2NPSB

Crystal structure of the early endosomal snare complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
68
structure length
68
Chain Sequence
b'GSMRETAIQQLEADILDVNQIFKDLAMMIHDQGDLIDSIEANVESSEVHVERASDQLQRAAYYQKKSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 4
molecule tags Transport protein
source organism Mus musculus
publication title Early endosomal SNAREs form a structurally conserved SNARE complex and fuse liposomes with multiple topologies
pubmed doi rcsb
total genus 29
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2006-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2npsB00
5CCGC 1N7SB 4W7YA 3PP5A 3RK3B 3RK2B 1L4AA 2N1TA 2NPSC 1GL2A 2M8RA 4N78E 5CCHA 1URQD 3HTKB 1KILD 4WY4D 1GL2C 3HD7D 1KILA 4LGDE 1URQB 3RL0C 3RK2D 3RK3D 3RK3C 3RK2C 1KILC 1KILB 3HD7A 3RL0B 1SFCC 3HD7C 1L4AC 2N1TC 3B5NB 2NPSA 4WY4C 5KJ7C 3B5NC 5CCGD 1URQC 2H8PD 1NHLA 2PP6A 2YMYA 4JF7A 3HD7B 5KJ7D 3B5NA 1T3JA 4W80A 4WY4A 3B5ND 3M0DC 5CCHD 3P8CE 4OH8B 1L4AD 2N1TD 1N7SD 2WZ7A 1SFCD 5CCGA 1SFCB 1JTHB 3TSIA 3RL0D 3VOPA 1URQA 2HG5D 5KJ7A 1N7SC 1HVVA 1GL2D 5CCHC 1SFCA 1JTHA 1N7SA 4W7ZA 2NPSD 2HFED 2KOGA 1L4AB 2N1TB 1GL2B 1XTGB 4WY4B 3KYQA 2XDJA 2NPSB
chains in the Genus database with same CATH superfamily
1USDA 3L72E 1IFIA 1KFMA 3EFGA 2IFNA 2RN0A 1VF5C 3MD0A 2WPQA 3PP5A 1YJWP 1H0TB 1M1JA 1GL2A 2IYOA 4Y99C 1SQBJ 4H13C 1S72P 3PH0A 1H8AA 3TDKA 1NTZE 1BGYG 5CCHA 1SS1A 3HTKB 2XU6A 4I1LA 4YXWH 3GMAA 4H44B 4IL6H 1KILD 3H1JJ 5CMZA 2MKVA 2KNCA 2E76B 3E1IA 2E76C 1BGYD 4ZKUA 3BCCD 2K1AA 1EDIA 1AA0A 1KILA 2WSFH 4Y28J 3L72G 1GDTA 1LWUB 2C9LY 1D7MA 2R3SA 4N3YB 1NAYA 4NPDA 2W6BA 1HH0A 3L74G 2JR8A 2A06E 4WWIA 4L74A 1JCCA 1W2EA 3TYYA 1WRGA 1ZP0C 2D2CD 2Y0EA 2M3BA 3AECC 3RL0C 1NAFA 1K73Q 1N8RQ 1KN7A 2YIUC 1VF5B 2IZ0A 3MHVA 3RK3D 3RK2D 2YKOA 3FGAD 1YJNP 1DD4A 3IN6A 1OVRA 5AW7B 1KB9D 2W8ZA 3A2AA 4U7JA 3T97B 1BDDA 3H1LG 2ITAA 3L70E 4LLHA 4PD4I 4JYCA 1RE3A 2OYIB 3IR9A 1LWUA 2C9NY 1SVFA 4BWNA 1A02J 1IO4A 2XZRA 4C46A 4UB8H 2O01J 3VMXA 4EIJA 1W2BO 5CBOA 5APTA 4L76A 4ASWA 1HGVA 1BE3D 2Y0CA 2ZXEB 4I7ZC 1PZQA 1SQXK 1MKMA 2RKLA 2B87B 5TJHA 5EFWB 3GHGA 4OVNF 4WY4C 1MZ9A 1JY3N 1EQ7A 1NTZJ 1SQQG 1OX3A 2POHA 3B5NC 1NTMG 1T2KD 1HBWA 1MV8A 2I8DA 2RMZA 1NH4A 4Z1MH 1P84D 4EYYQ 3VMYA 2HODA 2Q3IA 2FYUG 3V4QA 4DT0A 1NTKJ 1NTMD 3H1IJ 2ZT9D 4IFFA 1PIXA 1NVOA 1EZVI 1BCCD 1IFMA 2P58A 4JQ0D 1KYOH 4PJ0E 1S9KD 1EXJA 1VQ4P 2OARA 1FC2C 1NKNA 4EDFA 1BE3G 2V7QH 3S1KA 3W68A 3CD6P 2LR2A 1WMKA 1EXIA 2Y0DA 1NTKD 4W80A 1AQ5A 3CCQP 1YQ4C 2K9JB 3CPWO 1KC8Q 2E42A 4NPEA 5B66H 1HGZA 1VQKP 1OMIA 2LXCB 2BCCD 2WSFJ 2ZYDA 1NU1D 4JBZA 4OH8B 5AW1B 2N1TD 1N7SD 1LT9B 3L37A 4HJGH 3A5TA 4L73A 5TISH 5APVA 3L70G 1SQXE 4OWFA 2QRXA 3B71A 4PD4E 1RE3C 4YTPC 4WB4A 1G1IA 2HPCA 1KILE 1S3JA 1TU3F 2CPSA 1VPCA 2B88A 2ZAEB 3C9IA 3PJSK 3VMAA 5CCGA 4C7RA 1KQLA 1SQVG 3EWKA 2KI7B 1S5LX 1VQ6P 2HLOA 3HTKA 4XE5B 2YKPA 2KNCB 3AEGC 5KAFE 2D2CC 3RL0D 2QE7H 4IOIH 4PV1C 3WUVA 1FZGA 2WSEJ 4IL6E 2DW3A 4K3AA 1PFIA 2W83C 3R2PA 4YPCA 1LTJB 2R32A 2K9YA 3AE1C 1LJ2A 4H0LD 5KJ7A 1SQQE 1M56D 4B86A 2HPCB 2E76D 2WSEH 1IZNB 2PAJA 2FFDA 1E5WA 3A0BE 3O6QB 1SQPJ 4IFMA 4RKUJ 1ZR2A 1NTMJ 2E74B 3H1ID 5CCHC 1PGQA 1IJDB 3N7NA 5B66E 1EZVD 1N7SA 2IBZG 2QG4A 2WWWA 3L71J 4A7PA 1PGPA 3H1JG 5KTBA 3M0DA 2NPSD 1NTZK 3H1LE 3IF4A 1SQBD 5KLVJ 2N1TB 2IYPA 2QM8A 3BRTB 1Z56A 3L75G 4YXDC 4IL6X 5CHXA 1YI2P 4H44C 1OW8A 2WQYC 1KQFB 3QH9A 4D6TD 1QVGO 1M1KQ 1DEEG 5APSA 2P7JA 1JEKA 3KYQA 3MUDA 1N73B 1P84E 3O6QA 3U59A 2E43A 1U57A 1L0NG 1CSBA 2PRRA 1NTKK 3L73E 1KFNA 4I6MC 2A45I 2AEFA 2WPVB 2KB7P 3HE5B 5CCGC 1OW6A 4H44D 4DCKA 1ZV8A 3KHUA 3NFQA 2Q7CA 2HODB 3H32A 3FXDA 1W5CE 1NOHA 1SQXG 4GKGA 1SQPD 2JDIH 1L4AA 3BVHA 2M8RA 2YO3A 3CWBJ 4N78E 2UWJE 5KAFH 2OYHC 4C7NB 1NKZB 2L5GB 3AEEC 3TGUE 4PV1D 1N73A 4WY4D 1VQ8P 1DIPA 1NYHA 3G4SP 3AEDC 1DX7A 2JWDA 3CX5D 2K9JA 3BCCJ 3TF5A 1BGYJ 4U3FE 3L75D 2Q1KA 3AEAC 3L71E 4ASVA 1NJIQ 4UB6H 3FX0A 3BASA 4L75A 3CC7P 1URQB 3AE4C 1NU1G 