2NPSB

Crystal structure of the early endosomal snare complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
68
structure length
68
Chain Sequence
GSMRETAIQQLEADILDVNQIFKDLAMMIHDQGDLIDSIEANVESSEVHVERASDQLQRAAYYQKKSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 4
publication title Early endosomal SNAREs form a structurally conserved SNARE complex and fuse liposomes with multiple topologies
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 29
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2006-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2npsB00
2M8RA 2N1TD 1SFCC 2H8PD 1HVVA 4WY4A 5CCHD 2HFED 1T3JA 1KILC 1XTGB 1JTHA 3RK2D 2NPSB 2XDJA 1GL2B 3TSIA 4W7YA 2YMYA 3M0DC 5CCHA 1JTHB 1N7SD 3RL0C 4OH8B 1URQA 2NPSD 3PP5A 4LGDE 3P8CE 1GL2D 4WY4C 3HD7A 1URQB 3VOPA 3RK2B 1N7SA 3HD7B 2N1TC 2NPSA 1N7SB 1URQD 1GL2A 3HD7D 3KYQA 5CCGA 5KJ7A 1KILD 1L4AA 3RK3B 1L4AB 1GL2C 3B5NB 5CCGD 3RK3D 1SFCB 5KJ7D 1KILA 2PP6A 5CCHC 1L4AD 2WZ7A 4W7ZA 3B5ND 1KILB 1URQC 4JF7A 1SFCD 3HTKB 3RK2C 3HD7C 1N7SC 3RL0B 3B5NA 2HG5D 2NPSC 1SFCA 1NHLA 4WY4B 3RL0D 2KOGA 2N1TA 4N78E 5CCGC 3RK3C 4WY4D 2N1TB 5KJ7C 4W80A 1L4AC 3B5NC
chains in the Genus database with same CATH superfamily
5L8RJ 3HRNA 4UB8H 5B5EE 2JJLA 3TF5A 3SWKA 5KLVG 1XTGB 2W6AA 4D6TJ 1NU1J 3SWFA 1NYHA 2M5AB 2NPSD 4OVNF 1N73C 2B87B 2NZ2A 3LIDA 4I7ZC 3H1ID 2CPBA 3AE9C 2HPCA 2IYPA 2AEFA 3CXHD 1S9KE 5KKZB 4WBAA 3MP7B 1VQ5P 1VQNP 2KIKA 1KQSO 3PTZA 5CCGA 4EI2A 2JWDA 1PP9J 2WSCJ 4UB8E 1GL2C 4H13D 1SQBG 5CCGD 1DD4A 2WTYA 1SQVJ 2Q3EA 1RF1A 2KLVA 1GZLA 5AVZB 4WWIA 5AVRB 2XNDH 3CC2P 3RL0g 3Q1MA 5BVZA 4L76A 1LTTC 1S9KD 3L72E 1N2DC 3OA7A 3D70A 2Q5UA 2C9NY 3B5NC 1JUNA 3KZIE 3F5HA 2J5UA 1KB9E 2XDJA 1JY2N 3M0DC 3L70J 1JTHB 2OGUA 1NU1K 2ZT9B 1JNMA 3WU2H 2OYHB 3VP8A 2D2CB 3H1JJ 3L72D 3CWBJ 5AW2B 1GL2A 3G6EP 2E43A 1EQ7A 3B4SA 1GDTA 3CMEP 1NTZD 4IFDK 1T3UA 2FYNB 2JO1A 5H2FH 3ZDMA 3U1CA 1KB9D 2YMKA 2H89C 3PH0A 1LT9C 4U3FG 1SQVK 1SS1A 2FYUJ 5GTHH 5KAIH 1TU3F 3NTNA 1SQQK 1L0NG 3C8VA 3RL0B 3B5NA 4DJGA 3PHLA 1M1JA 1Y8AA 2LR2A 2GUSA 1S5LX 3PRJA 3WU2E 3CC7P 2E75C 3AE2C 1NKZB 1X8YA 2KSJA 3RK3C 2N1TB 2J58A 1L0LE 3IFMA 5TISH 3AEFC 2KSEA 3H1LJ 1KILE 3L72G 1VF5C 3LW5H 1FZCA 1EC5A 3N4XA 5H2FE 1WMKA 3AE4C 2WPSA 3RK2D 2OYIA 3L73E 1LTJB 4Y28J 2W8ZA 3EFGA 4GOFA 3FGAD 1DH3A 1S5LH 4LGDE 1CSBA 5GTHE 4C46A 3HD7A 5KAIE 3RK2B 1EDJA 4H44C 5C39A 2A45H 1LTIC 1U57A 3HD7D 1R5SA 1L0LD 1IFJA 3KYQA 3TNUB 1YTZT 1M7LA 3CCQP 5TISE 3USSA 1KILD 1FDOA 5GTIH 1RQUA 3L73D 2XV5A 4HH2A 3MIWA 2XZRA 1KILB 3V2PA 2E74C 3VMAA 1FZEA 2QIWA 3CX5H 1NOHA 1AJYA 1EDIA 2KXPB 4EDFA 1NHLA 3H1KG 2KOGA 1KV4A 2ZXEB 3A0BH 1FOSE 1D7MA 1UIIA 1BGYE 2Y0EA 5CCHD 1ZR2A 5BU5A 4I1LA 1L0LG 5APTA 5AW4B 2LXBA 2IBZG 2YMYA 2HODB 4BRYA 2K9YA 1HJBA 2H88C 1W2BO 1LWUB 2OYOA 1X0TA 3GMAA 2XKMA 3CX5E 3Q5PA 1NAFA 3GLMA 2K9JA 3CLQA 3L73G 4K3AA 1VL2A 1VF5B 1HWTC 2YXQB 1IFDA 2GA1A 1Q86Q 3KXDA 3M06A 1K8AQ 3A0BE 1FU1A 4PJ0H 4JBZA 1MFTA 3T97A 3L71J 4C7RA 1NTZJ 1JEKA 4YXWH 2NRGA 4W7ZA 1ZOYC 3GF3A 3L4FA 3C9IA 3HTKB 3IR9A 4DT0A 2QJYB 3CX5D 2O1KA 1CI6B 1GK4A 3SFEC 1KZUB 1LNQA 3H1HJ 5APYA 2V7QJ 1USDA 2P67A 4C7NA 2GUVA 2E76C 3AEBC 2QRXA 2G3AA 1KD1Q 1W5CE 4LC1A 4AQRD 1H8AA 4Z1MH 1K05A 2L5GB 1XTCC 3AE5C 3EWKA 2WITA 5AW0B 4PJ0E 1T3JA 1SQXJ 2QM8A 2A45G 1G2CB 2SPZA 4IL6X 1PGJA 4PV1C 1JMMA 5APWA 1BGYG 1URQA 4L75A 4PD4I 1K73Q 3VYIA 3CXHI 2A06E 3BCCG 2Q6QA 1URQD 3V2NA 5AVSB 4OWFA 1HUCA 2W6JH 1KN7A 1CW5A 1L4AA 3CMAP 4IL6H 5CBNA 1NO4A 2WWWA 2QJKB 1SFCB 1IFMA 1HTLC 3KPEA 3M9HA 4K35A 2P1JA 1NTZK 1L4AD 2WZ7A 3AEDC 5KLVD 1IZNB 2ZVOB 4H0LC 5AW9B 1KYOI 2P2UA 2R32A 2A06D 2BEZF 1QL2A 1EDLA 2HG5D 1FOSF 1SQPG 1HGVA 4WY4B 2BCCE 2B89A 3CCMP 1T2KD 2KZIA 4H13C 3H32B 1GW3A 1NGMB 5CCGC 2FFDB 2WSEH 1GU5A 1FJPA 2IZ1A 1H89A 3L74J 1QVGO 1VQKP 1OVUA 1PGOA 3AE8C 1MZ9A 3N7NA 2HFED 4IL6E 1M57D 2YKQA 2QJPB 3S4RA 1SQXK 3K5BA 1HJ0A 1SQBD 3B8EB 1E79H 1RF1C 3TYYA 3SSUA 2YIUB 1X9VA 2B87A 3CCEP 2YO3A 1AFOA 2VRSA 3MHVA 2BCCD 