3WUUA

Structure basis of inactivating cell abscission with chimera peptide 1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
AMGSFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Centrosomal protein of 55 kDa
publication title Structural and biochemical insights into the role of testis-expressed gene 14 (TEX14) in forming the stable intercellular bridges of germ cells
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 54
sequence length 54
chains with identical sequence B, D, E, G, H, J, K
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12180 EABR TSG101 and ALIX binding domain of CEP55
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 3wuuA00
3WUUA 3WUTA 2WVRA 4BRYA 1UIIA 2ZXXA 3E1RA 2Q6QA 3F5HA 3WUVA 4BRYB
chains in the Genus database with same CATH superfamily
4N78E 1SQXK 1D7MA 1S9KD 4QMAA 4N6JA 1S9KE 2KS1B 3I5CA 1RE4C 3M9QA 5CCHD 3CWBJ 4NPDA 5BU8B 1AFOA 2ZT9C 2HYNA 1LTTC 3M0DC 1LT9B 2FFDB 1FDIA 2M5AA 1JEKA 3V2RA 1TU3F 1OWAA 2YO3A 4W7YA 3OAKA 2R3CA 1LTJA 2E74C 1ZRTD 1OX3A 2WQYC 4EIJA 3G6EP 5KAFH 2Y9ZA 1ZRTE 4U3FD 3IAOA 1PPJD 2JWDA 2QG4A 4U3FE 3L36A 1PPJE 1SFCB 5KJ7D 1NTKD 3II6A 5AW8B 2OYIC 2P67A 2HPCA 5K5GB 1LGHB 3QWOC 4H13C 2Y0EA 3L4FA 4I2LC 2WMMA 3AE1C 1LTBC 1VQ9P 1BCCG 1L0LD 2YXQB 2A06D 1KQFB 2W6AA 4U3FJ 1U7MA 2A06E 4IOIH 3Q5RA 3PJSK 4WWIA 2KLVA 1SQPD 4BRYB 2RN0A 1SQPE 4RJTA 1KB9D 3BASA 3EWKA 5AVQB 2H7HA 3HD7B 3VOPA 3GHGA 3V4WA 1RF0C 2O3JA 3L35A 2IBZD 3VN0A 1JMBA 2IBZE 1PP9G 4DOJA 3PHLA 3Q5SA 3MUDC 3TDKA 2AXTE 2KP8A 2ZXEB 2B87B 1K04A 3RK3E 2E76C 1N73A 3HUSA 4Y99B 2IZ0A 1SQPJ 1S72P 2ZVNB 2V7QH 3KHUA 2YXRB 4MN4C 3H1ID 1J2JB 3B4SA 4JYCA 2ZYAA 2WT7A 4IFMA 2K9JA 1XTCC 1NAYA 3WU2H 3P32A 1IFJA 3CX5I 1HBWA 2ITAA 2ZJSE 4IFFA 3AEFC 3E1RA 1WRGA 3O6QB 2QEXP 1L2PA 3C1LA 1SQVG 1N73C 2WSFJ 3D6YA 3GG2A 1VDFA 3ITKA 1OVVA 1JM0A 2D2CB 4PD4H 1T8ZA 1W2EA 1DIPA 4H0LD 1Q86Q 1KTMA 3JCUH 4H44C 5AW2B 2ZFCA 2QJYC 3RL0D 2Z5IA 3CX5E 2R5DA 1FS0E 5KLVG 1SQXG 2GUVA 4OGQD 3L72G 3TF5A 1IFDA 1E79H 3KZIH 3L75G 4HB1A 4TLFA 1NOHA 1JY3P 2QRXA 1ZXGA 4IL6X 5APYA 4LLHA 3QH9A 3H25A 2KZIA 2YO2A 1HH0A 1ZP0C 2KLUA 4Z1MH 3L74G 1N7LA 3AE7C 1VQLP 3AE8C 1N7SB 5H2FH 2WWWA 3CCQP 1M57D 1BE3G 1RQUA 1HVVA 2WZ7A 2C9LY 1SFCA 3BRTB 1GL2D 1HGZA 2PAJA 4PJ0H 3RK2D 4OVNF 4ASVA 2KYVA 1LT9C 1URQB 2VRSA 2FFDC 1CI6A 4WB4A 3FXDA 2IZ1A 4I6MC 1SQQD 2CPSA 2G3AA 1SQQE 3PTZA 2Y9YA 1VQKP 1VQMP 2WVRA 1QX8A 3CCVP 2M5AB 1K73Q 3R2PA 1YHQP 1HTLC 1DD4A 1SFCC 1G2CA 1LTJB 2QA4P 1P84I 3CXHH 3KXDA 2R5BA 3RBZA 1Y8AA 2WSCH 3U1AA 1USEA 2H43A 1SQQJ 1G1JA 3MD0A 3M06A 2HPCB 3ABVC 1NJIQ 4DCKA 1VQ7P 3L70E 3M0AA 1FJPA 3A7OA 1Z56A 2I8DA 1MFZA 1GW3A 4XA4A 3WUUA 4O9BA 2XNDH 2J59M 1GTWA 1SQBK 1MKMA 1AQTA 5CBOA 3L37A 1XTGB 3BRVB 3B5ND 1YQ3C 1Y9BA 