2NPSB

Crystal structure of the early endosomal snare complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
68
structure length
68
Chain Sequence
GSMRETAIQQLEADILDVNQIFKDLAMMIHDQGDLIDSIEANVESSEVHVERASDQLQRAAYYQKKSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Vesicle-associated membrane protein 4
publication title Early endosomal SNAREs form a structurally conserved SNARE complex and fuse liposomes with multiple topologies
pubmed doi rcsb
source organism Mus musculus
total genus 29
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2006-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2npsB00
5KJ7D 3RK3B 1L4AA 4WY4B 1JTHA 3RL0D 5CCGD 2XDJA 1URQC 2PP6A 5KJ7C 3B5NA 1N7SA 2NPSB 1KILB 4N78E 4JF7A 3RL0B 1SFCB 2HG5D 1L4AC 3B5NC 1N7SC 3RK2C 3HD7B 1GL2A 2YMYA 3TSIA 2KOGA 1URQD 2N1TA 5CCHD 4W80A 5CCHC 1URQB 1T3JA 1GL2C 1L4AD 3HTKB 1KILA 3B5ND 4OH8B 1N7SD 3RK2D 1SFCA 3KYQA 1L4AB 1JTHB 3M0DC 2M8RA 1XTGB 3B5NB 1N7SB 3RK2B 3HD7A 1GL2D 4WY4A 2WZ7A 3RK3D 2NPSA 1URQA 5KJ7A 1GL2B 2N1TC 4W7YA 3RK3C 4W7ZA 5CCGA 2HFED 1HVVA 4WY4C 1KILD 3P8CE 2NPSC 1SFCD 1KILC 3RL0C 2H8PD 1SFCC 5CCGC 3HD7D 3VOPA 2N1TD 3PP5A 1NHLA 3HD7C 4LGDE 4WY4D 5CCHA 2N1TB 2NPSD
chains in the Genus database with same CATH superfamily
2WSCH 4PD4I 1GU4A 2HYNA 3B5NA 2K9JB 3AEBC 3H1KG 1KILB 4OGQC 3H1KJ 1LNQA 3U1AA 2B88A 3A0HH 1S9KE 1LP1B 3IAOA 1LTIC 3AE7C 1NJIQ 2Z5HA 1NU1K 1R5SA 3IN6A 1AV1A 2CK3H 3H6PA 3L72G 3L72J 3A0HE 3WUVA 3E1RA 4HB1A 2QVAA 1BE3G 1SQXD 1LTSC 3H1KE 2J5UA 1BE3J 4PV1D 3EQ2A 1W2EA 1OWAA 2GM4A 1IC2A 2WSEJ 2Y9ZA 1PL5A 3K5BA 2KXPB 3S9OA 3CPWO 3L73D 4LLHA 4N3YB 1EDIA 3CCLP 2WSSH 2E76B 3TGUG 3TGUJ 2UWJE 1NTZJ 2WMMA 5AVQB 3L72E 1N86A 1EC5A 2NRGA 3L71D 5AW6B 2OYOA 1KYOH 2JEEA 3WU2H 1U57A 1BE3E 2Q3IA 2IZ0A 3HE5A 2FFDB 1IJDB 2FXOA 3A5TA 1U7MA 2VRSA 2E5YA 1EZVD 1KYOE 3WU2E 1OZHA 3S4RA 1NOHA 3TGUE 4H44C 5KJ7D 1NTZE 1OVUA 1KQGB 1L4AA 3CC7P 4IFFA 4Y99C 3TK1A 4M3LA 1BSHA 1FDIA 4I7ZC 3SSUA 4B86A 1USDA 1ZR4A 2HG5D 3TNUA 3CCVP 3GHGC 3SWYA 4WVZA 3SFDC 4AYCA 1AVOA 4C7NB 3B5NC 1NO4A 1GL2A 5APSA 3GG2A 3RBXA 3D71A 1ZRTD 1NGMB 2E75D 3H1LG 2HODB 2Y0EA 2KK7A 1DD4A 3CCMP 1OX3A 1KD1Q 1SQVK 1Q2NA 1IFJA 1XTGB 1S1CX 2KP8A 1SQQD 1LJ2A 3OA7A 4WBAA 3H1JJ 3BRVB 5TISH 1FJKA 4GKGA 3W67A 2J59M 3R4YA 2WTYA 3RL0g 2B89A 4RKUJ 4W7ZA 3AEDC 2BEQD 1KTMA 2M5AA 1VF5B 3A2AA 1KFMA 4GOEA 1PIXA 4WWIA 4LC1A 5CMZA 1S9KD 3VOPA 1NTKK 3CL3D 3H1JE 4Z1MH 2ZT9B 1Y8AA 1YQ4C 1S5LX 3H1IG 4DCKA 3L70D 3H1IJ 3RK3B 4RO0A 1KZUB 3B8EB 3RL0D 1FZAA 2M3BA 3NFQA 2JJLA 1IFIA 2BCCJ 3H1KD 2H89C 3RL0B 1SFCB 1L4AC 2I1KA 3D6ZA 5APTA 3F89A 3RK2C 1MFZA 2KOGA 1SQPG 2O01J 3OJAB 5APXA 5AW5B 4PJ0H 4IFMA 3OAKA 1FDOA 2O01N 3H1IE 3CXHH 1GD2E 1GL2C 1N2DC 1T6AA 3R2PA 2V7QJ 2KLVA 2BCCE 1BGYD 2FXPA 4OWFA 1JTHB 1RH5B 5GTIE 2YIUB 2M8RA 4PJ0E 3HD7A 3CXHE 2J58A 2KSJA 2Q5UA 3D70A 1NU1G 2K9JA 1NU1J 2FYUD 4XE5B 1T2KC 1KYOD 2H7HA 1URQA 1YIJP 3SWKA 1G1IA 2N1TC 3TGUD 1RY3A 3E7KA 1K9MQ 2FYNB 3CCSP 1S3JA 1T3UA 5C39A 4IFDK 1JY2P 1FOSE 1OVVA 3PP5A 1OVRA 1RF0A 1HUCA 2ZXEB 1GU5A 1NH4A 3FGAD 2K3RA 2YO2A 3VTPC 1VQNP 4OVNF 2C0WA 1OW7A 2XDJA 1YJNP 4H13B 5KLVG 2WSFJ 3FWNA 1OW6A 2YMYA 3CI9A 4GT1A 2IZ1A 5DJTB 3KDPB 3LW5J 1AFOA 1M57D 1SVFA 1P84H 3JCUE 1HH0A 1KYOI 3MGNA 4CPGA 2LXCB 1JEKA 3H1LD 3LW5H 2HR3A 3AECC 2XU6A 1L0LK 5KLIC 2V4HA 1DEEG 5K5GB 1HGZA 1P84E 2MKVA 4K3AA 1ZLLA 1OXZA 3CCEP 3KXDA 5BVZA 1S4XA 3W68A 2D2CC 1RE4A 5KJ7A 4U7JA 3I56P 3CX5D 2A45H 3MTUE 1DEBA 1IK9A 5AVWB 4C7NA 3GF3A 1KILC 1SQVG 1SQVJ 2FY8A 4K35A 2OYHB 1VPCA 3CCRP 2E43A 3H1ID 1FZCA 4Y28J 3LIDA 1ZXGA 2BEZF 5GTHH 1SQVE 1NTKG 3MUDA 1NTKJ 3CXHD 4XA4A 2NZ2A 1JB0J 1IFNA 1HGVA 1SQPD 4GDOA 2E76C 1GK6A 5GTHE 4JYBA 1KQSO 3FXEA 3PLNA 1IFDA 3P32A 3V6IA 2FFDC 1YTZI 5AW0B 1NTKE 3MIWA 3WUUA 1YI2P 3I55P 2IYOA 1IZNB 5AVZB 1N7LA 1NU1D 1VQ6P 2W6AA 1NTMK 2IBZG 1UIXA 2W6BA 1QVGO 2OTJP 2ZVOB 3Q5PA 1RE4C 2ZYGA 3L37A 3U59A 2JR8A 1TU3F 3CXHI 4WY4D 3MP7B 4I2LC 1PP9G 4WY4B 1JTHA 1UIIA 2JWAA 3U1CA 1DIPA 1PP9J 