3WUUA

Structure basis of inactivating cell abscission with chimera peptide 1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
AMGSFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and biochemical insights into the role of testis-expressed gene 14 (TEX14) in forming the stable intercellular bridges of germ cells
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Centrosomal protein of 55 kDa
total genus 22
structure length 54
sequence length 54
chains with identical sequence B, D, E, G, H, J, K
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12180 EABR TSG101 and ALIX binding domain of CEP55
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 3wuuA00
3WUUA 4BRYA 3WUVA 2ZXXA 3F5HA 3WUTA 4BRYB 2Q6QA 1UIIA 3E1RA 2WVRA
chains in the Genus database with same CATH superfamily
3GW6A 3WUUA 2L5GB 4ZNCA 2JP3A 3Q2YA 1YTZT 1HUCA 3BASA 3CX5H 2A45I 2W90A 3AE9C 5AW5B 3H1HJ 1CI6B 1FJKA 1MKMA 3L37A 3H1ID 1S5LX 2FXPA 1J1DC 1PGPA 1LTTC 2G3AA 3IN6A 1YTZI 4PD4I 1K04A 1SQXK 2FYUJ 1LT9B 3L75E 1DIPA 5L8RJ 4PV1D 1RE3C 2FXOA 2KS1A 4OWFA 4D6TE 1LT9C 1RQVA 1NTMJ 2WSCJ 1AVYA 2P7JA 3L70G 2GUSA 1FZBA 3H1JG 4ASVA 1YHQP 1JCCA 1UIIA 2R44A 1ZP0C 3FXEA 1BE3E 2FYUG 1ZOYC 4BXLA 4JYCA 2D2CB 2OYOA 2V7QH 2ZXXA 3H32A 3B5NC 1BGYD 1NO4A 2FYNB 4N78E 1NU1J 3WUTA 2QJKB 3EFGA 4H13D 1KN7A 3RBZA 1SFCC 4PV1C 4W7YA 3G3ZA 1CW5A 3GHGA 1FE6A 2KXPB 3B5NB 3T97A 1VQ8P 2XDJA 2RMZA 2WSCH 5KAIH 2E75B 2JJLA 1RY3A 4RESB 1IO4A 2O1JA 3RL0D 2WPQA 3L71D 1RQUA 1JCDA 5AVZB 2OYHA 3S1KA 1E5WA 1BE3D 2B89A 5APWA 5E79H 2K88A 2V7QJ 4Y99C 3CWBJ 3L74J 1BCCJ 1Q90D 2WT7B 4AUWA 1SP4A 4NPDA 4I7ZC 1L0LD 3CCEP 2V4HA 1W5CE 1KV4A 4LLHA 1VF5D 2Q9IA 1NTKE 3AECC 1HJ0A 3FXDA 1L0LJ 5B66E 1VQNP 3JC22 3SFDC 3U59A 2XV5A 1KYOE 2M5AB 3H1HE 3D6YA 4NPFX 3TGUG 4EIJA 4H13B 1RHZB 2WTYA 1FOSF 2QG4A 1NJIQ 1URQD 1ZXGA 2A06E 3LIEA 3B71A 2FFDA 5KKZB 4DZOA 1RF1C 3E7KA 1DX7A 1IFJA 1L0LE 2AXCA 2GUVA 2K1AA 4GOEA 3G6EP 2IDBA 4PD4D 1VF5B 2ZFCA 5APTA 5KLVD 1JNMA 4K3AA 5TJHA 1H88A 2ZXEB 1M57D 3R2PA 4ZKPA 1L4AB 3TGUJ 3CCUP 2GA1A 3CX5E 1GK6A 1EZVG 1VF5C 4D6TD 2H8PD 5KLIC 4C46A 5CCGD 1VQOP 2Q5UA 4NPEA 2E5YA 3I56P 3G71P 1USDA 4B86A 1AVOA 1LTGC 3H1LE 3Q5RA 5B5EE 1YI2P 2N1TD 4ZMDA 2H89C 3B5NA 4KT0J 4IFFA 5KLVG 3H25A 5TISE 3GHGC 1AQ5A 3JCUE 1PPJG 3MUDA 1IK7A 2O1KA 3NFQA 2RN0A 2XNXA 1E79H 1VL2A 2WVRA 2LKMA 5APVA 4IFDK 1X0TA 3CLQA 3M9BA 1VQ9P 1NHLA 2YKQA 1VQMP 2Y0DA 1U7JA 3H1LD 4YPCA 1PFIA 1URQA 1NKZB 3N4XA 1L0NK 4U3FD 3S4RA 5KJ7C 5AW6B 2E74C 1SQPD 1GL2C 1NOHA 1GMJA 2JWDA 1VQ7P 3L73J 3M9QA 1NU1G 2LXCB 2FBWC 1RH5B 1JEKA 3HE4A 2E5TA 2P10A 2FYUE 2ZYDA 4TT3H 1RF0A 2WZ7A 2ZYGA 3A2AA 3O6QA 1YYCA 1FS0E 3H1IG 2K3RA 2IZ0A 3TDKA 1ZV8A 4WY4B 5GTHE 3Q5SA 1FBMA 3CMAP 1A02J 3VYIA 2E76B 3UIAA 1EXJA 