2KZIA

Solution structure of the zher2 affibody
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
58
structure length
58
Chain Sequence
b'VDNKFNKEMRNAYWEIALLPNLNNQQKRAFIRSLYDDPSQSANLLAEAKKLNDAQAPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Engineered protein, ZHER2 Affibody
molecule tags Protein binding
source organism Staphylococcus aureus
publication title Structural basis for high-affinity HER2 receptor binding by an engineered protein.
pubmed doi rcsb
total genus 19
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2010-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2kziA00
1JM0A 1OVUA 4CPGA 2QVAA 2KZIA 1BDCA 2ZAEB 1SS1A 2SPZA 4ASVA 1Y47A 4K3AA 5C39A 5K5GB 2M5AA 4ASWA 2B87B 1LP1A 2R44A 1LT1A 4HB1A 2P58A 2WMMA 1OVRA 2KS1B 3PH0A 4IOIH 3MHVA 3RGUA 2M0BA 5DJUB 1MFTA 2OTKE 4GODA 3FXDA 1EDIA 2K3RA 3QWOC 4ZMDA 1Q2NA 2B88A 2UWJE 2KI7B 2M5AB 4K35A 1FC2C 4JBZA 1X0TA 1S3JA 4NPFX 2B89A 2LXCB 5CBNA 2LXBA 1H0TB 2KUBA 3ZDMA 2JWDA 3MZWB 1EC5A 3S1KA 2I8DA 4HKZH 1ZW0A 5DJTB 1H0TA 5CBOA 3FXEA 5EFWB 2RKLA 2HR3A 1LP1B 4GOEA 1ZXGA 1JMBA 1DEEG 4NPEA 1BDDA 2Q1KA 4KJMA 1U7MA 4BXLA 1EDLA 2QRXA 1NVOA 1U7JA 4ZNCA 2B87A 2LR2A 1EDKA 2KZJA 4EYYQ 1EDJA 4GOFA 1OVVA 4HJGH 4NPDA 2KIKA 4WWIA 4MN4C
chains in the Genus database with same CATH superfamily
5CCHD 5E79H 3CC7P 1AFOA 1SQXD 4D6TG 1KQLA 2IYPA 1LTJC 2QVAA 3TGUD 1S2EA 3SFDC 4H0LD 1G2CA 5KJ7D 3HD7B 2ZAEB 1SS1A 3PHLA 5AVXB 2Z5HA 3CXHH 4H13D 3M0DC 3RK2D 4D6TD 4I7ZB 1WT6A 5C39A 1LWUA 2FYUK 3GF7A 4BRYB 1KC8Q 5AW1B 3RK3B 1BCCD 5APVA 3TYYA 3V2NA 1CW5A 1J1DC 3L74D 3NXSA 2HODA 5GTHE 2FFDB 1JTHB 1KILA 2AEMA 1EQ7A 2E75B 2K9JA 4OGQC 3RL0C 1KORA 1SQBE 2E74D 1LP1A 1SQBG 2QE7H 3F5HA 5AW8B 3V4QA 5APWA 1NU1J 5B66E 1FZBA 1VQ9P 1OZHA 3HD7C 2P58A 1XTGB 3CX5I 4HB1A 4U3FG 4U3FJ 2WMMA 1IFJA 4IL6E 4RO0A 4AUWA 2A45H 5AVVB 1YBKA 2Q3EA 1M1JB 2YXRB 3H1KE 3JCUE 5KKZC 1M57D 3PH0A 1GW3A 4ZKPA 5CHXA 3CCQP 2BCCD 3L74E 1FZCB 1M90Q 4IL6X 3FWLA 5KLIC 2OTJP 1N7SA 3TSIA 1USEA 1T2KD 2B9BA 3E1RA 4N3YB 2YMYA 1KQSO 1SQQD 1Y9BA 2YXQB 1MFTA 1NKZB 1M1KQ 3GG2A 1URQC 1SQPG 4GODA 3RK2C 1VQPP 2KNCB 1D7MA 1P84H 2KS1A 1VF5C 3LW5J 3OAKA 4LGDE 3OW2O 2IBZE 1L0LJ 3GHGB 4ZMDA 1DIPA 1KD1Q 1Q2NA 2PP6A 3TNUA 3L70E 2OYIB 1P84D 2B88A 3H1LE 1FS0E 2Y0CA 1SQXJ 5AVTB 3RL0D 3A5TA 3H1JD 1SQPE 1RQVA 3C9IA 1SQXE 3KZIH 2E74C 3M0DA 3LW5H 2WZ7A 3A0BE 1DD3A 1KFNA 1MZ9A 4I6MC 1PGOA 3L73D 1FOSE 5CJ4A 3CCMP 4HH2A 1KYOH 2NPSB 1X0TA 3JC22 3M9QA 1X9VA 3M0AA 1LT9A 2Q6QA 2WSFH 3I5CA 1GW4A 1KILC 3IN6A 2P7JA 4W7YA 2Y9ZA 1JNMA 2N1TA 3BCCE 5CMZA 2LXCB 1DEBA 3H1HG 1YQ4C 3JCUH 1IC2A 3H1HE 3H1HD 2YKPA 3P8CE 2KUBA 3V2PA 1YI2P 2LKMA 1H88A 3MIWA 1SQPD 2O1KA 1BGYJ 5KJ7A 1VQNP 2P1JA 3S1KA 1YQ3C 5GTIH 1LT9C 2I8DA 1ZW0A 1VQ4P 1NHLA 1SLQA 1BE3E 3R2PA 1AVYA 2IBZD 1H0TA 1NAFA 1PP9E 2L91A 3JSVC 1YJNP 2FYZA 3L71G 3NFQA 5CBOA 2Z4EA 2FYUG 2E42A 2D2CC 1EZVI 4KT0J 3CCSP 1QGKB 1HF9A 3H1JE 2JR8A 1SQQJ 3USSA 1CI6A 3TF5A 1DEEG 1L0NG 5CCGC 1LTJB 1H8AA 3P32A 4PV1B 1NTMK 4BXLA 1USDA 2R5DA 1E79H 1JY2N 3HE4A 1FU1A 1NVOA 3MTUE 4OWFA 2XDJA 1KILD 1KILE 1N7SC 4WY4D 4IFDK 