3WUUA

Structure basis of inactivating cell abscission with chimera peptide 1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
b'AMGSFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Centrosomal protein of 55 kDa
molecule tags Cell cycle
source organism Homo sapiens
publication title Structural and biochemical insights into the role of testis-expressed gene 14 (TEX14) in forming the stable intercellular bridges of germ cells
pubmed doi rcsb
total genus 22
structure length 54
sequence length 54
chains with identical sequence B, D, E, G, H, J, K
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12180 EABR TSG101 and ALIX binding domain of CEP55
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 3wuuA00
2ZXXA 2Q6QA 1UIIA 3WUTA 3E1RA 4BRYA 3WUUA 4BRYB 3F5HA 3WUVA 2WVRA
chains in the Genus database with same CATH superfamily
1L0LG 1FU1A 3M0DA 2K9JB 2IYPA 1RY3A 2IPPA 3Q3DA 2OYHA 1IFIA 2JP3A 2P10A 1VQNP 5APYA 2HG5D 2JWAA 5KJ7D 3RL0g 3II6A 1G2CB 2ZT9B 2KS1B 1S3JA 5B5EE 3A5TA 1IFNA 2H8PD 2L91A 2YNYA 4K3AA 3D71A 2E74D 2OTKE 2ZXEB 2WSFJ 3CCMP 4XFJA 1BGYD 1G1IA 1LT9A 1PGJA 1S5LH 1VQ4P 3Q2YA 3L71D 2Y0DA 3V2QA 2OYIC 5K5GB 4DCKA 3LW5H 2W8ZA 3H1JJ 1L0LD 1NOHA 4NPDA 1OVUA 5E79E 3KZIH 5AW4B 3RL0C 4TLFA 4Y99B 1GMJA 1P84H 1JCCA 2O1KA 4IFMA 1AVYA 1SQVG 4D6TJ 4C7NB 1JY3O 2E75C 1YI2P 3B5ND 2OYIA 3VN0A 1AVOA 5TJHA 1M7LA 1W5CE 1KYOD 1BE3J 5KLVK 3GHGA 5AVUB 1T2KC 1KZUB 5BU8B 5APUA 3CI9A 2C9NY 5GTIH 5AVRB 1FZBA 3L4FA 2OYHC 4H44B 3VP9A 5KJ7A 1NTZK 4C7RA 3IAOA 1M57D 4D6TE 2I8DA 2B87B 2ZXXA 2CPBA 1ZRTD 2WTYA 3AEDC 4DJGA 3CCUP 1RF0C 2K9YA 3IR9A 1LTJB 2OGUA 1NTMJ 2A06D 1RE4C 2RH0A 5KAFH 4QMAA 2YIUC 1IFJA 1RQUA 2WPRA 2PRRA 3L73G 2HPCB 2ZVOB 1KMIZ 1ZXGA 1LGHB 2FYZA 3KYQA 1ZP0C 3BCCG 5C39A 1PGPA 3JCUE 1S1CX 2E75B 3CL3D 3UIAA 2QA4P 2R5BA 4KT0J 3PH0A 2HODB 2R3SA 3CC7P 2V4HA 1BSHA 3C8VA 2ZYDA 3G3ZA 5M1BA 3SFEC 2WSEJ 1LT9C 1HJ0A 1KILA 1HVVA 2FFDB 1NU1D 1K05A 1KYOE 1L0NK 2CPSA 3H1KE 1GD2E 2KNCB 2VRSA 4GKGA 3HRNA 1QEXA 3CD6P 1VQ5P 1NTKG 1VF5D 1X79B 4EDFA 4GDOA 1DH3A 4UB6H 2IFNA 1CI6A 2B89A 2KZJA 2A45H 3CWBG 1SQBJ 1OVVA 2Q6QA 3M0DC 1YTZI 2NPSD 2B87A 3H1JG 3QH9A 2BEQD 1FZCA 1QL1A 1RF0A 3HE4A 2A06E 5APSA 2IX7C 4L75A 3HE5A 1ZR4A 4H13B 4WBAA 1LTTC 1KC8Q 3OA7A 2Y9YA 3W67A 3NXSA 1SFCA 2QE7H 4IFFA 3O8ZA 4WB4A 3L70E 4GT1A 2KIKA 2KK7A 4EYYQ 1PV3A 2AEJA 1KILE 2WSEH 3TYYA 2WSSH 2YO2A 1S9KE 5AW0B 4GOEA 4OH8B 3CCSP 5AW8B 5AVSB 1SQXD 4HB1A 1U7MA 1K8AQ 1NWQA 1YYCA 5TISE 1EC5A 2IYOA 1PFIA 1RF1C 2AXTH 2YO3A 2WPQA 2O1JA 1JY3P 1LTBC 3L72J 2H89C 1BCCE 1SQQE 2A45G 2W27A 5AVZB 5AVXB 2QVAA 3BCCE 1ZV8A 3SWKA 3A3YB 3AE3C 1VF5C 3L75G 2KI7B 4PV1B 5GTHE 4OGQD 2Y0CA 3WU2E 2D2CD 3M0AA 3ITKA 1L4AD 1IJDB 3L70G 4GODA 2KYVA 4PJ0E 2C9LY 4AUWA 2QJKC 