4IL6H 1P84D 5M1BA 4EOTA 1P84E 3CPWO 3CCEP 2WITA 3L70J 4WVZA 3HD7C 2FYUD 1NYHA 2HG5D 2QIWA 1JUNA 1S2EA 1JCCA 2ZT9D 2GA1A 3TGUG 3F5HA 3GHGB 2HODA 3O6QA 4UB8E 4WY4A 4ASWA 3TNUB 1KYOH 4Y99C 4D6TE 3H1KD 3CLQA 5TISE 3Q3DA 3H1KE 2Q3IA 1IK7A 4CPGA 1FZCA 1NVOA 3AEEC 4HJGH 1BGYE 4HYTB 2E74D 3HUSB 3H1HD 1E5WA 3H1HE 3SFEC 5B66H 3V2PA 3VP9A 5APVA 1GK4A 1YITP 3L73D 2E75B 1PL5A 2O01H 3L73E 4D6TJ 5E79H 2WT7B 1QL2A 2K9JB 3H1KJ 3CC7P 1PGPA 4H13D 3EQ2A 4KJMA 4H44B 1BGYJ 4JF7A 3NXSA 1VQ8P 2FKWB 3H1HJ 1HUCA 3W68A 1M1JA 3AEBC 5CCGC 1AA0A 2D2CC 1X9VA 3L73J 3TSIA 2Q5UA 3VMXA 2ZYGA 1A02J 3HE4A 4GIFA 5AW6B 1R5LA 1BCCD 2N9BA 3G4SP 5APSA 3SWFA 5AW4B 3U1CA 3GF7A 1FE6A 1H88A 2NPSA 3G71P 3GMAA 5CMZA 1FAVA 2E76D 3I56P 2I1KA 1M1KQ 1L4AA 2A45I 2KIKA 1QEXA 3A0HE 3CC4P 3H1JG 2ZXXA 3NTNA 1NKZB 4RKUJ 1URQA 3L71G 1KORA 1N86A 3RK3B 1SQPK 2WSSH 3N7NA 1KFNA 2K1AA 3FWLA 1N7SC 2QSIA 2B88A 3VYIA 2ZYDA 1H89A 1J1EB 1NTZD 2MKVA 4I1LA 1FZAA 3CCRP 1KC8Q 4GODA 2N1TD 1ZV8A 4NPFX 4PD4D 1UIIA 1VF5B 3BCCD 1URQC 1ZLLA 3BCCE 3A3YB 3LIEA 1KB9I 1NTKE 4JPZB 4HH2A 1SQVD 1FZGA 1SQBG 1RE3A 2IBZI 3BVHA 1NTZJ 1CI6B 3KYQA 3JC22 4DJGA 2AEMA 5AVYB 2QJKB 1KD1Q 4BWNA 2J5UA 1KQSO 2P1JA 4PV1B 4YPCA 4M3LA 2XDJA 1LTJC 5AVTB 1L0LE 3FWNA 3S1KA 3BCCJ 3G9RA 1GDTA 1NTKJ 3B8EB 3MGNA 1EDLA 4OWFA 1G2CB 3RL0B 4LC1A 5AVXB 5KLIB 2W90A 1JY3N 3CWBG 3W67A 5KLVD 1KB9E 3B71A 5AVSB 3T97A 4OH8B 1ZN5A 3L72D 1JTHA 3AE2C 3TNUA 1VQ4P 1CZQA 1YQ4C 1L0LJ 3A0BE 1PGOA 1LT1A 3E1IA 4Y28J 3M9HA 1DH3A 1N2DC 2W83C 5CCHA 1NAFA 1S5LE 4HKZH 2BASA 1OW6A 2B9BA 1Q82Q 3V4QA 2SPZA 2QJPB 2JDIH 1EXJA 2YMKA 1JCDA 1PIXA 5AVVB 3S4RA 4UB6E 1FDMA 2GM4A 3H1IE 1IC2A 3L74D 2OTKE 1X0TA 3SSUA 4C7RA 3GHGC 5L8RJ 4YXDC 2M3EA 5AW7B 1S5LX 1RHZB 1H8AA 2YMYA 2J58A 2HODB 3H6PA 2MJZA 2WPQA 4WY4B 3NFQA 3AE9C 4DZOA 5KJ7A 1GL2B 3HUSC 4I7ZB 4U3FG 1X79B 1PPJG 1OMIA 1RY3A 3H1IJ 2IDBA 5DJTB 1FZBA 1FZCB 3EFGA 1IO4A 2Z5HA 3LIDA 1KILD 3S9OA 4ZNCA 1KILE 2E75C 2BCCD 3VMAA 2P2UA 2BCCE 1T2KC 2JO1A 2FYZA 3NMDA 1QL1A 4R4MA 1NU1D 4L74A 5C39A 1NU1E 1AVOA 1G1IA 1VQOP 3AEGC 4EYYQ 2A06G 4EI2A 1SQQK 1MZ9A 1SLQA 3P8MC 2Q1KA 3VTPC 2BCCJ 1LTSC 1SQPG 2O1KA 1M1JB 1NU1J 1KN7A 2H88C 3WUTA 3OJAB 1T3UA 3HD7D 2IBZG 1EZVI 2Z4EA 5GTHE 2FXOA 3HE4B 1JY2O 1DD3A 4L75A 3F89A 1EDJA 2W8ZA 3B5NB 1JNMA 1U7JA 3SWKA 5GTIE 1RQVA 2OGUA 3D70A 1VQ5P 1W2BO 1S4XA 1X22A 1KV4A 3GLMA 1L0ND 2NPSB 1L0NE 2R44A 5AVZB 1YTZT 1GU5A 3CMAP 1VQPP 2WSEH 1BSNA 2XNXA 5CJ4A 2AEJA 1L4AB 3RK3C 1FOSF 2HLOA 1GW4A 2E5TA 2AXTH 3LW5J 2P10A 3V6IA 1LNQA 1EZVD 1Q90D 3PH0A 1EZVE 5E79E 3MHVA 2L91A 1YBKA 3AEAC 4XFJA 3V2NA 2KXPB 1J1EC 1L0NJ 3HTKA 1KILA 1RH5B 3VP8A 3A2AA 2WSFH 1GK6A 3MZWB 1EDIA 1HGVA 1OW8A 2NRGA 2ZAEB 1VF5C 4W7ZA 1PZQA 1EC5A 5CCGD 2D2CD 2CK3H 1VQNP 4ZKPA 2QE7H 1KQLA 3N4XA 5AW5B 