2KZIA

Solution structure of the zher2 affibody
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
58
structure length
58
Chain Sequence
VDNKFNKEMRNAYWEIALLPNLNNQQKRAFIRSLYDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Engineered protein, ZHER2 Affibody
publication title Structural basis for high-affinity HER2 receptor binding by an engineered protein.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 19
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2010-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2kziA00
3FXDA 3FXEA 3MZWB 1H0TA 2ZAEB 2UWJE 1SS1A 3S1KA 1OVVA 1DEEG 4NPFX 2SPZA 5C39A 1U7JA 1EDLA 4JBZA 4GOEA 4CPGA 1EDIA 1LP1B 4ASWA 5EFWB 4WWIA 2KZIA 1Q2NA 5CBOA 4NPEA 2P58A 1LP1A 2QVAA 1OVRA 5DJTB 1EDJA 4HB1A 4GODA 2M0BA 2QRXA 2KIKA 2KI7B 2LXBA 4GOFA 2HR3A 3RGUA 4HJGH 1JM0A 4K3AA 3PH0A 4ASVA 4K35A 2Q1KA 5DJUB 4HKZH 2JWDA 2M5AB 2LXCB 4MN4C 2KZJA 3QWOC 4ZMDA 1ZXGA 1MFTA 2M5AA 2K3RA 1Y47A 1FC2C 3ZDMA 4IOIH 2R44A 4EYYQ 2B89A 1EDKA 2B88A 2OTKE 5CBNA 2KUBA 2KS1B 1JMBA 1U7MA 2LR2A 1OVUA 2B87B 3MHVA 1S3JA 4KJMA 2WMMA 1BDDA 2I8DA 5K5GB 4BXLA 1BDCA 1H0TB 1ZW0A 4ZNCA 2RKLA 1LT1A 4NPDA 1X0TA 1NVOA 2B87A 1EC5A
chains in the Genus database with same CATH superfamily
3GF7A 4H0LC 3I55P 1RE4A 4QMAA 4LC1A 1IFNA 5AVZB 2QM8A 1EDLA 2KXPB 1N8RQ 3VMZA 1QL1A 1KMIZ 3CC4P 4GOEA 2YO3A 1PGOA 4I7ZB 3M9HA 1LTIC 2YKQA 5B5EE 2WVRA 5CBOA 1WMKA 1FZFA 3B5NA 3AEDC 3WUVA 1EDJA 1ZR4A 3B4SA 3V2RA 2FBWC 1FZBA 4IL6E 5E79E 1BE3J 1LTJA 1SFCD 4K3AA 4JPZB 3A0HE 4PJ0H 4W7ZA 1BCCD 2ZXEB 2YXRB 3H1HD 1LT9B 2IYOA 1VQ9P 2PAJA 2IZ1A 1N7SD 5TISE 5KAIE 3USSA 1Y47A 3LW5J 4KHXA 2E42A 4UB8E 3V2NA 3C9IA 4YTPC 3KDPB 2QJYB 1FZCA 3NTNA 1S3JA 3H1KE 1L0NJ 1E5WA 5B66H 3L73E 1JTHB 4U3FE 4B86A 1NGMB 2E76D 3FXEA 3L75J 3MIWA 1AFOA 1JY2O 3M0AA 1G1IA 1JEKA 1MV8A 1BGYE 1PZQA 3H1KG 4XFJA 2KP8A 2AEFA 2OYHB 1T3JA 1DX7A 2FYZA 3L73G 3AE3C 4U3FG 5AW3B 3H32A 3H1KD 1EQ7A 3CMEP 2RN0A 4WWIA 2Q7CA 5AVQB 3AECC 1IK7A 1SFCA 4NPEA 1SQXE 5AW0B 3HRNA 1GDTA 1VQNP 5CCGD 1BGYG 2WSCJ 1LNQA 1SQPD 3R4YA 4RJTA 1L0NK 1PGPA 2WSFH 1RF1A 1RQVA 1WT6A 1N7SA 2AEJA 2M5AB 2OYIB 3QWOC 3D71A 1PV3A 1IO4A 1KILD 2PP6A 1SQXG 1MFTA 5AVUB 4H0LD 1M8OB 1Q7YQ 1CSBA 2FYUJ 2IX7C 1G1JA 3CWBJ 1YJNP 1FE6A 2ZYAA 2RH0A 2YMKA 1M1JA 3PP5A 1YI2P 1OWAA 2NZ2A 2GUVA 1AQTA 1SQVE 3U59A 3GMAA 1DIPA 3M9BA 3QH9A 5H2FE 1NTKD 1LT1A 3E7KA 1RQUA 2MKVA 2V7QJ 3F5HA 4OGQD 2QA4P 4D6TE 1XTCC 1L0LD 3SFDC 3MD0A 1PIXA 1WRGA 1CZQA 1SQVG 5AVWB 1KB9D 2W83C 4PD4E 3FGAD 4I1LA 3B5NB 5CCGA 2FYUK 4D6TG 1P84H 3TGUJ 3OJAB 1RHZB 2G8YA 3L72J 2NPSC 1LTJB 3CXHD 2KOGA 4R4LA 1X79B 3BCCJ 3P32A 1AA0A 3L74J 2M0BA 1IFIA 3E1IA 1KILA 1KYOD 4EOTA 3RK3B 3VN0A 3JSVC 1URQC 5GTHH 3CCRP 4OWFA 2HODA 1UIIA 3MUDC 2QM7A 2ZT9C 2I1KA 2QJPC 4GKGA 2GUSA 3M0DC 2LR2A 2Y9ZA 1VF5C 3O6QA 2I1JA 1J2JB 3PTZA 2QEXP 2XNXA 2KS1A 4NPDA 2BEQD 3KPEA 1K9MQ 1ZMEC 3MZWB 2XZRA 1NAFA 2UWJE 1SS1A 2W6AA 4H13C 3H32B 3WUUA 1KD1Q 3G6EP 1H88A 3NFQA 2Z5IA 1NAYA 1EDIA 1SFCB 1JCDA 1KZUB 3CCEP 1FOSE 5B5EH 1OIPA 3L36A 4M3LA 2JR8A 2FFDB 4DZOA 1KFMA 1JCCA 2Q9IA 3LIDA 1JNMA 