ A;  1YQ3 C;  3MIW A;  1NKZ B;  2JJL A;  2KS1 A;  1HTL C;  3CPW O;  1L4A C;  2M0B A;  1FDO A;  1L0L D;  1N7S B;  2LXB A;  1YYC A;  2D2C D;  3A3Y B;  3AEE C;  1LTJ A;  1EC5 A;  1JY3 N;  5AVW B;  1KC8 Q;  3BCC G;  1J1E C;  1M56 D;  2WSF J;  1NAY A;  2WPV B;  3G3Z A;  3MGN A;  3CCQ P;  4JPZ B;  1M1K Q;  1R5S A;  4N78 E;  3N7N A;  3H1J D;  4D6T J;  1SQQ J;  2JDI H;  3CI9 A;  3LIE A;  4HB1 A;  1N7S D;  4PD4 D;  4WBA A;  5KAI H;  1G1J A;  1NYH A;  3SFD C;  4H44 C;  2OYH C;  2FXO A;  2YO2 A;  3A7O A;  3BAS A;  2FYN B;  1OVV A;  1QLE D;  4IL6 X;  5CJ4 A;  4UB8 E;  1JUN A;  3KDP B;  2ZT9 B;  1PGQ A;  3H1J E;  3PJS K;  1YIJ P;  2WSE J;  3H1J J;  2NPS C;  3RK3 D;  4D6T D;  3CC7 P;  1LTG C;  2IYO A;  3G71 P;  1YHQ P;  2HOD B;  2IYP A;  1RF1 C;  2JP3 A;  4GOE A;  2OYO A;  4HYT B;  2FYN C;  5APW A;  1NJI Q;  2FBW C;  1PPJ E;  2WPS A;  2C0W A;  1JY3 P;  4C7R A;  3CL3 D;  4ZMD A;  1A02 F;  1A02 J;  1DX7 A;  1Z56 A;  1SFC B;  2IPP A;  1DEB A;  5M1B A;  1BGY E;  1NTM G;  2GM4 A;  4PJ0 E;  2FFD B;  4Y28 J;  1E79 H;  1NAF A;  2YKP A;  3H1I J;  3CWB D;  1MV8 A;  2Y0C A;  1OVR A;  2Q7C A;  3S9O A;  3VTP C;  3L71 D;  1K05 A;  1KQS O;  1XTG B;  3C9I A;  1N73 B;  1EZV E;  1KFN A;  1LTJ B;  3TNU B;  5AW2 B;  1SQB K;  5GTI H;  2W83 C;  1NTK G;  1SQQ D;  3NMD A;  1ZXG A;  2IZ1 A;  2KI7 B;  2WSC J;  3H1I D;  1RQU A;  2NPS A;  1LP1 A;  2ZYG A;  1LGH B;  4BXL A;  3AEB C;  3JCU H;  5AW3 B;  1L0L K;  1G2C B;  1S3J A;  4H0L D;  1OXZ A;  2W6J H;  3AE3 C;  2K37 A;  2Z5I A;  3RK2 D;  3W68 A;  3OAK A;  4L75 A;  3SWY A;  1URQ C;  3R4Y A;  2O01 J;  1HUC A;  3H1K G;  2B87 B;  3I5C A;  1DD3 A;  1LWU A;  1RE3 A;  2FXP A;  1SQB J;  3P8M C;  2WVR A;  4RES B;  1X8Y A;  1HJB A;  1IFP A;  1GW3 A;  1IO4 A;  4U7J A;  5KLV G;  1NTZ G;  1JTH A;  3L70 J;  1P84 E;  1BE3 E;  3L71 J;  1MUU A;  1K9M Q;  1GMJ A;  2FYU D;  1JY2 O;  2O1K A;  1ZME C;  1URQ A;  3CX5 I;  5EFW B;  3A5T A;  2VRS A;  1HH0 A;  1FZC B;  3I56 P;  3H6P A;  1KYO I;  4I1L A;  2RMZ A;  1P84 D;  3WUT A;  5KKZ C;  3M0D A;  1G1I A;  1SQP D;  3HE5 A;  2E5Y A;  2QRX A;  1W2B O;  1NU1 G;  1SFC C;  4AYC A;  2IBZ E;  2IBZ G;  1AQT A;  1GL2 D;  2R5D A;  1SQX D;  3JCU E;  5AVQ B;  1GU5 A;  4UB6 E;  1AQ5 A;  3VMZ A;  1JEK A;  4H13 C;  4WY4 A;  1NH4 A;  4RKU J;  2BCC D;  2I1J A;  1J1D B;  1H88 A;  1NTK J;  5KTB A;  1OIP A;  1SQV D;  1BCC D;  1LTJ C;  2YMK A;  1FBM A;  1GZL A;  3H1J G;  2RH0 A;  1T2K D;  1BGY D;  1KD1 Q;  1T8Z A;  5APS A;  1L4A A;  