5B66E

Crystal structure analysis of photosystem ii complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
78
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 21
structure length 78
sequence length 78
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5b66E00
5KAFE 5B66E 3A0BE 4PJ0E 4IL6E 5KAIE 3KZIE 4UB6E 4UB8E 5GTIE 1S5LE 5B5EE 5E79E 5TISE 5GTHE 5H2FE 3WU2E 3A0HE 3JCUE 1W5CE 2AXTE
chains in the Genus database with same CATH superfamily
1K04A 3GLMA 3MTUE 1VQOP 1UIIA 4W7YA 1LTJC 1SQVD 4GIFA 1SQPJ 4EDFA 4O9BA 1Y47A 3CCMP 2QA4P 3M0DA 2M5AB 3HRNA 3L71D 2KLVA 5AW6B 1GL2B 3JC22 1SQBK 2Z4EA 1S9KD 1OX3A 2C9NY 4RO0A 3MZWB 1BGYD 4PD4H 3H1JE 1YJNP 4WBAA 1U57A 2E74D 4N6JA 1N7LA 3CCLP 3RL0g 1T2KC 2Q1KA 2Q3EA 3M91A 3BCCD 3AE2C 3H1IG 4OVNF 1LTJA 1NU1E 2Q5UA 3SWKA 2OTLP 3H1HD 3P8CE 4H13B 3B4SA 1IO4A 1Y9BA 3GF3A 5AVQB 2K1AA 3VN0A 1HH0A 4OH8B 2OYIB 3ITKA 4Y99C 2KXPB 3JCUH 5GTHE 1QEXA 2L91A 3L72E 1U7MA 2W90A 1L4AB 1LTTC 3CWBJ 4HB1A 2OTKE 5AW7B 1VF5B 1LTBC 1DH3A 1LWUB 2HG5D 3E1RA 1YITP 1OIPA 2R5BA 2XNDH 4H0LC 3FWNA 2QJKB 3CXHE 4KT0J 3H32A 1K05A 2AXTH 4HKZH 1VQ7P 2ZXXA 1OXZA 2KB7P 3MP7B 4KJMA 3H1JD 3HD7B 2Y0EA 4JYBA 1H88A 3CCVP 1N73B 2WT7B 1AV1A 1Z56A 3RK2D 1FZGA 2JWAA 3BASA 5AVXB 3RGUA 3TGUG 5CJ4A 1R5SA 1RF0C 1NU1D 1IFIA 2JO1A 2A06E 1K73Q 3KQGA 2WTYA 2E74C 5GTIE 2FY8A 3P8CD 1JY3O 3CCEP 2WVRA 2GUSA 2FYUG 2XDJA 3B5NC 2H8PD 1ZOYC 5KAIH 1NAFA 3P32A 1SQVK 4I7ZC 2QJYB 4BRYB 2K9JA 2XNXA 5AVZB 4OGQB 1KC8Q 5KLIC 1M1KQ 1IC2A 2OYHB 1XTCC 3L72D 1KILD 3UIAA 5AW0B 1KFNA 1RF0A 3VMYA 1URQB 2OTJP 3CXHD 2H89C 3CMEP 1QLED 1VQ6P 2MJZA 4RKUJ 4DZOA 3M9BA 3F5HA 2P2UA 1JCDA 3B5NA 5APXA 3I56P 1SQQJ 4WWIA 2KZJA 3M0AA 2K9YA 2WSFH 1HGZA 3A5TA 2ZVOB 1P84E 3OW2O 5B5EH 1A02J 3U59A 3JSVC 3WUUA 3L75G 3N7NA 2DW3A 5APUA 2N1TB 2POHA 1FZEA 4PV1B 5APSA 3V5BA 4YPCA 1HJ0A 3NTNA 2K37A 2A06D 1H0TA 2P67A 2QJPB 2W83C 1U7JA 1LP1B 5DJTB 1NTZJ 4W7ZA 1UIXA 1PP9E 3L36A 3H1KJ 2FFDC 5BVZA 3PHLA 1GL2D 2KS1A 5APQA 3HUSB 4M3LA 2RH0A 1OMIA 1NTMK 1Q86Q 3CXHI 3CC2P 2R44A 1X8YA 5H2FH 4EYYQ 1JTHB 3V2QA 4KHXA 2KK7A 3A7OA 2J58A 2RKLA 1K9MQ 1SQBE 1HF9A 2E75B 4JF7A 1N2DC 1LTIC 1L0LD 3VOPA 1KILC 2YMKA 2FFDA 1NYHA 1G2CB 2Y9YA 3L74E 1IFMA 1J1DB 3AEAC 1QL2A 2JKVA 4U7JA 3V2PA 1W2BO 3FXDA 3V2RA 3PLNA 1P84D 2P58A 1GU4A 1JCCA 5CMZA 3L73E 3WUTA 3P8MC 1L4AD 3HE5B 4L75A 4TLFA 2NZ2A 2BCCG 3CC7P 1KILA 3A3YB 1L0NK 1M1JB 2C0XA 4UB8E 1PP9D 2K3RA 1SS1A 5L8RJ 3WU2E 3H1IJ 1HUCA 4R4MA 3RBZA 1EZVE 3GHGC 1FZFA 3CWBE 4Z1MH 1PL5A 2ZJSE 3CX5E 1FU1A 2GA1A 3HD7D 5CJ0A 1HWTC 2O1JA 3AECC 2J5UA 3VYIA 4NPEA 1SQBD 1GMJA 1H0TB 1SQVG 2CPSA 3S9OA 4YXDC 2HR3A 1P84I 1KORA 3M9HA 1J1EC 3L74D 3RL0D 1SQXG 3L71G 2OARA 4L76A 5CCGD 4ZKUA 1VQLP 4ZKPA 1W5CE 1BGYG 5B66E 2WSFJ 3L73D 