2KZIA

Solution structure of the zher2 affibody
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
58
structure length
58
Chain Sequence
b'VDNKFNKEMRNAYWEIALLPNLNNQQKRAFIRSLYDDPSQSANLLAEAKKLNDAQAPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Engineered protein, ZHER2 Affibody
publication title Structural basis for high-affinity HER2 receptor binding by an engineered protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 19
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2010-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2kziA00
1H0TB 2KIKA 2QRXA 2RKLA 1MFTA 4GOFA 5CBNA 2M5AA 2LXBA 1Y47A 1LT1A 2KZIA 5CBOA 2KS1B 3PH0A 2LR2A 2Q1KA 4JBZA 5K5GB 2B87B 1NVOA 4KJMA 4NPFX 1OVUA 1SS1A 1U7MA 2M0BA 4K35A 5DJTB 4HKZH 3FXDA 4ZNCA 1ZW0A 1S3JA 1JMBA 1LP1A 4GOEA 5EFWB 4K3AA 4NPEA 1ZXGA 2HR3A 4CPGA 2OTKE 1H0TA 3MZWB 4EYYQ 4BXLA 1Q2NA 1OVVA 2KUBA 2B88A 1EDKA 2KI7B 1EDJA 4MN4C 2JWDA 1EC5A 2P58A 1X0TA 4WWIA 4ASWA 3FXEA 1OVRA 4GODA 2R44A 1FC2C 2UWJE 2B87A 2M5AB 2KZJA 2LXCB 1BDDA 2I8DA 2ZAEB 3S1KA 5DJUB 2K3RA 2SPZA 3QWOC 2QVAA 1EDLA 4IOIH 1EDIA 4HJGH 4ZMDA 5C39A 3MHVA 1JM0A 2WMMA 3ZDMA 1U7JA 2B89A 4NPDA 1DEEG 3RGUA 4HB1A 1BDCA 4ASVA 1LP1B
chains in the Genus database with same CATH superfamily
1SQQK 3AEBC 2FYNB 3VOPA 2QM7A 3CXHH 1YJWP 2FXMA 2C9LY 4GKGA 3IFMA 3KXDA 2E74D 3PH0A 1NU1J 1DX7A 1K73Q 1SVFA 2Q3EA 1BCCJ 3CMEP 1URQD 3L70J 1J1DC 2P67A 1SQVD 2FFDC 3HTKA 1VF5D 2IPPA 1ZRTD 3RK3E 1KYOE 2V7QJ 2FYUD 4HYTB 2IX7C 1T3UA 2JWDA 2GA1A 5KTBA 2ZT9B 1FZAA 3WUUA 2FFDA 3AE1C 4WWIA 3HUSA 3L74D 1R8EA 1P84D 1NTZD 1T3JA 4IFDK 3SWYA 1GU4A 2YKOA 1NHLA 2SPZA 1DIPA 3BASA 1IK9A 2KSEA 2C0WA 3M9HA 3TGUD 3L73G 3KHUA 3H1LE 4H44D 3V2PA 4GIFA 3M0AA 3TF5A 4OGQB 2O01N 5KLIB 1RHZB 3HD7B 3G71P 2O3JA 2YO2A 3VMXA 3CX5H 2K1AA 3Q5RA 1LTJC 2N1TD 2H43A 1N73C 1SFCB 1IFPA 4EI2A 1L4AD 3FWLA 3G9RA 1KQLA 5B5EE 4HH2A 1SQPJ 2KS1B 2NPSC 3M06A 3VMAA 3II6A 2ZYGA 1CZQA 1Y9BA 1S72P 1SQVE 3CWBJ 5KJ7C 1U7MA 5DJTB 1LTJA 3R2PA 1PIXA 1N73A 1BGYE 1PPJG 1ZW0A 4CPGA 1FBMA 1AA0A 2CPSA 2NPSA 2IBZG 5KAIE 1DD3A 4LC1A 1L0ND 1AJYA 2XNXA 3L74E 1P84E 1IFIA 1NTZE 5KJ7A 5BU5A 1RE4A 2OYHC 1NU1G 1T2KC 3LIDA 1KYOH 3TNUB 2E76D 3L70G 1K04A 3TGUE 2QJYB 2Q3IA 3I5CA 4D6TE 1BE3J 1NTMJ 1GD2E 2OYHA 3C9IA 1GW3A 1GZLA 1SQXJ 3GF7A 4I6MC 1PP9E 1BDCA 2Q7CA 4L76A 1JY2N 1M1JB 2WPVB 5KAFE 1VQ9P 4C7RA 2YIUC 4DT0A 3H1ID 4OH8B 1LTBC 3CCRP 3LW5J 3P8CD 2Y0CA 3H1HD 1RF1B 1Q81Q 3T97A 1Y47A 3H1JJ 3RL0g 2P7JA 3RK2D 1LWUA 2XU6A 5B5EH 4JPZB 1N7SA 1OVUA 1AV1A 5CCGD 1LNQA 5EFWB 1KQSO 4NPEA 1JNMA 1L0NE 4EOTA 3HUSB 1CW5A 1HH0A 1VL2A 2QG4A 4H0LB 1OVVA 1BSHA 1XTGB 1M56D 1EDKA 5KAIH 3U59A 3GLMA 3CWBG 1P84H 1IZNB 3JCUE 2MJZA 3G4SP 2KZJA 3S1KA 2ZXXA 3H1KD 3G3ZA 1IJDB 2IYOA 2FYUJ 4Y99B 1VPCA 2E75D 1WRGA 1YTZT 5AVXB 1LGHB 3MHVA 1JM0A 1KN7A 1FOSE 3GG2A 4I1LA 1DEEG 1W2BO 3O8ZA 1HWTC 1Y8AA 1A02J 1S4XA 1PFIA 4PV1C 2WVRA 1KQFB 4H13C 1LTTC 4AUWA 4U7JA 1ZR4A 1GL2C 1EZVD 3P8CE 2KXPB 3TGUJ 1PPJD 1USDA 4N3YB 2YMYA 4XFJA 5KAFH 3A3YB 2IBZD 1BE3G 2ITAA 3Q3DA 1D7MA 1PGJA 1FDOA 1GL2A 1AVYA 2B87B 5AVTB 3R4YA 1BCCD 