5B66E

Crystal structure analysis of photosystem ii complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
78
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
total genus 21
structure length 78
sequence length 78
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5b66E00
5KAIE 5TISE 3KZIE 4UB6E 4UB8E 3A0BE 5B5EE 5E79E 1W5CE 5KAFE 5B66E 2AXTE 1S5LE 3WU2E 5H2FE 5GTHE 4IL6E 4PJ0E 3A0HE 5GTIE 3JCUE
chains in the Genus database with same CATH superfamily
1EDKA 3AEFC 1FZEA 3H1HE 1T2KD 4WBAA 1PPJG 2W8ZA 1K05A 1M1JC 1L0ND 1XTCC 2P67A 3B8EB 1SFCC 5AVYB 1Q2NA 4D6TJ 1N8RQ 3PP5A 1IFPA 5KLVG 2W6AA 2WPSA 1JY3O 2LR2A 4DOJA 3P32A 1BCCG 1HWTC 1AQ5A 1GW3A 5CCGC 1JNMA 2HR3A 4JYCA 2NRGA 3U1AA 1X0TA 1PL5A 4W7ZA 2Q3EA 2NPSA 3RK3E 1H0TB 1SQPJ 5B5EH 1EZVI 2Q6QA 2XV5A 3H1JD 2J58A 2KIKA 2ZAEB 1LJ2A 1KV4A 4LLHA 1G1JA 3LW5H 1GL2D 2LXBA 1VQOP 2QJYB 1IZNB 2FBWC 3OAKA 1LT1A 1UIIA 4PV1B 2M5AA 3RK3B 3JSVC 1FU1A 3A0BH 3SSUA 2W27A 3AE4C 1SQXJ 2MJZA 3CXHI 3PRJA 3H1JJ 1PPJE 5CCGA 5DJTB 1H8AA 1VQ4P 3VN0A 3H32B 2RMZA 2HG5D 1Y9BA 2KB7P 5APSA 2WTYA 1EZVG 1PP9D 1SQQK 1GD2E 1PGOA 4Z1MH 2Z4EA 2OYHC 5APQA 3CCEP 3PTZA 4IOIH 1SQQG 4D6TE 3L70J 3RBZA 3GHGB 1PIXA 2E76B 3SFEC 3TGUG 1A02F 2ZFCA 1HGVA 1NTKD 1RY3A 1PV3A 3L35A 4HKZH 3RGUA 1IFNA 1L0NK 1OMIA 2KI7B 5AW3B 2M8RA 1MUUA 2XDJA 3GHGA 2E76D 1KB9H 2P1JA 1OX3A 3H1JG 3T97A 3MGNA 1ZR2A 1GK4A 3CWBJ 2OYIB 3L37A 3L71G 3L70E 2KYVA 1USDA 3R4YA 4N78D 1QVFO 1JUNA 1SQBJ 2QM7A 1WMKA 3AE2C 1OWAA 1EZVD 1PP9G 1PGQA 2P58A 1T8ZA 2ZVNB 4H0LD 2NPSD 1LTJB 4H44C 2Y0CA 1H89A 1NVOA 1KD1Q 3RK2D 5GTIE 2HYNA 4KHXA 2QJPC 5AW0B 1TU3F 4BRYB 1VQKP 1ZRTD 2E42A 5AVWB 3CD6P 1P84D 1Q81Q 1URQC 1VQ6P 2H88C 3RK2C 1SQPG 3LW5J 1KQFB 2B89A 1PPJD 4EI2A 1OW8A 3G71P 1IC2A 2YMKA 3EWKA 1T6AA 4XA4A 1P84H 1RF0C 3VOPA 5KLVJ 2QA4P 3MZWB 1SQQD 4TLFA 4WY4B 2YXRB 5AW2B 4W80A 2WSSH 2E74D 3TYYA 1L0LE 1NTZG 1NU1E 2UWJE 1SFCA 4C7NA 1P84E 3TSIA 4CPGA 3NMDA 1BGYJ 1SP4A 2WSFJ 2ZYDA 1LP1A 1NO4A 1RE3C 3O6QB 4OGQB 4OWFA 4C7NB 3CCJP 2KS1B 1N7SC 5KTBA 1KILC 1YQ4C 1LP1B 3H1IG 4BXLA 4EOTA 4HYTB 1EDLA 1KN7A 4N78E 1VF5C 2WQYC 3AE1C 1KYOH 3V5BA 4LC1A 1VDFA 4R4LA 1L0NE 1R5LA 2ZJSE 3CX5H 1NAFA 4WVZA 4UB8E 1ZR4A 1RF1A 2HPCB 2PGDA 3L72G 1IK9A 2BASA 3GF7A 3HE5B 3TDKA 1FOSF 1SS1A 2XNXA 3QH9A 1GMJA 4GOFA 1Z56A 5AVUB 1SQBG 2Q3IA 5AW5B 3CCQP 1KFMA 4PD4H 4WB4A 4U3FD 1BCCJ 1UIXA 5KAFE 4PD4I 1J1DB 2FYNB 1LTIC 3L73D 2FYUK 4DJGA 3RK2B 5CCHD 1Q7YQ 3ITKA 2QIWA 1JCDA 1SQQE 4NPEA 3WU2E 4D6TG 1S5LX 1YJWP 1HH0A 1QGKB 2E5YA 2FYUG 1G1IA 1X22A 2QJYC 3FWNA 1EZVE 3L70G 1LTJA 2BCCJ 2OTJP 1KYOI 2QJKB 2V7QJ 1SFCD 1NU1G 1OVRA 1L0LG 3A0HE 2HLOA 2HFED 2K3RA 2XU6A 3H1KD 3L74J 1LTGC 2RKLA 2YKOA 3HUSA 3Q5PA 2K88A 5AW1B 1M8OB 1FZGA 1S3JA 3B4SA 2IZ1A 5AW6B 