1RF1B 1LP1A 3WMM0 1N7SB 2WSEH 2YO2A 1Q82Q 1UIXA 4IL6H 5E79H 1LWUA 2RMZA 1J1DC 3GLMA 1ZRTE 2XKMA 3A0HH 3HUSC 1HBWA 4HKZH 2ZVOB 2KB7P 2FYNC 1ZN5A 1RH5B 2OYOA 3KQGA 2AXTE 5TISH 5KAIH 1M1JB 1N7LA 2E76B 3L71J 1GL2C 3AE7C 2YKPA 1J1EC 4UB8H 2NRGA 5APQA 3ZDMA 4XE5B 1VQPP 3H1LE 1K73Q 1EDKA 1VQOP 3CPWO 1OVUA 3IN6A 3RL0C 1PFIA 3OAKA 1FJPA 3H1IE 1IFDA 1LTTC 1NTZJ 2NPSD 5AW5B 1ZV8A 3P8CE 2ZYDA 2HLOA 3H1LG 3TDKA 3TF5A 1OVVA 2M3EA 3Q5SA 2LKMA 5KLIC 1SQBD 5KKZB 1URQD 3D70A 1NO4A 4UB6E 4CPGA 1EXJA 3H1IG 2W90A 5AVRB 1JOCA 2JEEA 3W67A 4BRYB 2WTYA 4A7PA 2WITA 1KILB 3AEEC 4H0LB 1QX8A 4IFFA 2Q5UA 1NJIQ 3V4WA 2IBZD 3VP9A 3EFGA 2HODB 1VF5D 1FZEA 5KLVD 1T2KC 2A45H 1FZAA 1R5SA 1NTZK 2XU6A 3RK3E 3HE4A 2GA1A 2JDIH 3CI9A 4OGQB 2P7JA 3O6QB 4H13D 2ITAA 1HGZA 5KAFH 2KS1B 2NPSA 4I2LC 3MP7B 1TU3F 2E43A 2KSJA 1N73C 2I8DA 5K5GB 2W8ZA 1K04A 1BDCA 1NTMD 5H2FH 2CPSA 1R5LA 2Q3EA 2R3CA 3AE6C 3D6YA 3C1LA 4BWNA 1KTMA 2V7QH 3TYYA 1HUCA 3MUDA 4PD4H 3BVHA 3H6PA 1LP1B 2PFXA 3M0DA 2IYPA 3RBXA 1HF9A 1JY3N 1GL2D 1PL5A 1HH0A 2FXOA 1AVYA 2J5UA 3SWKA 1BCCE 3CCUP 3FX0A 5AW6B 3H1HE 3RL0D 1VQ6P 1S4XA 3NMDA 5DJUB 2D2CC 2W6JH 3A0BE 2WSEJ 2AEMA 2KZJA 4EI2A 1P84I 2OGUA 1SVFA 3JC22 3L70D 1BCCG 1DD3A 3CCSP 3H1HG 4YXWH 1DD4A 1LTBC 2OTKE 3CCVP 1H89A 3CD6P 2K88A 1KFNA 1SLQA 1OX3A 2ZFCA 3CMAP 2Y0EA 2O3JA 1JY2P 1Q90D 1RY3A 3JCUE 2B9BA 3HUSA 3H1KJ 4I6MC 1H0TA 2Q6QA 1A02J 3L73J 4U3FJ 1YBKA 4NPFX 1T2KD 5APVA 5CJ4A 1GL2A 4W7YA 2YIUC 1PPJE 4L76A 1LWUC 1OZHA 2IFMA 3A5TA 3N7NA 5KJ7C 4OVNF 1BGYJ 2L5GB 1JO5A 1SQPE 2WPVB 3CX5E 2QVAA 3Q5PA 3D6ZA 3IAOA 1BE3D 1PPJG 1KILE 1JM0A 4ASVA 1KQSO 1S1CX 1SQXJ 2H88C 3HE4B 4C7NA 1NH4A 2AXTH 3AEBC 1MUUA 1SQPG 3L35A 1PPJD 4LGDE 5APXA 1Y8AA 1VQKP 2NPSB 2K3RA 1SQQE 1NHLA 4LLHA 2WPRA 2WZ7A 3CX5D 1L2PA 2P2UA 1NTKE 1M1KQ 1BSNA 1L0ND 4KJMA 1L0LE 1URQB 3I5CA 5AW8B 1OW8A 2XV5A 2H43A 2B87A 1SQQG 3AE8C 1SQVJ 1FBMA 1EC5A 3IR9A 1KB9E 5L8RJ 1KQFB 3FXDA 1M56D 2QJPB 1QVFO 1L4AC 1NTKG 2R32A 1SQQD 1SQXK 1YQ3C 2WPQA 3CL3D 1VPCA 2P1JA 5APSA 4D6TJ 1L0LG 2D2CD 1VF5B 1LGHB 3CXHE 1T3UA 3KZIE 2W27A 3R2PA 2Q3IA 2H8PD 2QJKC 3CCMP 2K1AA 1KYOE 3Q3DA 1N73A 1S9KD 2A06E 4Z1MH 4H13B 3SFEC 3AE9C 2E74C 5BU5A 1GZLA 3CC7P 1FOSF 1SQVK 3KXDA 4KT0J 3CWBD 3S9OA 3FWNA 2A06G 2R44A 4AYCA 4EIJA 1GK4A 1J1DB 2K9YA 2O1KA 2A06D 2A45I 4AUWA 3HUSB 2WMMA 5KJ7D 1QLED 2QE7H 2Y9YA 1VL2A 1H0TB 2FYNB 2IDBA 1ZW0A 1IC2A 4JF7A 1FZCB 1X0TA 5AVTB 1IZNB 1W2BO 1M7LA 1NU1E 3V6IA 2OTJP 1GTWA 1GL2B 1NWQA 1J1EB 1HVVA 2C0WA 2O01J 1FAVA 2FXPA 5KTBA 2SPZA 3PRJA 4N78D 3RL0B 4JBZA 4ZKUA 5EFWB 1PGJA 4TT3H 1NU1G 3L72D 1QL2A 4TLFA 3BATA 1CW5A 5AVYB 3UIAA 3BCCD 5DJTB 3L74D 4WB4A 1NU1D 2JJLA 4PD4I 3HD7C 2KI7B 2LXBA 1H8AA 5KLIB 1Y9BA 1N86A 1FJKA 3AEGC 3A0BH 3Q2YA 2WWWA 3BRTB 2LXCB 1GK6A 3KHUA 4YPCA 1MKMA 2N9BA 1L4AD 5KJ7A 4IOIH 4EYYQ 1JY3O 5CBNA 3O8ZA 4L73A 5APWA 2B87B 3U1AA 2HG5D 3H1LJ 2KLUA 2Y0CA 2BCCE 3JCUH 3WU2E 1EZVE 4ZKPA 3G71P 1SQBE 1JUNA 3VMXA 2G3AA 2DW3A 2OTLP 3GF3A 3S1KA 1MZ9A 3H1IJ 1G2CA 1RF0C 2E74D 3G4SP 4Y99C 1DEBA 3GHGC 2ZXXA 1N73B 2BCCG 1OXZA 1EZVG 1SQBG 1YTZT 4PV1C 1GW3A 3CX5H 3HE5A 2IBZE 2CPBA 