5AW6B 3R4YA 2I1KA 2NPSA 4ZKUA 3MGNA 3CWBG 1HGZA 3VMXA 3BRTB 3OJAB 1H0TA 2FXPA 2A06G 3KHUA 1PV3A 2V4HA 1NTKE 4PD4D 2KS1B 1KB9I 3CCJP 1M56D 1QX8A 1DD3A 1L0LK 4L74A 1KYOE 1RH5B 2HR3A 1UIXA 1NTMG 4MN4C 1KQGB 3HUSB 3GW6A 2K88A 3S9OA 3L36A 3VN0A 2FYUG 4U3FE 3V4WA 1J1DB 1R5LA 1L0NE 1BDCA 1FZBA 1GTWA 1PIXA 4O9BA 1A02J 2C0XA 3VP9A 4CPGA 2C0WA 1VQOP 5TJHA 4BWNA 1SQQJ 1BCCE 2WPVB 3W68A 1SVFA 2W90A 1KORA 1NTKD 2BCCG 4HYTB 4H0LB 5AVTB 1Z56A 1KYOD 2N9BA 1ZR4A 1GMJA 1J1EC 2KLUA 1JTHA 1BE3E 1N7SD 2ZJSE 2QSIA 4U3FD 3A0HH 2OYHA 1M1JC 2QM7A 3HE5A 1L0ND 3CCLP 2WSFJ 2ZT9D 1NAYA 1YBKA 1N7SB 2HYNA 2IBZI 1VQ8P 2D2CD 1BCCD 3JC22 2B88A 1S72P 4HJGH 1FZCC 1PZQA 1YYCA 2ZYGA 3M0AA 2OYIC 2P10A 1U7JA 1FZAA 1KFNA 1DIPA 3V4QA 5B66H 1OWAA 3FWNA 5KAFH 1NTKG 4RKUJ 1JCCA 3HD7C 4RESB 3Q2YA 3A0HE 5KLVJ 3L75J 4YTPC 1KC8Q 2OTJP 1N73B 3L35A 1VDFA 3RL0D 2AEMA 2N1TA 2Y9ZA 4I7ZB 1LP1A 5KLIC 5AVXB 2FBWC 3H1KE 2Q1KA 2KZJA 2N1TD 4EYYQ 1T6AA 2H8PD 1YITP 2Q9IA 3AEGC 1LTJA 1FBMA 1YQ3C 2C9LY 1BCCG 1GL2B 4OH8B 3VTPC 1MV8A 5B66E 2W27A 3V2QA 2W83C 2FY8A 5KAFE 2IBZE 1PGPA 1SQBJ 3Q5SA 5CJ4A 1BE3G 2A45I 1QEXA 2MKVA 1GD2E 2I8DA 1JCDA 1JY3O 3TNUA 3H1KD 3RGUA 1R8EA 4IFMA 3C1LA 5AW5B 1DEEG 3A3YB 4XE5B 4XA4A 3B5NB 3G9RA 2QE7H 1QLED 1KILA 3L71G 2PP6A 1YI2P 2Y0DA 1ZMEC 3G71P 1RE4A 2IBZD 3CX5I 3TK1A 4JQ0D 3H1IJ 1RE3A 1PGQA 3V2RA 5AVUB 5KLVK 3GHGC 3SFDC 2FXMA 1KMIZ 1IO4A 3HE4A 3E1IA 1S5LE 3I55P 3KQGA 2WPRA 2IPPA 1S1CX 1YQ4C 2RKLA 3NXSA 2WSCH 1DX7A 2YKPA 5CCHA 1LWUA 2Z5HA 3F89A 3FWLA 1LT9B 4D6TE 2WMMA 1NU1E 1SQBK 5GTIE 1SP4A 2XU6A 2ZVNB 1FJKA 2O01J 4U7JA 1X79B 4OGQC 3V5BA 1YJ9P 4L73A 3BCCE 2WQYC 1RF0A 1VF5D 2WT7A 3TGUG 2E75B 2OQQA 3RK3B 3AEEC 4IFFA 2IZ0A 3V6IA 1ZV8A 3GHGA 3AEAC 2IYOA 1Q90D 1S2EA 2ZAEB 3HTKA 1PP9E 2ITAA 1URQC 1Q81Q 3OAKA 1U7MA 3L72J 1CI6A 4D6TD 1BGYD 1SQVE 3QWOC 5AVQB 3D6YA 4KT0J 2KNCB 5APSA 1FAVA 1LTBC 3BCCD 5AVYB 1SQPE 1X22A 4N78E 4H44B 2WPQA 1IFIA 1VQMP 4Y99C 1L4AC 4RJTA 4BRYB 1FS0E 2JKVA 2O01N 3PLNA 1S3JA 2K9JB 1GU4A 3JSVC 2KK7A 2KUBA 1PP9D 3TSIA 4RO0A 2AXTH 2Y0CA 3MUDA 1BDDA 1T2KC 2E5YA 5EFWB 1SQVD 5CHXA 2K3RA 2PAJA 3P7KA 2E74B 2Z4EA 3L70E 1HF9A 1FE6A 2LKMA 3T97B 3BASA 1SQPD 2W6BA 1G1JA 1W2EA 2QG4A 1PPJE 1MFZA 1VQPP 2DW3A 4D6TG 1NU1G 3H1JE 2I1JA 4LLHA 3CWBE 1L0NK 4I2LC 2H43A 5AVWB 1VQ7P 3CI9A 4JYBA 3AE7C 1LTGC 3H1KJ 4DOJA 1H88A 4GOEA 1N7LA 2QA4P 3EFFK 4UB6H 1SFCD 4C7NB 4OGQB 1NTME 2RMZA 1BSNA 5KKZC 1L0LJ 2NPSC 1N86A 1NWQA 1RQVA 2FYUE 3H32A 1PP9G 3IF4A 2R3SA 2GM4A 1K9MQ 4WY4D 3E1RA 3H1JD 1SQVG 1AQ5A 3CWBD 1M8OB 3W67A 5APQA 3L73J 1OZHA 1JB0J 2AXCA 3O6QB 1P84H 1VQLP 2OTKE 3S1KA 1QGKB 3H1LE 1OXZA 1NTMD 3CD6P 3UIAA 4UB6E 3PP5A 2JP3A 5DJUB 5CJ0A 3GF7A 3CCRP 2FYUD 5CMZA 3P8MC 1KTMA 2M5AA 3D6ZA 1YTZI 3LW5J 5KJ7A 1JY3P 2KS1A 3L70G 5APUA 2E76B 1OW6A 2ZFCA 4PV1D 1EZVE 1P84E 1PPJG 1E5WA 5KJ7D 2BASA 3H1JG 3HUSA 2M3EA 3MD0A 5M1BA 2OYHC 4PV1B 2QEXP 1Q7YQ 2D2CC 3BRVB 2P58A 2J59M 4TLFA 3L75G 3AE1C 3M9QA 2B9BA 3FX0A 1HBWA 1BGYJ 2ZYAA 2RN0A 3P32A 2FYNC 1KQFB 1EXIA 1JM0A 1WRGA 3BCCJ 3WUVA 1EZVD 3WUTA 1P84D 2BEQD 1USEA 4B86A 3U1AA 2NPSB 4H0LD 2H7HA 3O8ZA 3RL0C 3CCSP 3L37A 4ASVA 3KZIH 4HKZH 1H0TB 1AA0A 4BXLA 1N7SA 1KB9H 3H1LG 2N1TC 3LIEA 3VMYA 1OVRA 3OW2O 2HPCB 1J2JB 2K1AA 4H13B 1SQPJ 1Q2NA 2V7QH 1OIPA 1RHZB 1LTJC 1JOCA 2O1JA 1AQTA 1PFIA 1ZLLA 5AW1B 3I56P 4JF7A 2KB7P 2FYZA 3RK2C 1OFCX 3L71E 3NMDA 1EZVG 1NTZE 1RF1B 3H1IG 1N73A 2G8YA 2OARA 2ZYDA 1EXJA 2IFMA 2K37A 3AE6C 3VMZA 1OVVA 1BE3D 3Q3DA 4R4LA 1PL5A 1NVOA 4JPZB 4YPCA 3RBZA 1M90Q 3CPWO 3H1HE 3HE5B 1KILC 3NFQA 1OW7A 4AYCA 1RE4C 3E7KA 3L71D 4XFJA 1SQXE 4NPFX 1RE3C 1GL2D 1JO5A 3G3ZA 1SLQA 3CCUP 1NTMJ 1NH4A 4A7PA 3R2PA 3ITKA 3M91A 2R3CA 1AVYA 3JCUH 3MTUE 3U59A 3H1HD 4WVZA 4EIJA 2JWAA 3PJSK 1SQPK 3A5TA 3MZWB 3TGUE 1MKMA 1M1KQ 1IJDB 3H25A 5CCHC 2L91A 3B5ND 1LWUC 1SQXD 1LP1B 1JY2P 1J1EB 2BCCJ 3B71A 3M0DA 2R5BA 1IK7A 2YNYA 2LXCB 1IK9A 1T8ZA 1M1JB 2M0BA 1NTZG 4KHXA 1RF0C 1LJ2A 3CL3D 3JCUE 3A7OA 1IFPA 4M3LA 4HB1A 3TGUD 3AECC 4I6MC 3SWYA 