4WY4D 1NO4A 1JMBA 3AE2C 3WUTA 3MTUE 3L73E 3L4FA 2I1KA 3AE4C 1PL5A 3AEAC 2QA4P 1N7LA 4L73A 2O1KA 1KILB 5CHXA 2WPSA 3H1JG 3GHGB 1ZOYC 1FZCB 2P58A 1JB0J 2XZRA 2Z5HA 4ASWA 2R5DA 3EWKA 3H1KE 3KYQA 2AEJA 1BDDA 2ZAEB 3G6EP 3I55P 3UIAA 4IL6X 2YNYA 2ZT9C 3QWOC 1IFNA 1NAFA 3B8EB 2B9BA 1U7JA 1CI6B 3S9OA 1SQVG 1EZVE 1FS0E 1PPJE 1HGZA 3AE6C 5AVRB 1ZP0C 1JTHB 3PLNA 3E7KA 2IBZE 2E5TA 3EFGA 3SWKA 3U1AA 4GOFA 1KFMA 2FYUG 2A45I 3A7OA 4OGQC 4YXWH 1NU1E 5GTHE 1LT1A 1W5CE 2BASA 3L74G 1RQVA 1NTZG 2GM4A 1SQPD 1BCCE 3A0BE 4DZOA 1VF5B 4PD4I 2K9JB 2VRSA 3L70E 4NPFX 2O01J 2IFMA 1NH4A 3JC22 3H1IJ 1NU1K 1SFCC 5TJHA 3H1HJ 5AW4B 3CCEP 2HODB 3HE5B 3TGUG 1ZXGA 3HD7A 3CC4P 2FXOA 1IO4A 2WZ7A 2OYIB 1SFCA 1EC5A 3L75D 5APSA 2H8PD 2QJKC 2KS1A 1FU1A 1T6AA 2G8YA 5BU8B 2WSCJ 1J2JB 4XA4A 1RF0A 1FJPA 3BRVB 1NTMD 2QM8A 3ZDMA 2NPSD 1KORA 1SQXD 1NTKJ 3RGUA 2D2CB 1K05A 5KJ7D 1H0TB 1L4AB 1FZGA 4JF7A 2QRXA 2ZYDA 3TNUA 1IK7A 3AE8C 2RN0A 3KQGA 4I2LC 1SQPE 3CCVP 2KB7P 2M3BA 2IZ0A 3CWBE 1J1EB 1T2KD 5GTHH 1ZV8A 3L72J 1RF1C 1SS1A 3D6ZA 2KNCB 3A0BH 5TISE 4ZNCA 1M1JA 4K3AA 4EIJA 3CL3D 2OTKE 3OAKA 1MV8A 1H8AA 5AVUB 1QEXA 2Q5UA 4EYYQ 3W67A 2JEEA 1G2CB 3CXHI 4LGDE 1RF1A 2E76B 5AVZB 1LTGC 2V7QH 1OVRA 1WMKA 3HUSC 2IZ1A 2QEXP 2ZFCA 3H1IG 4R4LA 3H1HG 5CJ0A 1BE3E 1NTME 1Z56A 5DJUB 3WUVA 1YITP 1S5LE 1YBKA 1USEA 2JP3A 1QVGO 1SQXE 2GUSA 3P8MC 3V2NA 1SQBD 2R3CA 3FX0A 5KKZB 1GW4A 1KB9D 3V2QA 2Y0EA 4O9BA 1JY3O 2XV5A 3C1LA 3RK2B 5CBNA 3H1JE 3CPWO 5AW5B 5APTA 2G3AA 2WITA 4EDFA 3V5BA 5K5GB 1VQLP 1NTKG 1EXJA 1VQKP 3Q2YA 3F5HA 2JO1A 3H1KG 5AW1B 1MUUA 1DD4A 3U1CA 2H7HA 3NTNA 1GTWA 3OW2O 5TISH 1L0LJ 1VQ4P 1LJ2A 3AEEC 5AVWB 2KI7B 3OA7A 4YPCA 1RE4C 3CMAP 1EZVG 2BEQD 4KT0J 4PV1D 3A5TA 1SQQJ 2WT7B 3L72G 1ZRTE 2KK7A 4H13D 5APVA 1OXZA 2W83C 2E75B 1SQVK 1GL2D 1VQMP 1KILC 2B87A 2LXCB 2FYUE 1X79B 3VTPC 1FZEA 3GHGC 1FZCC 3BATA 2P10A 1EDIA 3L75J 1YHQP 2QJPC 5APUA 2FYUK 1QLED 1X9VA 1S5LH 1N86A 2Z4EA 1BCCG 1EXIA 1SQBE 1KILA 3S4RA 1NTZK 3OJAB 1LP1B 5APXA 2M3EA 2RH0A 1Q7YQ 3GHGA 3PP5A 2K9YA 1FZCA 1KB9E 3MGNA 4C46A 3JSVC 2RKLA 3H25A 1KTMA 1H88A 4Z1MH 2QSIA 4RO0A 4RESB 1GK6A 1JY2O 3AE9C 2XNDH 3USSA 1LWUC 1AQ5A 1IC2A 1JOCA 1YQ3C 1N7SC 1CI6A 2M0BA 2W6AA 4U3FD 1FZBA 2XKMA 3M9QA 4KHXA 4W7YA 4RJTA 3MZWB 2ZT9D 1JTHA 3EQ2A 3RBZA 3RL0C 3MIWA 4L74A 2YXQB 1EDJA 3AEGC 3M91A 5CCHA 1PGQA 1YJNP 5AW8B 5B66E 2K9JA 2OYIC 3CLQA 3SSUA 1OW8A 2QVAA 2ZVOB 2HODA 3MUDA 1L0LG 1JY3P 1SQPG 3HE5A 4OGQD 1L0NK 4NPDA 1JCCA 1J1DB 2BCCJ 4JYBA 2OARA 1NTKD 3QH9A 1TU3F 2OYIA 3L71J 1SFCD 3O6QB 1JMMA 2M8RA 2WTYA 1KB9H 2CPBA 1WT6A 2D2CC 3L75G 1LTSC 2KZIA 2W90A 5CBOA 3Q1MA 2WSSH 3B5NB 2LR2A 1SQBJ 4I7ZC 3H1IE 4U3FE 3H1HE 3L72D 3CCQP 3CD6P 5AVVB 2FKWB 2I1JA 1NTMG 1S1CX 3CC2P 1H0TA 1L4AA 1FOSF 1YQ4C 1SQXG 3D6YA 2FYNC 4TT3H 2J58A 5BVZA 3L37A 2R44A 2OQQA 3VMZA 3RK3B 2UWJE 3ITKA 1KZUB 2FBWC 2K3RA 1VQ6P 1VQ5P 2KNCA 5B66H 3M0DC 3W68A 5KLVD 2C9NY 2V4HA 3CXHD 2WQYC 1NTKE 1OX3A 2XDJA 5CJ4A 2DW3A 1G2CA 1VQNP 1ZN5A 3WMM0 1M57D 1SP4A 3M0DA 3JCUH 2WSEJ 2JDIH 2RMZA 2AXTE 1HJ0A 1IFMA 1XTCC 1HUCA 3H32B 3A2AA 3L72E 3V2RA 5KKZC 1LTAC 2W6BA 4KJMA 