2BCCD 5KLVE 1YIJP 1OVRA 1EZVD 2IPPA 4YXDC 2QRXA 1QVGO 2ZT9D 5AVVB 1L4AA 2IBZG 1S72P 5KLVG 3IF4A 3L71D 1FU1A 3H1JE 1S5LX 2FFDC 1KC8Q 5AVXB 1FC2C 1RE3C 1NTME 2OQQA 4C7RA 1PP9E 4JYBA 1ZP0C 1W5CE 5CJ0A 4HYTB 4R4MA 5CCHC 2D2CB 3OA7A 2ZJSE 2YNYA 4L74A 3H1JG 1VQ7P 1KB9H 5APUA 2M8RA 1NTMG 5BVZA 1PP9G 3H1JD 3CCJP 3HD7D 2Z4EA 1ZLLA 1NOHA 1USEA 4RKUJ 1SP4A 3CXHH 1PP9D 3KZIH 4DJGA 1KYOH 1NKNA 2WPSA 1FDOA 1AJYA 3GW6A 5AVSB 4IFMA 1USDA 1P84D 2WQYC 2JKVA 1LJ2A 1YITP 3V2PA 3L70E 1A02F 2Q1KA 1IJDB 1KN7A 2E5YA 2YIUB 1S5LE 1LWUB 2J58A 1BCCJ 3H1HJ 4ZMDA 1S2EA 3CCQP 1BSHA 1M90Q 2HYNA 4HH2A 2YKOA 2H7HA 3G9RA 2B89A 2QIWA 3L70G 2CK3H 4XA4A 5TJHA 3LIEA 3MHVA 3G3ZA 3F89A 4H44C 4PV1D 3HD7A 1OW7A 1G2CB 4WY4C 3H25A 3TK1A 3II6A 4W80A 3IFMA 5APYA 3BASA 1DEEG 4OGQC 2KSEA 3RBZA 3PHLA 1HWTC 3HE5B 2O01H 3RK2C 2J59M 2R3SA 2O1JA 1YTZI 2QG4A 1KQLA 3M9QA 5AW1B 2KZIA 1BE3E 1Q2NA 3B71A 3VYIA 3C8VA 1QGKB 5AW9B 1L4AB 2N1TC 3MTUE 1SQPJ 1KV4A 2HPCA 2M3BA 2FKWB 3RGUA 2E75C 4HJGH 4N3YB 1N2DC 4K35A 3VTPC 5CCHD 2KLVA 2JWDA 4MN4C 3W68A 1BE3G 1KORA 1RF0A 2QJKB 5M1BA 1LTSC 3V4QA 1Z56A 1MFZA 3GHGA 1GU5A 2KNCA 1NKZB 3A7OA 1L0NE 1E79H 4L75A 1IFPA 1FS0E 1XTGB 3VMYA 1JMBA 1SQQJ 2E74B 2K9JA 1VQ4P 1CI6A 3L75E 3S4RA 4I7ZC 2RKLA 4RO0A 3V5BA 3WU2H 2IZ0A 1NTKJ 1Q81Q 2WSSH 1L0NG 2P67A 4IFDK 3V2QA 1L0LJ 1SQPK 3GG2A 3L73D 2ZYGA 1OFCX 4U3FD 4EDFA 2BEZF 3KYQA 3L75G 1T8ZA 2FFDA 2KK7A 3L37A 1S9KE 4ASWA 1RE3A 1BGYD 1LT9C 2ZT9B 3L75D 3CLQA 5CCHA 4HB1A 3PJSK 4GODA 2OARA 2QJYC 4UB6H 2KIKA 1SQQK 3T97A 4GOFA 4DT0A 1SQXD 1VQMP 2FYUE 1M57D 1YQ4C 2AXCA 3AEFC 3CWBE 1YJWP 5KAFE 2MJZA 4H44D 1NTKK 4DCKA 2A45G 3CX5I 5GTIE 1OW6A 4WY4D 1VDFA 1L0LK 2C9NY 3TNUA 1IK9A 1R8EA 1GU4A 1EXIA 3EWKA 2PGDA 3U1CA 5CMZA 2FYUG 3CWBG 3HD7B 4N6JA 3RK2D 2KUBA 2P10A 2OYHC 3AE2C 3M06A 4O9BA 1ZOYC 3FWLA 2FYUD 1Q86Q 4ZNCA 2JO1A 1D7MA 1NVOA 1SQVD 4WBAA 2ZAEB 4N78E 1ZR2A 2N1TD 3WUTA 2E75D 3HTKA 1FZGA 4BRYA 4D6TD 3TGUE 1U7JA 2R5DA 1NU1J 3PLNA 2KYVA 3L72E 2OYIC 4GDOA 3Q1MA 3AE1C 3BCCE 2FXMA 2N9YB 2WT7A 1KB9I 3L74E 2QSIA 2GM4A 4PD4D 1KQGB 2HPCB 1OMIA 1AV1A 5AW7B 1FDMA 3TGUG 3MGNA 3L72G 4WY4A 2FY8A 3CXHI 3L4FA 3BCCG 2Z5HA 1S5LH 3VP8A 4Y99B 3L74G 3TGUD 3GHGB 1RE4C 2KNCB 4PJ0E 1JY2N 1KYOI 1VQ5P 4PV1B 2C0XA 1JY3P 4C7NB 4U7JA 1GD2E 1FDIA 3VOPA 2BASA 2K9JB 1AVOA 4C46A 3TSIA 1CI6B 5BU8B 1NU1K 2YXQB 2B88A 5AW4B 4DOJA 4GT1A 4AQRD 2C9LY 2YMYA 3B5NC 2H89C 2N1TA 1QEXA 1X8YA 5B66E 1LTJC 1VQLP 2Y0DA 1PGQA 3M91A 2BCCJ 3CCLP 1GMJA 5C39A 1SQBJ 3RK3C 1LTGC 3P8MC 3EQ2A 4WVZA 3K5BA 1U57A 2XNDH 3T97B 1FZCC 5AW2B 2P58A 3VMAA 2WSFJ 1W2EA 4RESB 1HGVA 4GIFA 4JQ0D 3N4XA 3PH0A 5KLVJ 3EFFK 3LW5H 3TNUB 3L71E 3AEAC 1VQ8P 2HFED 2JWAA 1ZRTD 3A3YB 3RL0g 1LTAC 1K8AQ 1SQBK 1LT9A 3AE4C 1NTZE 3L71G 3H1JJ 1YYCA 3ABVC 1SFCC 1BDDA 3B8EB 3H1LD 1NTMJ 3SSUA 2V4HA 2POHA 1PP9J 3SWYA 3HTKB 1HJBA 1RF1C 3Q5RA 1N7SC 2E5TA 3P7KA 1JTHA 3H1ID 1NTZG 3I56P 5KLVK 2WT7B 3P8CD 1NYHA 5APTA 1K05A 2WSCH 1NTZD 2K37A 1HJ0A 1HTLC 3CC2P 1EZVI 1GW4A 4H44B 1DH3A 1YHQP 1M1JC 3SWFA 2OYHA 1P84E 1IFMA 2E76C 4WY4B 3A2AA 2VRSA 1X9VA 2HR3A 3AE5C 2JP3A 3B5ND 1X22A 1JB0J 1NTMK 3RK2B 2ZVNB 2L91A 5GTIH 2IBZI 3BRVB 5GTHE 2PRRA 4IL6X 3E1RA 2R5BA 1ZXGA 1T6AA 1YJ9P 3L70J 2M5AA 5CHXA 3NXSA 2OYIA 1AQ5A 5CCGC 3OW2O 1URQA 5KKZC 3RK3D 2N1TB 3ITKA 4JYCA 1U7MA 1IFJA 2E75B 2O01N 4OH8B 4BXLA 2IFNA 1JMMA 2XDJA 4Y28J 2W6BA 1KILC