2QVAA 1S4XA 1FZCB 2KP8A 3RK3E 3L74E 2QJYC 4N3YB 2OYIB 3H1HG 1QVFO 1LT9A 2R44A 1ZW0A 2HLOA 1YJNP 1FDMA 3P8CE 2YXRB 3EQ2A 2MJZA 3VOPA 5CBOA 3HD7B 1N8RQ 3IN6A 2WSEJ 4NPEA 1CZQA 5AW3B 2WSSH 4DZOA 1NTMK 2ZXXA 2HODA 1SQXG 2POHA 1NTKJ 2JEEA 3FXDA 2JR8A 1HH0A 2FYUK 5KLIB 3GG2A 1G1IA 2XNXA 3A2AA 4KJMA 2E75D 1OX3A 3RK3D 3L74D 4U3FJ 2Y9YA 3MUDC 1JMBA 4N6JA 4GODA 1L0NJ 2IDBA 1AVOA 3P8CD 1Y47A 4NPDA 2KNCA 3HE4B 1K04A 3WMM0 3ABVC 3M9BA 5APXA 1BCCJ 2E5TA 3I5CA 2CK3H 2UWJE 4EOTA 2WSFH 2P7JA 1FZGA 1KFMA 4GKGA 1BSHA 1BE3J 2M8RA 1VPCA 4H44D 2QJKC 1NU1D 1SFCC 5AW7B 3CC4P 3II6A 1SQQE 1MUUA 1Y9BA 4W7YA 1LTSC 1VQ4P 2WVRA 2PFXA 4WY4C 2WT7B 2IX7C 2M3BA 1EDKA 1YJWP 4TT3H 2FFDC 1G2CA 3L74G 2Q7CA 3TDKA 2E74D 1NJIQ 5KTBA 2O3JA 2YKOA 4AUWA 4YXDC 3GHGB 2OTLP 1QL1A 1NTKK 1FC2C 1FDIA 2QJPC 4GIFA 3WUUA 1DEBA 1Q82Q 2YO2A 2RH0A 1SQQD 2JDIH 2E42A 1LT1A 2YIUC 4N78D 1ZXGA 3D71A 2KI7B 2Z5IA 4ZMDA 2R5DA 2FKWB 5APVA 4OGQD 4ZNCA 4DCKA 1SFCA 5AVVB 1JY2O 5BU8B 3AE3C 5KLVE 3L75E 5KJ7C 1JY3N 2KYVA 2PRRA 1YIJP 2AXTE 1EZVI 3O6QA 1P84I 5K5GB 4ZKPA 3IAOA 1HVVA 4WY4A 3L70D 5DJTB 2FFDA 3HUSC 1PPJD 1YHQP 3QH9A 3TGUJ 4QMAA 2Q3IA 1KQLA 1IC2A 1J1DC 3KDPB 1RY3A 3Q5RA 4PD4H 1SQQG 1URQB 5E79H 5AW8B 4GDOA 3CXHH 4R4MA 3CCVP 3L75D 1SQBE 4ASWA 1ZP0C 1L2PA 4GT1A 1ZRTE 1ZN5A 4IOIH 1VQ9P 1OMIA 5B5EH 3G4SP 2AEJA 1IFNA 3BVHA 2PGDA 1WT6A 4Y99B 1L4AB 2E76D 1LGHB 2CPSA 1AV1A 2FXOA 2N9YB 3RBXA 1LTAC 1OW8A 4WB4A 1N7SC 2IFNA 3BATA 1GW4A 4PD4E 1KYOH 1GK6A 3FXEA 5E79E 3H1IE 4JYCA 1A02F 3H1LD 3CXHE 3H6PA 2ZT9C 1NKNA 1ZRTD 1VQ6P 2O01H 4W80A 1FZFA
chains in the Genus database with same CATH topology
3E1IA 2L5GB 3HRNA 1XTCC 2JJLA 3KQGA 2WITA 2WPRA 5AW0B 2IPPA 1T3JA 2QM8A 3HE5B 2A45G 1KILC 1XTGB 3NFQA 2W6AA 1G2CB 3NXSA 4AYCA 2WSCH 1DX7A 1JMMA 3SWFA 1RE4C 2YKPA 5CCHA 5APWA 1LWUA 2Z5HA 1RE3C 1URQA 2NPSD 1GL2D 1LT9B 1N73C 3G3ZA 1JO5A 3VYIA 1SLQA 3LIDA 1SQBK 1SP4A 1NH4A 2CPBA 2HPCA 2XU6A 1FJKA 3R2PA 1URQD 3V2NA 1X79B 3M91A 1S9KE 2R3CA 4WBAA 3V5BA 5AVSB 5CCGA 3MTUE 3U59A 1RF0A 2WT7A 1HUCA 1CW5A 1L4AA 3RK3B 4EIJA 4IFFA 1SQPK 3A5TA 1GL2C 5CCGD 1NO4A 2WWWA 2WTYA 1SFCB 1IFMA 1ZV8A 1HTLC 3GHGA 1IJDB 3KPEA 3M9HA 5CCHC 2P1JA 1NTZK 1L4AD 2WZ7A 3HTKA 3B5ND 1LWUC 1URQC 1JY2P 3OAKA 1J1EB 1RF1A 3M0DA 2KLVA 1CI6A 5AW9B 2R5BA 1GZLA 2P2UA 5AVZB 5AVRB 2R32A 5AVQB 2YNYA 1QL2A 2HG5D 1FOSF 5BVZA 1HGVA 1IK9A 1T8ZA 4WY4B 5APSA 1LTTC 1S9KD 1M1JB 1FAVA 1T2KD 1LTBC 1N2DC 3OA7A 5AVYB 3H32B 1GW3A 4N78E 5CCGC 2FFDB 4KHXA 1RF0C 2WPQA 1IFIA 2WSEH 3CL3D 4Y99C 1L4AC 2Q5UA 3A7OA 2C9NY 3B5NC 1GU5A 1FJPA 1JUNA 4M3LA 1H89A 1MZ9A 3N7NA 2HFED 4I6MC 3SWYA 2YKQA 1GU4A 1FZCB 1SQXK 2KP8A 2XDJA 3TSIA 1JY2N 4N3YB 3B8EB 1RF1C 3M0DC 3TYYA 1JTHB 3MUDA 2OYIB 1T2KC 1NU1K 1LT9A 2HLOA 1X9VA 1FDMA 3P8CE 5CHXA 2YO3A 3EQ2A 2MJZA 1AFOA 2PAJA 2VRSA 3P7KA 1JNMA 3VOPA 2OYHB 3VP8A 3HD7B 5AW6B 2Z4EA 2LKMA 2I1KA 1CZQA 2NPSA 5AW2B 5AW3B 4ZKUA 4DZOA 1GL2A 3BASA 1NTMK 3MGNA 2W6BA 2HODA 1G1JA 2POHA 1W2EA 1HGZA 2JEEA 2E43A 1MFZA 1EQ7A 3VMXA 1HH0A 3BRTB 3OJAB 1GDTA 2I1JA 4LLHA 4IFDK 1L0NK 1T3UA 4I2LC 2H43A 2FYUK 5AVWB 3CI9A 4JYBA 1G1IA 1LTGC 2XNXA 3A2AA 4DOJA 1H88A 3U1CA 1L0LK 3RK3D 1N7LA 1LT9C 1SQVK 4N6JA 1SFCD 4C7NB 3HUSB 3P8CD 3NTNA 1SQQK 3L36A 3VN0A 3V4WA 3RL0B 3HE4B 3B5NA 1M1JA 1J1DB 3WMM0 2GUSA 2NPSC 1N86A 3M9BA 5APXA 1NWQA 3I5CA 1FZBA 3H32A 1GTWA 4EOTA 4O9BA 1A02J 2C0XA 2GM4A 1NKZB 3VP9A 1X8YA 2WSFH 2KSJA 4WY4D 2P7JA 2N1TB 2C0WA 3RK3C 2J58A 1AQ5A 3IFMA 1FZGA 1SVFA 1KFMA 4GKGA 5APQA 2M8RA 1VPCA 4HYTB 1SFCC 5AW7B 5AVTB 3LW5H 1Z56A 1FZCA 3N4XA 3II6A 2N9BA 1ZR4A 1MUUA 1J1EC 2WPSA 1JTHA 3RK2D 2OYIA 1LTJB 4W7YA 1LTSC 3EFGA 1OXZA 1N7SD 3UIAA 1DH3A 3PP5A 4LGDE 1CSBA 4WY4C 2OYHA 4C46A 2WT7B 2IX7C 2M3BA 1M1JC 3HD7A 2QM7A 5CJ0A 3HE5A 3RK2B 5CMZA 2FFDC 1G2CA 2Q7CA 1N7SB 3P8MC 2HYNA 2A45H 5KTBA 1LTIC 2YKOA 4AUWA 3HD7D 3GHGB 1IFJA 3KYQA 1QL1A 1YTZI 1NTKK 3TNUB 1YTZT 1M7LA 5KJ7A 1JY3P 5APUA 1KILD 4GIFA 1FZCC 2ZFCA 1DEBA 2YO2A 1YYCA 3M0AA 1E5WA 2OYIC 5KJ7D 2BASA 2XV5A 2E42A 