4N3YB 3IF4A 1VQKP 1S2EA 2JP3A 1X79B 3BCCG 1YJWP 2MKVA 3D70A 2YIUC 1URQD 1JUNA 1VQPP 3II6A 4A7PA 2H7HA 1KD1Q 2WZ7A 1BDDA 5KJ7D 2M8RA 1LWUC 1NWQA 2CK3H 3TSIA 3CL3D 3TGUJ 5AW5B 2FYNC 1EZVD 4XA4A 3CWBD 4GOEA 3CX5D 2Y0CA 3TK1A 3AEBC 1N7SD 1PGQA 1AVYA 4W80A 1GK4A 1KB9E 1JB0J 1S5LE 1TU3F 2WQYC 4WB4A 1LT1A 4GDOA 4C7RA 1G1JA 3HD7C 2LXBA 1X0TA 1AA0A 4L73A 1KMIZ 3SSUA 1S5LX 1DEEG 1PPJE 1NO4A 3AE4C 2V4HA 1WMKA 3H1JG 1FDOA 2UWJE 2D2CD 4U3FE 3RL0C 4N78E 3VP8A 1NJIQ 5CCGC 1JNMA 2XV5A 2BEZF 3P7KA 2QJYC 1NTZE 1NU1G 1MUUA 3RK3B 2K88A 1KV4A 2WSSH 1EZVI 4I1LA 3MUDC 3CX5I 3S1KA 1NTME 2YXRB 1IZNB 1M7LA 3L75J 5DJUB 1FE6A 2IPPA 3AE3C 1IK9A 4HJGH 1VL2A 1OW8A 2W6JH 4I2LC 1KZUB 3SFDC 1RHZB 5CHXA 2SPZA 1PGPA 3CCUP 2E76B 1JY2N 3GMAA 3L72G 5KJ7C 5CCGA 1KB9D 3BRVB 4H44C 1OVVA 2OQQA 2I1JA 3B8EB 1FBMA 3C9IA 3MIWA 1JY3P 3MUDA 2KNCA 3V2NA 2JJLA 1N7SC 2AXTE 3VMZA 4WY4B 1PPJD 1KYOE 3G4SP 3M06A 1YQ4C 1FJKA 3LW5H 5AW8B 5CBOA 4U3FD 4N78D 3A0HE 1L0NE 2I8DA 3T97B 1E5WA 3TNUB 5AW3B 1RY3A 2G3AA 3AEFC 4QMAA 2HPCB 1NTZD 4OWFA 2A06G 2GUVA 1LNQA 2D2CC 4GKGA 5M1BA 1VQ9P 2GM4A 3LIEA 1NTMD 2O1KA 1LJ2A 5AVSB 2KI7B 2C0WA 3C8VA 2Y9ZA 1KB9I 1ZP0C 3HTKB 2B87B 2NPSB 2BCCJ 1RF1B 3K5BA 2ZT9B 1Q82Q 2QG4A 3NMDA 5KAFH 4TT3H 3G71P 4PJ0H 4IL6H 1JMMA 3KZIH 4LC1A 1Y8AA 4D6TG 3BATA 1YBKA 1SLQA 2WSEJ 5K5GB 2WMMA 1FOSF 5GTHH 4C7NA 1M57D 1L0LG 3OJAB 1GK6A 4IFDK 1KYOD 2WPRA 5KLVJ 1NKZB 3H1LE 1LT9C 3L37A 3CXHH 1BCCE 1SFCD 5B5EE 1EXJA 5E79E 3AE8C 1L0ND 3KXDA 5AW9B 4CPGA 2PFXA 1BSHA 5KKZC 3C1LA 3OA7A 2Q3IA 1SQXJ 1LTJB 1NTKJ 3CMAP 2KUBA 3CCJP 1FZCC 2HYNA 1BGYJ 3MGNA 1QGKB 1PP9G 2YKOA 1AQTA 4C46A 4L74A 3TGUE 1LT9A 1FDIA 3KDPB 3R4YA 3Q5RA 3HE4A 2YO3A 3AEGC 3FGAD 2J59M 5TJHA 2KYVA 2W6AA 5H2FE 1YQ3C 2LXCB 1KYOI 1N8RQ 1SQBG 1BE3J 2R5DA 1LGHB 2OYOA 3D6YA 3I55P 1FDMA 3H32B 3RK2C 3O8ZA 3L74G 3H1LD 1NTZK 1GZLA 4Y99B 1OVUA 1BCCD 2B9BA 2IZ0A 2R3CA 2A45I 2IFMA 3FXEA 3LW5J 3E1IA 5BU8B 2IBZG 3L73G 1AFOA 2IYPA 1SQPE 1P84H 1T3UA 1GU5A 4YXWH 4H0LB 1SFCC 3A0BE 1ZN5A 1GW4A 2KZIA 5CBNA 3H1JJ 3W68A 3D6ZA 1QX8A 4H13D 2FXPA 2H88C 4WY4D 2JWDA 2KLUA 4AYCA 1IFDA 2K9JB 3O6QA 4IFFA 3U1AA 1NU1J 3CWBG 1H8AA 1YIJP 2HODA 1VF5D 1XTGB 1YI2P 4JBZA 3EFFK 1ZMEC 1PIXA 3B5NB 4LLHA 1T3JA 4DT0A 2QM7A 2Y0DA 5AVWB 3L72J 1HJBA 4I7ZB 5C39A 3CPWO 5BU5A 1USEA 2RN0A 5KLIB 1VQMP 2E5YA 2KOGA 3L70G 1RQVA 2ZT9D 1HBWA 1SQPD 1GL2C 3I5CA 3GG2A 2FYZA 2WPVB 3AE5C 1OW6A 4HYTB 1LTGC 4DCKA 3IAOA 1ZV8A 1IK7A 3LIDA 2ZYGA 2QRXA 4ZNCA 2IYOA 1DEBA 2BCCE 1FC2C 3V4WA 2ZAEB 2KS1B 3GHGA 4BWNA 3CCRP 3CC4P 2M5AA 5AVTB 4UB8H 1PGJA 4OGQD 1NGMB 1GL2A 4H13C 3IR9A 1L2PA 3V6IA 4NPDA 1GDTA 1EDJA 1GW3A 2VRSA 2OYIC 3CX5H 4WVZA 2IDBA 3H1HG 5KLVE 1L4AC 1AJYA 2WSCH 2FFDB 5AVRB 1VF5C 2LKMA 1PPJG 2E42A 2M3EA 2KIKA 5APYA 4D6TJ 