5B66E

Crystal structure analysis of photosystem ii complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
78
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 21
structure length 78
sequence length 78
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5b66E00
3KZIE 5KAFE 2AXTE 1S5LE 3WU2E 3A0BE 5E79E 3A0HE 1W5CE 4IL6E 3JCUE 4UB6E 5B66E 5B5EE 4PJ0E 4UB8E 5H2FE 5TISE 5GTHE 5GTIE 5KAIE
chains in the Genus database with same CATH superfamily
3KZIE 5CBOA 1GL2C 2D2CC 2KLVA 1HF9A 2SPZA 2NPSB 1KB9I 4PD4H 2I1KA 1KB9E 1FDIA 3H1KG 3KHUA 4EYYQ 2R32A 4WY4A 1PGPA 1E5WA 2A45G 1BE3J 3H6PA 3L70E 2WTYA 3H1IJ 2OTJP 1IFNA 3RK3C 4WBAA 5CHXA 4EIJA 1Q82Q 2WSCH 3SSUA 1NU1E 1PP9G 4UB6E 3CMEP 1KQFB 1X9VA 3CX5E 3CPWO 4UB8E 1FZEA 1BSNA 4RKUJ 3CC2P 1LT1A 1RQUA 4TLFA 1SQVD 1LWUB 4HYTB 3QH9A 1PPJD 3IN6A 1AA0A 4N78D 2R44A 2HLOA 5KLVG 3H1LG 1XTGB 1BCCJ 4OGQD 1JY2P 1KQGB 4DZOA 4WY4C 3TDKA 4UB6H 1GU4A 1OMIA 3CX5H 2ZVNB 2N9YB 3V2PA 4PJ0E 5KJ7C 2WITA 3L74J 5BU5A 2WSEH 3Q3DA 1NTKD 3NFQA 2W6AA 2Z4EA 2B87B 3CI9A 2FFDA 4JYBA 1VF5D 1BSHA 1KV4A 2R5BA 3B8EB 2KLUA 1LTAC 1R5SA 3ITKA 3BCCJ 3OA7A 4C7NA 1GW4A 4GOEA 1T3UA 2CPSA 4H44D 2H8PD 3TF5A 1Q86Q 4ZNCA 5KLVK 1VQKP 2KNCB 2XNXA 2H43A 3EQ2A 5BU8B 2WSSH 5AVXB 3ZDMA 1ZR4A 4Y99B 4D6TD 3PHLA 1WRGA 2IBZD 1SQQE 1GL2D 1NKNA 1MFTA 2D2CD 4YXDC 3T97A 2FXMA 3CL3D 3Q2YA 1SFCB 1DEEG 1VDFA 1H88A 3VN0A 2KS1A 3CWBJ 2VRSA 2E74B 1IZNB 2QJPB 3AEDC 4JYCA 1BGYJ 5AVVB 1W2BO 1URQB 1ZOYC 3AE9C 3RK3D 3M0DA 4ASWA 3C1LA 2O1KA 4H13D 2K37A 1YJWP 4W7YA 4R4MA 3RK2C 2QEXP 4Z1MH 2ZT9D 1VQMP 1IK9A 4DJGA 1IFDA 1LTIC 1MV8A 4K35A 4XA4A 3USSA 1S5LH 1L4AA 2B9BA 4LGDE 2C9NY 3CCJP 2LR2A 1LTJC 1PGJA 5AVWB 1Y8AA 3L72D 2IX7C 2W83C 4I7ZC 3CXHD 4W80A 4JPZB 2K3RA 4OH8B 2Q5UA 2M5AB 3B5NB 4WY4D 5AVRB 3A7OA 4ASVA 3G3ZA 2YO2A 1LGHB 2FYUD 1L0LD 2JO1A 3TGUD 1ZN5A 5KJ7D 1ZR2A 4H13B 2FBWC 4I6MC 2QVAA 2FYNC 1KILE 4GT1A 2ZT9B 1M7LA 3GF7A 3VTPC 1VQNP 2QE7H 1N2DC 1J1EC 5KAFE 3M9HA 1EXJA 4YTPC 1HUCA 1J1DC 1NTMK 1BE3G 1L0NJ 1DEBA 1Q2NA 3H1IG 4ZKPA 1GD2E 3H1KE 3L71G 5AW4B 3CLQA 2ZYDA 2WT7A 2NRGA 1HBWA 4WY4B 4D6TG 3U1AA 2A45I 1FDMA 5AVSB 4WWIA 4K3AA 2GA1A 3SFEC 1YTZI 5AW2B 1JO5A 4PV1C 1FU1A 2ZFCA 1PP9E 1H0TB 1AVOA 2XDJA 1JMMA 1OVVA 3HE5A 1YQ3C 2BCCG 3TYYA 3IFMA 2GM4A 1FZGA 1EQ7A 1BCCG 1JM0A 1RF0C 3KXDA 1FZBA 1OVRA 3B71A 5KLVE 2BASA 3H1LE 3L75E 1R5LA 3L74G 3HE4B 5CCGC 3H32B 2QSIA 3GLMA 1PP9J 3RL0B 3H1JG 3D6YA 2JDIH 3BCCG 2R5DA 4OVNF 1FJKA 1NWQA 4A7PA 1N86A 4QMAA 4MN4C 2FFDB 3F5HA 3AE2C 3GMAA 3RL0g 3H1LJ 3JC22 1P84I 4C7NB 1SQPJ 1GZLA 3IAOA 2E76D 4DOJA 3V4QA 3SFDC 3E7KA 1IFJA 2KSEA 5M1BA 2PP6A 5APVA 1JY2N 5AVTB 4BRYA 1N7SA 2FY8A 1X22A 3FWLA 1FZCA 1CW5A 1PZQA 3CWBG 4N3YB 1BGYG 1L4AD 3V2QA 1X79B 3VYIA 2E75C 3T97B 1JB0J 