4N78E

The wave regulatory complex links diverse receptors to the actin cytoskeleton
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
67
structure length
67
Chain Sequence
DPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Cytoplasmic FMR1-interacting protein 1
publication title The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2013-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4n78E01
1GL2B 3RL0C 1URQB 1L4AA 3RK3B 3KYQA 4OH8B 5KJ7A 1NHLA 3RK2C 4WY4B 1SFCD 2NPSA 1KILD 1N7SD 2N1TD 3RL0D 3M0DC 3RK2D 3HD7C 1SFCB 1JTHA 3B5NA 3TSIA 2WZ7A 2PP6A 1N7SB 2N1TB 2KOGA 3RL0B 1GL2A 1URQA 3RK2B 1L4AC 3HD7D 4WY4A 5KJ7C 4W7YA 5CCHA 4LGDE 2XDJA 2NPSC 5CCGA 1L4AD 3P8CE 1KILB 5KJ7D 3HD7B 1SFCA 1XTGB 5CCGC 2M8RA 1N7SA 1T3JA 2N1TA 2YMYA 2NPSD 3B5NC 2HG5D 1GL2C 3VOPA 1L4AB 1URQC 3RK3C 2H8PD 2N1TC 5CCGD 4WY4C 4W80A 5CCHC 3B5ND 1HVVA 2NPSB 3HTKB 1GL2D 1URQD 3RK3D 1KILA 3HD7A 3PP5A 2HFED 4N78E 4WY4D 5CCHD 1SFCC 1JTHB 3B5NB 4W7ZA 1KILC 4JF7A 1N7SC
chains in the Genus database with same CATH superfamily
1QGKB 3FXDA 3KYQA 5C39A 4WWIA 1M57D 1BGYD 4H13B 1ZR4A 3H1KG 4IFFA 1RF1C 2WWWA 4EOTA 3CWBD 1Q2NA 5AW5B 3L74J 3H1ID 2K88A 1HJ0A 3L73G 2HPCA 1EDLA 3WUUA 2WSSH 1T2KD 2KLVA 3SFDC 2QJYC 4EI2A 3AE8C 2ZYDA 2B87A 2O01H 3AEEC 2BEZF 1WT6A 1H0TA 3H1LE 3AE7C 4OWFA 1KILB 4L75A 3P7KA 1L0LE 3KZIE 1ZMEC 4AYCA 2PRRA 2C9NY 3TYYA 1YQ4C 2RMZA 1H8AA 2JWAA 2QJYB 5DJTB 1ZP0C 1OIPA 1HVVA 3CXHD 2JO1A 1VF5C 4HYTB 3TK1A 5B66H 3WUTA 2WTYA 1NTZK 3A0BE 5H2FE 2C9LY 1FJKA 2CPBA 3GHGC 2Y0DA 3MTUE 5BVZA 4RESB 4IOIH 4DOJA 2UWJE 2NPSA 1AFOA 1N7SD 1VF5B 3PH0A 1SQQG 1DEBA 5CJ4A 2Q3IA 3GMAA 1X8YA 2V4HA 3M0DC 1YYCA 1S3JA 5KKZC 1LTSC 1VQLP 3VP8A 5AW3B 1NU1D 4N3YB 1LT9A 3GHGB 3TDKA 1JCDA 2WSFJ 1KFNA 4L73A 1NGMB 3FX0A 3CX5H 3L71G 1DH3A 2O1KA 1N7LA 1YTZI 3VN0A 2R5BA 2R5DA 3WU2E 1AVOA 1SQBJ 2KIKA 5KKZB 2A06D 5AVVB 4D6TJ 1K73Q 1MZ9A 4DJGA 1BE3D 3NTNA 