1ZRTD 1VQOP 3GG2A 1LT9C 2I1JA 3MUDC 5AVRB 3M9HA 1KD1Q 1PGJA 1SQPK 5AVUB 2WVRA 1GW4A 1YQ3C 2Z5IA 3E1RA 1SP4A 2YNYA 3Q3DA 1YIJP 2Z4EA 1Y47A 1M7LA 2O01N 3L72D 3L74J 3F5HA 2XKMA 2Z5HA 2WSCJ 1LTSC 3MP7B 1BCCG 2KIKA 3U1AA 3IAOA 3RL0B 1FAVA 2CPBA 3G6EP 1QL2A 1KYOE 4PJ0H 2ZYAA 4RJTA 3HD7C 1GMJA 3OW2O 2N1TC 3W67A 1HJ0A 1LWUC 1SQBK 2KS1A 2L91A 2M5AB 2W27A 3Q1MA 3AEFC 5CCGD 1URQC 2AXCA 1EZVE 2M0BA 1OW7A 3L73G 4BXLA 5L8RJ 2Y9YA 2KZIA 2OTKE 3BCCE 3L36A 2YMYA 1G1JA 1LP1B 3UIAA 1JM0A 1FJKA 1JY2O 1PP9J 2R5DA 3A0BH 1NGMB 1RF1B 2ZFCA 3K5BA 3AE2C 3SFEC 1H89A 2ZT9C 4EI2A 5KLVK 4XA4A 1IFPA 3AEBC 2O1KA 1T3JA 3RK3E 1EZVG 2IBZD 3RBZA 4O9BA 1RY3A 3M0DC 1QLED 2NRGA 5AVXB 1DD3A 3CCLP 1R5LA 2E75B 1BSHA 1BDCA 3PLNA 5KLIC 1X79B 4UB8E 3R4YA 4OGQC 4EOTA 2B89A 3II6A 3NTNA 1SFCD 3FWNA 5H2FE 1BCCE 4M3LA 1U7JA 2JO1A 2GUSA 2Q3EA 3H32B 1JMMA 3H1HG 3LW5H 2BEZF 3RGUA 3BATA 4KJMA 2VRSA 3CL3D 5KLVD 1T6AA 1L0NK 2IDBA 3G71P 2E5YA 2QM7A 3M9QA 3LW5J 3CCUP 1RH5B 3WUTA 3L71D 1JTHB 1XTCC 3HUSA 1L0LK 2OTLP 3A7OA 3B8EB 3KQGA 1K04A 3PHLA 2AEMA 3CMAP 2PGDA 1VDFA 3GLMA 2SPZA 1ZN5A 2IZ1A 2QIWA 3GHGC 1YTZI 1URQA 2HG5D 1P84I 3M06A 3TGUJ 1N73C 2BCCG 2QEXP 2J59M 5APWA 1PPJG 1VF5D 1NTMK 5APUA 2JP3A 1ZLLA 2RH0A 3GW6A 3WUUA 3U1CA 1YJ9P 4D6TJ 4JPZB 1JTHA 1PPJE 2J58A 2Q6QA 3C1LA 1AQTA 2FYUK 2BCCE 3HUSB 2H88C 4H13D 4BRYB 5BU5A 1FZFA 2ZXXA 2GUVA 2HFED 2KOGA 4GOEA 1PP9G 2N9BA 2O01H 1SQPG 1EC5A 1GL2B 2G3AA 3CXHD 4PD4D 1Q86Q 1T8ZA 2QSIA 2HYNA 1RQUA 2KK7A 3O8ZA 4MN4C 3HUSC 2Y9ZA 2FYUD 1S1CX 5KLVG 1SQQD 1SQVK 1GU5A 2P67A 3CX5I 3L70J 2OYHB 3CWBE 3PTZA 2J5UA 5AW2B 4BRYA 4PV1B 2E74D 5BU8B 2K88A 3VMZA 2ZT9B 3AE5C 2FBWC 1JY3O 4NPFX 1LGHB 1X8YA 5APXA 3H1LD 1LP1A 1YBKA 1J1DC 2P2UA 3Q2YA 1K9MQ 4AUWA 2QJYB 1WT6A 3CX5H 3AE3C 2M3EA 3KDPB 1FE6A 2YKQA 1CI6A 1L0LD 1URQD 1SQQJ 2A06D 3A3YB 2KP8A 3NMDA 1ZR4A 3USSA 3KZIH 1J1EB 3T97A 2FFDC 3GF3A 3CMEP 1M8OB 4UB6E 3PRJA 2PFXA 2NZ2A 4H0LC 5AVQB 5KAIH 3I56P 1MFTA 2IX7C 2ZVNB 3CWBG 4LGDE 3H1IG 1RHZB 2K37A 3FXEA 5AVVB 3TNUB 1NTZD 1KB9E 3IFMA 4H13B 1J1EC 1LT1A 1IK9A 1N86A 1LTIC 2H89C 5KLVE 3AE6C 1M1JB 1FOSE 1LTAC 1AVOA 3L74E 4I2LC 2O3JA 1FZCC 3JCUE 4TLFA 1X22A 2KSJA 2QJYC 1PGOA 2JJLA 4GT1A 3H1HD 1PL5A 2QVAA 4Y99B 3V2NA 3A0HE 1OIPA 2FYNC 3ZDMA 1AV1A 3P8CD 1KILC 4RO0A 2WT7B 3D71A 1KILB 2KYVA 5BVZA 2WMMA 2P10A 2YXQB 3HD7A 3L75J 3TNUA 1HTLC 1UIXA 4R4LA 5AVSB 3SWYA 3CLQA 2YIUB 2A45G 4OGQD 3B5NB 2XNDH 1M1JC 2JEEA 3KZIE 3MZWB 4N78D 3EQ2A 3L70D 5AW0B 1Q90D 3M91A 3TK1A 5KJ7C 1PPJD 1OVUA 1OXZA 2H8PD 2QJKB 2HR3A 2FYUJ 3GF7A 5E79H 2PP6A 3S9OA 4U3FD 2B9BA 3Q5RA 1ZMEC 1LT9A 1JCDA 1Q2NA 3HD7B 4GDOA 3P7KA 4HKZH 4KHXA 3H1KJ 1NU1K 3H1KD 1NU1E 3I5CA 5H2FH 2FYUE 2R3CA 2IBZI 3VTPC 3VN0A 2GA1A 2WSSH 1IFDA 2B87A 2AEJA 1J1DB 2IFMA 3B5NA 3GHGB 1HWTC 4WY4A 1N7LA 1NTME 1FZCB 4IFDK 4GODA 1X9VA 1RE4C 1T2KC 1FZBA 3WMM0 1VQPP 1NWQA 1L4AD 5B5EH 1FDMA 1IK7A 1PP9D 2WZ7A 3FWLA 4TT3H 3HE4B 3D70A 3AE9C 3CCRP 3H1KG 1H88A 1M57D 4D6TG 1OFCX 3SFDC 1VQMP 1N2DC 1FDIA 2C0XA 1JMBA 1HUCA 1KORA 1SQBG 3L35A 1AFOA 5AVWB 4HH2A 3V6IA 5KLIB 1J2JB 1L0NE 2N9YB 1CI6B 2LXBA 2P1JA 3WU2E 2H7HA 1ZOYC 3I55P 4LC1A 1RQVA 1K8AQ 2OQQA 3H1HJ 3KPEA 3TSIA 1YITP 4DJGA 5TISE 3VOPA 3H1IE 1QX8A 5AW6B 3H25A 1JNMA 1KZUB 1EDLA 3L74D 3HE4A 3M9BA 2OYIC 1FZEA 3S4RA 2WTYA 1KYOI 3H1HE 2A45H 1N7SC 2FXMA 1MUUA 1RF0C 1E79H 3H1JE 2IBZE 4WBAA 1GD2E 5DJTB 1OWAA 1BGYE 4U3FJ 1KB9I 3HE5A 1QL1A 1RF0A 3OA7A 3V2PA 3SWFA 1IFNA 1PV3A 2ZYGA 4QMAA 4H0LB 2ZJSE 3OJAB 2WT7A 1FOSF 1FDOA 3A0HH 1L4AB 2BASA 3LIEA 1LNQA 1KTMA 1EDJA 1LTTC 2H43A 5B5EE 1FZAA 5AW4B 2QA4P 2XDJA 3AE8C 4KT0J 2WITA 4XFJA 1L2PA 1YHQP 2KXPB 1IC2A 2KSEA 1FU1A 1SQBE 3F89A 1SQVE 3C8VA 2ZVOB 3CI9A 5AW5B 1N7SB 2E75C 4U3FG 4W7YA 5KAIE 3LIDA 4GIFA 4WVZA 2YXRB 1VQ9P 1CW5A 2KUBA 1NTKG 1S4XA 3CX5E 3RK3B 3RK2B 4AYCA 2N1TA 3NXSA 2NPSC 2R44A 3CXHE 4N6JA 1QGKB 2QJPB 3L72J 4ZNCA 1AJYA 3L73D 2E5TA 3MGNA 4HB1A 3CCEP 3OAKA 5AW3B 3CXHH 1BE3J 1GL2C 4JYBA 1YYCA 3MIWA 3HD7D 3JC22 2FYZA 1L0LJ 1ZW0A 1QVFO 1BE3E 5AVYB 