3WUUA

Structure basis of inactivating cell abscission with chimera peptide 1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
b'AMGSFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Centrosomal protein of 55 kDa
publication title Structural and biochemical insights into the role of testis-expressed gene 14 (TEX14) in forming the stable intercellular bridges of germ cells
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 22
structure length 54
sequence length 54
chains with identical sequence B, D, E, G, H, J, K
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12180 EABR TSG101 and ALIX binding domain of CEP55
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 3wuuA00
2ZXXA 4BRYA 4BRYB 3WUUA 1UIIA 2Q6QA 3F5HA 3WUTA 3WUVA 3E1RA 2WVRA
chains in the Genus database with same CATH superfamily
3L74G 1G1IA 3P8CE 1PIXA 3L72D 1IFDA 3CXHI 3O6QA 4EIJA 1Q90D 2ZYAA 3A3YB 1RE3A 1JY3P 1LWUA 1SP4A 1PP9J 5H2FE 1NTMD 5APXA 4O9BA 5AW8B 4K35A 1M1JB 2FYUK 1WMKA 2WQYC 4GOEA 2M0BA 1BGYJ 3JSVC 1LTJB 4AYCA 1FDOA 3A5TA 3VMYA 3MUDC 3TNUA 2KI7B 3H1JG 4IL6H 3L74D 1HJBA 1SLQA 1WT6A 4PV1C 3W68A 1RE4A 1L0LK 3HD7A 1AVYA 2QE7H 3I56P 1VQ8P 2QJPB 3HE4B 1FU1A 3AEDC 2RKLA 1LGHB 2ZYDA 1SQPK 2V7QH 3AE6C 1KD1Q 3RL0B 1G2CB 3PJSK 1YIJP 1AJYA 1RHZB 2Y9ZA 3GF7A 2OYHC 1KQLA 1PGOA 2KXPB 1CI6A 2ZXEB 2FFDB 5AW0B 1CZQA 2RN0A 3M9BA 1GL2A 3BASA 3KQGA 1N7LA 1M1JC 1M56D 3NTNA 1VQ4P 4XA4A 1KB9E 3M9QA 1EC5A 3HTKB 4OGQD 2H7HA 4B86A 1OIPA 3R2PA 2B88A 4YXDC 1SQVG 2WSFJ 1P84I 1EDJA 1J2JB 2FYUE 3L75E 2YMYA 1LTGC 1HGZA 4IL6X 1HWTC 1KILB 2QJYB 4IL6E 4GDOA 4JF7A 3UIAA 2QJPC 1BCCG 1URQA 3LIDA 3QH9A 5APVA 1YHQP 3CMEP 2J59M 3RL0C 1JO5A 4L74A 1UIXA 3L72E 3TK1A 2HPCB 1VQPP 1M8OB 3HUSB 1NTKJ 2GA1A 1M90Q 1LNQA 3H25A 1SQVD 1NTME 3RK3B 1YQ3C 2FFDC 1P84H 1Q86Q 3MP7B 4W80A 3U1AA 1Z56A 1LTBC 3Q5RA 3L36A 4Y28J 1LT9A 5KLIC 1BE3G 1BCCD 3AE4C 2M3EA 1KYOD 2JJLA 3L74E 4U3FJ 3H1KG 2N1TD 4I7ZB 3RK2C 1SQXJ 1N7SC 2QJYC 1VQKP 4ZKPA 4YXWH 1DIPA 2D2CD 4IFMA 1FZEA 3GHGA 4W7ZA 1Q7YQ 1X8YA 3AECC 1BE3D 3T97B 1PL5A 1JNMA 5KJ7D 2WSEJ 1NVOA 1QVFO 3H1KD 1L0NJ 2XNXA 3B5NB 5CCHA 1GDTA 2ZYGA 1DD3A 2KNCA 1KYOH 2W83C 1U7JA 1SQQG 2O01J 2C9LY 3VMAA 1NU1G 5CJ0A 2OGUA 3L4FA 5AW5B 3TF5A 3H1IG 2NRGA 4I1LA 1USEA 2O1JA 2KS1B 3AEEC 2FXOA 1NH4A 1KN7A 1NO4A 1PPJG 3MTUE 2JP3A 3FXDA 1AVOA 5B66H 3L71D 4PD4I 2AXTH 1H88A 1JY2P 4IFDK 1RF1C 1BSHA 4WY4D 4HKZH 1EZVG 1SQQD 4C7NB 1XTGB 5CCGC 1HBWA 1USDA 1JY3O 2IFNA 3H1ID 3C1LA 5KAIH 1NOHA 1T2KC 2ZVOB 1R8EA 1PPJD 3N4XA 1FZGA 1GU4A 1SQVE 1G1JA 2KLUA 3CCRP 3GMAA 4PD4H 1FAVA 4ASWA 1JY2N 2W6BA 2G8YA 2IFMA 1M1JA 1ZW0A 1WRGA 2YKOA 2IBZG 1BCCE 2YO2A 2I1KA 3MD0A 1LTJA 2E74D 1D7MA 1OFCX 3VOPA 1RY3A 1KYOE 3CWBG 1JOCA 1VF5D 3CCLP 3K5BA 3CCQP 4ASVA 