5CMZA 2XU6A 2G3AA 1VPCA 4U3FG 4IL6E 2W27A 3HD7C 3VOPA 2O01H 1M1JA 4I2LC 3AE8C 2E76B 3M91A 1LP1B 2GUVA 1PV3A 3P8CE 1IFIA 5DJUB 4PV1D 4GODA 3V4WA 5CCHA 3E1RA 1N7SC 3H25A 1K8AQ 1QL2A 1FZCC 3H1HE 3IF4A 1L4AB 4IL6H 1KD1Q 1RQVA 1NYHA 2PRRA 1YIJP 1MKMA 2XKMA 5AVQB 5CCGD 1YI2P 3N7NA 2N1TB 2QJKC 1GL2A 1SQVJ 1M1JC 1LTSC 3L75D 3CCEP 1SQQK 1WT6A 3Q5SA 2WPRA 2PAJA 1GTWA 1KC8Q 1KFNA 2HG5D 2CPBA 5CCHC 1LT9B 1RF1A 4IOIH 4H0LB 4EI2A 3VMAA 5APSA 1L2PA 2IPPA 3V5BA 2IDBA 1SQXG 2KUBA 1BE3E 1AV1A 3H1IE 1AQTA 3VMZA 1NTKJ 1GK6A 3L71E 2N9BA 1FAVA 2WT7B 3G4SP 3LIEA 1LTBC 3S1KA 2OYIA 3C9IA 2PFXA 2H88C 3AE7C 3G9RA 4RO0A 1NTZD 2E75D 5KLIC 2AXTH 3M9BA 5APTA 3JSVC 3EFGA 1YITP 1MUUA 1T2KC 3HE5B 2BCCE 3RBXA 1RF1C 5AW7B 5KJ7A 1BCCE 1L0NK 3L71J 1SQBD 5H2FH 3NXSA 2AEJA 3AECC 3I5CA 1VQLP 4IL6X 4D6TJ 3KZIH 1CI6A 5KTBA 2K9JA 2O3JA 3L74E 2A06D 4KT0J 1N7LA 3PJSK 4BWNA 1KB9H 1N7SD 2Y0EA 1AQ5A 3H1JE 2OYIC 2BCCJ 3BCCE 1JNMA 2WSFJ 5GTHE 2YIUC 3ABVC 3L73D 3CCRP 1SQPG 1JOCA 2V4HA 1ZRTE 3H1HD 1Z56A 4UB8H 1NTMD 3JCUE 1JCDA 3M0AA 1FJPA 1MZ9A 1DD3A 1YHQP 3CC7P 2XV5A 1KYOI 1USDA 1EZVG 2Q9IA 1KYOE 1S3JA 3H1JJ 1FBMA 2FKWB 3BASA 2WSEJ 5CCHD 2O01N 1T3JA 4AUWA 4R4LA 5GTHH 2WMMA 4TT3H 1H8AA 3CWBE 2P1JA 2FYUJ 1L0LJ 1BGYE 1G1JA 2C9LY 3TGUJ 1HTLC 4OGQB 2W8ZA 4HKZH 3CCUP 4PD4D 4PJ0H 1U7MA 1S9KE 4U3FE 2RH0A 3W67A 1LTJA 3FWNA 4L73A 1QL1A 3FGAD 1VF5B 2QM7A 1K05A 2OQQA 1KN7A 2DW3A 2QJYB 1T2KD 2KXPB 1IO4A 2Y0CA 4H44B 2R3SA 3CCVP 1KB9D 2I8DA 4U3FJ 1X8YA 3C8VA 2BEZF 5KKZB 1SQVG 2HODB 2ITAA 3P32A 2RKLA 1NKZB 1PPJG 5BVZA 1PFIA 3L70D 3L37A 1YJ9P 2YO3A 2JP3A 1NU1D 1RH5B 2AEMA 1GL2B 3CX5D 2D2CB 1KTMA 4NPFX 3L73G 1ZV8A 2B89A 2V7QJ 3MIWA 5B66E 2OYHA 3EWKA 1Q90D 3OW2O 5TISE 1GDTA 4GDOA 1L0NE 1QX8A 1DD4A 3RK3B 2Q7CA 5AVZB 4JQ0D 1NTKG 4N6JA 1UIIA 3OJAB 1DH3A 1HGVA 3FXEA 1S1CX 1SQXE 1DIPA 2M8RA 1KMIZ 4Y28J 3V6IA 1D7MA 1ZLLA 1RF0A 5B66H 1N73C 1EXIA 3A0BE 3L4FA 2W6BA 1N8RQ 2KOGA 2P67A 1KILC 2BEQD 3AEFC 2K9YA 2YIUB 1NO4A 5CCGA 1R8EA 2AEFA 2OYHC 2W90A 5KAIE 2CK3H 2IBZG 3UIAA 1SQXJ 1FZFA 1VQ4P 3SWYA 2WVRA 1SLQA 2E5TA 2ZVOB 1NTKK 5KAFH 3MGNA 1IK7A 1S9KD 1VQ5P 2YKPA 3IR9A 2JR8A 3GHGC 1SQQD 2KZIA 1JY2O 1KQLA 4GIFA 3BVHA 4KJMA 5KAIH 2A45H 1SQPE 3RK2D 1LNQA 1BDDA 1ZW0A 3RBZA 5B5EE 4CPGA 2KI7B 3L72G 2HFED 3HUSC 1PIXA 1LWUA 1M90Q 3LW5H 3PP5A 2YXRB 1X0TA 2L91A 1UIXA 1EZVI 1EZVE 1QVFO 1G2CA 2JKVA 3HD7A 2FXOA 2YKQA 3CCLP 1NAYA 2ZXXA 2FYUG 1L0LG 3FXDA 2NPSC 3TGUG 1P84E 4I1LA 2QM8A 2YNYA 2PGDA 3VMXA 2J5UA 2ZAEB 3RK2B 1L0ND 1S2EA 2P58A 2ZYAA 5DJTB 1USEA 1RE4A 3AE6C 4XE5B 3D6ZA 1LTJB 1KILD 2R3CA 1JCCA 2LXCB 1LWUC 4IFDK 1P84H 4I7ZB 4HJGH 5APUA 4AYCA 2KS1B 1T8ZA 2AXCA 1Q7YQ 3VP8A 2FYUK 1L0LK 5GTIE 4JBZA 1AVYA 1LJ2A 3H1KD 1JY3O 2Y9ZA 2E42A 1Q81Q 3U1CA 2ZYGA 2FYNB 3D70A 