1IC2A 1SQVD 4D6TG 2KB7P 1KTMA 1RF1A 1DD3A 3P8CE 1OVVA 5GTHH 4BRYB 1SQPE 5CCHC 1L4AD 1BE3G 3F89A 5AW7B 2Q7CA 3VN0A 2WPRA 3RK3B 3AE5C 5KLVE 4IL6X 1S3JA 2OTKE 2ZAEB 1X8YA 2B87B 5GTIH 3CC4P 3CD6P 3CXHD 1S72P 1H8AA 1KB9E 2HG5D 3AEEC 3SWYA 3D71A 1L0NJ 3M06A 4L75A 5APSA 2JO1A 5AVYB 3V2PA 2FFDB 1CSBA 1S5LE 2IX7C 3GMAA 4RKUJ 3HUSA 2Y9ZA 3SWFA 1PGJA 1MFTA 2OYIC 1M1KQ 1OZHA 2GM4A 2NPSB 3V4WA 2CK3H 2WPSA 1L0LK 3MP7B 1T2KD 1GU4A 3BCCE 1GU5A 1X79B 1VQ4P 2DW3A 1VQKP 1OW7A 2KZIA 3EWKA 2QJKC 4LC1A 2OYIB 1FZCC 4U7JA 1LWUA 2KNCB 4I6MC 4PV1B 4EI2A 3A5TA 1T2KC 3MTUE 1NGMB 3V5BA 1URQB 1JY3N 1KB9D 2R3CA 2ZT9C 2YMKA 1FZCB 1P84H 3VP8A 3WU2H 1K8AQ 1X9VA 1KQGB 1URQC 2BEZF 3KYQA 4OGQB 2H88C 3WUVA 5KJ7A 5TISH 4H0LB 4U3FE 1YITP 2K37A 3VMYA 4WWIA 1SQVG 1DEEG 3H6PA 4Y99B 1H0TA 1J2JB 3L73G 4KJMA 1FDMA 4L73A 4HJGH 3A0BE 4IL6E 1KILB 4K35A 2E75C 3AEGC 3RK2C 1GDTA 2FYUD 2K9YA 3Q5PA 2LR2A 2Q6QA 1YIJP 1XTCC 4YXDC 4W80A 2J59M 1BCCE 5DJUB 3U1AA 3U1CA 4M3LA 2KP8A 4EYYQ 3VMAA 2HODB 3A0BH 4IL6H 1S9KD 1SQQD 1J1EB 2XU6A 1LP1A 3AE1C 1EDIA 2IFMA 3L4FA 1LT1A 1ZRTD 3ZDMA 5BU8B 2B87A 3H1LG 3KXDA 3VOPA 3D70A 1ZMEC 3CXHH 1SVFA 1UIXA 1ZR4A 2FY8A 4AYCA 3MD0A 3I5CA 1OXZA 1RE3A 3H1KG 1HVVA 2KOGA 3VP9A 4DT0A 2KI7B 1N8RQ 2QIWA 1IFMA 1SFCD 2HPCA 2WSEH 3CXHE 1JM0A 2M0BA 1IK9A 1FC2C 2KS1B 2PAJA 3FGAD 2OTLP 3L70J 1JTHB 4UB8E 2JWAA 4LGDE 1Q82Q 1ZRTE 1G2CA 1PZQA 1KYOI 2R3SA 2YO2A 3CWBD 3L74D 2OYIA 1QGKB 1SFCA 1P84D 2Q3IA 1SQPK 2R5DA 1EDLA 3LIDA 1KB9H 3AE3C 3TK1A 1CI6A 1LWUC 1QL1A 3AE4C 1S1CX 2Z5IA 3CX5D 2W6JH 1W2EA 1NTMG 1JB0J 5AW3B 2CPBA 3QWOC 1H89A 2BCCE 1T3JA 1VQ6P 2IZ1A 1WRGA 1JMMA 3L35A 1H0TB 1BGYJ 2OQQA 4U3FG 2OGUA 1L0ND 3M0DC 2PGDA 3HTKB 4GKGA 2O3JA 1SQQG 1NVOA 3H1LJ 5CCGC 3BRTB 1M90Q 1LTAC 2YXQB 1M1JB 3F5HA 3CCQP 4CPGA 1PIXA 3KHUA 1SS1A 3L75D 3NTNA 4HB1A 5APUA 1DH3A 1RE4C 4JBZA 1PPJD 1LP1B 1AQTA 1KFNA 4WBAA 3C8VA 5AVSB 2BCCD 3CCSP 1S9KE 4BWNA 3IF4A 1NTZG 2A45H 3L71J 4C7RA 5AW1B 1R5LA 2KIKA 1SQVK 1JUNA 2E74B 1KYOH 2N1TA 1IZNB 3CL3D 3P8MC 5AVTB 2K9JA 1YJNP 2BEQD 2M8RA 1FZFA 4XE5B 3P7KA 1BGYE 2QRXA 4N78D 4YXWH 2YIUB 1N7SC 3MIWA 2OYHB 1FZAA 1NAYA 1U57A 2W8ZA 4TLFA 4HH2A 1GW4A 1SQXE 1NTZD 3ABVC 4GDOA 3O8ZA 3VTPC 3RK3C 1Q2NA 3MZWB 2AXTE 3EQ2A 1EZVD 1Y9BA 2Y0CA 3RL0B 3HD7B 3L75J 1OW8A 3RK2D 5CCHD 3CCMP 5M1BA 4C7NA 5APYA 2RKLA 3KZIH 1LTSC 2Z4EA 1EC5A 2W6BA 1NU1K 2AEFA 2HYNA 3H1JD 3RL0C 5C39A 5CBNA 3TGUE 1PGOA 3C1LA 4N6JA 3CC7P 3SWKA 1MUUA 4JF7A 5CHXA 5AW8B 3BCCG 1EDJA 3TYYA 1J1DB 3CPWO 5AVRB 1ZN5A 2I1JA 1EDKA 1MV8A 3KPEA 3QH9A 1T8ZA 2HLOA 3H1HD 2QE7H 1EZVE 1OX3A 4GIFA 4R4LA 1SQXJ 3LW5J 2D2CC 1T3UA 1N7LA 1L4AA 3H1KE 3TNUB 2CPSA 2A06D 5AW0B 5KJ7D 2IPPA 1OWAA 1L0NE 2NZ2A 3PHLA 1GL2A 1VQPP 3H1JE 1BE3J 1X22A 5CCGA 3MGNA 1GK4A 1KQLA 3C9IA 3CI9A 4UB6E 