1JY2N 3N4XA 4AQRD 2BEQD 4ZKPA 3KXDA 1S5LE 3L75E 3JSVC 1L0LE 3G9RA 2K3RA 2FYNB 3P32A 3RK3C 3RK2C 1U7MA 2R5BA 1GZLA 3D6YA 5AVZB 1ZRTE 2OYOA 1HF9A 3CWBD 2FKWB 1Y8AA 1X0TA 1SQXJ 3D6ZA 3Q5PA 3MTUE 3TGUG 1SFCC 1KMIZ 3L4FA 3WU2H 3AE7C 1KQSO 1L4AC 3H1JD 3SWKA 1NTKE 2I1KA 2W6JH 2NPSA 5GTIH 2OYIA 3P8MC 1LTJA 1UIIA 2QJKC 1SLQA 1GK4A 3CXHI 5GTIE 3G3ZA 3CC2P 1NHLA 1KYOD 1CZQA 1KB9H 5AVTB 2FFDB 1KV4A 5C39A 4JF7A 3V2RA 2XNXA 1SQXD 4RESB 5KJ7D 1Q82Q 2E74C 1T3UA 3BCCG 2E75D 1KQGB 1R8EA 3JCUH 1HJBA 3QWOC 5KKZC 2V4HA 1MFZA 2KS1B 1GU4A 3ABVC 2OTJP 2D2CB 1DH3A 2V7QJ 1AVYA 5GTHE 2YO2A 1SQVD 1IFJA 5DJUB 1G2CA 3B5ND 5CCHD 3SSUA 3VYIA 1SQQK 3B4SA 3CCSP 5APYA 1RF1C 5KKZB 3P8CE 3V2QA 2G8YA 1VQ5P 1NTZG 3CCMP 1LTGC 3VP9A 2C0WA 1RF1A 1NO4A 1L0NJ 5AW8B 1JUNA 2AXTE 3HRNA 4K35A 3VP8A 2LKMA 1Y9BA 2OGUA 4DZOA 1VQLP 4ZMDA 1JB0J 3BRVB 1JOCA 1S2EA 5CBNA 2JKVA 5M1BA 3CC4P 1L0LG 4CPGA 5E79E 2QJPC 1FJPA 2O1JA 3L73J 1FS0E 4C7NA 1SFCB 1G2CB 1OVVA 1VL2A 1P84H 1VQ7P 3CCVP 1Q81Q 2MJZA 1FBMA 3Q5SA 3CCJP 2WSCH 3EFFK 1OZHA 2YMKA 2W6AA 3L71G 1SQPE 5AW9B 2GM4A 1JO5A 1PP9E 5APQA 1ZXGA 1S9KE 3V5BA 5CJ0A 4D6TE 1GTWA 3H1KE 1GW3A 1Q7YQ 3E7KA 3RBXA 1BSNA 1NU1J 1LTBC 1LTJC 2BCCJ 2KLVA 2WPSA 4GOFA 5CJ4A 3ITKA 1HVVA 2FXPA 3H1LJ 1GL2D 1R5SA 2W90A 3V4WA 1K05A 1SFCA 1L0ND 2XV5A 2OYHA 1M90Q 1JY2P 1YTZT 4DOJA 1RE4A 1S5LH 1GK6A 4W7ZA 1EDKA 1USEA 5GTHH 2JWAA 3RL0g 5K5GB 1DEBA 1H0TA 2FXOA 4I7ZB 2WPRA 1BCCJ 1XTGB 2IPPA 1SQVJ 4WY4B 1FZCA 2Q9IA 1A02F 3H6PA 4OGQB 3TGUD 2A06G 2CK3H 1VQNP 2FY8A 1JY3P 3M0AA 2KLUA 2NPSB 2Q5UA 2M5AA 4HYTB 2AXTH 4PD4H 4R4MA 1QEXA 2KZJA
chains in the Genus database with same CATH topology
1IFIA 1KFMA 3EFGA 2IFNA 3MD0A 2WPQA 3PP5A 1M1JA 1GL2A 4Y99C 1H8AA 5CCHA 3HTKB 2XU6A 4I1LA 1KILD 5CMZA 3E1IA 4ZKUA 1KILA 2WSFH 1GDTA 1LWUB 2C9LY 4N3YB 2W6BA 1HH0A 1JCCA 1W2EA 3TYYA 1WRGA 3RL0C 2M3BA 1NAFA 3RK3D 3RK2D 2YKOA 5AW7B 3A2AA 4LLHA 4JYCA 1RE3A 3IR9A 1LWUA 2C9NY 1SVFA 1IO4A 1A02J 2XZRA 4C46A 3VMXA 4EIJA 5APTA 1HGVA 2ZXEB 1SQXK 3GHGA 4WY4C 1MZ9A 1JY3N 1EQ7A 1T2KD 2POHA 3B5NC 1HBWA 1MV8A 1NH4A 2HODA 2Q3IA 3V4QA 4IFFA 1S9KD 1IFMA 2OARA 1NKNA 4W80A 1AQ5A 2E42A 1HGZA 4OH8B 5AW1B 2N1TD 1N7SD 1LT9B 3L37A 3A5TA 5APVA 1RE3C 4WB4A 1G1IA 2HPCA 2FFDB 2CPSA 3C9IA 1VPCA 5CCGA 4C7RA 1KQLA 2HLOA 3HTKA 4XE5B 2YKPA 3RL0D 1FZGA 1PFIA 3R2PA 1LTJB 2R32A 5KJ7A 2HPCB 4B86A 2FFDA 2WSEH 2PAJA 1E5WA 4IFMA 1ZR2A 5CCHC 1IJDB 3N7NA 1N7SA 2WWWA 5KTBA 3M0DA 2NPSD 1NTZK 2N1TB 2QM8A 3BRTB 1Z56A 5CHXA 5APSA 2P7JA 3KYQA 3MUDA 1N73B 3U59A 2E43A 1CSBA 4I6MC 1NTKK 1S9KE 1KFNA 2Z4EA 2A45I 5CCGC 3HE5B 2KB7P 1ZV8A 3NFQA 2Q7CA 2HODB 3H32A 4GKGA 1NOHA 1L4AA 3BVHA 2M8RA 2YO3A 4N78E 2OYHC 4C7NB 1NKZB 2L5GB 1N73A 4WY4D 1DX7A 3BASA 1URQB 1LT9C 2I1JA 5AVRB 3M9HA 1SQPK 5AVUB 1GW4A 2Z5IA 1SP4A 2YNYA 1M7LA 2XKMA 2Z5HA 1LTSC 3U1AA 3RL0B 1FAVA 2CPBA 1QL2A 3HD7C 2N1TC 1LWUC 1SQBK 2W27A 5CCGD 1URQC 3L36A 2YMYA 1G1JA 3UIAA 1RF1B 1FJKA 1JY2O 2R5DA 2ZFCA 1H89A 4XA4A 2O1KA 1T3JA 4O9BA 1RY3A 3M0DC 5AVXB 4EOTA 3II6A 3NTNA 1SFCD 4M3LA 2GUSA 3H32B 1JMMA 3LW5H 3BATA 2VRSA 3CL3D 1L0NK 3M9QA 2QM7A 1JTHB 1XTCC 3HUSA 1L0LK 3A7OA 3B8EB 3KQGA 1VDFA 1ZN5A 3GHGC 1YTZI 1URQA 2HG5D 3M06A 1N73C 2J59M 5APWA 1NTMK 5APUA 3U1CA 1ZLLA 1JTHA 2J58A 2FYUK 3HUSB 1FZFA 5BU5A 2GUVA 2HFED 2KOGA 2N9BA 2O01H 1GL2B 1T8ZA 2HYNA 3O8ZA 3HUSC 1SQVK 1GU5A 2P67A 2OYHB 5AW2B 5BU8B 1JY3O 1LGHB 1X8YA 5APXA 2P2UA 4AUWA 1J1DC 3KDPB 1WT6A 2YKQA 1CI6A 1URQD 3A3YB 1ZR4A 2FFDC 2KP8A 3NMDA 1J1EB 3T97A 5AVQB 2IX7C 4LGDE 5AVVB 5KLVK 3TNUB 3IFMA 1J1EC 1IK9A 1N86A 1LTIC 1M1JB 1FOSE 1LTAC 4I2LC 1FZCC 2KSJA 3VMZA 2JJLA 4Y99B 4GT1A 3V2NA 3P8CD 1KILC 2WT7B 1KILB 2KYVA 5BVZA 3TNUA 3HD7A 1HTLC 5AVSB 3SWYA 3CLQA 2A45G 3B5NB 4N78D 1M1JC 2JEEA 3VMYA 5AW0B 3EQ2A 3TK1A 3M91A 5KJ7C 2H8PD 1OXZA 2PP6A 1LT9A 1JCDA 3HD7B 3P7KA 4KHXA 1NU1K 3I5CA 2R3CA 3VTPC 3VN0A 1IFDA 2IFMA 3B5NA 1J1DB 1HWTC 3GHGB 4WY4A 1N7LA 1FZCB 4IFDK 1X9VA 1RE4C 1T2KC 1FZBA 3WMM0 1NWQA 1L4AD 1FDMA 2WZ7A 3HE4B 1H88A 1N2DC 