5M1BA 1JO5A 3K5BA 4TLFA 3L71G 2O01H 2E74B 4W80A 1Q90D 1YIJP 4H0LD 2HLOA 1RH5B 4GOEA 1UIXA 5KLIC 3HD7C 1NGMB 2Y0DA 2N9YB 1URQB 2L5GB 1L0LD 4WB4A 3TK1A 2B88A 3H6PA 4U3FJ 1SQBG 2ZXEB 3FXEA 3V6IA 2R3SA 5CCGA 1SQQD 1RQUA 3EFFK 1RF0C 2WSCH 3NFQA 3P7KA 3CXHE 4HJGH 2PRRA 4ZMDA 2Z5IA 4DOJA 3NXSA 4B86A 1FZFA 5AVQB 3GF3A 4DJGA 1JCDA 4ASVA 3CCLP 5APWA 1LT9B 3CC7P 3TDKA 3RBXA 1S2EA 2R5BA 2ZYAA 4H44B 2WT7A 3M9BA 3I56P 2YXRB 4N78D 2QIWA 3D70A 2QJYC 2QE7H 1NKNA 4JYCA 3VMYA 2N1TB 3IN6A 2Q1KA 4JBZA 1NVOA 3BRTB 2IDBA 1KILD 3CCMP 1LP1A 1L0LE 3LIEA 1M1JC 3IR9A 2JWAA 1PZQA 1QL1A 1Q2NA 4PV1B 1PGOA 1E79H 2KUBA 2OTLP 1PGPA 1Q86Q 1SQPK 1VDFA 1SQQE 4GODA 4BWNA 3B4SA 2R32A 1FC2C 1S5LX 2M5AB 3WU2E 3ABVC 3L75E 2E42A 4OVNF 2KYVA 3KDPB 4IOIH 3VN0A 2Q9IA 2WSFJ 2L91A 1SLQA 4WBAA 1HJBA 3HE4B 2BCCD 4U3FG 2ZVNB 2W8ZA 3PHLA 1OFCX 4H0LC 1NOHA 1IFJA 1N7SD 2HPCB 3L71D 5CCHD 2JR8A 1EQ7A 1QVFO 5KLVJ 2KIKA 2A45G 4N78E 1MFTA 1DH3A 2C0XA 1X8YA 3RL0D 1NTMK 2AXCA 2E5YA 5AW7B 3VP9A 2WPQA 1BGYD 1SQXK 4Y99C 1QGKB 2Q6QA 1KILE 3FWNA 4BRYB 4XE5B 1S3JA 5E79E 3B5NC 2KLUA 1FJKA 2WPRA 3O6QA 1ZR2A 3IF4A 4LLHA 5GTIE 4RKUJ 3V4QA 2JKVA 1MZ9A 1U57A 4C7NB 5AW6B 4MN4C 3MD0A 4D6TD 1S9KD 1M90Q 3N7NA 3SWFA 5APQA 1JY3N 1N8RQ 3B5NA 1G1JA 1HVVA 4M3LA 3CX5I 4AQRD 1YI2P 2HG5D 1VQ8P 2I8DA 1PP9D 3BCCJ 1KQGB 4PJ0E 2J5UA 2D2CD 5AW9B 2BCCE 3RK3C 3WU2H 2B89A 1VQ7P 1E5WA 1HTLC 3L71E 5CMZA 3L35A 3TSIA 1ZLLA 1OIPA 1N2DC 1VQOP 1OWAA 3FGAD 2HFED 1AVOA 1NKZB 3PTZA 2PGDA 3AECC 2QJKB 5H2FE 1PV3A 1KYOI 3BVHA 1K9MQ 3KZIE 3CI9A 1SQBK 3IAOA 4K35A 4L75A 3FXDA 1GDTA 4JQ0D 1HGVA 3LW5H 5KLVG 3AEDC 2LKMA 2Y9YA 4WY4B 5E79H 2FYZA 1A02F 1S9KE 1MFZA 2E74C 5AW3B 2H88C 4ZKUA 2OYOA 5GTIH 1YJ9P 5CCHC 3H32A 3AE7C 1URQC 2FY8A 2AEMA 3HRNA 3AEFC 1VF5C 1YYCA 3N4XA 1X22A 1NJIQ 1JEKA 3MUDC 2KLVA 2WMMA 3D71A 4PJ0H 4PD4D 1URQA 5AVYB 5L8RJ 3H1LJ 4A7PA 2AEFA 3HTKB 3Q5SA 1R5LA 1OW6A 1FE6A 1M8OB 1K8AQ 2A06G 1LTIC 2KOGA 3BCCG 3HD7D 1VQPP 1QL2A 1FDIA 1Q82Q 2LXBA 1AQTA 1LT9C 2FFDB 2NRGA 2H89C 1GU5A 2Y9ZA 1DEBA 4H44C 3L73D 1NAYA 1SQQG 5H2FH 1P84I 3KPEA 3MP7B 1SQVJ 4HKZH 1W2EA 3KZIH 1LT9A 1OW7A 1BGYJ 2N1TC 2K37A 2OTJP 1L4AC 1KB9I 1KMIZ 4WVZA 3L74J 1NTZJ 4UB8E 2IFNA 4AYCA 2N1TA 1J1EC 4GDOA 4OWFA 4PD4E 2HYNA 4D6TJ 1LTJB 2K88A 1FAVA 3A0HE 1N73B 1PP9J 1NU1D 2YMKA 2E76C 2NPSB 1FDMA 3B71A 1HBWA 2JJLA 3L70D 2WSEH 2M5AA 1JY2P 2WWWA 2GUVA 2E43A 4N6JA 1MKMA 1YTZI 2YKPA 3H1LG 3C8VA 1NTKK 4UB6E 3HE4A 1AFOA 1OZHA 2OYHB 2QJPB 4Y28J 2HPCA 1L0NJ 1QX8A 4BXLA 2YO3A 2BCCG 3GMAA 1GMJA 3RK2C 5AW2B 1CSBA 1RE3C 3V4WA 4YTPC 5CCGC 1KD1Q 4UB8H 3VYIA 2A06D 3T97B 3L36A 1R5SA 1BGYG 2A45H 3NMDA 3BCCD 3PRJA 4BRYA 1LWUB 1EDLA 4ZKPA 1KC8Q 1RE3A 5C39A 2YIUB 4IL6E 4IFFA 1T8ZA 2CK3H 1N7SB 4PD4H 2J59M 2O1JA 3E1IA 1IFDA 1OMIA 2YKQA 1G1IA 2KSJA 2W27A 4C7NA 5AW0B 3RL0B 5KLVE 2PAJA 2PP6A 2W6JH 3A0HH 3CX5D 3CWBD 3B5ND 4QMAA 1NYHA 2E75C 3SFEC 1ZMEC 5KLVK 4D6TG 1M7LA 2IYPA 5APYA 3AE3C 4R4MA 2OGUA 2P2UA 1GK4A 2FXPA 3SFDC 1PP9G 2NZ2A 3TYYA 3PJSK 4UB6H 3VP8A 2N9BA 3E1RA 2HR3A 4GT1A 2AXTH 3P32A 3L73J 2BEZF 3CCSP 3CCUP 3RK3D 3Q5PA 1HF9A 1BE3D 1UIIA 1NWQA 1H89A 1KYOD 1X0TA 4DCKA 1KV4A 1M1KQ 5AVSB 1L2PA 2POHA 4WY4C 2A06E 4W7ZA 1KFNA 1BSNA 1EZVI 3BCCE 3H1KJ 4IFMA 3AE5C 2PFXA 2IBZI 4H13B 4I7ZB 1L0LK 1JUNA 1GL2B 1L0NG 2ZJSE 2MKVA 4WY4A 3F89A 2WSFH 1RY3A 3GW6A 4HB1A 2P1JA 4IL6H 3H1JD 4YXDC 3H1LD 3CCJP 2KP8A 3CX5E