2PFXA 2JR8A 3AE2C 1QEXA 3BCCD 1RF0C 2IYOA 2J58A 5AVWB 1RE4A 1S2EA 2XKMA 4W7ZA 3V4QA 2ZVNB 3HE4B 3PJSK 2WPVB 1PPJE 4R4MA 1G1JA 1NKNA 3HE5A 5CBOA 3G4SP 3LW5H 1VQ5P 3SFEC 4OGQC 4N3YB 2IYPA 4H0LC 1SQQK 4I7ZB 2N1TC 4DCKA 2KZJA 2QA4P 4WB4A 3L72D 3W67A 3AE8C 3H1IE 1M1JA 1BGYG 2A45G 4U3FJ 3KDPB 4BRYA 1N7SA 1SQBE 1NWQA 1HGZA 1R5SA 1SQQJ 4OH8B 5E79E 5DJTB 1NTZE 1SQBG 1N7SD 2IFNA 2J5UA 1LTIC 1GZLA 2QJPB 2W27A 2YXRB 3WMM0 1BCCD 1KB9I 2KSJA 4RO0A 4XFJA 1ZR2A 1KILD 1PP9E 4L74A 3V2RA 1PV3A 1FDIA 3HUSC 2SPZA 1BDCA 2YMYA 2N9BA 3L72E 4GT1A 1YJ9P 4WY4A 1HH0A 1SQBD 3CCLP 1OW6A 2VRSA 4ZKUA 2AXTH 1AA0A 3BRVB 2IBZI 1KD1Q 1LTJA 1N86A 2FXMA 3HD7D 5KKZC 3BCCJ 4YTPC 1RF1B 1A02F 1OVRA 1QVFO 2P2UA 3IR9A 2G8YA 2I8DA 1KQFB 4HYTB 1NTKG 5CJ0A 4GODA 3PLNA 3HD7A 3CC2P 1KILE 1PP9D 3H32B 1BSNA 1L0NG 1L4AC 5AW2B 3H1KD 1IFPA 3L75G 3PTZA 5APQA 3CCRP 2NPSD 5KLIB 1KORA 2QJYB 3GHGB 4OVNF 5AVXB 1K9MQ 2WSFH 1P84E 2MKVA 3AEFC 2QM8A 3HE5B 1IFNA 2BCCJ 5KAFE 3L73D 3K5BA 2MJZA 2YO3A 3AE7C 3II6A 5K5GB 2BASA 1L0LG 3M91A 2AEJA 4I2LC 1ZW0A 5KAFH 2Y9YA 4UB6H 1FJPA 2A06G 3G9RA 2FYZA 1GL2B 1JY2O 2YKPA 1KFMA 1BCCG 1L2PA 4I1LA 5AW9B 3V2NA 1M1JC 2PRRA 4D6TJ 1KQSO 3GF3A 1Y47A 2D2CD 1P84I 1N73A 2N9YB 5KAIE 1HBWA 3A3YB 1HF9A 3L70E 1SQVJ 3L73E 1FU1A 1ZLLA 2JDIH 2LXBA 2ZJSE 3T97B 3OW2O 2YIUC 1YQ3C 1SQBJ 2W6AA 2HR3A 5KLVK 1HJBA 1K73Q 4H44B 1PGQA 1DEBA 3E1RA 4EOTA 1YBKA 3P32A 3BATA 1U7MA 3VMZA 2HFED 1JY2P 1NU1D 1LTJB 3B8EB 3L72G 4H44C 1LJ2A 1N7SB 3USSA 1Q86Q 2OYHC 3MHVA 3TF5A 2WMMA 5CJ4A 1JOCA 3L70D 2FYUK 1LTJC 1SQBK 2NRGA 1NYHA 5EFWB 1LGHB 3ITKA 5H2FE 5KLVJ 2O01H 1FAVA 1WT6A 2KLVA 1NTZK 1MFZA 2JKVA 1QLED 3HD7C 3M0AA 5H2FH 4AQRD 1HGVA 5KTBA 3B4SA 3M0DA 3GG2A 1AJYA 1TU3F 3V2QA 5GTIE 2NPSC 1Q81Q 3IFMA 2HPCB 3RL0g 1JMBA 1NTME 1GD2E 2ZYAA 3SSUA 3HTKA 1JTHA 2FKWB 1QL2A 2M3EA 3TSIA 2FFDC 1HWTC 2YNYA 2XNDH 1OMIA 3CCVP 3H1KJ 1G2CB 2FYNC 2POHA 3FWLA 5APXA 1YQ4C 1XTGB 5AVQB 1SQPG 5AW4B 3RK3E 4RJTA 1SFCB 2QSIA 4Z1MH 1SLQA 3NMDA 4KHXA 2H7HA 1IFDA 5B5EH 1USEA 3NXSA 1NTZJ 1Q7YQ 3KQGA 2QVAA 4IFMA 1FZGA 1SQVE 1PP9G 1NTMK 5AVUB 3JCUH 1M8OB 3CWBE 2ZT9B 3L74E 3R4YA 1NTMD 2PP6A 3P8CD 1KILC 1MZ9A 2KYVA 2N1TB 2C9LY 3O6QB 4OGQD 3Q1MA 4L76A 3W68A 3PH0A 3V6IA 1EXIA 3MUDC 1K05A 1J1EC 3TGUD 1PL5A 3H1IJ 4JPZB 1EZVI 2QJPC 3PRJA 3RK2B 1VQLP 2YKOA 3B5ND 1QX8A 2P58A 4H44D 4PD4H 2L91A 2W83C 1AV1A 3L71G 2P67A 1NU1E 4H0LD 3Q3DA 2R32A 1N73B 3CX5I 3FX0A 3RBXA 1LTBC 1NH4A 3A0HH 3VMXA 3EFFK 2Z5HA 2O01N 4PD4E 2IBZE 2BCCG 2K9JB 4IOIH 1SQXG 4UB8H 1R8EA 3H1JJ 1S4XA 2Y0EA 3A0HE 3JSVC 4H13C 4MN4C 1YJWP 1IFIA 1GL2D 2WWWA 2E74D 3HUSB 4Y28J 2H43A 2I1KA 3BVHA 3S9OA 1T6AA 1VDFA 2NPSA 2E42A 1PP9J 3E1IA 2QM7A 1OFCX 1KMIZ 2KSEA 1KZUB 2WITA 3AE6C 3L72J 3A7OA 3N7NA 1QVGO 4HKZH 1LWUB 2KNCA 2OARA 2QJYC 