2QJKC 2XZRA 1IFMA 3KPEA 4PV1C 5B5EE 1K8AQ 1IFPA 1FU1A 1MUUA 2KSEA 5KAIE 2YNYA 3H1LD 1FC2C 1IK9A 3H1LE 2FY8A 1NTMD 2OQQA 3AE6C 1WMKA 1NTME 3VMYA 3C8VA 2JJLA 3RL0C 1KMIZ 5KLIC 3P8CD 3CCMP 2L5GB 3P8CE 2RKLA 3CX5H 3SWYA 1OVUA 1GZLA 1JY2N 2C0XA 1J1DB 1JOCA 2FYUE 3TK1A 1K9MQ 3H1LJ 3T97B 4R4LA 1JTHB 1N7SD 1NTMJ 4KT0J 4NPEA 3MP7B 1YTZI 1GL2A 2N9YB 1X8YA 2QJPC 1DX7A 3V5BA 4RESB 1HF9A 1LWUA 2POHA 2FYNB 5DJUB 4BXLA 2E5YA 3FX0A 3L71D 5KAFE 1MFTA 3CMEP 2FYUJ 3Q2YA 2PRRA 2R3SA 3SFDC 4AUWA 3CCUP 2FXPA 3G3ZA 1SQQG 4GOEA 2Y0DA 1GD2E 1BDDA 2Y0CA 1Q81Q 4WY4C 2Q6QA 3WUVA 2N1TB 4U7JA 1GL2C 4I7ZC 2KB7P 2I1JA 1FZCC 3H32A 2E43A 2KNCB 1HJBA 1SQBD 2RH0A 2Q9IA 3L70G 4RO0A 1H0TA 2KK7A 3GW6A 3B5NA 1NTKK 1BCCE 3HE5A 3P7KA 3PP5A 2R32A 2H8PD 1AJYA 3CL3D 1SS1A 3U59A 1RE4A 2KUBA 1NHLA 1M1JC 2XKMA 1KQGB 1N8RQ 1L0LK 3M0DA 1KZUB 4PD4I 1JY2P 3IFMA 4C46A 1BCCJ 1YYCA 4KHXA 1PP9D 3AE3C 3CI9A 1GU4A 1PP9E 3B5NC 1NH4A 2E42A 3WU2E 1CW5A 4D6TG 2JR8A 3H1KG 5APWA 1DEBA 2NPSC 2JP3A 1P84H 2V7QJ 1BGYG 2FXMA 3OW2O 3H1HG 1NTZE 2OYIA 1W5CE 1L4AC 1PP9J 1Y47A 2QM8A 4WBAA 2WPRA 4UB8H 3L73G 4PD4E 3MIWA 3RBXA 4B86A 2E75D 3V2QA 2PFXA 1T2KD 5TISH 3JCUE 5KKZB 1AVYA 1S1CX 1ZR4A 3CCLP 4JBZA 1SQVE 4H44D 3KDPB 3AEDC 1LJ2A 2Q3EA 3ZDMA 4C7NA 5CJ0A 2K88A 3HTKB 1KILB 2OYHB 2QVAA 2LKMA 1VL2A 1VQ6P 3KZIE 4H0LB 4LGDE 1SP4A 1IFNA 5BVZA 1RF0A 3AE4C 3AE5C 1SQVJ 3WMM0 3MUDA 5APQA 2YIUB 1HWTC 2FBWC 5AVUB 3K5BA 5CBNA 1IZNB 3FGAD 4OGQB 1RE3C 1SQXD 5KLVE 1SQXE 3BATA 4GT1A 3O8ZA 1NU1K 3L72E 1SVFA 1S3JA 3L75D 1LTAC 3L75E 2P7JA 1OVRA 5H2FE 3GF3A 1FZFA 1NKNA 2K37A 4DT0A 5AVWB 1EDKA 1ZW0A 3CXHI 4L76A 1J1DC 1M7LA 3M91A 5KLVJ 1SQXJ 1VPCA 4PJ0E 3RK3D 3L72J 4K3AA 5AW3B 1ZMEC 1OXZA 3L74E 3L75J 4JYBA 2N1TA 3D71A 1NTZG 2XU6A 4GOFA 2FYNC 5CCHC 1BE3D 2WSEJ 3A0HH 3D6ZA 1BE3E 2RMZA 2HR3A 3KQGA 3RK2B 2A45G 1JO5A 2KNCA 1LWUB 3BCCG 2M0BA 1L0NK 1VF5D 3L74J 3CXHD 4AYCA 1NTKG 1SFCD 3CXHE 1LP1A 2IX7C 1QLED 1RF1B 2LXCB 1Q2NA 1QGKB 2UWJE 1USDA 1YJNP 2N1TC 1PGQA 2W27A 1BE3J 1OW7A 2P58A 1IJDB 3PRJA 1KYOI 1ZR2A 1L0LG 1OFCX 4PV1D 5KJ7C 2A45H 2H89C 2KSJA 2PGDA 4GDOA 2WSCJ 4AQRD 3H32B 2V4HA 2DW3A 2BEQD 2IPPA 3CX5D 1JMMA 4IL6E 4GKGA 2M3BA 1MV8A 3PLNA 2OYOA 1NGMB 5BU5A 1PV3A 3IF4A 1R8EA 1BSHA 1NO4A 1H0TB 4YXWH 5APUA 2KS1A 1M90Q 2AEFA 3Q1MA 1KYOD 3HE5B 1KYOE 2WPVB 5EFWB 2JKVA 2KZJA 1LT9A 1KB9H 5AW1B 2FFDA 3H1IG 1NTMK 2ZT9B 5B66E 4A7PA 3A0BH 2YKOA 3TGUD 2BEZF 3TGUE 3C9IA 2LR2A 1S5LH 2W6JH 2FYUK 2PP6A 1R5SA 1EQ7A 3VMZA 5AVRB 4WY4D 2E74B 2OTLP 2OYHA 3OA7A 4UB6H 1FOSE 3A5TA 1LTIC 5CHXA 3TGUJ 2OYIB 2BCCG 3CCJP 2O01J 3FXEA 2Q7CA 3HRNA 1NU1G 1YJWP 2AXCA 5KKZC 2IYOA 4H13B 4IFDK 3CCSP 2K3RA 1KILC 2OYHC 2IYPA 2K9YA 1K05A 4BRYA 2YKQA 1KFMA 2G8YA 4H0LC 4C7NB 3HD7A 2CPBA 5KTBA 1T6AA 3M9BA 4YTPC 1CSBA 5AW0B 