1OVVA 1NYHA 1SQPE 1QEXA 1CI6A 1EDJA 1J1EC 1SVFA 3R4YA 2R3CA 1FE6A 1RE3C 3H1KD 2W6BA 3A0HE 3HD7A 1ZN5A 1PV3A 1VQ7P 1S9KD 4WY4D 1IFDA 2V7QJ 2KSJA 1X0TA 1NTMD 4EIJA 2JP3A 2CK3H 1KILE 4I6MC 1Q90D 3TGUG 3L73D 1J1EB 1KQLA 4I7ZB 1PP9E 3B8EB 4NPEA 1S2EA 2L5GB 3MP7B 2Q5UA 1EZVD 4N6JA 3CPWO 1SQBE 2B89A 4D6TE 1Q86Q 5APQA 4YPCA 5CBOA 3OA7A 5APYA 2CPSA 2R44A 3LW5J 5APVA 2B9BA 4K3AA 3D71A 3HE4B 1NTZG 1KB9H 5KLVJ 1LTJA 4H44C 4JPZB 1T6AA 2YMYA 1KFMA 1LP1B 3WMM0 1FOSE 4MN4C 1KZUB 2Q1KA 1FDIA 2ZT9C 1PZQA 2FXOA 4UB8E 5AVSB 3WU2H 3L36A 2POHA 2OYHA 3S4RA 2B88A 2ZYAA 3QWOC 2W27A 3P8CD 3PP5A 1PFIA 2HFED 4H44B 2LKMA 2FYUK 1SFCC 1FZCC 4IL6X 5B5EE 2KS1B 3BCCG 1RY3A 5KJ7A 2ZT9B 3V2QA 1HF9A 3EFGA 1KB9I 1DD3A 2K3RA 3K5BA 3A0HH 4QMAA 1FZGA 1VPCA 3H1JG 4EYYQ 1E79H 3CCLP 1AVYA 1SFCB 1FZCB 5E79E 1JTHA 2D2CC 5KLVE 1NU1K 1NKNA 4KJMA 4RO0A 1HGVA 2XNDH 2KNCA 2YMKA 4LLHA 1L4AC 3E7KA 5CCHA 3ZDMA 2E75D 3CCQP 1FZBA 2XDJA 1RQVA 5AVZB 2VRSA 1HTLC 1KV4A 3H1HJ 2AEMA 2E43A 4H0LC 4CPGA 2YIUC 3E1RA 3FWNA 5AW6B 3S9OA 1MKMA 2WQYC 5APSA 3VMAA 1FZEA 1L4AB 1Q7YQ 2N1TC 3O6QB 3H1IG 3RK3E 1CZQA 1M1JA 3FWLA 3OAKA 1OFCX 4GOEA 3H32B 1OW8A 3BASA 3L71J 4H0LB 3RL0g 2E5YA 2YIUB 4ZKPA 2V7QH 5DJUB 1SQVD 2ZAEB 1NTMK 4W7ZA 4N78D 3TNUB 3L75J 2QEXP 4PD4H 1LTBC 4OH8B 2IYPA 1JO5A 2YKOA 1X79B 1S5LH 3S1KA 3AE2C 2N1TD 1SP4A 1K9MQ 1KORA 3BRVB 4AUWA 1NTZD 3H1HE 1VQMP 4BWNA 1KYOD 1URQA 3N7NA 1VQPP 4C7NB 2H43A 3VMZA 3VYIA 4WVZA 1IFMA 3LW5H 4ASWA 2FYUG 1PP9G 5E79H 1YJNP 2G8YA 2E74C 2WPVB 5M1BA 3M0AA 1PPJG 3CC4P 1GL2C 3T97A 1IK9A 2H8PD 3L75E 1FAVA 3W67A 2Z4EA 3B5ND 3U1AA 2XV5A 1K8AQ 2FFDA 1Z56A 4O9BA 1PGOA 2ZVNB 2E74B 3H1JD 3G6EP 1RHZB 1MUUA 1GL2B 4EDFA 4BRYB 5TISH 1HJBA 1IFPA 3HUSC 4JYBA 5KAFE 1N2DC 3D6YA 4XE5B 2WT7A 2Y9ZA 4ASVA 1YITP 1BE3G 1S1CX 2WPRA 2PGDA 5CMZA 4IFDK 2I1KA 1T2KC 2JR8A 1L0NJ 3GF3A 2WZ7A 3Q3DA 5GTHH 2QVAA 1MFZA 2E5TA 3AE6C 4HH2A 5AW7B 3HUSB 1BDDA 1D7MA 2O3JA 2P7JA 