3Q5SA 1HTLC 3CL3D 4C7RA 2KZIA 4OH8B 4RESB 1GZLA 3KDPB 2E76B 1YI2P 2Z4EA 3AE1C 3HE4A 4Y99B 5APQA 2KP8A 2IBZD 1BE3E 2OQQA 1GW4A 3H1LG 3B8EB 1G2CA 1YJ9P 1EDLA 3CWBD 4RKUJ 3M91A 3H1KE 5TJHA 1YQ4C 1J1DC 3FWLA 3AE9C 1J1EB 3LIEA 5AVTB 3AE3C 2FFDA 1HVVA 5BVZA 3II6A 1JB0J 1H0TB 2WITA 2WSCJ 1FOSF 4C46A 2IYOA 3TSIA 3VN0A 1L4AD 1K05A 3HTKA 2XZRA 3G4SP 5AW3B 1FS0E 3A0HH 3L71E 1NWQA 1KQFB 3H1LD 3F5HA 5KLVJ 1NTZG 5APUA 2B89A 2WPRA 5B5EE 5GTIH 1PGPA 1OMIA 1X22A 1S5LH 4OGQC 5AW2B 2QJKC 1SQQE 3RBXA 1N73B 1KILA 1EXJA 2E5TA 4JYCA 4H44D 3H1IE 4Y99C 5EFWB 3CMAP 1L0LG 4JBZA 1S4XA 3H1HJ 1PPJE 4HB1A 2FBWC 4PV1B 3OW2O 5AVYB 2HPCA 3V4QA 3HUSA 4U7JA 2YMKA 3CCEP 3EFGA 1J1EC 1SQPG 2POHA 1NTZD 2YNYA 3M0AA 1VQ9P 2P7JA 2Q6QA 2C0XA 3A0BH 2ZT9D 3CXHD 1A02J 3HD7D 1QX8A 3BCCG 2WPVB 4L75A 1L0LD 1A02F 2OYHB 3PHLA 1ZR4A 2KB7P 1RH5B 1LTAC 5AVZB 5AW6B 3JCUH 3AE8C 2UWJE 2WSFH 3V2RA 1VQLP 1SQPD 1N73C 3E1IA 1GD2E 1NTZK 2IZ0A 2IBZE 3SSUA 2K3RA 2N1TC 2A06D 5GTIE 1GL2D 1KQSO 3CWBE 4DZOA 2M8RA 1OX3A 3BCCD 1S72P 1N2DC 1NTKK 3T97A 1ZOYC 3CXHH 1JY3N 1MFZA 3CCJP 4GIFA 3B5NA 2D2CC 1MFTA 1OZHA 3U59A 1U7MA 3BRVB 2R32A 1SQBJ 2KOGA 1ZR2A 1KFNA 3H32B 3USSA 4A7PA 5KJ7C 2W27A 1JY2O 2KS1A 1RQUA 2OTKE 3H1LE 3W67A 2WWWA 4H13D 2FYNC 3JC22 1URQD 1JCCA 3SWKA 1OVUA 1PGJA 2W6AA 1SQXK 4QMAA 3HE5B 4LC1A 2KZJA 3M0DC 3G9RA 3BVHA 5KLIB 2OYIC 2B87B 3FXEA 2QIWA 4C7NA 1ZLLA 1Q82Q 3JCUE 2XDJA 1OVRA 1P84D 1EDIA 1RF0C 3O8ZA 3TGUG 2WMMA 3CC4P 1JCDA 2BCCG 1FZCC 3GW6A 1L0NK 4AQRD 3RK2B 1T3UA 1Y8AA 1N7SB 5AVXB 2ZFCA 2WSEH 4GODA 1NTZE 2H8PD 2PP6A 1KQGB 5AVWB 3V5BA 5E79H 2L91A 4ZNCA 1NGMB 3Q1MA 2O01H 4ZKUA 2Y0DA 3SFEC 3CXHE 3N7NA 3G3ZA 5GTHH 5KAFH 2E43A 3G6EP 1SFCB 1S2EA 2FYUJ 3L75J 1L0LE 4UB6H 5AVSB 3Q3DA 3AEBC 3D6YA 3TGUD 4JQ0D 2BCCD 4DT0A 1NHLA 1ZP0C 3U1CA 1SQPE 1N8RQ 2HFED 2E74C 2P10A 3NMDA 3L72J 1OW6A 2Q5UA 5KTBA 1VF5C 1HGVA 3AE2C 1AQTA 5CCHD 2RMZA 3PH0A 2A06E 2A45I 1ZXGA 1NTMJ 3BCCE 2E75B 3GG2A 2BEQD 1OW8A 4D6TG 3S4RA 1YTZI 1FZAA 3M9HA 2OYOA 3B71A 3SWYA 1RF1B 1DH3A 4NPDA 4RJTA 3L74J 3VP8A 3E7KA 3CCVP 1H0TA 3G71P 2ZVNB 3L71G 2E42A 3L73G 1SFCC 1IZNB 1SVFA 2NPSB 1FE6A 2LKMA 2A45H 2JDIH 2KUBA 2FYZA 1JMBA 5KAFE 1CSBA 4D6TD 4TT3H 1BDDA 1VDFA 2YKPA 3PTZA 1LJ2A 1FZBA 3H1JJ 1N73A 3D6ZA 1X0TA 3L70G 4H0LC 1LP1B 2YIUB 1P84E 3MUDA 4PD4D 2Q7CA 1JUNA 3L73D 2E75C 2LXCB 3CX5I 4MN4C 5C39A 5DJTB 3IR9A 3AE5C 1LT1A 2H89C 1IFJA 4ZMDA 2P2UA 5M1BA 1RE3C 4H44C 2HR3A 1LWUC 1KC8Q 1YBKA 1PGQA 3AEFC 2Y0EA 3E1RA 1PP9G 3L70D 3TGUE 3ITKA 2NPSC 4KHXA 1J1DB 1OW7A 1FDMA 1X9VA 2BCCE 1BGYG 2I1JA 2PAJA 3EWKA 2OYHA 3CX5H 5TISH 3S1KA 4HJGH 3RL0D 2GUSA 2ZT9C 3HD7C 3TDKA 2HODB 2IYPA 3P8MC 1SQVJ 2YIUC 2Q3EA 2Y9YA 1RF0A 1PP9D 1JTHB 3VTPC 3RBZA 1K73Q 4YPCA 2E5YA 2MJZA 1BGYD 1L2PA 3V4WA 1BCCJ 4OGQB 2QJKB 