4AYCA 3HUSB 2P10A 2KSEA 2IYOA 1CSBA 3A0HH 1YTZI 2D2CC 2K9JA 2O01J 2AEJA 3H1IE 3MTUE 3USSA 3L36A 4ASVA 3CCMP 1FZFA 1BE3G 2ZT9D 3H25A 1M90Q 1NTZE 1KQLA 1LTTC 1N7SD 3BVHA 1M1JB 1AV1A 2Z5HA 4R4MA 1KFNA 1SQVK 5AVZB 5AVXB 1GU4A 3F89A 1EC5A 2H89C 4JBZA 4O9BA 1EDJA 4U3FE 2SPZA 4YPCA 1QVGO 1K9MQ 3H1KJ 4EIJA 1S5LH 1RQVA 3H1LJ 1KILA 3RK3C 2C9NY 1W2BO 3L4FA 1RHZB 4GODA 1JY3P 1LT9A 2IBZG 4PJ0E 1HF9A 1ZN5A 4B86A 3L74D 2Y9ZA 1SQVE 2YO3A 1MZ9A 1W2EA 3JC22 2V4HA 2M0BA 2ZVOB 1IFDA 2HPCA 3RL0C 3II6A 1DH3A 1SQXE 4I2LC 4UB6E 3VMXA 1VQLP 3HE5A 2QM8A 5KLVK 4PJ0H 1FC2C 1URQD 1KTMA 1OW7A 2R32A 1FZCA 2QE7H 2C0XA 2KLUA 1FDIA 3ZDMA 3G4SP 2XNDH 1ZW0A 2IFNA 1BGYE 1Y8AA 1LT9C 1PZQA 2IBZI 1FS0E 2IX7C 2KK7A 2KOGA 2H8PD 4H44D 3FXDA 5APTA 1NGMB 5L8RJ 1L0LD 1NU1D 2JDIH 2N1TB 3GW6A 3LIDA 4IL6X 3IF4A 3OJAB 5CJ0A 2QSIA 5KLIC 4AUWA 3KYQA 1YHQP 1KMIZ 3M0DC 3RL0g 3L75J 4RESB 1PFIA 2J5UA 3CWBE 1BE3D 1QL1A 2ZT9B 3MP7B 4JQ0D 1BSHA 3CCSP 1FZAA 3GLMA 3TK1A 3JCUE 2E74B 2FYUE 4UB6H 5BU8B 3V4WA 1KQGB 1OVUA 3L74G 1QLED 4L73A 2LKMA 1N73A 3VTPC 1DIPA 1SFCB 2A45G 1BCCE 5DJUB 1M1JA 1FE6A 3SFDC 2R44A 4WY4C 2AXCA 1YJ9P 5AVTB 1SQQJ 2K1AA 2YNYA 2B9BA 1SQBE 4W7YA 3WMM0 3A2AA 4YXDC 5B66H 2FFDB 2E43A 3MD0A 3E7KA 3Q1MA 4DCKA 1YBKA 2PRRA 3BCCJ 4GKGA 4DT0A 2AXTE 3AEBC 4TT3H 3CPWO 1N73C 1SVFA 2NPSB 3M0AA 1R5SA 2E75C 3H6PA 4RJTA 4PD4E 3C1LA 1EDIA 1RQUA 3KZIH 3AECC 3CX5I 3KPEA 4OH8B 1E5WA 1LT9B 1Q82Q 2IBZD 1WT6A 1G2CB 1KYOD 1VF5B 3FWLA 5TISH 3HD7D 3PH0A 1HJ0A 1NTMD 1GL2A 2P7JA 3L72D 5E79H 2D2CD 5KLIB 2OYIC 3P8CE 2KZIA 2Y0EA 1LTBC 3ABVC 3HD7A 3H32A 1GDTA 1GL2B 1CI6A 1FZCC 2N1TD 1NYHA 2D2CB 2ZXXA 2M5AB 1BGYG 3GMAA 3H1ID 1KZUB 3HD7B 1L4AA 1N2DC 1S72P 5E79E 1T2KC 2JKVA 2E74C 2BEQD 2ZYAA 1VQ5P 1ZP0C 3L73G 3M06A 1N86A 2KUBA 1K8AQ 1SQPE 2Z5IA 5GTHH 3W68A 3RBXA 4WY4D 2KLVA 3BCCE 3T97B 4QMAA 1FZCB 4PV1C 4I6MC 3H1LD 4DZOA 1MV8A 3H1KG 3AE3C 2AXTH 3G9RA 4EYYQ 2Q1KA 2QJPB 3L70D 2A06D 2JEEA 1ZXGA 1RH5B 4RO0A 2WPQA 2FYNC 3L71E 3R2PA 5CHXA 1N7LA 1NTKG 2KP8A 2NPSC 1N73B 1YJNP 3MHVA 1RF1C 2FFDA 1SQPD 4HH2A 3I5CA 2L91A 3D6YA 1EXJA 1OFCX 2YKQA 3A7OA 3F5HA 2YXQB 3L74E 5KJ7A 4H0LB 3V6IA 1CW5A 1HGZA 3V2PA 1IK7A 4HB1A 2IYPA 1GK6A 1YTZT 4ZKPA 3Q2YA 2E76C 2H7HA 1VF5D 3CLQA 1JY3N 2R5DA 1P84I 5K5GB 3WU2H 2QG4A 2BCCD 4OVNF 2M3EA 5KKZB 1KC8Q 2WSCJ 2WSEH 1JY2N 3AE6C 1K04A 3LIEA 3L71D 1G2CA 3FX0A 1LTAC 1NHLA 1DD3A 1NTZJ 2FXMA 3M9HA 2JWDA 4HJGH 4OGQC 2CPSA 4H44B 1LTJC 2B87B 1R8EA 2FKWB 2FYZA 3KXDA 2ITAA 3TGUD 1GW4A 4U3FJ 5AVQB 4YTPC 3WUTA 1S2EA 3WUVA 1FDMA 3H1LE 2OTKE 3BATA 2OQQA 1D7MA 4LGDE 3KDPB 2JWAA 5M1BA 1KB9I 3RK3D 2W6JH 1BCCD 3FGAD 3M9QA 1SQVJ 2W83C 2Q7CA 3CCUP 2A06E 4N3YB 5APUA 2W90A 5KLVE 3CC4P 1X9VA 1H88A 1S9KD 2Y9YA 2FXOA 2CK3H 3NFQA 3G6EP 3GF3A 1E79H 2WITA 