2QIWA 3CX5E 1ZRTE 2M0BA 3W68A 1JY2N 1NTMG 5CCGA 3G9RA 3IAOA 5KLIC 3CC2P 1N86A 2IDBA 1AA0A 1OWAA 3MIWA 1SQXJ 1WRGA 4PV1D 1EXJA 2Y9YA 1RF1B 2LR2A 2QSIA 4U3FG 2WSEH 2WPQA 1NTKK 5CCGD 1EZVG 3L72J 1BSHA 1SQPD 3H25A 2HYNA 5AVQB 5KLIB 1KILA 4GDOA 1SQVK 3EQ2A 3Q1MA 4GOFA 1JOCA 1OW6A 4LC1A 1LTIC 1BGYJ 1N7SC 2M5AB 1L0NE 1VQ5P 2P1JA 2OTLP 3M9QA 3KXDA 3ABVC 3CMAP 3A3YB 1KILD 3CWBJ 2P2UA 3RL0D 4A7PA 3H1IJ 2KZIA 2JWDA 2ITAA 2IX7C 2IZ1A 2FYUD 4WBAA 4OVNF 1PP9D 3FXEA 3L74E 2XZRA 3CD6P 1FJPA 1N7SB 1GK4A 2KSEA 3V2PA 1SQXE 2K9JB 4GT1A 5KAFH 1OVUA 2M3EA 1SQBD 3MD0A 1PPJD 5AVYB 1IFNA 1LT9C 1OW7A 3G71P 4XA4A 3U1CA 1IO4A 1G2CB 3L72E 1W5CE 2J5UA 1KB9E 1GMJA 3CCRP 1XTGB 1XTCC 1FS0E 2NPSD 3AE3C 2PFXA 1L0LK 1RF0C 3GHGA 4JBZA 2WITA 3V6IA 2Q3EA 1BGYE 1CW5A 2MJZA 1NKZB 1YQ3C 2H88C 3LIDA 3MZWB 4WY4C 3L70J 3Q2YA 4KHXA 1QL2A 3M0DA 1JUNA 3CLQA 3CWBE 4L74A 1NOHA 3BVHA 5AW4B 3IFMA 5AW1B 1P84D 4IFMA 4WY4B 2J59M 1W2EA 1NU1J 1NAYA 3CX5I 1NTKG 2GUVA 3AEFC 3PJSK 1ZW0A 1FZAA 2BCCJ 3HE5B 5KLVD 3HD7D 1EQ7A 1PL5A 4LGDE 1E5WA 1SQVG 1Q81Q 1BCCJ 1RE4A 1A02F 4U3FD 3SWFA 2YNYA 4HJGH 1KTMA 3L70E 1BE3J 2IBZI 1TU3F 3CC7P 1CSBA 5EFWB 3Q5SA 1LTJC 5AVTB 4TLFA 1IFIA 2GA1A 1SQPK 3H1KJ 3EFFK 5CBNA 1AQTA 2WVRA 3HTKB 3VMYA 1U7JA 3RK3D 1LWUC 1NTMJ 1HUCA 1LP1A 3L73J 1VQ8P 3P8MC 1NU1E 1W2BO 3V5BA 4PD4E 3P32A 1NJIQ 2BCCE 3CCSP 3H1LG 1LT1A 1S5LE 4Z1MH 2KLUA 1FDMA 1DEEG 2OARA 1WMKA 1LWUB 1DX7A 3Q5PA 1BCCE 1L0LG 2Z5IA 3RK2D 5APXA 2A06E 3USSA 3CL3D 2AXCA 3PTZA 2E75C 1LTAC 3II6A 3GW6A 2KS1A 4UB6E 2A45H 1KD1Q 1SQBK 1GU4A 1OXZA 3AE9C 1L2PA 2H7HA 3JCUH 4ZMDA 2AEFA 3H1KE 3OJAB 5KJ7D 1SFCA 1FZCA 2E76D 2I1JA 2XKMA 2O01N 3ITKA 4JYCA 4GODA 1Y8AA 3L73E 2N9BA 3CXHH 1GD2E 3M06A 2AXTH 3L75D 1SQQJ 1J2JB 1OZHA 2D2CB 4GKGA 2WSCJ 2A45I 2L91A 5CCHD 4L76A 2PAJA 3B4SA 1M8OB 2N9YB 2WSEJ 1L4AA 3AEDC 1NTKD 1NHLA 5TISE 3O6QA 4NPFX 3H32A 2SPZA 1X9VA 5APWA 3TSIA 3CXHI 4NPDA 3TNUA 1SQPG 2N1TB 