5B66E

Crystal structure analysis of photosystem ii complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
78
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
total genus 21
structure length 78
sequence length 78
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5b66E00
5GTIE 4UB8E 5KAFE 3JCUE 5KAIE 5B66E 4UB6E 4PJ0E 5E79E 1W5CE 1S5LE 5H2FE 3KZIE 5B5EE 3WU2E 5TISE 2AXTE 4IL6E 3A0HE 3A0BE 5GTHE
chains in the Genus database with same CATH superfamily
1JY3O 1G1IA 4WB4A 1FBMA 3B5NC 3PTZA 3Q3DA 4L73A 4NPDA 1GMJA 4ZKUA 3V6IA 2K37A 1G1JA 1JTHB 1L0ND 2POHA 2ZT9B 3L36A 3L73D 1X22A 3JCUE 4U3FG 3M9QA 4H0LC 2B89A 1K05A 2IBZE 1ZLLA 4WVZA 2E5YA 1SQPD 2OYHA 3LIEA 1QVFO 2XZRA 1G2CB 1ZXGA 4GOFA 1P84E 1L4AB 1SQQJ 2RN0A 1T2KC 1SQVK 1KYOD 2JR8A 1PP9J 3CCJP 2OYHB 3I5CA 3ZDMA 1GW4A 1NKZB 5AW3B 1T8ZA 5AW0B 1RQVA 2M0BA 1KQSO 1QL2A 1ZN5A 2KXPB 2SPZA 3AEBC 2LR2A 2WZ7A 1OW6A 3F5HA 2KUBA 3GF3A 4WWIA 4B86A 3H25A 4H13C 1SP4A 3L75G 1OX3A 1NTKD 2Q7CA 1SQBG 5CBOA 5GTHE 1FJPA 5CHXA 1L0LK 2N1TD 4ZMDA 5CCGD 2O1KA 4GT1A 2FYUD 3RBZA 1ZRTD 4ASVA 1RH5B 1N7SB 2A45G 1YI2P 1JCCA 1KQLA 1VDFA 2FYNB 3L73G 3VP9A 4PV1D 1OW7A 4U3FD 5KAIE 1GD2E 3B5NA 4DZOA 5AVQB 1GU4A 4IOIH 3VP8A 2BEZF 3V2NA 1MUUA 1SQPG 1S1CX 2A45H 4L74A 1MKMA 1EQ7A 2M5AB 1D7MA 1Y9BA 1LT9B 1S5LE 1LTIC 3PHLA 3VMAA 2N9BA 5B5EH 3CMAP 1Q81Q 1VQ4P 2K1AA 1YIJP 1LP1B 1M1JC 2IYOA 2OQQA 3AEGC 1NOHA 4HJGH 1YITP 2J59M 4L76A 1PPJG 1GZLA 1LTJA 3A0HE 2QJKB 1UIIA 4RO0A 1UIXA 4Y99C 3AE7C 5KKZC 1NTKG 4PD4E 4K35A 3AEEC 3TF5A 3HD7A 4OGQB 1L0LD 2A45I 2P1JA 5AVWB 3CC2P 4BRYB 3D6ZA 2G3AA 2B87B 4LLHA 2P7JA 4UB8E 2WPQA 4H44D 4YXDC 3Q5SA 3HD7B 1P84H 2B9BA 3L72G 5AW7B 2PP6A 1BGYE 2H8PD 5APVA 5KAFH 4GKGA 1X79B 1GL2D 2AEJA 2PFXA 1KV4A 3AEFC 1FDIA 3C9IA 4JBZA 4N78D 2HPCA 1FZCB 1YJNP 1PFIA 2JEEA 1VF5C 3RBXA 5AVVB 3TGUJ 4AUWA 3NXSA 1ZOYC 5CBNA 3CXHD 1PGOA 1NU1G 2VRSA 3H1KE 5AW4B 1NU1J 1HF9A 3NFQA 2JP3A 1NTME 2D2CC 2KYVA 4N3YB 3RK3B 1GTWA 1ZMEC 2B87A 1LWUA 1M1KQ 3WUVA 5B66H 1J1EC 1SQQG 2H89C 3AE1C 1IK7A 5BU5A 5KJ7D 5KKZB 1NYHA 3CC7P 2R44A 1EZVE 1RE3A 4IFDK 5KTBA 5DJTB 3WU2E 3O6QA 2ZXXA 4KJMA 1M7LA 1S3JA 4GDOA 3TK1A 2G8YA 3E1IA 5TISH 2YMKA 1SQQE 1URQA 2ITAA 2OYIA 1VQKP 2Q6QA 2XNDH 3L75J 1OIPA 1BCCE 3AEDC 3QH9A 5APTA 1RE3C 2BCCD 4M3LA 5E79E 2WMMA 3RL0B 2HYNA 2O3JA 2OTKE 1NU1E 2XDJA 3MHVA 4YPCA 1L0NJ 4TLFA 3U1AA 3KQGA 1IJDB 4PV1C 1EDJA 1NVOA 4U7JA 1HUCA 1RF1C 3EWKA 1MV8A 4EOTA 2YMYA 1VQ9P 3HTKB 2OYIB 2P2UA 2IFMA 2PAJA 2CPBA 5APUA 4KT0J 5KLVE 2KSJA 4DT0A 3MUDC 2E74D 5H2FH 3VMXA 1EDLA 1Q82Q 2JO1A 3V2PA 1KB9D 4H0LB 2QJYC 3RL0g 2NPSD 1BSNA 1KFMA 1NAYA 3L72E 1YYCA 5KLIB 2OGUA 1K8AQ 2R3CA 3A3YB 3BASA 1L4AC 2I1KA 1ZRTE 3BCCJ 2FYUE 2I1JA 3CWBG 5CJ4A 3CCLP 2W27A 1CZQA 4IL6X 2FBWC 