2C0XA 1HUCA 3L35A 1AFOA 5AVWB 4HH2A 1J2JB 2P1JA 1CI6B 2H7HA 4LC1A 3KPEA 3TSIA 3VOPA 5AW6B 1JNMA 1KZUB 3HE4A 3M9BA 2OYIC 1FZEA 2WTYA 2A45H 1N7SC 2FXMA 1MUUA 1RF0C 4WBAA 1GD2E 1OWAA 3HE5A 1QL1A 1RF0A 3OA7A 3V2PA 3SWFA 1IFNA 2WT7A 3OJAB 1FOSF 1L4AB 2BASA 3LIEA 1LTTC 2H43A 1FZAA 5AW4B 2XDJA 2WITA 1IC2A 1FU1A 5AW5B 3CI9A 1N7SB 4W7YA 3LIDA 4GIFA 1CW5A 3RK3B 3RK2B 4AYCA 2N1TA 3NXSA 2NPSC 4N6JA 3MGNA 3OAKA 5AW3B 1GL2C 4JYBA 1YYCA 3MIWA 3HD7D 2FYZA 5AVYB 1JY2N 3N4XA 4AQRD 4ZKPA 3RK3C 3P32A 3RK2C 2R5BA 1GZLA 5AVZB 2FKWB 3MTUE 1SFCC 3L4FA 1L4AC 2I1KA 2NPSA 2OYIA 3P8MC 1LTJA 1SLQA 1GK4A 3G3ZA 1NHLA 1CZQA 5AVTB 4JF7A 3V2RA 2XNXA 4RESB 5KJ7D 1T3UA 1HJBA 1GU4A 1MFZA 1DH3A 2YO2A 1IFJA 1G2CA 3B5ND 5CCHD 3VYIA 1SQQK 5APYA 1RF1C 3P8CE 3V2QA 1LTGC 3VP9A 2C0WA 1RF1A 1NO4A 5AW8B 1JUNA 3HRNA 3VP8A 2LKMA 4DZOA 3BRVB 1JOCA 1FJPA 2O1JA 4C7NA 1SFCB 1G2CB 2MJZA 1FBMA 2WSCH 2W6AA 5AW9B 2GM4A 1JO5A 5APQA 3V5BA 5CJ0A 1GTWA 1GW3A 2KLVA 1LTBC 1LTJC 2WPSA 5CJ4A 1HVVA 1GL2D 3V4WA 1SFCA 2XV5A 2OYHA 1JY2P 1YTZT 4DOJA 1RE4A 1GK6A 4W7ZA 1DEBA 2WPRA 1XTGB 2IPPA 4WY4B 1FZCA 2Q9IA 1A02F 3H6PA 3M0AA 1JY3P 4HYTB 2NPSB 2Q5UA 2OYIB 1X79B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCG C;  1N7S B;  4W7Y A;  3PP5 A;  3RK3 B;  3RK2 B;  1L4A A;  2N1T A;  2NPS C;  1GL2 A;  2M8R A;  4N78 E;  5CCH A;  1URQ D;  3HTK B;  1KIL D;  4WY4 D;  1GL2 C;  3HD7 D;  1KIL A;  4LGD E;  1URQ B;  3RL0 C;  3RK2 D;  3RK3 D;  3RK3 C;  3RK2 C;  1KIL C;  1KIL B;  3HD7 A;  3RL0 B;  1SFC C;  3HD7 C;  1L4A C;  2N1T C;  3B5N B;  2NPS A;  4WY4 C;  5KJ7 C;  3B5N C;  5CCG D;  1URQ C;  2H8P D;  1NHL A;  2PP6 A;  2YMY A;  4JF7 A;  3HD7 B;  5KJ7 D;  3B5N A;  1T3J A;  4W80 A;  4WY4 A;  3B5N D;  3M0D C;  5CCH D;  3P8C E;  4OH8 B;  1L4A D;  2N1T D;  1N7S D;  2WZ7 A;  1SFC D;  5CCG A;  1SFC B;  1JTH B;  3TSI A;  3RL0 D;  3VOP A;  1URQ A;  2HG5 D;  5KJ7 A;  1N7S C;  1HVV A;  1GL2 D;  5CCH C;  1SFC A;  1JTH A;  1N7S A;  4W7Z A;  2NPS D;  2HFE D;  2KOG A;  1L4A B;  2N1T B;  1GL2 B;  1XTG B;  4WY4 B;  3KYQ A;  2XDJ A;  2NPS B; 
#chains in the Genus database with same CATH topology
 1USD A;  3L72 E;  1IFI A;  1KFM A;  3EFG A;  2IFN A;  2RN0 A;  1VF5 C;  3MD0 A;  2WPQ A;  3PP5 A;  1YJW P;  1H0T B;  1M1J A;  1GL2 A;  2IYO A;  4Y99 C;  1SQB J;  4H13 C;  1S72 P;  3PH0 A;  1H8A A;  3TDK A;  1NTZ E;  1BGY G;  5CCH A;  1SS1 A;  3HTK B;  2XU6 A;  4I1L A;  4YXW H;  3GMA A;  4H44 B;  4IL6 H;  1KIL D;  3H1J J;  5CMZ A;  2MKV A;  2KNC A;  2E76 B;  3E1I A;  2E76 C;  1BGY D;  4ZKU A;  3BCC D;  2K1A A;  1EDI A;  1AA0 A;  1KIL A;  2WSF H;  4Y28 J;  3L72 G;  1GDT A;  1LWU B;  2C9L Y;  1D7M A;  2R3S A;  4N3Y B;  1NAY A;  4NPD A;  2W6B A;  1HH0 A;  3L74 G;  2JR8 A;  2A06 E;  4WWI A;  4L74 A;  1JCC A;  1W2E A;  3TYY A;  1WRG A;  1ZP0 C;  2D2C D;  2Y0E A;  2M3B A;  3AEC C;  3RL0 C;  1NAF A;  1K73 Q;  1N8R Q;  1KN7 A;  2YIU C;  1VF5 B;  2IZ0 A;  3MHV A;  3RK3 D;  3RK2 D;  2YKO A;  3FGA D;  1YJN P;  1DD4 A;  3IN6 A;  1OVR A;  5AW7 B;  1KB9 D;  2W8Z A;  3A2A A;  4U7J A;  3T97 B;  1BDD A;  3H1L G;  2ITA A;  3L70 E;  4LLH A;  4PD4 I;  4JYC A;  1RE3 A;  2OYI B;  3IR9 A;  1LWU A;  2C9N Y;  1SVF A;  4BWN A;  1A02 J;  1IO4 A;  2XZR A;  4C46 A;  4UB8 H;  2O01 J;  3VMX A;  4EIJ A;  1W2B O;  5CBO A;  5APT A;  4L76 A;  4ASW A;  1HGV A;  1BE3 D;  2Y0C A;  2ZXE B;  4I7Z C;  1PZQ A;  1SQX K;  1MKM A;  2RKL A;  2B87 B;  5TJH A;  5EFW B;  3GHG A;  4OVN F;  4WY4 C;  1MZ9 A;  1JY3 N;  1EQ7 A;  1NTZ J;  1SQQ G;  1OX3 A;  2POH A;  3B5N C;  1NTM G;  1T2K D;  1HBW A;  1MV8 A;  2I8D A;  2RMZ A;  1NH4 A;  4Z1M H;  1P84 D;  4EYY Q;  3VMY A;  2HOD A;  2Q3I A;  2FYU G;  3V4Q A;  4DT0 A;  1NTK J;  1NTM D;  3H1I J;  2ZT9 D;  4IFF A;  1PIX A;  1NVO A;  1EZV I;  1BCC D;  1IFM A;  2P58 A;  4JQ0 D;  1KYO H;  4PJ0 E;  1S9K D;  1EXJ A;  1VQ4 P;  2OAR A;  1FC2 C;  1NKN A;  4EDF A;  1BE3 G;  2V7Q H;  3S1K A;  3W68 A;  3CD6 P;  2LR2 A;  1WMK A;  1EXI A;  2Y0D A;  