1J1EC 3CC2P 2E75D 2I1KA 3BCCD 3C9IA 5KJ7D 3L72E 2WPRA 2R3CA 1HUCA 3BCCG 3P7KA 3CXHH 1NKNA 2E75B 3KQGA 3P8CD 3VYIA 4GIFA 3B5NA 2OTLP 1BDCA 1KB9D 5H2FE 2CPBA 2LXCB 1DD4A 1N7SB 2POHA 2WSEJ 3SWFA 1JB0J 1L4AC 1NAYA 2BCCG 2E5TA 3HTKB 4I7ZC 1GU5A 2IBZE 2WMMA 3B5ND 3BASA 2B87A 3IFMA 3M9BA 2GM4A 3CX5E 5KLVD 3D6ZA 2K9YA 3S1KA 5TISE 1ZOYC 3HUSC 5BU5A 1L0NG 2IZ0A 1FOSE 2FYUJ 2PP6A 3CX5D 3Q5SA 5EFWB 1H0TA 1BGYD 3B5NC 3HD7C 1X8YA 3VMZA 1Q86Q 3H1HG 3MUDA 4H13C 2H43A 2B88A 2YO2A 1J2JB 2KSJA 1JOCA 5AW4B 2O1KA 1U7MA 2QVAA 4BWNA 1OVVA 1XTGB 1KB9E 2R3SA 1NTKJ 3AEEC 2WSCH 1URQB 2O01N 1VL2A 5AVSB 5AW9B 1LNQA 3HE4B 1FBMA 1QL2A 3N4XA 5KAFH 1LGHB 3AE5C 3L72J 4U7JA 5KJ7C 1DX7A 1SQVG 3TF5A 3CXHE 3U59A 3WUUA 1NH4A 1RE4C 1S4XA 2YIUB 3CMEP 5GTHE 3CCLP 1IFMA 1CZQA 1IFJA 4ZNCA 3H1JE 1FDOA 1KILE 1KILD 1L0LJ 1NU1J 3OW2O 1JO5A 1JTHB 4JPZB 2OGUA 2FXPA 2PFXA 1OW6A 2C0WA 2JO1A 3NXSA 1AVYA 2OYHA 3AEAC 1JTHA 3H1LG 3VP9A 5KAIH 2I8DA 3CWBD 2OYOA 1AA0A 2JR8A 3CXHD 3TGUE 1RE3A 2NZ2A 3IN6A 3K5BA 4A7PA 1MFZA 1GTWA 5AVRB 1NWQA 4L75A 1AQTA 2OYHB 3EQ2A 1FZBA 1W5CE 1YIJP 1FJKA 3SWKA 3D71A 1M7LA 2KZJA 3V2NA 1QEXA 1SLQA 4C7RA 1JY2O 2KNCA 2XZRA 2Y0DA 3BRVB 3NTNA 2ZYGA 1T3UA 2JP3A 3AE9C 1PP9J 2G8YA 5APVA 5AW7B 3TNUA 2A06G 1IJDB 3PLNA 3OA7A 5AVVB 2A45H 4K35A 1Q90D 1SQBK 2WWWA 1SQXD 3PHLA 4XE5B 1JY2P 5TJHA 3A5TA 3CMAP 4ASWA 5KAIE 4H0LC 2IFMA 2AEFA 3L71J 3A0BE 2I1JA 1IFIA 1L0NJ 2YIUC 3EFFK 1NJIQ 2RN0A 3KHUA 1AJYA 2Q9IA 4M3LA 3E1IA 3EFGA 1KYOE 4WY4A 5CCHC 2IPPA 1VQ9P 1VQ8P 3L73J 4ZMDA 4JYBA 4OGQD 2W6BA 3GG2A 3O6QA 3TGUJ 1YITP 1JCCA 1BDDA 3V2QA 3D70A 1L0LK 1NU1K 3MIWA 1M1KQ 1QX8A 3HE4A 5AW8B 1FJPA 2VRSA 2P2UA 1T3JA 4GT1A 2QRXA 1A02J 1OIPA 1NTMG 1SQXK 2IDBA 2ZT9C 4I7ZB 4KT0J 1MKMA 3VMAA 4IFMA 1KORA 3L75G 1ZLLA 5CCHA 4IL6E 1ZV8A 2R5BA 3BRTB 3V4QA 3CC7P 1HTLC 3UIAA 4H13D 1NTKK 1GL2C 3AE7C 1SQPK 2G3AA 2YMYA 4IFFA 3B5NB 2HODA 1YI2P 2OYIA 3VP8A 3H1KE 1ZRTE 4IL6H 2FY8A 1JMBA 3S9OA 1WRGA 1J1EB 3SWYA 1L2PA 3VMYA 1VPCA 2WT7A 2KXPB 2N9YB 3H1HJ 5B5EE 1JEKA 1M57D 5BVZA 2QEXP 3H1IJ 1IO4A 1MFTA 1DEEG 2N1TA 4PV1D 1VQMP 1HVVA 4PD4D 4BRYA 2WT7B 3AE8C 3RL0B 3B71A 2M3BA 1L4AD 4MN4C 3L73E 1JMMA 1VQ7P 1GZLA 1LWUB 1S5LE 2KNCB 4NPFX 3C8VA 3QWOC 3IAOA 4RKUJ 5APYA 3TNUB 4KJMA 2YKPA 2OARA 4YXWH 2PAJA 2BEZF 1K73Q 5KKZC 1RE4A 1VQNP 2N1TC 2O1JA 1JM0A 1NOHA 1S1CX 2QJKC 4UB8H 3E1RA 4Y99C 1AFOA 2WSFH 1HJBA 1HBWA 1NKZB 5CJ4A 3N7NA 3M91A 3CCRP 1SQBD 1VQPP 1DEBA 3L75E 3Q5RA 4AQRD 1BE3E 2O3JA 2KS1A 1YYCA 4C46A 3HTKA 2J59M 2V7QH 2WPVB 3CI9A 2L5GB 1KILB 1X79B 3GHGC 4ZKUA 2GA1A 5H2FH 3FXEA 4L74A 2FYUD 3IR9A 1U7JA 3G3ZA 5APWA 2O01H 1NTMJ 2XKMA 4Y28J 2C9LY 4H13B 2AEMA 2Q5UA 3O8ZA 1OXZA 4U3FG 1S9KE 4EDFA 1FAVA 2DW3A 1NTZK 1PGJA 1Y47A 4GOEA 1BSNA 3L75D 5CBNA 4WWIA 3PJSK 