3L70D 1DEEG 2ZVOB 1IFIA 1BDCA 5APTA 2YIUC 2B87A 1ZOYC 1Q7YQ 4OGQC 4K35A 1JB0J 1YI2P 4EDFA 2WPSA 2KOGA 1PGJA 2E76B 3JSVC 2M8RA 2B89A 3CC2P 1L0NG 2JWAA 3EFFK 2NPSD 3CD6P 3UIAA 2O01N 1T3JA 1EXIA 3AECC 2IFMA 3H1JD 5APXA 5GTHH 3H1JE 1LTGC 2LXBA 4XE5B 3L71E 1L4AD 4N3YB 3R4YA 3LW5H 2YKPA 1EZVG 4D6TD 1FBMA 5GTIH 1OZHA 2W6BA 1RF1A 1AV1A 3IN6A 1URQD 1PFIA 5AW9B 1A02F 1BGYD 2OTJP 3E7KA 1GMJA 1N73B 5CCGA 3IR9A 2NZ2A 4TT3H 3Q5PA 2C0WA 2JEEA 3H1JJ 1YJ9P 5TJHA 3I55P 3RK2C 1QVFO 3L71J 1LWUC 3RL0g 4JQ0D 1AQ5A 1UIXA 3USSA 1YIJP 1NTZK 2HFED 2QM7A 1RF1C 1SQBE 2QJYB 2OARA 1LP1B 4L73A 1NWQA 3TYYA 4ZKUA 3RGUA 2KI7B 1FZEA 3H1LG 1SQVK 1NTMG 4W80A 1OIPA 2XV5A 3MTUE 2WTYA 1WT6A 1SQBJ 1JY3O 3CWBD 2IFNA 2FYUG 3CWBE 1QVGO 5B5EH 1N7SA 1FJKA 4ZMDA 5KAIH 1U57A 1HJ0A 2GUSA 1FDOA 2C9NY 1M8OB 4N78D 2O1JA 1M56D 5KLVK
chains in the Genus database with same CATH topology
3WUUA 3WUTA 2WVRA 4BRYA 1UIIA 2ZXXA 3E1RA 2Q6QA 3F5HA 3WUVA 4BRYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WUU A;  3WUT A;  2WVR A;  4BRY A;  1UII A;  2ZXX A;  3E1R A;  2Q6Q A;  3F5H A;  3WUV A;  4BRY B; 
#chains in the Genus database with same CATH topology
 4N78 E;  1SQX K;  1D7M A;  1S9K D;  4QMA A;  4N6J A;  1S9K E;  2KS1 B;  3I5C A;  1RE4 C;  3M9Q A;  5CCH D;  3CWB J;  4NPD A;  5BU8 B;  1AFO A;  2ZT9 C;  2HYN A;  1LTT C;  3M0D C;  1LT9 B;  2FFD B;  1FDI A;  2M5A A;  1JEK A;  3V2R A;  1TU3 F;  1OWA A;  2YO3 A;  4W7Y A;  3OAK A;  2R3C A;  1LTJ A;  2E74 C;  1ZRT D;  1OX3 A;  2WQY C;  4EIJ A;  3G6E P;  5KAF H;  2Y9Z A;  1ZRT E;  4U3F D;  3IAO A;  1PPJ D;  2JWD A;  2QG4 A;  4U3F E;  3L36 A;  1PPJ E;  1SFC B;  5KJ7 D;  1NTK D;  3II6 A;  5AW8 B;  2OYI C;  2P67 A;  2HPC A;  5K5G B;  1LGH B;  3QWO C;  4H13 C;  2Y0E A;  3L4F A;  4I2L C;  2WMM A;  3AE1 C;  1LTB C;  1VQ9 P;  1BCC G;  1L0L D;  2YXQ B;  2A06 D;  1KQF B;  2W6A A;  4U3F J;  1U7M A;  2A06 E;  4IOI H;  3Q5R A;  3PJS K;  4WWI A;  2KLV A;  1SQP D;  4BRY B;  2RN0 A;  1SQP E;  4RJT A;  1KB9 D;  3BAS A;  3EWK A;  5AVQ B;  2H7H A;  3HD7 B;  3VOP A;  3GHG A;  3V4W A;  1RF0 C;  2O3J A;  3L35 A;  2IBZ D;  3VN0 A;  1JMB A;  2IBZ E;  1PP9 G;  4DOJ A;  3PHL A;  3Q5S A;  3MUD C;  3TDK A;  2AXT E;  2KP8 A;  2ZXE B;  2B87 B;  1K04 A;  3RK3 E;  2E76 C;  1N73 A;  3HUS A;  4Y99 B;  2IZ0 A;  1SQP J;  1S72 P;  2ZVN B;  2V7Q H;  3KHU A;  2YXR B;  4MN4 C;  3H1I D;  1J2J B;  3B4S A;  4JYC A;  2ZYA A;  2WT7 A;  4IFM A;  2K9J A;  1XTC C;  1NAY A;  3WU2 H;  3P32 A;  1IFJ A;  3CX5 I;  1HBW A;  2ITA A;  2ZJS E;  4IFF A;  3AEF C;  3E1R A;  1WRG A;  3O6Q B;  2QEX P;  1L2P A;  3C1L A;  1SQV G;  1N73 C;  2WSF J;  3D6Y A;  3GG2 A;  1VDF A;  3ITK A;  1OVV A;  1JM0 A;  2D2C B;  4PD4 H;  1T8Z A;  1W2E A;  1DIP A;  4H0L D;  