3S4RA 1M1KQ 1YQ4C 1URQA 1BSNA 1AJYA 1MFZA 1PZQA 1SQVE 2FKWB 5KKZB 5AVVB 1KN7A 2QG4A 4U3FJ 5AW3B 2E43A 3TF5A 2M3EA 2GUVA 1Y47A 1H0TB 3L70D 3CCEP 3CWBJ 1KD1Q 1JEKA 1ZR2A 2PAJA 1KB9E 2QM8A 3L75D 2L5GB 1NTZJ 1NKNA 3CX5D 3HUSA 3U1AA 1VQ8P 3P7KA 1N7SD 1R5LA 1VQPP 3H1IE 3OJAB 3V6IA 2OTJP 3NFQA 3N7NA 2WITA 3BRTB 3LW5J 1USDA 1SQPE 2N1TA 3AE5C 3USSA 4W7YA 1BCCD 1SQQD 2SPZA 4B86A 3G6EP 1AV1A 3AEFC 1HTLC 2E76D 2M0BA 3BCCD 4N6JA 3V2NA 1USEA 2QJPC 4DZOA 5CBNA 3I5CA 1URQD 4OGQC 2FXPA 4U3FD 1FZCC 1LJ2A 1OWAA 1LWUC 2JKVA 2GM4A 3K5BA 1KFMA 1L4AC 3L74J 2A45I 3H32B 2KLVA 3RBXA 3L72G 5AVTB 1EZVI 1BGYG 2YXQB 1LTIC 3CXHH 3HE4B 1W2BO 2NZ2A 1VQ7P 1RE3A 2OTLP 1LTJC 3N4XA 1UIXA 2RMZA 4I1LA 4N78D 1EZVE 3A0BH 4WWIA 1N73A 2IBZE 2WSCJ 3G9RA 1QLED 3H1LG 1PP9G 2P7JA 3PTZA 1Z56A 3SFDC 3TGUJ 1GK4A 1MUUA 3CLQA 1KILC 4RKUJ 4BRYB 1KB9D 1L0ND 2NRGA 1SQQK 2O01J 2PGDA 1N86A 3CX5E 4I2LC 1N7SC 1OW7A 2AXCA 4N3YB 1NU1K 5APTA 3CCVP 1EXIA 1P84I 1M1JA 1MFTA 3WUVA 1OZHA 2C0XA 5B66E 1FZAA 1LTSC 3L74E 3V2PA 1IC2A 1HGZA 1NTZG 2HYNA 1SFCD 3OAKA 4UB8H 3VMAA 2N1TB 5CJ4A 3D6YA 1YQ3C 1HH0A 3LIDA 2KS1A 3MUDC 2JJLA 3FWLA 2WWWA 2YXRB 3P32A 3JC22 3PRJA 4Z1MH 2RKLA 3Q5PA 2XZRA 4U3FG 1GTWA 1NJIQ 3AE4C 2ZYGA 1QX8A 1SQPJ 3A2AA 3E7KA 1QL2A 2R3CA 2FYNC 1OW6A 1NKZB 1S2EA 3L72D 5H2FE 2B88A 2WSCH 3A0HH 3JSVC 3L73D 3RK2D 2Q9IA 1WRGA 2FYUJ 1SQBD 3CXHD 1UIIA 4H0LB 2PFXA 4L73A 1EZVD 4NPEA 3RBZA 5KJ7C 1BDDA 3M9HA 3H1HE 2E74C 2V7QH 5AW1B 3MUDA 1KILB 1YBKA 2QEXP 5CCGA 1HWTC 3EWKA 1LTGC 2OQQA 2POHA 1BGYE 3H1IG 1K04A 5CJ0A 3TGUD 1EDLA 2H88C 4U3FE 1IFPA 1L0NE 3SWYA 2WPVB 1EQ7A 3PP5A 2Q7CA 2XKMA 4IL6H 1FDOA 1SQVJ 2KSJA 4M3LA 1DD3A 4WY4A 2WPSA 3RL0D 2N9BA 5AW7B 2BASA 3VTPC 1LT1A 1LTAC 1P84D 3CCRP 3CC2P 2M8RA 4PD4I 1NTKK 1JOCA 3KHUA 3MP7B 1OMIA 1HGVA 3H1HG 3P8MC 3G4SP 1Q7YQ 3RK3B 2W6BA 3GLMA 2G8YA 4ZMDA 3VMXA 5KAIH 1Q81Q 5CCHD 2KLUA 1VF5B 2QRXA 3EQ2A 2KXPB 3H32A 4EI2A 5AVQB 1FDMA 1BE3E 1NHLA 4CPGA 1OVRA 1U7JA 3AEEC 3L72E 3AE1C 5APXA 1BE3G 3RK2C 3WUUA 1JMBA 1GU4A 1L0LE 1LNQA 2QJKB 2R5DA 4H0LC 1PL5A 4HJGH 2P1JA 1EZVG 2QJYB 4H44D 4HH2A 3O6QA 1VQOP 1BDCA 3RK3E 1HUCA 1FS0E 1DD4A 2QM7A 3PLNA 4L76A 4R4MA 2YKPA 4YXWH 2MJZA 2YKQA 3CWBD 3GHGB 3L70J 3S1KA 3NMDA 3MIWA 1VQKP 3B5NA 2ZT9C 3TNUA 4PD4H 2OARA 1RH5B 2Z5IA 1NTMG 3HUSB 4YXDC 3Q5RA 2KB7P 4Y28J 1M1JB 2HR3A 1VQ6P 2IZ0A 1ZRTE 3KPEA 3U59A 3HTKA 4OVNF 1VL2A 1OW8A 3PHLA 4D6TD 3CCQP 3AE9C 5CBOA 1YITP 1MZ9A 2OYIB 1VQ9P 1HBWA 2N1TD 4YTPC 2XDJA 5B5EH 3GW6A 2J59M 2IBZG 3H1LE 3M06A 4IOIH 3TK1A 4C46A 3B71A 2AEFA 1GZLA 2Q3IA 2QJPB 5CCHC 2LXBA 1N7SA 3D70A 1IK9A 1GK6A 1LP1A 4OGQB 1S5LE 2IZ1A 3WUTA 3KXDA 1L4AB 1JUNA 4ZKPA 2XNDH 5KLVG 2YKOA 2KZIA 3FX0A 4NPFX 1BE3D 5AW9B 5KTBA 3H1IJ 3SSUA 3CX5I 5KLIC 2NPSC 2QJYC 5E79H 2O3JA 3KZIE 3MHVA 4JBZA 