2KZIA

Solution structure of the zher2 affibody
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
58
structure length
58
Chain Sequence
VDNKFNKEMRNAYWEIALLPNLNNQQKRAFIRSLYDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for high-affinity HER2 receptor binding by an engineered protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
molecule keywords Engineered protein, ZHER2 Affibody
total genus 19
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2010-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2kziA00
3MZWB 2KIKA 1BDDA 3ZDMA 1ZW0A 4HJGH 1JM0A 4NPDA 5EFWB 2QRXA 1LP1A 1EDKA 4K35A 4BXLA 2B89A 2M0BA 2UWJE 4NPFX 3QWOC 4CPGA 2M5AB 2P58A 1X0TA 1S3JA 1Q2NA 1FC2C 2KI7B 4ASVA 1EDLA 5DJTB 5K5GB 4GOFA 3FXEA 1LP1B 4HB1A 2HR3A 2KZJA 4JBZA 2ZAEB 3RGUA 5CBNA 2SPZA 1OVRA 1U7MA 2B87A 4ASWA 2B88A 1NVOA 4ZMDA 5CBOA 2KS1B 4HKZH 2I8DA 1EC5A 4K3AA 2KUBA 4WWIA 1BDCA 1EDJA 1ZXGA 2M5AA 4GODA 1U7JA 4NPEA 3FXDA 4GOEA 2RKLA 4ZNCA 2K3RA 2OTKE 4KJMA 1JMBA 2Q1KA 2JWDA 1Y47A 1SS1A 1DEEG 2B87B 1H0TB 4MN4C 1LT1A 1H0TA 1OVUA 2LXCB 1MFTA 5C39A 4EYYQ 2KZIA 2WMMA 2LR2A 3PH0A 1OVVA 4IOIH 5DJUB 1EDIA 2R44A 3S1KA 2QVAA 3MHVA 2LXBA
chains in the Genus database with same CATH superfamily
2Z5HA 1ZRTE 3CCLP 2KIKA 4N3YB 5APUA 1SQPD 3D6ZA 1YJ9P 2N9YB 1LTJC 1SQXJ 3L72E 3L74G 1S5LH 4UB8E 5L8RJ 3RK3B 3HE4B 4DOJA 2PGDA 1JCCA 5KTBA 1J1EB 3D71A 3P7KA 1JTHA 3JCUE 2FYNB 2WVRA 4U3FG 3A0HE 3PRJA 5AVUB 3VMYA 1G2CB 3AE5C 1L0LG 1SFCA 3H1KD 4HYTB 3WUUA 4WY4D 2K37A 3AE9C 3F89A 1EXJA 1GK4A 3B5NC 1J2JB 1L0NK 2GUVA 4Y99C 1R8EA 3BRVB 4IL6H 3B5NB 4EOTA 3MD0A 2ZYAA 3I56P 1RQUA 3P32A 3VTPC 3CX5D 2BEQD 3SFDC 3BASA 3H1ID 1NKZB 1PPJE 3MGNA 5B5EH 1S3JA 2ZFCA 5CCGD 1S2EA 1SQVD 5KLIC 3JSVC 1R5LA 2ZT9C 1KQGB 2A06D 1FZGA 3P8CE 4XE5B 1IFMA 2JWAA 1CZQA 4ZKUA 1PP9G 1VQNP 1OW8A 1PV3A 1OZHA 5K5GB 4WB4A 3W68A 4GOFA 4EI2A 5APXA 1BCCE 4LC1A 1KMIZ 2H88C 3RBXA 2YMYA 1LP1B 1ZRTD 3Q5RA 1URQD 1SVFA 3H1JG 5M1BA 4U3FD 3A0BE 3L36A 3VMXA 4IL6X 3HD7B 3EWKA 1LWUC 2BASA 1URQC 3IN6A 3KZIE 3PP5A 4JBZA 4PD4D 5BU8B 2WWWA 2E76D 1KFNA 2ZAEB 1NTMK 2CK3H 2WSEH 3HUSC 2JO1A 4L74A 2PRRA 1U7MA 2A06G 2B87A 2QJKB 2XNXA 2E75C 1NH4A 1VQOP 2E74C 3QH9A 1IK7A 5AW0B 2Q5UA 3H6PA 1NVOA 1NTZK 4EDFA 1K05A 3NTNA 4H13C 2H89C 2QE7H 1Q7YQ 2C9LY 1VF5B 1KYOD 1BGYJ 2HLOA 3FWNA 3H1KG 1VQ8P 1VF5C 3CX5E 4DCKA 2WPQA 5KLVJ 1G2CA 3RK2C 4EIJA 3Q5SA 1KORA 1PGQA 2HODB 3BCCJ 3C8VA 1A02F 5CHXA 5CCHA 1JTHB 2FFDC 2PP6A 2QJYC 5AVQB 2I8DA 3LW5J 3M9QA 1H8AA 1KB9E 1NTMG 3OA7A 2QJKC 1Q81Q 1KQFB 1N8RQ 3HE4A 1P84E 3HUSB 1CI6B 1S5LX 2ZXXA 4IFMA 1FAVA 1GL2C 3VP8A 1UIXA 1NJIQ 1IO4A 4Z1MH 2YMKA 1VQ5P 2M5AA 1FS0E 3M06A 1J1DB 4GODA 2QSIA 3L70G 2N9BA 3AE1C 2BCCE 1NTZG 3MUDC 1J1DC 3OAKA 4OGQC 1ZR4A 3CC7P 1SQQD 2YIUB 3CCVP 3WMM0 3TDKA 2BCCG 1ZLLA 2C0WA 4PD4E 2HPCA 4N6JA 4DZOA 1Q90D 2YNYA 1VPCA 3ITKA 1FOSF 2OYHA 1FZEA 1FZAA 5AW9B 1S9KD 3T97A 2Y0DA 3WUVA 4H0LD 1S4XA 2JWDA 3C1LA 3HTKB 3L75G 4IL6E 3K5BA 1SS1A 3MTUE 2WT7A 1SQQK 3TNUB 2B87B 3PLNA 3R2PA 2H7HA 1DIPA 2LXCB 5C39A 2Q7CA 3TYYA 4EYYQ 2QA4P 1LTTC 3AEGC 1KYOH 5AVZB 2WMMA 