1MKMA 2WPQA 2QJKC 1VQ5P 1NH4A 2YMYA 1HTLC 2QM8A 4U3FG 1SQXE 1L0LJ 1NTKE 2FYUJ 2PAJA 4DJGA 2QE7H 1CZQA 2N1TD 2OYIA 4PV1D 1S72P 1NTZG 5B66H 1SQQE 1KILB 1FZBA 2YNYA 1L4AA 1N73C 1NVOA 3Q5SA 2IX7C 1LWUA 1NTMG 1RE3C 3TDKA 1S1CX 1FAVA 2BCCD 1WT6A 5AVYB 2AEFA 3Q3DA 2HLOA 1M8OB 4PD4E 2WWWA 5AVUB 2B88A 3PRJA 3PJSK 3KHUA 1BE3E 4K3AA 1NHLA 1PP9J 2FKWB 3RBXA 5TISH 1KN7A 1JY2O 1PFIA 3HD7A 1N73A 3NFQA 3GW6A 3SWFA 3QH9A 2WT7A 2E75D 4OGQC 3KPEA 3H1KE 3KYQA 1CI6A 2OYHC 1EDIA 3AEDC 1RE3A 5KLVD 1SQPK 2LR2A 2ITAA 1KB9H 2H43A 1S5LH 1URQC 3GHGB 4I6MC 2P10A 1SQBJ 3JCUE 1JO5A 1SQXD 4Y28J 2AEJA 1L0NG 1NTKD 1JEKA 4UB6H 2L5GB 1YYCA 2W8ZA 1IFJA 4XFJA 4BRYA 3D71A 3SFEC 2IFNA 2R32A 3L74J 4EOTA 1YJ9P 3G9RA 2O01H 3L35A 1SQQD 2OYHA 2A45G 2W6BA 3QWOC 1J1EB 1S4XA 4R4LA 1LTSC 3B5ND 4JPZB 2N1TC 1URQA 2Z5HA 4PV1C 2WPSA 1ZLLA 3L73J 3E7KA 2XKMA 5CCHD 3ABVC 4PD4D 2QJPC 2YO2A 5KJ7A 2KP8A 5KAFE 1BE3D 1EDLA 4PJ0E 4IL6E 2YIUB 3KZIE 1EQ7A 1DIPA 5KTBA 4AUWA 1S3JA 3HUSC 1N7SA 2Q6QA 3H1KD 1VPCA 2CPBA 1KILE 2N1TA 2FXOA 2IZ1A 1FJPA 1JMBA 3H1IE 2P7JA 4IL6X 1CSBA 2Q9IA 4YTPC 5KAIE 3M9QA 2AXCA 1USDA 3H1LG 2FYNB 1M90Q 2WSCJ 2E75C 1LP1A 1BCCG 1IJDB 1SVFA 3AE1C 1IFNA 3S4RA 1KYOH 3H6PA 3PP5A 5AW1B 1J1DC 1FZAA 2ZYAA 1AVOA 3FX0A 1VQ4P 3HUSA 1GTWA 2ZXEB 2PGDA 1NAYA 1X9VA 3A0HH 2N9YB 4PD4I 3RK3E 3L70J 1ZW0A 1CI6B 1JTHA 1VQNP 1R8EA 3GF7A 1W2EA 4BXLA 2E5TA 2JEEA 2R3SA 2A45H 1KTMA 5KLVK 1M1JC 1G2CA 2PP6A 3RL0B 1M56D 1SQVJ 1DD4A 5APVA 2M3BA 2B89A 3PH0A 4GODA 3AE7C 2QIWA 3N4XA 3F89A 3CD6P 1G1IA 4XE5B 5CCHC 3L71J 4LGDE 1IFPA 1E79H 3MHVA 1ZXGA 2G8YA 1SQXK 2C9LY 2YKPA 2KNCB 4B86A 1MZ9A 1NTKK 3H1ID 3HE5A 1JY3N 4IFMA 3ZDMA 3CCSP 3MD0A 3G6EP 4D6TE 2FXMA 2Q7CA 4GOFA 1SQQK 3Q5PA 1PZQA 3BCCJ 1OFCX 1M1JA 4RESB 2V7QH 5GTIH 3Q1MA 1L0LE 1WRGA 1MFTA 2FYUE 1OW7A 2Z5IA 1YHQP 3G3ZA 3VP9A 5CCHA 4H44B 1Q90D 3H1HJ 1T8ZA 4ASWA 4ASVA 1SQPG 1MFZA 2N9BA 1JM0A 3AE6C 1FZCA 5E79H 3VTPC 1N7SB 3RK3D 2OGUA 2O01J 3W67A 2YXQB 1YTZI 2O01N 1CW5A 1OWAA 4U3FJ 2QEXP 4HH2A 4JYCA 1A02F 3VMAA 1N86A 3FWLA 1KFMA 2E76D 1Q2NA 1ZR2A 1NTMJ 3AEEC 3H25A 3BRTB 1NKNA 2W27A 2D2CB 1ZR4A 3SWYA 4IOIH 2E43A 3L75E 4C7NB 2O3JA 3TGUD 4D6TD 3EWKA 4GT1A 2KSJA 1DX7A 1EZVG 2FYUD 1ZRTE 1QL1A 3R2PA 3EFGA 1MV8A 2AEMA 1NU1K 1Q81Q 1SFCA 1EXIA 2P1JA 1OZHA 1D7MA 2E74B 2JDIH 4EIJA 1KQGB 2IBZE 1X22A 1EDKA 1L0NJ 3EQ2A 1JOCA 1LT9B 3NXSA 3A0BH 1R5LA 3HE4B 3RK3C 2NPSD 1T6AA 2QSIA 2BEQD 5KKZB 5AW2B 1RE4C 2XU6A 4MN4C 1FZCB 3L75D 4DOJA 2E76C 3Q2YA 5KLVG 2ZYDA 3B71A 5AVVB 1PV3A 3OAKA 2FBWC 1QVGO 1FOSE 1YTZT 2WITA 4ZMDA 2JR8A 3V4QA 1ZRTD 3USSA 1RE4A 5APWA 2V7QJ 2XZRA 4WY4C 3TYYA 3WU2H 1NTKG 3VMXA 4K35A 1JY2P 1HVVA 2BASA 3L4FA 4JQ0D 3CLQA 3L70E 3BVHA 3H1LJ 1SQQG 2HFED 3IN6A 2IBZD 4RJTA 1BCCJ 3RK2B 1VQ8P 2RMZA 1OVRA 