1EZVI 2C9NY 5B66E 4UB8H 1AA0A 1VQMP 4BRYB 1GK4A 3P7KA 2AXTE 2QSIA 1GL2C 5AW9B 3H32A 2KSJA 1FDIA 1LTIC 4HYTB 1KILD 3LW5J 1R5SA 1HH0A 3RGUA 1FBMA 4D6TE 5AVVB 2WT7B 3VMXA 5KAIE 1SQBD 4TLFA 2CPBA 1BE3J 2KK7A 5CHXA 3HE5A 5L8RJ 3PLNA 3WUUA 2K37A 3MZWB 3H1KJ 2B87A 1VQ7P 4PD4E 3C9IA 1NYHA 3NXSA 4H13C 4LLHA 5TISE 5AVUB 2MKVA 2IX7C 1H89A 3L73E 3RK3D 1PFIA 4GKGA 2PRRA 1W5CE 4EI2A 3WUVA 1YJNP 1T8ZA 2N9BA 1ZV8A 2R3SA 3V2PA 1MUUA 4DJGA 3I5CA 5AW1B 1N7SA 1BDCA 3RL0g 1SQBK 2P58A 1NTKG 3L35A 3PRJA 4GT1A 3I55P 3FWNA 3VMZA 2N1TB 3L70E 2FKWB 2B9BA 3EFFK 4WB4A 1T6AA 4UB8E 2JWDA 1SFCA 4WVZA 2JWAA 2W90A 4W7YA 2OARA 1SQQJ 1HUCA 1QL1A 2ZXXA 1NU1J 3WMM0 2C0WA 2D2CB 1KB9I 1DX7A 3H1IJ 2R5BA 1YTZT 4U3FG 2YXQB 2A06G 1ZN5A 1NTKD 1U57A 1GW3A 3B5ND 1SQXG 2R44A 1PP9E 4L76A 1K04A 2FYNB 4CPGA 2K9JB 1EQ7A 2O1KA 3EQ2A 3GHGC 1NAYA 4EOTA 2QM8A 1BGYE 2K88A 3A0HE 2FXPA 2QM7A 5CCHC 1RF1A 2QA4P 1KB9H 1DEEG 1Q2NA 2OYIB 1M7LA 4XFJA 5CCGA 2OTLP 3IFMA 4U3FD 1L0NG 1S5LX 3AEGC 5KKZC 1FJPA 3CC2P 2P1JA 1S5LE 2KIKA 3V2NA 4XE5B 1FZCB 1KILE 3KPEA 2HLOA 2JEEA 2YXRB 1IJDB 1SQXD 3SFDC 1LTSC 4NPFX 2NPSA 4WY4B 1SQBE 2ZJSE 2I8DA 2AEJA 1KV4A 2XV5A 2OTJP 4KT0J 3CWBJ 2GUVA 4L73A 3CPWO 1AQ5A 1NTMK 1L0ND 1LP1A 3RK3E 2Z5HA 4IFFA 1YYCA 3A0BE 3A2AA 1JMMA 2R5DA 2IZ1A 1NJIQ 2FXMA 1OVVA 3CC7P 1E79H 2E74B 3H1JD 4R4MA 1EXIA 1VF5B 5CBNA 2Y0CA 3H1LJ 1M57D 2YKQA 4JYBA 2Q9IA 3MIWA 1N86A 1VPCA 4RO0A 2WVRA 2E76D 1LTJC 2QVAA 2W6JH 1HF9A 2JR8A 4WY4C 3CCSP 3CI9A 4PJ0H 4R4LA 4N78D 2RH0A 2A45G 3AEAC 3TYYA 3L37A 1LTTC 3WUTA 2VRSA 3BRTB 2LXBA 3CCMP 1NTKE 2ITAA 2Z5IA 1Y9BA 3KZIH 2HODA 2QRXA 2DW3A 3KXDA 1NTZJ 3HRNA 1MV8A 4NPEA 2Q3IA 1JTHA 1DD4A 2N9YB 3IF4A 1EDKA 1L4AB 1OXZA 3KYQA 1GTWA 1L0LJ 3R4YA 4H0LB 4U3FE 2M5AB 2PFXA 1FZFA 2KYVA 4BRYA 2V7QJ 2BEZF 1K8AQ 1RQVA 1IC2A 1PZQA 3V2QA 1SQXE 1SQPJ 3Q2YA 1IK9A 3VYIA 1SS1A 5AVRB 5CBOA 1Q81Q 3O6QB 4H44B 1LWUB 2WT7A 3KHUA 3MGNA 1KYOI 1W2BO 1GU5A 2AXCA 2BASA 5APWA 2K1AA 3BCCJ 1JM0A 4PV1D 1VQNP 5KLVG 4PJ0E 2YO3A 1KILC 1SQVK 1L0NE 5E79E 3TNUB 2K9YA 1QEXA 3H6PA 3GF3A 5GTHE 3GLMA 5APTA 1W2EA 3KZIE 4YTPC 4UB6E 1T3JA 3H1JE 2ZT9B 2AEMA 1VQOP 1GK6A 3HD7B 3HUSC 1L4AC 4I2LC 4GOFA 3H1HG 3A7OA 2SPZA 4AUWA 3RK3C 2JKVA 3CX5D 5AW4B 2H43A 1MKMA 2AEFA 2NZ2A 1IO4A 5KLVD 2G3AA 2N1TA 3VP9A 1ZMEC 4DCKA 3IN6A 3OA7A 1NKNA 4OVNF 3BATA 1MZ9A 2O01N 3ABVC 4N78E 3D70A 2FY8A 3LW5H 3CD6P 1CI6B 1GL2B 4I7ZC 2XNDH 5AVQB 1IFPA 3H1HD 2P67A 3FX0A 5KJ7A 5CMZA 2WSCH 3S9OA 4EYYQ 3F89A 4I6MC 1QLED 1NU1D 5KLVK 2K9JA 1ZRTD 5AW7B 2XKMA 1KFMA 1KMIZ 3OAKA 4N3YB 1S9KD 3D71A 1RE4C 3V6IA 2WPSA 2CK3H 4HH2A 4OWFA 3M0DA 3B5NC 1IFMA 2OYIA 3TGUJ 1VQ5P 4H13B 2JO1A 3C8VA 2WTYA 1URQB 2R3CA 2BCCJ 5K5GB 1QVGO 2J5UA 2CPSA 4BXLA 1EZVD 1SQBG 1FZCA 1SQQK 5B5EH 1DEBA 1NU1K 4WY4A 3P8CD 1IK7A 3WU2H 