3F89A 3S9OA 3FWNA 3A0HH 3H1HG 3WU2H 3A5TA 3JSVC 2Y9YA 3A7OA 3H1KD 1IFMA 4I2LC 3G4SP 2PGDA 5CCGA 1LWUC 1LTSC 1BCCD 1PPJE 4UB8H 3RGUA 1H88A 1VQ7P 2E74B 3CWBE 3R4YA 1DX7A 3A0BH 1EC5A 1T6AA 4ZNCA 3P32A 3MP7B 3MD0A 2O01J 1KYOE 3N4XA 2M3EA 3PJSK 5TJHA 1J1DC 1FZBA 4U3FE 1L0NK 1IFIA 1FOSE 2FYNC 2Y0DA 4R4MA 3VMZA 1NHLA 1SQPJ 2ZVNB 3TGUG 2QE7H 3V2QA 2GUVA 3H1LD 3HE5A 2FXPA 3SSUA 3CI9A 4WY4D 1LTTC 1L0LE 4NPFX 1QLED 2W6JH 1ZV8A 1Q7YQ 1BDCA 2Q9IA 1LTJB 1L0NE 2WITA 4PD4D 1Z56A 1YQ3C 1NTZK 1U57A 2H88C 2MKVA 3RK2C 1GU5A 1BE3J 1M1JB 1FZEA 2J58A 3AEAC 3C1LA 5AW8B 1LP1A 4GOEA 3USSA 3HD7D 1BCCG 2HFED 3KZIE 1GDTA 2WTYA 1VQ8P 1P84D 2FYUJ 2Q3IA 5TISE 2E75B 2L5GB 2NPSC 1LTGC 3H1IJ 1N7LA 4JYBA 1FJKA 3PH0A 2IBZD 3V4WA 2WVRA 2OYOA 5GTHH 1KFNA 1MFZA 2MJZA 1SLQA 1JOCA 1LGHB 2YKPA 2ZYDA 3N7NA 1CW5A 1H0TA 4BRYA 2C9LY 1HH0A 1L4AD 1SFCD 1CI6A 2Z5IA 3HD7C 2QIWA 4EI2A 1PGJA 2R5DA 4ASWA 3OJAB 2FXMA 2C0XA 1PGPA 1DH3A 3B71A 4YXWH 2YNYA 1JY2O 4C7RA 1HVVA 2QJPC 2KNCB 3M91A 1S5LX 2FFDC 1RF0C 1IO4A 1SQVE 3CC4P 2I8DA 1FZAA 2W6BA 3CCSP 1M90Q 2FYZA 2JWAA 3I56P 5M1BA 1SQPK 4D6TD 4KHXA 2OTJP 3IAOA 5APSA 4I6MC 1N73C 3HTKA 1QL1A 1J2JB 3VTPC 2HODB 2WSEJ 3BRVB 3OW2O 5EFWB 1LNQA 4I1LA 3SFDC 1X8YA 4PJ0H 3M0DC 1NTZG 1NTZJ 1J1EB 2HODA 3C8VA 2IX7C 4Z1MH 1KILE 3SWYA 1URQD 2LXBA 2N1TB 2Y0EA 3H6PA 3PLNA 2QRXA 3SFEC 2ZXEB 1A02J 3CCRP 3HUSB 5L8RJ 3UIAA 1JY3P 3CL3D 1NTMK 2ZVOB 1SQBJ 1AQTA 2FYUK 2W83C 2K9JA 3O6QB 5AW1B 3LW5H 3M9HA 1DD4A 1KILA 1SQXD 3L71E 3VYIA 2CPSA 2WT7A 1ZR2A 4H13B 1L0NG 3HUSA 3O8ZA 1E5WA 1H89A 4DCKA 3WMM0 3RK3E 1Q2NA 1ZR4A 4GODA 3L73J 3D70A 1HBWA 2JDIH 3Q1MA 1N2DC 2Q1KA 1N7SC 1JO5A 1H0TB 1NAFA 3KPEA 3LW5J 3TGUE 4PV1B 1EDIA 1R5LA 1AV1A 1NJIQ 5KAIH 2IFNA 2WSFJ 2YKQA 3M9BA 5CJ0A 2QA4P 1VQMP 1W2BO 1VQLP 1EXJA 3EFGA 1BGYJ 2E5TA 1NH4A 1BDDA 2NPSA 1NTZD 1PGQA 2CK3H 3SWFA 1VF5D 2XV5A 2KP8A 4LGDE 2IZ0A 2KB7P 1FZCA 1URQB 3A0BE 2QJYB 2AXCA 2E75D 2YKOA 3CCMP 2KNCA 5AW2B 3CCQP 3L75D 2Z4EA 1JTHA 1KYOH 3GHGB 1VQ5P 5C39A 1NTKJ 1FZFA 1RE4C 2JWDA 2BCCJ 4ZKPA 1SQXJ 3L75E 1HGVA 1GW3A 2FYUG 1OVUA 1SQXG 3H1HJ 3JC22 4JF7A 3L4FA 3BCCE 5GTIE 2A06G 2P67A 3RL0D 1YHQP 3D6YA 4PD4H 3PRJA 2BASA 2E42A 4C7NA 2FKWB 1AVOA 1CI6B 3QWOC 4OGQC 4XE5B 2DW3A 2WQYC 3L72J 3H1LE 1SQBK 3I55P 1IFPA 1M57D 1ZW0A 3H32B 2W8ZA 1USEA 1W5CE 4PJ0E 3VMYA 4BWNA 4DJGA 1SQXK 1OVVA 3MZWB 1KYOI 3SWKA 5AVYB 1N86A 1VL2A 2FXOA 3D71A 1J1DB 1PZQA 1OMIA 1WMKA 1XTGB 4WBAA 1BSHA 1LT9A 1P84I 2QG4A 1IZNB 1VF5B 1JY2P 1PPJD 4D6TE 2W90A 3L74D 1EXIA 1QVGO 1OXZA 5AW9B 2XNXA 3L37A 1LTAC 1SQVD 1XTCC 1Q90D 2WSEH 3GF7A 2P58A 1IC2A 1S9KD 1FC2C 1T3JA 2A06D 4L75A 5AW6B 4CPGA 1BCCJ 1KILB 2WT7B 3RK2B 3VN0A 3H1IG 3G71P 3VOPA 3L72D 2YIUB 5CCGC 1Y8AA 2E76B 3CCEP 1PP9E 4I7ZC 1NU1K 1OFCX 2IYPA 2K88A 