1FOSF 3I55P 4OWFA 2QIWA 1SQVE 1PPJE 4N78E 1NTZJ 1SFCA 1J1EB 3AE4C 5AVUB 3G71P 1RE4C 3HRNA 1PP9D 4L74A 1J1DB 1WMKA 1J2JB 1SQBJ 2KP8A 1URQA 2M3EA 3N4XA 2JWAA 1VL2A 3CCQP 1MFZA 1JTHA 4W7ZA 2UWJE 5KLVD 1NTKE 3H1LD 4PV1B 2IFNA 1S4XA 1YTZT 4HB1A 1OW7A 2H89C 3AE1C 3L73J 3U59A 2P2UA 5AW6B 2NPSD 1SFCC 1FE6A 3AEEC 2WQYC 3A0HE 3QWOC 1NJIQ 1NTMJ 3AE3C 3OAKA 3AEAC 1IFPA 2E74C 2QJPC 3B5NA 1JEKA 3A5TA 1FC2C 4DT0A 1URQC 3LIDA 1NVOA 2JWDA 1P84D 3MD0A 2IBZI 5AW1B 4D6TE 5APYA 2IBZE 2IZ0A 1DX7A 3MTUE 3KQGA 3S9OA 3TSIA 4HH2A 2FXPA 4KHXA 1TU3F 1OXZA 2IYOA 3A0HH 3MP7B 4O9BA 1EDIA 2LKMA 1SS1A 3HD7D 3RK3E 1YQ4C 1YYCA 3M06A 1KZUB 3B5NC 2OTKE 1HH0A 1NGMB 1EDKA 1VQ9P 1SQXK 2HPCA 2GUSA 1KORA 1CSBA 2WSCJ 1RE3C 1H0TA 3CX5I 1AFOA 4H13C 1M1KQ 3P8CD 2YKOA 2P10A 1VQOP 2WZ7A 3L72E 1GK4A 2ZT9C 2Y0DA 4L75A 1QGKB 3NTNA 3CXHI 2K88A 2E75B 2QRXA 2WSFH 5EFWB 4IFMA 3L35A 3CXHE 2J58A 5APXA 3PRJA 1T6AA 5AW0B 3HTKA 1GU5A 1W5CE 1G2CB 4C46A 2QA4P 3HD7B 2FYUE 1L0LE 3L70J 3TGUE 2HYNA 3L75G 5K5GB 3RGUA 3HE4A 1HVVA 3H32A 2O1JA 3II6A 1NU1J 2E5YA 2WPQA 3MUDA 3O6QA 3BRVB 1JUNA 2JJLA 3L72J 1NH4A 1QEXA 4BRYB 1N7SB 2P7JA 3TK1A 2Q3IA 1FS0E 3CXHH 1FZCB 2Q3EA 1PGOA 1SFCD 5AW8B 2IZ1A 1G1IA 2E74D 3JCUH 3BRTB 2XZRA 3F89A 1K73Q 1FZAA 3PLNA 1URQD 5AW9B 3MHVA 1SQPK 2IFMA 3CMAP 3GG2A 1OX3A 2QJKB 4L76A 1KYOH 2XNDH 3W68A 1OIPA 1M1JB 1A02F 4LLHA 2KSJA 3R2PA 1BE3D 3K5BA 3H1ID 1NTZG 1QVGO 1JMBA 3L71D 3Q5PA 3RL0C 2C0WA 3MUDC 4DCKA 1AJYA 1BDCA 1SQBG 2Y9YA 3EFFK 1S5LE 2FFDC 2OARA 3WMM0 2HR3A 5CJ4A 5APQA 2A06G 2KYVA 3E1IA 3B5ND 1LP1A 2BCCD 3NMDA 1IJDB 1BCCD 1Y47A 5C39A 3L36A 4YPCA 1N73A 3A3YB 1KILA 3S4RA 2L5GB 1JTHB 1CZQA 1YBKA 3CD6P 1SQQJ 1A02J 2OTLP 1OWAA 1LTTC 3L74D 5AW5B 2V7QH 1NTZK 1RY3A 5KLIB 1JY3P 3H1HG 1NTMG 4EDFA 3H1JD 1RF1B 1U57A 1NOHA 3BCCD 1HGZA 1SQBK 1S72P 1VQ8P 2N1TA 2FYZA 1ZRTD 1OVUA 4JF7A 1SQVK 2E76C 3GF3A 2C0XA 3GHGA 2YXQB 3M0DC 2RN0A 4GKGA 2K1AA 3VP9A 2WPVB 3KYQA 5TISH 4WB4A 5CBNA 2OYIB 1LT9A 1KYOD 1H89A 2ZXEB 3CC4P 2OYOA 3WUVA 3CCSP 3KPEA 1XTCC 4XFJA 2KIKA 1L4AC 3CWBD 3HUSA 1ZP0C 1LTGC 1BGYD 5APWA 3TNUA 4U7JA 1OFCX 2KZJA 2N1TC 4U3FD 3A0BH 1CI6B 3RL0D 2NPSA 3V2NA 2HPCB 2K9JB 2RMZA 3G6EP 4NPEA 5L8RJ 3O8ZA 2G8YA 1NHLA 3L70G 1K04A 1LT9C 4M3LA 1E79H 3PH0A 3H1KJ 4H0LC 2ZJSE 2MJZA 1S5LX 1NU1G 3WUTA 4WVZA 2J59M 1IFMA 3HTKB 2M0BA 2H7HA 3KDPB 5CJ0A 2E43A 3PTZA 3O6QB 1W2EA 3AEBC 1GMJA 4C7RA 1KFMA 3LW5J 2OGUA 2QG4A 5AW3B 2LXBA 2Z5IA 2WWWA 4NPDA 5KLVJ 3P7KA 3AE5C 5B5EH 3L75J 1QLED 1YJNP 3GW6A 4AQRD 4ZMDA 4ZKUA 3CCMP 4LC1A 2B87A 1GW3A 1NU1K 3R4YA 1ZMEC 2W6JH 1SQXD 1IC2A 3WU2E 1NTZE 5E79E 1M56D 4RJTA 3M9QA 1FDOA 1HJ0A 2YMKA 3V2RA 2MKVA 1NAFA 2Q6QA 3BATA 1SQBE 2KNCA 2YMYA 3Q5RA 3D71A 1SP4A 2Z5HA 2O01J 3P8MC 1VQ6P 2A06E 3Q1MA 2N1TD 2I1JA 5TJHA 