3RL0D 3HRNA 1YQ3C 1ZMEC 5CBOA 1NTME 1URQA 1LWUC 1NTKE 1NTMK 1SQXG 4K3AA 3S4RA 3I55P 3KZIE 1J1DC 1EXIA 2HODB 3CL3D 1U57A 5GTIH 3AEDC 1L4AB 2JJLA 4GDOA 4JF7A 2WVRA 1RF0A 3H1HD 3JCUH 4NPDA 3U1CA 3Q3DA 3P8MC 4Y99B 1CI6B 4D6TD 2A45I 3CCVP 2N9BA 2MKVA 2ZXEB 1BE3J 5C39A 1EQ7A 2FFDC 2K37A 5APXA 5B66E 1SQVD 1LWUA 4L76A 4N6JA 1AVOA 4I1LA 1OZHA 4XFJA 1PGPA 3M0DA 1NTZD 5CCGD 2RH0A 3I56P 2BCCE 1LTSC 1RF1B 3CWBG 3A3YB 2GUVA 2WZ7A 1M56D 1N7SA 2K9JB 3MUDC 3V2RA 5CMZA 2GUSA 4IFDK 1USEA 3AEGC 1KQSO 1PP9E 3W67A
chains in the Genus database with same CATH topology
5KAIE 5TISE 3KZIE 4UB6E 4UB8E 3A0BE 5B5EE 5E79E 1W5CE 5KAFE 5B66E 2AXTE 1S5LE 3WU2E 5H2FE 5GTHE 4IL6E 4PJ0E 3A0HE 5GTIE 3JCUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAI E;  5TIS E;  3KZI E;  4UB6 E;  4UB8 E;  3A0B E;  5B5E E;  5E79 E;  1W5C E;  5KAF E;  5B66 E;  2AXT E;  1S5L E;  3WU2 E;  5H2F E;  5GTH E;  4IL6 E;  4PJ0 E;  3A0H E;  5GTI E;  3JCU E; 
#chains in the Genus database with same CATH topology
 1EDK A;  3AEF C;  1FZE A;  3H1H E;  1T2K D;  4WBA A;  1PPJ G;  2W8Z A;  1K05 A;  1M1J C;  1L0N D;  1XTC C;  2P67 A;  3B8E B;  1SFC C;  5AVY B;  1Q2N A;  4D6T J;  1N8R Q;  3PP5 A;  1IFP A;  5KLV G;  2W6A A;  2WPS A;  1JY3 O;  2LR2 A;  4DOJ A;  3P32 A;  1BCC G;  1HWT C;  1AQ5 A;  1GW3 A;  5CCG C;  1JNM A;  2HR3 A;  4JYC A;  2NRG A;  3U1A A;  1X0T A;  1PL5 A;  4W7Z A;  2Q3E A;  2NPS A;  3RK3 E;  1H0T B;  1SQP J;  5B5E H;  1EZV I;  2Q6Q A;  2XV5 A;  3H1J D;  2J58 A;  2KIK A;  2ZAE B;  1LJ2 A;  1KV4 A;  4LLH A;  1G1J A;  3LW5 H;  1GL2 D;  2LXB A;  1VQO P;  2QJY B;  1IZN B;  2FBW C;  3OAK A;  1LT1 A;  1UII A;  4PV1 B;  2M5A A;  3RK3 B;  3JSV C;  1FU1 A;  3A0B H;  3SSU A;  2W27 A;  3AE4 C;  1SQX J;  2MJZ A;  3CXH I;  3PRJ A;  3H1J J;  1PPJ E;  5CCG A;  5DJT B;  1H8A A;  1VQ4 P;  3VN0 A;  3H32 B;  2RMZ A;  2HG5 D;  1Y9B A;  2KB7 P;  5APS A;  2WTY A;  1EZV G;  1PP9 D;  1SQQ K;  1GD2 E;  1PGO A;  4Z1M H;  2Z4E A;  2OYH C;  5APQ A;  3CCE P;  3PTZ A;  4IOI H;  1SQQ G;  4D6T E;  3L70 J;  3RBZ A;  3GHG B;  1PIX A;  2E76 B;  3SFE C;  3TGU G;  1A02 F;  2ZFC A;  1HGV A;  1NTK D;  1RY3 A;  1PV3 A;  3L35 A;  4HKZ H;  3RGU A;  1IFN A;  1L0N K;  1OMI A;  2KI7 B;  5AW3 B;  2M8R A;  1MUU A;  2XDJ A;  3GHG A;  2E76 D;  1KB9 H;  2P1J A;  1OX3 A;  3H1J G;  3T97 A;  3MGN A;  1ZR2 A;  1GK4 A;  3CWB J;  2OYI B;  3L37 A;  3L71 G;  3L70 E;  2KYV A;  1USD A;  3R4Y A;  4N78 D;  1QVF O;  1JUN A;  1SQB J;  2QM7 A;  1WMK A;  3AE2 C;  1OWA A;  1EZV D;  1PP9 G;  1PGQ A;  2P58 A;  1T8Z A;  2ZVN B;  4H0L D;  2NPS D;  1LTJ B;  4H44 C;  2Y0C A;  1H89 A;  1NVO A;  1KD1 Q;  3RK2 D;  5GTI E;  2HYN A;  4KHX A;  2QJP C;  5AW0 B;  1TU3 F;  4BRY B;  1VQK P;  1ZRT D;  