2AEMA 3M9HA 4WVZA 5CCHA 4C7NB 5BVZA 2WSFJ 2KUBA 3OA7A 4O9BA 5BU5A 1NAFA 1CZQA 1W2BO 1KC8Q 3RK3D 3CMEP 1IJDB 1SQXD 2OTJP 1N2DC 1BSHA 2JEEA 2WSEJ 1JY2N 1VPCA 2E75D 1D7MA 2WSSH 2Q1KA 3OJAB 4XA4A 1S5LH 1LT9A 3HRNA 4JQ0D 3D6ZA 2RH0A 2ITAA 2Q3EA 1SQQE 2C0XA 2R5BA 2P1JA 4A7PA 1JO5A 3CWBG 3AEBC 3L74G 3H1HG 3IAOA 3PP5A 1JY3O 1KILA 4WY4D 1BDDA 1OIPA 4PJ0E 2WQYC 3FWNA 2WT7A 3TNUA 3AEDC 2ZT9D 1EQ7A 1NTKK 3WU2E 1N73C 2KK7A 2IBZG 4DOJA 2M3BA 3I55P 2C9NY 2E43A 4PJ0H 1Z56A 3CXHI 4DJGA 1M56D 2B88A 4ASWA 1FZCA 2UWJE 3GLMA 4QMAA 3GF7A 2M5AA 3L71E 3L36A 2E76D 1WMKA 1G1IA 5B66H 1FZEA 4WY4C 2O01J 4GOFA 2E76C 2KLUA 1HTLC 1JY3P 1GW3A 3CCJP 5AVVB 2C0WA 1Y8AA 1DD4A 1AFOA 1LNQA 1FOSE 2IBZD 1NTKD 4JYBA 2QEXP 2B9BA 3OAKA 2XZRA 5CMZA 3AEAC 4EDFA 1SQPJ 1KYOD 1FDOA 1OVUA 2HODA 2ZVOB 3KZIE 3RGUA 1GTWA 1NTKJ 1M7LA
chains in the Genus database with same CATH topology
3WUUA 4BRYA 3WUVA 2ZXXA 3F5HA 3WUTA 4BRYB 2Q6QA 1UIIA 3E1RA 2WVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WUU A;  4BRY A;  3WUV A;  2ZXX A;  3F5H A;  3WUT A;  4BRY B;  2Q6Q A;  1UII A;  3E1R A;  2WVR A; 
#chains in the Genus database with same CATH topology
 3GW6 A;  3WUU A;  2L5G B;  4ZNC A;  2JP3 A;  3Q2Y A;  1YTZ T;  1HUC A;  3BAS A;  3CX5 H;  2A45 I;  2W90 A;  3AE9 C;  5AW5 B;  3H1H J;  1CI6 B;  1FJK A;  1MKM A;  3L37 A;  3H1I D;  1S5L X;  2FXP A;  1J1D C;  1PGP A;  1LTT C;  2G3A A;  3IN6 A;  1YTZ I;  4PD4 I;  1K04 A;  1SQX K;  2FYU J;  1LT9 B;  3L75 E;  1DIP A;  5L8R J;  4PV1 D;  1RE3 C;  2FXO A;  2KS1 A;  4OWF A;  4D6T E;  1LT9 C;  1RQV A;  1NTM J;  2WSC J;  1AVY A;  2P7J A;  3L70 G;  2GUS A;  1FZB A;  3H1J G;  4ASV A;  1YHQ P;  1JCC A;  1UII A;  2R44 A;  1ZP0 C;  3FXE A;  1BE3 E;  2FYU G;  1ZOY C;  4BXL A;  4JYC A;  2D2C B;  2OYO A;  2V7Q H;  2ZXX A;  3H32 A;  3B5N C;  1BGY D;  1NO4 A;  2FYN B;  4N78 E;  1NU1 J;  3WUT A;  2QJK B;  3EFG A;  4H13 D;  1KN7 A;  3RBZ A;  1SFC C;  4PV1 C;  4W7Y A;  3G3Z A;  1CW5 A;  3GHG A;  1FE6 A;  2KXP B;  3B5N B;  3T97 A;  1VQ8 P;  2XDJ A;  2RMZ A;  2WSC H;  5KAI H;  2E75 B;  2JJL A;  1RY3 A;  4RES B;  1IO4 A;  2O1J A;  3RL0 D;  2WPQ A;  3L71 D;  1RQU A;  1JCD A;  5AVZ B;  2OYH A;  3S1K A;  1E5W A;  1BE3 D;  2B89 A;  5APW A;  5E79 H;  2K88 A;  2V7Q J;  4Y99 C;  3CWB J;  3L74 J;  1BCC J;  1Q90 D;  2WT7 B;  4AUW A;  1SP4 A;  4NPD A;  4I7Z C;  1L0L D;  3CCE P;  2V4H A;  1W5C E;  1KV4 A;  4LLH A;  1VF5 D;  2Q9I A;  1NTK E;  3AEC C;  1HJ0 A;  3FXD A;  1L0L J;  5B66 E;  1VQN P;  3JC2 2;  3SFD C;  3U59 A;  2XV5 A;  1KYO E;  2M5A B;  3H1H E;  3D6Y A;  4NPF X;  3TGU G;  4EIJ A;  4H13 B;  1RHZ B;  2WTY A;  1FOS F;  2QG4 A;  1NJI Q;  1URQ D;  1ZXG A;  2A06 E;  3LIE A;  3B71 A;  2FFD A;  5KKZ B;  4DZO A;  1RF1 C;  