1SQQG 4B86A 1VQ7P 3WU2H 5E79H 1N73B 4GOFA 1KILB 1FOSE 3L73E 3B4SA 3SWFA 5GTIH 3AEGC 2OYHB 4H0LD 1NTME 2B88A 3VMYA 3FX0A 1VQPP 4EOTA 2HODA 1M8OB 1OW8A 4OGQC 3WUUA 1PL5A 2KK7A 3I56P 1ZXGA 1SQPD 1RHZB 1EDJA 4IFFA 4Y99C 1OZHA 1U7JA 2NZ2A 2KB7P 3GHGB 2JEEA 4YXWH 4RESB 1VF5C 2M3BA 3H1HJ 5AVYB 3SWKA 2M5AA 4PD4I 1EZVD 1PGQA 1K9MQ 1L0NG 4PD4E 1HJBA 3MZWB 1JY3N 2QJYC 1Y9BA 1RE3A 1M57D 4H44C 2AXTE 1OW6A 1EC5A 4BXLA 1EDLA 1HWTC 2IYPA 5KKZC 3A2AA 1KQSO 2WPSA 2POHA 2Q1KA 3HUSB 5H2FE 3TNUB 1SVFA
chains in the Genus database with same CATH topology
3KZIE 5KAFE 2AXTE 1S5LE 3WU2E 3A0BE 5E79E 3A0HE 1W5CE 4IL6E 3JCUE 4UB6E 5B66E 5B5EE 4PJ0E 4UB8E 5H2FE 5TISE 5GTHE 5GTIE 5KAIE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI E;  5KAF E;  2AXT E;  1S5L E;  3WU2 E;  3A0B E;  5E79 E;  3A0H E;  1W5C E;  4IL6 E;  3JCU E;  4UB6 E;  5B66 E;  5B5E E;  4PJ0 E;  4UB8 E;  5H2F E;  5TIS E;  5GTH E;  5GTI E;  5KAI E; 
#chains in the Genus database with same CATH topology
 3KZI E;  5CBO A;  1GL2 C;  2D2C C;  2KLV A;  1HF9 A;  2SPZ A;  2NPS B;  1KB9 I;  4PD4 H;  2I1K A;  1KB9 E;  1FDI A;  3H1K G;  3KHU A;  4EYY Q;  2R32 A;  4WY4 A;  1PGP A;  1E5W A;  2A45 G;  1BE3 J;  3H6P A;  3L70 E;  2WTY A;  3H1I J;  2OTJ P;  1IFN A;  3RK3 C;  4WBA A;  5CHX A;  4EIJ A;  1Q82 Q;  2WSC H;  3SSU A;  1NU1 E;  1PP9 G;  4UB6 E;  3CME P;  1KQF B;  1X9V A;  3CX5 E;  3CPW O;  4UB8 E;  1FZE A;  1BSN A;  4RKU J;  3CC2 P;  1LT1 A;  1RQU A;  4TLF A;  1SQV D;  1LWU B;  4HYT B;  3QH9 A;  1PPJ D;  3IN6 A;  1AA0 A;  4N78 D;  2R44 A;  2HLO A;  5KLV G;  3H1L G;  1XTG B;  1BCC J;  4OGQ D;  1JY2 P;  1KQG B;  4DZO A;  4WY4 C;  3TDK A;  4UB6 H;  1GU4 A;  1OMI A;  3CX5 H;  2ZVN B;  2N9Y B;  3V2P A;  4PJ0 E;  5KJ7 C;  2WIT A;  3L74 J;  5BU5 A;  2WSE H;  3Q3D A;  1NTK D;  3NFQ A;  2W6A A;  2Z4E A;  2B87 B;  3CI9 A;  2FFD A;  4JYB A;  1VF5 D;  1BSH A;  1KV4 A;  2R5B A;  3B8E B;  2KLU A;  1LTA C;  1R5S A;  3ITK A;  3BCC J;  3OA7 A;  4C7N A;  1GW4 A;  4GOE A;  1T3U A;  2CPS A;  4H44 D;  2H8P D;  3TF5 A;  1Q86 Q;  4ZNC A;  5KLV K;  1VQK P;  2KNC B;  2XNX A;  2H43 A;  3EQ2 A;  5BU8 B;  2WSS H;  5AVX B;  3ZDM A;  1ZR4 A;  4Y99 B;  4D6T D;  3PHL A;  1WRG A;  2IBZ D;  1SQQ E;  1GL2 D;  1NKN A;  1MFT A;  2D2C D;  4YXD C;  3T97 A;  2FXM A;  3CL3 D;  3Q2Y A;  1SFC B;  1DEE G;  1VDF A;  1H88 A;  3VN0 A;  2KS1 A;  3CWB J;  2VRS A;  2E74 B;  1IZN B;  2QJP B;  3AED C;  4JYC A;  1BGY J;  5AVV B;  1W2B O;  1URQ B;  1ZOY C;  3AE9 C;  3RK3 D;  3M0D A;  4ASW A;  3C1L A;  2O1K A;  4H13 D;  2K37 A;  1YJW P;  4W7Y A;  4R4M A;  3RK2 C;  2QEX P;  4Z1M H;  2ZT9 D;  1VQM P;  1IK9 A;  4DJG A;  1IFD A;  1LTI C;  1MV8 A;  4K35 A;  4XA4 A;  3USS A;  1S5L H;  1L4A A;  