4JYCA 2V7QJ 3AE7C 4ZNCA 1Q90D 3N4XA 2H89C 1EDKA 3B4SA 2WSCJ 1VF5B 3RK3C 2QJKB 1XTCC 3V2RA 1SQQK 3L75E 1N7SD 1RE4A 2AEJA 2ZXXA 1OVVA 1CZQA 2QA4P 2P67A 2KIKA 4PD4H 3L37A 1LGHB 2AXTE 2E76B 1LTBC 4MN4C 2BEZF 2XKMA 4U3FD 2C0XA 3RL0B 3WMM0 3WUUA 1VF5D 1SFCB 2OYIC 4D6TE 3D70A 1G1IA 1M7LA 1YTZT 1HGZA 2QSIA 3II6A 3WUTA 1IK7A 3AECC 4I2LC 5KTBA 1MUUA 1S5LX 1SFCA 2K9YA 1WMKA 1IZNB 2KZIA 4YXDC 4WY4B 1P84I 1AV1A 2ITAA 1IO4A 3WU2H 4LC1A 3OJAB 4ASVA 2O01H 1HWTC 1GL2C 2WVRA 1Y47A 1GL2A 2WWWA 5BU8B 2N1TD 3SWYA 3CC4P 1HJ0A 2FYNB 1KB9E 2YMKA 2OYHC 1JO5A 2W90A 3T97B 2JDIH 1VQ7P 1TU3F 5L8RJ 3CCLP 2H43A 1PIXA 5CCGD 3FX0A 4I7ZC 1NKNA 3O6QB 1QEXA 1N73A 3FWNA 1P84E 2E5TA 4A7PA 2PRRA 4Z1MH 1LT1A 4PD4I 5H2FE 1S9KD 5CJ0A 4H44B 3B5NA 1KMIZ 1T6AA 2E76D 3M91A 2E75C 3SSUA 5KLVG 1IFMA 5KLVJ 2FFDC 2O3JA 3CCEP 1NU1D 2A06D 2ZFCA 3H1KG 1N2DC 1IFDA 1VPCA 3K5BA 3CCVP 3VP9A 2OYHB 4YXWH 2ZXEB 1KZUB 1NGMB 1FDMA 3E1IA 4RESB 4U3FE 1R5SA 1QVGO 1PP9D 2IYOA 4IOIH 3MHVA 2NPSD 1VQMP 1A02J 3BVHA 1KV4A 5DJUB 2O01J 3HD7D 3H1LG 3O6QA 1SQVJ 2WTYA 3H1LJ 5KAFE 1Q86Q 1AA0A 1VL2A 1HH0A 2K3RA 3AEEC 3T97A 4B86A 1T3UA 2KLVA 2YKOA 2OTLP 1A02F 1NJIQ 1OXZA 3A3YB 1L0LG 1OWAA 4M3LA 1BGYG 1NU1K 2E76C 2VRSA 3D71A 4IFMA 2WSSH 3M9BA 1RF1C 1RE3C 3CL3D 1DH3A 1RF1A 4DCKA 1QLED 2HODB 1NAYA 1QX8A 3WU2E 2XZRA 5BU5A 1GU4A 1KYOD 2Q3IA 5TJHA 1KB9I 4K35A 1Z56A 2H8PD 4JBZA 3GLMA 1YJWP 1X79B 3M9HA 2AEFA 3BASA 2GUSA 3L35A 1S3JA 3V5BA 4NPFX 1OW6A 3CMAP 1W5CE 1RE3A 1JY3N 1ZV8A 1SVFA 1LTAC 2WPQA 2NRGA 2YIUC 1BE3G 1ZMEC 3L71D 3V2QA 2FBWC 2QJYC 2LXBA 2ZT9B 1AVOA 5TISE 3CCUP 2JWDA 3CXHE 3VMAA 1SQBJ 4GT1A 1VQ8P 3CXHD 2AXTH 1M56D 3V6IA 2IFNA 1BSNA 1AQTA 1L0NE 2KK7A 4ZKUA 3CX5H 1HUCA 3B5NB 3A0HE 5KAFH 2KSEA 1BSHA 1JY3O 2KP8A 5GTHH 1Q7YQ 2FYUE 2W6BA 2C9LY 1SQVE 1FZGA 4GOEA 1S1CX 1ZLLA 3RK3D 1NU1G 2A06E 5KAIE 2Q1KA 5APYA 3D6YA 3RK2B 1HJBA 3G3ZA 3L73G 1EDLA 1OX3A 3AEGC 4IL6H 5AVSB 4N78D 3H6PA 4DT0A 3U1CA 3H1JG 1GL2B 3HUSA 3IF4A 3H1LD 2KB7P 2QIWA 3AEFC 3HUSB 1HGVA 3H1IE 1NO4A 2IPPA 3KPEA 2LR2A 3PRJA 3WUVA 2J59M 1PPJG 2IDBA 2XNDH 1KQFB 1J2JB 2KZJA 4EYYQ 2R3SA 3U59A 3GMAA 1KN7A 3P8MC 2FYNC 1NTMD 1YITP 2Q9IA 3BRTB 2I1KA 1JMMA 4NPDA 5AVYB 1X8YA 1IFNA 2WITA 2WPVB 3A7OA 3L4FA 3L74G 4UB8E 2ZVOB 1KTMA 3PTZA 2OARA 1HVVA 2BCCE 2P10A 4GDOA 3VP8A 5AVQB 4DJGA 2MKVA 2JEEA 1CSBA 1QL2A 1SP4A 2YO2A 2C0WA 1JM0A 1OVUA 2FXPA 2WPSA 3A2AA 4PJ0H 3SWKA 3A0HH 2QJPB 3UIAA 2OYHA 1W2BO 1UIXA 3PLNA 3CPWO 4PJ0E 3E7KA 1NTKK 1L0LE 2SPZA 4L75A 3BCCD 2M3EA 2V4HA 1KYOI 4W7ZA 1YJ9P 1YYCA 1K8AQ 1RH5B 1H89A 3GF3A 4K3AA 4AQRD 1N73B 3GHGA 5K5GB 1GTWA 1J1DB 1EZVD 4ASWA 3MD0A 3VTPC 1BCCE 1M8OB 1JY2P 2B87B 2NZ2A 3AE1C 4GIFA 1PL5A 1CI6B 3BATA 2P2UA 1NTME 1IFPA 2HYNA 1NTMG 2FXMA 3CWBE 5BVZA 3B5ND 4Y99C 3H1IJ 3Q2YA 1RF1B 1N7SB 1JY2O 2E5YA 3VN0A 1QVFO 1VQ6P 2NPSA 5APSA 1PPJE 1PPJD 2NPSC 1ZRTE 3MGNA 2WT7A 3B8EB 3PJSK 5KKZB 4XFJA 1ZR2A 2FYUJ 5CCGA 1LWUB 3W68A 2QJKC 1OFCX 1M1JA 2HFED 2IBZI 3L75G 1VQ5P 1URQD 1K73Q 3CMEP 1OMIA 4OGQD 2FY8A 3CD6P 3MUDA 3L72D 3HUSC 2IBZG 2YIUB 4JYBA 1FZCC 2CPBA 3RK3E 4R4MA 2M0BA 3B71A 1NTKJ 1LT9B 2K9JB 3AE9C 3AEDC 