1BE3 G;  2FY8 A;  3L73 D;  4HJG H;  5H2F E;  2V7Q H;  1LNQ A;  1PIX A;  4AQR D;  4NPD A;  1N73 C;  1VQL P;  5CCH C;  1DD4 A;  3L75 E;  2KZJ A;  3PTZ A;  4JF7 A;  4OH8 B;  3SSU A;  2W6A A;  3QH9 A;  4GT1 A;  1JNM A;  1RH5 B;  1USD A;  1VL2 A;  4EI2 A;  2JWA A;  2M5A B;  1UII A;  4RJT A;  3CWB E;  5GTH E;  2B87 A;  3VYI A;  3VN0 A;  4PV1 B;  5KLI B;  3IFM A;  1EDL A;  3RK3 E;  4EOT A;  2JWD A;  3L72 J;  2PAJ A;  3QWO C;  1EDJ A;  2JR8 A;  1KB9 E;  3L73 G;  2KOG A;  1IJD B;  3H1H J;  1VQK P;  1KMI Z;  1FAV A;  1DEE G;  2E76 D;  2O1J A;  2ZT9 C;  2ZYA A;  4PD4 E;  4WY4 C;  5CHX A;  5APX A;  2AXT E;  4ASV A;  1LWU C;  2B89 A;  3D6Z A;  2C0X A;  1DH3 A;  2FFD C;  1X9V A;  3BRV B;  5H2F H;  2OTL P;  5KAI E;  3S4R A;  1KIL A;  2WQY C;  2XDJ A;  1IFM A;  3TGU E;  1VQ8 P;  2OYH B;  4GKG A;  1X22 A;  3M9Q A;  1YI2 P;  1FZG A;  2ZXE B;  1S72 P;  3CX5 D;  1L0L E;  3VMX A;  5KJ7 A;  2FFD A;  5B5E E;  2LR2 A;  2P67 A;  4OWF A;  5AVY B;  1ZN5 A;  2YO3 A;  2BCC G;  2D2C B;  2E74 C;  4IFF A;  1SQP K;  2FXM A;  5APV A;  1SQB G;  2KK7 A;  2M3B A;  2SPZ A;  4OGQ C;  1CI6 B;  1PFI A;  1VQ6 P;  1YJW P;  1SQX K;  1EDI A;  3SWK A;  4OGQ B;  3P8C D;  3CCL P;  3L75 G;  3MUD C;  4YXD C;  2B88 A;  1GL2 A;  3H1K D;  1PGJ A;  1JB0 J;  1LT9 B;  3P8C E;  1NTM D;  5BVZ A;  2WIT A;  3NXS A;  4KJM A;  3BCC D;  2XV5 A;  3A0H H;  2YKO A;  1R8E A;  1ZP0 C;  1OW6 A;  2MKV A;  4QMA A;  5DJT B;  3M0D C;  4DZO A;  3KXD A;  2A06 E;  4GIF A;  5GTI E;  3GF3 A;  1L0L J;  2AEM A;  3ABV C;  3H1L E;  4BWN A;  1OZH A;  4PV1 D;  4CPG A;  3WU2 H;  2JKV A;  2G8Y A;  2QJP C;  2O01 H;  1NU1 E;  1JTH B;  2Q1K A;  3U1A A;  4YXW H;  1L4A B;  1CSB A;  1MKM A;  5AW5 B;  1J2J B;  2YKQ A;  5KAF E;  1HVV A;  2E75 B;  3RK3 B;  3TGU D;  3D6Y A;  3FX0 A;  3HE4 B;  2N1T B;  1BDD A;  1BE3 J;  2WSF H;  4WB4 A;  4D6T G;  1JO5 A;  1LP1 B;  3B5N D;  2P7J A;  1OFC X;  3Q2Y A;  3E1I A;  1R5L A;  4XFJ A;  1JY3 O;  1G2C A;  1NTZ E;  5APT A;  2E42 A;  1M7L A;  1QL1 A;  1LTS C;  2FYU J;  2FYU E;  1RY3 A;  4NPE A;  1OW8 A;  1BE3 D;  3GHG A;  2QM8 A;  2NZ2 A;  1PP9 E;  1VDF A;  1OVU A;  2P1J A;  3AE9 C;  2JO1 A;  4L74 A;  5AVR B;  1FS0 E;  2O3J A;  1S5L H;  1FZF A;  2H7H A;  1KN7 A;  1VQ5 P;  2H89 C;  2FYU G;  3KYQ A;  1FZA A;  3T97 A;  3MZW B;  3TYY A;  4NPF X;  5CCG C;  1VQO P;  1VQ4 P;  1KIL E;  3CXH E;  1XTC C;  1TU3 F;  1NTK K;  2H88 C;  2BEQ D;  2L91 A;  3V2R A;  1Y8A A;  2OYI C;  3MP7 B;  4U3F D;  1MZ9 A;  3L71 G;  1NOH