1NTK D;  4W80 A;  1AQ5 A;  3CCQ P;  1YQ4 C;  2K9J B;  3CPW O;  1KC8 Q;  2E42 A;  4NPE A;  5B66 H;  1HGZ A;  1VQK P;  1OMI A;  2LXC B;  2BCC D;  2WSF J;  2ZYD A;  1NU1 D;  4JBZ A;  4OH8 B;  5AW1 B;  2N1T D;  1N7S D;  1LT9 B;  3L37 A;  4HJG H;  3A5T A;  4L73 A;  5TIS H;  5APV A;  3L70 G;  1SQX E;  4OWF A;  2QRX A;  3B71 A;  4PD4 E;  1RE3 C;  4YTP C;  4WB4 A;  1G1I A;  2HPC A;  1KIL E;  1S3J A;  1TU3 F;  2CPS A;  1VPC A;  2B88 A;  2ZAE B;  3C9I A;  3PJS K;  3VMA A;  5CCG A;  4C7R A;  1KQL A;  1SQV G;  3EWK A;  2KI7 B;  1S5L X;  1VQ6 P;  2HLO A;  3HTK A;  4XE5 B;  2YKP A;  2KNC B;  3AEG C;  5KAF E;  2D2C C;  3RL0 D;  2QE7 H;  4IOI H;  4PV1 C;  3WUV A;  1FZG A;  2WSE J;  4IL6 E;  2DW3 A;  4K3A A;  1PFI A;  2W83 C;  3R2P A;  4YPC A;  1LTJ B;  2R32 A;  2K9Y A;  3AE1 C;  1LJ2 A;  4H0L D;  5KJ7 A;  1SQQ E;  1M56 D;  4B86 A;  2HPC B;  2E76 D;  2WSE H;  1IZN B;  2PAJ A;  2FFD A;  1E5W A;  3A0B E;  3O6Q B;  1SQP J;  4IFM A;  4RKU J;  1ZR2 A;  1NTM J;  2E74 B;  3H1I D;  5CCH C;  1PGQ A;  1IJD B;  3N7N A;  5B66 E;  1EZV D;  1N7S A;  2IBZ G;  2QG4 A;  2WWW A;  3L71 J;  4A7P A;  1PGP A;  3H1J G;  5KTB A;  3M0D A;  2NPS D;  1NTZ K;  3H1L E;  3IF4 A;  1SQB D;  5KLV J;  2N1T B;  2IYP A;  2QM8 A;  3BRT B;  1Z56 A;  3L75 G;  4YXD C;  4IL6 X;  5CHX A;  1YI2 P;  4H44 C;  1OW8 A;  2WQY C;  1KQF B;  3QH9 A;  4D6T D;  1QVG O;  1M1K Q;  1DEE G;  5APS A;  2P7J A;  1JEK A;  3KYQ A;  3MUD A;  1N73 B;  1P84 E;  3O6Q A;  3U59 A;  2E43 A;  1U57 A;  1L0N G;  1CSB A;  2PRR A;  1NTK K;  3L73 E;  1KFN A;  4I6M C;  2A45 I;  2AEF A;  2WPV B;  2KB7 P;  3HE5 B;  5CCG C;  1OW6 A;  4H44 D;  4DCK A;  1ZV8 A;  3KHU A;  3NFQ A;  2Q7C A;  2HOD B;  3H32 A;  3FXD A;  1W5C E;  1NOH A;  1SQX G;  4GKG A;  1SQP D;  2JDI H;  1L4A A;  3BVH A;  2M8R A;  2YO3 A;  3CWB J;  4N78 E;  2UWJ E;  5KAF H;  2OYH C;  4C7N B;  1NKZ B;  2L5G B;  3AEE C;  3TGU E;  4PV1 D;  1N73 A;  4WY4 D;  1VQ8 P;  1DIP A;  1NYH A;  3G4S P;  3AED C;  1DX7 A;  2JWD A;  3CX5 D;  2K9J A;  3BCC J;  3TF5 A;  1BGY J;  4U3F E;  3L75 D;  2Q1K A;  3AEA C;  3L71 E;  4ASV A;  1NJI Q;  4UB6 H;  3FX0 A;  3BAS A;  4L75 A;  3CC7 P;  1URQ B;  3AE4 C;  1NU1 G;  1ZRT D;  1VQO P;  3GG2 A;  1LT9 C;  2I1J A;  3MUD C;  5AVR B;  3M9H A;  1KD1 Q;  1PGJ A;  1SQP K;  5AVU B;  2WVR A;  1GW4 A;  1YQ3 C;  2Z5I A;  3E1R A;  1SP4 A;  2YNY A;  3Q3D A;  1YIJ P;  2Z4E A;  1Y47 A;  1M7L A;  2O01 N;  3L72 D;  3L74 J;  3F5H A;  2XKM A;  2Z5H A;  2WSC J;  1LTS C;  3MP7 B;  1BCC G;  2KIK A;  3U1A A;  3IAO A;  3RL0 B;  1FAV A;  2CPB A;  3G6E P;  1QL2 A;  1KYO E;  4PJ0 H;  2ZYA A;  4RJT A;  3HD7 C;  1GMJ A;  3OW2 O;  2N1T C;  3W67 A;  1HJ0 A;  1LWU C;  1SQB K;  2KS1 A;  2L91 A;  2M5A B;  2W27 A;  3Q1M A;  3AEF C;  5CCG D;  1URQ C;  2AXC A;  1EZV E;  2M0B A;  1OW7 A;  3L73 G;  4BXL A;  5L8R J;  2Y9Y A;  2KZI A;  2OTK E;  3BCC E;  3L36 A;  2YMY A;  1G1J A;  1LP1 B;  3UIA A;  1JM0 A;  1FJK A;  1JY2 O;  1PP9 J;  2R5D A;  3A0B H;  1NGM B;  1RF1 B;  2ZFC A;  3K5B A;  3AE2 C;  3SFE C;  1H89 A;  2ZT9 C;  4EI2 A;  5KLV K;  4XA4 A;  1IFP A;  3AEB C;  2O1K A;  1T3J A;  3RK3 E;  1EZV G;  2IBZ D;  3RBZ A;  4O9B A;  1RY3 A;  3M0D C;  1QLE D;  2NRG A;  5AVX B;  1DD3 A;  3CCL P;  1R5L A;  2E75 B;  1BSH A;  1BDC A;  3PLN A;  5KLI C;  1X79 B;  4UB8 E;  3R4Y A;  4OGQ C;  4EOT A;  2B89 A;  3II6 A;  3NTN A;  1SFC D;  3FWN A;  5H2F E;  1BCC E;  4M3L A;  1U7J A;  2JO1 A;  2GUS A;  2Q3E A;  3H32 B;  1JMM A;  3H1H G;  3LW5 H;  2BEZ F;  3RGU A;  3BAT A;  4KJM A;  2VRS A;  3CL3 D;  5KLV D;  1T6A A;  1L0N K;  2IDB A;  3G71 P;  2E5Y A;  2QM7 A;  3M9Q A;  3LW5 J;  3CCU P;  1RH5 B;  3WUT A;  3L71 D;  1JTH B;  1XTC C;  3HUS A;  1L0L K;  2OTL P;  3A7O A;  3B8E B;  3KQG A;  1K04 A;  3PHL A;  2AEM A;  3CMA P;  2PGD A;  1VDF A;  3GLM A;  2SPZ A;  1ZN5 A;  2IZ1 A;  2QIW A;  3GHG C;  1YTZ I;  1URQ A;  2HG5 D;  1P84 I;  3M06 A;  3TGU J;  1N73 C;  2BCC G;  2QEX P;  2J59 M;  5APW A;  