1K8AQ 4AQRD 3WUVA 5AW4B 5EFWB 3TF5A 1SQVE 1KQFB 3PTZA 3O6QB 1SP4A 4NPFX 4WY4A 2M0BA 1T2KD 3L71E 1QVFO 1FS0E 1GD2E 4EI2A 2KSEA 1BE3G 4H44D 1J2JB 1S9KE 2HODB 1LTAC 1SFCB 5TISE 1L0LK 1BGYE 3CI9A 1BDCA 2PRRA 2NPSC 1VDFA 2FYUK 1DD3A 1RF1C 2ZT9C 2YKQA 3H1KG 3T97A 2NRGA 1Q7YQ 2WSEH 1HGVA 2ZVNB 3TNUA 2ZFCA 3BCCE 3U1CA 3A2AA 2HPCA 1RQUA 1H89A 3WMM0 3H1HE 3M0DC 5APTA 2IBZI 2I1KA 4UB6E 1PGOA 3HTKA 2B87A 2NPSA 1KQLA 3CCQP 3AE9C 3L70D 1NOHA 1RF1A 2QVAA 1BSNA 4H0LD 1RH5B 3IFMA 1KQSO 1AQ5A 1EC5A
chains in the Genus database with same CATH topology
5KAFE 5B66E 3A0BE 4PJ0E 4IL6E 5KAIE 3KZIE 4UB6E 4UB8E 5GTIE 1S5LE 5B5EE 5E79E 5TISE 5GTHE 5H2FE 3WU2E 3A0HE 3JCUE 1W5CE 2AXTE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAF E;  5B66 E;  3A0B E;  4PJ0 E;  4IL6 E;  5KAI E;  3KZI E;  4UB6 E;  4UB8 E;  5GTI E;  1S5L E;  5B5E E;  5E79 E;  5TIS E;  5GTH E;  5H2F E;  3WU2 E;  3A0H E;  3JCU E;  1W5C E;  2AXT E; 
#chains in the Genus database with same CATH topology
 1K04 A;  3GLM A;  3MTU E;  1VQO P;  1UII A;  4W7Y A;  1LTJ C;  1SQV D;  4GIF A;  1SQP J;  4EDF A;  4O9B A;  1Y47 A;  3CCM P;  2QA4 P;  3M0D A;  2M5A B;  3HRN A;  3L71 D;  2KLV A;  5AW6 B;  1GL2 B;  3JC2 2;  1SQB K;  2Z4E A;  1S9K D;  1OX3 A;  2C9N Y;  4RO0 A;  3MZW B;  1BGY D;  4PD4 H;  3H1J E;  1YJN P;  4WBA A;  1U57 A;  2E74 D;  4N6J A;  1N7L A;  3CCL P;  3RL0 g;  1T2K C;  2Q1K A;  2Q3E A;  3M91 A;  3BCC D;  3AE2 C;  3H1I G;  4OVN F;  1LTJ A;  1NU1 E;  2Q5U A;  3SWK A;  2OTL P;  3H1H D;  3P8C E;  4H13 B;  3B4S A;  1IO4 A;  1Y9B A;  3GF3 A;  5AVQ B;  2K1A A;  3VN0 A;  1HH0 A;  4OH8 B;  2OYI B;  3ITK A;  4Y99 C;  2KXP B;  3JCU H;  5GTH E;  1QEX A;  2L91 A;  3L72 E;  1U7M A;  2W90 A;  1L4A B;  1LTT C;  3CWB J;  4HB1 A;  2OTK E;  5AW7 B;  1VF5 B;  1LTB C;  1DH3 A;  1LWU B;  2HG5 D;  3E1R A;  1YIT P;  1OIP A;  2R5B A;  2XND H;  4H0L C;  3FWN A;  2QJK B;  3CXH E;  4KT0 J;  3H32 A;  1K05 A;  2AXT H;  4HKZ H;  1VQ7 P;  2ZXX A;  1OXZ A;  2KB7 P;  3MP7 B;  4KJM A;  3H1J D;  3HD7 B;  2Y0E A;  4JYB A;  1H88 A;  3CCV P;  1N73 B;  2WT7 B;  1AV1 A;  1Z56 A;  3RK2 D;  1FZG A;  2JWA A;  3BAS A;  5AVX B;  3RGU A;  3TGU G;  5CJ4 A;  1R5S A;  1RF0 C;  1NU1 D;  1IFI A;  2JO1 A;  2A06 E;  1K73 Q;  3KQG A;  2WTY A;  2E74 C;  5GTI E;  2FY8 A;  3P8C D;  1JY3 O;  3CCE P;  2WVR A;  2GUS A;  2FYU G;  2XDJ A;  3B5N C;  2H8P D;  1ZOY C;  5KAI H;  1NAF A;  3P32 A;  1SQV K;  4I7Z C;  2QJY B;  4BRY B;  2K9J A;  2XNX A;  5AVZ B;  4OGQ B;  1KC8 Q;  5KLI C;  1M1K Q;  1IC2 A;  2OYH B;  1XTC C;  3L72 D;  1KIL D;  3UIA A;  5AW0 B;  1KFN A;  1RF0 A;  3VMY A;  1URQ B;  2OTJ P;  3CXH D;  2H89 C;  3CME P;  1QLE D;  1VQ6 P;  2MJZ A;  4RKU J;  4DZO A;  3M9B A;  3F5H A;  