4N78D 1FZAA 1KFNA 3V4QA 4HH2A 3MIWA 2Z5IA 2XZRA 3HUSA 1KILB 1OWAA 3V2PA 2R5DA 3MD0A 1FZEA 2OYHC 1JCCA 2FKWB 3HD7C 5APVA 3BRVB 4RESB 1NOHA 2J59M 1SFCA 1NHLA 5AVVB 1N73B 3L35A 1VDFA 3M9QA 1JY2O 3RL0D 2KOGA 1HBWA 2N1TA 5BU8B 3P32A 5AVXB 2ZXEB 5KJ7C 1FOSE 1JY3N 2KYVA 1WRGA 2N1TD 4ZKPA 2H8PD 1HVVA 2Q9IA 4WY4A 5CCHD 1ZR2A 1LTJA 4I1LA 4B86A 5BU5A 3U1AA 2FFDA 1FBMA 3HUSC 5APTA 2NPSB 2C9LY 5AW4B 2H7HA 1GL2B 3O8ZA 2YMYA 2HODB 2Q3IA 3RL0C 4OH8B 1KQLA 1MV8A 3V2QA 2W27A 3L37A 1IC2A 3VTPC 1HJBA 1J1DC 3KDPB 1LWUB 1RY3A 1URQB 2XKMA 1NAFA 1N7SA 3CLQA 5CJ4A 5AW8B 2A45I 2N1TC 3LIEA 1GD2E 3VMYA 1HWTC 1JCDA 1JY3O 2HPCB 3TNUA 1IFDA 4GT1A 1ZN5A 1J2JB 3M06A 4IFMA 1FU1A 5AW5B 3BVHA 1IFNA 3A3YB 4XE5B 1WT6A 4Y99B 1L4AB 3T97A 4XA4A 1LTJC 3B5NB 1JOCA 2O1JA 4C7RA 1LGHB 2CPSA 1KILA 1PFIA 1ZLLA 2PP6A 5AW1B 4W7ZA 4JF7A 3L4FA 2KB7P 2FYZA 3C9IA 1RE4A 3HTKB 3TK1A 3RK2C 3NMDA 3IR9A 1LTAC 1RE3A 1RF1B 4WB4A 1N7SC 2O1KA 2IFNA 3BATA 1CI6B 1GW4A 1GK4A 1N73A 3V2RA 5AVUB 2OARA 1GK6A 2IFMA 5KLVK 3GHGC 2FXMA 3VMZA 4JYCA 1A02F 1KZUB 5APYA 3H6PA 1NKNA 2P67A 4C7NA 2GUVA 2O01H 4W80A 4LC1A 1FZFA 1IO4A 4AQRD 1H8AA 3HE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8R A;  2N1T D;  1SFC C;  2H8P D;  1HVV A;  4WY4 A;  5CCH D;  2HFE D;  1T3J A;  1KIL C;  1XTG B;  1JTH A;  3RK2 D;  2NPS B;  2XDJ A;  1GL2 B;  3TSI A;  4W7Y A;  2YMY A;  3M0D C;  5CCH A;  1JTH B;  1N7S D;  3RL0 C;  4OH8 B;  1URQ A;  2NPS D;  3PP5 A;  4LGD E;  3P8C E;  1GL2 D;  4WY4 C;  3HD7 A;  1URQ B;  3VOP A;  3RK2 B;  1N7S A;  3HD7 B;  2N1T C;  2NPS A;  1N7S B;  1URQ D;  1GL2 A;  3HD7 D;  3KYQ A;  5CCG A;  5KJ7 A;  1KIL D;  1L4A A;  3RK3 B;  1L4A B;  1GL2 C;  3B5N B;  5CCG D;  3RK3 D;  1SFC B;  5KJ7 D;  1KIL A;  2PP6 A;  5CCH C;  1L4A D;  2WZ7 A;  4W7Z A;  3B5N D;  1KIL B;  1URQ C;  4JF7 A;  1SFC D;  3HTK B;  3RK2 C;  3HD7 C;  1N7S C;  3RL0 B;  3B5N A;  2HG5 D;  2NPS C;  1SFC A;  1NHL A;  4WY4 B;  3RL0 D;  2KOG A;  2N1T A;  4N78 E;  5CCG C;  3RK3 C;  4WY4 D;  2N1T B;  5KJ7 C;  4W80 A;  1L4A C;  3B5N C; 
#chains in the Genus database with same CATH topology
 5L8R J;  3HRN A;  4UB8 H;  5B5E E;  2JJL A;  3TF5 A;  3SWK A;  5KLV G;  1XTG B;  2W6A A;  4D6T J;  1NU1 J;  3SWF A;  1NYH A;  2M5A B;  2NPS D;  4OVN F;  1N73 C;  2B87 B;  2NZ2 A;  3LID A;  4I7Z C;  3H1I D;  2CPB A;  3AE9 C;  2HPC A;  2IYP A;  2AEF A;  3CXH D;  1S9K E;  5KKZ B;  4WBA A;  3MP7 B;  1VQ5 P;  1VQN P;  2KIK A;  1KQS O;  3PTZ A;  5CCG A;  4EI2 A;  2JWD A;  1PP9 J;  2WSC J;  4UB8 E;  1GL2 C;  4H13 D;  1SQB G;  5CCG D;  1DD4 A;  2WTY A;  1SQV J;  2Q3E A;  1RF1 A;  2KLV A;  1GZL A;  5AVZ B;  4WWI A;  5AVR B;  2XND H;  3CC2 P;  3RL0 g;  3Q1M A;  5BVZ A;  4L76 A;  1LTT C;  1S9K D;  3L72 E;  1N2D C;  3OA7 A;  3D70 A;  2Q5U A;  2C9N Y;  3B5N C;  1JUN A;  3KZI E;  3F5H A;  2J5U A;  1KB9 E;  2XDJ A;  1JY2 N;  3M0D C;  3L70 J;  1JTH B;  2OGU A;  1NU1 K;  2ZT9 B;  1JNM A;  3WU2 H;  2OYH B;  3VP8 A;  2D2C B;  3H1J J;  3L72 D;  3CWB J;  5AW2 B;  1GL2 A;  3G6E P;  2E43 A;  1EQ7 A;  3B4S A;  1GDT A;  3CME P;  1NTZ D;  4IFD K;  1T3U A;  2FYN B;  2JO1 A;  5H2F H;  3ZDM A;  3U1C A;  1KB9 D;  2YMK A;  2H89 C;  3PH0 A;  1LT9 C;  4U3F G;  1SQV K;  1SS1 A;  2FYU J;  5GTH H;  5KAI H;  1TU3 F;  3NTN A;  1SQQ K;  1L0N G;  3C8V A;  3RL0 B;  3B5N A;  4DJG A;  3PHL A;  1M1J A;  1Y8A A;  2LR2 A;  2GUS A;  1S5L X;  3PRJ A;  3WU2 E;  3CC7 P;  2E75 C;  3AE2 C;  1NKZ B;  1X8Y A;  2KSJ A;  3RK3 C;  2N1T B;  2J58 A;  1L0L E;  3IFM A;  5TIS H;  3AEF C;  2KSE A;  3H1L J;  1KIL E;  3L72 G;  1VF5 C;  3LW5 H;  1FZC A;  1EC5 A;  3N4X A;  5H2F E;  1WMK A;  3AE4 C;  2WPS A;  3RK2 D;  2OYI A;  3L73 E;  1LTJ B;  4Y28 J;  2W8Z A;  3EFG A;  4GOF A;  3FGA D;  1DH3 A;  1S5L H;  4LGD E;  1CSB A;  5GTH E;  4C46 A;  3HD7 A;  5KAI E;  3RK2 B;  1EDJ A;  4H44 C;  5C39 A;  2A45 H;  1LTI C;  1U57 A;  3HD7 D;  1R5S A;  1L0L D;  1IFJ A;  3KYQ A;  3TNU B;  1YTZ T;  1M7L A;  3CCQ P;  5TIS E;  