1Q86 Q;  1KTM A;  3JCU H;  4H44 C;  5AW2 B;  2ZFC A;  2QJY C;  3RL0 D;  2Z5I A;  3CX5 E;  2R5D A;  1FS0 E;  5KLV G;  1SQX G;  2GUV A;  4OGQ D;  3L72 G;  3TF5 A;  1IFD A;  1E79 H;  3KZI H;  3L75 G;  4HB1 A;  4TLF A;  1NOH A;  1JY3 P;  2QRX A;  1ZXG A;  4IL6 X;  5APY A;  4LLH A;  3QH9 A;  3H25 A;  2KZI A;  2YO2 A;  1HH0 A;  1ZP0 C;  2KLU A;  4Z1M H;  3L74 G;  1N7L A;  3AE7 C;  1VQL P;  3AE8 C;  1N7S B;  5H2F H;  2WWW A;  3CCQ P;  1M57 D;  1BE3 G;  1RQU A;  1HVV A;  2WZ7 A;  2C9L Y;  1SFC A;  3BRT B;  1GL2 D;  1HGZ A;  2PAJ A;  4PJ0 H;  3RK2 D;  4OVN F;  4ASV A;  2KYV A;  1LT9 C;  1URQ B;  2VRS A;  2FFD C;  1CI6 A;  4WB4 A;  3FXD A;  2IZ1 A;  4I6M C;  1SQQ D;  2CPS A;  2G3A A;  1SQQ E;  3PTZ A;  2Y9Y A;  1VQK P;  1VQM P;  2WVR A;  1QX8 A;  3CCV P;  2M5A B;  1K73 Q;  3R2P A;  1YHQ P;  1HTL C;  1DD4 A;  1SFC C;  1G2C A;  1LTJ B;  2QA4 P;  1P84 I;  3CXH H;  3KXD A;  2R5B A;  3RBZ A;  1Y8A A;  2WSC H;  3U1A A;  1USE A;  2H43 A;  1SQQ J;  1G1J A;  3MD0 A;  3M06 A;  2HPC B;  3ABV C;  1NJI Q;  4DCK A;  1VQ7 P;  3L70 E;  3M0A A;  1FJP A;  3A7O A;  1Z56 A;  2I8D A;  1MFZ A;  1GW3 A;  4XA4 A;  3WUU A;  4O9B A;  2XND H;  2J59 M;  1GTW A;  1SQB K;  1MKM A;  1AQT A;  5CBO A;  3L37 A;  1XTG B;  3BRV B;  3B5N D;  1YQ3 C;  1Y9B A;  4IL6 H;  1P84 D;  5M1B A;  4EOT A;  1P84 E;  3CPW O;  3CCE P;  2WIT A;  3L70 J;  4WVZ A;  3HD7 C;  2FYU D;  1NYH A;  2HG5 D;  2QIW A;  1JUN A;  1S2E A;  1JCC A;  2ZT9 D;  2GA1 A;  3TGU G;  3F5H A;  3GHG B;  2HOD A;  3O6Q A;  4UB8 E;  4WY4 A;  4ASW A;  3TNU B;  1KYO H;  4Y99 C;  4D6T E;  3H1K D;  3CLQ A;  5TIS E;  3Q3D A;  3H1K E;  2Q3I A;  1IK7 A;  4CPG A;  1FZC A;  1NVO A;  3AEE C;  4HJG H;  1BGY E;  4HYT B;  2E74 D;  3HUS B;  3H1H D;  1E5W A;  3H1H E;  3SFE C;  5B66 H;  3V2P A;  3VP9 A;  5APV A;  1GK4 A;  1YIT P;  3L73 D;  2E75 B;  1PL5 A;  2O01 H;  3L73 E;  4D6T J;  5E79 H;  2WT7 B;  1QL2 A;  2K9J B;  3H1K J;  3CC7 P;  1PGP A;  4H13 D;  3EQ2 A;  4KJM A;  4H44 B;  1BGY J;  4JF7 A;  3NXS A;  1VQ8 P;  2FKW B;  3H1H J;  1HUC A;  3W68 A;  1M1J A;  3AEB C;  5CCG C;  1AA0 A;  2D2C C;  1X9V A;  3L73 J;  3TSI A;  2Q5U A;  3VMX A;  2ZYG A;  1A02 J;  3HE4 A;  4GIF A;  5AW6 B;  1R5L A;  1BCC D;  2N9B A;  3G4S P;  5APS A;  3SWF A;  5AW4 B;  3U1C A;  3GF7 A;  1FE6 A;  1H88 A;  2NPS A;  3G71 P;  3GMA A;  5CMZ A;  1FAV A;  2E76 D;  3I56 P;  2I1K A;  1M1K Q;  1L4A A;  2A45 I;  2KIK A;  1QEX A;  3A0H E;  3CC4 P;  3H1J G;  2ZXX A;  3NTN A;  1NKZ B;  4RKU J;  1URQ A;  3L71 G;  1KOR A;  1N86 A;  3RK3 B;  1SQP K;  2WSS H;  3N7N A;  1KFN A;  2K1A A;  3FWL A;  1N7S C;  2QSI A;  2B88 A;  3VYI A;  2ZYD A;  1H89 A;  1J1E B;  1NTZ D;  2MKV A;  4I1L A;  1FZA A;  3CCR P;  1KC8 Q;  4GOD A;  2N1T D;  