3E7K A;  1DX7 A;  1IFJ A;  1L0L E;  2AXC A;  2GUV A;  2K1A A;  4GOE A;  3G6E P;  2IDB A;  4PD4 D;  1VF5 B;  2ZFC A;  5APT A;  5KLV D;  1JNM A;  4K3A A;  5TJH A;  1H88 A;  2ZXE B;  1M57 D;  3R2P A;  4ZKP A;  1L4A B;  3TGU J;  3CCU P;  2GA1 A;  3CX5 E;  1GK6 A;  1EZV G;  1VF5 C;  4D6T D;  2H8P D;  5KLI C;  4C46 A;  5CCG D;  1VQO P;  2Q5U A;  4NPE A;  2E5Y A;  3I56 P;  3G71 P;  1USD A;  4B86 A;  1AVO A;  1LTG C;  3H1L E;  3Q5R A;  5B5E E;  1YI2 P;  2N1T D;  4ZMD A;  2H89 C;  3B5N A;  4KT0 J;  4IFF A;  5KLV G;  3H25 A;  5TIS E;  3GHG C;  1AQ5 A;  3JCU E;  1PPJ G;  3MUD A;  1IK7 A;  2O1K A;  3NFQ A;  2RN0 A;  2XNX A;  1E79 H;  1VL2 A;  2WVR A;  2LKM A;  5APV A;  4IFD K;  1X0T A;  3CLQ A;  3M9B A;  1VQ9 P;  1NHL A;  2YKQ A;  1VQM P;  2Y0D A;  1U7J A;  3H1L D;  4YPC A;  1PFI A;  1URQ A;  1NKZ B;  3N4X A;  1L0N K;  4U3F D;  3S4R A;  5KJ7 C;  5AW6 B;  2E74 C;  1SQP D;  1GL2 C;  1NOH A;  1GMJ A;  2JWD A;  1VQ7 P;  3L73 J;  3M9Q A;  1NU1 G;  2LXC B;  2FBW C;  1RH5 B;  1JEK A;  3HE4 A;  2E5T A;  2P10 A;  2FYU E;  2ZYD A;  4TT3 H;  1RF0 A;  2WZ7 A;  2ZYG A;  3A2A A;  3O6Q A;  1YYC A;  1FS0 E;  3H1I G;  2K3R A;  2IZ0 A;  3TDK A;  1ZV8 A;  4WY4 B;  5GTH E;  3Q5S A;  1FBM A;  3CMA P;  1A02 J;  3VYI A;  2E76 B;  3UIA A;  1EXJ A;  1IC2 A;  1SQV D;  4D6T G;  2KB7 P;  1KTM A;  1RF1 A;  1DD3 A;  3P8C E;  1OVV A;  5GTH H;  4BRY B;  1SQP E;  5CCH C;  1L4A D;  1BE3 G;  3F89 A;  5AW7 B;  2Q7C A;  3VN0 A;  2WPR A;  3RK3 B;  3AE5 C;  5KLV E;  4IL6 X;  1S3J A;  2OTK E;  2ZAE B;  1X8Y A;  2B87 B;  5GTI H;  3CC4 P;  3CD6 P;  3CXH D;  1S72 P;  1H8A A;  1KB9 E;  2HG5 D;  3AEE C;  3SWY A;  3D71 A;  1L0N J;  3M06 A;  4L75 A;  5APS A;  2JO1 A;  5AVY B;  3V2P A;  2FFD B;  1CSB A;  1S5L E;  2IX7 C;  3GMA A;  4RKU J;  3HUS A;  2Y9Z A;  3SWF A;  1PGJ A;  1MFT A;  2OYI C;  1M1K Q;  1OZH A;  2GM4 A;  2NPS B;  3V4W A;  2CK3 H;  2WPS A;  1L0L K;  3MP7 B;  1T2K D;  1GU4 A;  3BCC E;  1GU5 A;  1X79 B;  1VQ4 P;  2DW3 A;  1VQK P;  1OW7 A;  2KZI A;  3EWK A;  2QJK C;  4LC1 A;  2OYI B;  1FZC C;  4U7J A;  1LWU A;  2KNC B;  4I6M C;  4PV1 B;  4EI2 A;  3A5T A;  1T2K C;  3MTU E;  1NGM B;  3V5B A;  1URQ B;  1JY3 N;  1KB9 D;  2R3C A;  2ZT9 C;  2YMK A;  1FZC B;  1P84 H;  3VP8 A;  3WU2 H;  1K8A Q;  1X9V A;  1KQG B;  1URQ C;  2BEZ F;  3KYQ A;  4OGQ B;  2H88 C;  3WUV A;  5KJ7 A;  5TIS H;  4H0L B;  4U3F E;  1YIT P;  2K37 A;  3VMY A;  4WWI A;  1SQV G;  1DEE G;  3H6P A;  4Y99 B;  1H0T A;  1J2J B;  3L73 G;  4KJM A;  1FDM A;  4L73 A;  4HJG H;  3A0B E;  4IL6 E;  1KIL B;  4K35 A;  2E75 C;  3AEG C;  3RK2 C;  1GDT A;  2FYU D;  2K9Y A;  3Q5P A;  2LR2 A;  2Q6Q A;  1YIJ P;  1XTC C;  4YXD C;  4W80 A;  2J59 M;  1BCC E;  5DJU B;  3U1A A;  3U1C A;  4M3L A;  