2QJPB 3BATA 1Q81Q 4JBZA 4ZMDA 3JC22 2M0BA 1VQ4P 5KLVD 3HD7B 1QGKB 1URQD 3AEAC 5CCHD 4EOTA 3MUDC 2YKOA 1URQB 2IYPA 1PP9E 2GA1A 2ZYDA 3FXDA 2RN0A 3A7OA 1PPJD 1VF5C 1FDMA 1JCDA 1KB9E 3II6A 2WZ7A 2ZT9C 1JUNA 3RK3C 1NVOA 2HFED 2W27A 4ASWA 1MUUA 2OYIA 1L0LJ 4PV1B 1LTAC 1W5CE 3RL0C 1SFCC 2IFMA 2KS1A 1VQ5P 2JO1A 2BASA 1NTZG 2WSEH 1P84I 1ZV8A 1J2JB 4DOJA 2YO3A 3IR9A 3M9HA 1JY3P 3M0AA 1S72P 2NPSD 1K8AQ 2QSIA 2RKLA 3FWLA 2NPSB 2A06G 2OQQA 2P2UA 2L91A 1L0LE 3L36A 2Y9YA 5B66H 2YKPA 2GUSA 2YIUC 3CCUP 1N73B 2ZJSE 2GUVA 4NPFX 3TSIA 1JY2N 2QJKB 1Y47A 2K37A 3FX0A 2E74D 1KV4A 1R5LA 2A45I 4L76A 1KORA 5B66E 3PJSK 1RF1A 4KT0J 1CW5A 3ZDMA 1GTWA 2FYNC 4C7RA 2A06E 1H0TB 1J1DB 3G6EP 2Q6QA 2OYHA 3AE2C 4RESB 1U7JA 3AEGC 3CMEP 2E75B 3RBZA 1EXIA 1R8EA 1E79H 3C1LA 1KQLA 2IBZD 1FZCB 3B4SA 4R4MA 3H1JG 1M1KQ 1SQXK 1QEXA 1OFCX 2Z5IA 4H13C 5APUA 4BWNA 1Q7YQ 4HYTB 1VQPP 3AEEC 5AW8B 2QIWA 5L8RJ 2KB7P 2DW3A 2KI7B 2HPCB 1NTMG 1NTMJ 4OGQD 3L75G 3HRNA 3L75J 1LT1A 1JNMA 3M0DA 1AJYA 3VP8A 3UIAA 1G1JA 1YJWP 4KJMA 2AEJA 2K88A 4I1LA 1L2PA 3M91A 2KNCA 2BCCG 1NTME 1FAVA 4U3FJ 2LKMA 3L75E 3GF7A 3NXSA 3KYQA 2IBZI 3VN0A 1X79B 5AW1B 5GTIH 4WY4A 3G71P 2Q1KA 1JY2O 2W8ZA 3L72D 2O01H 2OYHC 2Y0DA 2KIKA 4U3FE 3QH9A 3IFMA 1BE3D 4D6TG 1LT9B 2V7QH 4D6TJ 3NTNA 1J1EB 3F5HA 1NAYA 3HE4A 2KYVA 4DT0A 2ZAEB 4MN4C 1SQQK 1KB9I 2W83C 4H44D 5CCHA 1NKZB 2Q9IA 1NTZD 1X22A 1RE3A 4EI2A 1WMKA 4I6MC 1EDJA 3M06A 1LWUA 3EFFK 1SQBK 1JO5A 4D6TE 1W2BO 1MZ9A 2A06D 3BCCG 5APYA 3BCCJ 4QMAA 3H1HG 2WPVB 1PV3A 2YKQA 4R4LA 5APQA 3H1HJ 3SFEC 3PH0A 3V4WA 1AQ5A 4NPDA 2AEFA 4BXLA 4W80A 2YXRB 3JCUH 4ZKUA 1RHZB 1Q86Q 3EWKA 2KLUA 1KMIZ 4EDFA 2OYIB 2QEXP 1NKNA 3BCCE 2KS1B 3NMDA 2WSFH 3H1HE 1FC2C 3GW6A 1ZP0C 2NPSA 3V2PA 3VMYA 3PRJA 2R5DA 4WB4A 2AXCA 4WY4C 3N7NA 1YITP 5AVVB 1QL1A 4UB8E 2QJPC 1N73A 5KAIH 2A45G 5H2FE 3H1JD 4XFJA 2R5BA 2ZVNB 2QRXA 1M7LA 3N4XA 3HD7C 1Q82Q 4GIFA 3AE3C 3CLQA 3L4FA 5EFWB 5KAIE 4C46A 1SS1A 2FYUK 1KILE 1L0NK 5CCGD 1H0TA 1URQC 1YBKA 3Q5RA 4AQRD 3L75D 2M3EA 4YTPC 1X0TA 1RE3C 1RF1B 4L73A 4JF7A 1SQXJ 1OW8A 4H0LD 2Z4EA 3WMM0 1M56D 2JDIH 4JYCA 5AW4B 3Q1MA 3MD0A 5APWA 3CWBG 1OMIA 3CWBJ 4H0LB 2IPPA 1ZN5A 1DD3A 1RF0C 2OGUA 5AW3B 5CJ0A 1JY3N 4EIJA 2IFNA 3AE8C 2BCCD 3C8VA 3L71G 3L71J 2E5TA 1SQXE 3A0BH 4YPCA 1LTJA 4PV1C 2WWWA 2HPCA 5KKZB 1EDLA 1T2KD 1CSBA 3CWBE 3V4QA 1EZVG 1H89A 3P7KA 4A7PA 3HTKA 3H32B 4L75A 3A0BE 1HTLC 3MHVA 1JCCA 1HF9A 3CD6P 3L71E 2NPSC 1DH3A 3BVHA 1X9VA 3ITKA 2H43A 5M1BA 2WT7A 4LGDE 1FJPA 2QJKC 1EZVE 2YMKA 2SPZA 1KQFB 3O6QB 3P8MC 5AW9B 2POHA 3EFGA 2QG4A 2KNCB 3C9IA 4ZKPA 5KJ7C 3MZWB 2OTKE 1Y9BA 1NWQA 3GLMA 1VQMP 1FZGA 1ZR2A 1J1DC 1QX8A 1MKMA 1SQQG 4NPEA 1IFMA 1SQQJ 3G4SP 1BDDA 1GW3A 1LT9A 2LXBA 1K04A 2P10A 1ZRTE 1VQOP 2E75C 4OH8B 1N7SD 1IO4A 1SQBG 1LTTC 2IX7C 1SQBJ 1P84D 3O8ZA 1FZCC 1Q90D 1N7SB 2KZIA 2D2CD 1S2EA 4TLFA 4IL6H 3HE4B 1IK7A 3IF4A 4KHXA 1SQQE 1KB9H 3VMAA 1FBMA 3WUTA 2W90A 4HJGH 2P7JA 3L70J 1HVVA 1KILD 1JY3O 4N6JA 4IL6E 1SQBE 3GHGA 1NYHA 1LWUB 2O3JA 2WPSA 3AE5C 3KZIH 1KC8Q 5AVYB 3TYYA 3RK3E 1YJ9P 1VQLP 2QE7H 3BASA 2R3CA 3L70E 2R3SA 1L0LG 2PP6A 3KZIE 1X8YA 2FXMA 2N9YB 1PZQA 1SQVD 1A02J 1BGYG 3VP9A 1K73Q 1BGYJ 3M9QA 2I1JA 1G2CB 5AVUB 3L74G 2E76D 2PFXA 3CWBD 3L74J 1HJ0A 1ZMEC 1FE6A 2FYUG 5BU8B 2P58A 2FYUJ 1L0NG 1T3JA 2RMZA 4JPZB 5CJ4A 1L0NJ 1GMJA 2PAJA 3AE9C 1LT9C 1DX7A 2P1JA 3CC4P 5BU5A 1J1EC 2R44A 1NTKD 1BGYE 1CZQA 3AEFC 3V2QA 3G9RA 1JOCA 2QJYB 5KLVK 3L74E 2E74B 2FYUE 1M1JB 3D6YA 4W7YA 5CCGA 4DZOA 3HUSB 1L0NE 5AW2B 1AQTA 1YTZT 1ZOYC 2JP3A 1MFTA 5AVSB 2H8PD 2QM7A 3GMAA 2PGDA 2LR2A 2ZFCA 5DJUB 2H88C 1EQ7A 1H88A 4GODA 1SLQA 1HWTC 2KSEA 3H1LJ 1AVYA 5E79H 3I5CA 5APVA 1T8ZA 1LTJB 2OYIC 1Z56A 3H32A 1CI6A 2OARA 3QWOC 2N1TA 3RGUA 1PGQA 4HKZH 1PP9D 1EZVI 3HTKB 5E79E 3PHLA 4OGQB 1D7MA 1VF5D 2G8YA 1ZW0A 3JSVC 1PGOA 3H1LE 1SQBD 1KB9D 3AE4C 1SP4A 2YXQB 3CX5H 1YHQP 5TISE 2ZT9D 2C9NY 3O6QA 1AA0A 4U3FG 2C0XA 2WT7B 3RK3D 3V5BA 2XNDH 4HH2A 3G3ZA 1JMBA 3CX5E 1QL2A 1GK4A 1SFCD 2Q7CA 3TDKA 4ASVA 