2P2U A;  1JCD A;  3B5N A;  5APX A;  3I56 P;  1SQQ J;  4WWI A;  2KZJ A;  3M0A A;  2K9Y A;  2WSF H;  1HGZ A;  3A5T A;  2ZVO B;  1P84 E;  3OW2 O;  5B5E H;  1A02 J;  3U59 A;  3JSV C;  3WUU A;  3L75 G;  3N7N A;  2DW3 A;  5APU A;  2N1T B;  2POH A;  1FZE A;  4PV1 B;  5APS A;  3V5B A;  4YPC A;  1HJ0 A;  3NTN A;  2K37 A;  2A06 D;  1H0T A;  2P67 A;  2QJP B;  2W83 C;  1U7J A;  1LP1 B;  5DJT B;  1NTZ J;  4W7Z A;  1UIX A;  1PP9 E;  3L36 A;  3H1K J;  2FFD C;  5BVZ A;  3PHL A;  1GL2 D;  2KS1 A;  5APQ A;  3HUS B;  4M3L A;  2RH0 A;  1OMI A;  1NTM K;  1Q86 Q;  3CXH I;  3CC2 P;  2R44 A;  1X8Y A;  5H2F H;  4EYY Q;  1JTH B;  3V2Q A;  4KHX A;  2KK7 A;  3A7O A;  2J58 A;  2RKL A;  1K9M Q;  1SQB E;  1HF9 A;  2E75 B;  4JF7 A;  1N2D C;  1LTI C;  1L0L D;  3VOP A;  1KIL C;  2YMK A;  2FFD A;  1NYH A;  1G2C B;  2Y9Y A;  3L74 E;  1IFM A;  1J1D B;  3AEA C;  1QL2 A;  2JKV A;  4U7J A;  3V2P A;  1W2B O;  3FXD A;  3V2R A;  3PLN A;  1P84 D;  2P58 A;  1GU4 A;  1JCC A;  5CMZ A;  3L73 E;  3WUT A;  3P8M C;  1L4A D;  3HE5 B;  4L75 A;  4TLF A;  2NZ2 A;  2BCC G;  3CC7 P;  1KIL A;  3A3Y B;  1L0N K;  1M1J B;  2C0X A;  4UB8 E;  1PP9 D;  2K3R A;  1SS1 A;  5L8R J;  3WU2 E;  3H1I J;  1HUC A;  4R4M A;  3RBZ A;  1EZV E;  3GHG C;  1FZF A;  3CWB E;  4Z1M H;  1PL5 A;  2ZJS E;  3CX5 E;  1FU1 A;  2GA1 A;  3HD7 D;  5CJ0 A;  1HWT C;  2O1J A;  3AEC C;  2J5U A;  3VYI A;  4NPE A;  1SQB D;  1GMJ A;  1H0T B;  1SQV G;  2CPS A;  3S9O A;  4YXD C;  2HR3 A;  1P84 I;  1KOR A;  3M9H A;  1J1E C;  3L74 D;  3RL0 D;  1SQX G;  3L71 G;  2OAR A;  4L76 A;  5CCG D;  4ZKU A;  1VQL P;  4ZKP A;  1W5C E;  1BGY G;  5B66 E;  2WSF J;  3L73 D;  4N3Y B;  3IF4 A;  1VQK P;  1S2E A;  2JP3 A;  1X79 B;  3BCC G;  1YJW P;  2MKV A;  3D70 A;  2YIU C;  1URQ D;  1JUN A;  1VQP P;  3II6 A;  4A7P A;  2H7H A;  1KD1 Q;  2WZ7 A;  1BDD A;  5KJ7 D;  2M8R A;  1LWU C;  1NWQ A;  2CK3 H;  3TSI A;  3CL3 D;  3TGU J;  5AW5 B;  2FYN C;  1EZV D;  4XA4 A;  3CWB D;  4GOE A;  3CX5 D;  2Y0C A;  3TK1 A;  3AEB C;  1N7S D;  1PGQ A;  1AVY A;  4W80 A;  1GK4 A;  1KB9 E;  1JB0 J;  1S5L E;  1TU3 F;  2WQY C;  4WB4 A;  1LT1 A;  4GDO A;  4C7R A;  1G1J A;  3HD7 C;  2LXB A;  1X0T A;  1AA0 A;  4L73 A;  1KMI Z;  3SSU A;  1S5L X;  1DEE G;  1PPJ E;  1NO4 A;  3AE4 C;  2V4H A;  1WMK A;  3H1J G;  1FDO A;  2UWJ E;  2D2C D;  4U3F E;  3RL0 C;  4N78 E;  3VP8 A;  1NJI Q;  5CCG C;  1JNM A;  2XV5 A;  2BEZ F;  3P7K A;  2QJY C;  1NTZ E;  1NU1 G;  1MUU A;  3RK3 B;  2K88 A;  1KV4 A;  2WSS H;  1EZV I;  4I1L A;  3MUD C;  3CX5 I;  3S1K A;  1NTM E;  2YXR B;  1IZN B;  1M7L A;  3L75 J;  5DJU B;  1FE6 A;  2IPP A;  3AE3 C;  1IK9 A;  4HJG H;  1VL2 A;  1OW8 A;  2W6J H;  4I2L C;  1KZU B;  3SFD C;  1RHZ B;  5CHX A;  2SPZ A;  1PGP