4EOTA 1P84E 2K9JA 5L8RJ 5AW2B 1L0NG 3F89A 2Y9ZA 2OYHB 1LTJA 2BCCG 2FFDA 1JTHA 1DIPA 1DX7A 1NTZE 2BEZF 3V2RA 1ZN5A 3VMYA 1H88A 1PP9D 1FE6A 2P2UA 2H7HA 1KQSO 1JB0J 1DEBA 2G3AA 2I1KA 1MKMA 1JM0A 1LP1B 2Q3EA 3L71J 3AE7C 1S4XA 1IK7A 3E1IA 3FXEA 4RESB 3V4QA 5GTIE 3V4WA 1SQVK 1IFDA 2WMMA 4RJTA 5BVZA 1Q82Q 5CMZA 1M8OB 1A02F 1SP4A 1PGOA 3H1KG 4A7PA 3QWOC 1SQXJ 2Z5HA 2GUSA 2WQYC 1U57A 2R32A 3HE5B 1NYHA 4ASVA 1L0LK 4BWNA 4C7NA 1YIJP 5KAFE 1KFNA 1URQB 3GF3A 4HYTB 3ABVC 1SVFA 1L2PA 3IN6A 3CPWO 2Z4EA 1T6AA 1EDIA 2D2CC 1LT9B 4JYBA 3W68A 4ASWA 1KB9I 4GIFA 2FFDC 2ZAEB 3CXHI 3KQGA 3BATA 3O6QB 5BU5A 1OFCX 1GW3A 1JY3N 1PPJD 2XV5A 3JCUH 4U7JA 1N73C 1VDFA 1FZCB 1GU5A 1A02J 1JY2O 2YIUB 4W80A 3H1JE 1AA0A 4R4LA 2KSEA 3A7OA 1HF9A 2M3BA 1OX3A 1SQPG 1NAYA 2NPSA 1S5LX 3KDPB 3F5HA 1JY2P 1KYOH 3IF4A 5CCHA 3CMEP 1SS1A 3AEGC 3L37A 2K37A 3VYIA 2H43A 1NU1J 3HTKB 2KOGA 3H6PA 2KP8A 2Q1KA 4L74A 4UB6E 4AQRD 3HD7A 1QGKB 3L35A 3MGNA 3CMAP 1SQXK 1KQFB 3BASA 3GMAA 4WY4D 1N7SB 1FZGA 1Q86Q 1FJPA 2HODA 2LXCB 1SQPD 1X9VA 2E76C 1R8EA 2IBZI 1NU1G 2MKVA 3Q5SA 2BCCJ 1CSBA 2WZ7A 4MN4C 1QVFO 3MTUE 1J2JB 1T2KD 2HPCA 2LR2A 1SLQA 1G1JA 2WSFH 1FC2C 3LIEA 2ITAA 1N73B 3M9QA 1RQVA 4I7ZC 1ZMEC 1VPCA 1JMMA 2QSIA 1JTHB 1YJWP 1CI6B 2FYUK 3H1ID 2FBWC 1D7MA 3H1JD 5TISH 2W83C 1X8YA 3TDKA 5DJTB 1OIPA 2AXTE 3L74G 2YMYA 1Y8AA 1YTZT 4WVZA 1XTGB 2FXOA 1BGYJ 3B8EB 2ZJSE 3CWBE 3R4YA 4YPCA 4KJMA 5CHXA 3VMZA 1IZNB 2UWJE 3PJSK 2E74B 1GL2A 2HFED 3FGAD 5GTHH 1FOSF 1KV4A 1VQLP 4JPZB 1AQTA 1PP9J 3WU2H 2R44A 2Y0EA 4K35A 4OWFA 3U1CA 1RF1B 3SWFA 2FYUE 1PPJE 2I1JA 1NO4A 4LGDE 2YMKA 4O9BA 3C1LA 4PJ0H 5AVWB 1TU3F 3HD7B 3MZWB 4WY4C 1EXJA 3OW2O 1ZW0A 3VOPA 2E76B 1G2CA 3L74D 2W6JH 3AE6C 2E5TA 1L0LJ 3NTNA 3H1LD 5DJUB 1BCCG 1SQQG 2K1AA 2PP6A 3M91A 4BRYA 1Y9BA 2P58A 4DT0A 1SFCB 4PD4D 1KB9H 1W2EA 4W7ZA 1RE3C 5AW6B 5KLIB 3AEAC 1GL2B 1NTKE 2V7QJ 2ZYAA 1MV8A 3IFMA 2XNXA 5KKZC 3RGUA 1JNMA 1RE4A 1FZFA 3M9BA 5CCGD 1EDJA 2E5YA 1ZOYC 2JR8A 2K3RA 3MD0A 3RK2B 3E1RA 1NTZD 2KNCA 1H8AA 1T3UA 1OXZA 5APWA 4D6TG 1QVGO 4IFDK 3TGUE 2J5UA 4LC1A 4LLHA 1DEEG 1KQGB 5KLVD 3GHGC 1S9KD 1WMKA 4KHXA 2WT7A 2CK3H 3HD7C 3S9OA 1E79H 1N8RQ 1SQBE 1J1DB 3CXHE 4ZNCA 3CCLP 2ZVNB 3AE2C 3HUSC 1SQVD 3L73E 3I56P 3H25A 3L71G 3CCJP 1M1JC 3H1HD 2O01H 2OYOA 2M5AA 3A0BE 1K9MQ 3L36A 3ZDMA 1T3JA 1GW4A 1LWUB 2AEMA 3H1KJ 1PPJG 1T8ZA 1Q2NA 1H0TA 1GL2C 1Q90D 5APQA 3D6ZA 1FJKA 3L75E 3CX5H 4H0LD 3TNUB 1WT6A 1JCDA 2FYUD 4HKZH 1R5SA 3GG2A 3H1LJ 3L73J 4H44C 4RO0A 5CCGC 3AE8C 1ZLLA 4EIJA 5B66H 1KORA 1NAFA 2FYNB 4JYCA 3WMM0 1BCCJ 4JF7A 2NPSB 4UB8E 1PGQA 3VP8A 2FYUG 3P8CE 4ZKUA 1H89A 1JY2N 1NU1E 2ZT9D 2B9BA 1LWUA 1K73Q 3AEBC 4H13D 4JQ0D 1CW5A 1RF1A 1NTME 2IDBA 3R2PA 1HJBA 2QIWA 3C9IA 2FY8A 2Q5UA 2JEEA 1KYOI 1NTKD 1NVOA 5EFWB 3HD7D 5KLVE 