2XZRA 1RF1C 2W6JH 5CCGC 3KHUA 2ITAA 1PGPA 1VQKP 1N8RQ 1KFNA 4L74A 2O1KA 4H0LC 1YQ3C 3VMXA 2QA4P 2I8DA 1SQPJ 1JM0A 1N7SA 1L0LD 4N78E 5CHXA 2ZYAA 4BRYA 2B87A 4AUWA 4UB6H 3T97B 1KN7A 2KZJA 3CC2P 4TT3H 3TF5A 5KKZC 2WVRA 4H44B 3L74D 2O1JA 4GOFA 2Y0CA 4Y99B 4UB6E 1SQPE 2AXTH 1KILA 4I7ZB 3B5ND 4PD4H 1L0ND 1M8OB 4O9BA 1OIPA 1LP1A 5KAFH 3M0DC 3GHGB 3B5NB 1MV8A 1GW4A 2AXTE 2G3AA 1BCCG 4PD4E 1LGHB 2MJZA 2P67A 1BCCJ 2WPQA 1NU1E 1FU1A 5KAFE 1VQ8P 5CBNA 1BSNA 1LTGC 2PRRA 3P8CE 1FZFA 3CMAP 4H13D 1G2CA 1A02F 1EDKA 4UB8H 4EYYQ 2KUBA 5H2FH 4ZNCA 1EXJA 5KLVJ 5CBOA 1E5WA 1FZBA 1BCCE 3S1KA 2OTLP 1HJBA 1WT6A 1GZLA 2WITA 4JQ0D 3Q2YA 3SWFA 3Q5SA 1PPJG 2FFDA 1GDTA 2AEMA 1RQVA 1N7SC 1S5LH 5B5EH 1M1JA 2HLOA 5KLVE 3H25A 2XV5A 3HE5B 3HUSA 4IL6X 1NTMD 1NTZK 5CCHC 2XNXA 1L4AD 1SQXG 1FS0E 2YNYA 1S5LE 3RK2D 3CCQP 1QVFO 5B5EE 3BRTB 1L4AB 1M90Q 1PPJE 3V2RA 3L73G 1LWUC 3B71A 3RK2B 3L73J 1GL2D 2ZXXA 4YXDC 1FZEA 3TNUB 4YXWH 1HBWA 2JWDA 4U3FD 1GL2B 2HODA 2FKWB 3E1IA 3LIEA 1VQ7P 2Q3EA 2FYZA 4N78D 1QLED 5AVRB 2IDBA 3L73E 4RJTA 3AE6C 2N1TD 2FBWC 1PFIA 2R32A 1NHLA 1CI6B 1YYCA 1K05A 2CPSA 2N1TB 2E42A 3L35A 5AVXB 2B9BA 4D6TD 2L5GB 3CX5I 1N73C 2M5AB 3PTZA 1XTCC 5KTBA 1LTBC 2QJYC 5AVTB 3ABVC 4PD4D 1JMMA 2E74C 3A3YB 2WQYC 3KQGA 1M1JC 2K9YA 3HUSC 3P8CD 3AE1C 1SFCA 1IFPA 3V2NA 2QM8A 3BCCD 2C9LY 3H1HD 4IOIH 3VMZA 2N9BA 2WPRA 3Q3DA 2RH0A 1PGJA 3OW2O 1BCCD 2JKVA 1BDCA 1VL2A 1WRGA 3T97A 5KLIB 5AW7B 2IBZE 2K1AA 4BRYB 2B87B 2CPBA 1RQUA 4DJGA 3HD7D 3M9BA 3USSA 3KPEA 2WSCJ 1VQ9P 5TJHA 1H8AA 1LTJC 1NAFA 1USEA 3VYIA 2D2CB 3CCJP 1VDFA 3L70G 1SQPK 2XKMA 1FOSF
chains in the Genus database with same CATH topology
2WSCH 2E43A 4I6MC 2ZFCA 1GU4A 1EQ7A 2HYNA 3M06A 3B5NA 1FZCA 1KILB 3LIDA 1H88A 1LWUA 1JO5A 1SQBK 1SLQA 1HWTC 1MZ9A 3U1AA 5APYA 1S9KE 3I5CA 5APVA 1T8ZA 3MUDA 1LTJB 2OYIC 1Z56A 4XA4A 3H32A 1LTIC 2YKQA 1CI6A 5APQA 2OARA 1IFNA 2Z5HA 3V4WA 1AQ5A 2N1TA 1NU1K 1HGVA 4W80A 1GK6A 3H6PA 3HTKB 4JYBA 4ZKUA 1LTSC 3EQ2A 1W2EA 1IFDA 1OWAA 1SP4A 2GM4A 2OYIB 3P32A 1IC2A 1NKNA 2FFDC 1YTZI 5AW0B 3MIWA 4LLHA 2C9NY 3NMDA 2WSFH 4N3YB 5AVZB 2C0XA 2WT7B 1N7LA 3RK3D 3V5BA 2NPSA 3V2PA 3VMYA 2W6AA 2R5DA 4HH2A 1NTMK 5AVQB 3G3ZA 4WB4A 1N86A 4WY4C 2W6BA 5AW6B 3N7NA 2JEEA 1QL2A 5AVVB 1QL1A 1N73A 1GK4A 1RE4C 1SFCD 2Q3IA 2A45G 2Q7CA 2XZRA 1RF1C 3HE5A 2FFDB 1IJDB 5CCGC 3L37A 2R5BA 3U59A 1M7LA 3N4XA 3A5TA 2VRSA 3HD7C 4WY4D 1KFNA 4GIFA 2O1KA 3CLQA 3L4FA 1NOHA 4C46A 3VMXA 5KJ7D 2FYUK 4I2LC 1L4AA 4IFFA 4WY4B 4Y99C 1JTHA 3TK1A 3U1CA 1L0NK 5CCGD 4M3LA 1URQC 1N7SA 4AQRD 4B86A 3BATA 4N78E 1RE3C 5CHXA 1RF1B 4JF7A 1ZR4A 4AUWA 2HG5D 2Z4EA 3TNUA 3WMM0 3GHGC 3SWYA 4C7NB 4AYCA 3B5NC 1NO4A 4JYCA 5AW4B 3MD0A 5APWA 1GL2A 3HD7B 5APSA 1URQD 2IPPA 5CCHD 1ZN5A 2O1JA 1RF0C 4EOTA 5AW3B 4Y99B 5CJ0A 1JY3N 2YKOA 4EIJA 1URQB 2IFNA 2HODB 1KILA 3B5ND 3A7OA 4O9BA 1SQVK 3M0DC 1FDMA 3GHGB 1JCDA 1LTJA 1IFJA 3B5NB 1XTGB 2KP8A 1MV8A 2WWWA 1GW4A 3OA7A 2HPCA 4WBAA 3II6A 1T2KD 3BRVB 1CSBA 3V4QA 2WZ7A 1H89A 3P7KA 1LGHB 2MJZA 1FJKA 4GKGA 2P67A 3HTKA 2J59M 2WPQA 3H32B 1JUNA 2WTYA 3RK3C 1FU1A 4W7ZA 2HFED 2W27A 1HTLC 1LTGC 3P8CE 1FZFA 1JCCA 2NPSC 1MUUA 1G2CA 3A2AA 1A02F 2OYIA 1DH3A 1KFMA 1LTAC 3RL0C 1SFCC 2IFMA 3BVHA 4LC1A 5CMZA 1S9KD 3VOPA 1NTKK 1X9VA 2H43A 3CL3D 2BASA 2WSEH 1ZV8A 1J2JB 2WT7A 4LGDE 4DOJA 2YO3A 3IR9A 1FJPA 3M9HA 1JY3P 1E5WA 3M0AA 1FZBA 2NPSD 3RK3B 3P8MC 5AW9B 2POHA 3EFGA 1KZUB 3B8EB 3RL0D 3C9IA 1FZAA 2M3BA 4ZKPA 5KJ7C 1HJBA 1WT6A 1GZLA 2NPSB 2WITA 3NFQA 2JJLA 1IFIA 3SWFA 1NWQA 2P2UA 2FFDA 3RL0B 1SFCB 3L36A 1GDTA 1L4AC 2I1KA 2YKPA 5APTA 2GUSA 1FZGA 1ZR2A 1J1DC 1N73B 1N7SC 3RK2C 1MFZA 2GUVA 1M1JA 3TSIA 2HLOA 2KOGA 1IFMA 1JY2N 2XV5A 3HE5B 3HUSA 3OJAB 5APXA 2A45I 5AW5B 4IFMA 3OAKA 1GW3A 1LT9A 1NTZK 1GD2E 5CCHC 2XNXA 1GL2C 1L4AD 1N2DC 3R2PA 4OH8B 1N7SD 1RF1A 2YNYA 1LTTC 2IX7C 3RK2D 1IO4A 1GTWA 1CW5A 2KLVA 3BRTB 4C7RA 1L4AB 3O8ZA 1FZCC 1JTHB 3V2RA 1LWUC 1J1DB 2M8RA 1N7SB 3RK2B 3HD7A 2OYHA 2J58A 4RESB 2KSJA 1GL2D 3HE4B 4KHXA 2Q5UA 1FZEA 1FBMA 