A;  2B9B A;  2C9N Y;  4K3A A;  4W7Z A;  5AW0 B;  2HOD A;  3BCC J;  2POH A;  5AW9 B;  3EQ2 A;  4EYY Q;  3Q1M A;  2QG4 A;  3H1I E;  2ZVO B;  5AVU B;  5APY A;  1Q81 Q;  1BCC E;  1SQV E;  1ZW0 A;  2WSS H;  3B71 A;  2XKM A;  3M06 A;  1BGY J;  2LKM A;  4U3F E;  4U3F J;  4C7N A;  2OTJ P;  2IBZ I;  2WT7 B;  2QM7 A;  2KUB A;  4M3L A;  2PRR A;  3B4S A;  5CJ0 A;  3G9R A;  3CME P;  1RQV A;  4IFD K;  1QL2 A;  1SQX E;  1L2P A;  3V6I A;  2KB7 P;  4H0L B;  1BSN A;  1YJ9 P;  4K35 A;  4L73 A;  1SQP E;  2GUS A;  3CWB J;  1PP9 D;  4HH2 A;  1PPJ G;  3OJA B;  2W27 A;  3CXH H;  1JY2 P;  2WSC H;  3B5N C;  5CMZ A;  2ITA A;  4TT3 H;  2V4H A;  3V2N A;  3V2P A;  3IR9 A;  5C39 A;  1IFD A;  3Q5R A;  2OYH A;  4EDF A;  2W8Z A;  1AFO A;  5KJ7 C;  3CMA P;  2PGD A;  3LW5 H;  1LTI C;  3R2P A;  3VMA A;  2CPB A;  3C8V A;  1SP4 A;  3RGU A;  1S1C X;  2DW3 A;  1L0N E;  1ZLL A;  2O01 N;  3FWN A;  2KNC B;  1SQP G;  3GLM A;  1HWT C;  5AVX B;  2A45 G;  1PV3 A;  2WMM A;  3P32 A;  2LXC B;  4B86 A;  2NPS D;  3RK3 C;  4WWI A;  4I6M C;  1VQ9 P;  1N86 A;  1SQP J;  4W80 A;  2N9B A;  2QJP B;  1FOS E;  2KZI A;  1H0T A;  3BCC E;  1QVG O;  1SQX J;  2KLV A;  2QJK C;  2QSI A;  3H1L J;  1AVO A;  3I55 P;  1KIL B;  1E5W A;  1HGV A;  1JY2 N;  1SS1 A;  2ZYD A;  3AED C;  1FZB A;  1FE6 A;  3F5H A;  4JBZ A;  3L71 E;  5APU A;  1AJY A;  4ZKP A;  1WT6 A;  4A7P A;  2WSE H;  2K1A A;  1Q82 Q;  1SQB D;  2AXT H;  2BAS A;  2WPR A;  1U57 A;  1KYO D;  2YNY A;  3L74 E;  3M91 A;  3LW5 J;  3L70 D;  1RF1 B;  1L4A D;  3A0B H;  1DIP A;  3M0A A;  1KYO E;  1PP9 G;  2V7Q J;  2XND H;  5KLV J;  2HFE D;  3CX5 E;  1NVO A;  2R44 A;  4Y99 B;  1QVF O;  3L72 G;  4WVZ A;  2G3A A;  1P84 I;  4I7Z C;  3U59 A;  4ZKU A;  1M57 D;  4LLH A;  1ZR4 A;  2IDB A;  2H8P D;  2WZ7 A;  3HD7 A;  5KAF H;  1FZC A;  1IK7 A;  1Y9B A;  2E76 C;  4C7N B;  1ZR2 A;  1HBW A;  2P10 A;  3D71 A;  3L70 G;  2K9Y A;  3E1R A;  3HTK B;  2M5A A;  2QE7 H;  2FYU K;  1VQM P;  1LTT C;  3CC2 P;  4IL6 H;  4OGQ D;  1FZE A;  4R4M A;  3F89 A;  1P84 H;  2E74 D;  5AW8 B;  4WY4 B;  2IX7 C;  2WPQ A;  3L72 D;  1LWU B;  3H1L G;  4AUW A;  3CCS P;  2A06 G;  2HR3 A;  4IL6 E;  2A45 I;  1N7L A;  1RF0 C; 
#chains in the Genus database with same CATH homology
 5KAI E;  3A0B E;  3WU2 E;  5TIS E;  5H2F E;  5E79 E;  5KAF E;  5B5E E;  3A0H E;  4PJ0 E;  5GTH E;  3KZI E;  3JCU E;  4UB8 E;  4UB6 E;  2AXT E;  1W5C E;  1S5L E;  4IL6 E;  5GTI E;  5B66 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...