5KLVK 5GTHE 1Y47A 1BDCA 1VQOP 1QVGO 4DZOA 1JY3N 3P8CE 1H88A 3CX5D 2HODB 1ZRTD 2IZ0A 4UB6H 1SQQE 2GUSA 4HKZH 2XU6A 1JEKA 3B5NC 2HG5D 3NMDA 4C7NA 4C7RA 4KT0J 1AQ5A 2OGUA 3TGUJ 2M3BA 1SLQA 2Z5HA 3CCMP 2OYIC 1URQD 4PD4I 2YKQA 3L71E 1NWQA 4DT0A 3H1LD 1SQBG 2YO3A 4D6TG 2Q7CA 3VP9A 3MUDA 1OVRA 3HRNA 3B5NB 1L0LD 1SS1A 4WB4A 2W6JH 3EWKA 4XFJA 3SSUA 1X22A 1K05A 1L0ND 1RQUA 1LNQA 1JY2P 4YXDC 3PLNA 1NO4A 2ZVOB 5L8RJ 2OYIB 2FXPA 1JNMA 1NTZJ 1N73C 1PIXA 1M1KQ 2FYNC 2RKLA 2QJKC 1YIJP 2Y0CA 1GL2A 4RKUJ 4BRYA 2WMMA 3L74D 2KXPB 4ZKUA 1USEA 1Y9BA 1KQSO 2QA4P 2QJPC 1IJDB 1LJ2A 3PHLA 2OYOA 1R8EA 3TGUE 1KQGB 4PV1C 3C8VA 2GM4A 1N73B 4I2LC 2FKWB 1JMBA 2FYNB 1LTTC 2QJKB 3V4WA 5CCGC 1IFJA 1KB9D 4OGQD 3BCCJ 3VOPA 4R4MA 1YHQP 2QJPB 3HUSA 1EZVI 3I5CA 3E1IA 4PV1B 2QM8A 3SWYA 5TJHA 3H1JJ 3KPEA 5CHXA 2WSCH 5KLVG 1NTZE 4H13D 1YJ9P 3F89A 3GG2A 3WUVA 1M56D 3PRJA 1KYOE 1KILC 2QRXA 1RF1A 3D6ZA 2HPCB 3RL0C 2IBZE 3RGUA 2AEJA 1JCCA 4ZNCA 2KI7B 1FBMA 3M9HA 4PJ0H 1MFTA 2BASA 2B87B 5AVRB 1GW4A 2W8ZA 1S5LX 1H0TB 3I56P 1GK6A 5K5GB 3BATA 1FC2C 1R5LA 1LTGC 2M5AA 2KOGA 3RL0B 3CCUP 1YBKA 2RN0A 3IN6A 5GTIH 2JDIH 5AVUB 3BCCE 3C1LA 1G1JA 3L4FA 1VQNP 1HGZA 2NPSC 1FDOA 3H1JE 2G3AA 3B71A 3AECC 3L70D 1N7SA 1T3JA 4I1LA 2K9JA 4BXLA 4D6TD 1SQPJ 3AE5C 1YI2P 2NPSB 2ZXEB 3A5TA 1G2CA 1GZLA 3H1HG 4IL6H 1YJWP 1JY2O 1K04A 3A2AA 1VF5D 3AEBC 1LT9B 1L0NK 1AV1A 1QL1A 4YXWH 1R5SA 4PD4D 2FYUJ 3VMXA 1AJYA 1N8RQ 1PP9J 3Q5RA 2BCCD 3H1IE 5AVXB 3LIEA 3GF7A 1KYOH 2KYVA 4TT3H 3QH9A 3HD7C 2IPPA 1BCCD 2ZJSE 3AEAC 3AE1C 1RF0A 2PP6A 1FOSF 4RJTA 3L75G 4Y28J 3U59A 2KK7A 2JJLA 1SQXK 4WY4A 1U57A 1BSNA 1EDIA 3V2NA 5KAIE 1CI6B 1IC2A 3JCUE 5AW2B 2O1JA 3SWKA 3TF5A 1UIIA 1PGQA 3G4SP 4I7ZC 3HD7B 1RE4C 1VQ9P 3KZIH 5APTA 4HB1A 2FBWC 4C46A 3V2RA 3HE5A 3RK3C 2Y0EA 1RE3A 3CXHE 3OW2O 1H89A 1JMMA 1M7LA 1NVOA 5AW8B 1KYOI 4W80A 1IZNB 2FXMA 2AXTE 3MHVA 2Q9IA 2K37A 2FYUE 3A7OA 3D70A 1QVFO 1EC5A 2OTJP 