chains in the Genus database with same CATH topology
1H0TB 2KIKA 2QRXA 2RKLA 1MFTA 4GOFA 5CBNA 2M5AA 2LXBA 1Y47A 1LT1A 2KZIA 5CBOA 2KS1B 3PH0A 2LR2A 2Q1KA 4JBZA 5K5GB 2B87B 1NVOA 4KJMA 4NPFX 1OVUA 1SS1A 1U7MA 2M0BA 4K35A 5DJTB 4HKZH 3FXDA 4ZNCA 1ZW0A 1S3JA 1JMBA 1LP1A 4GOEA 5EFWB 4K3AA 4NPEA 1ZXGA 2HR3A 4CPGA 2OTKE 1H0TA 3MZWB 4EYYQ 4BXLA 1Q2NA 1OVVA 2KUBA 2B88A 1EDKA 2KI7B 1EDJA 4MN4C 2JWDA 1EC5A 2P58A 1X0TA 4WWIA 4ASWA 3FXEA 1OVRA 4GODA 2R44A 1FC2C 2UWJE 2B87A 2M5AB 2KZJA 2LXCB 1BDDA 2I8DA 2ZAEB 3S1KA 5DJUB 2K3RA 2SPZA 3QWOC 2QVAA 1EDLA 4IOIH 1EDIA 4HJGH 4ZMDA 5C39A 3MHVA 1JM0A 2WMMA 3ZDMA 1U7JA 2B89A 4NPDA 1DEEG 3RGUA 4HB1A 1BDCA 4ASVA 1LP1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0T B;  2KIK A;  2QRX A;  2RKL A;  1MFT A;  4GOF A;  5CBN A;  2M5A A;  2LXB A;  1Y47 A;  1LT1 A;  2KZI A;  5CBO A;  2KS1 B;  3PH0 A;  2LR2 A;  2Q1K A;  4JBZ A;  5K5G B;  2B87 B;  1NVO A;  4KJM A;  4NPF X;  1OVU A;  1SS1 A;  1U7M A;  2M0B A;  4K35 A;  5DJT B;  4HKZ H;  3FXD A;  4ZNC A;  1ZW0 A;  1S3J A;  1JMB A;  1LP1 A;  4GOE A;  5EFW B;  4K3A A;  4NPE A;  1ZXG A;  2HR3 A;  4CPG A;  2OTK E;  1H0T A;  3MZW B;  4EYY Q;  4BXL A;  1Q2N A;  1OVV A;  2KUB A;  2B88 A;  1EDK A;  2KI7 B;  1EDJ A;  4MN4 C;  2JWD A;  1EC5 A;  2P58 A;  1X0T A;  4WWI A;  4ASW A;  3FXE A;  1OVR A;  4GOD A;  2R44 A;  1FC2 C;  2UWJ E;  2B87 A;  2M5A B;  2KZJ A;  2LXC B;  1BDD A;  2I8D A;  2ZAE B;  3S1K A;  5DJU B;  2K3R A;  2SPZ A;  3QWO C;  2QVA A;  1EDL A;  4IOI H;  1EDI A;  4HJG H;  4ZMD A;  5C39 A;  3MHV A;  1JM0 A;  2WMM A;  3ZDM A;  1U7J A;  2B89 A;  4NPD A;  1DEE G;  3RGU A;  4HB1 A;  1BDC A;  4ASV A;  1LP1 B; 
#chains in the Genus database with same CATH topology
 1SQQ K;  3AEB C;  2FYN B;  3VOP A;  2QM7 A;  3CXH H;  1YJW P;  2FXM A;  2C9L Y;  4GKG A;  3IFM A;  3KXD A;  2E74 D;  3PH0 A;  1NU1 J;  1DX7 A;  1K73 Q;  1SVF A;  2Q3E A;  1BCC J;  3CME P;  1URQ D;  3L70 J;  1J1D C;  2P67 A;  1SQV D;  2FFD C;  3HTK A;  1VF5 D;  2IPP A;  1ZRT D;  3RK3 E;  1KYO E;  2V7Q J;  2FYU D;  4HYT B;  2IX7 C;  1T3U A;  2JWD A;  2GA1 A;  5KTB A;  2ZT9 B;  1FZA A;  3WUU A;  2FFD A;  3AE1 C;  4WWI A;  3HUS A;  3L74 D;  1R8E A;  1P84 D;  1NTZ D;  1T3J A;  4IFD K;  3SWY A;  1GU4 A;  2YKO A;  1NHL A;  2SPZ A;  1DIP A;  3BAS A;  1IK9 A;  2KSE A;  2C0W A;  3M9H A;  3TGU D;  3L73 G;  3KHU A;  3H1L E;  4H44 D;  3V2P A;  4GIF A;  3M0A A;  3TF5 A;  4OGQ B;  2O01 N;  5KLI B;  1RHZ B;  3HD7 B;  3G71 P;  2O3J A;  2YO2 A;  3VMX A;  3CX5 H;  2K1A A;  3Q5R A;  1LTJ C;  2N1T D;  2H43 A;  1N73 C;  1SFC B;  1IFP A;  4EI2 A;  1L4A D;  3FWL A;  3G9R A;  1KQL A;  5B5E E;  4HH2 A;  1SQP J;  2KS1 B;  2NPS C;  3M06 A;  3VMA A;  3II6 A;  2ZYG A;  1CZQ A;  1Y9B A;  1S72 P;  1SQV E;  3CWB J;  5KJ7 C;  1U7M A;  5DJT B;  1LTJ A;  