2KP8 A;  4EYY Q;  3VMA A;  2HOD B;  3A0B H;  4IL6 H;  1S9K D;  1SQQ D;  1J1E B;  2XU6 A;  1LP1 A;  3AE1 C;  1EDI A;  2IFM A;  3L4F A;  1LT1 A;  1ZRT D;  3ZDM A;  5BU8 B;  2B87 A;  3H1L G;  3KXD A;  3VOP A;  3D70 A;  1ZME C;  3CXH H;  1SVF A;  1UIX A;  1ZR4 A;  2FY8 A;  4AYC A;  3MD0 A;  3I5C A;  1OXZ A;  1RE3 A;  3H1K G;  1HVV A;  2KOG A;  3VP9 A;  4DT0 A;  2KI7 B;  1N8R Q;  2QIW A;  1IFM A;  1SFC D;  2HPC A;  2WSE H;  3CXH E;  1JM0 A;  2M0B A;  1IK9 A;  1FC2 C;  2KS1 B;  2PAJ A;  3FGA D;  2OTL P;  3L70 J;  1JTH B;  4UB8 E;  2JWA A;  4LGD E;  1Q82 Q;  1ZRT E;  1G2C A;  1PZQ A;  1KYO I;  2R3S A;  2YO2 A;  3CWB D;  3L74 D;  2OYI A;  1QGK B;  1SFC A;  1P84 D;  2Q3I A;  1SQP K;  2R5D A;  1EDL A;  3LID A;  1KB9 H;  3AE3 C;  3TK1 A;  1CI6 A;  1LWU C;  1QL1 A;  3AE4 C;  1S1C X;  2Z5I A;  3CX5 D;  2W6J H;  1W2E A;  1NTM G;  1JB0 J;  5AW3 B;  2CPB A;  3QWO C;  1H89 A;  2BCC E;  1T3J A;  1VQ6 P;  2IZ1 A;  1WRG A;  1JMM A;  3L35 A;  1H0T B;  1BGY J;  2OQQ A;  4U3F G;  2OGU A;  1L0N D;  3M0D C;  2PGD A;  3HTK B;  4GKG A;  2O3J A;  1SQQ G;  1NVO A;  3H1L J;  5CCG C;  3BRT B;  1M90 Q;  1LTA C;  2YXQ B;  1M1J B;  3F5H A;  3CCQ P;  4CPG A;  1PIX A;  3KHU A;  1SS1 A;  3L75 D;  3NTN A;  4HB1 A;  5APU A;  1DH3 A;  1RE4 C;  4JBZ A;  1PPJ D;  1LP1 B;  1AQT A;  1KFN A;  4WBA A;  3C8V A;  5AVS B;  2BCC D;  3CCS P;  1S9K E;  4BWN A;  3IF4 A;  1NTZ G;  2A45 H;  3L71 J;  4C7R A;  5AW1 B;  1R5L A;  2KIK A;  1SQV K;  1JUN A;  2E74 B;  1KYO H;  2N1T A;  1IZN B;  3CL3 D;  3P8M C;  5AVT B;  2K9J A;  1YJN P;  2BEQ D;  2M8R A;  1FZF A;  4XE5 B;  3P7K A;  1BGY E;  2QRX A;  4N78 D;  4YXW H;  2YIU B;  1N7S C;  3MIW A;  2OYH B;  1FZA A;  1NAY A;  1U57 A;  2W8Z A;  4TLF A;  4HH2 A;  1GW4 A;  1SQX E;  1NTZ D;  3ABV C;  4GDO A;  3O8Z A;  3VTP C;  3RK3 C;  1Q2N A;  3MZW B;  2AXT E;  3EQ2 A;  1EZV D;  1Y9B A;  2Y0C A;  3RL0 B;  3HD7 B;  3L75 J;  1OW8 A;  3RK2 D;  5CCH D;  3CCM P;  5M1B A;  4C7N A;  5APY A;  2RKL A;  3KZI H;  1LTS C;  2Z4E A;  1EC5 A;  2W6B A;  1NU1 K;  2AEF A;  2HYN A;  3H1J D;  3RL0 C;  5C39 A;  5CBN A;  3TGU E;  1PGO A;  3C1L A;  4N6J A;  3CC7 P;  3SWK A;  1MUU A;  4JF7 A;  5CHX A;  5AW8 B;  3BCC G;  1EDJ A;  3TYY A;  1J1D B;  3CPW O;  5AVR B;  1ZN5 A;  2I1J A;  1EDK A;  1MV8 A;  3KPE A;  3QH9 A;  1T8Z A;  2HLO A;  3H1H D;  2QE7 H;  1EZV E;  1OX3 A;  4GIF A;  4R4L A;  1SQX J;  3LW5 J;  2D2C C;  1T3U A;  1N7L A;  1L4A A;  3H1K E;  3TNU B;  2CPS A;  2A06 D;  5AW0 B;  5KJ7 D;  2IPP A;  1OWA A;  1L0N E;  2NZ2 A;  3PHL A;  1GL2 A;  1VQP P;  3H1J E;  1BE3 J;  1X22 A;  5CCG A;  3MGN A;  1GK4 A;  1KQL A;  3C9I A;  3CI9 A;  4UB6 E;  2PFX A;  2JR8 A;  3AE2 C;  1QEX A;  3BCC D;  1RF0 C;  2IYO A;  2J58 A;  5AVW B;  