4A7PA 4C7NA 2C9NY 1YQ4C 2Q3IA 2OYIC 2E75B 2R3SA 1NTMD 2WSFH 2QM8A 2V7QJ 1KYOI 2XDJA 1JY3P 3S9OA 1KILA 1WMKA 3SWKA 5KJ7C 4TLFA 1OW6A 4PJ0H 1VQMP 1D7MA 1MZ9A 1MV8A 1P84D 2NPSD 2FFDB 3MHVA 5KJ7D 2OYOA 1SQQG 2NPSC 1N73B 3H1JE 2PFXA 3L71J 1GZLA 3ZDMA 1W2EA 1VQLP 4JF7A 1KFMA 1FZCB 3FGAD 4BRYA 1L0NE 1L4AC 3EFFK 2WT7B 3F5HA 1R5SA 1BGYE 3U1CA 2OARA 3M9HA 2NRGA 4PV1D 5EFWB 2Z5IA 2CPBA 3H1KJ 5AVRB 2GA1A 3CWBJ 3V4WA 1URQA 3L75E 3WUTA 2WSEJ 1EDKA 2YKPA 3N7NA 5KLVG 4K35A 1S9KE 4BXLA 3V5BA 2HFED 2IYPA 2KLUA 1PGJA 1ZR2A 1PZQA 3BATA 2UWJE 3RL0C 4WBAA 1OWAA 3QWOC 2FY8A 1JY2O 1KQLA 2KB7P 1FU1A 3M91A 1OX3A 3O6QB 3RL0D 2WSCH 3H1LG 2KOGA 2M5AB 2WITA 1X8YA 1T2KC 3TGUJ 1X0TA 4H13D 1SQVJ 1GW3A 1Q2NA 1BE3D 4LLHA 2O01H 1NU1J 1FC2C 3L73D 1EZVE 1GK6A 1NU1D 3L73J 1NTME 1PL5A 1E5WA 3Q3DA 5APQA 1MUUA 2FXOA 4C7RA 2LKMA 1S72P 3B4SA 1YTZT 5DJTB 5KLVK 3M0AA 5APYA 1GD2E 2HODA 3A7OA 1DEBA 1LGHB 2WSSH 4N78E 3FXEA 4AQRD 4ZKPA 2H43A 1IFDA 2K88A 2P1JA 3H32A 4BWNA 5KJ7A 1WT6A 1OMIA 1SFCD 2JKVA 4LGDE 3WU2H 3L75J 4HB1A 1JEKA 1LT9C 1AVYA 2IBZE 1HF9A 2KNCA 1SFCC 2M8RA 1URQB 3KXDA 1L0ND 2YO3A 1L0NJ 2WPRA 3CL3D 1BGYD 4H44B 5CCHD 3CCQP 1RF1A 5CBNA 1YHQP 2SPZA 4I6MC 1FOSE 1OVRA 1GMJA 4U7JA 2D2CD 2A45G 2KK7A 1SQBJ 3AE8C 3CXHH 1NTZD 2JDIH 4PD4I 3V2PA 4XA4A 1N73A 3A0HH 2POHA 3H1LD 3H32B 4W7YA 3USSA 2XNDH 3VYIA 2FYUE 1HUCA 1LTIC 4UB6E 1QL1A 3CXHD 4W7ZA 4TT3H 2YIUC 5CBOA 1GDTA 1NYHA 1L0LJ 2NZ2A 1M57D 2I1JA 1HGZA 1SQXE 1M8OB 3HD7C 4WVZA 1BE3E 1VDFA 1YBKA 3B5ND 3A5TA 1NU1E 3G71P 4K3AA 1HJ0A 4D6TD 3I55P 3U1AA 4H44C 2FXMA 1KB9H 3AEAC 1K04A 2QEXP 1HWTC 1AA0A 4N78D 2ZXEB 2IBZG 3GW6A 3NMDA 2BEZF 3FXDA 1JMMA 1G1JA 1LTAC 3H1HE 3H1IJ 3CMEP 3B5NA 2PAJA 1RE4A 1SQBE 3AE2C 3MIWA 3CWBE 3P8MC 1USEA 2B9BA 2OTKE 4DT0A 4I2LC 1L4AD 2WPVB 3PHLA 1EZVG 1Z56A 1OIPA 1RF0A 4KT0J 1FZCA 1X9VA 1M1JB 3GHGB 1FJKA 3LIDA 3S4RA 1S5LE 3L73G 5APTA 1H0TB 1DX7A 3AEDC 1CI6A 1MFTA 4U3FJ 3Q5PA 1HJBA 2KZIA 1FZFA 2KYVA 3JC22 3CC4P 1VQ6P 1KV4A 2AXTE 1AQTA 2AEFA 3L72D 5GTHE 5AW1B 2LR2A 2N1TD 3BRTB 2OYHC 3GLMA 3G4SP 1SQPJ 1JY2N 2M3EA 2E75D 1TU3F 1SQXD 2N1TC 2E5TA 3L72G 5BVZA 1VQ9P 3V2RA 1NTKK 5GTIH 1HTLC 1W5CE 2K9JB 3SSUA 5B66H 1ZMEC 2R44A 4D6TE 3MUDA 3CCSP 2QVAA 3GF7A 1JUNA 1FDMA 2L5GB 1RE3C 1AVOA 4PJ0E 3RL0g 1KILD 3M9BA 2ZT9B 2NPSA 1BDDA 4HH2A 2YXQB 1RF1B 3HTKA 1N2DC 5KLVD 1VQPP 3E1IA 2JR8A 3BCCD 1SQXK 2XZRA 1JM0A 4NPDA 3IR9A 3CCMP 1PP9J 2FYUJ 3TF5A 3UIAA 1YIJP 1ZP0C 1SQBD 2HPCB 2QRXA 3CWBD 2IFNA 1FJPA 5KAFH 2A06E 3HE5A 3CPWO 3P8CD 3SWYA 2YXRB 5AW7B 5BU5A 1NTKG 4AUWA 1IJDB 1MKMA 1N7SB 2D2CB 2V4HA 3A3YB 1BE3J 3AE6C 4Y99B 2ZYGA 1BCCJ 2K1AA 3KZIH 3KPEA 4JYBA 1BCCD 4NPFX 1SQPE 5AVYB 1HBWA 2M3BA 2O1KA 3L71E 4JPZB 1FBMA 4CPGA 5KKZB 1GW4A 2W6AA 4U3FE 1FDIA 2P58A 1EQ7A 4GDOA 1SQXG 1M90Q 3L74J 3H1KE 1YI2P 5E79E 4WY4A 1K8AQ 3H1HJ 1GL2A 4GIFA 1LWUA 1IZNB 5CJ0A 3JCUH 5H2FE 4O9BA 5TISH 1EDLA 2WTYA 3AECC 1RQVA 3C9IA 4I1LA 1NTKD 1YYCA 2IFMA 3CCEP 2IZ0A 2QG4A 3FWLA 1YTZI 4C46A 3CXHI 3RK2D 1H89A 1KILE 4KHXA 1LT9A 3H1IE 2W90A 2AEJA 2HR3A 1PPJD 2KSEA 4WY4B 3SFEC 5KLVE 1SFCB 3VMAA 3WU2E 3TGUE 1AJYA 3BCCE 