2B9B A;  4LGD E;  2C9N Y;  3CCJ P;  2LR2 A;  1LTJ C;  1PGJ A;  5AVW B;  1Y8A A;  3L72 D;  2IX7 C;  2W83 C;  4I7Z C;  3CXH D;  4W80 A;  4JPZ B;  2K3R A;  4OH8 B;  2Q5U A;  2M5A B;  3B5N B;  4WY4 D;  5AVR B;  3A7O A;  4ASV A;  3G3Z A;  2YO2 A;  1LGH B;  2FYU D;  1L0L D;  2JO1 A;  3TGU D;  1ZN5 A;  5KJ7 D;  1ZR2 A;  4H13 B;  2FBW C;  4I6M C;  2QVA A;  2FYN C;  1KIL E;  4GT1 A;  2ZT9 B;  1M7L A;  3GF7 A;  3VTP C;  1VQN P;  2QE7 H;  1N2D C;  1J1E C;  5KAF E;  3M9H A;  1EXJ A;  4YTP C;  1HUC A;  1J1D C;  1NTM K;  1BE3 G;  1L0N J;  1DEB A;  1Q2N A;  3H1I G;  4ZKP A;  1GD2 E;  3H1K E;  3L71 G;  5AW4 B;  3CLQ A;  2ZYD A;  2WT7 A;  2NRG A;  1HBW A;  4WY4 B;  4D6T G;  3U1A A;  2A45 I;  1FDM A;  5AVS B;  4WWI A;  4K3A A;  2GA1 A;  3SFE C;  1YTZ I;  5AW2 B;  1JO5 A;  4PV1 C;  1FU1 A;  2ZFC A;  1PP9 E;  1H0T B;  1AVO A;  2XDJ A;  1JMM A;  1OVV A;  3HE5 A;  1YQ3 C;  2BCC G;  3TYY A;  3IFM A;  2GM4 A;  1FZG A;  1EQ7 A;  1BCC G;  1JM0 A;  1RF0 C;  3KXD A;  1FZB A;  1OVR A;  3B71 A;  5KLV E;  2BAS A;  3H1L E;  3L75 E;  1R5L A;  3L74 G;  3HE4 B;  5CCG C;  3H32 B;  2QSI A;  3GLM A;  1PP9 J;  3RL0 B;  3H1J G;  3D6Y A;  2JDI H;  3BCC G;  2R5D A;  4OVN F;  1FJK A;  1NWQ A;  4A7P A;  1N86 A;  4QMA A;  4MN4 C;  2FFD B;  3F5H A;  3AE2 C;  3GMA A;  3RL0 g;  3H1L J;  3JC2 2;  1P84 I;  4C7N B;  1SQP J;  1GZL A;  3IAO A;  2E76 D;  4DOJ A;  3V4Q A;  3SFD C;  3E7K A;  1IFJ A;  2KSE A;  5M1B A;  2PP6 A;  5APV A;  1JY2 N;  5AVT B;  4BRY A;  1N7S A;  2FY8 A;  1X22 A;  3FWL A;  1FZC A;  1CW5 A;  1PZQ A;  3CWB G;  4N3Y B;  1BGY G;  1L4A D;  3V2Q A;  1X79 B;  3VYI A;  2E75 C;  3T97 B;  1JB0 J;  5CMZ A;  2XU6 A;  2G3A A;  1VPC A;  4U3F G;  4IL6 E;  2W27 A;  3HD7 C;  3VOP A;  2O01 H;  1M1J A;  4I2L C;  3AE8 C;  2E76 B;  3M91 A;  1LP1 B;  2GUV A;  1PV3 A;  3P8C E;  1IFI A;  5DJU B;  4PV1 D;  4GOD A;  3V4W A;  5CCH A;  3E1R A;  1N7S C;  3H25 A;  1K8A Q;  1QL2 A;  1FZC C;  3H1H E;  3IF4 A;  1L4A B;  4IL6 H;  1KD1 Q;  1RQV A;  1NYH A;  2PRR A;  1YIJ P;  1MKM A;  2XKM A;  5AVQ B;  5CCG D;  1YI2 P;  3N7N A;  2N1T B;  2QJK C;  1GL2 A;  1SQV J;  1M1J C;  1LTS C;  3L75 D;  3CCE P;  1SQQ K;  1WT6 A;  3Q5S A;  2WPR A;  2PAJ A;  1GTW A;  1KC8 Q;  1KFN A;  2HG5 D;  2CPB A;  5CCH C;  1LT9 B;  1RF1 A;  4IOI H;  4H0L B;  4EI2 A;  3VMA A;  5APS A;  1L2P A;  2IPP A;  3V5B A;  2IDB A;  1SQX G;  2KUB A;  1BE3 E;  1AV1 A;  3H1I E;  1AQT A;  3VMZ A;  1NTK J;  1GK6 A;  3L71 E;  2N9B A;  1FAV A;  2WT7 B;  3G4S P;  3LIE A;  1LTB C;  3S1K A;  2OYI A;  3C9I A;  2PFX A;  2H88 C;  3AE7 C;  3G9R A;  4RO0 A;  1NTZ D;  2E75 D;  5KLI C;  2AXT H;  3M9B A;  5APT A;  3JSV C;  3EFG A;  1YIT P;  1MUU A;  1T2K C;  3HE5 B;  2BCC E;  3RBX A;  1RF1 