4UB8H 2WPRA 1GU5A 3CX5E 1Q81Q 2W8ZA 3S9OA 2XU6A 3CWBJ 3KZIE 5AVZB 3V4WA 1FJPA 1JUNA 3S4RA 1KFMA 3MUDC 1RE4C 3L70J 5AW6B 3L70G 4C7NA 5E79E 1EXIA 2KXPB 4D6TJ 4H0LC 4N6JA 1S9KE 1FZFA 5AVUB 1T3JA 3VOPA 3TNUB 1SQVD 1VDFA 1S5LE 2FYUD 2E75D 2ZVNB 1DD4A 2UWJE 2QJPC 2W27A 3HE4B 2KI7B 2M5AB 2Y0DA 3MP7B 1L2PA 1LTJA 3LIEA 1PV3A 3W67A 2JJLA 2R32A 2V7QH 2OGUA 2XV5A 3L70D 3RBXA 3EFFK 5GTIE 1ZOYC 3EWKA 1JTHA 1KILB 4XE5B 4GKGA 3H32B 4O9BA 5AW4B 1KYOE 5CBNA 2G3AA 1H0TB 1L4AB 1NOHA 2BEQD 1J1EC 1PGQA 5AW2B 3SWFA 2G8YA 3MZWB 1WRGA 4EDFA 3TGUE 4H44D 1EC5A 2GUVA 2YKQA 2K1AA 3CWBG 1FBMA 3HE5B 4H13C 1KB9H 4JPZB 1BGYD 2QJYB 2ZT9C 3H25A 1LJ2A 1PP9J 4WB4A 2H88C 1W2EA 2D2CB 5AW7B 1NTZD 2KYVA 2Q7CA 3HD7A 5M1BA 3N7NA 3GHGC 1JOCA 1N7LA 1RHZB 1LP1B 2ZYAA 3CCRP 1KQGB 4EOTA 4PV1C 1JMBA 5AW5B 2QEXP 2HLOA 2R5BA 3HTKB 5H2FH 2OQQA 1SQBK 1L4AC 3L72J 1J1EB 1U7MA 2BASA 1MV8A 1NTZK 1GK6A 1L4AD 2WSCH 3L73J 4Y28J 1BGYE 1FDIA 2PFXA 1SQPK 2MJZA 2ZYDA 1LTTC 1T8ZA 3H1KJ 1EXJA 4EI2A 1GL2D 1OW7A 1NTZJ 3QH9A 1ZRTD 5AVRB 5KLVE 1JEKA 2AXCA 2HG5D 1M1JC 1OW8A 2DW3A 1GZLA 3GW6A 3CC2P 2KNCA 1SFCD 3EQ2A 5KLVK 4DOJA 4GOFA 1JB0J 3L75D 4H44C 3A0BH 4L73A 4Y99B 1RQUA 3SFEC 4TT3H 3HRNA 1LTIC 4YTPC 2Y0EA 1Y8AA 2JKVA 3CLQA 3G9RA 3KDPB 1UIIA 4YPCA 3NMDA 4CPGA 3Q5PA 1S72P 3KXDA 1LWUC 1OIPA 1SQXG 1K04A 2N9BA 2PGDA 4PD4E 4N78E 1BDCA 1BE3J 1FAVA 3AE5C 2PAJA 3BRVB 5B5EE 1T2KC 2K37A 1BCCG 1FE6A 3CXHI 4JQ0D 1BCCJ 3D6ZA 3L75J 1L0NK 1PZQA 3OA7A 2N1TB 1KB9D 1NTKG 4OGQB 4QMAA 4LLHA 2RH0A 2KLUA 2QM8A 2WSEJ 2Y9YA 3BCCG 5CCHA 3BCCJ 2M5AA 2FFDA 4UB6E 4JF7A 3KQGA 4XA4A 3L73E 4AYCA 3H1HJ 4C7RA 1PFIA 1GD2E 1AQ5A 2M8RA 2WQYC 4BRYA 5TISH 5APXA 1N73C 3TGUG 1ZP0C 3TGUJ 1VQLP 1NTKD 5AW0B 1JCDA 1FJKA 2D2CD 3IAOA 2R44A 3LIDA 4KHXA 4C7NB 3Q1MA 3G71P 1Q82Q 2OYOA 3AE2C 2BCCJ 2IZ0A 2R3CA 2WSFJ 1G2CB 1RY3A 2KOGA 1OVRA 3AE6C 3H1ID 3L71J 4R4LA 1VQOP 2O1JA 3AE4C 1LTGC 2KS1B 1PGJA 4WBAA 1MFZA 1S5LH 2J58A 1K05A 1L0NJ 1ZN5A 5AW9B 1NWQA 3PP5A 4EIJA 1FDOA 3TK1A 3AE8C 3RGUA 3VYIA 5APQA 1VQKP 2JO1A 2YO3A 2Q5UA 3ABVC 3AEAC 3C8VA 3HE5A 3VMYA 2CK3H 2KSJA 2OTKE 1FZCA 2HPCA 1HTLC 5AW3B 2W6JH 1GDTA 3FXDA 1EDIA 1URQA 2IX7C 2JP3A 3L74J 3AEBC 3QWOC 3TDKA 1ZR4A 1RF0C 3H32A 2O01N 3U1AA 1GK4A 1BE3D 3G6EP 1PGPA 2N9YB 2XNXA 2W6AA 3CWBD 1NTKE 1S4XA 3IR9A 5B5EH 1G1JA 1N8RQ 1IK9A 1IFIA 3P8CD 5B66H 3G4SP 2OYIA 2H7HA 1FZEA 4C46A 1RF0A 1EZVE 1FC2C 3O8ZA 4L76A 1SQVK 5KJ7C 2YNYA 1L0ND 3CI9A 5AVWB 2ZJSE 1IJDB 4OVNF 2FKWB 2N1TC 1NH4A 1AJYA 1SQPJ 5KLIB 1L0LD 1NTZE 5CCHC 2B89A 2JWAA 1NTZG 4W80A 3Q5RA 1HBWA 1QL1A 1LTSC 3Q3DA 1X22A 2CPSA 4I1LA 3L71E 3ZDMA 4PD4D 2C9NY 1FZAA 3H1JJ 3CX5D 3HTKA 1NTMJ 4RJTA 2E43A 2Z5IA 2IZ1A 1YIJP 2GM4A 4HKZH 4WVZA 1EZVG 2IFMA 2QM7A 3KHUA 2E74B 1SQXK 1E5WA 1PP9G 4HYTB 5DJTB 1MKMA 3KYQA 5APUA 3RL0g 4DZOA 2L5GB 3L72E 3Q5SA 3FXEA 5EFWB 2W83C 2M3BA 2RKLA 2HR3A 3B5NC 1L0LK 3ITKA 5APTA 3VMXA 1ZXGA 1NYHA 2A06G 1K9MQ 3H1IG 1BDDA 3L36A 4NPEA 1LNQA 1L4AA 2RN0A 4KJMA 4U7JA 5KLVD 2WT7B 2I1JA 3FGAD 3L72G 1N86A 2A45G 1U57A 2QRXA 2RMZA 4WY4A 4H13B 2ZT9D 1SQVG 2ZYGA 3M06A 3C1LA 4WY4C 1YHQP 5KAIH 1U7JA 4H0LB 4OH8B 3I56P 1NU1E 1SQQE 2B87A 3AE3C 1JCCA 4BWNA 2GA1A 1FOSF 4PV1D 3F89A 4TLFA 2K88A 3I55P 1EDJA 1URQB 1GMJA 2A45I 4L74A 4RKUJ 3RBZA 1SQBD 2FXOA 3VMZA 1DX7A 1SFCC 4HJGH 3P7KA 3IFMA 3NTNA 2WSEH 3H1KD 2HPCB 4UB6H 1SQQG 4IFFA 4WWIA 1R8EA 3CCJP 2QG4A 2POHA 1R5LA 3EFGA 1JY3P 2BCCG 1YTZI 3R4YA 2J5UA