5CJ0A 3H6PA 3A0BH 3BRTB 5BU5A 5H2FH 4JF7A 2YO2A 3RK3B 2YKPA 2KP8A 3SFEC 3UIAA 1PPJE 3RK2C 3HE4A 1A02J 2FY8A 3HTKA 5AVWB 3CCEP 1HBWA 2FYZA 2NZ2A 1YTZT 2OYHC 1VQ6P 1LTJB 3CMEP 2W90A 2IYOA 2IFMA 1KN7A 2IBZG 2XNXA 3RK2B 4U3FJ 2ZFCA 1FU1A 1HWTC 5KJ7C 2Q6QA 4K35A 1S72P 3VTPC 2ZYGA 2E76C 1LWUA 3M9BA 2OYHB 1BE3E 1L0NG 2NRGA 4B86A 3H1HD 1SQQD 1MV8A 1GW3A 3IF4A 3RBXA 1NH4A 5KAIH 1P84E 4H44D 3JC22 2E76B 5CCHC 3KDPB 1VL2A 2IFNA 3IR9A 1S9KE 3L74G 1PGPA 2E75B 1DD4A 2ZT9D 1NTME 1GTWA 1UIXA 1T3UA 1SQXG 3L71D 3FGAD 1JTHB 3C9IA 4R4LA 2J58A 2KNCB 1ZLLA 2BEQD 1USDA 3CCJP 4U7JA 1ZR2A 1SFCD 3F5HA 3L72G 4U3FE 2WSFH 1JY3P 2KUBA 1ZOYC 1M1JC 2OQQA 1EZVE 2W6AA 5AW9B 1QX8A 3R2PA 2C0WA 1BGYG 5BU8B 2R32A 3I55P 2K9YA 2ZXXA 1T8ZA 4W7YA 1JB0J 2LXBA 2D2CD 3CWBG 1M1JB 2O01J 3AE4C 1KQFB 3G3ZA 3KHUA 1IK7A 1J1DC 1GDTA 1L4AD 3TGUD 3RBZA 2I8DA 1GU5A 3JSVC 2P10A 2YXRB 2HLOA 2M8RA 4GIFA 2N1TA 1OMIA 2A45G 2R3SA 1URQC 2QG4A 4H0LD 5KTBA 1VDFA 4UB8H 2YXQB 2JKVA 4JQ0D 1PGJA 3L37A 1J1DB 2HODA 3V4QA 5AW0B 4Y99C 3NFQA 1LGHB 1P84H 1NTKJ 1VQKP 2JEEA 5B5EH 1URQB 1VQ4P 4M3LA 1NAFA 3CCVP 2OTKE 3L35A 3MUDC 2HR3A 2E42A 1RH5B 1M90Q 2IBZD 4PJ0E 1SQVJ 5APUA 3L70G 1FZFA 1G1IA 2DW3A 3KQGA 4Y99B 2FFDC 1S4XA 2QE7H 2KB7P 3B5NA 3M91A 1ZXGA 1EXIA 3GLMA 2H89C 5GTIE 2MKVA 3T97B 2KZJA 3MGNA 2OYIA 3NXSA 4OGQC 3BCCD 1P84I 2QM7A 4DCKA 2FFDB 1NU1G 1ZV8A 5B66E 1SQQK 1EDKA 1U7MA 3N4XA 2C0XA 3O8ZA 2BCCG 1SQXD 1NTKE 1HH0A 3CI9A 2E74D 4H13C 2P67A 1BCCG 4OGQB 3H1LJ 2LXCB 1KMIZ 2WT7B 1N73A 2WPSA 2A06G 1KC8Q 2RH0A 1GL2D 1SQVE 3L72D 1L0LJ 4IL6E 1JM0A 1OX3A 4N78E 4AQRD 2W83C 2K1AA 1JY3O 1DIPA 2P58A 3AEGC 4YTPC 1Q82Q 1QLED
chains in the Genus database with same CATH topology