A;  3CCU P;  2E76 B;  1JY2 N;  3GMA A;  3L72 G;  5KJ7 C;  5CCG A;  1KB9 D;  3BRV B;  4H44 C;  1OVV A;  2OQQ A;  2I1J A;  3B8E B;  1FBM A;  3C9I A;  3MIW A;  1JY3 P;  3MUD A;  2KNC A;  3V2N A;  2JJL A;  1N7S C;  2AXT E;  3VMZ A;  4WY4 B;  1PPJ D;  1KYO E;  3G4S P;  3M06 A;  1YQ4 C;  1FJK A;  3LW5 H;  5AW8 B;  5CBO A;  4U3F D;  4N78 D;  3A0H E;  1L0N E;  2I8D A;  3T97 B;  1E5W A;  3TNU B;  5AW3 B;  1RY3 A;  2G3A A;  3AEF C;  4QMA A;  2HPC B;  1NTZ D;  4OWF A;  2A06 G;  2GUV A;  1LNQ A;  2D2C C;  4GKG A;  5M1B A;  1VQ9 P;  2GM4 A;  3LIE A;  1NTM D;  2O1K A;  1LJ2 A;  5AVS B;  2KI7 B;  2C0W A;  3C8V A;  2Y9Z A;  1KB9 I;  1ZP0 C;  3HTK B;  2B87 B;  2NPS B;  2BCC J;  1RF1 B;  3K5B A;  2ZT9 B;  1Q82 Q;  2QG4 A;  3NMD A;  5KAF H;  4TT3 H;  3G71 P;  4PJ0 H;  4IL6 H;  1JMM A;  3KZI H;  4LC1 A;  1Y8A A;  4D6T G;  3BAT A;  1YBK A;  1SLQ A;  2WSE J;  5K5G B;  2WMM A;  1FOS F;  5GTH H;  4C7N A;  1M57 D;  1L0L G;  3OJA B;  1GK6 A;  4IFD K;  1KYO D;  2WPR A;  5KLV J;  1NKZ B;  3H1L E;  1LT9 C;  3L37 A;  3CXH H;  1BCC E;  1SFC D;  5B5E E;  1EXJ A;  5E79 E;  3AE8 C;  1L0N D;  3KXD A;  5AW9 B;  4CPG A;  2PFX A;  1BSH A;  5KKZ C;  3C1L A;  3OA7 A;  2Q3I A;  1SQX J;  1LTJ B;  1NTK J;  3CMA P;  2KUB A;  3CCJ P;  1FZC C;  2HYN A;  1BGY J;  3MGN A;  1QGK B;  1PP9 G;  2YKO A;  1AQT A;  4C46 A;  4L74 A;  3TGU E;  1LT9 A;  1FDI A;  3KDP B;  3R4Y A;  3Q5R A;  3HE4 A;  2YO3 A;  3AEG C;  3FGA D;  2J59 M;  5TJH A;  2KYV A;  2W6A A;  5H2F E;  1YQ3 C;  2LXC B;  1KYO I;  1N8R Q;  1SQB G;  1BE3 J;  2R5D A;  1LGH B;  2OYO A;  3D6Y A;  3I55 P;  1FDM A;  3H32 B;  3RK2 C;  3O8Z A;  3L74 G;  3H1L D;  1NTZ K;  1GZL A;  4Y99 B;  1OVU A;  1BCC D;  2B9B A;  2IZ0 A;  2R3C A;  2A45 I;  2IFM A;  3FXE A;  3LW5 J;  3E1I A;  5BU8 B;  2IBZ G;  3L73 G;  1AFO A;  2IYP A;  1SQP E;  1P84 H;  1T3U A;  1GU5 A;  4YXW H;  4H0L B;  1SFC C;  3A0B E;  1ZN5 A;  1GW4 A;  2KZI A;  5CBN A;  3H1J J;  3W68 A;  3D6Z A;  1QX8 A;  4H13 D;  2FXP A;  2H88 C;  4WY4 D;  2JWD A;  2KLU A;  4AYC A;  1IFD A;  2K9J B;  3O6Q A;  4IFF A;  3U1A A;  1NU1 J;  3CWB G;  1H8A A;  1YIJ P;  2HOD A;  1VF5 D;  1XTG B;  1YI2 P;  4JBZ A;  3EFF K;  1ZME C;  1PIX A;  3B5N B;  4LLH A;  1T3J A;  4DT0 A;  2QM7 A;  2Y0D A;  5AVW B;  3L72 J;  1HJB A;  4I7Z B;  5C39 A;  3CPW O;  5BU5 A;  1USE A;  2RN0 A;  5KLI B;  1VQM P;  2E5Y A;  2KOG A;  3L70 G;  1RQV A;  2ZT9 D;  1HBW A;  1SQP D;  1GL2 C;  3I5C A;  3GG2 A;  2FYZ A;  2WPV B;  3AE5 C;  1OW6 A;  4HYT B;  1LTG C;  4DCK A;  3IAO A;  1ZV8 A;  1IK7 A;  3LID A;  2ZYG A;  2QRX A;  4ZNC A;  2IYO A;  1DEB A;  2BCC E;  1FC2 C;  3V4W A;  2ZAE B;  2KS1 B;  3GHG A;  4BWN A;  3CCR P;  3CC4 P;  2M5A A;  5AVT B;  4UB8 H;  1PGJ A;  