3R2P A;  1PIX A;  1N73 A;  1BGY E;  1PPJ G;  1ZW0 A;  4CPG A;  1FBM A;  1AA0 A;  2CPS A;  2NPS A;  2IBZ G;  5KAI E;  1DD3 A;  4LC1 A;  1L0N D;  1AJY A;  2XNX A;  3L74 E;  1P84 E;  1IFI A;  1NTZ E;  5KJ7 A;  5BU5 A;  1RE4 A;  2OYH C;  1NU1 G;  1T2K C;  3LID A;  1KYO H;  3TNU B;  2E76 D;  3L70 G;  1K04 A;  3TGU E;  2QJY B;  2Q3I A;  3I5C A;  4D6T E;  1BE3 J;  1NTM J;  1GD2 E;  2OYH A;  3C9I A;  1GW3 A;  1GZL A;  1SQX J;  3GF7 A;  4I6M C;  1PP9 E;  1BDC A;  2Q7C A;  4L76 A;  1JY2 N;  1M1J B;  2WPV B;  5KAF E;  1VQ9 P;  4C7R A;  2YIU C;  4DT0 A;  3H1I D;  4OH8 B;  1LTB C;  3CCR P;  3LW5 J;  3P8C D;  2Y0C A;  3H1H D;  1RF1 B;  1Q81 Q;  3T97 A;  1Y47 A;  3H1J J;  3RL0 g;  2P7J A;  3RK2 D;  1LWU A;  2XU6 A;  5B5E H;  4JPZ B;  1N7S A;  1OVU A;  1AV1 A;  5CCG D;  1LNQ A;  5EFW B;  1KQS O;  4NPE A;  1JNM A;  1L0N E;  4EOT A;  3HUS B;  1CW5 A;  1HH0 A;  1VL2 A;  2QG4 A;  4H0L B;  1OVV A;  1BSH A;  1XTG B;  1M56 D;  1EDK A;  5KAI H;  3U59 A;  3GLM A;  3CWB G;  1P84 H;  1IZN B;  3JCU E;  2MJZ A;  3G4S P;  2KZJ A;  3S1K A;  2ZXX A;  3H1K D;  3G3Z A;  1IJD B;  2IYO A;  2FYU J;  4Y99 B;  1VPC A;  2E75 D;  1WRG A;  1YTZ T;  5AVX B;  1LGH B;  3MHV A;  1JM0 A;  1KN7 A;  1FOS E;  3GG2 A;  4I1L A;  1DEE G;  1W2B O;  3O8Z A;  1HWT C;  1Y8A A;  1A02 J;  1S4X A;  1PFI A;  4PV1 C;  2WVR A;  1KQF B;  4H13 C;  1LTT C;  4AUW A;  4U7J A;  1ZR4 A;  1GL2 C;  1EZV D;  3P8C E;  2KXP B;  3TGU J;  1PPJ D;  1USD A;  4N3Y B;  2YMY A;  4XFJ A;  5KAF H;  3A3Y B;  2IBZ D;  1BE3 G;  2ITA A;  3Q3D A;  1D7M A;  1PGJ A;  1FDO A;  1GL2 A;  1AVY A;  2B87 B;  5AVT B;  3R4Y A;  1BCC D;  4WY4 D;  1NO4 A;  1JMB A;  3AE2 C;  3WUT A;  3MTU E;  3L73 E;  3L4F A;  2I1K A;  3AE4 C;  1PL5 A;  3AEA C;  2QA4 P;  1N7L A;  4L73 A;  2O1K A;  1KIL B;  5CHX A;  2WPS A;  3H1J G;  3GHG B;  1ZOY C;  1FZC B;  2P58 A;  1JB0 J;  2XZR A;  2Z5H A;  4ASW A;  2R5D A;  3EWK A;  3H1K E;  3KYQ A;  2AEJ A;  1BDD A;  2ZAE B;  3G6E P;  3I55 P;  3UIA A;  4IL6 X;  2YNY A;  2ZT9 C;  3QWO C;  1IFN A;  1NAF A;  3B8E B;  2B9B A;  1U7J A;  1CI6 B;  3S9O A;  1SQV G;  1EZV E;  1FS0 E;  1PPJ E;  1HGZ A;  3AE6 C;  5AVR B;  1ZP0 C;  1JTH B;  3PLN A;  3E7K A;  2IBZ E;  2E5T A;  3EFG A;  3SWK A;  3U1A A;  4GOF A;  1KFM A;  2FYU G;  2A45 I;  3A7O A;  4OGQ C;  4YXW H;  1NU1 E;  5GTH E;  1LT1 A;  1W5C E;  2BAS A;  3L74 G;  1RQV A;  1NTZ G;  2GM4 A;  1SQP D;  1BCC E;  3A0B E;  4DZO A;  1VF5 B;  4PD4 I;  2K9J B;  2VRS A;  3L70 E;  4NPF X;  2O01 J;  2IFM A;  1NH4 A;  3JC2 2;  3H1I J;  1NU1 K;  1SFC C;  5TJH A;  3H1H J;  5AW4 B;  3CCE P;  2HOD B;  3HE5 B;  3TGU G;  1ZXG A;  3HD7 A;  3CC4 P;  2FXO A;  1IO4 A;  2WZ7 A;  2OYI B;  1SFC A;  1EC5 A;  3L75 D;  5APS A;  2H8P D;  2QJK C;  2KS1 A;  1FU1 A;  1T6A A;  2G8Y A;  5BU8 B;  2WSC J;  1J2J B;  4XA4 A;  1RF0 A;  1FJP A;  3BRV B;  1NTM D;  2QM8 A;  3ZDM A;  2NPS D;  1KOR A;  1SQX D;  1NTK J;  3RGU A;  2D2C B;  1K05 A;  5KJ7 D;  1H0T B;  1L4A B;  1FZG A;  4JF7 A;  2QRX A;  2ZYD A;  3TNU A;  1IK7 A;  3AE8 C;  2RN0 A;  3KQG A;  4I2L C;  1SQP E;  3CCV