1SQVE 1GL2B 1KZUB 2O01N 2CPSA 1P84H 3EQ2A 1IFIA 1RF1C 1FE6A 4ASWA 2B88A 1T3UA 3HD7A 1OXZA 4L76A 1NTZJ 3FX0A 2ZT9D 3L72J 3L70D 2FFDA 1QGKB 2FYZA 1M1KQ 2RMZA 2P2UA 3IFMA 1BSHA 2OYIA 3CX5I 3L74E 2R3CA 3AE4C 4D6TJ 1N86A 4YTPC 1QVGO 4PD4H 2BCCD 1NU1K 3L71D 1JCDA 3RBZA 1GU5A 1NO4A 2RH0A 2OTLP 1QEXA 3AEFC 3VOPA 4QMAA 3KYQA 1ZN5A 3H1JJ 4H0LC 3A0BH 3Q1MA 1SLQA 2KSJA 3NXSA 4HKZH 2HYNA 2WSCJ 1EC5A 2WSFJ 3SWFA 2IYOA 5AVXB 5AW5B 1HGVA 2KUBA 1NGMB 1PFIA 4AYCA 1NTKE 1BDCA 1HH0A 1KC8Q 5KKZC 1VQ7P 3T97B 1EDJA 5AVSB 1KYOE 1U7JA 1L4AA 4NPEA 4OGQB 3IF4A 2W8ZA 1A02J 1ZV8A 1PPJG 1N7SD 1DD4A 2K9JA 1QVFO 1PGOA 4L75A 5AW4B 4ZNCA 1NU1G 3V6IA 1KILC 1N7SC 3TGUD 5APVA 2L91A 2W6JH 1FZBA 2FXPA 2R5BA 2KLVA 3V2NA 1EXIA 1KB9D 1IFNA 5KAFE 5CCGC 1FZCC 1JMBA 5AW6B 1MFZA 4H0LB 3CCUP 1YITP 3GG2A 3G6EP 5B5EE 1DEEG 1JOCA 1NTMJ 1L0LE 3L70E 3H1HG 3RK3C 3B71A 1M1JA 3GHGA 3N4XA 3ABVC 5APSA 3L74D 1H0TA 1RE4C 4W80A 1SQQE 1USDA 1GTWA 5CJ4A 1W2BO 1P84I 2DW3A 2ZYDA 1LT9B 3PH0A 4OGQD 5CMZA 1DH3A 1M7LA 1OVVA 2KS1A 2D2CC 1PIXA 4GT1A 2E5YA 3MP7B 4IFFA 4IOIH 1CSBA 2N1TA 2E76C 2N1TB 4UB6H 3KHUA 1QX8A 5DJUB 1EDIA 1FDOA 2QJYB 2FBWC 2IPPA 2YKOA 3O8ZA 1NOHA 1YJNP 1KQSO 1LWUB 1JY2P 2I1KA 2LXBA 3OJAB 2FKWB 3MZWB 3PTZA 4UB8H 1Q82Q 1SP4A 4GKGA 2ITAA 1LTJB 3R4YA 2KXPB 1QLED 1ZW0A 2O01J 4HJGH 1M56D 1T8ZA 3E1RA 1VF5D 2JJLA 1NKNA 3I5CA 1G1IA 2IDBA 4D6TG 1NAYA 2E74B 2XKMA 2QJPB 3M0DA 3L73E 2W83C 3BCCG 1EZVD 1LP1A 4R4LA 1UIIA 1VQ4P 1JY3O 1N7SA 2B89A 5KAIH 4I7ZB 2M0BA 3B8EB 3II6A 2G8YA 1ZOYC 1QL2A 1S1CX 2RN0A 3AEEC 1L0LD 1NAFA 1RH5B 3H1JD 4C7NB 2QJPC 1GL2D 4JQ0D 4M3LA 2MJZA 4DJGA 3M0DC 2VRSA 3RK3E 1LTSC 1BGYG 3W67A 2IBZD 5AW3B 1SQQJ 1JNMA 3CD6P 1YQ3C 5AVVB 2P67A 3L75D 2KI7B 1SQBG 2O1JA 2R32A 3KQGA 4H13B 4ASVA 5CCGA 4R4MA 1U57A 2OQQA 1VQKP 2GM4A 3AEBC 2KNCB 4L73A 4PV1C 3L35A 5E79H 3RL0B 4YPCA 3LIEA 4RKUJ 2Y9ZA 1DD3A 3EFGA 1XTGB 1VL2A 2E76B 2WPSA 2QM7A 3AE3C 1RHZB 1XTCC 1HVVA 1LTBC 2AXCA 3H1LE 1Y9BA 2E42A 1IFJA 2JP3A 2K9YA 2V7QH 3HD7D 3L70J 2OYIB 4IFDK 2KZJA 2AEMA 4WY4C 3GF3A 2IX7C 4OWFA 3RK2B 1IC2A 2IBZI 1K9MQ 1BSNA 2J59M 4H44D 1RF0C 2G3AA 4OVNF 2BCCJ 3HUSA 4Y28J 3RGUA 3TSIA 1GU4A 3TGUG 1T2KD 1Q86Q 1SQBK 1BE3G 2WQYC 3IAOA 3O6QA 3GMAA 4RJTA 2E43A 2ZVNB 3HRNA 1KTMA 2FYNC 2H8PD 3A2AA 3G9RA 1OW7A 2MKVA 2W27A 2Y0EA 3CI9A 3TK1A 3CX5H 3VN0A 1YJWP 3H1IG 2Z4EA 1SQPK 2P10A 2QIWA 1EZVI 4ZMDA 1E79H 4OH8B 1H88A 2OYHB 2WZ7A 3RK3D 3VP9A 1WRGA 1M1JC 2HG5D 3GHGC 3D70A 3G3ZA 2KS1B 3L37A 3OW2O 1RE3A 3H25A 1AQ5A 1X22A 1T6AA 3V2QA 3CMAP 4RO0A 2P7JA 1PP9E 1BCCG 4B86A 4WWIA 3CWBG 4BRYB 2Y9YA 1N7LA 1NTZE 2JEEA 5CCHC 1LNQA 1AV1A 2ZVOB 1LJ2A 1ZXGA 2AXTH 2FYUK 1T3JA 2FYUD 2O3JA 2J5UA 5GTHH 3U59A 1AFOA 5TISE 3CXHE 5H2FH 1JO5A 1L2PA 1SQPG 2GUSA 2ZJSE 2RKLA 3LW5H 4GOEA 1OFCX 5AW8B 2C0XA 3CLQA 1X79B 3L71G 5TJHA 5KLIB 2A45I 2K3RA 1KILB 5GTIE 2OTJP 1SQVK 1Y8AA 2YO2A 1LTGC 5AVTB 2E74D 5AW2B 4YXDC 5B66E 2Q3EA 2Q6QA 4PV1B 4KJMA 1CW5A 3BVHA 3HE5B 2Q1KA 2Y0CA 2A45H 3Q2YA 1N73C 3PJSK 4JYCA 5KAIE 1Y47A 1L4AB 1LTJA 2KP8A 4XFJA 5APWA 1K73Q 3D6YA 3CC2P 1KN7A 2XU6A 1NWQA 5AVWB 2W6BA 4MN4C 1LT1A 1OVUA 2R5DA 1IFPA 2FYUG 2NPSB 3TNUA 1KB9I 1IK9A 1JY3N 4YXWH 3AE7C 3H1HD 3NFQA 3L4FA 3H1LJ 2Q9IA 2IZ1A 1J1EC 1PGPA 2XV5A 1L0LK 1JB0J 1NTKJ 4I7ZC 3V4QA 3CCRP 1SQVG 1RY3A 2J58A 1KD1Q 1L0NG 3VMZA 1NHLA 3CCJP 1PP9D 3S1KA 4RESB 2YKQA 2OGUA 3E7KA 3KDPB