chains in the Genus database with same CATH topology
3FXDA 3FXEA 3MZWB 1H0TA 2ZAEB 2UWJE 1SS1A 3S1KA 1OVVA 1DEEG 4NPFX 2SPZA 5C39A 1U7JA 1EDLA 4JBZA 4GOEA 4CPGA 1EDIA 1LP1B 4ASWA 5EFWB 4WWIA 2KZIA 1Q2NA 5CBOA 4NPEA 2P58A 1LP1A 2QVAA 1OVRA 5DJTB 1EDJA 4HB1A 4GODA 2M0BA 2QRXA 2KIKA 2KI7B 2LXBA 4GOFA 2HR3A 3RGUA 4HJGH 1JM0A 4K3AA 3PH0A 4ASVA 4K35A 2Q1KA 5DJUB 4HKZH 2JWDA 2M5AB 2LXCB 4MN4C 2KZJA 3QWOC 4ZMDA 1ZXGA 1MFTA 2M5AA 2K3RA 1Y47A 1FC2C 3ZDMA 4IOIH 2R44A 4EYYQ 2B89A 1EDKA 2B88A 2OTKE 5CBNA 2KUBA 2KS1B 1JMBA 1U7MA 2LR2A 1OVUA 2B87B 3MHVA 1S3JA 4KJMA 2WMMA 1BDDA 2I8DA 5K5GB 4BXLA 1BDCA 1H0TB 1ZW0A 4ZNCA 2RKLA 1LT1A 4NPDA 1X0TA 1NVOA 2B87A 1EC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXD A;  3FXE A;  3MZW B;  1H0T A;  2ZAE B;  2UWJ E;  1SS1 A;  3S1K A;  1OVV A;  1DEE G;  4NPF X;  2SPZ A;  5C39 A;  1U7J A;  1EDL A;  4JBZ A;  4GOE A;  4CPG A;  1EDI A;  1LP1 B;  4ASW A;  5EFW B;  4WWI A;  2KZI A;  1Q2N A;  5CBO A;  4NPE A;  2P58 A;  1LP1 A;  2QVA A;  1OVR A;  5DJT B;  1EDJ A;  4HB1 A;  4GOD A;  2M0B A;  2QRX A;  2KIK A;  2KI7 B;  2LXB A;  4GOF A;  2HR3 A;  3RGU A;  4HJG H;  1JM0 A;  4K3A A;  3PH0 A;  4ASV A;  4K35 A;  2Q1K A;  5DJU B;  4HKZ H;  2JWD A;  2M5A B;  2LXC B;  4MN4 C;  2KZJ A;  3QWO C;  4ZMD A;  1ZXG A;  1MFT A;  2M5A A;  2K3R A;  1Y47 A;  1FC2 C;  3ZDM A;  4IOI H;  2R44 A;  4EYY Q;  2B89 A;  1EDK A;  2B88 A;  2OTK E;  5CBN A;  2KUB A;  2KS1 B;  1JMB A;  1U7M A;  2LR2 A;  1OVU A;  2B87 B;  3MHV A;  1S3J A;  4KJM A;  2WMM A;  1BDD A;  2I8D A;  5K5G B;  4BXL A;  1BDC A;  1H0T B;  1ZW0 A;  4ZNC A;  2RKL A;  1LT1 A;  4NPD A;  1X0T A;  1NVO A;  2B87 A;  1EC5 A; 
#chains in the Genus database with same CATH topology
 3GF7 A;  4H0L C;  3I55 P;  1RE4 A;  4QMA A;  4LC1 A;  1IFN A;  5AVZ B;  2QM8 A;  1EDL A;  2KXP B;  1N8R Q;  3VMZ A;  1QL1 A;  1KMI Z;  3CC4 P;  4GOE A;  2YO3 A;  1PGO A;  4I7Z B;  3M9H A;  1LTI C;  2YKQ A;  5B5E E;  2WVR A;  5CBO A;  1WMK A;  1FZF A;  3B5N A;  3AED C;  3WUV A;  1EDJ A;  1ZR4 A;  3B4S A;  3V2R A;  2FBW C;  1FZB A;  4IL6 E;  5E79 E;  1BE3 J;  1LTJ A;  1SFC D;  4K3A A;  4JPZ B;  3A0H E;  4PJ0 H;  4W7Z A;  1BCC D;  2ZXE B;  2YXR B;  3H1H D;  1LT9 B;  2IYO A;  1VQ9 P;  2PAJ A;  2IZ1 A;  1N7S D;  5TIS E;  5KAI E;  3USS A;  1Y47 A;  3LW5 J;  4KHX A;  2E42 A;  4UB8 E;  3V2N A;  3C9I A;  4YTP C;  3KDP B;  2QJY B;  1FZC A;  3NTN A;  1S3J A;  3H1K E;  1L0N J;  1E5W A;  5B66 H;  3L73 E;  1JTH B;  4U3F E;  4B86 A;  1NGM B;  2E76 D;  3FXE A;  3L75 J;  3MIW A;  1AFO A;  1JY2 O;  3M0A A;  1G1I A;  1JEK A;  1MV8 A;  1BGY E;  1PZQ A;  3H1K G;  4XFJ A;  2KP8 A;  2AEF A;  2OYH B;  1T3J A;  1DX7 A;  2FYZ A;  3L73 G;  3AE3 C;  4U3F G;  5AW3 B;  3H32 A;  3H1K D;  1EQ7 A;  3CME P;  2RN0 A;  4WWI A;  2Q7C A;  5AVQ B;  3AEC C;  1IK7 A;  