3USS A;  1KIL D;  1FDO A;  5GTI H;  1RQU A;  3L73 D;  2XV5 A;  4HH2 A;  3MIW A;  2XZR A;  1KIL B;  3V2P A;  2E74 C;  3VMA A;  1FZE A;  2QIW A;  3CX5 H;  1NOH A;  1AJY A;  1EDI A;  2KXP B;  4EDF A;  1NHL A;  3H1K G;  2KOG A;  1KV4 A;  2ZXE B;  3A0B H;  1FOS E;  1D7M A;  1UII A;  1BGY E;  2Y0E A;  5CCH D;  1ZR2 A;  5BU5 A;  4I1L A;  1L0L G;  5APT A;  5AW4 B;  2LXB A;  2IBZ G;  2YMY A;  2HOD B;  4BRY A;  2K9Y A;  1HJB A;  2H88 C;  1W2B O;  1LWU B;  2OYO A;  1X0T A;  3GMA A;  2XKM A;  3CX5 E;  3Q5P A;  1NAF A;  3GLM A;  2K9J A;  3CLQ A;  3L73 G;  4K3A A;  1VL2 A;  1VF5 B;  1HWT C;  2YXQ B;  1IFD A;  2GA1 A;  1Q86 Q;  3KXD A;  3M06 A;  1K8A Q;  3A0B E;  1FU1 A;  4PJ0 H;  4JBZ A;  1MFT A;  3T97 A;  3L71 J;  4C7R A;  1NTZ J;  1JEK A;  4YXW H;  2NRG A;  4W7Z A;  1ZOY C;  3GF3 A;  3L4F A;  3C9I A;  3HTK B;  3IR9 A;  4DT0 A;  2QJY B;  3CX5 D;  2O1K A;  1CI6 B;  1GK4 A;  3SFE C;  1KZU B;  1LNQ A;  3H1H J;  5APY A;  2V7Q J;  1USD A;  2P67 A;  4C7N A;  2GUV A;  2E76 C;  3AEB C;  2QRX A;  2G3A A;  1KD1 Q;  1W5C E;  4LC1 A;  4AQR D;  1H8A A;  4Z1M H;  1K05 A;  2L5G B;  1XTC C;  3AE5 C;  3EWK A;  2WIT A;  5AW0 B;  4PJ0 E;  1T3J A;  1SQX J;  2QM8 A;  2A45 G;  1G2C B;  2SPZ A;  4IL6 X;  1PGJ A;  4PV1 C;  1JMM A;  5APW A;  1BGY G;  1URQ A;  4L75 A;  4PD4 I;  1K73 Q;  3VYI A;  3CXH I;  2A06 E;  3BCC G;  2Q6Q A;  1URQ D;  3V2N A;  5AVS B;  4OWF A;  1HUC A;  2W6J H;  1KN7 A;  1CW5 A;  1L4A A;  3CMA P;  4IL6 H;  5CBN A;  1NO4 A;  2WWW A;  2QJK B;  1SFC B;  1IFM A;  1HTL C;  3KPE A;  3M9H A;  4K35 A;  2P1J A;  1NTZ K;  1L4A D;  2WZ7 A;  3AED C;  5KLV D;  1IZN B;  2ZVO B;  4H0L C;  5AW9 B;  1KYO I;  2P2U A;  2R32 A;  2A06 D;  2BEZ F;  1QL2 A;  1EDL A;  2HG5 D;  1FOS F;  1SQP G;  1HGV A;  4WY4 B;  2BCC E;  2B89 A;  3CCM P;  1T2K D;  2KZI A;  4H13 C;  3H32 B;  1GW3 A;  1NGM B;  5CCG C;  2FFD B;  2WSE H;  1GU5 A;  1FJP A;  2IZ1 A;  1H89 A;  3L74 J;  1QVG O;  1VQK P;  1OVU A;  1PGO A;  3AE8 C;  1MZ9 A;  3N7N A;  2HFE D;  4IL6 E;  1M57 D;  2YKQ A;  2QJP B;  3S4R A;  1SQX K;  3K5B A;  1HJ0 A;  1SQB D;  3B8E B;  1E79 H;  1RF1 C;  3TYY A;  3SSU A;  2YIU B;  1X9V A;  2B87 A;  3CCE P;  2YO3 A;  1AFO A;  2VRS A;  3MHV A;  2BCC D;  5AW6 B;  3R4Y A;  2I1K A;  2NPS A;  4ZKU A;  3MGN A;  3CWB G;  1HGZ A;  3VMX A;  3BRT B;  3OJA B;  1H0T A;  2FXP A;  2A06 G;  3KHU A;  1PV3 A;  2V4H A;  1NTK E;  4PD4 D;  2KS1 B;  1KB9 I;  3CCJ P;  1M56 D;  1QX8 A;  1DD3 A;  1L0L K;  4L74 A;  1KYO E;  1RH5 B;  2HR3 A;  1UIX A;  1NTM G;  4MN4 C;  1KQG B;  3HUS B;  3GW6 A;  2K88 A;  3S9O A;  3L36 A;  3VN0 A;  2FYU G;  4U3F E;  3V4W A;  1J1D B;  1R5L A;  1L0N E;  1BDC A;  1FZB A;  1GTW A;  1PIX A;  4O9B A;  1A02 J;  2C0X A;  3VP9 A;  4CPG A;  2C0W A;  1VQO P;  5TJH A;  4BWN A;  1SQQ J;  1BCC E;  2WPV B;  3W68 A;  1SVF A;  2W90 A;  1KOR A;  1NTK D;  2BCC G;  4HYT B;  4H0L B;  5AVT B;  1Z56 A;  1KYO D;  2N9B A;  1ZR4 A;  1GMJ A;  1J1E C;  2KLU A;  1JTH A;  1BE3 E;  1N7S D;  2ZJS E;  2QSI A;  4U3F D;  3A0H H;  2OYH A;  1M1J C;  2QM7 A;  3HE5 A;  1L0N D;  3CCL P;  2WSF J;  2ZT9 D;  1NAY A;  1YBK A;  1N7S B;  2HYN A;  2IBZ I;  1VQ8 P;  2D2C D;  1BCC D;  3JC2 2;  2B88 A;  1S72 P;  4HJG H;  1FZC C;  1PZQ A;  1YYC A;  2ZYG A;  3M0A A;  2OYI C;  2P10 A;  1U7J A;  1FZA A;  1KFN A;  1DIP A;  3V4Q A;  5B66 H;  1OWA A;  3FWN A;  5KAF H;  1NTK G;  4RKU J;  1JCC A;  3HD7 C;  4RES B;  3Q2Y A;  3A0H E;  5KLV J;  3L75 J;  4YTP C;  1KC8 Q;  2OTJ P;  1N73 B;  3L35 A;  1VDF A;  3RL0 D;  2AEM A;  2N1T A;  2Y9Z A;  4I7Z B;  1LP1 A;  5KLI C;  5AVX B;  2FBW C;  3H1K E;  2Q1K A;  2KZJ A;  2N1T D;  4EYY Q;  1T6A A;  2H8P D;  1YIT P;  2Q9I A;  3AEG C;  1LTJ A;  1FBM A;  1YQ3 C;  2C9L Y;  1BCC G;  1GL2 B;  4OH8 B;  3VTP C;  1MV8 A;  5B66 E;  2W27 A;  3V2Q A;  2W83 C;  2FY8 A;  5KAF E;  2IBZ E;  1PGP A;  1SQB J;  3Q5S A;  5CJ4 A;  1BE3 G;  2A45 I;  1QEX A;  2MKV A;  1GD2 E;  2I8D A;  1JCD A;  1JY3 O;  3TNU