1J1DC 5H2FH 3A0HE 2N1TC 4GOFA 3EFGA 2WT7B 2XU6A 2ZFCA 2FXMA 4IL6X 3RK3D 1PIXA 1IFMA 2IBZD 4N78E 1NTMK 1NTKJ 3TSIA 1CZQA 3T97B 3B5NB 4BXLA 3H1KD 1N7LA 2C0WA 1FOSE 1SQBG 1GL2D 1FBMA 4AYCA 1YJNP 3V5BA 1VQMP 1M90Q 1KQLA 3BRVB 3FXDA 4I7ZB 5AVYB 1URQC 1J1EB 2BCCD 4IL6E 1GDTA 2E42A 4XA4A 1YHQP 1EDKA 2KUBA 4PV1D 3FWNA 3TGUG 2D2CB 2JDIH 4I6MC 1SQBK 1SQXE 1YJ9P 2RN0A 1IO4A 1FZEA 3Q1MA 1AQ5A 5KLVJ 1AFOA 1FAVA 1JO5A 2W90A 1NH4A 1KTMA 1S72P 1PP9E 1NGMB 3P8CD 5KAIE 3G71P 4H13C 1XTCC 2DW3A 2JO1A 2IFMA 1L0NJ 1L4AA 3T97A 3L71E 2W6AA 1KILD 2HLOA 3I55P 4TT3H 1NTMD 3EFFK 3CC4P 1N2DC 3B4SA 1M56D 1SQPK 3GF7A 3H1HJ 4WY4B 1E5WA 2M5AB 2GA1A 3RK3C 3RL0B 3AECC 4Y99C 5AW5B 3L75J 2A06G 2E75D 2JWDA 3B5NC 1X22A 2N9YB 2WVRA 2P67A 1FDIA 1SFCC 1SQXG 5APVA 4DOJA 2K88A 2LKMA 1J1EC 2O01N 3BCCJ 2BCCE 4PD4E 1X0TA 3BVHA 4XE5B 1RHZB 2J58A 1SQQJ 4PV1C
chains in the Genus database with same CATH topology
2ZXXA 2Q6QA 1UIIA 3WUTA 3E1RA 4BRYA 3WUUA 4BRYB 3F5HA 3WUVA 2WVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXX A;  2Q6Q A;  1UII A;  3WUT A;  3E1R A;  4BRY A;  3WUU A;  4BRY B;  3F5H A;  3WUV A;  2WVR A; 
#chains in the Genus database with same CATH topology
 1L0L G;  1FU1 A;  3M0D A;  2K9J B;  2IYP A;  1RY3 A;  2IPP A;  3Q3D A;  2OYH A;  1IFI A;  2JP3 A;  2P10 A;  1VQN P;  5APY A;  2HG5 D;  2JWA A;  5KJ7 D;  3RL0 g;  3II6 A;  1G2C B;  2ZT9 B;  2KS1 B;  1S3J A;  5B5E E;  3A5T A;  1IFN A;  2H8P D;  2L91 A;  2YNY A;  4K3A A;  3D71 A;  2E74 D;  2OTK E;  2ZXE B;  2WSF J;  3CCM P;  4XFJ A;  1BGY D;  1G1I A;  1LT9 A;  1PGJ A;  1S5L H;  1VQ4 P;  3Q2Y A;  3L71 D;  2Y0D A;  3V2Q A;  2OYI C;  5K5G B;  4DCK A;  3LW5 H;  2W8Z A;  3H1J J;  1L0L D;  1NOH A;  4NPD A;  1OVU A;  5E79 E;  3KZI H;  5AW4 B;  3RL0 C;  4TLF A;  4Y99 B;  1GMJ A;  1P84 H;  1JCC A;  2O1K A;  4IFM A;  1AVY A;  1SQV G;  4D6T J;  4C7N B;  1JY3 O;  2E75 C;  1YI2 P;  3B5N D;  2OYI A;  3VN0 A;  1AVO A;  5TJH A;  1M7L A;  1W5C E;  1KYO D;  1BE3 J;  5KLV K;  3GHG A;  5AVU B;  1T2K C;  1KZU B;  5BU8 B;  5APU A;  3CI9 A;  2C9N Y;  5GTI H;  5AVR B;  1FZB A;  3L4F A;  2OYH C;  4H44 B;  3VP9 A;  5KJ7 A;  1NTZ K;  4C7R A;  3IAO A;  1M57 D;  4D6T E;  2I8D A;  2B87 B;  2ZXX A;  2CPB A;  1ZRT D;  2WTY A;  3AED C;  4DJG A;  3CCU P;  1RF0 C;  2K9Y A;  3IR9 A;  1LTJ B;  2OGU A;  1NTM J;  2A06 D;  1RE4 C;  2RH0 A;  5KAF H;  4QMA A;  2YIU C;  1IFJ A;  1RQU A;  2WPR A;  2PRR A;  3L73 G;  2HPC B;  2ZVO B;  1KMI Z;  1ZXG A;  1LGH B;  2FYZ A;  3KYQ A;  1ZP0 C;  3BCC G;  5C39 A;  1PGP A;  3JCU E;  1S1C X;  2E75 B;  3CL3 D;  3UIA A;  2QA4 P;  2R5B A;  4KT0 J;  3PH0 A;  2HOD B;  2R3S A;  3CC7 P;  2V4H A;  1BSH A;  3C8V A;  2ZYD A;  3G3Z A;  5M1B A;  3SFE C;  2WSE J;  1LT9 C;  1HJ0 A;  1KIL