chains in the Genus database with same CATH topology
1JM0A 1OVUA 4CPGA 2QVAA 2KZIA 1BDCA 2ZAEB 1SS1A 2SPZA 4ASVA 1Y47A 4K3AA 5C39A 5K5GB 2M5AA 4ASWA 2B87B 1LP1A 2R44A 1LT1A 4HB1A 2P58A 2WMMA 1OVRA 2KS1B 3PH0A 4IOIH 3MHVA 3RGUA 2M0BA 5DJUB 1MFTA 2OTKE 4GODA 3FXDA 1EDIA 2K3RA 3QWOC 4ZMDA 1Q2NA 2B88A 2UWJE 2KI7B 2M5AB 4K35A 1FC2C 4JBZA 1X0TA 1S3JA 4NPFX 2B89A 2LXCB 5CBNA 2LXBA 1H0TB 2KUBA 3ZDMA 2JWDA 3MZWB 1EC5A 3S1KA 2I8DA 4HKZH 1ZW0A 5DJTB 1H0TA 5CBOA 3FXEA 5EFWB 2RKLA 2HR3A 1LP1B 4GOEA 1ZXGA 1JMBA 1DEEG 4NPEA 1BDDA 2Q1KA 4KJMA 1U7MA 4BXLA 1EDLA 2QRXA 1NVOA 1U7JA 4ZNCA 2B87A 2LR2A 1EDKA 2KZJA 4EYYQ 1EDJA 4GOFA 1OVVA 4HJGH 4NPDA 2KIKA 4WWIA 4MN4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JM0 A;  1OVU A;  4CPG A;  2QVA A;  2KZI A;  1BDC A;  2ZAE B;  1SS1 A;  2SPZ A;  4ASV A;  1Y47 A;  4K3A A;  5C39 A;  5K5G B;  2M5A A;  4ASW A;  2B87 B;  1LP1 A;  2R44 A;  1LT1 A;  4HB1 A;  2P58 A;  2WMM A;  1OVR A;  2KS1 B;  3PH0 A;  4IOI H;  3MHV A;  3RGU A;  2M0B A;  5DJU B;  1MFT A;  2OTK E;  4GOD A;  3FXD A;  1EDI A;  2K3R A;  3QWO C;  4ZMD A;  1Q2N A;  2B88 A;  2UWJ E;  2KI7 B;  2M5A B;  4K35 A;  1FC2 C;  4JBZ A;  1X0T A;  1S3J A;  4NPF X;  2B89 A;  2LXC B;  5CBN A;  2LXB A;  1H0T B;  2KUB A;  3ZDM A;  2JWD A;  3MZW B;  1EC5 A;  3S1K A;  2I8D A;  4HKZ H;  1ZW0 A;  5DJT B;  1H0T A;  5CBO A;  3FXE A;  5EFW B;  2RKL A;  2HR3 A;  1LP1 B;  4GOE A;  1ZXG A;  1JMB A;  1DEE G;  4NPE A;  1BDD A;  2Q1K A;  4KJM A;  1U7M A;  4BXL A;  1EDL A;  2QRX A;  1NVO A;  1U7J A;  4ZNC A;  2B87 A;  2LR2 A;  1EDK A;  2KZJ A;  4EYY Q;  1EDJ A;  4GOF A;  1OVV A;  4HJG H;  4NPD A;  2KIK A;  4WWI A;  4MN4 C; 
#chains in the Genus database with same CATH topology
 5CCH D;  5E79 H;  3CC7 P;  1AFO A;  1SQX D;  4D6T G;  1KQL A;  2IYP A;  1LTJ C;  2QVA A;  3TGU D;  1S2E A;  3SFD C;  4H0L D;  1G2C A;  5KJ7 D;  3HD7 B;  2ZAE B;  1SS1 A;  3PHL A;  5AVX B;  2Z5H A;  3CXH H;  4H13 D;  3M0D C;  3RK2 D;  4D6T D;  4I7Z B;  1WT6 A;  5C39 A;  1LWU A;  2FYU K;  3GF7 A;  4BRY B;  1KC8 Q;  5AW1 B;  3RK3 B;  1BCC D;  5APV A;  3TYY A;  3V2N A;  1CW5 A;  1J1D C;  3L74 D;  3NXS A;  2HOD A;  5GTH E;  2FFD B;  1JTH B;  1KIL A;  2AEM A;  1EQ7 A;  2E75 B;  2K9J A;  4OGQ C;  3RL0 C;  1KOR A;  1SQB E;  2E74 D;  1LP1 A;  1SQB G;  2QE7 H;  3F5H A;  5AW8 B;  3V4Q A;  5APW A;  1NU1 J;  5B66 E;  1FZB A;  1VQ9 P;  1OZH A;  3HD7 C;  2P58 A;  1XTG B;  3CX5 I;  4HB1 A;  4U3F G;  4U3F J;  2WMM A;  1IFJ A;  4IL6 E;  4RO0 A;  4AUW A;  2A45 H;  5AVV B;  1YBK A;  2Q3E A;  1M1J B;  2YXR B;  3H1K E;  3JCU E;  5KKZ C;  1M57 D;  3PH0 A;  1GW3 A;  4ZKP A;  5CHX A;  3CCQ P;  2BCC D;  3L74 E;  1FZC B;  1M90 Q;  4IL6 X;  3FWL A;  5KLI C;  2OTJ P;  1N7S A;  3TSI A;  1USE A;  1T2K D;  2B9B A;  3E1R A;  4N3Y