P;  2KB7 P;  2M3B A;  2IZ0 A;  3CWB E;  1J1E B;  1T2K D;  5GTH H;  1ZV8 A;  3L72 J;  1RF1 C;  1SS1 A;  3D6Z A;  2KNC B;  3A0B H;  5TIS E;  4ZNC A;  1M1J A;  4K3A A;  4EIJ A;  3CL3 D;  2OTK E;  3OAK A;  1MV8 A;  1H8A A;  5AVU B;  1QEX A;  2Q5U A;  4EYY Q;  3W67 A;  2JEE A;  1G2C B;  3CXH I;  4LGD E;  1RF1 A;  2E76 B;  5AVZ B;  1LTG C;  2V7Q H;  1OVR A;  1WMK A;  3HUS C;  2IZ1 A;  2QEX P;  2ZFC A;  3H1I G;  4R4L A;  3H1H G;  5CJ0 A;  1BE3 E;  1NTM E;  1Z56 A;  5DJU B;  3WUV A;  1YIT P;  1S5L E;  1YBK A;  1USE A;  2JP3 A;  1QVG O;  1SQX E;  2GUS A;  3P8M C;  3V2N A;  1SQB D;  2R3C A;  3FX0 A;  5KKZ B;  1GW4 A;  1KB9 D;  3V2Q A;  2Y0E A;  4O9B A;  1JY3 O;  2XV5 A;  3C1L A;  3RK2 B;  5CBN A;  3H1J E;  3CPW O;  5AW5 B;  5APT A;  2G3A A;  2WIT A;  4EDF A;  3V5B A;  5K5G B;  1VQL P;  1NTK G;  1EXJ A;  1VQK P;  3Q2Y A;  3F5H A;  2JO1 A;  3H1K G;  5AW1 B;  1MUU A;  1DD4 A;  3U1C A;  2H7H A;  3NTN A;  1GTW A;  3OW2 O;  5TIS H;  1L0L J;  1VQ4 P;  1LJ2 A;  3AEE C;  5AVW B;  2KI7 B;  3OA7 A;  4YPC A;  1RE4 C;  3CMA P;  1EZV G;  2BEQ D;  4KT0 J;  4PV1 D;  3A5T A;  1SQQ J;  2WT7 B;  3L72 G;  1ZRT E;  2KK7 A;  4H13 D;  5APV A;  1OXZ A;  2W83 C;  2E75 B;  1SQV K;  1GL2 D;  1VQM P;  1KIL C;  2B87 A;  2LXC B;  2FYU E;  1X79 B;  3VTP C;  1FZE A;  3GHG C;  1FZC C;  3BAT A;  2P10 A;  1EDI A;  3L75 J;  1YHQ P;  2QJP C;  5APU A;  2FYU K;  1QLE D;  1X9V A;  1S5L H;  1N86 A;  2Z4E A;  1BCC G;  1EXI A;  1SQB E;  1KIL A;  3S4R A;  1NTZ K;  3OJA B;  1LP1 B;  5APX A;  2M3E A;  2RH0 A;  1Q7Y Q;  3GHG A;  3PP5 A;  2K9Y A;  1FZC A;  1KB9 E;  3MGN A;  4C46 A;  3JSV C;  2RKL A;  3H25 A;  1KTM A;  1H88 A;  4Z1M H;  2QSI A;  4RO0 A;  4RES B;  1GK6 A;  1JY2 O;  3AE9 C;  2XND H;  3USS A;  1LWU C;  1AQ5 A;  1IC2 A;  1JOC A;  1YQ3 C;  1N7S C;  1CI6 A;  2M0B A;  2W6A A;  4U3F D;  1FZB A;  2XKM A;  3M9Q A;  4KHX A;  4W7Y A;  4RJT A;  3MZW B;  2ZT9 D;  1JTH A;  3EQ2 A;  3RBZ A;  3RL0 C;  3MIW A;  4L74 A;  2YXQ B;  1EDJ A;  3AEG C;  3M91 A;  5CCH A;  1PGQ A;  1YJN P;  5AW8 B;  5B66 E;  2K9J A;  2OYI C;  3CLQ A;  3SSU A;  1OW8 A;  2QVA A;  2ZVO B;  2HOD A;  3MUD A;  1L0L G;  1JY3 P;  1SQP G;  3HE5 A;  4OGQ D;  1L0N K;  4NPD A;  1JCC A;  1J1D B;  2BCC J;  4JYB A;  2OAR A;  1NTK D;  3QH9 A;  1TU3 F;  2OYI A;  3L71 J;  1SFC D;  3O6Q B;  1JMM A;  2M8R A;  2WTY A;  1KB9 H;  2CPB A;  1WT6 A;  2D2C C;  3L75 G;  1LTS C;  2KZI A;  2W90 A;  5CBO A;  3Q1M A;  2WSS H;  3B5N B;  2LR2 A;  1SQB J;  4I7Z C;  3H1I E;  4U3F E;  3H1H E;  3L72 D;  3CCQ P;  3CD6 P;  5AVV B;  2FKW B;  2I1J A;  1NTM G;  1S1C X;  3CC2 P;  1H0T A;  1L4A A;  1FOS F;  1YQ4 C;  1SQX G;  3D6Y A;  2FYN C;  4TT3 H;  2J58 A;  5BVZ A;  3L37 A;  2R44 A;  2OQQ A;  3VMZ A;  3RK3 B;  2UWJ E;  3ITK A;  1KZU B;  2FBW C;  2K3R A;  1VQ6 P;  1VQ5 P;  2KNC A;  5B66 H;  3M0D C;  3W68 A;  5KLV D;  2C9N Y;  2V4H A;  3CXH D;  2WQY C;  1NTK E;  1OX3 A;  2XDJ A;  5CJ4 A;  2DW3 A;  1G2C A;  1VQN P;  1ZN5 A;  3WMM 0;  1M57 D;  1SP4 A;  3M0D A;  3JCU H;  2WSE J;  2JDI H;  2RMZ A;  2AXT E;  1HJ0 A;  1IFM A;  