A;  1HVV A;  2FFD B;  1NU1 D;  1K05 A;  1KYO E;  1L0N K;  2CPS A;  3H1K E;  1GD2 E;  2KNC B;  2VRS A;  4GKG A;  3HRN A;  1QEX A;  3CD6 P;  1VQ5 P;  1NTK G;  1VF5 D;  1X79 B;  4EDF A;  4GDO A;  1DH3 A;  4UB6 H;  2IFN A;  1CI6 A;  2B89 A;  2KZJ A;  2A45 H;  3CWB G;  1SQB J;  1OVV A;  2Q6Q A;  3M0D C;  1YTZ I;  2NPS D;  2B87 A;  3H1J G;  3QH9 A;  2BEQ D;  1FZC A;  1QL1 A;  1RF0 A;  3HE4 A;  2A06 E;  5APS A;  2IX7 C;  4L75 A;  3HE5 A;  1ZR4 A;  4H13 B;  4WBA A;  1LTT C;  1KC8 Q;  3OA7 A;  2Y9Y A;  3W67 A;  3NXS A;  1SFC A;  2QE7 H;  4IFF A;  3O8Z A;  4WB4 A;  3L70 E;  4GT1 A;  2KIK A;  2KK7 A;  4EYY Q;  1PV3 A;  2AEJ A;  1KIL E;  2WSE H;  3TYY A;  2WSS H;  2YO2 A;  1S9K E;  5AW0 B;  4GOE A;  4OH8 B;  3CCS P;  5AW8 B;  5AVS B;  1SQX D;  4HB1 A;  1U7M A;  1K8A Q;  1NWQ A;  1YYC A;  5TIS E;  1EC5 A;  2IYO A;  1PFI A;  1RF1 C;  2AXT H;  2YO3 A;  2WPQ A;  2O1J A;  1JY3 P;  1LTB C;  3L72 J;  2H89 C;  1BCC E;  1SQQ E;  2A45 G;  2W27 A;  5AVZ B;  5AVX B;  2QVA A;  3BCC E;  1ZV8 A;  3SWK A;  3A3Y B;  3AE3 C;  1VF5 C;  3L75 G;  2KI7 B;  4PV1 B;  5GTH E;  4OGQ D;  2Y0C A;  3WU2 E;  2D2C D;  3M0A A;  3ITK A;  1L4A D;  1IJD B;  3L70 G;  4GOD A;  2KYV A;  4PJ0 E;  2C9L Y;  4AUW A;  2QJK C;  3S4R A;  1M1K Q;  1YQ4 C;  1URQ A;  1BSN A;  1AJY A;  1MFZ A;  1PZQ A;  1SQV E;  2FKW B;  5KKZ B;  5AVV B;  1KN7 A;  2QG4 A;  4U3F J;  5AW3 B;  2E43 A;  3TF5 A;  2M3E A;  2GUV A;  1Y47 A;  1H0T B;  3L70 D;  3CCE P;  3CWB J;  1KD1 Q;  1JEK A;  1ZR2 A;  2PAJ A;  1KB9 E;  2QM8 A;  3L75 D;  2L5G B;  1NTZ J;  1NKN A;  3CX5 D;  3HUS A;  3U1A A;  1VQ8 P;  3P7K A;  1N7S D;  1R5L A;  1VQP P;  3H1I E;  3OJA B;  3V6I A;  2OTJ P;  3NFQ A;  3N7N A;  2WIT A;  3BRT B;  3LW5 J;  1USD A;  1SQP E;  2N1T A;  3AE5 C;  3USS A;  4W7Y A;  1BCC D;  1SQQ D;  2SPZ A;  4B86 A;  3G6E P;  1AV1 A;  3AEF C;  1HTL C;  2E76 D;  2M0B A;  3BCC D;  4N6J A;  3V2N A;  1USE A;  2QJP C;  4DZO A;  5CBN A;  3I5C A;  1URQ D;  4OGQ C;  2FXP A;  4U3F D;  1FZC C;  1LJ2 A;  1OWA A;  1LWU C;  2JKV A;  2GM4 A;  3K5B A;  1KFM A;  1L4A C;  3L74 J;  2A45 I;  3H32 B;  2KLV A;  3RBX A;  3L72 G;  5AVT B;  1EZV I;  1BGY G;  2YXQ B;  1LTI C;  3CXH H;  3HE4 B;  1W2B O;  2NZ2 A;  1VQ7 P;  1RE3 A;  2OTL P;  1LTJ C;  3N4X A;  1UIX A;  2RMZ A;  4I1L A;  4N78 D;  1EZV E;  3A0B H;  4WWI A;  1N73 A;  2IBZ E;  2WSC J;  3G9R A;  1QLE D;  3H1L G;  1PP9 G;  2P7J A;  3PTZ A;  1Z56 A;  3SFD C;  3TGU J;  1GK4 A;  1MUU A;  3CLQ A;  1KIL C;  4RKU J;  4BRY B;  1KB9 D;  1L0N D;  2NRG A;  1SQQ K;  2O01 J;  2PGD A;  1N86 A;  3CX5 E;  4I2L C;  1N7S C;  1OW7 A;  2AXC A;  4N3Y B;  1NU1 K;  5APT A;  3CCV P;  1EXI A;  1P84 I;  1M1J A;  1MFT A;  3WUV A;  1OZH A;  2C0X A;  5B66 E;  1FZA A;  1LTS C;  