1SFC A;  4NPE A;  1SQX E;  5AW0 B;  3HRN A;  1GDT A;  1VQN P;  5CCG D;  1BGY G;  2WSC J;  1LNQ A;  1SQP D;  3R4Y A;  4RJT A;  1L0N K;  1PGP A;  2WSF H;  1RF1 A;  1RQV A;  1WT6 A;  1N7S A;  2AEJ A;  2M5A B;  2OYI B;  3QWO C;  3D71 A;  1PV3 A;  1IO4 A;  1KIL D;  2PP6 A;  1SQX G;  1MFT A;  5AVU B;  4H0L D;  1M8O B;  1Q7Y Q;  1CSB A;  2FYU J;  2IX7 C;  1G1J A;  3CWB J;  1YJN P;  1FE6 A;  2ZYA A;  2RH0 A;  2YMK A;  1M1J A;  3PP5 A;  1YI2 P;  1OWA A;  2NZ2 A;  2GUV A;  1AQT A;  1SQV E;  3U59 A;  3GMA A;  1DIP A;  3M9B A;  3QH9 A;  5H2F E;  1NTK D;  1LT1 A;  3E7K A;  1RQU A;  2MKV A;  2V7Q J;  3F5H A;  4OGQ D;  2QA4 P;  4D6T E;  1XTC C;  1L0L D;  3SFD C;  3MD0 A;  1PIX A;  1WRG A;  1CZQ A;  1SQV G;  5AVW B;  1KB9 D;  2W83 C;  4PD4 E;  3FGA D;  4I1L A;  3B5N B;  5CCG A;  2FYU K;  4D6T G;  1P84 H;  3TGU J;  3OJA B;  1RHZ B;  2G8Y A;  3L72 J;  2NPS C;  1LTJ B;  3CXH D;  2KOG A;  4R4L A;  1X79 B;  3BCC J;  3P32 A;  1AA0 A;  3L74 J;  2M0B A;  1IFI A;  3E1I A;  1KIL A;  1KYO D;  4EOT A;  3RK3 B;  3VN0 A;  3JSV C;  1URQ C;  5GTH H;  3CCR P;  4OWF A;  2HOD A;  1UII A;  3MUD C;  2QM7 A;  2ZT9 C;  2I1K A;  2QJP C;  4GKG A;  2GUS A;  3M0D C;  2LR2 A;  2Y9Z A;  1VF5 C;  3O6Q A;  2I1J A;  1J2J B;  3PTZ A;  2QEX P;  2XNX A;  2KS1 A;  4NPD A;  2BEQ D;  3KPE A;  1K9M Q;  1ZME C;  3MZW B;  2XZR A;  1NAF A;  2UWJ E;  1SS1 A;  2W6A A;  4H13 C;  3H32 B;  3WUU A;  1KD1 Q;  3G6E P;  1H88 A;  3NFQ A;  2Z5I A;  1NAY A;  1EDI A;  1SFC B;  1JCD A;  1KZU B;  3CCE P;  1FOS E;  5B5E H;  1OIP A;  3L36 A;  4M3L A;  2JR8 A;  2FFD B;  4DZO A;  1KFM A;  1JCC A;  2Q9I A;  3LID A;  1JNM A;  1RF1 B;  1LP1 A;  3WMM 0;  1N7S B;  2WSE H;  2YO2 A;  1Q82 Q;  1UIX A;  4IL6 H;  5E79 H;  1LWU A;  2RMZ A;  1J1D C;  3GLM A;  1ZRT E;  2XKM A;  3A0H H;  3HUS C;  1HBW A;  4HKZ H;  2ZVO B;  2KB7 P;  2FYN C;  1ZN5 A;  1RH5 B;  2OYO A;  3KQG A;  2AXT E;  5TIS H;  5KAI H;  1M1J B;  1N7L A;  2E76 B;  3L71 J;  1GL2 C;  3AE7 C;  2YKP A;  1J1E C;  4UB8 H;  2NRG A;  5APQ A;  3ZDM A;  4XE5 B;  1VQP P;  3H1L E;  1K73 Q;  1EDK A;  1VQO P;  3CPW O;  1OVU A;  3IN6 A;  3RL0 C;  1PFI A;  3OAK A;  1FJP A;  3H1I E;  1IFD A;  1LTT C;  1NTZ J;  2NPS D;  5AW5 B;  1ZV8 A;  3P8C E;  2ZYD A;  2HLO A;  3H1L G;  3TDK A;  3TF5 A;  1OVV A;  2M3E A;  3Q5S A;  2LKM A;  5KLI C;  1SQB D;  5KKZ B;  1URQ D;  3D70 A;  1NO4 A;  4UB6 E;  4CPG A;  1EXJ A;  3H1I G;  2W90 A;  5AVR B;  1JOC A;  2JEE A;  3W67 A;  4BRY B;  2WTY A;  4A7P A;  2WIT A;  1KIL B;  3AEE C;  4H0L B;  1QX8 A;  4IFF A;  2Q5U A;  1NJI Q;  3V4W A;  2IBZ D;  3VP9 A;  3EFG A;  2HOD B;  1VF5 D;  1FZE A;  5KLV D;  1T2K C;  2A45 H;  1FZA A;  1R5S A;  1NTZ K;  2XU6 A;  3RK3 E;  3HE4 A;  2GA1 A;  2JDI H;  3CI9 A;  4OGQ B;  2P7J A;  3O6Q B;  4H13 D;  2ITA A;  1HGZ A;  5KAF H;  2KS1 B;  2NPS A;  4I2L C;  3MP7 B;  1TU3 F;  2E43 A;  2KSJ A;  1N73 C;  2I8D A;  5K5G B;  2W8Z A;  1K04 A;  1BDC A;  1NTM D;  5H2F H;  2CPS A;  1R5L A;  2Q3E A;  2R3C A;  3AE6 C;  3D6Y A;  3C1L A;  4BWN A;  1KTM A;  2V7Q H;  3TYY A;  1HUC A;  3MUD A;  4PD4 