B;  2YMY A;  1KQS O;  1SQQ D;  1Y9B A;  2YXQ B;  1MFT A;  1NKZ B;  1M1K Q;  3GG2 A;  1URQ C;  1SQP G;  4GOD A;  3RK2 C;  1VQP P;  2KNC B;  1D7M A;  1P84 H;  2KS1 A;  1VF5 C;  3LW5 J;  3OAK A;  4LGD E;  3OW2 O;  2IBZ E;  1L0L J;  3GHG B;  4ZMD A;  1DIP A;  1KD1 Q;  1Q2N A;  2PP6 A;  3TNU A;  3L70 E;  2OYI B;  1P84 D;  2B88 A;  3H1L E;  1FS0 E;  2Y0C A;  1SQX J;  5AVT B;  3RL0 D;  3A5T A;  3H1J D;  1SQP E;  1RQV A;  3C9I A;  1SQX E;  3KZI H;  2E74 C;  3M0D A;  3LW5 H;  2WZ7 A;  3A0B E;  1DD3 A;  1KFN A;  1MZ9 A;  4I6M C;  1PGO A;  3L73 D;  1FOS E;  5CJ4 A;  3CCM P;  4HH2 A;  1KYO H;  2NPS B;  1X0T A;  3JC2 2;  3M9Q A;  1X9V A;  3M0A A;  1LT9 A;  2Q6Q A;  2WSF H;  3I5C A;  1GW4 A;  1KIL C;  3IN6 A;  2P7J A;  4W7Y A;  2Y9Z A;  1JNM A;  2N1T A;  3BCC E;  5CMZ A;  2LXC B;  1DEB A;  3H1H G;  1YQ4 C;  3JCU H;  1IC2 A;  3H1H E;  3H1H D;  2YKP A;  3P8C E;  2KUB A;  3V2P A;  1YI2 P;  2LKM A;  1H88 A;  3MIW A;  1SQP D;  2O1K A;  1BGY J;  5KJ7 A;  1VQN P;  2P1J A;  3S1K A;  1YQ3 C;  5GTI H;  1LT9 C;  2I8D A;  1ZW0 A;  1VQ4 P;  1NHL A;  1SLQ A;  1BE3 E;  3R2P A;  1AVY A;  2IBZ D;  1H0T A;  1NAF A;  1PP9 E;  2L91 A;  3JSV C;  1YJN P;  2FYZ A;  3L71 G;  3NFQ A;  5CBO A;  2Z4E A;  2FYU G;  2E42 A;  2D2C C;  1EZV I;  4KT0 J;  3CCS P;  1QGK B;  1HF9 A;  3H1J E;  2JR8 A;  1SQQ J;  3USS A;  1CI6 A;  3TF5 A;  1DEE G;  1L0N G;  5CCG C;  1LTJ B;  1H8A A;  3P32 A;  4PV1 B;  1NTM K;  4BXL A;  1USD A;  2R5D A;  1E79 H;  1JY2 N;  3HE4 A;  1FU1 A;  1NVO A;  3MTU E;  4OWF A;  2XDJ A;  1KIL D;  1KIL E;  1N7S C;  4WY4 D;  4IFD K;  4JYC A;  2V7Q J;  3AE7 C;  4ZNC A;  1Q90 D;  3N4X A;  2H89 C;  1EDK A;  3B4S A;  2WSC J;  1VF5 B;  3RK3 C;  2QJK B;  1XTC C;  3V2R A;  1SQQ K;  3L75 E;  1N7S D;  1RE4 A;  2AEJ A;  2ZXX A;  1OVV A;  1CZQ A;  2QA4 P;  2P67 A;  2KIK A;  4PD4 H;  3L37 A;  1LGH B;  2AXT E;  2E76 B;  1LTB C;  4MN4 C;  2BEZ F;  2XKM A;  4U3F D;  2C0X A;  3RL0 B;  3WMM 0;  3WUU A;  1VF5 D;  1SFC B;  2OYI C;  4D6T E;  3D70 A;  1G1I A;  1M7L A;  1YTZ T;  1HGZ A;  2QSI A;  3II6 A;  3WUT A;  1IK7 A;  3AEC C;  4I2L C;  5KTB A;  1MUU A;  1S5L X;  1SFC A;  2K9Y A;  1WMK A;  1IZN B;  2KZI A;  4YXD C;  4WY4 B;  1P84 I;  1AV1 A;  2ITA A;  1IO4 A;  3WU2 H;  4LC1 A;  3OJA B;  4ASV A;  2O01 H;  1HWT C;  1GL2 C;  2WVR A;  1Y47 A;  1GL2 A;  2WWW A;  5BU8 B;  2N1T D;  3SWY A;  3CC4 P;  1HJ0 A;  2FYN B;  1KB9 E;  2YMK A;  2OYH C;  1JO5 A;  2W90 A;  3T97 B;  2JDI H;  1VQ7 P;  1TU3 F;  5L8R J;  3CCL P;  2H43 A;  1PIX A;  5CCG D;  3FX0 A;  4I7Z C;  1NKN A;  3O6Q B;  1QEX A;  1N73 A;  3FWN A;  1P84 E;  2E5T A;  4A7P A;  2PRR A;  4Z1M H;  1LT1 A;  4PD4 I;  5H2F E;  1S9K D;  5CJ0 A;  4H44 B;  3B5N A;  1KMI Z;  1T6A A;  2E76 D;  3M91 A;  2E75 C;  3SSU A;  5KLV G;  1IFM A;  5KLV J;  2FFD C;  2O3J A;  3CCE P;  1NU1 D;  2A06 D;  2ZFC A;  3H1K G;  1N2D C;  1IFD A;  1VPC A;  3K5B A;  3CCV P;  3VP9 A;  2OYH B;  4YXW H;  2ZXE B;  1KZU B;  1NGM B;  1FDM A;  3E1I A;  4RES B;  4U3F E;  1R5S A;  1QVG O;  1PP9 D;  2IYO A;  4IOI H;  3MHV A;  2NPS D;  1VQM P;  1A02 