3TNUB 1HBWA 4XE5B 1T2KC 2H7HA 1URQA 1GL2B 1G1IA 2N1TC 2HODA 1RY3A 2P7JA 2FKWB 1HVVA 1JY3O 1KILD 3E1IA 3LIEA 4N6JA 1KQLA 2FYZA 1FZCB 1SQXK 3GHGA 4N78D 1LWUB 5AVRB 1T3UA 2WPSA 2Z5IA 4IFDK 5APUA 1JY2P 2N1TD 4HYTB 5AVYB 1PFIA 1FOSE 5AW8B 3PP5A 2KB7P 1RF0A 1HUCA 1NHLA 2R32A 3TYYA 2ZXEB 1CI6B 1GU5A 1NH4A 1YYCA 2CPSA 2YO2A 2N1TB 3VTPC 2HPCB 2C0WA 2E42A 3BASA 3L35A 2R3CA 2XDJA 5AVXB 2PP6A 3HRNA 1X8YA 1JNMA 3M0DA 2L5GB 2FXMA 1A02J 3VP9A 3VP8A 3UIAA 1G1JA 1N73C 3M9QA 2I1JA 1XTCC 1G2CB 2YMYA 4I1LA 3CI9A 5KTBA 4GT1A 5AVUB 1LTBC 5AVTB 3KDPB 1AFOA 1SVFA 1JMMA 3M91A 5BU8B 3A3YB 1HH0A 3KQGA 3MGNA 1T3JA 1FAVA 1M1JC 5CJ4A 2LKMA 3LW5H 2PAJA 3HUSC 3P8CD 1SFCA 3V2NA 3NXSA 1LT9C 2XU6A 2QM8A 3KYQA 1DX7A 1L0LK 2P1JA 3VN0A 1J1EC 5BU5A 2C9LY 1HGZA 1X79B 1CZQA 5AW1B 3V2QA 3VMZA 2N9BA 1JOCA 1ZLLA 1OXZA 5KLVK 2WPRA 4WY4A 5BVZA 1JY2O 1RE4A 5KJ7A 2O01H 2OYHC 1M1JB 2A45H 3MTUE 4W7YA 1DEBA 1IK9A 5CCGA 4DZOA 1WRGA 3HUSB 5AVWB 3T97A 3IFMA 5AW2B 4C7NA 1LT9B 1YTZT 1KILC 3NTNA 1J1EB 5AW7B 5AVSB 2H8PD 2QM7A 2CPBA 3HD7D 3M9BA 3HE4A 2KYVA 3KPEA 1H8AA 1LTJC 1NAFA 1SQQK 3VYIA 1VDFA 5CCHA 1NKZB 1SQPK 2Q9IA 2XKMA 1FOSF 2OYHB 1VPCA 1RE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJ7 D;  3RK3 B;  1L4A A;  4WY4 B;  1JTH A;  3RL0 D;  5CCG D;  2XDJ A;  1URQ C;  2PP6 A;  5KJ7 C;  3B5N A;  1N7S A;  2NPS B;  1KIL B;  4N78 E;  4JF7 A;  3RL0 B;  1SFC B;  2HG5 D;  1L4A C;  3B5N C;  1N7S C;  3RK2 C;  3HD7 B;  1GL2 A;  2YMY A;  3TSI A;  2KOG A;  1URQ D;  2N1T A;  5CCH D;  4W80 A;  5CCH C;  1URQ B;  1T3J A;  1GL2 C;  1L4A D;  3HTK B;  1KIL A;  3B5N D;  4OH8 B;  1N7S D;  3RK2 D;  1SFC A;  3KYQ A;  1L4A B;  1JTH B;  3M0D C;  2M8R A;  1XTG B;  3B5N B;  1N7S B;  3RK2 B;  3HD7 A;  1GL2 D;  4WY4 A;  2WZ7 A;  3RK3 D;  2NPS A;  1URQ A;  5KJ7 A;  1GL2 B;  2N1T C;  4W7Y A;  3RK3 C;  4W7Z A;  5CCG A;  2HFE D;  1HVV A;  4WY4 C;  1KIL D;  3P8C E;  2NPS C;  1SFC D;  1KIL C;  3RL0 C;  2H8P D;  1SFC C;  5CCG C;  3HD7 D;  3VOP A;  2N1T D;  3PP5 A;  1NHL A;  3HD7 C;  4LGD E;  4WY4 D;  5CCH A;  2N1T B;  2NPS D; 
#chains in the Genus database with same CATH topology
 2WSC H;  4PD4 I;  1GU4 A;  2HYN A;  3B5N A;  2K9J B;  3AEB C;  3H1K G;  1KIL B;  4OGQ C;  3H1K J;  1LNQ A;  3U1A A;  2B88 A;  3A0H H;  1S9K E;  1LP1 B;  3IAO A;  1LTI C;  3AE7 C;  1NJI Q;  2Z5H A;  1NU1 K;  1R5S A;  3IN6 A;  1AV1 A;  2CK3 H;  3H6P A;  3L72 G;  3L72 J;  3A0H E;  3WUV A;  3E1R A;  4HB1 A;  2QVA A;  1BE3 G;  1SQX D;  1LTS C;  3H1K E;  2J5U A;  1BE3 J;  4PV1 D;  3EQ2 A;  1W2E A;  1OWA A;  2GM4 A;  1IC2 A;  2WSE J;  2Y9Z A;  1PL5 A;  3K5B A;  2KXP B;  3S9O A;  3CPW O;  3L73 D;  4LLH A;  4N3Y B;  1EDI A;  3CCL P;  2WSS H;  2E76 B;  3TGU G;  3TGU J;  2UWJ E;  1NTZ J;  2WMM A;  5AVQ B;  3L72 E;  1N86 A;  1EC5 A;  2NRG A;  3L71 D;  5AW6 B;  2OYO A;  1KYO H;  2JEE A;  3WU2 H;  1U57 A;  1BE3 E;  2Q3I A;  2IZ0 A;  3HE5 A;  2FFD B;  1IJD B;  2FXO A;  3A5T A;  1U7M A;  2VRS A;  2E5Y A;  1EZV D;  1KYO E;  3WU2 E;  1OZH A;  3S4R A;  1NOH A;  3TGU E;  4H44 C;  5KJ7 D;  1NTZ E;  1OVU A;  1KQG B;  1L4A A;  3CC7 P;  4IFF A;  4Y99 C;  3TK1 A;  4M3L A;  1BSH A;  1FDI A;  4I7Z C;  3SSU A;  4B86 A;  1USD A;  1ZR4 A;  2HG5 D;  3TNU A;  3CCV P;  3GHG C;  3SWY A;  4WVZ A;  3SFD C;  4AYC A;  1AVO A;  4C7N B;  3B5N C;  1NO4 A;  1GL2 A;  5APS A;  3GG2 A;  3RBX A;  3D71 A;  1ZRT D;  1NGM B;  2E75 D;  3H1L G;  2HOD B;  2Y0E A;  2KK7 A;  1DD4 A;  3CCM P;  1OX3 A;  1KD1 Q;  1SQV K;  1Q2N A;  1IFJ A;  1XTG B;  1S1C X;  2KP8 A;  1SQQ D;  1LJ2 A;  3OA7 A;  4WBA A;  3H1J J;  3BRV B;  5TIS H;  1FJK A;  4GKG A;  3W67 A;  2J59 M;  3R4Y A;  2WTY A;  3RL0 g;  2B89 A;  4RKU J;  4W7Z A;  3AED C;  2BEQ D;  1KTM A;  2M5A A;  1VF5 B;  3A2A A;  1KFM A;  4GOE A;  1PIX A;  4WWI A;  4LC1 A;  5CMZ A;  1S9K D;  3VOP A;  1NTK K;  3CL3 D;  3H1J E;  4Z1M H;  2ZT9 B;  1Y8A A;  1YQ4 C;  1S5L X;  3H1I G;  4DCK A;  3L70 D;  3H1I J;  3RK3 B;  4RO0 A;  1KZU B;  3B8E B;  