2KOGA 4H44C 2XKMA 4HB1A 2QSIA 1AQ5A 2N1TA 1IFJA 2QVAA 4H0LD 3G3ZA 2UWJE 1QX8A 3CCVP 2K3RA 2RH0A 3CXHI 1SFCA 3GMAA 1LJ2A 1NTMG 1KTMA 2O01H 1NTMJ 2RKLA 2AXTE 4PD4I 1JCDA 3B5ND 2R32A 5AVRB 1T2KD 3AE6C 3B5NB 2LXCB 2IPPA 2KS1A 2C0WA 3FX0A 1RE4A 3HE4B 3MGNA 3V2RA 1KD1Q 2KSEA 2ZT9C 1RF1B 1SQVJ 1SFCC 2QJPB 1GL2A 2WSFH 1DEBA 3CX5E 3AECC 4OH8B 1Q86Q 2ZJSE 3AE4C 3L35A 2Y0CA 4C46A 1BGYG 2OYIC 2ZYAA 4OWFA 1NWQA 3IR9A 3TSIA 1VPCA 1IFNA 1QEXA 1SS1A 3IF4A 4JYCA 4U3FJ 5KLVD 3H1ID 4MN4C 3HRNA 3GW6A 4EYYQ 2HG5D 3H1JE 2FY8A 1GL2C 1OW8A 1PIXA 2V7QH 3CWBJ 2Q3EA 3IN6A 1WT6A 1GK6A 3E7KA 1JMMA 2BCCG 3L70J 4XA4A 5KLIC 3U59A 5GTIH 3Q5RA 2OYHC 1VQOP 2O01N 5KJ7A 3BATA 1Y47A 1NTMD 2N1TC 3G6EP 1KQGB 1G2CA 1OWAA 1OZHA 3AE3C 1DD3A 2Z5HA 3BRTB 1KB9H 3M0DA 4JPZB 1BE3E 2BEQD 3AE8C 4NPEA 2BCCE 4OGQD 2GM4A 1E79H 5DJUB 1M8OB 4IL6E 4WY4C 1JEKA 3MIWA 4QMAA 3EQ2A 3CPWO 1NGMB 3KYQA 1DEEG 2ZYGA 3B4SA 4D6TJ 1FE6A 1BGYD 1L0LG 5AVUB 2YO2A 1KMIZ 1HGZA 3CLQA 2KZIA 2WPVB 3HE5B 3CMEP 1PV3A 5KLVG 2AEFA 1HJBA 1MZ9A 1N73B 1LT9C 2O1JA 3FXDA 3CWBD 1ZP0C 2N9YB 2P10A 1JNMA 3LIDA 1KORA 3A2AA 3P8MC 3ITKA 1AJYA 3H1HD 4HH2A 1LTJC 2ZT9D 2E76D 5AVSB 3WUTA 1VQNP 1BE3G 1AVYA 3TNUB 1M1JA 1URQC 3Q5PA 1N7SD 4AYCA 1EDKA 2OTLP 2FFDA 1NU1D 3T97B 2GA1A 3H1HE 3R2PA 4C7NB 1T3UA 2ZAEB 1KB9E 2YXRB 4UB6H 4Y28J 1RY3A 2V7QJ 1K9MQ 1SQQD 1FAVA 1KZUB 2KI7B 2M8RA 3S4RA 1PP9D 2H43A 1HWTC 1SQQK 3M06A 2H7HA 3V4QA 2YO3A 3KDPB 1FDOA 1YTZI 1EZVD 1LTBC 2JKVA 2Y9ZA 5KAFE 1YQ4C 1GK4A 1K73Q 1VQPP 1R5SA 3GHGA 3MUDA 3U1CA 1HTLC 4W7ZA 1X9VA 2WSCH 5APWA 2FFDB 4W80A 1M56D 5BU8B 2WSCJ 1LT1A 2WPSA 1YBKA 1BE3D 3GG2A 3CX5H 1IK9A 4H13D 4HYTB 1AFOA 4BXLA 2IBZI 3RK3C 5B5EE 5CCHA 4WY4A 1YJWP 1PL5A 4N78E 3FWLA 2NZ2A 3L70G 4R4LA 3V5BA 4OVNF 3GLMA 1JUNA 1IFDA 2KIKA 2Q5UA 4A7PA 1MFTA 4RESB 2QM7A 3H1IE 4YTPC 3W67A 5KJ7C 4RKUJ 2A06E 3FXEA 4N6JA 1PP9G 1YJ9P 4W7YA 2YIUC 3M0AA 2XU6A 1EZVG 2KLUA 3HUSC 4TT3H 1NO4A 2LKMA 3CX5D 2KS1B 3G9RA 3HE4A 1JB0J 1USDA 3BCCD 3CXHE 5CMZA 5B66E 1RF1A 2KZJA 2OARA 5CCHC 2R3SA 2YXQB 2R5BA 3L74J 2KK7A 4D6TG 2QEXP 1FZGA 1L0LJ 2V4HA 2HLOA 3H1KG 2KLVA 1L4AA 3OA7A 3Q2YA 5AVTB 2E43A 3CD6P 3TDKA 5KLVJ 3H1JD 1FS0E 2D2CD 2IDBA 1HJ0A 3II6A 3NMDA 5APQA 3CCUP 1SFCB 1SQPE 3CX5I 3OAKA 3TGUD 3CXHH 3IFMA 3P8CE 4AQRD 3L70D 1OVRA 1RF0A 5E79H 3EFFK 3JCUH 1KC8Q 4IL6H 1X0TA 2HR3A 3H1LJ 1NKNA 5AW5B 1N8RQ 2K9JB 3H1LG 3PP5A 2QJKC 5KLVK 2JJLA 3MTUE 1GL2B 4Y99B 1S72P 2WWWA 2C9NY 4EIJA 3GHGC 4IFMA 1SQBE 2WSSH 5CCHD 2K9YA 1SVFA 1NTKE 3BCCG 3K5BA 2B88A 3L71D 1SQXE 3S1KA 1LWUB 1RHZB 3AE9C 4O9BA 4UB6E 2E74C 1K04A 1S2EA 4HKZH 3AE5C 4XFJA 1AA0A 1RQUA 5H2FE 4WY4B 1R8EA 3H1JJ 1KILD 1NTKK 2HPCB 3KHUA 3H1JG 4EDFA 1FZCC 1S4XA 3WUUA 2IBZG 2M5AA 1KN7A 1S9KE 3W68A 1YTZT 5K5GB 1WRGA 1TU3F 1L2PA 