3L74 E;  3V2P A;  1IC2 A;  1HGZ A;  1NTZ G;  2HYN A;  1SFC D;  3OAK A;  4UB8 H;  3VMA A;  2N1T B;  5CJ4 A;  3D6Y A;  1YQ3 C;  1HH0 A;  3LID A;  2KS1 A;  3MUD C;  2JJL A;  3FWL A;  2WWW A;  2YXR B;  3P32 A;  3JC2 2;  3PRJ A;  4Z1M H;  2RKL A;  3Q5P A;  2XZR A;  4U3F G;  1GTW A;  1NJI Q;  3AE4 C;  2ZYG A;  1QX8 A;  1SQP J;  3A2A A;  3E7K A;  1QL2 A;  2R3C A;  2FYN C;  1OW6 A;  1NKZ B;  1S2E A;  3L72 D;  5H2F E;  2B88 A;  2WSC H;  3A0H H;  3JSV C;  3L73 D;  3RK2 D;  2Q9I A;  1WRG A;  2FYU J;  1SQB D;  3CXH D;  1UII A;  4H0L B;  2PFX A;  4L73 A;  1EZV D;  4NPE A;  3RBZ A;  5KJ7 C;  1BDD A;  3M9H A;  3H1H E;  2E74 C;  2V7Q H;  5AW1 B;  3MUD A;  1KIL B;  1YBK A;  2QEX P;  5CCG A;  1HWT C;  3EWK A;  1LTG C;  2OQQ A;  2POH A;  1BGY E;  3H1I G;  1K04 A;  5CJ0 A;  3TGU D;  1EDL A;  2H88 C;  4U3F E;  1IFP A;  1L0N E;  3SWY A;  2WPV B;  1EQ7 A;  3PP5 A;  2Q7C A;  2XKM A;  4IL6 H;  1FDO A;  1SQV J;  2KSJ A;  4M3L A;  1DD3 A;  4WY4 A;  2WPS A;  3RL0 D;  2N9B A;  5AW7 B;  2BAS A;  3VTP C;  1LT1 A;  1LTA C;  1P84 D;  3CCR P;  3CC2 P;  2M8R A;  4PD4 I;  1NTK K;  1JOC A;  3KHU A;  3MP7 B;  1OMI A;  1HGV A;  3H1H G;  3P8M C;  3G4S P;  1Q7Y Q;  3RK3 B;  2W6B A;  3GLM A;  2G8Y A;  4ZMD A;  3VMX A;  5KAI H;  1Q81 Q;  5CCH D;  2KLU A;  1VF5 B;  2QRX A;  3EQ2 A;  2KXP B;  3H32 A;  4EI2 A;  5AVQ B;  1FDM A;  1BE3 E;  1NHL A;  4CPG A;  1OVR A;  1U7J A;  3AEE C;  3L72 E;  3AE1 C;  5APX A;  1BE3 G;  3RK2 C;  3WUU A;  1JMB A;  1GU4 A;  1L0L E;  1LNQ A;  2QJK B;  2R5D A;  4H0L C;  1PL5 A;  4HJG H;  2P1J A;  1EZV G;  2QJY B;  4H44 D;  4HH2 A;  3O6Q A;  1VQO P;  1BDC A;  3RK3 E;  1HUC A;  1FS0 E;  1DD4 A;  2QM7 A;  3PLN A;  4L76 A;  4R4M A;  2YKP A;  4YXW H;  2MJZ A;  2YKQ A;  3CWB D;  3GHG B;  3L70 J;  3S1K A;  3NMD A;  3MIW A;  1VQK P;  3B5N A;  2ZT9 C;  3TNU A;  4PD4 H;  2OAR A;  1RH5 B;  2Z5I A;  1NTM G;  3HUS B;  4YXD C;  3Q5R A;  2KB7 P;  4Y28 J;  1M1J B;  2HR3 A;  1VQ6 P;  2IZ0 A;  1ZRT E;  3KPE A;  3U59 A;  3HTK A;  4OVN F;  1VL2 A;  1OW8 A;  3PHL A;  4D6T D;  3CCQ P;  3AE9 C;  5CBO A;  1YIT P;  1MZ9 A;  2OYI B;  1VQ9 P;  1HBW A;  2N1T D;  4YTP C;  2XDJ A;  5B5E H;  3GW6 A;  2J59 M;  2IBZ G;  3H1L E;  3M06 A;  4IOI H;  3TK1 A;  4C46 A;  3B71 A;  2AEF A;  1GZL A;  2Q3I A;  2QJP B;  5CCH C;  2LXB A;  1N7S A;  3D70 A;  1IK9 A;  1GK6 A;  1LP1 A;  4OGQ B;  1S5L E;  2IZ1 A;  3WUT A;  3KXD A;  1L4A B;  1JUN A;  4ZKP A;  2XND H;  5KLV G;  2YKO A;  2KZI A;  3FX0 A;  4NPF X;  1BE3 D;  5AW9 B;  5KTB A;  3H1I J;  3SSU A;  3CX5 I;  5KLI C;  2NPS C;  2QJY C;  5E79 H;  2O3J A;  3KZI E;  3MHV A;  4JBZ A;  4EOT A;  1P84 E;  2K9J A;  5L8R J;  5AW2 B;  1L0N G;  3F89 A;  2Y9Z A;  2OYH B;  1LTJ A;  2BCC G;  2FFD A;  1JTH A;  1DIP