A;  3H1K D;  3RGU A;  1R8E A;  4IFM A;  3C1L A;  5AW5 B;  1DEE G;  3A3Y B;  4XE5 B;  4XA4 A;  3B5N B;  3G9R A;  2QE7 H;  1QLE D;  1KIL A;  3L71 G;  2PP6 A;  1YI2 P;  2Y0D A;  1ZME C;  3G71 P;  1RE4 A;  2IBZ D;  3CX5 I;  3TK1 A;  4JQ0 D;  3H1I J;  1RE3 A;  1PGQ A;  3V2R A;  5AVU B;  5KLV K;  3GHG C;  3SFD C;  2FXM A;  1KMI Z;  1IO4 A;  3HE4 A;  3E1I A;  1S5L E;  3I55 P;  3KQG A;  2WPR A;  2IPP A;  1S1C X;  1YQ4 C;  2RKL A;  3NXS A;  2WSC H;  1DX7 A;  2YKP A;  5CCH A;  1LWU A;  2Z5H A;  3F89 A;  3FWL A;  1LT9 B;  4D6T E;  2WMM A;  1NU1 E;  1SQB K;  5GTI E;  1SP4 A;  2XU6 A;  2ZVN B;  1FJK A;  2O01 J;  4U7J A;  1X79 B;  4OGQ C;  3V5B A;  1YJ9 P;  4L73 A;  3BCC E;  2WQY C;  1RF0 A;  1VF5 D;  2WT7 A;  3TGU G;  2E75 B;  2OQQ A;  3RK3 B;  3AEE C;  4IFF A;  2IZ0 A;  3V6I A;  1ZV8 A;  3GHG A;  3AEA C;  2IYO A;  1Q90 D;  1S2E A;  2ZAE B;  3HTK A;  1PP9 E;  2ITA A;  1URQ C;  1Q81 Q;  3OAK A;  1U7M A;  3L72 J;  1CI6 A;  4D6T D;  1BGY D;  1SQV E;  3QWO C;  5AVQ B;  3D6Y A;  4KT0 J;  2KNC B;  5APS A;  1FAV A;  1LTB C;  3BCC D;  5AVY B;  1SQP E;  1X22 A;  4N78 E;  4H44 B;  2WPQ A;  1IFI A;  1VQM P;  4Y99 C;  1L4A C;  4RJT A;  4BRY B;  1FS0 E;  2JKV A;  2O01 N;  3PLN A;  1S3J A;  2K9J B;  1GU4 A;  3JSV C;  2KK7 A;  2KUB A;  1PP9 D;  3TSI A;  4RO0 A;  2AXT H;  2Y0C A;  3MUD A;  1BDD A;  1T2K C;  2E5Y A;  5EFW B;  1SQV D;  5CHX A;  2K3R A;  2PAJ A;  3P7K A;  2E74 B;  2Z4E A;  3L70 E;  1HF9 A;  1FE6 A;  2LKM A;  3T97 B;  3BAS A;  1SQP D;  2W6B A;  1G1J A;  1W2E A;  2QG4 A;  1PPJ E;  1MFZ A;  1VQP P;  2DW3 A;  4D6T G;  1NU1 G;  3H1J E;  2I1J A;  4LLH A;  3CWB E;  1L0N K;  4I2L C;  2H43 A;  5AVW B;  1VQ7 P;  3CI9 A;  4JYB A;  3AE7 C;  1LTG C;  3H1K J;  4DOJ A;  1H88 A;  4GOE A;  1N7L A;  2QA4 P;  3EFF K;  4UB6 H;  1SFC D;  4C7N B;  4OGQ B;  1NTM E;  2RMZ A;  1BSN A;  5KKZ C;  1L0L J;  2NPS C;  1N86 A;  1NWQ A;  1RQV A;  2FYU E;  3H32 A;  1PP9 G;  3IF4 A;  2R3S A;  2GM4 A;  1K9M Q;  4WY4 D;  3E1R A;  3H1J D;  1SQV G;  1AQ5 A;  3CWB D;  1M8O B;  3W67 A;  5APQ A;  3L73 J;  1OZH A;  1JB0 J;  2AXC A;  3O6Q B;  1P84 H;  1VQL P;  2OTK E;  3S1K A;  1QGK B;  3H1L E;  1OXZ A;  1NTM D;  3CD6 P;  3UIA A;  4UB6 E;  3PP5 A;  2JP3 A;  5DJU B;  5CJ0 A;  3GF7 A;  3CCR P;  2FYU D;  5CMZ A;  3P8M C;  1KTM A;  2M5A A;  3D6Z A;  1YTZ I;  3LW5 J;  5KJ7 A;  1JY3 P;  2KS1 A;  3L70 G;  5APU A;  2E76 B;  1OW6 A;  2ZFC A;  4PV1 D;  1EZV E;  1P84 E;  1PPJ G;  1E5W A;  5KJ7 D;  2BAS A;  3H1J G;  3HUS A;  2M3E A;  3MD0 A;  5M1B A;  2OYH C;  4PV1 B;  2QEX P;  1Q7Y Q;  2D2C C;  3BRV B;  2P58 A;  2J59 M;  4TLF A;  3L75 G;  3AE1 C;  3M9Q A;  2B9B A;  3FX0 A;  1HBW A;  1BGY J;  2ZYA A;  2RN0 A;  3P32 A;  2FYN C;  1KQF B;  1EXI A;  1JM0 A;  1WRG A;  3BCC J;  3WUV A;  1EZV D;  3WUT A;  1P84 D;  2BEQ D;  1USE A;  4B86 A;  3U1A A;  2NPS B;  4H0L D;  2H7H A;  3O8Z A;  3RL0 C;  3CCS P;  3L37 A;  4ASV A;  3KZI H;  4HKZ H;  1H0T B;  1AA0 A;  4BXL A;  1N7S A;  1KB9 H;  3H1L G;  2N1T C;  3LIE A;  3VMY A;  1OVR A;  3OW2 O;  2HPC B;  1J2J B;  2K1A A;  4H13 B;  1SQP J;  1Q2N A;  2V7Q H;  1OIP A;  1RHZ B;  1LTJ C;  1JOC A;  2O1J A;  1AQT A;  1PFI A;  1ZLL A;  5AW1 B;  3I56 P;  4JF7 A;  2KB7 P;  2FYZ A;  3RK2 C;  1OFC X;  3L71 E;  3NMD A;  1EZV G;  1NTZ E;  1RF1 B;  3H1I G;  1N73 A;  2G8Y A;  2OAR A;  2ZYD A;  1EXJ A;  2IFM A;  2K37 A;  3AE6 C;  3VMZ A;  1OVV A;  1BE3 D;  3Q3D A;  4R4L A;  1PL5 A;  1NVO A;  4JPZ B;  4YPC A;  3RBZ A;  1M90 Q;  3CPW O;  3H1H E;  3HE5 B;  1KIL C;  3NFQ A;  1OW7 A;  4AYC A;  1RE4 C;  3E7K A;  3L71 D;  4XFJ A;  1SQX E;  4NPF X;  1RE3 C;  1GL2 D;  1JO5 A;  3G3Z A;  1SLQ A;  3CCU P;  1NTM J;  1NH4 A;  4A7P A;  3R2P A;  3ITK A;  3M91 A;  2R3C A;  1AVY A;  3JCU H;  3MTU E;  3U59 A;  3H1H D;  4WVZ A;  4EIJ A;  2JWA A;  3PJS K;  1SQP K;  3A5T A;  3MZW B;  3TGU E;  1MKM A;  1M1K Q;  1IJD B;  3H25 A;  5CCH C;  2L91 A;  3B5N D;  1LWU C;  1SQX D;  1LP1 B;  1JY2 P;  