3RL0 D;  1FZA A;  2M3B A;  3NFQ A;  2JJL A;  1IFI A;  2BCC J;  3H1K D;  2H89 C;  3RL0 B;  1SFC B;  1L4A C;  2I1K A;  3D6Z A;  5APT A;  3F89 A;  3RK2 C;  1MFZ A;  2KOG A;  1SQP G;  2O01 J;  3OJA B;  5APX A;  5AW5 B;  4PJ0 H;  4IFM A;  3OAK A;  1FDO A;  2O01 N;  3H1I E;  3CXH H;  1GD2 E;  1GL2 C;  1N2D C;  1T6A A;  3R2P A;  2V7Q J;  2KLV A;  2BCC E;  1BGY D;  2FXP A;  4OWF A;  1JTH B;  1RH5 B;  5GTI E;  2YIU B;  2M8R A;  4PJ0 E;  3HD7 A;  3CXH E;  2J58 A;  2KSJ A;  2Q5U A;  3D70 A;  1NU1 G;  2K9J A;  1NU1 J;  2FYU D;  4XE5 B;  1T2K C;  1KYO D;  2H7H A;  1URQ A;  1YIJ P;  3SWK A;  1G1I A;  2N1T C;  3TGU D;  1RY3 A;  3E7K A;  1K9M Q;  2FYN B;  3CCS P;  1S3J A;  1T3U A;  5C39 A;  4IFD K;  1JY2 P;  1FOS E;  1OVV A;  3PP5 A;  1OVR A;  1RF0 A;  1HUC A;  2ZXE B;  1GU5 A;  1NH4 A;  3FGA D;  2K3R A;  2YO2 A;  3VTP C;  1VQN P;  4OVN F;  2C0W A;  1OW7 A;  2XDJ A;  1YJN P;  4H13 B;  5KLV G;  2WSF J;  3FWN A;  1OW6 A;  2YMY A;  3CI9 A;  4GT1 A;  2IZ1 A;  5DJT B;  3KDP B;  3LW5 J;  1AFO A;  1M57 D;  1SVF A;  1P84 H;  3JCU E;  1HH0 A;  1KYO I;  3MGN A;  4CPG A;  2LXC B;  1JEK A;  3H1L D;  3LW5 H;  2HR3 A;  3AEC C;  2XU6 A;  1L0L K;  5KLI C;  2V4H A;  1DEE G;  5K5G B;  1HGZ A;  1P84 E;  2MKV A;  4K3A A;  1ZLL A;  1OXZ A;  3CCE P;  3KXD A;  5BVZ A;  1S4X A;  3W68 A;  2D2C C;  1RE4 A;  5KJ7 A;  4U7J A;  3I56 P;  3CX5 D;  2A45 H;  3MTU E;  1DEB A;  1IK9 A;  5AVW B;  4C7N A;  3GF3 A;  1KIL C;  1SQV G;  1SQV J;  2FY8 A;  4K35 A;  2OYH B;  1VPC A;  3CCR P;  2E43 A;  3H1I D;  1FZC A;  4Y28 J;  3LID A;  1ZXG A;  2BEZ F;  5GTH H;  1SQV E;  1NTK G;  3MUD A;  1NTK J;  3CXH D;  4XA4 A;  2NZ2 A;  1JB0 J;  1IFN A;  1HGV A;  1SQP D;  4GDO A;  2E76 C;  1GK6 A;  5GTH E;  4JYB A;  1KQS O;  3FXE A;  3PLN A;  1IFD A;  3P32 A;  3V6I A;  2FFD C;  1YTZ I;  5AW0 B;  1NTK E;  3MIW A;  3WUU A;  1YI2 P;  3I55 P;  2IYO A;  1IZN B;  5AVZ B;  1N7L A;  1NU1 D;  1VQ6 P;  2W6A A;  1NTM K;  2IBZ G;  1UIX A;  2W6B A;  1QVG O;  2OTJ P;  2ZVO B;  3Q5P A;  1RE4 C;  2ZYG A;  3L37 A;  3U59 A;  2JR8 A;  1TU3 F;  3CXH I;  4WY4 D;  3MP7 B;  4I2L C;  1PP9 G;  4WY4 B;  1JTH A;  1UII A;  2JWA A;  3U1C A;  1DIP A;  1PP9 J;  2QJP B;  3BAT A;  1Q81 Q;  4JBZ A;  4ZMD A;  3JC2 2;  2M0B A;  1VQ4 P;  5KLV D;  3HD7 B;  1QGK B;  1URQ D;  3AEA C;  5CCH D;  4EOT A;  3MUD C;  2YKO A;  1URQ B;  2IYP A;  1PP9 E;  2GA1 A;  2ZYD A;  3FXD A;  2RN0 A;  3A7O A;  1PPJ D;  1VF5 C;  1FDM A;  1JCD A;  1KB9 E;  3II6 A;  2WZ7 A;  2ZT9 C;  1JUN A;  3RK3 C;  1NVO A;  2HFE D;  2W27 A;  4ASW A;  1MUU A;  2OYI A;  1L0L J;  4PV1 B;  1LTA C;  1W5C E;  3RL0 C;  1SFC C;  2IFM A;  2KS1 A;  1VQ5 P;  2JO1 A;  2BAS A;  1NTZ G;  2WSE H;  1P84 I;  1ZV8 A;  1J2J B;  4DOJ A;  2YO3 A;  3IR9 A;  3M9H A;  1JY3 P;  3M0A A;  1S72 P;  2NPS D;  1K8A Q;  2QSI A;  2RKL A;  3FWL A;  2NPS B;  2A06 G;  2OQQ A;  2P2U A;  2L91 A;  1L0L E;  3L36 A;  2Y9Y A;  5B66 H;  2YKP A;  2GUS A;  2YIU C;  3CCU P;  1N73 B;  2ZJS E;  2GUV A;  4NPF X;  3TSI A;  1JY2 N;  2QJK B;  1Y47 A;  2K37 A;  3FX0 A;  2E74 D;  1KV4 A;  1R5L A;  2A45 I;  4L76 A;  1KOR A;  5B66 E;  3PJS K;  1RF1 A;  4KT0 J;  1CW5 A;  3ZDM A;  1GTW A;  2FYN C;  4C7R A;  2A06 E;  1H0T B;  1J1D B;  3G6E P;  2Q6Q A;  2OYH A;  3AE2 C;  4RES B;  1U7J A;  3AEG C;  3CME P;  2E75 B;  3RBZ A;  1EXI A;  1R8E A;  1E79 H;  3C1L A;  1KQL A;  2IBZ D;  1FZC B;  3B4S A;  4R4M A;  3H1J G;  1M1K Q;  1SQX K;  1QEX A;  1OFC X;  2Z5I A;  4H13 C;  5APU A;  4BWN A;  1Q7Y Q;  4HYT B;  1VQP P;  3AEE C;  5AW8 B;  2QIW A;  5L8R J;  2KB7 P;  2DW3 A;  2KI7 B;  2HPC B;  1NTM G;  1NTM J;  4OGQ D;  3L75 G;  3HRN A;  3L75 J;  1LT1 A;  1JNM A;  3M0D A;  1AJY A;  3VP8 A;  3UIA A;  1G1J A;  1YJW P;  4KJM A;  2AEJ A;  2K88 A;  4I1L A;  1L2P A;  3M91 A;  2KNC A;  2BCC G;  1NTM E;  1FAV A;  4U3F J;  2LKM A;  3L75 E;  3GF7 A;  3NXS A;  3KYQ A;  2IBZ I;  3VN0 A;  1X79 B;  5AW1 B;  5GTI H;  4WY4 A;  3G71 P;  2Q1K A;  1JY2 O;  