1ZV8 A;  4NPF X;  4PD4 D;  1UII A;  1VF5 B;  3BCC D;  1URQ C;  1ZLL A;  3BCC E;  3A3Y B;  3LIE A;  1KB9 I;  1NTK E;  4JPZ B;  4HH2 A;  1SQV D;  1FZG A;  1SQB G;  1RE3 A;  2IBZ I;  3BVH A;  1NTZ J;  1CI6 B;  3KYQ A;  3JC2 2;  4DJG A;  2AEM A;  5AVY B;  2QJK B;  1KD1 Q;  4BWN A;  2J5U A;  1KQS O;  2P1J A;  4PV1 B;  4YPC A;  4M3L A;  2XDJ A;  1LTJ C;  5AVT B;  1L0L E;  3FWN A;  3S1K A;  3BCC J;  3G9R A;  1GDT A;  1NTK J;  3B8E B;  3MGN A;  1EDL A;  4OWF A;  1G2C B;  3RL0 B;  4LC1 A;  5AVX B;  5KLI B;  2W90 A;  1JY3 N;  3CWB G;  3W67 A;  5KLV D;  1KB9 E;  3B71 A;  5AVS B;  3T97 A;  4OH8 B;  1ZN5 A;  3L72 D;  1JTH A;  3AE2 C;  3TNU A;  1VQ4 P;  1CZQ A;  1YQ4 C;  1L0L J;  3A0B E;  1PGO A;  1LT1 A;  3E1I A;  4Y28 J;  3M9H A;  1DH3 A;  1N2D C;  2W83 C;  5CCH A;  1NAF A;  1S5L E;  4HKZ H;  2BAS A;  1OW6 A;  2B9B A;  1Q82 Q;  3V4Q A;  2SPZ A;  2QJP B;  2JDI H;  1EXJ A;  2YMK A;  1JCD A;  1PIX A;  5AVV B;  3S4R A;  4UB6 E;  1FDM A;  2GM4 A;  3H1I E;  1IC2 A;  3L74 D;  2OTK E;  1X0T A;  3SSU A;  4C7R A;  3GHG C;  5L8R J;  4YXD C;  2M3E A;  5AW7 B;  1S5L X;  1RHZ B;  1H8A A;  2YMY A;  2J58 A;  2HOD B;  3H6P A;  2MJZ A;  2WPQ A;  4WY4 B;  3NFQ A;  3AE9 C;  4DZO A;  5KJ7 A;  1GL2 B;  3HUS C;  4I7Z B;  4U3F G;  1X79 B;  1PPJ G;  1OMI A;  1RY3 A;  3H1I J;  2IDB A;  5DJT B;  1FZB A;  1FZC B;  3EFG A;  1IO4 A;  2Z5H A;  3LID A;  1KIL D;  3S9O A;  4ZNC A;  1KIL E;  2E75 C;  2BCC D;  3VMA A;  2P2U A;  2BCC E;  1T2K C;  2JO1 A;  2FYZ A;  3NMD A;  1QL1 A;  4R4M A;  1NU1 D;  4L74 A;  5C39 A;  1NU1 E;  1AVO A;  1G1I A;  1VQO P;  3AEG C;  4EYY Q;  2A06 G;  4EI2 A;  1SQQ K;  1MZ9 A;  1SLQ A;  3P8M C;  2Q1K A;  3VTP C;  2BCC J;  1LTS C;  1SQP G;  2O1K A;  1M1J B;  1NU1 J;  1KN7 A;  2H88 C;  3WUT A;  3OJA B;  1T3U A;  3HD7 D;  2IBZ G;  1EZV I;  2Z4E A;  5GTH E;  2FXO A;  3HE4 B;  1JY2 O;  1DD3 A;  4L75 A;  3F89 A;  1EDJ A;  2W8Z A;  3B5N B;  1JNM A;  1U7J A;  3SWK A;  5GTI E;  1RQV A;  2OGU A;  3D70 A;  1VQ5 P;  1W2B O;  1S4X A;  1X22 A;  1KV4 A;  3GLM A;  1L0N D;  2NPS B;  1L0N E;  2R44 A;  5AVZ B;  1YTZ T;  1GU5 A;  3CMA P;  1VQP P;  2WSE H;  1BSN A;  2XNX A;  5CJ4 A;  2AEJ A;  1L4A B;  3RK3 C;  1FOS F;  2HLO A;  1GW4 A;  2E5T A;  2AXT H;  3LW5 J;  2P10 A;  3V6I A;  1LNQ A;  1EZV D;  1Q90 D;  3PH0 A;  1EZV E;  5E79 E;  3MHV A;  2L91 A;  1YBK A;  3AEA C;  4XFJ A;  3V2N A;  2KXP B;  1J1E C;  1L0N J;  3HTK A;  1KIL A;  1RH5 B;  3VP8 A;  3A2A A;  2WSF H;  1GK6 A;  3MZW B;  1EDI A;  1HGV A;  1OW8 A;  2NRG A;  2ZAE B;  1VF5 C;  4W7Z A;  1PZQ A;  1EC5 A;  5CCG D;  2D2C D;  2CK3 H;  1VQN P;  4ZKP A;  2QE7 H;  1KQL A;  3N4X A;  5AW5 B;  2QJK C;  2XZR A;  1IFM A;  3KPE A;  4PV1 C;  5B5E E;  1K8A Q;  1IFP A;  1FU1 A;  