1PPJ G;  1VF5 D;  1NTM K;  5APU A;  2JP3 A;  1ZLL A;  2RH0 A;  3GW6 A;  3WUU A;  3U1C A;  1YJ9 P;  4D6T J;  4JPZ B;  1JTH A;  1PPJ E;  2J58 A;  2Q6Q A;  3C1L A;  1AQT A;  2FYU K;  2BCC E;  3HUS B;  2H88 C;  4H13 D;  4BRY B;  5BU5 A;  1FZF A;  2ZXX A;  2GUV A;  2HFE D;  2KOG A;  4GOE A;  1PP9 G;  2N9B A;  2O01 H;  1SQP G;  1EC5 A;  1GL2 B;  2G3A A;  3CXH D;  4PD4 D;  1Q86 Q;  1T8Z A;  2QSI A;  2HYN A;  1RQU A;  2KK7 A;  3O8Z A;  4MN4 C;  3HUS C;  2Y9Z A;  2FYU D;  1S1C X;  5KLV G;  1SQQ D;  1SQV K;  1GU5 A;  2P67 A;  3CX5 I;  3L70 J;  2OYH B;  3CWB E;  3PTZ A;  2J5U A;  5AW2 B;  4BRY A;  4PV1 B;  2E74 D;  5BU8 B;  2K88 A;  3VMZ A;  2ZT9 B;  3AE5 C;  2FBW C;  1JY3 O;  4NPF X;  1LGH B;  1X8Y A;  5APX A;  3H1L D;  1LP1 A;  1YBK A;  1J1D C;  2P2U A;  3Q2Y A;  1K9M Q;  4AUW A;  2QJY B;  1WT6 A;  3CX5 H;  3AE3 C;  2M3E A;  3KDP B;  1FE6 A;  2YKQ A;  1CI6 A;  1L0L D;  1URQ D;  1SQQ J;  2A06 D;  3A3Y B;  2KP8 A;  3NMD A;  1ZR4 A;  3USS A;  3KZI H;  1J1E B;  3T97 A;  2FFD C;  3GF3 A;  3CME P;  1M8O B;  4UB6 E;  3PRJ A;  2PFX A;  2NZ2 A;  4H0L C;  5AVQ B;  5KAI H;  3I56 P;  1MFT A;  2IX7 C;  2ZVN B;  3CWB G;  4LGD E;  3H1I G;  1RHZ B;  2K37 A;  3FXE A;  5AVV B;  3TNU B;  1NTZ D;  1KB9 E;  3IFM A;  4H13 B;  1J1E C;  1LT1 A;  1IK9 A;  1N86 A;  1LTI C;  2H89 C;  5KLV E;  3AE6 C;  1M1J B;  1FOS E;  1LTA C;  1AVO A;  3L74 E;  4I2L C;  2O3J A;  1FZC C;  3JCU E;  4TLF A;  1X22 A;  2KSJ A;  2QJY C;  1PGO A;  2JJL A;  4GT1 A;  3H1H D;  1PL5 A;  2QVA A;  4Y99 B;  3V2N A;  3A0H E;  1OIP A;  2FYN C;  3ZDM A;  1AV1 A;  3P8C D;  1KIL C;  4RO0 A;  2WT7 B;  3D71 A;  1KIL B;  2KYV A;  5BVZ A;  2WMM A;  2P10 A;  2YXQ B;  3HD7 A;  3L75 J;  3TNU A;  1HTL C;  1UIX A;  4R4L A;  5AVS B;  3SWY A;  3CLQ A;  2YIU B;  2A45 G;  4OGQ D;  3B5N B;  2XND H;  1M1J C;  2JEE A;  3KZI E;  3MZW B;  4N78 D;  3EQ2 A;  3L70 D;  5AW0 B;  1Q90 D;  3M91 A;  3TK1 A;  5KJ7 C;  1PPJ D;  1OVU A;  1OXZ A;  2H8P D;  2QJK B;  2HR3 A;  2FYU J;  3GF7 A;  5E79 H;  2PP6 A;  3S9O A;  4U3F D;  2B9B A;  3Q5R A;  1ZME C;  1LT9 A;  1JCD A;  1Q2N A;  3HD7 B;  4GDO A;  3P7K A;  4HKZ H;  4KHX A;  3H1K J;  1NU1 K;  3H1K D;  1NU1 E;  3I5C A;  5H2F H;  2FYU E;  2R3C A;  2IBZ I;  3VTP C;  3VN0 A;  2GA1 A;  2WSS H;  1IFD A;  2B87 A;  2AEJ A;  1J1D B;  2IFM A;  3B5N A;  3GHG B;  1HWT C;  4WY4 A;  1N7L A;  1NTM E;  1FZC B;  4IFD K;  4GOD A;  1X9V A;  1RE4 C;  1T2K C;  1FZB A;  3WMM 0;  1VQP P;  1NWQ A;  1L4A D;  5B5E H;  1FDM A;  1IK7 A;  1PP9 D;  2WZ7 A;  3FWL A;  4TT3 H;  3HE4 B;  3D70 A;  3AE9 C;  3CCR P;  3H1K G;  1H88 A;  1M57 D;  4D6T G;  1OFC X;  3SFD C;  1VQM P;  1N2D C;  1FDI A;  2C0X A;  1JMB A;  1HUC A;  1KOR A;  1SQB G;  3L35 A;  1AFO A;  5AVW B;  4HH2 A;  3V6I A;  5KLI B;  1J2J B;  1L0N E;  2N9Y B;  1CI6 B;  2LXB A;  2P1J A;  3WU2 E;  2H7H A;  1ZOY C;  3I55 P;  4LC1 A;  1RQV A;  1K8A Q;  2OQQ A;  3H1H J;  3KPE A;  3TSI A;  1YIT P;  4DJG A;  5TIS E;  3VOP A;  3H1I E;  1QX8 A;  5AW6 B;  3H25 A;  1JNM A;  1KZU B;  1EDL A;  3L74 D;  3HE4 A;  3M9B A;  2OYI C;  1FZE A;  3S4R A;  2WTY A;  1KYO I;  3H1H E;  2A45 H;  1N7S C;  2FXM A;  1MUU A;  1RF0 C;  1E79 H;  3H1J E;  2IBZ E;  4WBA A;  1GD2 E;  5DJT B;  1OWA A;  1BGY E;  4U3F J;  1KB9 I;  3HE5 A;  1QL1 A;  1RF0 A;  3OA7 A;  3V2P A;  3SWF A;  1IFN A;  1PV3 A;  2ZYG A;  4QMA A;  4H0L B;  2ZJS E;  3OJA B;  2WT7 A;  1FOS F;  1FDO A;  3A0H H;  1L4A B;  2BAS A;  3LIE A;  1LNQ A;  1KTM A;  1EDJ A;  1LTT C;  2H43 A;  5B5E E;  1FZA A;  5AW4 B;  2QA4 P;  2XDJ A;  3AE8 C;  4KT0 J;  2WIT A;  4XFJ A;  1L2P A;  1YHQ P;  2KXP B;  1IC2 A;  2KSE A;  1FU1 A;  1SQB E;  3F89 A;  1SQV E;  3C8V A;  2ZVO B;  3CI9 A;  5AW5 B;  1N7S B;  2E75 C;  4U3F G;  4W7Y A;  5KAI E;  3LID A;  4GIF A;  4WVZ A;  2YXR B;  1VQ9 P;  1CW5 A;  2KUB A;  1NTK G;  1S4X A;  3CX5 E;  3RK3 B;  3RK2 B;  4AYC A;  2N1T A;  3NXS A;  2NPS C;  2R44 A;  3CXH E;  4N6J A;  1QGK B;  2QJP B;  3L72 J;  