C;  5AW7 B;  5KJ7 A;  1BCC E;  1L0N K;  3L71 J;  1SQB D;  5H2F H;  3NXS A;  2AEJ A;  3AEC C;  3I5C A;  1VQL P;  4IL6 X;  4D6T J;  3KZI H;  1CI6 A;  5KTB A;  2K9J A;  2O3J A;  3L74 E;  2A06 D;  4KT0 J;  1N7L A;  3PJS K;  4BWN A;  1KB9 H;  1N7S D;  2Y0E A;  1AQ5 A;  3H1J E;  2OYI C;  2BCC J;  3BCC E;  1JNM A;  2WSF J;  5GTH E;  2YIU C;  3ABV C;  3L73 D;  3CCR P;  1SQP G;  1JOC A;  2V4H A;  1ZRT E;  3H1H D;  1Z56 A;  4UB8 H;  1NTM D;  3JCU E;  1JCD A;  3M0A A;  1FJP A;  1MZ9 A;  1DD3 A;  1YHQ P;  3CC7 P;  2XV5 A;  1KYO I;  1USD A;  1EZV G;  2Q9I A;  1KYO E;  1S3J A;  3H1J J;  1FBM A;  2FKW B;  3BAS A;  2WSE J;  5CCH D;  2O01 N;  1T3J A;  4AUW A;  4R4L A;  5GTH H;  2WMM A;  4TT3 H;  1H8A A;  3CWB E;  2P1J A;  2FYU J;  1L0L J;  1BGY E;  1G1J A;  2C9L Y;  3TGU J;  1HTL C;  4OGQ B;  2W8Z A;  4HKZ H;  3CCU P;  4PD4 D;  4PJ0 H;  1U7M A;  1S9K E;  4U3F E;  2RH0 A;  3W67 A;  1LTJ A;  3FWN A;  4L73 A;  1QL1 A;  3FGA D;  1VF5 B;  2QM7 A;  1K05 A;  2OQQ A;  1KN7 A;  2DW3 A;  2QJY B;  1T2K D;  2KXP B;  1IO4 A;  2Y0C A;  4H44 B;  2R3S A;  3CCV P;  1KB9 D;  2I8D A;  4U3F J;  1X8Y A;  3C8V A;  2BEZ F;  5KKZ B;  1SQV G;  2HOD B;  2ITA A;  3P32 A;  2RKL A;  1NKZ B;  1PPJ G;  5BVZ A;  1PFI A;  3L70 D;  3L37 A;  1YJ9 P;  2YO3 A;  2JP3 A;  1NU1 D;  1RH5 B;  2AEM A;  1GL2 B;  3CX5 D;  2D2C B;  1KTM A;  4NPF X;  3L73 G;  1ZV8 A;  2B89 A;  2V7Q J;  3MIW A;  5B66 E;  2OYH A;  3EWK A;  1Q90 D;  3OW2 O;  5TIS E;  1GDT A;  4GDO A;  1L0N E;  1QX8 A;  1DD4 A;  3RK3 B;  2Q7C A;  5AVZ B;  4JQ0 D;  1NTK G;  4N6J A;  1UII A;  3OJA B;  1DH3 A;  1HGV A;  3FXE A;  1S1C X;  1SQX E;  1DIP A;  2M8R A;  1KMI Z;  4Y28 J;  3V6I A;  1D7M A;  1ZLL A;  1RF0 A;  5B66 H;  1N73 C;  1EXI A;  3A0B E;  3L4F A;  2W6B A;  1N8R Q;  2KOG A;  2P67 A;  1KIL C;  2BEQ D;  3AEF C;  2K9Y A;  2YIU B;  1NO4 A;  5CCG A;  1R8E A;  2AEF A;  2OYH C;  2W90 A;  5KAI E;  2CK3 H;  2IBZ G;  3UIA A;  1SQX J;  1FZF A;  1VQ4 P;  3SWY A;  2WVR A;  1SLQ A;  2E5T A;  2ZVO B;  1NTK K;  5KAF H;  3MGN A;  1IK7 A;  1S9K D;  1VQ5 P;  2YKP A;  3IR9 A;  2JR8 A;  3GHG C;  1SQQ D;  2KZI A;  1JY2 O;  1KQL A;  4GIF A;  3BVH A;  4KJM A;  5KAI H;  2A45 H;  1SQP E;  3RK2 D;  1LNQ A;  1BDD A;  1ZW0 A;  3RBZ A;  5B5E E;  4CPG A;  2KI7 B;  3L72 G;  2HFE D;  3HUS C;  1PIX A;  1LWU A;  1M90 Q;  3LW5 H;  3PP5 A;  2YXR B;  1X0T A;  2L91 A;  1UIX A;  1EZV I;  1EZV E;  1QVF O;  1G2C A;  2JKV A;  3HD7 A;  2FXO A;  2YKQ A;  3CCL P;  1NAY A;  2ZXX A;  2FYU G;  1L0L G;  3FXD A;  2NPS C;  3TGU G;  1P84 E;  4I1L A;  2QM8 A;  2YNY A;  2PGD A;  3VMX A;  2J5U A;  2ZAE B;  3RK2 B;  1L0N D;  1S2E A;  2P58 A;  2ZYA A;  5DJT B;  1USE A;  1RE4 A;  3AE6 C;  4XE5 B;  3D6Z A;  1LTJ B;  