1J1E B;  2BCC J;  3B71 A;  3M0D A;  2R5B A;  1IK7 A;  2YNY A;  2LXC B;  1IK9 A;  1T8Z A;  1M1J B;  2M0B A;  1NTZ G;  4KHX A;  1RF0 C;  1LJ2 A;  3CL3 D;  3JCU E;  3A7O A;  1IFP A;  4M3L A;  4HB1 A;  3TGU D;  3AEC C;  4I6M C;  3SWY A;  2QVA A;  1S4X A;  1FZC B;  2KP8 A;  3RK3 E;  3L74 E;  2QJY C;  4N3Y B;  2OYI B;  3H1H G;  1QVF O;  1LT9 A;  2R44 A;  1ZW0 A;  2HLO A;  1YJN P;  1FDM A;  3P8C E;  2YXR B;  3EQ2 A;  2MJZ A;  3VOP A;  5CBO A;  3HD7 B;  1N8R Q;  3IN6 A;  2WSE J;  4NPE A;  1CZQ A;  5AW3 B;  2WSS H;  4DZO A;  1NTM K;  2ZXX A;  2HOD A;  1SQX G;  2POH A;  1NTK J;  2JEE A;  3FXD A;  2JR8 A;  1HH0 A;  2FYU K;  5KLI B;  3GG2 A;  1G1I A;  2XNX A;  3A2A A;  4KJM A;  2E75 D;  1OX3 A;  3RK3 D;  3L74 D;  4U3F J;  2Y9Y A;  3MUD C;  1JMB A;  4N6J A;  4GOD A;  1L0N J;  2IDB A;  1AVO A;  3P8C D;  1Y47 A;  4NPD A;  2KNC A;  3HE4 B;  1K04 A;  3WMM 0;  3ABV C;  3M9B A;  5APX A;  1BCC J;  2E5T A;  3I5C A;  2CK3 H;  2UWJ E;  4EOT A;  2WSF H;  2P7J A;  1FZG A;  1KFM A;  4GKG A;  1BSH A;  1BE3 J;  2M8R A;  1VPC A;  4H44 D;  2QJK C;  1NU1 D;  1SFC C;  5AW7 B;  3CC4 P;  3II6 A;  1SQQ E;  1MUU A;  1Y9B A;  4W7Y A;  1LTS C;  1VQ4 P;  2WVR A;  2PFX A;  4WY4 C;  2WT7 B;  2IX7 C;  2M3B A;  1EDK A;  1YJW P;  4TT3 H;  2FFD C;  1G2C A;  3L74 G;  2Q7C A;  3TDK A;  2E74 D;  1NJI Q;  5KTB A;  2O3J A;  2YKO A;  4AUW A;  4YXD C;  3GHG B;  2OTL P;  1QL1 A;  1NTK K;  1FC2 C;  1FDI A;  2QJP C;  4GIF A;  3WUU A;  1DEB A;  1Q82 Q;  2YO2 A;  2RH0 A;  1SQQ D;  2JDI H;  2E42 A;  1LT1 A;  2YIU C;  4N78 D;  1ZXG A;  3D71 A;  2KI7 B;  2Z5I A;  4ZMD A;  2R5D A;  2FKW B;  5APV A;  4OGQ D;  4ZNC A;  4DCK A;  1SFC A;  5AVV B;  1JY2 O;  5BU8 B;  3AE3 C;  5KLV E;  3L75 E;  5KJ7 C;  1JY3 N;  2KYV A;  2PRR A;  1YIJ P;  2AXT E;  1EZV I;  3O6Q A;  1P84 I;  5K5G B;  4ZKP A;  3IAO A;  1HVV A;  4WY4 A;  3L70 D;  5DJT B;  2FFD A;  3HUS C;  1PPJ D;  1YHQ P;  3QH9 A;  3TGU J;  4QMA A;  2Q3I A;  1KQL A;  1IC2 A;  1J1D C;  3KDP B;  1RY3 A;  3Q5R A;  4PD4 H;  1SQQ G;  1URQ B;  5E79 H;  5AW8 B;  4GDO A;  3CXH H;  4R4M A;  3CCV P;  3L75 D;  1SQB E;  4ASW A;  1ZP0 C;  1L2P A;  4GT1 A;  1ZRT E;  1ZN5 A;  4IOI H;  1VQ9 P;  1OMI A;  5B5E H;  3G4S P;  2AEJ A;  1IFN A;  3BVH A;  2PGD A;  1WT6 A;  4Y99 B;  1L4A B;  2E76 D;  1LGH B;  2CPS A;  1AV1 A;  2FXO A;  2N9Y B;  3RBX A;  1LTA C;  1OW8 A;  4WB4 A;  1N7S C;  2IFN A;  3BAT A;  1GW4 A;  4PD4 E;  1KYO H;  1GK6 A;  3FXE A;  5E79 E;  3H1I E;  4JYC A;  1A02 F;  3H1L D;  3CXH E;  3H6P A;  2ZT9 C;  1NKN A;  1ZRT D;  1VQ6 P;  2O01 H;  4W80 A;  1FZF A; 
#chains in the Genus database with same CATH homology
 3E1I A;  2L5G B;  3HRN A;  1XTC C;  2JJL A;  3KQG A;  2WIT A;  2WPR A;  5AW0 B;  2IPP A;  1T3J A;  2QM8 A;  3HE5 B;  2A45 G;  1KIL C;  1XTG B;  3NFQ A;  2W6A A;  1G2C B;  3NXS A;  4AYC A;  2WSC H;  1DX7 A;  1JMM A;  3SWF A;  1RE4 C;  2YKP A;  5CCH A;  5APW A;  1LWU A;  2Z5H A;  1RE3 C;  1URQ A;  2NPS D;  1GL2 D;  1LT9 B;  1N73 C;  3G3Z A;  1JO5 A;  3VYI A;  1SLQ A;  3LID A;  1SQB K;  1SP4 A;  1NH4 A;  2CPB A;  2HPC A;  2XU6 A;  1FJK A;  3R2P A;  1URQ D;  3V2N A;  1X79 B;  3M91 A;  1S9K E;  2R3C A;  4WBA A;  3V5B A;  5AVS B;  5CCG A;  3MTU E;  3U59 A;  1RF0 A;  2WT7 A;  1HUC A;  1CW5 A;  1L4A A;  3RK3 B;  4EIJ A;  4IFF A;  1SQP K;  3A5T A;  1GL2 C;  5CCG D;  1NO4 A;  2WWW A;  2WTY A;  1SFC B;  1IFM A;  1ZV8 A;  1HTL C;  3GHG A;  1IJD B;  3KPE A;  3M9H A;  5CCH C;  2P1J A;  1NTZ K;  1L4A D;  2WZ7 A;  3HTK A;  3B5N D;  1LWU C;  1URQ C;  1JY2 P;  3OAK A;  1J1E B;  1RF1 A;  3M0D A;  2KLV A;  1CI6 A;  5AW9 B;  2R5B A;  1GZL A;  2P2U A;  5AVZ B;  5AVR B;  2R32 A;  5AVQ B;  2YNY A;  1QL2 A;  2HG5 D;  1FOS F;  5BVZ A;  1HGV A;  1IK9 A;  1T8Z A;  4WY4 B;  5APS A;  1LTT C;  1S9K D;  1M1J B;  1FAV A;  1T2K D;  1LTB C;  1N2D C;  3OA7 A;  5AVY B;  3H32 B;  1GW3 A;  4N78 E;  5CCG C;  2FFD B;  4KHX A;  1RF0 C;  2WPQ A;  1IFI A;  2WSE H;  3CL3 D;  