3SWFA 1FJKA 4LGDE 1BSNA 2H88C 2ZAEB 1NAFA 3M06A 1FC2C 1GMJA 1AFOA 5APSA 2L5GB 1LT9B 4WWIA 3RK2D 3FGAD 1N7SD 1OWAA 4KJMA 2QG4A 1FOSE 1S1CX 2HG5D 1NKZB 5DJUB 5BU8B 2IPPA 1QL2A 1AV1A 2PGDA 4Z1MH 3PP5A 1QGKB 2IBZI 1SFCD 2WPQA 1H8AA 2IDBA 1K9MQ 3MHVA 3CX5E 2V4HA 1URQC 4D6TJ 4K3AA 5KLVE 3GHGB 4M3LA 1X79B 3IAOA 5H2FH 1KZUB 1Y47A 1VL2A 1PV3A 5APYA 3AE7C 1VQ6P 4H0LD 4BWNA 2FYUG 3L75G 2KNCB 2WZ7A 4EDFA 2XU6A 3L71J 1M1KQ 3L73J 3H1HE 1YITP 3P32A 2E75D 1UIIA 2J58A 5KKZB 2KSEA 2O3JA 2E76C 4N6JA 1KTMA 1IFIA 2WSSH 3ZDMA 1JEKA 1LT9C 1HJ0A 3WU2E 1NU1E 1XTCC 1KB9D 3NFQA 3CCUP 2M3BA 1ZRTE 5CJ4A 3Q5PA 3CLQA 5CCGD 3L72G 1YJWP 1S9KE 2HYNA 4JPZB 2KLVA 3OJAB 5BU5A 3B4SA 1R5LA 1NTMG 3L70J 1T2KD 2W8ZA 2QEXP 1CW5A 1L4AA 4IOIH 2FYUD 3L75D 4DOJA 3QWOC 2NPSD 1S3JA 2GM4A 2M5AA 2Q1KA 4WBAA 1KORA 1EZVE 1TU3F 1IFNA 1E5WA 2LR2A
chains in the Genus database with same CATH topology
2ZXXA 4BRYA 4BRYB 3WUUA 1UIIA 2Q6QA 3F5HA 3WUTA 3WUVA 3E1RA 2WVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXX A;  4BRY A;  4BRY B;  3WUU A;  1UII A;  2Q6Q A;  3F5H A;  3WUT A;  3WUV A;  3E1R A;  2WVR A; 
#chains in the Genus database with same CATH topology
 3L74 G;  1G1I A;  3P8C E;  1PIX A;  3L72 D;  1IFD A;  3CXH I;  3O6Q A;  4EIJ A;  1Q90 D;  2ZYA A;  3A3Y B;  1RE3 A;  1JY3 P;  1LWU A;  1SP4 A;  1PP9 J;  5H2F E;  1NTM D;  5APX A;  4O9B A;  5AW8 B;  4K35 A;  1M1J B;  2FYU K;  1WMK A;  2WQY C;  4GOE A;  2M0B A;  1BGY J;  3JSV C;  1LTJ B;  4AYC A;  1FDO A;  3A5T A;  3VMY A;  3MUD C;  3TNU A;  2KI7 B;  3H1J G;  4IL6 H;  3L74 D;  1HJB A;  1SLQ A;  1WT6 A;  4PV1 C;  3W68 A;  1RE4 A;  1L0L K;  3HD7 A;  1AVY A;  2QE7 H;  3I56 P;  1VQ8 P;  2QJP B;  3HE4 B;  1FU1 A;  3AED C;  2RKL A;  1LGH B;  2ZYD A;  1SQP K;  2V7Q H;  3AE6 C;  1KD1 Q;  3RL0 B;  1G2C B;  3PJS K;  1YIJ P;  1AJY A;  1RHZ B;  2Y9Z A;  3GF7 A;  2OYH C;  1KQL A;  1PGO A;  2KXP B;  1CI6 A;  2ZXE B;  2FFD B;  5AW0 B;  1CZQ A;  2RN0 A;  3M9B A;  1GL2 A;  3BAS A;  3KQG A;  1N7L A;  1M1J C;  1M56 D;  3NTN A;  1VQ4 P;  4XA4 A;  1KB9 E;  3M9Q A;  1EC5 A;  3HTK B;  4OGQ D;  2H7H A;  4B86 A;  1OIP A;  3R2P A;  2B88 A;  4YXD C;  1SQV G;  2WSF J;  1P84 I;  1EDJ A;  1J2J B;  2FYU E;  3L75 E;  2YMY A;  1LTG C;  1HGZ A;  4IL6 X;  1HWT C;  1KIL B;  2QJY B;  4IL6 E;  4GDO A;  4JF7 A;  3UIA A;  2QJP C;  1BCC G;  1URQ A;  3LID A;  3QH9 A;  5APV A;  1YHQ P;  3CME P;  2J59 M;  3RL0 C;  1JO5 A;  4L74 A;  1UIX A;  3L72 E;  3TK1 A;  2HPC B;  1VQP P;  1M8O B;  3HUS B;  1NTK J;  2GA1 A;  1M90 Q;  1LNQ A;  3H25 A;  1SQV D;  1NTM E;  3RK3 B;  1YQ3 C;  2FFD C;  1P84 H;  1Q86 Q;  3MP7 B;  4W80 A;  3U1A A;  1Z56 A;  1LTB C;  3Q5R A;  3L36 A;  4Y28 J;  1LT9 A;  5KLI C;  1BE3 G;  1BCC D;  3AE4 C;  2M3E A;  