3RK3D 2ZFCA 3L73E 1A02F 3ABVC 2AXTH 2D2CB 2RMZA 2L91A 1FU1A 1H8AA 5AVZB 3L74E 1N7SA 3KXDA 2W6AA 2WPRA 5AVXB 2QM8A 3AE2C 2AEMA 3L71J 1EZVI 3L71G 4LC1A 3T97A 3TYYA 3RK2D 3B8EB 1KILC 2E75C 2NPSB 3FGAD 3KZIH 5APXA 1JY3N 4IFFA 1FOSF 1KQFB 1NTZE 3P7KA 5APYA 2E76C 3NTNA 4K3AA 4I7ZB 3L70E 1VQ6P 2M3BA 3P8CD 4H44B 1QGKB 1KB9I 4DOJA 4RJTA 3H32A 1JM0A 3RL0C 1CSBA 3TNUA 1DIPA 1W2EA 1U7MA 1S5LH 2GUSA 1FDMA 1U7JA 1JMBA 1JY2N 2IZ1A 2J5UA 2NRGA 3L74G 2PRRA 4JQ0D 3E1RA 5BVZA 1N73A 3H1KJ 3BVHA 4GIFA 1SQBD 1SQVG
chains in the Genus database with same CATH topology
5GTIE 4UB8E 5KAFE 3JCUE 5KAIE 5B66E 4UB6E 4PJ0E 5E79E 1W5CE 1S5LE 5H2FE 3KZIE 5B5EE 3WU2E 5TISE 2AXTE 4IL6E 3A0HE 3A0BE 5GTHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTI E;  4UB8 E;  5KAF E;  3JCU E;  5KAI E;  5B66 E;  4UB6 E;  4PJ0 E;  5E79 E;  1W5C E;  1S5L E;  5H2F E;  3KZI E;  5B5E E;  3WU2 E;  5TIS E;  2AXT E;  4IL6 E;  3A0H E;  3A0B E;  5GTH E; 
#chains in the Genus database with same CATH topology
 1JY3 O;  1G1I A;  4WB4 A;  1FBM A;  3B5N C;  3PTZ A;  3Q3D A;  4L73 A;  4NPD A;  1GMJ A;  4ZKU A;  3V6I A;  2K37 A;  1G1J A;  1JTH B;  1L0N D;  2POH A;  2ZT9 B;  3L36 A;  3L73 D;  1X22 A;  3JCU E;  4U3F G;  3M9Q A;  4H0L C;  2B89 A;  1K05 A;  2IBZ E;  1ZLL A;  4WVZ A;  2E5Y A;  1SQP D;  2OYH A;  3LIE A;  1QVF O;  2XZR A;  1G2C B;  1ZXG A;  4GOF A;  1P84 E;  1L4A B;  1SQQ J;  2RN0 A;  1T2K C;  1SQV K;  1KYO D;  2JR8 A;  1PP9 J;  3CCJ P;  2OYH B;  3I5C A;  3ZDM A;  1GW4 A;  1NKZ B;  5AW3 B;  1T8Z A;  5AW0 B;  1RQV A;  2M0B A;  1KQS O;  1QL2 A;  1ZN5 A;  2KXP B;  2SPZ A;  3AEB C;  2LR2 A;  2WZ7 A;  1OW6 A;  3F5H A;  2KUB A;  3GF3 A;  4WWI A;  4B86 A;  3H25 A;  4H13 C;  1SP4 A;  3L75 G;  1OX3 A;  1NTK D;  2Q7C A;  1SQB G;  5CBO A;  5GTH E;  1FJP A;  5CHX A;  1L0L K;  2N1T D;  4ZMD A;  5CCG D;  2O1K A;  4GT1 A;  2FYU D;  3RBZ A;  1ZRT D;  4ASV A;  1RH5 B;  1N7S B;  2A45 G;  1YI2 P;  1JCC A;  1KQL A;  1VDF A;  2FYN B;  3L73 G;  3VP9 A;  4PV1 D;  1OW7 A;  4U3F D;  5KAI E;  1GD2 E;  3B5N A;  4DZO A;  5AVQ B;  1GU4 A;  4IOI H;  3VP8 A;  2BEZ F;  3V2N A;  1MUU A;  1SQP G;  1S1C X;  2A45 H;  4L74 A;  1MKM A;  1EQ7 A;  2M5A B;  1D7M A;  1Y9B A;  1LT9 B;  1S5L E;  1LTI C;  3PHL A;  3VMA A;  2N9B A;  5B5E H;  3CMA P;  1Q81 Q;  1VQ4 P;  2K1A A;  1YIJ P;  1LP1 B;  1M1J C;  2IYO A;  2OQQ A;  3AEG C;  1NOH A;  4HJG H;  1YIT P;  2J59 M;  4L76 A;  1PPJ G;  1GZL A;  1LTJ A;  3A0H E;  2QJK B;  1UII A;  4RO0 A;  1UIX A;  4Y99 C;  3AE7 C;  5KKZ C;  1NTK G;  4PD4 E;  4K35 A;  3AEE C;  3TF5 A;  3HD7 A;  4OGQ B;  1L0L D;  2A45 I;  2P1J A;  5AVW B;  3CC2 P;  4BRY B;  3D6Z A;  2G3A A;  2B87 B;  4LLH A;  2P7J A;  4UB8 E;  2WPQ A;  4H44 D;  4YXD C;  