1XTC C;  1HUC A;  3H32 B;  3A2A A;  3L72 E;  3V2R A;  5KKZ C;  1LTA C;  2W6B A;  4KJM A;  5M1B A;  1JO5 A;  3K5B A;  4TLF A;  3L71 G;  2O01 H;  2E74 B;  4W80 A;  1Q90 D;  1YIJ P;  4H0L D;  2HLO A;  1RH5 B;  4GOE A;  1UIX A;  5KLI C;  3HD7 C;  1NGM B;  2Y0D A;  2N9Y B;  1URQ B;  2L5G B;  1L0L D;  4WB4 A;  3TK1 A;  2B88 A;  3H6P A;  4U3F J;  1SQB G;  2ZXE B;  3FXE A;  3V6I A;  2R3S A;  5CCG A;  1SQQ D;  1RQU A;  3EFF K;  1RF0 C;  2WSC H;  3NFQ A;  3P7K A;  3CXH E;  4HJG H;  2PRR A;  4ZMD A;  2Z5I A;  4DOJ A;  3NXS A;  4B86 A;  1FZF A;  5AVQ B;  3GF3 A;  4DJG A;  1JCD A;  4ASV A;  3CCL P;  5APW A;  1LT9 B;  3CC7 P;  3TDK A;  3RBX A;  1S2E A;  2R5B A;  2ZYA A;  4H44 B;  2WT7 A;  3M9B A;  3I56 P;  2YXR B;  4N78 D;  2QIW A;  3D70 A;  2QJY C;  2QE7 H;  1NKN A;  4JYC A;  3VMY A;  2N1T B;  3IN6 A;  2Q1K A;  4JBZ A;  1NVO A;  3BRT B;  2IDB A;  1KIL D;  3CCM P;  1LP1 A;  1L0L E;  3LIE A;  1M1J C;  3IR9 A;  2JWA A;  1PZQ A;  1QL1 A;  1Q2N A;  4PV1 B;  1PGO A;  1E79 H;  2KUB A;  2OTL P;  1PGP A;  1Q86 Q;  1SQP K;  1VDF A;  1SQQ E;  4GOD A;  4BWN A;  3B4S A;  2R32 A;  1FC2 C;  1S5L X;  2M5A B;  3WU2 E;  3ABV C;  3L75 E;  2E42 A;  4OVN F;  2KYV A;  3KDP B;  4IOI H;  3VN0 A;  2Q9I A;  2WSF J;  2L91 A;  1SLQ A;  4WBA A;  1HJB A;  3HE4 B;  2BCC D;  4U3F G;  2ZVN B;  2W8Z A;  3PHL A;  1OFC X;  4H0L C;  1NOH A;  1IFJ A;  1N7S D;  2HPC B;  3L71 D;  5CCH D;  2JR8 A;  1EQ7 A;  1QVF O;  5KLV J;  2KIK A;  2A45 G;  4N78 E;  1MFT A;  1DH3 A;  2C0X A;  1X8Y A;  3RL0 D;  1NTM K;  2AXC A;  2E5Y A;  5AW7 B;  3VP9 A;  2WPQ A;  1BGY D;  1SQX K;  4Y99 C;  1QGK B;  2Q6Q A;  1KIL E;  3FWN A;  4BRY B;  4XE5 B;  1S3J A;  5E79 E;  3B5N C;  2KLU A;  1FJK A;  2WPR A;  3O6Q A;  1ZR2 A;  3IF4 A;  4LLH A;  5GTI E;  4RKU J;  3V4Q A;  2JKV A;  1MZ9 A;  1U57 A;  4C7N B;  5AW6 B;  4MN4 C;  3MD0 A;  4D6T D;  1S9K D;  1M90 Q;  3N7N A;  3SWF A;  5APQ A;  1JY3 N;  1N8R Q;  3B5N A;  1G1J A;  1HVV A;  4M3L A;  3CX5 I;  4AQR D;  1YI2 P;  2HG5 D;  1VQ8 P;  2I8D A;  1PP9 D;  3BCC J;  1KQG B;  4PJ0 E;  2J5U A;  2D2C D;  5AW9 B;  2BCC E;  3RK3 C;  3WU2 H;  2B89 A;  1VQ7 P;  1E5W A;  1HTL C;  3L71 E;  5CMZ A;  3L35 A;  3TSI A;  1ZLL A;  1OIP A;  1N2D C;  1VQO P;  1OWA A;  3FGA D;  2HFE D;  1AVO A;  1NKZ B;  3PTZ A;  2PGD A;  3AEC C;  2QJK B;  5H2F E;  1PV3 A;  1KYO I;  3BVH A;  1K9M Q;  3KZI E;  3CI9 A;  1SQB K;  3IAO A;  4K35 A;  4L75 A;  3FXD A;  1GDT A;  4JQ0 D;  1HGV A;  3LW5 H;  5KLV G;  3AED C;  2LKM A;  2Y9Y A;  4WY4 B;  5E79 H;  2FYZ A;  1A02 F;  1S9K E;  1MFZ A;  2E74 C;  5AW3 B;  2H88 C;  4ZKU A;  2OYO A;  5GTI H;  1YJ9 P;  5CCH C;  3H32 A;  3AE7 C;  1URQ C;  2FY8 A;  2AEM A;  3HRN A;  3AEF C;  1VF5 C;  1YYC A;  3N4X A;  1X22 A;  1NJI Q;  1JEK A;  3MUD C;  2KLV A;  2WMM A;  3D71 A;  4PJ0 H;  4PD4 D;  1URQ A;  5AVY B;  5L8R J;  3H1L J;  4A7P A;  2AEF A;  3HTK B;  3Q5S A;  1R5L A;  1OW6 A;  1FE6 A;  1M8O B;  1K8A Q;  2A06 G;  1LTI C;  2KOG A;  3BCC G;  3HD7 D;  1VQP P;  1QL2 A;  1FDI A;  1Q82 Q;  2LXB A;  1AQT A;  1LT9 C;  2FFD B;  2NRG A;  2H89 