1KYO D;  2JJL A;  3L74 E;  4U3F J;  3H1K G;  2N1T D;  4I7Z B;  3RK2 C;  1SQX J;  1N7S C;  2QJY C;  1VQK P;  4ZKP A;  4YXW H;  1DIP A;  2D2C D;  4IFM A;  1FZE A;  3GHG A;  4W7Z A;  1Q7Y Q;  1X8Y A;  3AEC C;  1BE3 D;  3T97 B;  1PL5 A;  1JNM A;  5KJ7 D;  2WSE J;  1NVO A;  1QVF O;  3H1K D;  1L0N J;  2XNX A;  3B5N B;  5CCH A;  1GDT A;  2ZYG A;  1DD3 A;  2KNC A;  1KYO H;  2W83 C;  1U7J A;  1SQQ G;  2O01 J;  2C9L Y;  3VMA A;  1NU1 G;  5CJ0 A;  2OGU A;  3L4F A;  5AW5 B;  3TF5 A;  3H1I G;  2NRG A;  4I1L A;  1USE A;  2O1J A;  2KS1 B;  3AEE C;  2FXO A;  1NH4 A;  1KN7 A;  1NO4 A;  1PPJ G;  3MTU E;  2JP3 A;  3FXD A;  1AVO A;  5B66 H;  3L71 D;  4PD4 I;  2AXT H;  1H88 A;  1JY2 P;  4IFD K;  1RF1 C;  1BSH A;  4WY4 D;  4HKZ H;  1EZV G;  1SQQ D;  4C7N B;  1XTG B;  5CCG C;  1HBW A;  1USD A;  1JY3 O;  2IFN A;  3H1I D;  3C1L A;  5KAI H;  1NOH A;  1T2K C;  2ZVO B;  1R8E A;  1PPJ D;  3N4X A;  1FZG A;  1GU4 A;  1SQV E;  1G1J A;  2KLU A;  3CCR P;  3GMA A;  4PD4 H;  1FAV A;  4ASW A;  1JY2 N;  2W6B A;  2G8Y A;  2IFM A;  1M1J A;  1ZW0 A;  1WRG A;  2YKO A;  2IBZ G;  1BCC E;  2YO2 A;  2I1K A;  3MD0 A;  1LTJ A;  2E74 D;  1D7M A;  1OFC X;  3VOP A;  1RY3 A;  1KYO E;  3CWB G;  1JOC A;  1VF5 D;  3CCL P;  3K5B A;  3CCQ P;  4ASV A;  3Q5S A;  1HTL C;  3CL3 D;  4C7R A;  2KZI A;  4OH8 B;  4RES B;  1GZL A;  3KDP B;  2E76 B;  1YI2 P;  2Z4E A;  3AE1 C;  3HE4 A;  4Y99 B;  5APQ A;  2KP8 A;  2IBZ D;  1BE3 E;  2OQQ A;  1GW4 A;  3H1L G;  3B8E B;  1G2C A;  1YJ9 P;  1EDL A;  3CWB D;  4RKU J;  3M91 A;  3H1K E;  5TJH A;  1YQ4 C;  1J1D C;  3FWL A;  3AE9 C;  1J1E B;  3LIE A;  5AVT B;  3AE3 C;  2FFD A;  1HVV A;  5BVZ A;  3II6 A;  1JB0 J;  1H0T B;  2WIT A;  2WSC J;  1FOS F;  4C46 A;  2IYO A;  3TSI A;  3VN0 A;  1L4A D;  1K05 A;  3HTK A;  2XZR A;  3G4S P;  5AW3 B;  1FS0 E;  3A0H H;  3L71 E;  1NWQ A;  1KQF B;  3H1L D;  3F5H A;  5KLV J;  1NTZ G;  5APU A;  2B89 A;  2WPR A;  5B5E E;  5GTI H;  1PGP A;  1OMI A;  1X22 A;  1S5L H;  4OGQ C;  5AW2 B;  2QJK C;  1SQQ E;  3RBX A;  1N73 B;  1KIL A;  1EXJ A;  2E5T A;  4JYC A;  4H44 D;  3H1I E;  4Y99 C;  5EFW B;  3CMA P;  1L0L G;  4JBZ A;  1S4X A;  3H1H J;  1PPJ E;  4HB1 A;  2FBW C;  4PV1 B;  3OW2 O;  5AVY B;  2HPC A;  3V4Q A;  3HUS A;  4U7J A;  2YMK A;  3CCE P;  3EFG A;  1J1E C;  1SQP G;  2POH A;  1NTZ D;  2YNY A;  3M0A A;  1VQ9 P;  2P7J A;  2Q6Q A;  2C0X A;  3A0B H;  2ZT9 D;  3CXH D;  1A02 J;  3HD7 D;  1QX8 A;  3BCC G;  2WPV B;  4L75 A;  1L0L D;  1A02 F;  2OYH B;  3PHL A;  1ZR4 A;  2KB7 P;  1RH5 B;  1LTA C;  5AVZ B;  5AW6 B;  3JCU H;  3AE8 C;  2UWJ E;  2WSF H;  3V2R A;  1VQL P;  1SQP D;  1N73 C;  3E1I A;  1GD2 E;  1NTZ K;  2IZ0 A;  2IBZ E;  3SSU A;  2K3R A;  2N1T C;  2A06 D;  5GTI E;  1GL2 D;  1KQS O;  