A;  1DX7 A;  1NTZ E;  2BEZ F;  3V2R A;  1ZN5 A;  3VMY A;  1H88 A;  1PP9 D;  1FE6 A;  2P2U A;  2H7H A;  1KQS O;  1JB0 J;  1DEB A;  2G3A A;  2I1K A;  1MKM A;  1JM0 A;  1LP1 B;  2Q3E A;  3L71 J;  3AE7 C;  1S4X A;  1IK7 A;  3E1I A;  3FXE A;  4RES B;  3V4Q A;  5GTI E;  3V4W A;  1SQV K;  1IFD A;  2WMM A;  4RJT A;  5BVZ A;  1Q82 Q;  5CMZ A;  1M8O B;  1A02 F;  1SP4 A;  1PGO A;  3H1K G;  4A7P A;  3QWO C;  1SQX J;  2Z5H A;  2GUS A;  2WQY C;  1U57 A;  2R32 A;  3HE5 B;  1NYH A;  4ASV A;  1L0L K;  4BWN A;  4C7N A;  1YIJ P;  5KAF E;  1KFN A;  1URQ B;  3GF3 A;  4HYT B;  3ABV C;  1SVF A;  1L2P A;  3IN6 A;  3CPW O;  2Z4E A;  1T6A A;  1EDI A;  2D2C C;  1LT9 B;  4JYB A;  3W68 A;  4ASW A;  1KB9 I;  4GIF A;  2FFD C;  2ZAE B;  3CXH I;  3KQG A;  3BAT A;  3O6Q B;  5BU5 A;  1OFC X;  1GW3 A;  1JY3 N;  1PPJ D;  2XV5 A;  3JCU H;  4U7J A;  1N73 C;  1VDF A;  1FZC B;  1GU5 A;  1A02 J;  1JY2 O;  2YIU B;  4W80 A;  3H1J E;  1AA0 A;  4R4L A;  2KSE A;  3A7O A;  1HF9 A;  2M3B A;  1OX3 A;  1SQP G;  1NAY A;  2NPS A;  1S5L X;  3KDP B;  3F5H A;  1JY2 P;  1KYO H;  3IF4 A;  5CCH A;  3CME P;  1SS1 A;  3AEG C;  3L37 A;  2K37 A;  3VYI A;  2H43 A;  1NU1 J;  3HTK B;  2KOG A;  3H6P A;  2KP8 A;  2Q1K A;  4L74 A;  4UB6 E;  4AQR D;  3HD7 A;  1QGK B;  3L35 A;  3MGN A;  3CMA P;  1SQX K;  1KQF B;  3BAS A;  3GMA A;  4WY4 D;  1N7S B;  1FZG A;  1Q86 Q;  1FJP A;  2HOD A;  2LXC B;  1SQP D;  1X9V A;  2E76 C;  1R8E A;  2IBZ I;  1NU1 G;  2MKV A;  3Q5S A;  2BCC J;  1CSB A;  2WZ7 A;  4MN4 C;  1QVF O;  3MTU E;  1J2J B;  1T2K D;  2HPC A;  2LR2 A;  1SLQ A;  1G1J A;  2WSF H;  1FC2 C;  3LIE A;  2ITA A;  1N73 B;  3M9Q A;  1RQV A;  4I7Z C;  1ZME C;  1VPC A;  1JMM A;  2QSI A;  1JTH B;  1YJW P;  1CI6 B;  2FYU K;  3H1I D;  2FBW C;  1D7M A;  3H1J D;  5TIS H;  2W83 C;  1X8Y A;  3TDK A;  5DJT B;  1OIP A;  2AXT E;  3L74 G;  2YMY A;  1Y8A A;  1YTZ T;  4WVZ A;  1XTG B;  2FXO A;  1BGY J;  3B8E B;  2ZJS E;  3CWB E;  3R4Y A;  4YPC A;  4KJM A;  5CHX A;  3VMZ A;  1IZN B;  2UWJ E;  3PJS K;  2E74 B;  1GL2 A;  2HFE D;  3FGA D;  5GTH H;  1FOS F;  1KV4 A;  1VQL P;  4JPZ B;  1AQT A;  1PP9 J;  3WU2 H;  2R44 A;  2Y0E A;  4K35 A;  4OWF A;  3U1C A;  1RF1 B;  3SWF A;  2FYU E;  1PPJ E;  2I1J A;  1NO4 A;  4LGD E;  2YMK A;  4O9B A;  3C1L A;  4PJ0 H;  5AVW B;  1TU3 F;  3HD7 B;  3MZW B;  4WY4 C;  1EXJ A;  3OW2 O;  1ZW0 A;  3VOP A;  2E76 B;  1G2C A;  3L74 D;  2W6J H;  3AE6 C;  2E5T A;  1L0L J;  3NTN A;  3H1L D;  5DJU B;  1BCC G;  1SQQ G;  2K1A A;  2PP6 A;  3M91 A;  4BRY A;  1Y9B A;  2P58 A;  4DT0 A;  1SFC B;  4PD4 D;  1KB9 H;  1W2E A;  4W7Z A;  1RE3 C;  5AW6 B;  5KLI B;  3AEA C;  1GL2 B;  1NTK E;  2V7Q J;  2ZYA A;  1MV8 A;  3IFM A;  2XNX A;  5KKZ C;  3RGU A;  1JNM A;  1RE4 A;  1FZF A;  