2W8Z A;  3L72 D;  2O01 H;  2OYH C;  2Y0D A;  2KIK A;  4U3F E;  3QH9 A;  3IFM A;  1BE3 D;  4D6T G;  1LT9 B;  2V7Q H;  4D6T J;  3NTN A;  1J1E B;  3F5H A;  1NAY A;  3HE4 A;  2KYV A;  4DT0 A;  2ZAE B;  4MN4 C;  1SQQ K;  1KB9 I;  2W83 C;  4H44 D;  5CCH A;  1NKZ B;  2Q9I A;  1NTZ D;  1X22 A;  1RE3 A;  4EI2 A;  1WMK A;  4I6M C;  1EDJ A;  3M06 A;  1LWU A;  3EFF K;  1SQB K;  1JO5 A;  4D6T E;  1W2B O;  1MZ9 A;  2A06 D;  3BCC G;  5APY A;  3BCC J;  4QMA A;  3H1H G;  2WPV B;  1PV3 A;  2YKQ A;  4R4L A;  5APQ A;  3H1H J;  3SFE C;  3PH0 A;  3V4W A;  1AQ5 A;  4NPD A;  2AEF A;  4BXL A;  4W80 A;  2YXR B;  3JCU H;  4ZKU A;  1RHZ B;  1Q86 Q;  3EWK A;  2KLU A;  1KMI Z;  4EDF A;  2OYI B;  2QEX P;  1NKN A;  3BCC E;  2KS1 B;  3NMD A;  2WSF H;  3H1H E;  1FC2 C;  3GW6 A;  1ZP0 C;  2NPS A;  3V2P A;  3VMY A;  3PRJ A;  2R5D A;  4WB4 A;  2AXC A;  4WY4 C;  3N7N A;  1YIT P;  5AVV B;  1QL1 A;  4UB8 E;  2QJP C;  1N73 A;  5KAI H;  2A45 G;  5H2F E;  3H1J D;  4XFJ A;  2R5B A;  2ZVN B;  2QRX A;  1M7L A;  3N4X A;  3HD7 C;  1Q82 Q;  4GIF A;  3AE3 C;  3CLQ A;  3L4F A;  5EFW B;  5KAI E;  4C46 A;  1SS1 A;  2FYU K;  1KIL E;  1L0N K;  5CCG D;  1H0T A;  1URQ C;  1YBK A;  3Q5R A;  4AQR D;  3L75 D;  2M3E A;  4YTP C;  1X0T A;  1RE3 C;  1RF1 B;  4L73 A;  4JF7 A;  1SQX J;  1OW8 A;  4H0L D;  2Z4E A;  3WMM 0;  1M56 D;  2JDI H;  4JYC A;  5AW4 B;  3Q1M A;  3MD0 A;  5APW A;  3CWB G;  1OMI A;  3CWB J;  4H0L B;  2IPP A;  1ZN5 A;  1DD3 A;  1RF0 C;  2OGU A;  5AW3 B;  5CJ0 A;  1JY3 N;  4EIJ A;  2IFN A;  3AE8 C;  2BCC D;  3C8V A;  3L71 G;  3L71 J;  2E5T A;  1SQX E;  3A0B H;  4YPC A;  1LTJ A;  4PV1 C;  2WWW A;  2HPC A;  5KKZ B;  1EDL A;  1T2K D;  1CSB A;  3CWB E;  3V4Q A;  1EZV G;  1H89 A;  3P7K A;  4A7P A;  3HTK A;  3H32 B;  4L75 A;  3A0B E;  1HTL C;  3MHV A;  1JCC A;  1HF9 A;  3CD6 P;  3L71 E;  2NPS C;  1DH3 A;  3BVH A;  1X9V A;  3ITK A;  2H43 A;  5M1B A;  2WT7 A;  4LGD E;  1FJP A;  2QJK C;  1EZV E;  2YMK A;  2SPZ A;  1KQF B;  3O6Q B;  3P8M C;  5AW9 B;  2POH A;  3EFG A;  2QG4 A;  2KNC B;  3C9I A;  4ZKP A;  5KJ7 C;  3MZW B;  2OTK E;  1Y9B A;  1NWQ A;  3GLM A;  1VQM P;  1FZG A;  1ZR2 A;  1J1D C;  1QX8 A;  1MKM A;  1SQQ G;  4NPE A;  1IFM A;  1SQQ J;  3G4S P;  1BDD A;  1GW3 A;  1LT9 A;  2LXB A;  1K04 A;  2P10 A;  1ZRT E;  1VQO P;  2E75 C;  4OH8 B;  1N7S D;  1IO4 A;  1SQB G;  1LTT C;  2IX7 C;  1SQB J;  1P84 D;  3O8Z A;  1FZC C;  1Q90 D;  1N7S B;  2KZI A;  2D2C D;  1S2E A;  4TLF A;  4IL6 H;  3HE4 B;  1IK7 A;  3IF4 A;  4KHX A;  1SQQ E;  1KB9 H;  3VMA A;  1FBM A;  3WUT A;  2W90 A;  4HJG H;  2P7J A;  3L70 J;  1HVV A;  1KIL D;  1JY3 O;  4N6J A;  4IL6 E;  1SQB E;  3GHG A;  1NYH A;  1LWU B;  2O3J A;  2WPS A;  3AE5 C;  3KZI H;  1KC8 Q;  5AVY B;  3TYY A;  3RK3 E;  1YJ9 P;  1VQL P;  2QE7 H;  3BAS A;  2R3C A;  3L70 E;  2R3S A;  1L0L G;  2PP6 A;  3KZI E;  1X8Y A;  2FXM A;  2N9Y B;  1PZQ A;  1SQV D;  1A02 J;  1BGY G;  3VP9 A;  1K73 Q;  1BGY J;  3M9Q A;  2I1J A;  1G2C B;  5AVU B;  3L74 G;  2E76 D;  2PFX A;  3CWB D;  3L74 J;  1HJ0 A;  1ZME C;  1FE6 A;  2FYU G;  5BU8 B;  2P58 A;  2FYU J;  1L0N G;  1T3J A;  2RMZ A;  4JPZ B;  5CJ4 A;  1L0N J;  1GMJ A;  2PAJ A;  3AE9 C;  1LT9 C;  1DX7 A;  2P1J A;  3CC4 P;  5BU5 A;  1J1E C;  2R44 A;  1NTK D;  1BGY E;  1CZQ A;  3AEF C;  3V2Q A;  3G9R A;  1JOC A;  2QJY B;  5KLV K;  3L74 E;  2E74 B;  2FYU E;  1M1J B;  3D6Y A;  4W7Y A;  5CCG A;  4DZO A;  3HUS B;  1L0N E;  5AW2 B;  1AQT A;  1YTZ T;  1ZOY C;  2JP3 A;  1MFT A;  5AVS B;  2H8P D;  2QM7 A;  3GMA A;  2PGD A;  2LR2 A;  2ZFC A;  5DJU B;  2H88 C;  1EQ7 A;  1H88 A;  4GOD A;  1SLQ A;  1HWT C;  2KSE A;  3H1L J;  1AVY A;  5E79 H;  3I5C A;  5APV A;  1T8Z A;  1LTJ B;  2OYI C;  1Z56 A;  3H32 A;  1CI6 A;  2OAR A;  3QWO C;  2N1T A;  3RGU A;  1PGQ A;  4HKZ H;  1PP9 D;  1EZV I;  3HTK B;  5E79 E;  3PHL A;  4OGQ B;  1D7M A;  1VF5 D;  2G8Y A;  1ZW0 A;  3JSV C;  1PGO A;  3H1L E;  1SQB D;  1KB9 D;  3AE4 C;  1SP4 A;  2YXQ B;  3CX5 H;  