3CWB E;  4DZO A;  2M8R A;  1OX3 A;  3BCC D;  1S72 P;  1N2D C;  1NTK K;  3T97 A;  1ZOY C;  3CXH H;  1JY3 N;  1MFZ A;  3CCJ P;  4GIF A;  3B5N A;  2D2C C;  1MFT A;  1OZH A;  3U59 A;  1U7M A;  3BRV B;  2R32 A;  1SQB J;  2KOG A;  1ZR2 A;  1KFN A;  3H32 B;  3USS A;  4A7P A;  5KJ7 C;  2W27 A;  1JY2 O;  2KS1 A;  1RQU A;  2OTK E;  3H1L E;  3W67 A;  2WWW A;  4H13 D;  2FYN C;  3JC2 2;  1URQ D;  1JCC A;  3SWK A;  1OVU A;  1PGJ A;  2W6A A;  1SQX K;  4QMA A;  3HE5 B;  4LC1 A;  2KZJ A;  3M0D C;  3G9R A;  3BVH A;  5KLI B;  2OYI C;  2B87 B;  3FXE A;  2QIW A;  4C7N A;  1ZLL A;  1Q82 Q;  3JCU E;  2XDJ A;  1OVR A;  1P84 D;  1EDI A;  1RF0 C;  3O8Z A;  3TGU G;  2WMM A;  3CC4 P;  1JCD A;  2BCC G;  1FZC C;  3GW6 A;  1L0N K;  4AQR D;  3RK2 B;  1T3U A;  1Y8A A;  1N7S B;  5AVX B;  2ZFC A;  2WSE H;  4GOD A;  1NTZ E;  2H8P D;  2PP6 A;  1KQG B;  5AVW B;  3V5B A;  5E79 H;  2L91 A;  4ZNC A;  1NGM B;  3Q1M A;  2O01 H;  4ZKU A;  2Y0D A;  3SFE C;  3CXH E;  3N7N A;  3G3Z A;  5GTH H;  5KAF H;  2E43 A;  3G6E P;  1SFC B;  1S2E A;  2FYU J;  3L75 J;  1L0L E;  4UB6 H;  5AVS B;  3Q3D A;  3AEB C;  3D6Y A;  3TGU D;  4JQ0 D;  2BCC D;  4DT0 A;  1NHL A;  1ZP0 C;  3U1C A;  1SQP E;  1N8R Q;  2HFE D;  2E74 C;  2P10 A;  3NMD A;  3L72 J;  1OW6 A;  2Q5U A;  5KTB A;  1VF5 C;  1HGV A;  3AE2 C;  1AQT A;  5CCH D;  2RMZ A;  3PH0 A;  2A06 E;  2A45 I;  1ZXG A;  1NTM J;  3BCC E;  2E75 B;  3GG2 A;  2BEQ D;  1OW8 A;  4D6T G;  3S4R A;  1YTZ I;  1FZA A;  3M9H A;  2OYO A;  3B71 A;  3SWY A;  1RF1 B;  1DH3 A;  4NPD A;  4RJT A;  3L74 J;  3VP8 A;  3E7K A;  3CCV P;  1H0T A;  3G71 P;  2ZVN B;  3L71 G;  2E42 A;  3L73 G;  1SFC C;  1IZN B;  1SVF A;  2NPS B;  1FE6 A;  2LKM A;  2A45 H;  2JDI H;  2KUB A;  2FYZ A;  1JMB A;  5KAF E;  1CSB A;  4D6T D;  4TT3 H;  1BDD A;  1VDF A;  2YKP A;  3PTZ A;  1LJ2 A;  1FZB A;  3H1J J;  1N73 A;  3D6Z A;  1X0T A;  3L70 G;  4H0L C;  1LP1 B;  2YIU B;  1P84 E;  3MUD A;  4PD4 D;  2Q7C A;  1JUN A;  3L73 D;  2E75 C;  2LXC B;  3CX5 I;  4MN4 C;  5C39 A;  5DJT B;  3IR9 A;  3AE5 C;  1LT1 A;  2H89 C;  1IFJ A;  4ZMD A;  2P2U A;  5M1B A;  1RE3 C;  4H44 C;  2HR3 A;  1LWU C;  1KC8 Q;  1YBK A;  1PGQ A;  3AEF C;  2Y0E A;  3E1R A;  1PP9 G;  3L70 D;  3TGU E;  3ITK A;  2NPS C;  4KHX A;  1J1D B;  1OW7 A;  1FDM A;  1X9V A;  2BCC E;  1BGY G;  2I1J A;  2PAJ A;  3EWK A;  2OYH A;  3CX5 H;  5TIS H;  3S1K A;  4HJG H;  3RL0 D;  2GUS A;  2ZT9 C;  3HD7 C;  3TDK A;  2HOD B;  2IYP A;  3P8M C;  1SQV J;  2YIU C;  2Q3E A;  2Y9Y A;  1RF0 A;  1PP9 D;  1JTH B;  3VTP C;  3RBZ A;  1K73 Q;  4YPC A;  2E5Y A;  2MJZ A;  1BGY D;  1L2P A;  3V4W A;  1BCC J;  4OGQ B;  2QJK B;  1EZV I;  2C9N Y;  5B66 E;  4UB8 H;  1AA0 A;  1VQM P;  4BRY B;  1GK4 A;  3P7K A;  2AXT E;  2QSI A;  