H;  3BVH A;  3H6P A;  1LP1 B;  2PFX A;  3M0D A;  2IYP A;  3RBX A;  1HF9 A;  1JY3 N;  1GL2 D;  1PL5 A;  1HH0 A;  2FXO A;  1AVY A;  2J5U A;  3SWK A;  1BCC E;  3CCU P;  3FX0 A;  5AW6 B;  3H1H E;  3RL0 D;  1VQ6 P;  1S4X A;  3NMD A;  5DJU B;  2D2C C;  2W6J H;  3A0B E;  2WSE J;  2AEM A;  2KZJ A;  4EI2 A;  1P84 I;  2OGU A;  1SVF A;  3JC2 2;  3L70 D;  1BCC G;  1DD3 A;  3CCS P;  3H1H G;  4YXW H;  1DD4 A;  1LTB C;  2OTK E;  3CCV P;  1H89 A;  3CD6 P;  2K88 A;  1KFN A;  1SLQ A;  1OX3 A;  2ZFC A;  3CMA P;  2Y0E A;  2O3J A;  1JY2 P;  1Q90 D;  1RY3 A;  3JCU E;  2B9B A;  3HUS A;  3H1K J;  4I6M C;  1H0T A;  2Q6Q A;  1A02 J;  3L73 J;  4U3F J;  1YBK A;  4NPF X;  1T2K D;  5APV A;  5CJ4 A;  1GL2 A;  4W7Y A;  2YIU C;  1PPJ E;  4L76 A;  1LWU C;  1OZH A;  2IFM A;  3A5T A;  3N7N A;  5KJ7 C;  4OVN F;  1BGY J;  2L5G B;  1JO5 A;  1SQP E;  2WPV B;  3CX5 E;  2QVA A;  3Q5P A;  3D6Z A;  3IAO A;  1BE3 D;  1PPJ G;  1KIL E;  1JM0 A;  4ASV A;  1KQS O;  1S1C X;  1SQX J;  2H88 C;  3HE4 B;  4C7N A;  1NH4 A;  2AXT H;  3AEB C;  1MUU A;  1SQP G;  3L35 A;  1PPJ D;  4LGD E;  5APX A;  1Y8A A;  1VQK P;  2NPS B;  2K3R A;  1SQQ E;  1NHL A;  4LLH A;  2WPR A;  2WZ7 A;  3CX5 D;  1L2P A;  2P2U A;  1NTK E;  1M1K Q;  1BSN A;  1L0N D;  4KJM A;  1L0L E;  1URQ B;  3I5C A;  5AW8 B;  1OW8 A;  2XV5 A;  2H43 A;  2B87 A;  1SQQ G;  3AE8 C;  1SQV J;  1FBM A;  1EC5 A;  3IR9 A;  1KB9 E;  5L8R J;  1KQF B;  3FXD A;  1M56 D;  2QJP B;  1QVF O;  1L4A C;  1NTK G;  2R32 A;  1SQQ D;  1SQX K;  1YQ3 C;  2WPQ A;  3CL3 D;  1VPC A;  2P1J A;  5APS A;  4D6T J;  1L0L G;  2D2C D;  1VF5 B;  1LGH B;  3CXH E;  1T3U A;  3KZI E;  2W27 A;  3R2P A;  2Q3I A;  2H8P D;  2QJK C;  3CCM P;  2K1A A;  1KYO E;  3Q3D A;  1N73 A;  1S9K D;  2A06 E;  4Z1M H;  4H13 B;  3SFE C;  3AE9 C;  2E74 C;  5BU5 A;  1GZL A;  3CC7 P;  1FOS F;  1SQV K;  3KXD A;  4KT0 J;  3CWB D;  3S9O A;  3FWN A;  2A06 G;  2R44 A;  4AYC A;  4EIJ A;  1GK4 A;  1J1D B;  2K9Y A;  2O1K A;  2A06 D;  2A45 I;  4AUW A;  3HUS B;  2WMM A;  5KJ7 D;  1QLE D;  2QE7 H;  2Y9Y A;  1VL2 A;  1H0T B;  2FYN B;  2IDB A;  1ZW0 A;  1IC2 A;  4JF7 A;  1FZC B;  1X0T A;  5AVT B;  1IZN B;  1W2B O;  1M7L A;  1NU1 E;  3V6I A;  2OTJ P;  1GTW A;  1GL2 B;  1NWQ A;  1J1E B;  1HVV A;  2C0W A;  2O01 J;  1FAV A;  2FXP A;  5KTB A;  2SPZ A;  3PRJ A;  4N78 D;  3RL0 B;  4JBZ A;  4ZKU A;  5EFW B;  1PGJ A;  4TT3 H;  1NU1 G;  3L72 D;  1QL2 A;  4TLF A;  3BAT A;  1CW5 A;  5AVY B;  3UIA A;  3BCC D;  5DJT B;  3L74 D;  4WB4 A;  1NU1 D;  2JJL A;  4PD4 I;  3HD7 C;  2KI7 B;  2LXB A;  1H8A A;  5KLI B;  1Y9B A;  1N86 A;  1FJK A;  3AEG C;  3A0B H;  3Q2Y A;  2WWW A;  3BRT B;  2LXC B;  1GK6 A;  3KHU A;  4YPC A;  1MKM A;  2N9B A;  1L4A D;  5KJ7 A;  4IOI H;  4EYY Q;  1JY3 O;  5CBN A;  3O8Z A;  4L73 A;  5APW A;  2B87 B;  3U1A A;  2HG5 D;  3H1L J;  2KLU A;  2Y0C A;  2BCC E;  3JCU H;  3WU2 E;  1EZV E;  4ZKP A;  3G71 P;  1SQB E;  1JUN A;  3VMX A;  2G3A A;  2DW3 A;  2OTL P;  3GF3 A;  3S1K A;  1MZ9 A;  3H1I J;  1G2C A;  1RF0 C;  2E74 D;  3G4S P;  4Y99 C;  1DEB A;  3GHG C;  2ZXX A;  1N73 