4OGQ D;  1NGM B;  1GL2 A;  4H13 C;  3IR9 A;  1L2P A;  3V6I A;  4NPD A;  1GDT A;  1EDJ A;  1GW3 A;  2VRS A;  2OYI C;  3CX5 H;  4WVZ A;  2IDB A;  3H1H G;  5KLV E;  1L4A C;  1AJY A;  2WSC H;  2FFD B;  5AVR B;  1VF5 C;  2LKM A;  1PPJ G;  2E42 A;  2M3E A;  2KIK A;  5APY A;  4D6T J;  1MKM A;  2WPQ A;  2QJK C;  1VQ5 P;  1NH4 A;  2YMY A;  1HTL C;  2QM8 A;  4U3F G;  1SQX E;  1L0L J;  1NTK E;  2FYU J;  2PAJ A;  4DJG A;  2QE7 H;  1CZQ A;  2N1T D;  2OYI A;  4PV1 D;  1S72 P;  1NTZ G;  5B66 H;  1SQQ E;  1KIL B;  1FZB A;  2YNY A;  1L4A A;  1N73 C;  1NVO A;  3Q5S A;  2IX7 C;  1LWU A;  1NTM G;  1RE3 C;  3TDK A;  1S1C X;  1FAV A;  2BCC D;  1WT6 A;  5AVY B;  2AEF A;  3Q3D A;  2HLO A;  1M8O B;  4PD4 E;  2WWW A;  5AVU B;  2B88 A;  3PRJ A;  3PJS K;  3KHU A;  1BE3 E;  4K3A A;  1NHL A;  1PP9 J;  2FKW B;  3RBX A;  5TIS H;  1KN7 A;  1JY2 O;  1PFI A;  3HD7 A;  1N73 A;  3NFQ A;  3GW6 A;  3SWF A;  3QH9 A;  2WT7 A;  2E75 D;  4OGQ C;  3KPE A;  3H1K E;  3KYQ A;  1CI6 A;  2OYH C;  1EDI A;  3AED C;  1RE3 A;  5KLV D;  1SQP K;  2LR2 A;  2ITA A;  1KB9 H;  2H43 A;  1S5L H;  1URQ C;  3GHG B;  4I6M C;  2P10 A;  1SQB J;  3JCU E;  1JO5 A;  1SQX D;  4Y28 J;  2AEJ A;  1L0N G;  1NTK D;  1JEK A;  4UB6 H;  2L5G B;  1YYC A;  2W8Z A;  1IFJ A;  4XFJ A;  4BRY A;  3D71 A;  3SFE C;  2IFN A;  2R32 A;  3L74 J;  4EOT A;  1YJ9 P;  3G9R A;  2O01 H;  3L35 A;  1SQQ D;  2OYH A;  2A45 G;  2W6B A;  3QWO C;  1J1E B;  1S4X A;  4R4L A;  1LTS C;  3B5N D;  4JPZ B;  2N1T C;  1URQ A;  2Z5H A;  4PV1 C;  2WPS A;  1ZLL A;  3L73 J;  3E7K A;  2XKM A;  5CCH D;  3ABV C;  4PD4 D;  2QJP C;  2YO2 A;  5KJ7 A;  2KP8 A;  5KAF E;  1BE3 D;  1EDL A;  4PJ0 E;  4IL6 E;  2YIU B;  3KZI E;  1EQ7 A;  1DIP A;  5KTB A;  4AUW A;  1S3J A;  3HUS C;  1N7S A;  2Q6Q A;  3H1K D;  1VPC A;  2CPB A;  1KIL E;  2N1T A;  2FXO A;  2IZ1 A;  1FJP A;  1JMB A;  3H1I E;  2P7J A;  4IL6 X;  1CSB A;  2Q9I A;  4YTP C;  5KAI E;  3M9Q A;  2AXC A;  1USD A;  3H1L G;  2FYN B;  1M90 Q;  2WSC J;  2E75 C;  1LP1 A;  1BCC G;  1IJD B;  1SVF A;  3AE1 C;  1IFN A;  3S4R A;  1KYO H;  3H6P A;  3PP5 A;  5AW1 B;  1J1D C;  1FZA A;  2ZYA A;  1AVO A;  3FX0 A;  1VQ4 P;  3HUS A;  1GTW A;  2ZXE B;  2PGD A;  1NAY A;  1X9V A;  3A0H H;  2N9Y B;  4PD4 I;  3RK3 E;  3L70 J;  1ZW0 A;  1CI6 B;  1JTH A;  1VQN P;  1R8E A;  3GF7 A;  1W2E A;  4BXL A;  2E5T A;  2JEE A;  2R3S A;  2A45 H;  1KTM A;  5KLV K;  1M1J C;  1G2C A;  2PP6 A;  3RL0 B;  1M56 D;  1SQV J;  1DD4 A;  5APV A;  2M3B A;  2B89 A;  3PH0 A;  4GOD A;  3AE7 C;  2QIW A;  3N4X A;  3F89 A;  3CD6 P;  1G1I A;  4XE5 B;  5CCH C;  3L71 J;  4LGD E;  1IFP A;  1E79 H;  3MHV A;  1ZXG A;  2G8Y A;  1SQX K;  2C9L Y;  2YKP A;  2KNC B;  4B86 A;  1MZ9 A;  1NTK K;  3H1I D;  3HE5 