4ZNC A;  1AJY A;  3L73 D;  2E5T A;  3MGN A;  4HB1 A;  3CCE P;  3OAK A;  5AW3 B;  3CXH H;  1BE3 J;  1GL2 C;  4JYB A;  1YYC A;  3MIW A;  3HD7 D;  3JC2 2;  2FYZ A;  1L0L J;  1ZW0 A;  1QVF O;  1BE3 E;  5AVY B;  1JY2 N;  3N4X A;  4AQR D;  2BEQ D;  4ZKP A;  3KXD A;  1S5L E;  3L75 E;  3JSV C;  1L0L E;  3G9R A;  2K3R A;  2FYN B;  3P32 A;  3RK3 C;  3RK2 C;  1U7M A;  2R5B A;  1GZL A;  3D6Y A;  5AVZ B;  1ZRT E;  2OYO A;  1HF9 A;  3CWB D;  2FKW B;  1Y8A A;  1X0T A;  1SQX J;  3D6Z A;  3Q5P A;  3MTU E;  3TGU G;  1SFC C;  1KMI Z;  3L4F A;  3WU2 H;  3AE7 C;  1KQS O;  1L4A C;  3H1J D;  3SWK A;  1NTK E;  2I1K A;  2W6J H;  2NPS A;  5GTI H;  2OYI A;  3P8M C;  1LTJ A;  1UII A;  2QJK C;  1SLQ A;  1GK4 A;  3CXH I;  5GTI E;  3G3Z A;  3CC2 P;  1NHL A;  1KYO D;  1CZQ A;  1KB9 H;  5AVT B;  2FFD B;  1KV4 A;  5C39 A;  4JF7 A;  3V2R A;  2XNX A;  1SQX D;  4RES B;  5KJ7 D;  1Q82 Q;  2E74 C;  1T3U A;  3BCC G;  2E75 D;  1KQG B;  1R8E A;  3JCU H;  1HJB A;  3QWO C;  5KKZ C;  2V4H A;  1MFZ A;  2KS1 B;  1GU4 A;  3ABV C;  2OTJ P;  2D2C B;  1DH3 A;  2V7Q J;  1AVY A;  5GTH E;  2YO2 A;  1SQV D;  1IFJ A;  5DJU B;  1G2C A;  3B5N D;  5CCH D;  3SSU A;  3VYI A;  1SQQ K;  3B4S A;  3CCS P;  5APY A;  1RF1 C;  5KKZ B;  3P8C E;  3V2Q A;  2G8Y A;  1VQ5 P;  1NTZ G;  3CCM P;  1LTG C;  3VP9 A;  2C0W A;  1RF1 A;  1NO4 A;  1L0N J;  5AW8 B;  1JUN A;  2AXT E;  3HRN A;  4K35 A;  3VP8 A;  2LKM A;  1Y9B A;  2OGU A;  4DZO A;  1VQL P;  4ZMD A;  1JB0 J;  3BRV B;  1JOC A;  1S2E A;  5CBN A;  2JKV A;  5M1B A;  3CC4 P;  1L0L G;  4CPG A;  5E79 E;  2QJP C;  1FJP A;  2O1J A;  3L73 J;  1FS0 E;  4C7N A;  1SFC B;  1G2C B;  1OVV A;  1VL2 A;  1P84 H;  1VQ7 P;  3CCV P;  1Q81 Q;  2MJZ A;  1FBM A;  3Q5S A;  3CCJ P;  2WSC H;  3EFF K;  1OZH A;  2YMK A;  2W6A A;  3L71 G;  1SQP E;  5AW9 B;  2GM4 A;  1JO5 A;  1PP9 E;  5APQ A;  1ZXG A;  1S9K E;  3V5B A;  5CJ0 A;  4D6T E;  1GTW A;  3H1K E;  1GW3 A;  1Q7Y Q;  3E7K A;  3RBX A;  1BSN A;  1NU1 J;  1LTB C;  1LTJ C;  2BCC J;  2KLV A;  2WPS A;  4GOF A;  5CJ4 A;  3ITK A;  1HVV A;  2FXP A;  3H1L J;  1GL2 D;  1R5S A;  2W90 A;  3V4W A;  1K05 A;  1SFC A;  1L0N D;  2XV5 A;  2OYH A;  1M90 Q;  1JY2 P;  1YTZ T;  4DOJ A;  1RE4 A;  1S5L H;  1GK6 A;  4W7Z A;  1EDK A;  1USE A;  5GTH H;  2JWA A;  3RL0 g;  5K5G B;  1DEB A;  1H0T A;  2FXO A;  4I7Z B;  2WPR A;  1BCC J;  1XTG B;  2IPP A;  1SQV J;  4WY4 B;  1FZC A;  2Q9I A;  1A02 F;  3H6P A;  4OGQ B;  3TGU D;  2A06 G;  2CK3 H;  1VQN P;  2FY8 A;  1JY3 P;  3M0A A;  2KLU A;  2NPS B;  2Q5U A;  2M5A A;  4HYT B;  2AXT H;  4PD4 H;  4R4M A;  1QEX A;  2KZJ A; 
#chains in the Genus database with same CATH homology
 1IFI A;  1KFM A;  3EFG A;  2IFN A;  3MD0 A;  2WPQ A;  3PP5 A;  1M1J A;  1GL2 A;  4Y99 C;  1H8A A;  5CCH A;  3HTK B;  2XU6 A;  4I1L A;  1KIL D;  5CMZ A;  3E1I A;  4ZKU A;  1KIL A;  2WSF H;  1GDT A;  1LWU B;  2C9L Y;  4N3Y B;  2W6B A;  1HH0 A;  1JCC A;  1W2E A;  3TYY A;  1WRG A;  3RL0 C;  2M3B A;  1NAF A;  3RK3 D;  3RK2 D;  2YKO A;  5AW7 B;  3A2A A;  4LLH A;  4JYC A;  1RE3 A;  3IR9 A;  1LWU A;  2C9N Y;  1SVF A;  1IO4 A;  1A02 J;  2XZR A;  4C46 A;  3VMX A;  4EIJ A;  5APT A;  1HGV A;  2ZXE B;  1SQX K;  3GHG A;  4WY4 C;  1MZ9 A;  1JY3 N;  1EQ7 A;  1T2K D;  2POH A;  3B5N C;  1HBW A;  1MV8 A;  1NH4 A;  2HOD A;  2Q3I A;  3V4Q A;  4IFF A;  1S9K D;  1IFM A;  2OAR A;  1NKN A;  4W80 A;  1AQ5 A;  2E42 A;  1HGZ A;  4OH8 B;  5AW1 B;  2N1T D;  1N7S D;  1LT9 B;  3L37 A;  3A5T A;  5APV A;  1RE3 C;  4WB4 A;  1G1I A;  2HPC A;  2FFD B;  2CPS A;  3C9I A;  1VPC A;  5CCG A;  4C7R A;  1KQL A;  2HLO A;  3HTK A;  4XE5 B;  2YKP A;  3RL0 D;  1FZG A;  1PFI A;  3R2P A;  1LTJ B;  2R32 A;  5KJ7 A;  2HPC B;  4B86 A;  2FFD A;  2WSE H;  2PAJ A;  1E5W A;  4IFM A;  1ZR2 A;  5CCH C;  1IJD B;  3N7N A;  1N7S A;  2WWW A;  5KTB A;  3M0D A;  2NPS D;  1NTZ K;  2N1T B;  2QM8 A;  3BRT B;  1Z56 A;  5CHX A;  5APS A;  2P7J A;  3KYQ A;  3MUD A;  1N73 B;  3U59 A;  2E43 A;  1CSB A;  