1MUU A;  2KSE A;  5KAI E;  2YNY A;  3H1L D;  1FC2 C;  1IK9 A;  3H1L E;  2FY8 A;  1NTM D;  2OQQ A;  3AE6 C;  1WMK A;  1NTM E;  3VMY A;  3C8V A;  2JJL A;  3RL0 C;  1KMI Z;  5KLI C;  3P8C D;  3CCM P;  2L5G B;  3P8C E;  2RKL A;  3CX5 H;  3SWY A;  1OVU A;  1GZL A;  1JY2 N;  2C0X A;  1J1D B;  1JOC A;  2FYU E;  3TK1 A;  1K9M Q;  3H1L J;  3T97 B;  4R4L A;  1JTH B;  1N7S D;  1NTM J;  4KT0 J;  4NPE A;  3MP7 B;  1YTZ I;  1GL2 A;  2N9Y B;  1X8Y A;  2QJP C;  1DX7 A;  3V5B A;  4RES B;  1HF9 A;  1LWU A;  2POH A;  2FYN B;  5DJU B;  4BXL A;  2E5Y A;  3FX0 A;  3L71 D;  5KAF E;  1MFT A;  3CME P;  2FYU J;  3Q2Y A;  2PRR A;  2R3S A;  3SFD C;  4AUW A;  3CCU P;  2FXP A;  3G3Z A;  1SQQ G;  4GOE A;  2Y0D A;  1GD2 E;  1BDD A;  2Y0C A;  1Q81 Q;  4WY4 C;  2Q6Q A;  3WUV A;  2N1T B;  4U7J A;  1GL2 C;  4I7Z C;  2KB7 P;  2I1J A;  1FZC C;  3H32 A;  2E43 A;  2KNC B;  1HJB A;  1SQB D;  2RH0 A;  2Q9I A;  3L70 G;  4RO0 A;  1H0T A;  2KK7 A;  3GW6 A;  3B5N A;  1NTK K;  1BCC E;  3HE5 A;  3P7K A;  3PP5 A;  2R32 A;  2H8P D;  1AJY A;  3CL3 D;  1SS1 A;  3U59 A;  1RE4 A;  2KUB A;  1NHL A;  1M1J C;  2XKM A;  1KQG B;  1N8R Q;  1L0L K;  3M0D A;  1KZU B;  4PD4 I;  1JY2 P;  3IFM A;  4C46 A;  1BCC J;  1YYC A;  4KHX A;  1PP9 D;  3AE3 C;  3CI9 A;  1GU4 A;  1PP9 E;  3B5N C;  1NH4 A;  2E42 A;  3WU2 E;  1CW5 A;  4D6T G;  2JR8 A;  3H1K G;  5APW A;  1DEB A;  2NPS C;  2JP3 A;  1P84 H;  2V7Q J;  1BGY G;  2FXM A;  3OW2 O;  3H1H G;  1NTZ E;  2OYI A;  1W5C E;  1L4A C;  1PP9 J;  1Y47 A;  2QM8 A;  4WBA A;  2WPR A;  4UB8 H;  3L73 G;  4PD4 E;  3MIW A;  3RBX A;  4B86 A;  2E75 D;  3V2Q A;  2PFX A;  1T2K D;  5TIS H;  3JCU E;  5KKZ B;  1AVY A;  1S1C X;  1ZR4 A;  3CCL P;  4JBZ A;  1SQV E;  4H44 D;  3KDP B;  3AED C;  1LJ2 A;  2Q3E A;  3ZDM A;  4C7N A;  5CJ0 A;  2K88 A;  3HTK B;  1KIL B;  2OYH B;  2QVA A;  2LKM A;  1VL2 A;  1VQ6 P;  3KZI E;  4H0L B;  4LGD E;  1SP4 A;  1IFN A;  5BVZ A;  1RF0 A;  3AE4 C;  3AE5 C;  1SQV J;  3WMM 0;  3MUD A;  5APQ A;  2YIU B;  1HWT C;  2FBW C;  5AVU B;  3K5B A;  5CBN A;  1IZN B;  3FGA D;  4OGQ B;  1RE3 C;  1SQX D;  5KLV E;  1SQX E;  3BAT A;  4GT1 A;  3O8Z A;  1NU1 K;  3L72 E;  1SVF A;  1S3J A;  3L75 D;  1LTA C;  3L75 E;  2P7J A;  1OVR A;  5H2F E;  3GF3 A;  1FZF A;  1NKN A;  2K37 A;  4DT0 A;  5AVW B;  1EDK A;  1ZW0 A;  3CXH I;  4L76 A;  1J1D C;  1M7L A;  3M91 A;  5KLV J;  1SQX J;  1VPC A;  4PJ0 E;  3RK3 D;  3L72 J;  4K3A A;  5AW3 B;  1ZME C;  1OXZ A;  3L74 E;  3L75 J;  4JYB A;  2N1T A;  3D71 A;  1NTZ G;  2XU6 A;  4GOF A;  2FYN C;  5CCH C;  1BE3 D;  2WSE J;  3A0H H;  3D6Z A;  1BE3 E;  2RMZ A;  2HR3 A;  3KQG A;  3RK2 B;  2A45 G;  1JO5 A;  2KNC A;  1LWU B;  3BCC G;  2M0B A;  1L0N K;  1VF5 D;  3L74 J;  3CXH D;  4AYC A;  1NTK G;  