A;  1JY3 N;  4IFM A;  3ZDM A;  3CCS P;  3MD0 A;  3G6E P;  4D6T E;  2FXM A;  2Q7C A;  4GOF A;  1SQQ K;  3Q5P A;  1PZQ A;  3BCC J;  1OFC X;  1M1J A;  4RES B;  2V7Q H;  5GTI H;  3Q1M A;  1L0L E;  1WRG A;  1MFT A;  2FYU E;  1OW7 A;  2Z5I A;  1YHQ P;  3G3Z A;  3VP9 A;  5CCH A;  4H44 B;  1Q90 D;  3H1H J;  1T8Z A;  4ASW A;  4ASV A;  1SQP G;  1MFZ A;  2N9B A;  1JM0 A;  3AE6 C;  1FZC A;  5E79 H;  3VTP C;  1N7S B;  3RK3 D;  2OGU A;  2O01 J;  3W67 A;  2YXQ B;  1YTZ I;  2O01 N;  1CW5 A;  1OWA A;  4U3F J;  2QEX P;  4HH2 A;  4JYC A;  1A02 F;  3VMA A;  1N86 A;  3FWL A;  1KFM A;  2E76 D;  1Q2N A;  1ZR2 A;  1NTM J;  3AEE C;  3H25 A;  3BRT B;  1NKN A;  2W27 A;  2D2C B;  1ZR4 A;  3SWY A;  4IOI H;  2E43 A;  3L75 E;  4C7N B;  2O3J A;  3TGU D;  4D6T D;  3EWK A;  4GT1 A;  2KSJ A;  1DX7 A;  1EZV G;  2FYU D;  1ZRT E;  1QL1 A;  3R2P A;  3EFG A;  1MV8 A;  2AEM A;  1NU1 K;  1Q81 Q;  1SFC A;  1EXI A;  2P1J A;  1OZH A;  1D7M A;  2E74 B;  2JDI H;  4EIJ A;  1KQG B;  2IBZ E;  1X22 A;  1EDK A;  1L0N J;  3EQ2 A;  1JOC A;  1LT9 B;  3NXS A;  3A0B H;  1R5L A;  3HE4 B;  3RK3 C;  2NPS D;  1T6A A;  2QSI A;  2BEQ D;  5KKZ B;  5AW2 B;  1RE4 C;  2XU6 A;  4MN4 C;  1FZC B;  3L75 D;  4DOJ A;  2E76 C;  3Q2Y A;  5KLV G;  2ZYD A;  3B71 A;  5AVV B;  1PV3 A;  3OAK A;  2FBW C;  1QVG O;  1FOS E;  1YTZ T;  2WIT A;  4ZMD A;  2JR8 A;  3V4Q A;  1ZRT D;  3USS A;  1RE4 A;  5APW A;  2V7Q J;  2XZR A;  4WY4 C;  3TYY A;  3WU2 H;  1NTK G;  3VMX A;  4K35 A;  1JY2 P;  1HVV A;  2BAS A;  3L4F A;  4JQ0 D;  3CLQ A;  3L70 E;  3BVH A;  3H1L J;  1SQQ G;  2HFE D;  3IN6 A;  2IBZ D;  4RJT A;  1BCC J;  3RK2 B;  1VQ8 P;  2RMZ A;  1OVR A;  1K8A Q;  4AQR D;  3WUV A;  5AW4 B;  5EFW B;  3TF5 A;  1SQV E;  1KQF B;  3PTZ A;  3O6Q B;  1SP4 A;  4NPF X;  4WY4 A;  2M0B A;  1T2K D;  3L71 E;  1QVF O;  1FS0 E;  1GD2 E;  4EI2 A;  2KSE A;  1BE3 G;  4H44 D;  1J2J B;  1S9K E;  2HOD B;  1LTA C;  1SFC B;  5TIS E;  1L0L K;  1BGY E;  3CI9 A;  1BDC A;  2PRR A;  2NPS C;  1VDF A;  2FYU K;  1DD3 A;  1RF1 C;  2ZT9 C;  2YKQ A;  3H1K G;  3T97 A;  2NRG A;  1Q7Y Q;  2WSE H;  1HGV A;  2ZVN B;  3TNU A;  2ZFC A;  3BCC E;  3U1C A;  3A2A A;  2HPC A;  1RQU A;  1H89 A;  3WMM 0;  3H1H E;  3M0D C;  5APT A;  2IBZ I;  2I1K A;  4UB6 E;  1PGO A;  3HTK A;  2B87 A;  2NPS A;  1KQL A;  3CCQ P;  3AE9 C;  3L70 D;  1NOH A;  1RF1 A;  2QVA A;  1BSN A;  4H0L D;  1RH5 B;  3IFM A;  1KQS O;  1AQ5 A;  1EC5 A; 
#chains in the Genus database with same CATH homology
 5KAF E;  5B66 E;  3A0B E;  4PJ0 E;  4IL6 E;  5KAI E;  3KZI E;  4UB6 E;  4UB8 E;  5GTI E;  1S5L E;  5B5E E;  5E79 E;  5TIS E;  5GTH E;  5H2F E;  3WU2 E;  3A0H E;  3JCU E;  1W5C E;  2AXT E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...