4I6M C;  1NTK K;  1S9K E;  1KFN A;  2Z4E A;  2A45 I;  5CCG C;  3HE5 B;  2KB7 P;  1ZV8 A;  3NFQ A;  2Q7C A;  2HOD B;  3H32 A;  4GKG A;  1NOH A;  1L4A A;  3BVH A;  2M8R A;  2YO3 A;  4N78 E;  2OYH C;  4C7N B;  1NKZ B;  2L5G B;  1N73 A;  4WY4 D;  1DX7 A;  3BAS A;  1URQ B;  1LT9 C;  2I1J A;  5AVR B;  3M9H A;  1SQP K;  5AVU B;  1GW4 A;  2Z5I A;  1SP4 A;  2YNY A;  1M7L A;  2XKM A;  2Z5H A;  1LTS C;  3U1A A;  3RL0 B;  1FAV A;  2CPB A;  1QL2 A;  3HD7 C;  2N1T C;  1LWU C;  1SQB K;  2W27 A;  5CCG D;  1URQ C;  3L36 A;  2YMY A;  1G1J A;  3UIA A;  1RF1 B;  1FJK A;  1JY2 O;  2R5D A;  2ZFC A;  1H89 A;  4XA4 A;  2O1K A;  1T3J A;  4O9B A;  1RY3 A;  3M0D C;  5AVX B;  4EOT A;  3II6 A;  3NTN A;  1SFC D;  4M3L A;  2GUS A;  3H32 B;  1JMM A;  3LW5 H;  3BAT A;  2VRS A;  3CL3 D;  1L0N K;  3M9Q A;  2QM7 A;  1JTH B;  1XTC C;  3HUS A;  1L0L K;  3A7O A;  3B8E B;  3KQG A;  1VDF A;  1ZN5 A;  3GHG C;  1YTZ I;  1URQ A;  2HG5 D;  3M06 A;  1N73 C;  2J59 M;  5APW A;  1NTM K;  5APU A;  3U1C A;  1ZLL A;  1JTH A;  2J58 A;  2FYU K;  3HUS B;  1FZF A;  5BU5 A;  2GUV A;  2HFE D;  2KOG A;  2N9B A;  2O01 H;  1GL2 B;  1T8Z A;  2HYN A;  3O8Z A;  3HUS C;  1SQV K;  1GU5 A;  2P67 A;  2OYH B;  5AW2 B;  5BU8 B;  1JY3 O;  1LGH B;  1X8Y A;  5APX A;  2P2U A;  4AUW A;  1J1D C;  3KDP B;  1WT6 A;  2YKQ A;  1CI6 A;  1URQ D;  3A3Y B;  1ZR4 A;  2FFD C;  2KP8 A;  3NMD A;  1J1E B;  3T97 A;  5AVQ B;  2IX7 C;  4LGD E;  5AVV B;  5KLV K;  3TNU B;  3IFM A;  1J1E C;  1IK9 A;  1N86 A;  1LTI C;  1M1J B;  1FOS E;  1LTA C;  4I2L C;  1FZC C;  2KSJ A;  3VMZ A;  2JJL A;  4Y99 B;  4GT1 A;  3V2N A;  3P8C D;  1KIL C;  2WT7 B;  1KIL B;  2KYV A;  5BVZ A;  3TNU A;  3HD7 A;  1HTL C;  5AVS B;  3SWY A;  3CLQ A;  2A45 G;  3B5N B;  4N78 D;  1M1J C;  2JEE A;  3VMY A;  5AW0 B;  3EQ2 A;  3TK1 A;  3M91 A;  5KJ7 C;  2H8P D;  1OXZ A;  2PP6 A;  1LT9 A;  1JCD A;  3HD7 B;  3P7K A;  4KHX A;  1NU1 K;  3I5C A;  2R3C A;  3VTP C;  3VN0 A;  1IFD A;  2IFM A;  3B5N A;  1J1D B;  1HWT C;  3GHG B;  4WY4 A;  1N7L A;  1FZC B;  4IFD K;  1X9V A;  1RE4 C;  1T2K C;  1FZB A;  3WMM 0;  1NWQ A;  1L4A D;  1FDM A;  2WZ7 A;  3HE4 B;  1H88 A;  1N2D C;  2C0X A;  1HUC A;  3L35 A;  1AFO A;  5AVW B;  4HH2 A;  1J2J B;  2P1J A;  1CI6 B;  2H7H A;  4LC1 A;  3KPE A;  3TSI A;  3VOP A;  5AW6 B;  1JNM A;  1KZU B;  3HE4 A;  3M9B A;  2OYI C;  1FZE A;  2WTY A;  2A45 H;  1N7S C;  2FXM A;  1MUU A;  1RF0 C;  4WBA A;  1GD2 E;  1OWA A;  3HE5 A;  1QL1 A;  1RF0 A;  3OA7 A;  3V2P A;  3SWF A;  1IFN A;  2WT7 A;  3OJA B;  1FOS F;  1L4A B;  2BAS A;  3LIE A;  1LTT C;  2H43 A;  1FZA A;  5AW4 B;  2XDJ A;  2WIT A;  1IC2 A;  1FU1 A;  5AW5 B;  3CI9 A;  1N7S B;  4W7Y A;  3LID A;  4GIF A;  1CW5 A;  3RK3 B;  3RK2 B;  4AYC A;  2N1T A;  3NXS A;  2NPS C;  4N6J A;  3MGN A;  3OAK A;  5AW3 B;  1GL2 C;  4JYB A;  1YYC A;  3MIW A;  3HD7 D;  2FYZ A;  5AVY B;  1JY2 N;  3N4X A;  4AQR D;  4ZKP A;  3RK3 C;  3P32 A;  3RK2 C;  2R5B A;  1GZL A;  5AVZ B;  2FKW B;  3MTU E;  1SFC C;  3L4F A;  1L4A C;  2I1K A;  2NPS A;  2OYI A;  3P8M C;  1LTJ A;  1SLQ A;  1GK4 A;  3G3Z A;  1NHL A;  1CZQ A;  5AVT B;  4JF7 A;  3V2R A;  2XNX A;  4RES B;  5KJ7 D;  1T3U A;  1HJB A;  1GU4 A;  1MFZ A;  1DH3 A;  2YO2 A;  1IFJ A;  1G2C A;  3B5N D;  5CCH D;  3VYI A;  1SQQ K;  5APY A;  1RF1 C;  3P8C E;  3V2Q A;  1LTG C;  3VP9 A;  2C0W A;  1RF1 A;  1NO4 A;  5AW8 B;  1JUN A;  3HRN A;  3VP8 A;  2LKM A;  4DZO A;  3BRV B;  1JOC A;  1FJP A;  2O1J A;  4C7N A;  1SFC B;  1G2C B;  2MJZ A;  1FBM A;  2WSC H;  2W6A A;  5AW9 B;  2GM4 A;  1JO5 A;  5APQ A;  3V5B A;  5CJ0 A;  1GTW A;  1GW3 A;  2KLV A;  1LTB C;  1LTJ C;  2WPS A;  5CJ4 A;  1HVV A;  1GL2 D;  3V4W A;  1SFC A;  2XV5 A;  2OYH A;  1JY2 P;  1YTZ T;  4DOJ A;  1RE4 A;  1GK6 A;  4W7Z A;  1DEB A;  2WPR A;  1XTG B;  2IPP A;  4WY4 B;  1FZC A;  2Q9I A;  1A02 F;  3H6P A;  3M0A A;  1JY3 P;  4HYT B;  2NPS B;  2Q5U A;  2OYI B;  1X79 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...