4Y99 C;  1L4A C;  2Q5U A;  3A7O A;  2C9N Y;  3B5N C;  1GU5 A;  1FJP A;  1JUN A;  4M3L A;  1H89 A;  1MZ9 A;  3N7N A;  2HFE D;  4I6M C;  3SWY A;  2YKQ A;  1GU4 A;  1FZC B;  1SQX K;  2KP8 A;  2XDJ A;  3TSI A;  1JY2 N;  4N3Y B;  3B8E B;  1RF1 C;  3M0D C;  3TYY A;  1JTH B;  3MUD A;  2OYI B;  1T2K C;  1NU1 K;  1LT9 A;  2HLO A;  1X9V A;  1FDM A;  3P8C E;  5CHX A;  2YO3 A;  3EQ2 A;  2MJZ A;  1AFO A;  2PAJ A;  2VRS A;  3P7K A;  1JNM A;  3VOP A;  2OYH B;  3VP8 A;  3HD7 B;  5AW6 B;  2Z4E A;  2LKM A;  2I1K A;  1CZQ A;  2NPS A;  5AW2 B;  5AW3 B;  4ZKU A;  4DZO A;  1GL2 A;  3BAS A;  1NTM K;  3MGN A;  2W6B A;  2HOD A;  1G1J A;  2POH A;  1W2E A;  1HGZ A;  2JEE A;  2E43 A;  1MFZ A;  1EQ7 A;  3VMX A;  1HH0 A;  3BRT B;  3OJA B;  1GDT A;  2I1J A;  4LLH A;  4IFD K;  1L0N K;  1T3U A;  4I2L C;  2H43 A;  2FYU K;  5AVW B;  3CI9 A;  4JYB A;  1G1I A;  1LTG C;  2XNX A;  3A2A A;  4DOJ A;  1H88 A;  3U1C A;  1L0L K;  3RK3 D;  1N7L A;  1LT9 C;  1SQV K;  4N6J A;  1SFC D;  4C7N B;  3HUS B;  3P8C D;  3NTN A;  1SQQ K;  3L36 A;  3VN0 A;  3V4W A;  3RL0 B;  3HE4 B;  3B5N A;  1M1J A;  1J1D B;  3WMM 0;  2GUS A;  2NPS C;  1N86 A;  3M9B A;  5APX A;  1NWQ A;  3I5C A;  1FZB A;  3H32 A;  1GTW A;  4EOT A;  4O9B A;  1A02 J;  2C0X A;  2GM4 A;  1NKZ B;  3VP9 A;  1X8Y A;  2WSF H;  2KSJ A;  4WY4 D;  2P7J A;  2N1T B;  2C0W A;  3RK3 C;  2J58 A;  1AQ5 A;  3IFM A;  1FZG A;  1SVF A;  1KFM A;  4GKG A;  5APQ A;  2M8R A;  1VPC A;  4HYT B;  1SFC C;  5AW7 B;  5AVT B;  3LW5 H;  1Z56 A;  1FZC A;  3N4X A;  3II6 A;  2N9B A;  1ZR4 A;  1MUU A;  1J1E C;  2WPS A;  1JTH A;  3RK2 D;  2OYI A;  1LTJ B;  4W7Y A;  1LTS C;  3EFG A;  1OXZ A;  1N7S D;  3UIA A;  1DH3 A;  3PP5 A;  4LGD E;  1CSB A;  4WY4 C;  2OYH A;  4C46 A;  2WT7 B;  2IX7 C;  2M3B A;  1M1J C;  3HD7 A;  2QM7 A;  5CJ0 A;  3HE5 A;  3RK2 B;  5CMZ A;  2FFD C;  1G2C A;  2Q7C A;  1N7S B;  3P8M C;  2HYN A;  2A45 H;  5KTB A;  1LTI C;  2YKO A;  4AUW A;  3HD7 D;  3GHG B;  1IFJ A;  3KYQ A;  1QL1 A;  1YTZ I;  1NTK K;  3TNU B;  1YTZ T;  1M7L A;  5KJ7 A;  1JY3 P;  5APU A;  1KIL D;  4GIF A;  1FZC C;  2ZFC A;  1DEB A;  2YO2 A;  1YYC A;  3M0A A;  1E5W A;  2OYI C;  5KJ7 D;  2BAS A;  2XV5 A;  2E42 A;  4N78 D;  1FZA A;  1KFN A;  3V4Q A;  4HH2 A;  3MIW A;  2Z5I A;  2XZR A;  3HUS A;  1KIL B;  1OWA A;  3V2P A;  2R5D A;  3MD0 A;  1FZE A;  2OYH C;  1JCC A;  2FKW B;  3HD7 C;  5APV A;  3BRV B;  4RES B;  1NOH A;  2J59 M;  1SFC A;  1NHL A;  5AVV B;  1N73 B;  3L35 A;  1VDF A;  3M9Q A;  1JY2 O;  3RL0 D;  2KOG A;  1HBW A;  2N1T A;  5BU8 B;  3P32 A;  5AVX B;  2ZXE B;  5KJ7 C;  1FOS E;  1JY3 N;  2KYV A;  1WRG A;  2N1T D;  4ZKP A;  2H8P D;  1HVV A;  2Q9I A;  4WY4 A;  5CCH D;  1ZR2 A;  1LTJ A;  4I1L A;  4B86 A;  5BU5 A;  3U1A A;  2FFD A;  1FBM A;  3HUS C;  5APT A;  2NPS B;  2C9L Y;  5AW4 B;  2H7H A;  1GL2 B;  3O8Z A;  2YMY A;  2HOD B;  2Q3I A;  3RL0 C;  4OH8 B;  1KQL A;  1MV8 A;  3V2Q A;  2W27 A;  3L37 A;  1IC2 A;  3VTP C;  1HJB A;  1J1D C;  3KDP B;  1LWU B;  1RY3 A;  1URQ B;  2XKM A;  1NAF A;  1N7S A;  3CLQ A;  5CJ4 A;  5AW8 B;  2A45 I;  2N1T C;  3LIE A;  1GD2 E;  3VMY A;  1HWT C;  1JCD A;  1JY3 O;  2HPC B;  3TNU A;  1IFD A;  4GT1 A;  1ZN5 A;  1J2J B;  3M06 A;  4IFM A;  1FU1 A;  5AW5 B;  3BVH A;  1IFN A;  3A3Y B;  4XE5 B;  1WT6 A;  4Y99 B;  1L4A B;  3T97 A;  4XA4 A;  1LTJ C;  3B5N B;  1JOC A;  2O1J A;  4C7R A;  1LGH B;  2CPS A;  1KIL A;  1PFI A;  1ZLL A;  2PP6 A;  5AW1 B;  4W7Z A;  4JF7 A;  3L4F A;  2KB7 P;  2FYZ A;  3C9I A;  1RE4 A;  3HTK B;  3TK1 A;  3RK2 C;  3NMD A;  3IR9 A;  1LTA C;  1RE3 A;  1RF1 B;  4WB4 A;  1N7S C;  2O1K A;  2IFN A;  3BAT A;  1CI6 B;  1GW4 A;  1GK4 A;  1N73 A;  3V2R A;  5AVU B;  2OAR A;  1GK6 A;  2IFM A;  5KLV K;  3GHG C;  2FXM A;  3VMZ A;  4JYC A;  1A02 F;  1KZU B;  5APY A;  3H6P A;  1NKN A;  2P67 A;  4C7N A;  2GUV A;  2O01 H;  4W80 A;  4LC1 A;  1FZF A;  1IO4 A;  4AQR D;  1H8A A;  3HE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...