C;  1GU5 A;  2Y9Z A;  1DEB A;  4H44 C;  3L73 D;  1NAY A;  1SQQ G;  5H2F H;  1P84 I;  3KPE A;  3MP7 B;  1SQV J;  4HKZ H;  1W2E A;  3KZI H;  1LT9 A;  1OW7 A;  1BGY J;  2N1T C;  2K37 A;  2OTJ P;  1L4A C;  1KB9 I;  1KMI Z;  4WVZ A;  3L74 J;  1NTZ J;  4UB8 E;  2IFN A;  4AYC A;  2N1T A;  1J1E C;  4GDO A;  4OWF A;  4PD4 E;  2HYN A;  4D6T J;  1LTJ B;  2K88 A;  1FAV A;  3A0H E;  1N73 B;  1PP9 J;  1NU1 D;  2YMK A;  2E76 C;  2NPS B;  1FDM A;  3B71 A;  1HBW A;  2JJL A;  3L70 D;  2WSE H;  2M5A A;  1JY2 P;  2WWW A;  2GUV A;  2E43 A;  4N6J A;  1MKM A;  1YTZ I;  2YKP A;  3H1L G;  3C8V A;  1NTK K;  4UB6 E;  3HE4 A;  1AFO A;  1OZH A;  2OYH B;  2QJP B;  4Y28 J;  2HPC A;  1L0N J;  1QX8 A;  4BXL A;  2YO3 A;  2BCC G;  3GMA A;  1GMJ A;  3RK2 C;  5AW2 B;  1CSB A;  1RE3 C;  3V4W A;  4YTP C;  5CCG C;  1KD1 Q;  4UB8 H;  3VYI A;  2A06 D;  3T97 B;  3L36 A;  1R5S A;  1BGY G;  2A45 H;  3NMD A;  3BCC D;  3PRJ A;  4BRY A;  1LWU B;  1EDL A;  4ZKP A;  1KC8 Q;  1RE3 A;  5C39 A;  2YIU B;  4IL6 E;  4IFF A;  1T8Z A;  2CK3 H;  1N7S B;  4PD4 H;  2J59 M;  2O1J A;  3E1I A;  1IFD A;  1OMI A;  2YKQ A;  1G1I A;  2KSJ A;  2W27 A;  4C7N A;  5AW0 B;  3RL0 B;  5KLV E;  2PAJ A;  2PP6 A;  2W6J H;  3A0H H;  3CX5 D;  3CWB D;  3B5N D;  4QMA A;  1NYH A;  2E75 C;  3SFE C;  1ZME C;  5KLV K;  4D6T G;  1M7L A;  2IYP A;  5APY A;  3AE3 C;  4R4M A;  2OGU A;  2P2U A;  1GK4 A;  2FXP A;  3SFD C;  1PP9 G;  2NZ2 A;  3TYY A;  3PJS K;  4UB6 H;  3VP8 A;  2N9B A;  3E1R A;  2HR3 A;  4GT1 A;  2AXT H;  3P32 A;  3L73 J;  2BEZ F;  3CCS P;  3CCU P;  3RK3 D;  3Q5P A;  1HF9 A;  1BE3 D;  1UII A;  1NWQ A;  1H89 A;  1KYO D;  1X0T A;  4DCK A;  1KV4 A;  1M1K Q;  5AVS B;  1L2P A;  2POH A;  4WY4 C;  2A06 E;  4W7Z A;  1KFN A;  1BSN A;  1EZV I;  3BCC E;  3H1K J;  4IFM A;  3AE5 C;  2PFX A;  2IBZ I;  4H13 B;  4I7Z B;  1L0L K;  1JUN A;  1GL2 B;  1L0N G;  2ZJS E;  2MKV A;  4WY4 A;  3F89 A;  2WSF H;  1RY3 A;  3GW6 A;  4HB1 A;  2P1J A;  4IL6 H;  3H1J D;  4YXD C;  3H1L D;  3CCJ P;  2KP8 A;  3CX5 E; 
#chains in the Genus database with same CATH homology
 1H0T B;  2KIK A;  2QRX A;  2RKL A;  1MFT A;  4GOF A;  5CBN A;  2M5A A;  2LXB A;  1Y47 A;  1LT1 A;  2KZI A;  5CBO A;  2KS1 B;  3PH0 A;  2LR2 A;  2Q1K A;  4JBZ A;  5K5G B;  2B87 B;  1NVO A;  4KJM A;  4NPF X;  1OVU A;  1SS1 A;  1U7M A;  2M0B A;  4K35 A;  5DJT B;  4HKZ H;  3FXD A;  4ZNC A;  1ZW0 A;  1S3J A;  1JMB A;  1LP1 A;  4GOE A;  5EFW B;  4K3A A;  4NPE A;  1ZXG A;  2HR3 A;  4CPG A;  2OTK E;  1H0T A;  3MZW B;  4EYY Q;  4BXL A;  1Q2N A;  1OVV A;  2KUB A;  2B88 A;  1EDK A;  2KI7 B;  1EDJ A;  4MN4 C;  2JWD A;  1EC5 A;  2P58 A;  1X0T A;  4WWI A;  4ASW A;  3FXE A;  1OVR A;  4GOD A;  2R44 A;  1FC2 C;  2UWJ E;  2B87 A;  2M5A B;  2KZJ A;  2LXC B;  1BDD A;  2I8D A;  2ZAE B;  3S1K A;  5DJU B;  2K3R A;  2SPZ A;  3QWO C;  2QVA A;  1EDL A;  4IOI H;  1EDI A;  4HJG H;  4ZMD A;  5C39 A;  3MHV A;  1JM0 A;  2WMM A;  3ZDM A;  1U7J A;  2B89 A;  4NPD A;  1DEE G;  3RGU A;  4HB1 A;  1BDC A;  4ASV A;  1LP1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...