3Q5S A;  3HD7 B;  1P84 H;  2B9B A;  3L72 G;  5AW7 B;  2PP6 A;  1BGY E;  2H8P D;  5APV A;  5KAF H;  4GKG A;  1X79 B;  1GL2 D;  2AEJ A;  2PFX A;  1KV4 A;  3AEF C;  1FDI A;  3C9I A;  4JBZ A;  4N78 D;  2HPC A;  1FZC B;  1YJN P;  1PFI A;  2JEE A;  1VF5 C;  3RBX A;  5AVV B;  3TGU J;  4AUW A;  3NXS A;  1ZOY C;  5CBN A;  3CXH D;  1PGO A;  1NU1 G;  2VRS A;  3H1K E;  5AW4 B;  1NU1 J;  1HF9 A;  3NFQ A;  2JP3 A;  1NTM E;  2D2C C;  2KYV A;  4N3Y B;  3RK3 B;  1GTW A;  1ZME C;  2B87 A;  1LWU A;  1M1K Q;  3WUV A;  5B66 H;  1J1E C;  1SQQ G;  2H89 C;  3AE1 C;  1IK7 A;  5BU5 A;  5KJ7 D;  5KKZ B;  1NYH A;  3CC7 P;  2R44 A;  1EZV E;  1RE3 A;  4IFD K;  5KTB A;  5DJT B;  3WU2 E;  3O6Q A;  2ZXX A;  4KJM A;  1M7L A;  1S3J A;  4GDO A;  3TK1 A;  2G8Y A;  3E1I A;  5TIS H;  2YMK A;  1SQQ E;  1URQ A;  2ITA A;  2OYI A;  1VQK P;  2Q6Q A;  2XND H;  3L75 J;  1OIP A;  1BCC E;  3AED C;  3QH9 A;  5APT A;  1RE3 C;  2BCC D;  4M3L A;  5E79 E;  2WMM A;  3RL0 B;  2HYN A;  2O3J A;  2OTK E;  1NU1 E;  2XDJ A;  3MHV A;  4YPC A;  1L0N J;  4TLF A;  3U1A A;  3KQG A;  1IJD B;  4PV1 C;  1EDJ A;  1NVO A;  4U7J A;  1HUC A;  1RF1 C;  3EWK A;  1MV8 A;  4EOT A;  2YMY A;  1VQ9 P;  3HTK B;  2OYI B;  2P2U A;  2IFM A;  2PAJ A;  2CPB A;  5APU A;  4KT0 J;  5KLV E;  2KSJ A;  4DT0 A;  3MUD C;  2E74 D;  5H2F H;  3VMX A;  1EDL A;  1Q82 Q;  2JO1 A;  3V2P A;  1KB9 D;  4H0L B;  2QJY C;  3RL0 g;  2NPS D;  1BSN A;  1KFM A;  1NAY A;  3L72 E;  1YYC A;  5KLI B;  2OGU A;  1K8A Q;  2R3C A;  3A3Y B;  3BAS A;  1L4A C;  2I1K A;  1ZRT E;  3BCC J;  2FYU E;  2I1J A;  3CWB G;  5CJ4 A;  3CCL P;  2W27 A;  1CZQ A;  4IL6 X;  2FBW C;  3F89 A;  3S9O A;  3FWN A;  3A0H H;  3H1H G;  3WU2 H;  3A5T A;  3JSV C;  2Y9Y A;  3A7O A;  3H1K D;  1IFM A;  4I2L C;  3G4S P;  2PGD A;  5CCG A;  1LWU C;  1LTS C;  1BCC D;  1PPJ E;  4UB8 H;  3RGU A;  1H88 A;  1VQ7 P;  2E74 B;  3CWB E;  3R4Y A;  1DX7 A;  3A0B H;  1EC5 A;  1T6A A;  4ZNC A;  3P32 A;  3MP7 B;  3MD0 A;  2O01 J;  1KYO E;  3N4X A;  2M3E A;  3PJS K;  5TJH A;  1J1D C;  1FZB A;  4U3F E;  1L0N K;  1IFI A;  1FOS E;  2FYN C;  2Y0D A;  4R4M A;  3VMZ A;  1NHL A;  1SQP J;  2ZVN B;  3TGU G;  2QE7 H;  3V2Q A;  2GUV A;  3H1L D;  3HE5 A;  2FXP A;  3SSU A;  3CI9 A;  4WY4 D;  1LTT C;  1L0L E;  4NPF X;  1QLE D;  2W6J H;  1ZV8 A;  1Q7Y Q;  1BDC A;  2Q9I A;  1LTJ B;  1L0N E;  2WIT A;  4PD4 D;  1Z56 A;  1YQ3 C;  1NTZ K;  1U57 A;  2H88 C;  2MKV A;  3RK2 C;  1GU5 A;  1BE3 J;  1M1J B;  1FZE A;  2J58 A;  3AEA C;  3C1L A;  5AW8 B;  1LP1 A;  4GOE A;  3USS A;  3HD7 D;  1BCC G;  2HFE D;  3KZI E;  1GDT A;  2WTY A;  1VQ8 P;  1P84 D;  2FYU J;  2Q3I A;  5TIS E;  2E75 B;  2L5G B;  2NPS C;  1LTG C;  3H1I J;  1N7L A;  4JYB A;  1FJK A;  3PH0 A;  2IBZ D;  