J;  3BVH A;  1KV4 A;  5DJU B;  2O01 J;  3HD7 D;  3H1L G;  3O6Q A;  1SQV J;  2WTY A;  3H1L J;  5KAF E;  1Q86 Q;  1AA0 A;  1VL2 A;  1HH0 A;  2K3R A;  3AEE C;  3T97 A;  4B86 A;  1T3U A;  2KLV A;  2YKO A;  2OTL P;  1A02 F;  1NJI Q;  1OXZ A;  3A3Y B;  1L0L G;  1OWA A;  4M3L A;  1BGY G;  1NU1 K;  2E76 C;  2VRS A;  3D71 A;  4IFM A;  2WSS H;  3M9B A;  1RF1 C;  1RE3 C;  3CL3 D;  1DH3 A;  1RF1 A;  4DCK A;  1QLE D;  2HOD B;  1NAY A;  1QX8 A;  3WU2 E;  2XZR A;  5BU5 A;  1GU4 A;  1KYO D;  2Q3I A;  5TJH A;  1KB9 I;  4K35 A;  1Z56 A;  2H8P D;  4JBZ A;  3GLM A;  1YJW P;  1X79 B;  3M9H A;  2AEF A;  3BAS A;  2GUS A;  3L35 A;  1S3J A;  3V5B A;  4NPF X;  1OW6 A;  3CMA P;  1W5C E;  1RE3 A;  1JY3 N;  1ZV8 A;  1SVF A;  1LTA C;  2WPQ A;  2NRG A;  2YIU C;  1BE3 G;  1ZME C;  3L71 D;  3V2Q A;  2FBW C;  2QJY C;  2LXB A;  2ZT9 B;  1AVO A;  5TIS E;  3CCU P;  2JWD A;  3CXH E;  3VMA A;  1SQB J;  4GT1 A;  1VQ8 P;  3CXH D;  2AXT H;  1M56 D;  3V6I A;  2IFN A;  1BSN A;  1AQT A;  1L0N E;  2KK7 A;  4ZKU A;  3CX5 H;  1HUC A;  3B5N B;  3A0H E;  5KAF H;  2KSE A;  1BSH A;  1JY3 O;  2KP8 A;  5GTH H;  1Q7Y Q;  2FYU E;  2W6B A;  2C9L Y;  1SQV E;  1FZG A;  4GOE A;  1S1C X;  1ZLL A;  3RK3 D;  1NU1 G;  2A06 E;  5KAI E;  2Q1K A;  5APY A;  3D6Y A;  3RK2 B;  1HJB A;  3G3Z A;  3L73 G;  1EDL A;  1OX3 A;  3AEG C;  4IL6 H;  5AVS B;  4N78 D;  3H6P A;  4DT0 A;  3U1C A;  3H1J G;  1GL2 B;  3HUS A;  3IF4 A;  3H1L D;  2KB7 P;  2QIW A;  3AEF C;  3HUS B;  1HGV A;  3H1I E;  1NO4 A;  2IPP A;  3KPE A;  2LR2 A;  3PRJ A;  3WUV A;  2J59 M;  1PPJ G;  2IDB A;  2XND H;  1KQF B;  1J2J B;  2KZJ A;  4EYY Q;  2R3S A;  3U59 A;  3GMA A;  1KN7 A;  3P8M C;  2FYN C;  1NTM D;  1YIT P;  2Q9I A;  3BRT B;  2I1K A;  1JMM A;  4NPD A;  5AVY B;  1X8Y A;  1IFN A;  2WIT A;  2WPV B;  3A7O A;  3L4F A;  3L74 G;  4UB8 E;  2ZVO B;  1KTM A;  3PTZ A;  2OAR A;  1HVV A;  2BCC E;  2P10 A;  4GDO A;  3VP8 A;  5AVQ B;  4DJG A;  2MKV A;  2JEE A;  1CSB A;  1QL2 A;  1SP4 A;  2YO2 A;  2C0W A;  1JM0 A;  1OVU A;  2FXP A;  2WPS A;  3A2A A;  4PJ0 H;  3SWK A;  3A0H H;  2QJP B;  3UIA A;  2OYH A;  1W2B O;  1UIX A;  3PLN A;  3CPW O;  4PJ0 E;  3E7K A;  1NTK K;  1L0L E;  2SPZ A;  4L75 A;  3BCC D;  2M3E A;  2V4H A;  1KYO I;  4W7Z A;  1YJ9 P;  1YYC A;  1K8A Q;  1RH5 B;  1H89 A;  3GF3 A;  4K3A A;  4AQR D;  1N73 B;  3GHG A;  5K5G B;  1GTW A;  1J1D B;  1EZV D;  4ASW A;  3MD0 A;  3VTP C;  1BCC E;  1M8O B;  1JY2 P;  2B87 B;  2NZ2 A;  3AE1 C;  4GIF A;  1PL5 A;  1CI6 B;  3BAT A;  2P2U A;  1NTM E;  1IFP A;  2HYN A;  1NTM G;  2FXM A;  3CWB E;  5BVZ A;  3B5N D;  4Y99 C;  3H1I J;  3Q2Y A;  1RF1 B;  1N7S B;  1JY2 O;  2E5Y A;  3VN0 A;  1QVF O;  1VQ6 P;  2NPS A;  5APS A;  1PPJ E;  1PPJ D;  2NPS C;  1ZRT E;  3MGN A;  2WT7 A;  3B8E B;  3PJS K;  5KKZ B;  4XFJ A;  1ZR2 A;  2FYU J;  5CCG A;  1LWU B;  3W68 A;  2QJK C;  1OFC X;  1M1J A;  2HFE D;  2IBZ I;  3L75 G;  1VQ5 P;  1URQ D;  1K73 Q;  3CME P;  1OMI A;  4OGQ D;  2FY8 A;  3CD6 P;  3MUD A;  3L72 D;  3HUS C;  2IBZ G;  2YIU B;  4JYB A;  1FZC C;  2CPB A;  3RK3 E;  4R4M A;  2M0B A;  3B71 