1SFC D;  3CXH E;  1LP1 A;  2IX7 C;  1QLE D;  1RF1 B;  2LXC B;  1Q2N A;  1QGK B;  2UWJ E;  1USD A;  1YJN P;  2N1T C;  1PGQ A;  2W27 A;  1BE3 J;  1OW7 A;  2P58 A;  1IJD B;  3PRJ A;  1KYO I;  1ZR2 A;  1L0L G;  1OFC X;  4PV1 D;  5KJ7 C;  2A45 H;  2H89 C;  2KSJ A;  2PGD A;  4GDO A;  2WSC J;  4AQR D;  3H32 B;  2V4H A;  2DW3 A;  2BEQ D;  2IPP A;  3CX5 D;  1JMM A;  4IL6 E;  4GKG A;  2M3B A;  1MV8 A;  3PLN A;  2OYO A;  1NGM B;  5BU5 A;  1PV3 A;  3IF4 A;  1R8E A;  1BSH A;  1NO4 A;  1H0T B;  4YXW H;  5APU A;  2KS1 A;  1M90 Q;  2AEF A;  3Q1M A;  1KYO D;  3HE5 B;  1KYO E;  2WPV B;  5EFW B;  2JKV A;  2KZJ A;  1LT9 A;  1KB9 H;  5AW1 B;  2FFD A;  3H1I G;  1NTM K;  2ZT9 B;  5B66 E;  4A7P A;  3A0B H;  2YKO A;  3TGU D;  2BEZ F;  3TGU E;  3C9I A;  2LR2 A;  1S5L H;  2W6J H;  2FYU K;  2PP6 A;  1R5S A;  1EQ7 A;  3VMZ A;  5AVR B;  4WY4 D;  2E74 B;  2OTL P;  2OYH A;  3OA7 A;  4UB6 H;  1FOS E;  3A5T A;  1LTI C;  5CHX A;  3TGU J;  2OYI B;  2BCC G;  3CCJ P;  2O01 J;  3FXE A;  2Q7C A;  3HRN A;  1NU1 G;  1YJW P;  2AXC A;  5KKZ C;  2IYO A;  4H13 B;  4IFD K;  3CCS P;  2K3R A;  1KIL C;  2OYH C;  2IYP A;  2K9Y A;  1K05 A;  4BRY A;  2YKQ A;  1KFM A;  2G8Y A;  4H0L C;  4C7N B;  3HD7 A;  2CPB A;  5KTB A;  1T6A A;  3M9B A;  4YTP C;  1CSB A;  5AW0 B;  3L70 D;  1DEE G;  2ZVO B;  1IFI A;  1BDC A;  5APT A;  2YIU C;  2B87 A;  1ZOY C;  1Q7Y Q;  4OGQ C;  4K35 A;  1JB0 J;  1YI2 P;  4EDF A;  2WPS A;  2KOG A;  1PGJ A;  2E76 B;  3JSV C;  2M8R A;  2B89 A;  3CC2 P;  1L0N G;  2JWA A;  3EFF K;  2NPS D;  3CD6 P;  3UIA A;  2O01 N;  1T3J A;  1EXI A;  3AEC C;  2IFM A;  3H1J D;  5APX A;  5GTH H;  3H1J E;  1LTG C;  2LXB A;  4XE5 B;  3L71 E;  1L4A D;  4N3Y B;  3R4Y A;  3LW5 H;  2YKP A;  1EZV G;  4D6T D;  1FBM A;  5GTI H;  1OZH A;  2W6B A;  1RF1 A;  1AV1 A;  3IN6 A;  1URQ D;  1PFI A;  5AW9 B;  1A02 F;  1BGY D;  2OTJ P;  3E7K A;  1GMJ A;  1N73 B;  5CCG A;  3IR9 A;  2NZ2 A;  4TT3 H;  3Q5P A;  2C0W A;  2JEE A;  3H1J J;  1YJ9 P;  5TJH A;  3I55 P;  3RK2 C;  1QVF O;  3L71 J;  1LWU C;  3RL0 g;  4JQ0 D;  1AQ5 A;  1UIX A;  3USS A;  1YIJ P;  1NTZ K;  2HFE D;  2QM7 A;  1RF1 C;  1SQB E;  2QJY B;  2OAR A;  1LP1 B;  4L73 A;  1NWQ A;  3TYY A;  4ZKU A;  3RGU A;  2KI7 B;  1FZE A;  3H1L G;  1SQV K;  1NTM G;  4W80 A;  1OIP A;  2XV5 A;  3MTU E;  2WTY A;  1WT6 A;  1SQB J;  1JY3 O;  3CWB D;  2IFN A;  2FYU G;  3CWB E;  1QVG O;  5B5E H;  1N7S A;  1FJK A;  4ZMD A;  5KAI H;  1U57 A;  1HJ0 A;  2GUS A;  1FDO A;  2C9N Y;  1M8O B;  4N78 D;  2O1J A;  1M56 D;  5KLV K; 
#chains in the Genus database with same CATH homology
 3WUU A;  3WUT A;  2WVR A;  4BRY A;  1UII A;  2ZXX A;  3E1R A;  2Q6Q A;  3F5H A;  3WUV A;  4BRY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...