3V4W A;  2WVR A;  2OYO A;  5GTH H;  1KFN A;  1MFZ A;  2MJZ A;  1SLQ A;  1JOC A;  1LGH B;  2YKP A;  2ZYD A;  3N7N A;  1CW5 A;  1H0T A;  4BRY A;  2C9L Y;  1HH0 A;  1L4A D;  1SFC D;  1CI6 A;  2Z5I A;  3HD7 C;  2QIW A;  4EI2 A;  1PGJ A;  2R5D A;  4ASW A;  3OJA B;  2FXM A;  2C0X A;  1PGP A;  1DH3 A;  3B71 A;  4YXW H;  2YNY A;  1JY2 O;  4C7R A;  1HVV A;  2QJP C;  2KNC B;  3M91 A;  1S5L X;  2FFD C;  1RF0 C;  1IO4 A;  1SQV E;  3CC4 P;  2I8D A;  1FZA A;  2W6B A;  3CCS P;  1M90 Q;  2FYZ A;  2JWA A;  3I56 P;  5M1B A;  1SQP K;  4D6T D;  4KHX A;  2OTJ P;  3IAO A;  5APS A;  4I6M C;  1N73 C;  3HTK A;  1QL1 A;  1J2J B;  3VTP C;  2HOD B;  2WSE J;  3BRV B;  3OW2 O;  5EFW B;  1LNQ A;  4I1L A;  3SFD C;  1X8Y A;  4PJ0 H;  3M0D C;  1NTZ G;  1NTZ J;  1J1E B;  2HOD A;  3C8V A;  2IX7 C;  4Z1M H;  1KIL E;  3SWY A;  1URQ D;  2LXB A;  2N1T B;  2Y0E A;  3H6P A;  3PLN A;  2QRX A;  3SFE C;  2ZXE B;  1A02 J;  3CCR P;  3HUS B;  5L8R J;  3UIA A;  1JY3 P;  3CL3 D;  1NTM K;  2ZVO B;  1SQB J;  1AQT A;  2FYU K;  2W83 C;  2K9J A;  3O6Q B;  5AW1 B;  3LW5 H;  3M9H A;  1DD4 A;  1KIL A;  1SQX D;  3L71 E;  3VYI A;  2CPS A;  2WT7 A;  1ZR2 A;  4H13 B;  1L0N G;  3HUS A;  3O8Z A;  1E5W A;  1H89 A;  4DCK A;  3WMM 0;  3RK3 E;  1Q2N A;  1ZR4 A;  4GOD A;  3L73 J;  3D70 A;  1HBW A;  2JDI H;  3Q1M A;  1N2D C;  2Q1K A;  1N7S C;  1JO5 A;  1H0T B;  1NAF A;  3KPE A;  3LW5 J;  3TGU E;  4PV1 B;  1EDI A;  1R5L A;  1AV1 A;  1NJI Q;  5KAI H;  2IFN A;  2WSF J;  2YKQ A;  3M9B A;  5CJ0 A;  2QA4 P;  1VQM P;  1W2B O;  1VQL P;  1EXJ A;  3EFG A;  1BGY J;  2E5T A;  1NH4 A;  1BDD A;  2NPS A;  1NTZ D;  1PGQ A;  2CK3 H;  3SWF A;  1VF5 D;  2XV5 A;  2KP8 A;  4LGD E;  2IZ0 A;  2KB7 P;  1FZC A;  1URQ B;  3A0B E;  2QJY B;  2AXC A;  2E75 D;  2YKO A;  3CCM P;  2KNC A;  5AW2 B;  3CCQ P;  3L75 D;  2Z4E A;  1JTH A;  1KYO H;  3GHG B;  1VQ5 P;  5C39 A;  1NTK J;  1FZF A;  1RE4 C;  2JWD A;  2BCC J;  4ZKP A;  1SQX J;  3L75 E;  1HGV A;  1GW3 A;  2FYU G;  1OVU A;  1SQX G;  3H1H J;  3JC2 2;  4JF7 A;  3L4F A;  3BCC E;  5GTI E;  2A06 G;  2P67 A;  3RL0 D;  1YHQ P;  3D6Y A;  4PD4 H;  3PRJ A;  2BAS A;  2E42 A;  4C7N A;  2FKW B;  1AVO A;  1CI6 B;  3QWO C;  4OGQ C;  4XE5 B;  2DW3 A;  2WQY C;  3L72 J;  3H1L E;  1SQB K;  3I55 P;  1IFP A;  1M57 D;  1ZW0 A;  3H32 B;  2W8Z A;  1USE A;  1W5C E;  4PJ0 E;  3VMY A;  4BWN A;  4DJG A;  1SQX K;  1OVV A;  3MZW B;  1KYO I;  3SWK A;  5AVY B;  1N86 A;  1VL2 A;  2FXO A;  3D71 A;  1J1D B;  1PZQ A;  1OMI A;  1WMK A;  1XTG B;  4WBA A;  1BSH A;  1LT9 A;  1P84 I;  2QG4 A;  1IZN B;  1VF5 B;  1JY2 P;  1PPJ D;  4D6T E;  2W90 A;  3L74 D;  1EXI A;  1QVG O;  1OXZ A;  5AW9 B;  2XNX A;  3L37 A;  1LTA C;  1SQV D;  1XTC C;  1Q90 D;  2WSE H;  3GF7 