3M9B A;  5CCG D;  1EDJ A;  2E5Y A;  1ZOY C;  2JR8 A;  2K3R A;  3MD0 A;  3RK2 B;  3E1R A;  1NTZ D;  2KNC A;  1H8A A;  1T3U A;  1OXZ A;  5APW A;  4D6T G;  1QVG O;  4IFD K;  3TGU E;  2J5U A;  4LC1 A;  4LLH A;  1DEE G;  1KQG B;  5KLV D;  3GHG C;  1S9K D;  1WMK A;  4KHX A;  2WT7 A;  2CK3 H;  3HD7 C;  3S9O A;  1E79 H;  1N8R Q;  1SQB E;  1J1D B;  3CXH E;  4ZNC A;  3CCL P;  2ZVN B;  3AE2 C;  3HUS C;  1SQV D;  3L73 E;  3I56 P;  3H25 A;  3L71 G;  3CCJ P;  1M1J C;  3H1H D;  2O01 H;  2OYO A;  2M5A A;  3A0B E;  1K9M Q;  3L36 A;  3ZDM A;  1T3J A;  1GW4 A;  1LWU B;  2AEM A;  3H1K J;  1PPJ G;  1T8Z A;  1Q2N A;  1H0T A;  1GL2 C;  1Q90 D;  5APQ A;  3D6Z A;  1FJK A;  3L75 E;  3CX5 H;  4H0L D;  3TNU B;  1WT6 A;  1JCD A;  2FYU D;  4HKZ H;  1R5S A;  3GG2 A;  3H1L J;  3L73 J;  4H44 C;  4RO0 A;  5CCG C;  3AE8 C;  1ZLL A;  4EIJ A;  5B66 H;  1KOR A;  1NAF A;  2FYN B;  4JYC A;  3WMM 0;  1BCC J;  4JF7 A;  2NPS B;  4UB8 E;  1PGQ A;  3VP8 A;  2FYU G;  3P8C E;  4ZKU A;  1H89 A;  1JY2 N;  1NU1 E;  2ZT9 D;  2B9B A;  1LWU A;  1K73 Q;  3AEB C;  4H13 D;  4JQ0 D;  1CW5 A;  1RF1 A;  1NTM E;  2IDB A;  3R2P A;  1HJB A;  2QIW A;  3C9I A;  2FY8 A;  2Q5U A;  2JEE A;  1KYO I;  1NTK D;  1NVO A;  5EFW B;  3HD7 D;  5KLV E;  1J1D C;  5H2F H;  3A0H E;  2N1T C;  4GOF A;  3EFG A;  2WT7 B;  2XU6 A;  2ZFC A;  2FXM A;  4IL6 X;  3RK3 D;  1PIX A;  1IFM A;  2IBZ D;  4N78 E;  1NTM K;  1NTK J;  3TSI A;  1CZQ A;  3T97 B;  3B5N B;  4BXL A;  3H1K D;  1N7L A;  2C0W A;  1FOS E;  1SQB G;  1GL2 D;  1FBM A;  4AYC A;  1YJN P;  3V5B A;  1VQM P;  1M90 Q;  1KQL A;  3BRV B;  3FXD A;  4I7Z B;  5AVY B;  1URQ C;  1J1E B;  2BCC D;  4IL6 E;  1GDT A;  2E42 A;  4XA4 A;  1YHQ P;  1EDK A;  2KUB A;  4PV1 D;  3FWN A;  3TGU G;  2D2C B;  2JDI H;  4I6M C;  1SQB K;  1SQX E;  1YJ9 P;  2RN0 A;  1IO4 A;  1FZE A;  3Q1M A;  1AQ5 A;  5KLV J;  1AFO A;  1FAV A;  1JO5 A;  2W90 A;  1NH4 A;  1KTM A;  1S72 P;  1PP9 E;  1NGM B;  3P8C D;  5KAI E;  3G71 P;  4H13 C;  1XTC C;  2DW3 A;  2JO1 A;  2IFM A;  1L0N J;  1L4A A;  3T97 A;  3L71 E;  2W6A A;  1KIL D;  2HLO A;  3I55 P;  4TT3 H;  1NTM D;  3EFF K;  3CC4 P;  1N2D C;  3B4S A;  1M56 D;  1SQP K;  3GF7 A;  3H1H J;  4WY4 B;  1E5W A;  2M5A B;  2GA1 A;  3RK3 C;  3RL0 B;  3AEC C;  4Y99 C;  5AW5 B;  3L75 J;  2A06 G;  2E75 D;  2JWD A;  3B5N C;  1X22 A;  2N9Y B;  2WVR A;  2P67 A;  1FDI A;  1SFC C;  1SQX G;  5APV A;  4DOJ A;  2K88 A;  2LKM A;  1J1E C;  2O01 N;  3BCC J;  2BCC E;  4PD4 E;  1X0T A;  3BVH A;  4XE5 B;  1RHZ B;  2J58 A;  1SQQ J;  4PV1 C; 
#chains in the Genus database with same CATH homology
 2ZXX A;  2Q6Q A;  1UII A;  3WUT A;  3E1R A;  4BRY A;  3WUU A;  4BRY B;  3F5H A;  3WUV A;  2WVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...