1GL2 C;  5AW9 B;  3H32 A;  2KSJ A;  1FDI A;  1LTI C;  4HYT B;  1KIL D;  3LW5 J;  1R5S A;  1HH0 A;  3RGU A;  1FBM A;  4D6T E;  5AVV B;  2WT7 B;  3VMX A;  5KAI E;  1SQB D;  4TLF A;  2CPB A;  1BE3 J;  2KK7 A;  5CHX A;  3HE5 A;  5L8R J;  3PLN A;  3WUU A;  2K37 A;  3MZW B;  3H1K J;  2B87 A;  1VQ7 P;  4PD4 E;  3C9I A;  1NYH A;  3NXS A;  4H13 C;  4LLH A;  5TIS E;  5AVU B;  2MKV A;  2IX7 C;  1H89 A;  3L73 E;  3RK3 D;  1PFI A;  4GKG A;  2PRR A;  1W5C E;  4EI2 A;  3WUV A;  1YJN P;  1T8Z A;  2N9B A;  1ZV8 A;  2R3S A;  3V2P A;  1MUU A;  4DJG A;  3I5C A;  5AW1 B;  1N7S A;  1BDC A;  3RL0 g;  1SQB K;  2P58 A;  1NTK G;  3L35 A;  3PRJ A;  4GT1 A;  3I55 P;  3FWN A;  3VMZ A;  2N1T B;  3L70 E;  2FKW B;  2B9B A;  3EFF K;  4WB4 A;  1T6A A;  4UB8 E;  2JWD A;  1SFC A;  4WVZ A;  2JWA A;  2W90 A;  4W7Y A;  2OAR A;  1SQQ J;  1HUC A;  1QL1 A;  2ZXX A;  1NU1 J;  3WMM 0;  2C0W A;  2D2C B;  1KB9 I;  1DX7 A;  3H1I J;  2R5B A;  1YTZ T;  4U3F G;  2YXQ B;  2A06 G;  1ZN5 A;  1NTK D;  1U57 A;  1GW3 A;  3B5N D;  1SQX G;  2R44 A;  1PP9 E;  4L76 A;  1K04 A;  2FYN B;  4CPG A;  2K9J B;  1EQ7 A;  2O1K A;  3EQ2 A;  3GHG C;  1NAY A;  4EOT A;  2QM8 A;  1BGY E;  2K88 A;  3A0H E;  2FXP A;  2QM7 A;  5CCH C;  1RF1 A;  2QA4 P;  1KB9 H;  1DEE G;  1Q2N A;  2OYI B;  1M7L A;  4XFJ A;  5CCG A;  2OTL P;  3IFM A;  4U3F D;  1L0N G;  1S5L X;  3AEG C;  5KKZ C;  1FJP A;  3CC2 P;  2P1J A;  1S5L E;  2KIK A;  3V2N A;  4XE5 B;  1FZC B;  1KIL E;  3KPE A;  2HLO A;  2JEE A;  2YXR B;  1IJD B;  1SQX D;  3SFD C;  1LTS C;  4NPF X;  2NPS A;  4WY4 B;  1SQB E;  2ZJS E;  2I8D A;  2AEJ A;  1KV4 A;  2XV5 A;  2OTJ P;  4KT0 J;  3CWB J;  2GUV A;  4L73 A;  3CPW O;  1AQ5 A;  1NTM K;  1L0N D;  1LP1 A;  3RK3 E;  2Z5H A;  4IFF A;  1YYC A;  3A0B E;  3A2A A;  1JMM A;  2R5D A;  2IZ1 A;  1NJI Q;  2FXM A;  1OVV A;  3CC7 P;  1E79 H;  2E74 B;  3H1J D;  4R4M A;  1EXI A;  1VF5 B;  5CBN A;  2Y0C A;  3H1L J;  1M57 D;  2YKQ A;  4JYB A;  2Q9I A;  3MIW A;  1N86 A;  1VPC A;  4RO0 A;  2WVR A;  2E76 D;  1LTJ C;  2QVA A;  2W6J H;  1HF9 A;  2JR8 A;  4WY4 C;  3CCS P;  3CI9 A;  4PJ0 H;  4R4L A;  4N78 D;  2RH0 A;  2A45 G;  3AEA C;  3TYY A;  3L37 A;  1LTT C;  3WUT A;  2VRS A;  3BRT B;  2LXB A;  3CCM P;  1NTK E;  2ITA A;  2Z5I A;  1Y9B A;  3KZI H;  2HOD A;  2QRX A;  2DW3 A;  3KXD A;  1NTZ J;  3HRN A;  1MV8 A;  4NPE A;  2Q3I A;  1JTH A;  1DD4 A;  2N9Y B;  3IF4 A;  1EDK A;  1L4A B;  1OXZ A;  3KYQ A;  1GTW A;  1L0L J;  3R4Y A;  4H0L B;  4U3F E;  2M5A B;  2PFX A;  1FZF A;  2KYV A;  4BRY A;  2V7Q J;  2BEZ F;  1K8A Q;  1RQV A;  1IC2 A;  1PZQ A;  3V2Q A;  1SQX E;  1SQP J;  3Q2Y A;  1IK9 A;  3VYI A;  1SS1 A;  5AVR B;  5CBO A;  1Q81 Q;  3O6Q B;  4H44 B;  1LWU B;  2WT7 A;  3KHU A;  3MGN A;  1KYO I;  1W2B