A;  2P58 A;  1IC2 A;  1S9K D;  1FC2 C;  1T3J A;  2A06 D;  4L75 A;  5AW6 B;  4CPG A;  1BCC J;  1KIL B;  2WT7 B;  3RK2 B;  3VN0 A;  3H1I G;  3G71 P;  3VOP A;  3L72 D;  2YIU B;  5CCG C;  1Y8A A;  2E76 B;  3CCE P;  1PP9 E;  4I7Z C;  1NU1 K;  1OFC X;  2IYP A;  2K88 A;  2KOG A;  4H44 C;  2XKM A;  4HB1 A;  2QSI A;  1AQ5 A;  2N1T A;  1IFJ A;  2QVA A;  4H0L D;  3G3Z A;  2UWJ E;  1QX8 A;  3CCV P;  2K3R A;  2RH0 A;  3CXH I;  1SFC A;  3GMA A;  1LJ2 A;  1NTM G;  1KTM A;  2O01 H;  1NTM J;  2RKL A;  2AXT E;  4PD4 I;  1JCD A;  3B5N D;  2R32 A;  5AVR B;  1T2K D;  3AE6 C;  3B5N B;  2LXC B;  2IPP A;  2KS1 A;  2C0W A;  3FX0 A;  1RE4 A;  3HE4 B;  3MGN A;  3V2R A;  1KD1 Q;  2KSE A;  2ZT9 C;  1RF1 B;  1SQV J;  1SFC C;  2QJP B;  1GL2 A;  2WSF H;  1DEB A;  3CX5 E;  3AEC C;  4OH8 B;  1Q86 Q;  2ZJS E;  3AE4 C;  3L35 A;  2Y0C A;  4C46 A;  1BGY G;  2OYI C;  2ZYA A;  4OWF A;  1NWQ A;  3IR9 A;  3TSI A;  1VPC A;  1IFN A;  1QEX A;  1SS1 A;  3IF4 A;  4JYC A;  4U3F J;  5KLV D;  3H1I D;  4MN4 C;  3HRN A;  3GW6 A;  4EYY Q;  2HG5 D;  3H1J E;  2FY8 A;  1GL2 C;  1OW8 A;  1PIX A;  2V7Q H;  3CWB J;  2Q3E A;  3IN6 A;  1WT6 A;  1GK6 A;  3E7K A;  1JMM A;  2BCC G;  3L70 J;  4XA4 A;  5KLI C;  3U59 A;  5GTI H;  3Q5R A;  2OYH C;  1VQO P;  2O01 N;  5KJ7 A;  3BAT A;  1Y47 A;  1NTM D;  2N1T C;  3G6E P;  1KQG B;  1G2C A;  1OWA A;  1OZH A;  3AE3 C;  1DD3 A;  2Z5H A;  3BRT B;  1KB9 H;  3M0D A;  4JPZ B;  1BE3 E;  2BEQ D;  3AE8 C;  4NPE A;  2BCC E;  4OGQ D;  2GM4 A;  1E79 H;  5DJU B;  1M8O B;  4IL6 E;  4WY4 C;  1JEK A;  3MIW A;  4QMA A;  3EQ2 A;  3CPW O;  1NGM B;  3KYQ A;  1DEE G;  2ZYG A;  3B4S A;  4D6T J;  1FE6 A;  1BGY D;  1L0L G;  5AVU B;  2YO2 A;  1KMI Z;  1HGZ A;  3CLQ A;  2KZI A;  2WPV B;  3HE5 B;  3CME P;  1PV3 A;  5KLV G;  2AEF A;  1HJB A;  1MZ9 A;  1N73 B;  1LT9 C;  2O1J A;  3FXD A;  3CWB D;  1ZP0 C;  2N9Y B;  2P10 A;  1JNM A;  3LID A;  1KOR A;  3A2A A;  3P8M C;  3ITK A;  1AJY A;  3H1H D;  4HH2 A;  1LTJ C;  2ZT9 D;  2E76 D;  5AVS B;  3WUT A;  1VQN P;  1BE3 G;  1AVY A;  3TNU B;  1M1J A;  1URQ C;  3Q5P A;  1N7S D;  4AYC A;  1EDK A;  2OTL P;  2FFD A;  1NU1 D;  3T97 B;  2GA1 A;  3H1H E;  3R2P A;  4C7N B;  1T3U A;  2ZAE B;  1KB9 E;  2YXR B;  4UB6 H;  4Y28 J;  1RY3 A;  2V7Q J;  1K9M Q;  1SQQ D;  1FAV A;  1KZU B;  2KI7 B;  2M8R A;  3S4R A;  1PP9 D;  2H43 A;  1HWT C;  1SQQ K;  3M06 A;  2H7H A;  3V4Q A;  2YO3 A;  3KDP B;  1FDO A;  1YTZ I;  1EZV D;  1LTB C;  2JKV A;  2Y9Z A;  5KAF E;  1YQ4 C;  1GK4 A;  1K73 Q;  1VQP P;  1R5S A;  3GHG A;  3MUD A;  3U1C A;  1HTL C;  4W7Z A;  1X9V A;  2WSC H;  5APW A;  2FFD B;  4W80 A;  1M56 D;  5BU8 B;  2WSC J;  1LT1 A;  2WPS A;  1YBK A;  1BE3 D;  3GG2 A;  3CX5 H;  1IK9 A;  4H13 D;  4HYT B;  