B;  2BCC G;  1OXZ A;  1EZV G;  1SQB G;  1YTZ T;  4PV1 C;  1GW3 A;  3CX5 H;  3HE5 A;  2IBZ E;  2CPB A;  2BCC D;  5KLV E;  1YIJ P;  1OVR A;  1EZV D;  2IPP A;  4YXD C;  2QRX A;  1QVG O;  2ZT9 D;  5AVV B;  1L4A A;  2IBZ G;  1S72 P;  5KLV G;  3IF4 A;  3L71 D;  1FU1 A;  3H1J E;  1S5L X;  2FFD C;  1KC8 Q;  5AVX B;  1FC2 C;  1RE3 C;  1NTM E;  2OQQ A;  4C7R A;  1PP9 E;  4JYB A;  1ZP0 C;  1W5C E;  5CJ0 A;  4HYT B;  4R4M A;  5CCH C;  2D2C B;  3OA7 A;  2ZJS E;  2YNY A;  4L74 A;  3H1J G;  1VQ7 P;  1KB9 H;  5APU A;  2M8R A;  1NTM G;  5BVZ A;  1PP9 G;  3H1J D;  3CCJ P;  3HD7 D;  2Z4E A;  1ZLL A;  1NOH A;  1USE A;  4RKU J;  1SP4 A;  3CXH H;  1PP9 D;  3KZI H;  4DJG A;  1KYO H;  1NKN A;  2WPS A;  1FDO A;  1AJY A;  3GW6 A;  5AVS B;  4IFM A;  1USD A;  1P84 D;  2WQY C;  2JKV A;  1LJ2 A;  1YIT P;  3V2P A;  3L70 E;  1A02 F;  2Q1K A;  1IJD B;  1KN7 A;  2E5Y A;  2YIU B;  1S5L E;  1LWU B;  2J58 A;  1BCC J;  3H1H J;  4ZMD A;  1S2E A;  3CCQ P;  1BSH A;  1M90 Q;  2HYN A;  4HH2 A;  2YKO A;  2H7H A;  3G9R A;  2B89 A;  2QIW A;  3L70 G;  2CK3 H;  4XA4 A;  5TJH A;  3LIE A;  3MHV A;  3G3Z A;  3F89 A;  4H44 C;  4PV1 D;  3HD7 A;  1OW7 A;  1G2C B;  4WY4 C;  3H25 A;  3TK1 A;  3II6 A;  4W80 A;  3IFM A;  5APY A;  3BAS A;  1DEE G;  4OGQ C;  2KSE A;  3RBZ A;  3PHL A;  1HWT C;  3HE5 B;  2O01 H;  3RK2 C;  2J59 M;  2R3S A;  2O1J A;  1YTZ I;  2QG4 A;  1KQL A;  3M9Q A;  5AW1 B;  2KZI A;  1BE3 E;  1Q2N A;  3B71 A;  3VYI A;  3C8V A;  1QGK B;  5AW9 B;  1L4A B;  2N1T C;  3MTU E;  1SQP J;  1KV4 A;  2HPC A;  2M3B A;  2FKW B;  3RGU A;  2E75 C;  4HJG H;  4N3Y B;  1N2D C;  4K35 A;  3VTP C;  5CCH D;  2KLV A;  2JWD A;  4MN4 C;  3W68 A;  1BE3 G;  1KOR A;  1RF0 A;  2QJK B;  5M1B A;  1LTS C;  3V4Q A;  1Z56 A;  1MFZ A;  3GHG A;  1GU5 A;  2KNC A;  1NKZ B;  3A7O A;  1L0N E;  1E79 H;  4L75 A;  1IFP A;  1FS0 E;  1XTG B;  3VMY A;  1JMB A;  1SQQ J;  2E74 B;  2K9J A;  1VQ4 P;  1CI6 A;  3L75 E;  3S4R A;  4I7Z C;  2RKL A;  4RO0 A;  3V5B A;  3WU2 H;  2IZ0 A;  1NTK J;  1Q81 Q;  2WSS H;  1L0N G;  2P67 A;  4IFD K;  3V2Q A;  1L0L J;  1SQP K;  3GG2 A;  3L73 D;  2ZYG A;  1OFC X;  4U3F D;  4EDF A;  2BEZ F;  3KYQ A;  3L75 G;  1T8Z A;  2FFD A;  2KK7 A;  3L37 A;  1S9K E;  4ASW A;  1RE3 A;  1BGY D;  1LT9 C;  2ZT9 B;  3L75 D;  3CLQ A;  5CCH A;  4HB1 A;  3PJS K;  4GOD A;  2OAR A;  2QJY C;  4UB6 H;  2KIK A;  1SQQ K;  3T97 A;  4GOF A;  4DT0 A;  1SQX D;  1VQM P;  2FYU E;  1M57 D;  1YQ4 C;  2AXC A;  3AEF C;  3CWB E;  1YJW P;  5KAF E;  2MJZ A;  4H44 D;  1NTK K;  4DCK A;  2A45 G;  3CX5 I;  5GTI E;  1OW6 A;  4WY4 D;  1VDF A;  1L0L K;  2C9N Y;  3TNU A;  1IK9 A;  1R8E A;  1GU4 A;  1EXI A;  3EWK A;  2PGD A;  3U1C A;  5CMZ A;  2FYU G;  3CWB G;  3HD7 B;  4N6J A;  3RK2 D;  2KUB A;  2P10 A;  2OYH C;  3AE2 C;  3M06 A;  4O9B A;  1ZOY C;  3FWL A;  2FYU D;  1Q86 Q;  4ZNC A;  2JO1 A;  1D7M A;  1NVO A;  1SQV D;  4WBA A;  2ZAE B;  4N78 E;  1ZR2 A;  2N1T D;  3WUT A;  2E75 D;  3HTK A;  1FZG A;  4BRY A;  4D6T D;  3TGU E;  1U7J A;  2R5D A;  1NU1 J;  3PLN A;  2KYV A;  3L72 E;  2OYI C;  4GDO A;  3Q1M