2E42 A;  5AVW B;  3CD6 P;  1P84 D;  1Q81 Q;  1URQ C;  1VQ6 P;  2H88 C;  3RK2 C;  1SQP G;  3LW5 J;  1KQF B;  2B89 A;  1PPJ D;  4EI2 A;  1OW8 A;  3G71 P;  1IC2 A;  2YMK A;  3EWK A;  1T6A A;  4XA4 A;  1P84 H;  1RF0 C;  3VOP A;  5KLV J;  2QA4 P;  3MZW B;  1SQQ D;  4TLF A;  4WY4 B;  2YXR B;  5AW2 B;  4W80 A;  2WSS H;  2E74 D;  3TYY A;  1L0L E;  1NTZ G;  1NU1 E;  2UWJ E;  1SFC A;  4C7N A;  1P84 E;  3TSI A;  4CPG A;  3NMD A;  1BGY J;  1SP4 A;  2WSF J;  2ZYD A;  1LP1 A;  1NO4 A;  1RE3 C;  3O6Q B;  4OGQ B;  4OWF A;  4C7N B;  3CCJ P;  2KS1 B;  1N7S C;  5KTB A;  1KIL C;  1YQ4 C;  1LP1 B;  3H1I G;  4BXL A;  4EOT A;  4HYT B;  1EDL A;  1KN7 A;  4N78 E;  1VF5 C;  2WQY C;  3AE1 C;  1KYO H;  3V5B A;  4LC1 A;  1VDF A;  4R4L A;  1L0N E;  1R5L A;  2ZJS E;  3CX5 H;  1NAF A;  4WVZ A;  4UB8 E;  1ZR4 A;  1RF1 A;  2HPC B;  2PGD A;  3L72 G;  1IK9 A;  2BAS A;  3GF7 A;  3HE5 B;  3TDK A;  1FOS F;  1SS1 A;  2XNX A;  3QH9 A;  1GMJ A;  4GOF A;  1Z56 A;  5AVU B;  1SQB G;  2Q3I A;  5AW5 B;  3CCQ P;  1KFM A;  4PD4 H;  4WB4 A;  4U3F D;  1BCC J;  1UIX A;  5KAF E;  4PD4 I;  1J1D B;  2FYN B;  1LTI C;  3L73 D;  2FYU K;  4DJG A;  3RK2 B;  5CCH D;  1Q7Y Q;  3ITK A;  2QIW A;  1JCD A;  1SQQ E;  4NPE A;  3WU2 E;  4D6T G;  1S5L X;  1YJW P;  1HH0 A;  1QGK B;  2E5Y A;  2FYU G;  1G1I A;  1X22 A;  2QJY C;  3FWN A;  1EZV E;  3L70 G;  1LTJ A;  2BCC J;  2OTJ P;  1KYO I;  2QJK B;  2V7Q J;  1SFC D;  1NU1 G;  1OVR A;  1L0L G;  3A0H E;  2HLO A;  2HFE D;  2K3R A;  2XU6 A;  3H1K D;  3L74 J;  1LTG C;  2RKL A;  2YKO A;  3HUS A;  3Q5P A;  2K88 A;  5AW1 B;  1M8O B;  1FZG A;  1S3J A;  3B4S A;  2IZ1 A;  5AW6 B;  4AYC A;  3HUS B;  2P10 A;  2KSE A;  2IYO A;  1CSB A;  3A0H H;  1YTZ I;  2D2C C;  2K9J A;  2O01 J;  2AEJ A;  3H1I E;  3MTU E;  3USS A;  3L36 A;  4ASV A;  3CCM P;  1FZF A;  1BE3 G;  2ZT9 D;  3H25 A;  1M90 Q;  1NTZ E;  1KQL A;  1LTT C;  1N7S D;  3BVH A;  1M1J B;  1AV1 A;  2Z5H A;  4R4M A;  1KFN A;  1SQV K;  5AVZ B;  5AVX B;  1GU4 A;  3F89 A;  1EC5 A;  2H89 C;  4JBZ A;  4O9B A;  1EDJ A;  4U3F E;  2SPZ A;  4YPC A;  1QVG O;  1K9M Q;  3H1K J;  4EIJ A;  1S5L H;  1RQV A;  3H1L J;  1KIL A;  3RK3 C;  2C9N Y;  1W2B O;  3L4F A;  1RHZ B;  4GOD A;  1JY3 P;  1LT9 A;  2IBZ G;  4PJ0 E;  1HF9 A;  1ZN5 A;  4B86 A;  3L74 D;  2Y9Z A;  1SQV E;  2YO3 A;  1MZ9 A;  1W2E A;  3JC2 2;  2V4H A;  2M0B A;  2ZVO B;  1IFD A;  2HPC A;  3RL0 C;  3II6 A;  1DH3 A;  1SQX E;  4I2L C;  4UB6 E;  3VMX A;  1VQL P;  3HE5 A;  2QM8 A;  5KLV K;  4PJ0 H;  1FC2 C;  1URQ D;  1KTM A;  1OW7 A;  2R32 A;  1FZC A;  2QE7 H;  2C0X A;  2KLU A;  1FDI A;  3ZDM A;  3G4S P;  2XND H;  1ZW0 A;  2IFN A;  1BGY E;  1Y8A A;  1LT9 C;  1PZQ A;  2IBZ I;  1FS0 E;  2IX7 C;  2KK7 A;  2KOG A;  2H8P D;  