chains in the Genus database with same CATH topology
3MZWB 2KIKA 1BDDA 3ZDMA 1ZW0A 4HJGH 1JM0A 4NPDA 5EFWB 2QRXA 1LP1A 1EDKA 4K35A 4BXLA 2B89A 2M0BA 2UWJE 4NPFX 3QWOC 4CPGA 2M5AB 2P58A 1X0TA 1S3JA 1Q2NA 1FC2C 2KI7B 4ASVA 1EDLA 5DJTB 5K5GB 4GOFA 3FXEA 1LP1B 4HB1A 2HR3A 2KZJA 4JBZA 2ZAEB 3RGUA 5CBNA 2SPZA 1OVRA 1U7MA 2B87A 4ASWA 2B88A 1NVOA 4ZMDA 5CBOA 2KS1B 4HKZH 2I8DA 1EC5A 4K3AA 2KUBA 4WWIA 1BDCA 1EDJA 1ZXGA 2M5AA 4GODA 1U7JA 4NPEA 3FXDA 4GOEA 2RKLA 4ZNCA 2K3RA 2OTKE 4KJMA 1JMBA 2Q1KA 2JWDA 1Y47A 1SS1A 1DEEG 2B87B 1H0TB 4MN4C 1LT1A 1H0TA 1OVUA 2LXCB 1MFTA 5C39A 4EYYQ 2KZIA 2WMMA 2LR2A 3PH0A 1OVVA 4IOIH 5DJUB 1EDIA 2R44A 3S1KA 2QVAA 3MHVA 2LXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZW B;  2KIK A;  1BDD A;  3ZDM A;  1ZW0 A;  4HJG H;  1JM0 A;  4NPD A;  5EFW B;  2QRX A;  1LP1 A;  1EDK A;  4K35 A;  4BXL A;  2B89 A;  2M0B A;  2UWJ E;  4NPF X;  3QWO C;  4CPG A;  2M5A B;  2P58 A;  1X0T A;  1S3J A;  1Q2N A;  1FC2 C;  2KI7 B;  4ASV A;  1EDL A;  5DJT B;  5K5G B;  4GOF A;  3FXE A;  1LP1 B;  4HB1 A;  2HR3 A;  2KZJ A;  4JBZ A;  2ZAE B;  3RGU A;  5CBN A;  2SPZ A;  1OVR A;  1U7M A;  2B87 A;  4ASW A;  2B88 A;  1NVO A;  4ZMD A;  5CBO A;  2KS1 B;  4HKZ H;  2I8D A;  1EC5 A;  4K3A A;  2KUB A;  4WWI A;  1BDC A;  1EDJ A;  1ZXG A;  2M5A A;  4GOD A;  1U7J A;  4NPE A;  3FXD A;  4GOE A;  2RKL A;  4ZNC A;  2K3R A;  2OTK E;  4KJM A;  1JMB A;  2Q1K A;  2JWD A;  1Y47 A;  1SS1 A;  1DEE G;  2B87 B;  1H0T B;  4MN4 C;  1LT1 A;  1H0T A;  1OVU A;  2LXC B;  1MFT A;  5C39 A;  4EYY Q;  2KZI A;  2WMM A;  2LR2 A;  3PH0 A;  1OVV A;  4IOI H;  5DJU B;  1EDI A;  2R44 A;  3S1K A;  2QVA A;  3MHV A;  2LXB A; 
#chains in the Genus database with same CATH topology
 2Z5H A;  1ZRT E;  3CCL P;  2KIK A;  4N3Y B;  5APU A;  1SQP D;  3D6Z A;  1YJ9 P;  2N9Y B;  1LTJ C;  1SQX J;  3L72 E;  3L74 G;  1S5L H;  4UB8 E;  5L8R J;  3RK3 B;  3HE4 B;  4DOJ A;  2PGD A;  1JCC A;  5KTB A;  1J1E B;  3D71 A;  3P7K A;  1JTH A;  3JCU E;  2FYN B;  2WVR A;  4U3F G;  3A0H E;  3PRJ A;  5AVU B;  3VMY A;  1G2C B;  3AE5 C;  1L0L G;  1SFC A;  3H1K D;  4HYT B;  3WUU A;  4WY4 D;  2K37 A;  3AE9 C;  3F89 A;  1EXJ A;  1GK4 A;  3B5N C;  1J2J B;  1L0N K;  2GUV A;  4Y99 C;  1R8E A;  3BRV B;  4IL6 H;  3B5N B;  4EOT A;  3MD0 A;  2ZYA A;  3I56 P;  1RQU A;  3P32 A;  3VTP C;  3CX5 D;  2BEQ D;  3SFD C;  3BAS A;  3H1I D;  1NKZ B;  1PPJ E;  3MGN A;  5B5E H;  1S3J A;  2ZFC A;  5CCG D;  1S2E A;  1SQV D;  5KLI C;  3JSV C;  1R5L A;  2ZT9 C;  1KQG B;  2A06 D;  1FZG A;  3P8C E;  4XE5 B;  1IFM A;  2JWA A;  1CZQ A;  4ZKU A;  1PP9 G;  1VQN P;  1OW8 A;  1PV3 A;  1OZH A;  5K5G B;  4WB4 A;  3W68 A;  4GOF A;  4EI2 A;  5APX A;  1BCC E;  4LC1 A;  1KMI Z;  2H88 C;  3RBX A;  2YMY A;  1LP1 B;  1ZRT D;  3Q5R A;  1URQ D;  1SVF A;  3H1J G;  5M1B A;  4U3F D;  3A0B