1YHQ P;  5TIS E;  2ZT9 D;  2C9N Y;  3O6Q A;  1AA0 A;  4U3F G;  2C0X A;  2WT7 B;  3RK3 D;  3V5B A;  2XND H;  4HH2 A;  3G3Z A;  1JMB A;  3CX5 E;  1QL2 A;  1GK4 A;  1SFC D;  2Q7C A;  3TDK A;  4ASV A;  2XZR A;  1RF1 C;  2W6J H;  5CCG C;  3KHU A;  2ITA A;  1PGP A;  1VQK P;  1N8R Q;  1KFN A;  4L74 A;  2O1K A;  4H0L C;  1YQ3 C;  3VMX A;  2QA4 P;  2I8D A;  1SQP J;  1JM0 A;  1N7S A;  1L0L D;  4N78 E;  5CHX A;  2ZYA A;  4BRY A;  2B87 A;  4AUW A;  4UB6 H;  3T97 B;  1KN7 A;  2KZJ A;  3CC2 P;  4TT3 H;  3TF5 A;  5KKZ C;  2WVR A;  4H44 B;  3L74 D;  2O1J A;  4GOF A;  2Y0C A;  4Y99 B;  4UB6 E;  1SQP E;  2AXT H;  1KIL A;  4I7Z B;  3B5N D;  4PD4 H;  1L0N D;  1M8O B;  4O9B A;  1OIP A;  1LP1 A;  5KAF H;  3M0D C;  3GHG B;  3B5N B;  1MV8 A;  1GW4 A;  2AXT E;  2G3A A;  1BCC G;  4PD4 E;  1LGH B;  2MJZ A;  2P67 A;  1BCC J;  2WPQ A;  1NU1 E;  1FU1 A;  5KAF E;  1VQ8 P;  5CBN A;  1BSN A;  1LTG C;  2PRR A;  3P8C E;  1FZF A;  3CMA P;  4H13 D;  1G2C A;  1A02 F;  1EDK A;  4UB8 H;  4EYY Q;  2KUB A;  5H2F H;  4ZNC A;  1EXJ A;  5KLV J;  5CBO A;  1E5W A;  1FZB A;  1BCC E;  3S1K A;  2OTL P;  1HJB A;  1WT6 A;  1GZL A;  2WIT A;  4JQ0 D;  3Q2Y A;  3SWF A;  3Q5S A;  1PPJ G;  2FFD A;  1GDT A;  2AEM A;  1RQV A;  1N7S C;  1S5L H;  5B5E H;  1M1J A;  2HLO A;  5KLV E;  3H25 A;  2XV5 A;  3HE5 B;  3HUS A;  4IL6 X;  1NTM D;  1NTZ K;  5CCH C;  2XNX A;  1L4A D;  1SQX G;  1FS0 E;  2YNY A;  1S5L E;  3RK2 D;  3CCQ P;  1QVF O;  5B5E E;  3BRT B;  1L4A B;  1M90 Q;  1PPJ E;  3V2R A;  3L73 G;  1LWU C;  3B71 A;  3RK2 B;  3L73 J;  1GL2 D;  2ZXX A;  4YXD C;  1FZE A;  3TNU B;  4YXW H;  1HBW A;  2JWD A;  4U3F D;  1GL2 B;  2HOD A;  2FKW B;  3E1I A;  3LIE A;  1VQ7 P;  2Q3E A;  2FYZ A;  4N78 D;  1QLE D;  5AVR B;  2IDB A;  3L73 E;  4RJT A;  3AE6 C;  2N1T D;  2FBW C;  1PFI A;  2R32 A;  1NHL A;  1CI6 B;  1YYC A;  1K05 A;  2CPS A;  2N1T B;  2E42 A;  3L35 A;  5AVX B;  2B9B A;  4D6T D;  2L5G B;  3CX5 I;  1N73 C;  2M5A B;  3PTZ A;  1XTC C;  5KTB A;  1LTB C;  2QJY C;  5AVT B;  3ABV C;  4PD4 D;  1JMM A;  2E74 C;  3A3Y B;  2WQY C;  3KQG A;  1M1J C;  2K9Y A;  3HUS C;  3P8C D;  3AE1 C;  1SFC A;  1IFP A;  3V2N A;  2QM8 A;  3BCC D;  2C9L Y;  3H1H D;  4IOI H;  3VMZ A;  2N9B A;  2WPR A;  3Q3D A;  2RH0 A;  1PGJ A;  3OW2 O;  1BCC D;  2JKV A;  1BDC A;  1VL2 A;  1WRG A;  3T97 A;  5KLI B;  5AW7 B;  2IBZ E;  2K1A A;  4BRY B;  2B87 B;  2CPB A;  1RQU A;  4DJG A;  3HD7 D;  3M9B A;  3USS A;  3KPE A;  2WSC J;  1VQ9 P;  5TJH A;  1H8A A;  1LTJ C;  1NAF A;  1USE A;  3VYI A;  2D2C B;  3CCJ P;  1VDF A;  3L70 G;  1SQP K;  2XKM A;  1FOS F; 
#chains in the Genus database with same CATH homology
 2WSC H;  2E43 A;  4I6M C;  2ZFC A;  1GU4 A;  1EQ7 A;  2HYN A;  3M06 A;  3B5N A;  1FZC A;  1KIL B;  3LID A;  1H88 A;  1LWU A;  1JO5 A;  1SQB K;  1SLQ A;  1HWT C;  1MZ9 A;  3U1A A;  5APY A;  1S9K E;  3I5C A;  5APV A;  1T8Z A;  3MUD A;  1LTJ B;  2OYI C;  1Z56 A;  4XA4 A;  3H32 A;  1LTI C;  2YKQ A;  1CI6 A;  5APQ A;  2OAR A;  1IFN A;  2Z5H A;  3V4W A;  1AQ5 A;  2N1T A;  1NU1 K;  1HGV A;  4W80 A;  1GK6 A;  3H6P A;  3HTK B;  4JYB A;  4ZKU A;  1LTS C;  3EQ2 A;  1W2E A;  1IFD A;  1OWA A;  1SP4 A;  2GM4 A;  2OYI B;  3P32 A;  1IC2 A;  1NKN A;  2FFD C;  1YTZ I;  5AW0 B;  3MIW A;  4LLH A;  2C9N Y;  3NMD A;  2WSF H;  4N3Y B;  5AVZ B;  2C0X A;  2WT7 B;  1N7L A;  3RK3 D;  3V5B A;  2NPS A;  3V2P A;  3VMY A;  2W6A A;  2R5D A;  4HH2 A;  1NTM K;  5AVQ B;  3G3Z A;  4WB4 A;  1N86 A;  4WY4 C;  2W6B A;  5AW6 B;  3N7N A;  2JEE A;  1QL2 A;  5AVV B;  1QL1 A;  1N73 A;  1GK4 A;  1RE4 C;  1SFC D;  2Q3I A;  2A45 G;  2Q7C A;  2XZR A;  1RF1 C;  3HE5 A;  2FFD B;  1IJD B;  5CCG C;  3L37 A;  2R5B A;  3U59 A;  1M7L A;  3N4X A;  3A5T A;  2VRS A;  3HD7 C;  4WY4 D;  1KFN A;  4GIF A;  2O1K A;  3CLQ A;  3L4F A;  1NOH A;  4C46 A;  3VMX A;  5KJ7 D;  2FYU K;  4I2L C;  1L4A A;  4IFF A;  4WY4 B;  4Y99 C;  1JTH A;  3TK1 A;  3U1C A;  1L0N K;  5CCG D;  4M3L A;  1URQ C;  1N7S