4H44 D;  3FXD A;  5APT A;  1NGM B;  5L8R J;  1L0L D;  1NU1 D;  2JDI H;  2N1T B;  3GW6 A;  3LID A;  4IL6 X;  3IF4 A;  3OJA B;  5CJ0 A;  2QSI A;  5KLI C;  4AUW A;  3KYQ A;  1YHQ P;  1KMI Z;  3M0D C;  3RL0 g;  3L75 J;  4RES B;  1PFI A;  2J5U A;  3CWB E;  1BE3 D;  1QL1 A;  2ZT9 B;  3MP7 B;  4JQ0 D;  1BSH A;  3CCS P;  1FZA A;  3GLM A;  3TK1 A;  3JCU E;  2E74 B;  2FYU E;  4UB6 H;  5BU8 B;  3V4W A;  1KQG B;  1OVU A;  3L74 G;  1QLE D;  4L73 A;  2LKM A;  1N73 A;  3VTP C;  1DIP A;  1SFC B;  2A45 G;  1BCC E;  5DJU B;  1M1J A;  1FE6 A;  3SFD C;  2R44 A;  4WY4 C;  2AXC A;  1YJ9 P;  5AVT B;  1SQQ J;  2K1A A;  2YNY A;  2B9B A;  1SQB E;  4W7Y A;  3WMM 0;  3A2A A;  4YXD C;  5B66 H;  2FFD B;  2E43 A;  3MD0 A;  3E7K A;  3Q1M A;  4DCK A;  1YBK A;  2PRR A;  3BCC J;  4GKG A;  4DT0 A;  2AXT E;  3AEB C;  4TT3 H;  3CPW O;  1N73 C;  1SVF A;  2NPS B;  3M0A A;  1R5S A;  2E75 C;  3H6P A;  4RJT A;  4PD4 E;  3C1L A;  1EDI A;  1RQU A;  3KZI H;  3AEC C;  3CX5 I;  3KPE A;  4OH8 B;  1E5W A;  1LT9 B;  1Q82 Q;  2IBZ D;  1WT6 A;  1G2C B;  1KYO D;  1VF5 B;  3FWL A;  5TIS H;  3HD7 D;  3PH0 A;  1HJ0 A;  1NTM D;  1GL2 A;  2P7J A;  3L72 D;  5E79 H;  2D2C D;  5KLI B;  2OYI C;  3P8C E;  2KZI A;  2Y0E A;  1LTB C;  3ABV C;  3HD7 A;  3H32 A;  1GDT A;  1GL2 B;  1CI6 A;  1FZC C;  2N1T D;  1NYH A;  2D2C B;  2ZXX A;  2M5A B;  1BGY G;  3GMA A;  3H1I D;  1KZU B;  3HD7 B;  1L4A A;  1N2D C;  1S72 P;  5E79 E;  1T2K C;  2JKV A;  2E74 C;  2BEQ D;  2ZYA A;  1VQ5 P;  1ZP0 C;  3L73 G;  3M06 A;  1N86 A;  2KUB A;  1K8A Q;  1SQP E;  2Z5I A;  5GTH H;  3W68 A;  3RBX A;  4WY4 D;  2KLV A;  3BCC E;  3T97 B;  4QMA A;  1FZC B;  4PV1 C;  4I6M C;  3H1L D;  4DZO A;  1MV8 A;  3H1K G;  3AE3 C;  2AXT H;  3G9R A;  4EYY Q;  2Q1K A;  2QJP B;  3L70 D;  2A06 D;  2JEE A;  1ZXG A;  1RH5 B;  4RO0 A;  2WPQ A;  2FYN C;  3L71 E;  3R2P A;  5CHX A;  1N7L A;  1NTK G;  2KP8 A;  2NPS C;  1N73 B;  1YJN P;  3MHV A;  1RF1 C;  2FFD A;  1SQP D;  4HH2 A;  3I5C A;  2L91 A;  3D6Y A;  1EXJ A;  1OFC X;  2YKQ A;  3A7O A;  3F5H A;  2YXQ B;  3L74 E;  5KJ7 A;  4H0L B;  3V6I A;  1CW5 A;  1HGZ A;  3V2P A;  1IK7 A;  4HB1 A;  2IYP A;  1GK6 A;  1YTZ T;  4ZKP A;  3Q2Y A;  2E76 C;  2H7H A;  1VF5 D;  3CLQ A;  1JY3 N;  2R5D A;  1P84 I;  5K5G B;  3WU2 H;  2QG4 A;  2BCC D;  4OVN F;  2M3E A;  5KKZ B;  1KC8 Q;  2WSC J;  2WSE H;  1JY2 N;  3AE6 C;  1K04 A;  3LIE A;  3L71 D;  1G2C A;  3FX0 A;  1LTA C;  1NHL A;  1DD3 A;  1NTZ J;  2FXM A;  3M9H A;  2JWD A;  4HJG H;  4OGQ C;  2CPS A;  4H44 B;  1LTJ C;  2B87 B;  1R8E A;  2FKW B;  2FYZ A;  3KXD A;  2ITA A;  3TGU D;  1GW4 A;  4U3F J;  5AVQ B;  4YTP C;  3WUT A;  1S2E A;  3WUV A;  1FDM A;  3H1L E;  2OTK E;  3BAT A;  2OQQ A;  1D7M A;  4LGD E;  3KDP B;  2JWA A;  5M1B A;  1KB9 I;  3RK3 D;  2W6J H;  1BCC D;  3FGA D;  3M9Q A;  1SQV J;  2W83 C;  2Q7C A;  3CCU P;  2A06 E;  4N3Y B;  5APU A;  2W90 A;  5KLV E;  3CC4 P;  1X9V A;  1H88 A;  1S9K D;  2Y9Y A;  2FXO A;  2CK3 H;  3NFQ A;  3G6E P;  3GF3 A;  1E79 H;  2WIT A;  1J1E C;  3CC2 P;  2E75 D;  2I1K A;  3BCC D;  3C9I A;  5KJ7 D;  3L72 E;  2WPR A;  2R3C A;  1HUC A;  3BCC G;  3P7K A;  3CXH H;  1NKN A;  2E75 B;  3KQG A;  3P8C D;  3VYI A;  4GIF A;  3B5N A;  2OTL P;  1BDC A;  1KB9 D;  5H2F E;  2CPB A;  2LXC B;  1DD4 A;  1N7S B;  2POH A;  2WSE J;  3SWF A;  1JB0 J;  1L4A C;  1NAY A;  2BCC G;  2E5T A;  3HTK B;  4I7Z C;  1GU5 A;  2IBZ E;  2WMM A;  3B5N D;  3BAS A;  2B87 A;  3IFM A;  3M9B A;  2GM4 A;  3CX5 E;  5KLV D;  3D6Z A;  2K9Y A;  3S1K A;  5TIS E;  1ZOY C;  3HUS C;  5BU5 A;  1L0N G;  2IZ0 A;  1FOS E;  2FYU J;  2PP6 A;  3CX5 D;  3Q5S A;  5EFW B;  1H0T A;  1BGY D;  3B5N C;  3HD7 C;  1X8Y A;  3VMZ A;  1Q86 Q;  3H1H G;  3MUD A;  4H13 C;  2H43 A;  2B88 A;  2YO2 A;  1J2J B;  2KSJ A;  1JOC A;  5AW4 B;  2O1K A;  1U7M A;  2QVA A;  4BWN A;  1OVV A;  1XTG B;  1KB9 E;  2R3S A;  1NTK J;  3AEE C;  2WSC H;  1URQ B;  2O01 N;  1VL2 A;  5AVS B;  5AW9 B;  1LNQ A;  3HE4 B;  1FBM A;  1QL2 A;  3N4X A;  5KAF H;  1LGH B;  3AE5 C;  3L72 J;  4U7J A;  5KJ7 C;  1DX7 A;  1SQV G;  3TF5 A;  3CXH E;  3U59 A;  3WUU A;  1NH4 A;  1RE4 C;  1S4X A;  2YIU B;  3CME P;  5GTH E;  3CCL P;  1IFM A;  1CZQ A;  1IFJ A;  4ZNC A;  3H1J E;  1FDO A;  1KIL E;  1KIL D;  1L0L J;  1NU1 J;  3OW2 O;  1JO5 A;  1JTH B;  4JPZ B;  2OGU A;  2FXP A;  2PFX A;  1OW6 A;  2C0W A;  2JO1 A;  3NXS A;  1AVY A;  2OYH A;  3AEA C;  1JTH A;  3H1L G;  3VP9 A;  5KAI H;  2I8D A;  3CWB D;  2OYO A;  1AA0 A;  2JR8 A;  3CXH D;  3TGU E;  1RE3 A;  2NZ2 A;  3IN6 A;  3K5B A;  4A7P A;  1MFZ A;  1GTW A;  5AVR B;  1NWQ A;  4L75 A;  1AQT A;  2OYH B;  3EQ2 A;  1FZB A;  1W5C E;  1YIJ P;  1FJK A;  3SWK A;  3D71 A;  1M7L A;  2KZJ A;  3V2N A;  1QEX A;  1SLQ A;  4C7R A;  1JY2 O;  2KNC A;  2XZR A;  2Y0D A;  3BRV B;  3NTN A;  2ZYG A;  1T3U A;  2JP3 A;  3AE9 C;  1PP9 J;  2G8Y A;  5APV A;  5AW7 B;  3TNU A;  2A06 G;  1IJD B;  3PLN A;  3OA7 A;  5AVV B;  2A45 H;  4K35 A;  1Q90 D;  1SQB K;  2WWW A;  1SQX D;  3PHL A;  4XE5 B;  1JY2 P;  5TJH A;  3A5T A;  3CMA P;  4ASW A;  5KAI E;  4H0L C;  2IFM A;  2AEF A;  3L71 J;  3A0B E;  2I1J A;  1IFI A;  1L0N J;  2YIU C;  3EFF K;  1NJI Q;  2RN0 A;  3KHU A;  1AJY A;  2Q9I A;  4M3L A;  3E1I A;  3EFG A;  1KYO E;  4WY4 A;  5CCH C;  2IPP A;  1VQ9 P;  1VQ8 P;  3L73 J;  4ZMD A;  4JYB A;  4OGQ D;  2W6B A;  3GG2 A;  3O6Q A;  3TGU J;  1YIT P;  1JCC A;  1BDD A;  3V2Q A;  3D70 A;  1L0L K;  1NU1 K;  3MIW A;  1M1K Q;  1QX8 A;  3HE4 A;  5AW8 B;  1FJP A;  