1RE4 A;  1S2E A;  2XKM A;  4W7Z A;  3V4Q A;  2ZVN B;  3HE4 B;  3PJS K;  2WPV B;  1PPJ E;  4R4M A;  1G1J A;  1NKN A;  3HE5 A;  5CBO A;  3G4S P;  3LW5 H;  1VQ5 P;  3SFE C;  4OGQ C;  4N3Y B;  2IYP A;  4H0L C;  1SQQ K;  4I7Z B;  2N1T C;  4DCK A;  2KZJ A;  2QA4 P;  4WB4 A;  3L72 D;  3W67 A;  3AE8 C;  3H1I E;  1M1J A;  1BGY G;  2A45 G;  4U3F J;  3KDP B;  4BRY A;  1N7S A;  1SQB E;  1NWQ A;  1HGZ A;  1R5S A;  1SQQ J;  4OH8 B;  5E79 E;  5DJT B;  1NTZ E;  1SQB G;  1N7S D;  2IFN A;  2J5U A;  1LTI C;  1GZL A;  2QJP B;  2W27 A;  2YXR B;  3WMM 0;  1BCC D;  1KB9 I;  2KSJ A;  4RO0 A;  4XFJ A;  1ZR2 A;  1KIL D;  1PP9 E;  4L74 A;  3V2R A;  1PV3 A;  1FDI A;  3HUS C;  2SPZ A;  1BDC A;  2YMY A;  2N9B A;  3L72 E;  4GT1 A;  1YJ9 P;  4WY4 A;  1HH0 A;  1SQB D;  3CCL P;  1OW6 A;  2VRS A;  4ZKU A;  2AXT H;  1AA0 A;  3BRV B;  2IBZ I;  1KD1 Q;  1LTJ A;  1N86 A;  2FXM A;  3HD7 D;  5KKZ C;  3BCC J;  4YTP C;  1RF1 B;  1A02 F;  1OVR A;  1QVF O;  2P2U A;  3IR9 A;  2G8Y A;  2I8D A;  1KQF B;  4HYT B;  1NTK G;  5CJ0 A;  4GOD A;  3PLN A;  3HD7 A;  3CC2 P;  1KIL E;  1PP9 D;  3H32 B;  1BSN A;  1L0N G;  1L4A C;  5AW2 B;  3H1K D;  1IFP A;  3L75 G;  3PTZ A;  5APQ A;  3CCR P;  2NPS D;  5KLI B;  1KOR A;  2QJY B;  3GHG B;  4OVN F;  5AVX B;  1K9M Q;  2WSF H;  1P84 E;  2MKV A;  3AEF C;  2QM8 A;  3HE5 B;  1IFN A;  2BCC J;  5KAF E;  3L73 D;  3K5B A;  2MJZ A;  2YO3 A;  3AE7 C;  3II6 A;  5K5G B;  2BAS A;  1L0L G;  3M91 A;  2AEJ A;  4I2L C;  1ZW0 A;  5KAF H;  2Y9Y A;  4UB6 H;  1FJP A;  2A06 G;  3G9R A;  2FYZ A;  1GL2 B;  1JY2 O;  2YKP A;  1KFM A;  1BCC G;  1L2P A;  4I1L A;  5AW9 B;  3V2N A;  1M1J C;  2PRR A;  4D6T J;  1KQS O;  3GF3 A;  1Y47 A;  2D2C D;  1P84 I;  1N73 A;  2N9Y B;  5KAI E;  1HBW A;  3A3Y B;  1HF9 A;  3L70 E;  1SQV J;  3L73 E;  1FU1 A;  1ZLL A;  2JDI H;  2LXB A;  2ZJS E;  3T97 B;  3OW2 O;  2YIU C;  1YQ3 C;  1SQB J;  2W6A A;  2HR3 A;  5KLV K;  1HJB A;  1K73 Q;  4H44 B;  1PGQ A;  1DEB A;  3E1R A;  4EOT A;  1YBK A;  3P32 A;  3BAT A;  1U7M A;  3VMZ A;  2HFE D;  1JY2 P;  1NU1 D;  1LTJ B;  3B8E B;  3L72 G;  4H44 C;  1LJ2 A;  1N7S B;  3USS A;  1Q86 Q;  2OYH C;  3MHV A;  3TF5 A;  2WMM A;  5CJ4 A;  1JOC A;  3L70 D;  2FYU K;  1LTJ C;  1SQB K;  2NRG A;  1NYH A;  5EFW B;  1LGH B;  3ITK A;  5H2F E;  5KLV J;  2O01 H;  1FAV A;  1WT6 A;  2KLV A;  1NTZ K;  1MFZ A;  2JKV A;  1QLE D;  3HD7 C;  3M0A A;  5H2F H;  4AQR D;  1HGV A;  5KTB A;  3B4S A;  3M0D A;  3GG2 A;  1AJY A;  1TU3 F;  3V2Q A;  5GTI E;  2NPS C;  1Q81 Q;  3IFM A;  2HPC B;  3RL0 g;  1JMB A;  1NTM E;  1GD2 E;  2ZYA A;  3SSU A;  3HTK A;  1JTH A;  2FKW B;  1QL2 A;  2M3E A;  3TSI A;  2FFD C;  1HWT C;  2YNY A;  2XND H;  1OMI A;  3CCV P;  3H1K J;  1G2C B;  2FYN C;  2POH A;  3FWL