E;  3L36 A;  3VMX A;  4IL6 X;  3HD7 B;  3EWK A;  1LWU C;  2BAS A;  1URQ C;  3IN6 A;  3KZI E;  3PP5 A;  4JBZ A;  4PD4 D;  5BU8 B;  2WWW A;  2E76 D;  1KFN A;  2ZAE B;  1NTM K;  2CK3 H;  2WSE H;  3HUS C;  2JO1 A;  4L74 A;  2PRR A;  1U7M A;  2A06 G;  2B87 A;  2QJK B;  2XNX A;  2E75 C;  1NH4 A;  1VQO P;  2E74 C;  3QH9 A;  1IK7 A;  5AW0 B;  2Q5U A;  3H6P A;  1NVO A;  1NTZ K;  4EDF A;  1K05 A;  3NTN A;  4H13 C;  2H89 C;  2QE7 H;  1Q7Y Q;  2C9L Y;  1VF5 B;  1KYO D;  1BGY J;  2HLO A;  3FWN A;  3H1K G;  1VQ8 P;  1VF5 C;  3CX5 E;  4DCK A;  2WPQ A;  5KLV J;  1G2C A;  3RK2 C;  4EIJ A;  3Q5S A;  1KOR A;  1PGQ A;  2HOD B;  3BCC J;  3C8V A;  1A02 F;  5CHX A;  5CCH A;  1JTH B;  2FFD C;  2PP6 A;  2QJY C;  5AVQ B;  2I8D A;  3LW5 J;  3M9Q A;  1H8A A;  1KB9 E;  1NTM G;  3OA7 A;  2QJK C;  1Q81 Q;  1KQF B;  1N8R Q;  3HE4 A;  1P84 E;  3HUS B;  1CI6 B;  1S5L X;  2ZXX A;  4IFM A;  1FAV A;  1GL2 C;  3VP8 A;  1UIX A;  1NJI Q;  1IO4 A;  4Z1M H;  2YMK A;  1VQ5 P;  2M5A A;  1FS0 E;  3M06 A;  1J1D B;  4GOD A;  2QSI A;  3L70 G;  2N9B A;  3AE1 C;  2BCC E;  1NTZ G;  3MUD C;  1J1D C;  3OAK A;  4OGQ C;  1ZR4 A;  3CC7 P;  1SQQ D;  2YIU B;  3CCV P;  3WMM 0;  3TDK A;  2BCC G;  1ZLL A;  2C0W A;  4PD4 E;  2HPC A;  4N6J A;  4DZO A;  1Q90 D;  2YNY A;  1VPC A;  3ITK A;  1FOS F;  2OYH A;  1FZE A;  1FZA A;  5AW9 B;  1S9K D;  3T97 A;  2Y0D A;  3WUV A;  4H0L D;  1S4X A;  2JWD A;  3C1L A;  3HTK B;  3L75 G;  4IL6 E;  3K5B A;  1SS1 A;  3MTU E;  2WT7 A;  1SQQ K;  3TNU B;  2B87 B;  3PLN A;  3R2P A;  2H7H A;  1DIP A;  2LXC B;  5C39 A;  2Q7C A;  3TYY A;  4EYY Q;  2QA4 P;  1LTT C;  3AEG C;  1KYO H;  5AVZ B;  2WMM A;  4A7P A;  4C7N A;  2C9N Y;  1YQ4 C;  2Q3I A;  2OYI C;  2E75 B;  2R3S A;  1NTM D;  2WSF H;  2QM8 A;  2V7Q J;  1KYO I;  2XDJ A;  1JY3 P;  3S9O A;  1KIL A;  1WMK A;  3SWK A;  5KJ7 C;  4TLF A;  1OW6 A;  4PJ0 H;  1VQM P;  1D7M A;  1MZ9 A;  1MV8 A;  1P84 D;  2NPS D;  2FFD B;  3MHV A;  5KJ7 D;  2OYO A;  1SQQ G;  2NPS C;  1N73 B;  3H1J E;  2PFX A;  3L71 J;  1GZL A;  3ZDM A;  1W2E A;  1VQL P;  4JF7 A;  1KFM A;  1FZC B;  3FGA D;  4BRY A;  1L0N E;  1L4A C;  3EFF K;  2WT7 B;  3F5H A;  1R5S A;  1BGY E;  3U1C A;  2OAR A;  3M9H A;  2NRG A;  4PV1 D;  5EFW B;  2Z5I A;  2CPB A;  3H1K J;  5AVR B;  2GA1 A;  3CWB J;  3V4W A;  1URQ A;  3L75 E;  3WUT A;  2WSE J;  1EDK A;  2YKP A;  3N7N A;  5KLV G;  4K35 A;  1S9K E;  4BXL A;  3V5B A;  2HFE D;  2IYP A;  2KLU A;  1PGJ A;  1ZR2 A;  1PZQ A;  3BAT A;  2UWJ E;  3RL0 C;  4WBA A;  1OWA A;  3QWO C;  2FY8 A;  1JY2 O;  1KQL A;  2KB7 P;  1FU1 A;  3M91 A;  1OX3 A;  3O6Q B;  3RL0 D;  2WSC H;  3H1L G;  2KOG A;  2M5A B;  2WIT A;  1X8Y A;  1T2K C;  3TGU J;  1X0T A;  4H13 D;  1SQV J;  1GW3 A;  1Q2N A;  1BE3 D;  4LLH A;  2O01 H;  1NU1 J;  1FC2 C;  3L73 D;  1EZV E;  1GK6 A;  1NU1 D;  3L73 J;  1NTM E;  1PL5 A;  1E5W A;  3Q3D A;  5APQ A;  1MUU A;  2FXO A;  4C7R A;  2LKM A;  1S72 P;  3B4S A;  1YTZ T;  5DJT B;  5KLV K;  3M0A A;  5APY A;  1GD2 E;  2HOD A;  3A7O A;  1DEB A;  1LGH B;  2WSS H;  4N78 E;  3FXE A;  4AQR D;  4ZKP A;  2H43 