2VRS A;  2P2U A;  1T3J A;  4GT1 A;  2QRX A;  1A02 J;  1OIP A;  1NTM G;  1SQX K;  2IDB A;  2ZT9 C;  4I7Z B;  4KT0 J;  1MKM A;  3VMA A;  4IFM A;  1KOR A;  3L75 G;  1ZLL A;  5CCH A;  4IL6 E;  1ZV8 A;  2R5B A;  3BRT B;  3V4Q A;  3CC7 P;  1HTL C;  3UIA A;  4H13 D;  1NTK K;  1GL2 C;  3AE7 C;  1SQP K;  2G3A A;  2YMY A;  4IFF A;  3B5N B;  2HOD A;  1YI2 P;  2OYI A;  3VP8 A;  3H1K E;  1ZRT E;  4IL6 H;  2FY8 A;  1JMB A;  3S9O A;  1WRG A;  1J1E B;  3SWY A;  1L2P A;  3VMY A;  1VPC A;  2WT7 A;  2KXP B;  2N9Y B;  3H1H J;  5B5E E;  1JEK A;  1M57 D;  5BVZ A;  2QEX P;  3H1I J;  1IO4 A;  1MFT A;  1DEE G;  2N1T A;  4PV1 D;  1VQM P;  1HVV A;  4PD4 D;  4BRY A;  2WT7 B;  3AE8 C;  3RL0 B;  3B71 A;  2M3B A;  1L4A D;  4MN4 C;  3L73 E;  1JMM A;  1VQ7 P;  1GZL A;  1LWU B;  1S5L E;  2KNC B;  4NPF X;  3C8V A;  3QWO C;  3IAO A;  4RKU J;  5APY A;  3TNU B;  4KJM A;  2YKP A;  2OAR A;  4YXW H;  2PAJ A;  2BEZ F;  1K73 Q;  5KKZ C;  1RE4 A;  1VQN P;  2N1T C;  2O1J A;  1JM0 A;  1NOH A;  1S1C X;  2QJK C;  4UB8 H;  3E1R A;  4Y99 C;  1AFO A;  2WSF H;  1HJB A;  1HBW A;  1NKZ B;  5CJ4 A;  3N7N A;  3M91 A;  3CCR P;  1SQB D;  1VQP P;  1DEB A;  3L75 E;  3Q5R A;  4AQR D;  1BE3 E;  2O3J A;  2KS1 A;  1YYC A;  4C46 A;  3HTK A;  2J59 M;  2V7Q H;  2WPV B;  3CI9 A;  2L5G B;  1KIL B;  1X79 B;  3GHG C;  4ZKU A;  2GA1 A;  5H2F H;  3FXE A;  4L74 A;  2FYU D;  3IR9 A;  1U7J A;  3G3Z A;  5APW A;  2O01 H;  1NTM J;  2XKM A;  4Y28 J;  2C9L Y;  4H13 B;  2AEM A;  2Q5U A;  3O8Z A;  1OXZ A;  4U3F G;  1S9K E;  4EDF A;  1FAV A;  2DW3 A;  1NTZ K;  1PGJ A;  1Y47 A;  4GOE A;  1BSN A;  3L75 D;  5CBN A;  4WWI A;  3PJS K;  3RL0 D;  3HRN A;  1YQ3 C;  1ZME C;  5CBO A;  1NTM E;  1URQ A;  1LWU C;  1NTK E;  1NTM K;  1SQX G;  4K3A A;  3S4R A;  3I55 P;  3KZI E;  1J1D C;  1EXI A;  2HOD B;  3CL3 D;  1U57 A;  5GTI H;  3AED C;  1L4A B;  2JJL A;  4GDO A;  4JF7 A;  2WVR A;  1RF0 A;  3H1H D;  3JCU H;  4NPD A;  3U1C A;  3Q3D A;  3P8M C;  4Y99 B;  1CI6 B;  4D6T D;  2A45 I;  3CCV P;  2N9B A;  2MKV A;  2ZXE B;  1BE3 J;  5C39 A;  1EQ7 A;  2FFD C;  2K37 A;  5APX A;  5B66 E;  1SQV D;  1LWU A;  4L76 A;  4N6J A;  1AVO A;  4I1L A;  1OZH A;  4XFJ A;  1PGP A;  3M0D A;  1NTZ D;  5CCG D;  2RH0 A;  3I56 P;  2BCC E;  1LTS C;  1RF1 B;  3CWB G;  3A3Y B;  2GUV A;  2WZ7 A;  1M56 D;  1N7S A;  2K9J B;  3MUD C;  3V2R A;  5CMZ A;  2GUS A;  4IFD K;  1USE A;  3AEG C;  1KQS O;  1PP9 E;  3W67 A; 
#chains in the Genus database with same CATH homology
 5KAI E;  5TIS E;  3KZI E;  4UB6 E;  4UB8 E;  3A0B E;  5B5E E;  5E79 E;  1W5C E;  5KAF E;  5B66 E;  2AXT E;  1S5L E;  3WU2 E;  5H2F E;  5GTH E;  4IL6 E;  4PJ0 E;  3A0H E;  5GTI E;  3JCU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...