A;  5APX A;  1YQ4 C;  1XTG B;  5AVQ B;  1SQP G;  5AW4 B;  3RK3 E;  4RJT A;  1SFC B;  2QSI A;  4Z1M H;  1SLQ A;  3NMD A;  4KHX A;  2H7H A;  1IFD A;  5B5E H;  1USE A;  3NXS A;  1NTZ J;  1Q7Y Q;  3KQG A;  2QVA A;  4IFM A;  1FZG A;  1SQV E;  1PP9 G;  1NTM K;  5AVU B;  3JCU H;  1M8O B;  3CWB E;  2ZT9 B;  3L74 E;  3R4Y A;  1NTM D;  2PP6 A;  3P8C D;  1KIL C;  1MZ9 A;  2KYV A;  2N1T B;  2C9L Y;  3O6Q B;  4OGQ D;  3Q1M A;  4L76 A;  3W68 A;  3PH0 A;  3V6I A;  1EXI A;  3MUD C;  1K05 A;  1J1E C;  3TGU D;  1PL5 A;  3H1I J;  4JPZ B;  1EZV I;  2QJP C;  3PRJ A;  3RK2 B;  1VQL P;  2YKO A;  3B5N D;  1QX8 A;  2P58 A;  4H44 D;  4PD4 H;  2L91 A;  2W83 C;  1AV1 A;  3L71 G;  2P67 A;  1NU1 E;  4H0L D;  3Q3D A;  2R32 A;  1N73 B;  3CX5 I;  3FX0 A;  3RBX A;  1LTB C;  1NH4 A;  3A0H H;  3VMX A;  3EFF K;  2Z5H A;  2O01 N;  4PD4 E;  2IBZ E;  2BCC G;  2K9J B;  4IOI H;  1SQX G;  4UB8 H;  1R8E A;  3H1J J;  1S4X A;  2Y0E A;  3A0H E;  3JSV C;  4H13 C;  4MN4 C;  1YJW P;  1IFI A;  1GL2 D;  2WWW A;  2E74 D;  3HUS B;  4Y28 J;  2H43 A;  2I1K A;  3BVH A;  3S9O A;  1T6A A;  1VDF A;  2NPS A;  2E42 A;  1PP9 J;  3E1I A;  2QM7 A;  1OFC X;  1KMI Z;  2KSE A;  1KZU B;  2WIT A;  3AE6 C;  3L72 J;  3A7O A;  3N7N A;  1QVG O;  4HKZ H;  1LWU B;  2KNC A;  2OAR A;  2QJY C;  2AEM A;  3M9H A;  4WVZ A;  5CCH A;  4C7N B;  5BVZ A;  2WSF J;  2KUB A;  3OA7 A;  4O9B A;  5BU5 A;  1NAF A;  1CZQ A;  1W2B O;  1KC8 Q;  3RK3 D;  3CME P;  1IJD B;  1SQX D;  2OTJ P;  1N2D C;  1BSH A;  2JEE A;  2WSE J;  1JY2 N;  1VPC A;  2E75 D;  1D7M A;  2WSS H;  2Q1K A;  3OJA B;  4XA4 A;  1S5L H;  1LT9 A;  3HRN A;  4JQ0 D;  3D6Z A;  2RH0 A;  2ITA A;  2Q3E A;  1SQQ E;  2C0X A;  2R5B A;  2P1J A;  4A7P A;  1JO5 A;  3CWB G;  3AEB C;  3L74 G;  3H1H G;  3IAO A;  3PP5 A;  1JY3 O;  1KIL A;  4WY4 D;  1BDD A;  1OIP A;  4PJ0 E;  2WQY C;  3FWN A;  2WT7 A;  3TNU A;  3AED C;  2ZT9 D;  1EQ7 A;  1NTK K;  3WU2 E;  1N73 C;  2KK7 A;  2IBZ G;  4DOJ A;  2M3B A;  3I55 P;  2C9N Y;  2E43 A;  4PJ0 H;  1Z56 A;  3CXH I;  4DJG A;  1M56 D;  2B88 A;  4ASW A;  1FZC A;  2UWJ E;  3GLM A;  4QMA A;  3GF7 A;  2M5A A;  3L71 E;  3L36 A;  2E76 D;  1WMK A;  1G1I A;  5B66 H;  1FZE A;  4WY4 C;  2O01 J;  4GOF A;  2E76 C;  2KLU A;  1HTL C;  1JY3 P;  1GW3 A;  3CCJ P;  5AVV B;  2C0W A;  1Y8A A;  1DD4 A;  1AFO A;  1LNQ A;  1FOS E;  2IBZ D;  1NTK D;  4JYB A;  2QEX P;  2B9B A;  3OAK A;  2XZR A;  5CMZ A;  3AEA C;  4EDF A;  1SQP J;  1KYO D;  1FDO A;  1OVU A;  2HOD A;  2ZVO B;  3KZI E;  3RGU A;  1GTW A;  1NTK J;  1M7L A; 
#chains in the Genus database with same CATH homology
 3WUU A;  4BRY A;  3WUV A;  2ZXX A;  3F5H A;  3WUT A;  4BRY B;  2Q6Q A;  1UII A;  3E1R A;  2WVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...