1AFO A;  4BXL A;  2IBZ I;  3RK3 C;  5B5E E;  5CCH A;  4WY4 A;  1YJW P;  1PL5 A;  4N78 E;  3FWL A;  2NZ2 A;  3L70 G;  4R4L A;  3V5B A;  4OVN F;  3GLM A;  1JUN A;  1IFD A;  2KIK A;  2Q5U A;  4A7P A;  1MFT A;  4RES B;  2QM7 A;  3H1I E;  4YTP C;  3W67 A;  5KJ7 C;  4RKU J;  2A06 E;  3FXE A;  4N6J A;  1PP9 G;  1YJ9 P;  4W7Y A;  2YIU C;  3M0A A;  2XU6 A;  1EZV G;  2KLU A;  3HUS C;  4TT3 H;  1NO4 A;  2LKM A;  3CX5 D;  2KS1 B;  3G9R A;  3HE4 A;  1JB0 J;  1USD A;  3BCC D;  3CXH E;  5CMZ A;  5B66 E;  1RF1 A;  2KZJ A;  2OAR A;  5CCH C;  2R3S A;  2YXQ B;  2R5B A;  3L74 J;  2KK7 A;  4D6T G;  2QEX P;  1FZG A;  1L0L J;  2V4H A;  2HLO A;  3H1K G;  2KLV A;  1L4A A;  3OA7 A;  3Q2Y A;  5AVT B;  2E43 A;  3CD6 P;  3TDK A;  5KLV J;  3H1J D;  1FS0 E;  2D2C D;  2IDB A;  1HJ0 A;  3II6 A;  3NMD A;  5APQ A;  3CCU P;  1SFC B;  1SQP E;  3CX5 I;  3OAK A;  3TGU D;  3CXH H;  3IFM A;  3P8C E;  4AQR D;  3L70 D;  1OVR A;  1RF0 A;  5E79 H;  3EFF K;  3JCU H;  1KC8 Q;  4IL6 H;  1X0T A;  2HR3 A;  3H1L J;  1NKN A;  5AW5 B;  1N8R Q;  2K9J B;  3H1L G;  3PP5 A;  2QJK C;  5KLV K;  2JJL A;  3MTU E;  1GL2 B;  4Y99 B;  1S72 P;  2WWW A;  2C9N Y;  4EIJ A;  3GHG C;  4IFM A;  1SQB E;  2WSS H;  5CCH D;  2K9Y A;  1SVF A;  1NTK E;  3BCC G;  3K5B A;  2B88 A;  3L71 D;  1SQX E;  3S1K A;  1LWU B;  1RHZ B;  3AE9 C;  4O9B A;  4UB6 E;  2E74 C;  1K04 A;  1S2E A;  4HKZ H;  3AE5 C;  4XFJ A;  1AA0 A;  1RQU A;  5H2F E;  4WY4 B;  1R8E A;  3H1J J;  1KIL D;  1NTK K;  2HPC B;  3KHU A;  3H1J G;  4EDF A;  1FZC C;  1S4X A;  3WUU A;  2IBZ G;  2M5A A;  1KN7 A;  1S9K E;  3W68 A;  1YTZ T;  5K5G B;  1WRG A;  1TU3 F;  1L2P A;  3RK3 D;  2ZFC A;  3L73 E;  1A02 F;  3ABV C;  2AXT H;  2D2C B;  2RMZ A;  2L91 A;  1FU1 A;  1H8A A;  5AVZ B;  3L74 E;  1N7S A;  3KXD A;  2W6A A;  2WPR A;  5AVX B;  2QM8 A;  3AE2 C;  2AEM A;  3L71 J;  1EZV I;  3L71 G;  4LC1 A;  3T97 A;  3TYY A;  3RK2 D;  3B8E B;  1KIL C;  2E75 C;  2NPS B;  3FGA D;  3KZI H;  5APX A;  1JY3 N;  4IFF A;  1FOS F;  1KQF B;  1NTZ E;  3P7K A;  5APY A;  2E76 C;  3NTN A;  4K3A A;  4I7Z B;  3L70 E;  1VQ6 P;  2M3B A;  3P8C D;  4H44 B;  1QGK B;  1KB9 I;  4DOJ A;  4RJT A;  3H32 A;  1JM0 A;  3RL0 C;  1CSB A;  3TNU A;  1DIP A;  1W2E A;  1U7M A;  1S5L H;  2GUS A;  1FDM A;  1U7J A;  1JMB A;  1JY2 N;  2IZ1 A;  2J5U A;  2NRG A;  3L74 G;  2PRR A;  4JQ0 D;  3E1R A;  5BVZ A;  1N73 A;  3H1K J;  3BVH A;  4GIF A;  1SQB D;  1SQV G; 
#chains in the Genus database with same CATH homology
 5GTI E;  4UB8 E;  5KAF E;  3JCU E;  5KAI E;  5B66 E;  4UB6 E;  4PJ0 E;  5E79 E;  1W5C E;  1S5L E;  5H2F E;  3KZI E;  5B5E E;  3WU2 E;  5TIS E;  2AXT E;  4IL6 E;  3A0H E;  3A0B E;  5GTH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...