A;  1NTK J;  1LT9 B;  2K9J B;  3AE9 C;  3AED C;  4UB8 H;  2WPR A;  1GU5 A;  3CX5 E;  1Q81 Q;  2W8Z A;  3S9O A;  2XU6 A;  3CWB J;  3KZI E;  5AVZ B;  3V4W A;  1FJP A;  1JUN A;  3S4R A;  1KFM A;  3MUD C;  1RE4 C;  3L70 J;  5AW6 B;  3L70 G;  4C7N A;  5E79 E;  1EXI A;  2KXP B;  4D6T J;  4H0L C;  4N6J A;  1S9K E;  1FZF A;  5AVU B;  1T3J A;  3VOP A;  3TNU B;  1SQV D;  1VDF A;  1S5L E;  2FYU D;  2E75 D;  2ZVN B;  1DD4 A;  2UWJ E;  2QJP C;  2W27 A;  3HE4 B;  2KI7 B;  2M5A B;  2Y0D A;  3MP7 B;  1L2P A;  1LTJ A;  3LIE A;  1PV3 A;  3W67 A;  2JJL A;  2R32 A;  2V7Q H;  2OGU A;  2XV5 A;  3L70 D;  3RBX A;  3EFF K;  5GTI E;  1ZOY C;  3EWK A;  1JTH A;  1KIL B;  4XE5 B;  4GKG A;  3H32 B;  4O9B A;  5AW4 B;  1KYO E;  5CBN A;  2G3A A;  1H0T B;  1L4A B;  1NOH A;  2BEQ D;  1J1E C;  1PGQ A;  5AW2 B;  3SWF A;  2G8Y A;  3MZW B;  1WRG A;  4EDF A;  3TGU E;  4H44 D;  1EC5 A;  2GUV A;  2YKQ A;  2K1A A;  3CWB G;  1FBM A;  3HE5 B;  4H13 C;  1KB9 H;  4JPZ B;  1BGY D;  2QJY B;  2ZT9 C;  3H25 A;  1LJ2 A;  1PP9 J;  4WB4 A;  2H88 C;  1W2E A;  2D2C B;  5AW7 B;  1NTZ D;  2KYV A;  2Q7C A;  3HD7 A;  5M1B A;  3N7N A;  3GHG C;  1JOC A;  1N7L A;  1RHZ B;  1LP1 B;  2ZYA A;  3CCR P;  1KQG B;  4EOT A;  4PV1 C;  1JMB A;  5AW5 B;  2QEX P;  2HLO A;  2R5B A;  3HTK B;  5H2F H;  2OQQ A;  1SQB K;  1L4A C;  3L72 J;  1J1E B;  1U7M A;  2BAS A;  1MV8 A;  1NTZ K;  1GK6 A;  1L4A D;  2WSC H;  3L73 J;  4Y28 J;  1BGY E;  1FDI A;  2PFX A;  1SQP K;  2MJZ A;  2ZYD A;  1LTT C;  1T8Z A;  3H1K J;  1EXJ A;  4EI2 A;  1GL2 D;  1OW7 A;  1NTZ J;  3QH9 A;  1ZRT D;  5AVR B;  5KLV E;  1JEK A;  2AXC A;  2HG5 D;  1M1J C;  1OW8 A;  2DW3 A;  1GZL A;  3GW6 A;  3CC2 P;  2KNC A;  1SFC D;  3EQ2 A;  5KLV K;  4DOJ A;  4GOF A;  1JB0 J;  3L75 D;  4H44 C;  3A0B H;  4L73 A;  4Y99 B;  1RQU A;  3SFE C;  4TT3 H;  3HRN A;  1LTI C;  4YTP C;  2Y0E A;  1Y8A A;  2JKV A;  3CLQ A;  3G9R A;  3KDP B;  1UII A;  4YPC A;  3NMD A;  4CPG A;  3Q5P A;  1S72 P;  3KXD A;  1LWU C;  1OIP A;  1SQX G;  1K04 A;  2N9B A;  2PGD A;  4PD4 E;  4N78 E;  1BDC A;  1BE3 J;  1FAV A;  3AE5 C;  2PAJ A;  3BRV B;  5B5E E;  1T2K C;  2K37 A;  1BCC G;  1FE6 A;  3CXH I;  4JQ0 D;  1BCC J;  3D6Z A;  3L75 J;  1L0N K;  1PZQ A;  3OA7 A;  2N1T B;  1KB9 D;  1NTK G;  4OGQ B;  4QMA A;  4LLH A;  2RH0 A;  2KLU A;  2QM8 A;  2WSE J;  2Y9Y A;  3BCC G;  5CCH A;  3BCC J;  2M5A A;  2FFD A;  4UB6 E;  4JF7 A;  3KQG A;  4XA4 A;  3L73 E;  4AYC A;  3H1H J;  4C7R A;  1PFI A;  1GD2 E;  1AQ5 A;  2M8R A;  2WQY C;  4BRY A;  5TIS H;  5APX A;  1N73 C;  3TGU G;  1ZP0 C;  3TGU J;  1VQL P;  1NTK D;  5AW0 B;  1JCD A;  1FJK A;  2D2C D;  3IAO A;  2R44 A;  3LID A;  4KHX A;  4C7N B;  3Q1M A;  3G71 P;  1Q82 Q;  2OYO A;  3AE2 C;  2BCC J;  2IZ0 A;  2R3C A;  2WSF J;  1G2C B;  1RY3 A;  2KOG A;  1OVR A;  3AE6 C;  3H1I D;  3L71 J;  4R4L A;  1VQO P;  2O1J A;  3AE4 C;  1LTG C;  2KS1 B;  1PGJ A;  4WBA A;  1MFZ A;  1S5L H;  2J58 A;  1K05 A;  1L0N J;  1ZN5 A;  5AW9 B;  1NWQ A;  3PP5 A;  4EIJ A;  1FDO A;  3TK1 A;  3AE8 C;  3RGU A;  3VYI A;  5APQ A;  1VQK P;  2JO1 A;  2YO3 A;  2Q5U