A;  3AE1 C;  3BCC E;  2FXM A;  2N9Y B;  2WT7 A;  1KB9 I;  3L74 E;  2QSI A;  2GM4 A;  4PD4 D;  1KQG B;  2HPC B;  1OMI A;  1AV1 A;  5AW7 B;  1FDM A;  3TGU G;  3MGN A;  3L72 G;  4WY4 A;  2FY8 A;  3CXH I;  3L4F A;  3BCC G;  2Z5H A;  1S5L H;  3VP8 A;  4Y99 B;  3L74 G;  3TGU D;  3GHG B;  1RE4 C;  2KNC B;  4PJ0 E;  1JY2 N;  1KYO I;  1VQ5 P;  4PV1 B;  2C0X A;  1JY3 P;  4C7N B;  4U7J A;  1GD2 E;  1FDI A;  3VOP A;  2BAS A;  2K9J B;  1AVO A;  4C46 A;  3TSI A;  1CI6 B;  5BU8 B;  1NU1 K;  2YXQ B;  2B88 A;  5AW4 B;  4DOJ A;  4GT1 A;  4AQR D;  2C9L Y;  2YMY A;  3B5N C;  2H89 C;  2N1T A;  1QEX A;  1X8Y A;  5B66 E;  1LTJ C;  1VQL P;  2Y0D A;  1PGQ A;  3M91 A;  2BCC J;  3CCL P;  1GMJ A;  5C39 A;  1SQB J;  3RK3 C;  1LTG C;  3P8M C;  3EQ2 A;  4WVZ A;  3K5B A;  1U57 A;  2XND H;  3T97 B;  1FZC C;  5AW2 B;  2P58 A;  3VMA A;  2WSF J;  1W2E A;  4RES B;  1HGV A;  4GIF A;  4JQ0 D;  3N4X A;  3PH0 A;  5KLV J;  3EFF K;  3LW5 H;  3TNU B;  3L71 E;  3AEA C;  1VQ8 P;  2HFE D;  2JWA A;  1ZRT D;  3A3Y B;  3RL0 g;  1LTA C;  1K8A Q;  1SQB K;  1LT9 A;  3AE4 C;  1NTZ E;  3L71 G;  3H1J J;  1YYC A;  3ABV C;  1SFC C;  1BDD A;  3B8E B;  3H1L D;  1NTM J;  3SSU A;  2V4H A;  2POH A;  1PP9 J;  3SWY A;  3HTK B;  1HJB A;  1RF1 C;  3Q5R A;  1N7S C;  2E5T A;  3P7K A;  1JTH A;  3H1I D;  1NTZ G;  3I56 P;  5KLV K;  2WT7 B;  3P8C D;  1NYH A;  5APT A;  1K05 A;  2WSC H;  1NTZ D;  2K37 A;  1HJ0 A;  1HTL C;  3CC2 P;  1EZV I;  1GW4 A;  4H44 B;  1DH3 A;  1YHQ P;  1M1J C;  3SWF A;  2OYH A;  1P84 E;  1IFM A;  2E76 C;  4WY4 B;  3A2A A;  2VRS A;  1X9V A;  2HR3 A;  3AE5 C;  2JP3 A;  3B5N D;  1X22 A;  1JB0 J;  1NTM K;  3RK2 B;  2ZVN B;  2L91 A;  5GTI H;  2IBZ I;  3BRV B;  5GTH E;  2PRR A;  4IL6 X;  3E1R A;  2R5B A;  1ZXG A;  1T6A A;  1YJ9 P;  3L70 J;  2M5A A;  5CHX A;  3NXS A;  2OYI A;  1AQ5 A;  5CCG C;  3OW2 O;  1URQ A;  5KKZ C;  3RK3 D;  2N1T B;  3ITK A;  4JYC A;  1U7M A;  1IFJ A;  2E75 B;  2O01 N;  4OH8 B;  4BXL A;  2IFN A;  1JMM A;  2XDJ A;  4Y28 J;  2W6B A;  1KIL C; 
#chains in the Genus database with same CATH homology
 3FXD A;  3FXE A;  3MZW B;  1H0T A;  2ZAE B;  2UWJ E;  1SS1 A;  3S1K A;  1OVV A;  1DEE G;  4NPF X;  2SPZ A;  5C39 A;  1U7J A;  1EDL A;  4JBZ A;  4GOE A;  4CPG A;  1EDI A;  1LP1 B;  4ASW A;  5EFW B;  4WWI A;  2KZI A;  1Q2N A;  5CBO A;  4NPE A;  2P58 A;  1LP1 A;  2QVA A;  1OVR A;  5DJT B;  1EDJ A;  4HB1 A;  4GOD A;  2M0B A;  2QRX A;  2KIK A;  2KI7 B;  2LXB A;  4GOF A;  2HR3 A;  3RGU A;  4HJG H;  1JM0 A;  4K3A A;  3PH0 A;  4ASV A;  4K35 A;  2Q1K A;  5DJU B;  4HKZ H;  2JWD A;  2M5A B;  2LXC B;  4MN4 C;  2KZJ A;  3QWO C;  4ZMD A;  1ZXG A;  1MFT A;  2M5A A;  2K3R A;  1Y47 A;  1FC2 C;  3ZDM A;  4IOI H;  2R44 A;  4EYY Q;  2B89 A;  1EDK A;  2B88 A;  2OTK E;  5CBN A;  2KUB A;  2KS1 B;  1JMB A;  1U7M A;  2LR2 A;  1OVU A;  2B87 B;  3MHV A;  1S3J A;  4KJM A;  2WMM A;  1BDD A;  2I8D A;  5K5G B;  4BXL A;  1BDC A;  1H0T B;  1ZW0 A;  4ZNC A;  2RKL A;  1LT1 A;  4NPD A;  1X0T A;  1NVO A;  2B87 A;  1EC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...