A;  1IFD A;  2K88 A;  2P1J A;  3H32 A;  4BWN A;  5KJ7 A;  1WT6 A;  1OMI A;  1SFC D;  2JKV A;  4LGD E;  3WU2 H;  3L75 J;  4HB1 A;  1JEK A;  1LT9 C;  1AVY A;  2IBZ E;  1HF9 A;  2KNC A;  1SFC C;  2M8R A;  1URQ B;  3KXD A;  1L0N D;  2YO3 A;  1L0N J;  2WPR A;  3CL3 D;  1BGY D;  4H44 B;  5CCH D;  3CCQ P;  1RF1 A;  5CBN A;  1YHQ P;  2SPZ A;  4I6M C;  1FOS E;  1OVR A;  1GMJ A;  4U7J A;  2D2C D;  2A45 G;  2KK7 A;  1SQB J;  3AE8 C;  3CXH H;  1NTZ D;  2JDI H;  4PD4 I;  3V2P A;  4XA4 A;  1N73 A;  3A0H H;  2POH A;  3H1L D;  3H32 B;  4W7Y A;  3USS A;  2XND H;  3VYI A;  2FYU E;  1HUC A;  1LTI C;  4UB6 E;  1QL1 A;  3CXH D;  4W7Z A;  4TT3 H;  2YIU C;  5CBO A;  1GDT A;  1NYH A;  1L0L J;  2NZ2 A;  1M57 D;  2I1J A;  1HGZ A;  1SQX E;  1M8O B;  3HD7 C;  4WVZ A;  1BE3 E;  1VDF A;  1YBK A;  3B5N D;  3A5T A;  1NU1 E;  3G71 P;  4K3A A;  1HJ0 A;  4D6T D;  3I55 P;  3U1A A;  4H44 C;  2FXM A;  1KB9 H;  3AEA C;  1K04 A;  2QEX P;  1HWT C;  1AA0 A;  4N78 D;  2ZXE B;  2IBZ G;  3GW6 A;  3NMD A;  2BEZ F;  3FXD A;  1JMM A;  1G1J A;  1LTA C;  3H1H E;  3H1I J;  3CME P;  3B5N A;  2PAJ A;  1RE4 A;  1SQB E;  3AE2 C;  3MIW A;  3CWB E;  3P8M C;  1USE A;  2B9B A;  2OTK E;  4DT0 A;  4I2L C;  1L4A D;  2WPV B;  3PHL A;  1EZV G;  1Z56 A;  1OIP A;  1RF0 A;  4KT0 J;  1FZC A;  1X9V A;  1M1J B;  3GHG B;  1FJK A;  3LID A;  3S4R A;  1S5L E;  3L73 G;  5APT A;  1H0T B;  1DX7 A;  3AED C;  1CI6 A;  1MFT A;  4U3F J;  3Q5P A;  1HJB A;  2KZI A;  1FZF A;  2KYV A;  3JC2 2;  3CC4 P;  1VQ6 P;  1KV4 A;  2AXT E;  1AQT A;  2AEF A;  3L72 D;  5GTH E;  5AW1 B;  2LR2 A;  2N1T D;  3BRT B;  2OYH C;  3GLM A;  3G4S P;  1SQP J;  1JY2 N;  2M3E A;  2E75 D;  1TU3 F;  1SQX D;  2N1T C;  2E5T A;  3L72 G;  5BVZ A;  1VQ9 P;  3V2R A;  1NTK K;  5GTI H;  1HTL C;  1W5C E;  2K9J B;  3SSU A;  5B66 H;  1ZME C;  2R44 A;  4D6T E;  3MUD A;  3CCS P;  2QVA A;  3GF7 A;  1JUN A;  1FDM A;  2L5G B;  1RE3 C;  1AVO A;  4PJ0 E;  3RL0 g;  1KIL D;  3M9B A;  2ZT9 B;  2NPS A;  1BDD A;  4HH2 A;  2YXQ B;  1RF1 B;  3HTK A;  1N2D C;  5KLV D;  1VQP P;  3E1I A;  2JR8 A;  3BCC D;  1SQX K;  2XZR A;  1JM0 A;  4NPD A;  3IR9 A;  3CCM P;  1PP9 J;  2FYU J;  3TF5 A;  3UIA A;  1YIJ P;  1ZP0 C;  1SQB D;  2HPC B;  2QRX A;  3CWB D;  2IFN A;  1FJP A;  5KAF H;  2A06 E;  3HE5 A;  3CPW O;  3P8C D;  3SWY A;  2YXR B;  5AW7 B;  5BU5 A;  1NTK G;  4AUW A;  1IJD B;  1MKM A;  1N7S B;  2D2C B;  2V4H A;  3A3Y B;  1BE3 J;  3AE6 C;  4Y99 B;  2ZYG A;  1BCC J;  2K1A A;  3KZI H;  3KPE A;  4JYB A;  1BCC D;  4NPF X;  1SQP E;  5AVY B;  1HBW A;  2M3B A;  2O1K A;  3L71 E;  4JPZ B;  1FBM A;  4CPG A;  5KKZ B;  1GW4 A;  2W6A A;  4U3F E;  1FDI A;  2P58 A;  1EQ7 A;  4GDO A;  1SQX G;  1M90 Q;  3L74 J;  3H1K E;  1YI2 P;  5E79 E;  4WY4 A;  1K8A Q;  3H1H J;  1GL2 A;  4GIF A;  1LWU A;  1IZN B;  5CJ0 A;  3JCU H;  5H2F E;  4O9B A;  5TIS H;  1EDL A;  2WTY A;  3AEC C;  1RQV A;  3C9I A;  4I1L A;  1NTK D;  1YYC A;  2IFM A;  3CCE P;  2IZ0 A;  2QG4 A;  3FWL A;  1YTZ I;  4C46 A;  3CXH I;  3RK2 D;  1H89 A;  1KIL E;  4KHX A;  1LT9 A;  3H1I E;  2W90 A;  2AEJ A;  2HR3 A;  1PPJ D;  2KSE A;  4WY4 B;  3SFE C;  5KLV E;  1SFC B;  3VMA A;  3WU2 E;  3TGU E;  1AJY A;  3BCC E;  1SQV E;  1GL2 B;  1KZU B;  2O01 N;  2CPS A;  1P84 H;  3EQ2 A;  1IFI A;  1RF1 C;  1FE6 A;  4ASW A;  2B88 A;  1T3U A;  3HD7 A;  1OXZ A;  4L76 A;  1NTZ J;  3FX0 A;  2ZT9 D;  3L72 J;  3L70 D;  2FFD A;  1QGK B;  2FYZ A;  1M1K Q;  2RMZ A;  2P2U A;  3IFM A;  1BSH A;  2OYI A;  3CX5 I;  3L74 E;  2R3C A;  3AE4 C;  4D6T J;  1N86 A;  4YTP C;  1QVG O;  4PD4 H;  2BCC D;  1NU1 K;  3L71 D;  1JCD A;  3RBZ A;  1GU5 A;  1NO4 A;  2RH0 A;  2OTL P;  1QEX A;  3AEF C;  3VOP A;  4QMA A;  3KYQ A;  1ZN5 A;  3H1J J;  4H0L C;  3A0B H;  3Q1M A;  1SLQ A;  2KSJ A;  3NXS A;  4HKZ H;  2HYN A;  2WSC J;  1EC5 A;  2WSF J;  3SWF A;  2IYO A;  5AVX B;  5AW5 B;  1HGV A;  2KUB A;  1NGM B;  1PFI A;  4AYC A;  1NTK E;  1BDC A;  1HH0 A;  1KC8 Q;  5KKZ C;  1VQ7 P;  3T97 B;  1EDJ A;  5AVS B;  1KYO E;  1U7J A;  1L4A A;  4NPE A;  4OGQ B;  3IF4 A;  2W8Z A;  1A02 J;  1ZV8 A;  1PPJ G;  1N7S D;  1DD4 A;  2K9J A;  1QVF O;  1PGO A;  4L75 A;  5AW4 B;  4ZNC A;  1NU1 G;  3V6I A;  1KIL C;  1N7S C;  3TGU D;  5APV A;  2L91 A;  2W6J H;  1FZB A;  2FXP A;  2R5B A;  2KLV A;  3V2N A;  1EXI A;  1KB9 D;  1IFN A;  5KAF E;  5CCG C;  1FZC C;  1JMB A;  5AW6 B;  1MFZ A;  4H0L B;  3CCU P;  1YIT P;  3GG2 A;  3G6E P;  5B5E E;  1DEE G;  1JOC A;  1NTM J;  1L0L E;  3L70 E;  3H1H G;  3RK3 C;  3B71 A;  1M1J A;  3GHG A;  3N4X A;  3ABV C;  5APS A;  3L74 D;  1H0T A;  1RE4 C;  4W80 A;  1SQQ E;  1USD A;  1GTW A;  5CJ4 A;  1W2B O;  1P84 I;  2DW3 A;  2ZYD A;  1LT9 B;  3PH0 A;  4OGQ D;  5CMZ A;  1DH3 A;  1M7L A;  1OVV A;  2KS1 A;  2D2C C;  1PIX A;  4GT1 A;  2E5Y A;  3MP7 B;  4IFF A;  4IOI H;  1CSB A;  2N1T A;  2E76 C;  2N1T B;  4UB6 H;  3KHU A;  1QX8 A;  5DJU B;  1EDI A;  1FDO A;  2QJY B;  2FBW C;  2IPP A;  2YKO A;  3O8Z A;  1NOH A;  1YJN P;  1KQS O;  1LWU B;  1JY2 P;  2I1K A;  2LXB A;  3OJA B;  2FKW B;  3MZW B;  3PTZ A;  4UB8 H;  1Q82 Q;  1SP4 A;  4GKG A;  2ITA A;  1LTJ B;  3R4Y A;  2KXP B;  1QLE D;  1ZW0 A;  2O01 J;  4HJG H;  1M56 D;  1T8Z A;  3E1R A;  1VF5 D;  2JJL A;  1NKN A;  3I5C A;  1G1I A;  2IDB A;  4D6T G;  1NAY A;  2E74 B;  2XKM A;  2QJP B;  3M0D A;  3L73 E;  2W83 C;  3BCC G;  1EZV D;  1LP1 A;  4R4L A;  1UII A;  1VQ4 P;  1JY3 O;  1N7S A;  2B89 A;  5KAI H;  4I7Z B;  2M0B A;  3B8E B;  3II6 A;  2G8Y A;  1ZOY C;  1QL2 A;  1S1C X;  2RN0 A;  3AEE C;  1L0L D;  1NAF A;  1RH5 B;  3H1J D;  4C7N B;  2QJP C;  1GL2 D;  4JQ0 D;  4M3L A;  2MJZ A;  4DJG A;  3M0D C;  2VRS A;  3RK3 E;  1LTS C;  1BGY G;  3W67 A;  2IBZ D;  5AW3 B;  1SQQ J;  1JNM A;  3CD6 P;  1YQ3 C;  5AVV B;  2P67 A;  3L75 D;  2KI7 B;  1SQB G;  2O1J A;  2R32 A;  3KQG A;  4H13 B;  4ASV A;  5CCG A;  4R4M A;  1U57 A;  2OQQ A;  1VQK P;  2GM4 A;  3AEB C;  2KNC B;  4L73 A;  4PV1 C;  3L35 A;  5E79 H;  3RL0 B;  4YPC A;  3LIE A;  4RKU J;  2Y9Z A;  1DD3 A;  3EFG A;  1XTG B;  1VL2 A;  2E76 B;  2WPS A;  2QM7 A;  3AE3 C;  1RHZ B;  1XTC C;  1HVV A;  1LTB C;  2AXC A;  3H1L E;  1Y9B A;  2E42 A;  1IFJ A;  2JP3 A;  2K9Y A;  2V7Q