A;  4AQR D;  4B86 A;  3BAT A;  4N78 E;  1RE3 C;  5CHX A;  1RF1 B;  4JF7 A;  1ZR4 A;  4AUW A;  2HG5 D;  2Z4E A;  3TNU A;  3WMM 0;  3GHG C;  3SWY A;  4C7N B;  4AYC A;  3B5N C;  1NO4 A;  4JYC A;  5AW4 B;  3MD0 A;  5APW A;  1GL2 A;  3HD7 B;  5APS A;  1URQ D;  2IPP A;  5CCH D;  1ZN5 A;  2O1J A;  1RF0 C;  4EOT A;  5AW3 B;  4Y99 B;  5CJ0 A;  1JY3 N;  2YKO A;  4EIJ A;  1URQ B;  2IFN A;  2HOD B;  1KIL A;  3B5N D;  3A7O A;  4O9B A;  1SQV K;  3M0D C;  1FDM A;  3GHG B;  1JCD A;  1LTJ A;  1IFJ A;  3B5N B;  1XTG B;  2KP8 A;  1MV8 A;  2WWW A;  1GW4 A;  3OA7 A;  2HPC A;  4WBA A;  3II6 A;  1T2K D;  3BRV B;  1CSB A;  3V4Q A;  2WZ7 A;  1H89 A;  3P7K A;  1LGH B;  2MJZ A;  1FJK A;  4GKG A;  2P67 A;  3HTK A;  2J59 M;  2WPQ A;  3H32 B;  1JUN A;  2WTY A;  3RK3 C;  1FU1 A;  4W7Z A;  2HFE D;  2W27 A;  1HTL C;  1LTG C;  3P8C E;  1FZF A;  1JCC A;  2NPS C;  1MUU A;  1G2C A;  3A2A A;  1A02 F;  2OYI A;  1DH3 A;  1KFM A;  1LTA C;  3RL0 C;  1SFC C;  2IFM A;  3BVH A;  4LC1 A;  5CMZ A;  1S9K D;  3VOP A;  1NTK K;  1X9V A;  2H43 A;  3CL3 D;  2BAS A;  2WSE H;  1ZV8 A;  1J2J B;  2WT7 A;  4LGD E;  4DOJ A;  2YO3 A;  3IR9 A;  1FJP A;  3M9H A;  1JY3 P;  1E5W A;  3M0A A;  1FZB A;  2NPS D;  3RK3 B;  3P8M C;  5AW9 B;  2POH A;  3EFG A;  1KZU B;  3B8E B;  3RL0 D;  3C9I A;  1FZA A;  2M3B A;  4ZKP A;  5KJ7 C;  1HJB A;  1WT6 A;  1GZL A;  2NPS B;  2WIT A;  3NFQ A;  2JJL A;  1IFI A;  3SWF A;  1NWQ A;  2P2U A;  2FFD A;  3RL0 B;  1SFC B;  3L36 A;  1GDT A;  1L4A C;  2I1K A;  2YKP A;  5APT A;  2GUS A;  1FZG A;  1ZR2 A;  1J1D C;  1N73 B;  1N7S C;  3RK2 C;  1MFZ A;  2GUV A;  1M1J A;  3TSI A;  2HLO A;  2KOG A;  1IFM A;  1JY2 N;  2XV5 A;  3HE5 B;  3HUS A;  3OJA B;  5APX A;  2A45 I;  5AW5 B;  4IFM A;  3OAK A;  1GW3 A;  1LT9 A;  1NTZ K;  1GD2 E;  5CCH C;  2XNX A;  1GL2 C;  1L4A D;  1N2D C;  3R2P A;  4OH8 B;  1N7S D;  1RF1 A;  2YNY A;  1LTT C;  2IX7 C;  3RK2 D;  1IO4 A;  1GTW A;  1CW5 A;  2KLV A;  3BRT B;  4C7R A;  1L4A B;  3O8Z A;  1FZC C;  1JTH B;  3V2R A;  1LWU C;  1J1D B;  2M8R A;  1N7S B;  3RK2 B;  3HD7 A;  2OYH A;  2J58 A;  4RES B;  2KSJ A;  1GL2 D;  3HE4 B;  4KHX A;  2Q5U A;  1FZE A;  1FBM A;  3TNU B;  1HBW A;  4XE5 B;  1T2K C;  2H7H A;  1URQ A;  1GL2 B;  1G1I A;  2N1T C;  2HOD A;  1RY3 A;  2P7J A;  2FKW B;  1HVV A;  1JY3 O;  1KIL D;  3E1I A;  3LIE A;  4N6J A;  1KQL A;  2FYZ A;  1FZC B;  1SQX K;  3GHG A;  4N78 D;  1LWU B;  5AVR B;  1T3U A;  2WPS A;  2Z5I A;  4IFD K;  5APU A;  1JY2 P;  2N1T D;  4HYT B;  5AVY B;  1PFI A;  1FOS E;  5AW8 B;  3PP5 A;  2KB7 P;  1RF0 A;  1HUC A;  1NHL A;  2R32 A;  3TYY A;  2ZXE B;  1CI6 B;  1GU5 A;  1NH4 A;  1YYC A;  2CPS A;  2YO2 A;  2N1T B;  3VTP C;  2HPC B;  2C0W A;  2E42 A;  3BAS A;  3L35 A;  2R3C A;  2XDJ A;  5AVX B;  2PP6 A;  3HRN A;  1X8Y A;  1JNM A;  3M0D A;  2L5G B;  2FXM A;  1A02 J;  3VP9 A;  3VP8 A;  3UIA A;  1G1J A;  1N73 C;  3M9Q A;  2I1J A;  1XTC C;  1G2C B;  2YMY A;  4I1L A;  3CI9 A;  5KTB A;  4GT1 A;  5AVU B;  1LTB C;  5AVT B;  3KDP B;  1AFO A;  1SVF A;  1JMM A;  3M91 A;  5BU8 B;  3A3Y B;  1HH0 A;  3KQG A;  3MGN A;  1T3J A;  1FAV A;  1M1J C;  5CJ4 A;  2LKM A;  3LW5 H;  2PAJ A;  3HUS C;  3P8C D;  1SFC A;  3V2N A;  3NXS A;  1LT9 C;  2XU6 A;  2QM8 A;  3KYQ A;  1DX7 A;  1L0L K;  2P1J A;  3VN0 A;  1J1E C;  5BU5 A;  2C9L Y;  1HGZ A;  1X79 B;  1CZQ A;  5AW1 B;  3V2Q A;  3VMZ A;  2N9B A;  1JOC A;  1ZLL A;  1OXZ A;  5KLV K;  2WPR A;  4WY4 A;  5BVZ A;  1JY2 O;  1RE4 A;  5KJ7 A;  2O01 H;  2OYH C;  1M1J B;  2A45 H;  3MTU E;  4W7Y A;  1DEB A;  1IK9 A;  5CCG A;  4DZO A;  1WRG A;  3HUS B;  5AVW B;  3T97 A;  3IFM A;  5AW2 B;  4C7N A;  1LT9 B;  1YTZ T;  1KIL C;  3NTN A;  1J1E B;  5AW7 B;  5AVS B;  2H8P D;  2QM7 A;  2CPB A;  3HD7 D;  3M9B A;  3HE4 A;  2KYV A;  3KPE A;  1H8A A;  1LTJ C;  1NAF A;  1SQQ K;  3VYI A;  1VDF A;  5CCH A;  1NKZ B;  1SQP K;  2Q9I A;  2XKM A;  1FOS F;  2OYH B;  1VPC A;  1RE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...