1KIL D;  2R3C A;  1JCC A;  2LXC B;  1LWU C;  4IFD K;  1P84 H;  4I7Z B;  4HJG H;  5APU A;  4AYC A;  2KS1 B;  1T8Z A;  2AXC A;  1Q7Y Q;  3VP8 A;  2FYU K;  1L0L K;  5GTI E;  4JBZ A;  1AVY A;  1LJ2 A;  3H1K D;  1JY3 O;  2Y9Z A;  2E42 A;  1Q81 Q;  3U1C A;  2ZYG A;  2FYN B;  3D70 A;  1FOS F;  3I55 P;  4OWF A;  2QIW A;  1SQV E;  1PPJ E;  4N78 E;  1NTZ J;  1SFC A;  1J1E B;  3AE4 C;  5AVU B;  3G71 P;  1RE4 C;  3HRN A;  1PP9 D;  4L74 A;  1J1D B;  1WMK A;  1J2J B;  1SQB J;  2KP8 A;  1URQ A;  2M3E A;  3N4X A;  2JWA A;  1VL2 A;  3CCQ P;  1MFZ A;  1JTH A;  4W7Z A;  2UWJ E;  5KLV D;  1NTK E;  3H1L D;  4PV1 B;  2IFN A;  1S4X A;  1YTZ T;  4HB1 A;  1OW7 A;  2H89 C;  3AE1 C;  3L73 J;  3U59 A;  2P2U A;  5AW6 B;  2NPS D;  1SFC C;  1FE6 A;  3AEE C;  2WQY C;  3A0H E;  3QWO C;  1NJI Q;  1NTM J;  3AE3 C;  3OAK A;  3AEA C;  1IFP A;  2E74 C;  2QJP C;  3B5N A;  1JEK A;  3A5T A;  1FC2 C;  4DT0 A;  1URQ C;  3LID A;  1NVO A;  2JWD A;  1P84 D;  3MD0 A;  2IBZ I;  5AW1 B;  4D6T E;  5APY A;  2IBZ E;  2IZ0 A;  1DX7 A;  3MTU E;  3KQG A;  3S9O A;  3TSI A;  4HH2 A;  2FXP A;  4KHX A;  1TU3 F;  1OXZ A;  2IYO A;  3A0H H;  3MP7 B;  4O9B A;  1EDI A;  2LKM A;  1SS1 A;  3HD7 D;  3RK3 E;  1YQ4 C;  1YYC A;  3M06 A;  1KZU B;  3B5N C;  2OTK E;  1HH0 A;  1NGM B;  1EDK A;  1VQ9 P;  1SQX K;  2HPC A;  2GUS A;  1KOR A;  1CSB A;  2WSC J;  1RE3 C;  1H0T A;  3CX5 I;  1AFO A;  4H13 C;  1M1K Q;  3P8C D;  2YKO A;  2P10 A;  1VQO P;  2WZ7 A;  3L72 E;  1GK4 A;  2ZT9 C;  2Y0D A;  4L75 A;  1QGK B;  3NTN A;  3CXH I;  2K88 A;  2E75 B;  2QRX A;  2WSF H;  5EFW B;  4IFM A;  3L35 A;  3CXH E;  2J58 A;  5APX A;  3PRJ A;  1T6A A;  5AW0 B;  3HTK A;  1GU5 A;  1W5C E;  1G2C B;  4C46 A;  2QA4 P;  3HD7 B;  2FYU E;  1L0L E;  3L70 J;  3TGU E;  2HYN A;  3L75 G;  5K5G B;  3RGU A;  3HE4 A;  1HVV A;  3H32 A;  2O1J A;  3II6 A;  1NU1 J;  2E5Y A;  2WPQ A;  3MUD A;  3O6Q A;  3BRV B;  1JUN A;  2JJL A;  3L72 J;  1NH4 A;  1QEX A;  4BRY B;  1N7S B;  2P7J A;  3TK1 A;  2Q3I A;  1FS0 E;  3CXH H;  1FZC B;  2Q3E A;  1PGO A;  1SFC D;  5AW8 B;  2IZ1 A;  1G1I A;  2E74 D;  3JCU H;  3BRT B;  2XZR A;  3F89 A;  1K73 Q;  1FZA A;  3PLN A;  1URQ D;  5AW9 B;  3MHV A;  1SQP K;  2IFM A;  3CMA P;  3GG2 A;  1OX3 A;  2QJK B;  4L76 A;  1KYO H;  2XND H;  3W68 A;  1OIP A;  1M1J B;  1A02 F;  4LLH A;  2KSJ A;  3R2P A;  1BE3 D;  3K5B A;  3H1I D;  1NTZ G;  1QVG O;  1JMB A;  3L71 D;  3Q5P A;  3RL0 C;  2C0W A;  3MUD C;  4DCK A;  1AJY A;  1BDC A;  1SQB G;  2Y9Y A;  3EFF K;  1S5L E;  2FFD C;  2OAR A;  3WMM 0;  2HR3 A;  5CJ4 A;  5APQ A;  2A06 G;  2KYV A;  3E1I A;  3B5N D;  1LP1 A;  2BCC D;  3NMD A;  1IJD B;  1BCC D;  1Y47 A;  5C39 A;  3L36 A;  4YPC A;  1N73 A;  3A3Y B;  1KIL A;  3S4R A;  2L5G