A;  3ABV C;  3AEA C;  3C8V A;  3HE5 A;  3VMY A;  2CK3 H;  2KSJ A;  2OTK E;  1FZC A;  2HPC A;  1HTL C;  5AW3 B;  2W6J H;  1GDT A;  3FXD A;  1EDI A;  1URQ A;  2IX7 C;  2JP3 A;  3L74 J;  3AEB C;  3QWO C;  3TDK A;  1ZR4 A;  1RF0 C;  3H32 A;  2O01 N;  3U1A A;  1GK4 A;  1BE3 D;  3G6E P;  1PGP A;  2N9Y B;  2XNX A;  2W6A A;  3CWB D;  1NTK E;  1S4X A;  3IR9 A;  5B5E H;  1G1J A;  1N8R Q;  1IK9 A;  1IFI A;  3P8C D;  5B66 H;  3G4S P;  2OYI A;  2H7H A;  1FZE A;  4C46 A;  1RF0 A;  1EZV E;  1FC2 C;  3O8Z A;  4L76 A;  1SQV K;  5KJ7 C;  2YNY A;  1L0N D;  3CI9 A;  5AVW B;  2ZJS E;  1IJD B;  4OVN F;  2FKW B;  2N1T C;  1NH4 A;  1AJY A;  1SQP J;  5KLI B;  1L0L D;  1NTZ E;  5CCH C;  2B89 A;  2JWA A;  1NTZ G;  4W80 A;  3Q5R A;  1HBW A;  1QL1 A;  1LTS C;  3Q3D A;  1X22 A;  2CPS A;  4I1L A;  3L71 E;  3ZDM A;  4PD4 D;  2C9N Y;  1FZA A;  3H1J J;  3CX5 D;  3HTK A;  1NTM J;  4RJT A;  2E43 A;  2Z5I A;  2IZ1 A;  1YIJ P;  2GM4 A;  4HKZ H;  4WVZ A;  1EZV G;  2IFM A;  2QM7 A;  3KHU A;  2E74 B;  1SQX K;  1E5W A;  1PP9 G;  4HYT B;  5DJT B;  1MKM A;  3KYQ A;  5APU A;  3RL0 g;  4DZO A;  2L5G B;  3L72 E;  3Q5S A;  3FXE A;  5EFW B;  2W83 C;  2M3B A;  2RKL A;  2HR3 A;  3B5N C;  1L0L K;  3ITK A;  5APT A;  3VMX A;  1ZXG A;  1NYH A;  2A06 G;  1K9M Q;  3H1I G;  1BDD A;  3L36 A;  4NPE A;  1LNQ A;  1L4A A;  2RN0 A;  4KJM A;  4U7J A;  5KLV D;  2WT7 B;  2I1J A;  3FGA D;  3L72 G;  1N86 A;  2A45 G;  1U57 A;  2QRX A;  2RMZ A;  4WY4 A;  4H13 B;  2ZT9 D;  1SQV G;  2ZYG A;  3M06 A;  3C1L A;  4WY4 C;  1YHQ P;  5KAI H;  1U7J A;  4H0L B;  4OH8 B;  3I56 P;  1NU1 E;  1SQQ E;  2B87 A;  3AE3 C;  1JCC A;  4BWN A;  2GA1 A;  1FOS F;  4PV1 D;  3F89 A;  4TLF A;  2K88 A;  3I55 P;  1EDJ A;  1URQ B;  1GMJ A;  2A45 I;  4L74 A;  4RKU J;  3RBZ A;  1SQB D;  2FXO A;  3VMZ A;  1DX7 A;  1SFC C;  4HJG H;  3P7K A;  3IFM A;  3NTN A;  2WSE H;  3H1K D;  2HPC B;  4UB6 H;  1SQQ G;  4IFF A;  4WWI A;  1R8E A;  3CCJ P;  2QG4 A;  2POH A;  1R5L A;  3EFG A;  1JY3 P;  2BCC G;  1YTZ I;  3R4Y A;  2J5U A; 
#chains in the Genus database with same CATH homology
 1JM0 A;  1OVU A;  4CPG A;  2QVA A;  2KZI A;  1BDC A;  2ZAE B;  1SS1 A;  2SPZ A;  4ASV A;  1Y47 A;  4K3A A;  5C39 A;  5K5G B;  2M5A A;  4ASW A;  2B87 B;  1LP1 A;  2R44 A;  1LT1 A;  4HB1 A;  2P58 A;  2WMM A;  1OVR A;  2KS1 B;  3PH0 A;  4IOI H;  3MHV A;  3RGU A;  2M0B A;  5DJU B;  1MFT A;  2OTK E;  4GOD A;  3FXD A;  1EDI A;  2K3R A;  3QWO C;  4ZMD A;  1Q2N A;  2B88 A;  2UWJ E;  2KI7 B;  2M5A B;  4K35 A;  1FC2 C;  4JBZ A;  1X0T A;  1S3J A;  4NPF X;  2B89 A;  2LXC B;  5CBN A;  2LXB A;  1H0T B;  2KUB A;  3ZDM A;  2JWD A;  3MZW B;  1EC5 A;  3S1K A;  2I8D A;  4HKZ H;  1ZW0 A;  5DJT B;  1H0T A;  5CBO A;  3FXE A;  5EFW B;  2RKL A;  2HR3 A;  1LP1 B;  4GOE A;  1ZXG A;  1JMB A;  1DEE G;  4NPE A;  1BDD A;  2Q1K A;  4KJM A;  1U7M A;  4BXL A;  1EDL A;  2QRX A;  1NVO A;  1U7J A;  4ZNC A;  2B87 A;  2LR2 A;  1EDK A;  2KZJ A;  4EYY Q;  1EDJ A;  4GOF A;  1OVV A;  4HJG H;  4NPD A;  2KIK A;  4WWI A;  4MN4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...