O;  1GU5 A;  2AXC A;  2BAS A;  5APW A;  2K1A A;  3BCC J;  1JM0 A;  4PV1 D;  1VQN P;  5KLV G;  4PJ0 E;  2YO3 A;  1KIL C;  1SQV K;  1L0N E;  5E79 E;  3TNU B;  2K9Y A;  1QEX A;  3H6P A;  3GF3 A;  5GTH E;  3GLM A;  5APT A;  1W2E A;  3KZI E;  4YTP C;  4UB6 E;  1T3J A;  3H1J E;  2ZT9 B;  2AEM A;  1VQO P;  1GK6 A;  3HD7 B;  3HUS C;  1L4A C;  4I2L C;  4GOF A;  3H1H G;  3A7O A;  2SPZ A;  4AUW A;  3RK3 C;  2JKV A;  3CX5 D;  5AW4 B;  2H43 A;  1MKM A;  2AEF A;  2NZ2 A;  1IO4 A;  5KLV D;  2G3A A;  2N1T A;  3VP9 A;  1ZME C;  4DCK A;  3IN6 A;  3OA7 A;  1NKN A;  4OVN F;  3BAT A;  1MZ9 A;  2O01 N;  3ABV C;  4N78 E;  3D70 A;  2FY8 A;  3LW5 H;  3CD6 P;  1CI6 B;  1GL2 B;  4I7Z C;  2XND H;  5AVQ B;  1IFP A;  3H1H D;  2P67 A;  3FX0 A;  5KJ7 A;  5CMZ A;  2WSC H;  3S9O A;  4EYY Q;  3F89 A;  4I6M C;  1QLE D;  1NU1 D;  5KLV K;  2K9J A;  1ZRT D;  5AW7 B;  2XKM A;  1KFM A;  1KMI Z;  3OAK A;  4N3Y B;  1S9K D;  3D71 A;  1RE4 C;  3V6I A;  2WPS A;  2CK3 H;  4HH2 A;  4OWF A;  3M0D A;  3B5N C;  1IFM A;  2OYI A;  3TGU J;  1VQ5 P;  4H13 B;  2JO1 A;  3C8V A;  2WTY A;  1URQ B;  2R3C A;  2BCC J;  5K5G B;  1QVG O;  2J5U A;  2CPS A;  4BXL A;  1EZV D;  1SQB G;  1FZC A;  1SQQ K;  5B5E H;  1DEB A;  1NU1 K;  4WY4 A;  3P8C D;  1IK7 A;  3WU2 H;  3SWF A;  1FJK A;  4LGD E;  1BSN A;  2H88 C;  2ZAE B;  1NAF A;  3M06 A;  1FC2 C;  1GMJ A;  1AFO A;  5APS A;  2L5G B;  1LT9 B;  4WWI A;  3RK2 D;  3FGA D;  1N7S D;  1OWA A;  4KJM A;  2QG4 A;  1FOS E;  1S1C X;  2HG5 D;  1NKZ B;  5DJU B;  5BU8 B;  2IPP A;  1QL2 A;  1AV1 A;  2PGD A;  4Z1M H;  3PP5 A;  1QGK B;  2IBZ I;  1SFC D;  2WPQ A;  1H8A A;  2IDB A;  1K9M Q;  3MHV A;  3CX5 E;  2V4H A;  1URQ C;  4D6T J;  4K3A A;  5KLV E;  3GHG B;  4M3L A;  1X79 B;  3IAO A;  5H2F H;  1KZU B;  1Y47 A;  1VL2 A;  1PV3 A;  5APY A;  3AE7 C;  1VQ6 P;  4H0L D;  4BWN A;  2FYU G;  3L75 G;  2KNC B;  2WZ7 A;  4EDF A;  2XU6 A;  3L71 J;  1M1K Q;  3L73 J;  3H1H E;  1YIT P;  3P32 A;  2E75 D;  1UII A;  2J58 A;  5KKZ B;  2KSE A;  2O3J A;  2E76 C;  4N6J A;  1KTM A;  1IFI A;  2WSS H;  3ZDM A;  1JEK A;  1LT9 C;  1HJ0 A;  3WU2 E;  1NU1 E;  1XTC C;  1KB9 D;  3NFQ A;  3CCU P;  2M3B A;  1ZRT E;  5CJ4 A;  3Q5P A;  3CLQ A;  5CCG D;  3L72 G;  1YJW P;  1S9K E;  2HYN A;  4JPZ B;  2KLV A;  3OJA B;  5BU5 A;  3B4S A;  1R5L A;  1NTM G;  3L70 J;  1T2K D;  2W8Z A;  2QEX P;  1CW5 A;  1L4A A;  4IOI H;  2FYU D;  3L75 D;  4DOJ A;  3QWO C;  2NPS D;  1S3J A;  2GM4 A;  2M5A A;  2Q1K A;  4WBA A;  1KOR A;  1EZV E;  1TU3 F;  1IFN A;  1E5W A;  2LR2 A; 
#chains in the Genus database with same CATH homology
 2ZXX A;  4BRY A;  4BRY B;  3WUU A;  1UII A;  2Q6Q A;  3F5H A;  3WUT A;  3WUV A;  3E1R A;  2WVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...