H;  3HD7 D;  3L70 J;  2OYI B;  4IFD K;  2KZJ A;  2AEM A;  4WY4 C;  3GF3 A;  2IX7 C;  4OWF A;  3RK2 B;  1IC2 A;  2IBZ I;  1K9M Q;  1BSN A;  2J59 M;  4H44 D;  1RF0 C;  2G3A A;  4OVN F;  2BCC J;  3HUS A;  4Y28 J;  3RGU A;  3TSI A;  1GU4 A;  3TGU G;  1T2K D;  1Q86 Q;  1SQB K;  1BE3 G;  2WQY C;  3IAO A;  3O6Q A;  3GMA A;  4RJT A;  2E43 A;  2ZVN B;  3HRN A;  1KTM A;  2FYN C;  2H8P D;  3A2A A;  3G9R A;  1OW7 A;  2MKV A;  2W27 A;  2Y0E A;  3CI9 A;  3TK1 A;  3CX5 H;  3VN0 A;  1YJW P;  3H1I G;  2Z4E A;  1SQP K;  2P10 A;  2QIW A;  1EZV I;  4ZMD A;  1E79 H;  4OH8 B;  1H88 A;  2OYH B;  2WZ7 A;  3RK3 D;  3VP9 A;  1WRG A;  1M1J C;  2HG5 D;  3GHG C;  3D70 A;  3G3Z A;  2KS1 B;  3L37 A;  3OW2 O;  1RE3 A;  3H25 A;  1AQ5 A;  1X22 A;  1T6A A;  3V2Q A;  3CMA P;  4RO0 A;  2P7J A;  1PP9 E;  1BCC G;  4B86 A;  4WWI A;  3CWB G;  4BRY B;  2Y9Y A;  1N7L A;  1NTZ E;  2JEE A;  5CCH C;  1LNQ A;  1AV1 A;  2ZVO B;  1LJ2 A;  1ZXG A;  2AXT H;  2FYU K;  1T3J A;  2FYU D;  2O3J A;  2J5U A;  5GTH H;  3U59 A;  1AFO A;  5TIS E;  3CXH E;  5H2F H;  1JO5 A;  1L2P A;  1SQP G;  2GUS A;  2ZJS E;  2RKL A;  3LW5 H;  4GOE A;  1OFC X;  5AW8 B;  2C0X A;  3CLQ A;  1X79 B;  3L71 G;  5TJH A;  5KLI B;  2A45 I;  2K3R A;  1KIL B;  5GTI E;  2OTJ P;  1SQV K;  1Y8A A;  2YO2 A;  1LTG C;  5AVT B;  2E74 D;  5AW2 B;  4YXD C;  5B66 E;  2Q3E A;  2Q6Q A;  4PV1 B;  4KJM A;  1CW5 A;  3BVH A;  3HE5 B;  2Q1K A;  2Y0C A;  2A45 H;  3Q2Y A;  1N73 C;  3PJS K;  4JYC A;  5KAI E;  1Y47 A;  1L4A B;  1LTJ A;  2KP8 A;  4XFJ A;  5APW A;  1K73 Q;  3D6Y A;  3CC2 P;  1KN7 A;  2XU6 A;  1NWQ A;  5AVW B;  2W6B A;  4MN4 C;  1LT1 A;  1OVU A;  2R5D A;  1IFP A;  2FYU G;  2NPS B;  3TNU A;  1KB9 I;  1IK9 A;  1JY3 N;  4YXW H;  3AE7 C;  3H1H D;  3NFQ A;  3L4F A;  3H1L J;  2Q9I A;  2IZ1 A;  1J1E C;  1PGP A;  2XV5 A;  1L0L K;  1JB0 J;  1NTK J;  4I7Z C;  3V4Q A;  3CCR P;  1SQV G;  1RY3 A;  2J58 A;  1KD1 Q;  1L0N G;  3VMZ A;  1NHL A;  3CCJ P;  1PP9 D;  3S1K A;  4RES B;  2YKQ A;  2OGU A;  3E7K A;  3KDP B; 
#chains in the Genus database with same CATH homology
 3MZW B;  2KIK A;  1BDD A;  3ZDM A;  1ZW0 A;  4HJG H;  1JM0 A;  4NPD A;  5EFW B;  2QRX A;  1LP1 A;  1EDK A;  4K35 A;  4BXL A;  2B89 A;  2M0B A;  2UWJ E;  4NPF X;  3QWO C;  4CPG A;  2M5A B;  2P58 A;  1X0T A;  1S3J A;  1Q2N A;  1FC2 C;  2KI7 B;  4ASV A;  1EDL A;  5DJT B;  5K5G B;  4GOF A;  3FXE A;  1LP1 B;  4HB1 A;  2HR3 A;  2KZJ A;  4JBZ A;  2ZAE B;  3RGU A;  5CBN A;  2SPZ A;  1OVR A;  1U7M A;  2B87 A;  4ASW A;  2B88 A;  1NVO A;  4ZMD A;  5CBO A;  2KS1 B;  4HKZ H;  2I8D A;  1EC5 A;  4K3A A;  2KUB A;  4WWI A;  1BDC A;  1EDJ A;  1ZXG A;  2M5A A;  4GOD A;  1U7J A;  4NPE A;  3FXD A;  4GOE A;  2RKL A;  4ZNC A;  2K3R A;  2OTK E;  4KJM A;  1JMB A;  2Q1K A;  2JWD A;  1Y47 A;  1SS1 A;  1DEE G;  2B87 B;  1H0T B;  4MN4 C;  1LT1 A;  1H0T A;  1OVU A;  2LXC B;  1MFT A;  5C39 A;  4EYY Q;  2KZI A;  2WMM A;  2LR2 A;  3PH0 A;  1OVV A;  4IOI H;  5DJU B;  1EDI A;  2R44 A;  3S1K A;  2QVA A;  3MHV A;  2LXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...