B;  1JTH B;  1CZQ A;  1YBK A;  3CD6 P;  1SQQ J;  1A02 J;  2OTL P;  1OWA A;  1LTT C;  3L74 D;  5AW5 B;  2V7Q H;  1NTZ K;  1RY3 A;  5KLI B;  1JY3 P;  3H1H G;  1NTM G;  4EDF A;  3H1J D;  1RF1 B;  1U57 A;  1NOH A;  3BCC D;  1HGZ A;  1SQB K;  1S72 P;  1VQ8 P;  2N1T A;  2FYZ A;  1ZRT D;  1OVU A;  4JF7 A;  1SQV K;  2E76 C;  3GF3 A;  2C0X A;  3GHG A;  2YXQ B;  3M0D C;  2RN0 A;  4GKG A;  2K1A A;  3VP9 A;  2WPV B;  3KYQ A;  5TIS H;  4WB4 A;  5CBN A;  2OYI B;  1LT9 A;  1KYO D;  1H89 A;  2ZXE B;  3CC4 P;  2OYO A;  3WUV A;  3CCS P;  3KPE A;  1XTC C;  4XFJ A;  2KIK A;  1L4A C;  3CWB D;  3HUS A;  1ZP0 C;  1LTG C;  1BGY D;  5APW A;  3TNU A;  4U7J A;  1OFC X;  2KZJ A;  2N1T C;  4U3F D;  3A0B H;  1CI6 B;  3RL0 D;  2NPS A;  3V2N A;  2HPC B;  2K9J B;  2RMZ A;  3G6E P;  4NPE A;  5L8R J;  3O8Z A;  2G8Y A;  1NHL A;  3L70 G;  1K04 A;  1LT9 C;  4M3L A;  1E79 H;  3PH0 A;  3H1K J;  4H0L C;  2ZJS E;  2MJZ A;  1S5L X;  1NU1 G;  3WUT A;  4WVZ A;  2J59 M;  1IFM A;  3HTK B;  2M0B A;  2H7H A;  3KDP B;  5CJ0 A;  2E43 A;  3PTZ A;  3O6Q B;  1W2E A;  3AEB C;  1GMJ A;  4C7R A;  1KFM A;  3LW5 J;  2OGU A;  2QG4 A;  5AW3 B;  2LXB A;  2Z5I A;  2WWW A;  4NPD A;  5KLV J;  3P7K A;  3AE5 C;  5B5E H;  3L75 J;  1QLE D;  1YJN P;  3GW6 A;  4AQR D;  4ZMD A;  4ZKU A;  3CCM P;  4LC1 A;  2B87 A;  1GW3 A;  1NU1 K;  3R4Y A;  1ZME C;  2W6J H;  1SQX D;  1IC2 A;  3WU2 E;  1NTZ E;  5E79 E;  1M56 D;  4RJT A;  3M9Q A;  1FDO A;  1HJ0 A;  2YMK A;  3V2R A;  2MKV A;  1NAF A;  2Q6Q A;  3BAT A;  1SQB E;  2KNC A;  2YMY A;  3Q5R A;  3D71 A;  1SP4 A;  2Z5H A;  2O01 J;  3P8M C;  1VQ6 P;  2A06 E;  3Q1M A;  2N1T D;  2I1J A;  5TJH A;  1SQQ G;  4B86 A;  1VQ7 P;  3WU2 H;  5E79 H;  1N73 B;  4GOF A;  1KIL B;  1FOS E;  3L73 E;  3B4S A;  3SWF A;  5GTI H;  3AEG C;  2OYH B;  4H0L D;  1NTM E;  2B88 A;  3VMY A;  3FX0 A;  1VQP P;  4EOT A;  2HOD A;  1M8O B;  1OW8 A;  4OGQ C;  3WUU A;  1PL5 A;  2KK7 A;  3I56 P;  1ZXG A;  1SQP D;  1RHZ B;  1EDJ A;  4IFF A;  4Y99 C;  1OZH A;  1U7J A;  2NZ2 A;  2KB7 P;  3GHG B;  2JEE A;  4YXW H;  4RES B;  1VF5 C;  2M3B A;  3H1H J;  5AVY B;  3SWK A;  2M5A A;  4PD4 I;  1EZV D;  1PGQ A;  1K9M Q;  1L0N G;  4PD4 E;  1HJB A;  3MZW B;  1JY3 N;  2QJY C;  1Y9B A;  1RE3 A;  1M57 D;  4H44 C;  2AXT E;  1OW6 A;  1EC5 A;  4BXL A;  1EDL A;  1HWT C;  2IYP A;  5KKZ C;  3A2A A;  1KQS O;  2WPS A;  2POH A;  2Q1K A;  3HUS B;  5H2F E;  3TNU B;  1SVF A; 
#chains in the Genus database with same CATH homology
 3KZI E;  5KAF E;  2AXT E;  1S5L E;  3WU2 E;  3A0B E;  5E79 E;  3A0H E;  1W5C E;  4IL6 E;  3JCU E;  4UB6 E;  5B66 E;  5B5E E;  4PJ0 E;  4UB8 E;  5H2F E;  5TIS E;  5GTH E;  5GTI E;  5KAI E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...