1LTBC 3KYQA 1LT9B 4OH8B 3V5BA 3P32A 1L0NK 1QL1A 1JO5A 1ZR4A 2YKOA 4IFFA 1RF1C 1X79B 3VMXA 2N1TD 2WWWA 1FDMA 2OARA 1LWUB 5AVXB 3LIEA 4EOTA 1DX7A 1SP4A 2KYVA 2Z5IA 5AW5B 3RK2D 5APXA 3CL3D 3BRVB 3HD7C 2IPPA 4AUWA 1LTAC 1RF0A 2PP6A 1FOSF 2HPCA 3II6A 1URQA 2A45H 3N7NA 1SQBK 1GU4A 3U59A 4C7NB 2JJLA 1T2KD 2H43A 1SQXK 1OXZA 2KLVA 4WY4A 3VMZA 3VYIA 1IFMA 2H7HA 3LW5H 3V2NA 1CI6B 1IC2A 5AW2B 2O01H 2O1JA 1WT6A 3OJAB 1KILB 5KJ7D 3HD7B 1RE4C 1SFCA 3P7KA 1FZCA 3M0AA 5APTA 2I1JA 2XKMA 4C46A 4AYCA 2C9NY 3V2RA 3HE5A 4JYCA 3TYYA 1GL2C 3RK3C 3T97A 2N9BA 1H8AA 1IK9A 2H8PD 1RE3A 1H89A 1JMMA 1GD2E 1M7LA 5AW8B 1FAVA 3M06A 4W80A 2FXMA 2Z4EA 3B5ND 1HVVA 3U1AA 2XV5A 2Q9IA 4HYTB 1J2JB 4GKGA 3TK1A 2FFDA 1Z56A 4O9BA 3A7OA 2A45I 5CCHD 2PAJA 5CJ0A 3H6PA 2WTYA 1NTZK 3BRTB 5BU5A 4JF7A 2C9LY 1MUUA 2YO2A 1GL2B 1L4AA 3RK3B 2YKPA 2KP8A 3UIAA 1FJKA 2CPBA 3GHGC 1NHLA 1HJBA 3RK2C 3MTUE 3HE4A 3HUSC 5BVZA 1A02J 4RESB 4DOJA 4JYBA 1N2DC 2NPSA 4XE5B 2WT7A 3HTKA 5AVWB 1AFOA 1N7SD 3H32A 1HBWA 2WPRA 2FYZA 1DEBA 5CJ4A 2Q3IA 5CMZA 4IFDK 1YTZT 1X8YA 3M0DC 1YYCA 2I1KA 1X9VA 1T2KC 2OYHC 1LTJB 5APWA 1LTSC 3TSIA 2WZ7A 3VP8A 2IFMA 3TNUA 2N1TB 5AW3B 5KLVK 4N3YB 2XNXA 1LT9A 3GHGB 1MFZA 3RK2B 4HH2A 2ZFCA 1JCDA 1FU1A 5AW7B 3HUSB 1HWTC 5KJ7C 1KFNA 3VTPC 2P7JA 1DH3A 2O1KA 1N7LA 1JY2N 1YTZI 5CCGA 1LWUA 3VN0A 4DZOA 1JY3N 2R5BA 2R5DA 3M9BA 3P8CE 2OYHB 1H88A 2HODB 1N86A 1OWAA 3MIWA 5AVVB 1MZ9A 2GUSA 1WRGA 4B86A 2XU6A 3B5NC 2HG5D 3NMDA 3NTNA 1MV8A 1GW3A 1RF1B 4C7NA 4C7RA 1AQ5A 1NH4A 2WSEH 2M3BA 2WPQA 1NTKK 5CCGD 1CI6A 5CCHC 1SLQA 2Z5HA 3KDPB 1J1EC 1SVFA 2IFNA 2R3CA 3IR9A 2HYNA 1S9KE 1RE3C 5AVQB 2OYIC 1URQD 2YKQA 1NWQA 1KILA 2W6BA 3HD7A 1ZN5A 2YO3A 1SQVK 3EQ2A 1S9KD 1GTWA 4WY4D 1IFDA 2Q7CA 1T3UA 2KSJA 3VP9A 1JOCA 3MUDA 3HRNA 1JTHB 3B5NB 3C9IA 4LC1A 1LTIC 2J58A 1N7SC 4WB4A 4EIJA 1ZLLA 2P1JA 3M9QA 4I6MC 1ZR2A 1SFCD 1J1EB 3A3YB 1JY2P 1KQLA 1KILD 2WSFH 1NO4A 1JY3P 2P2UA 2OYIB 1M1JC 3RL0D 3B8EB 1JNMA 1N73C 2W6AA 5AW9B 2L5GB 2IX7C 4WBAA 2Q5UA 3R2PA 2XZRA 2C0WA 4N6JA 1FJPA 1N7SB 5BU8B 1GL2A 1GK4A 2R32A 3V2PA 4ZKUA 4GT1A 5APQA 1T8ZA 3MD0A 3OA7A 4W7YA 5APYA 5AVYB 2CPSA 1IJDB 5APVA 1IFNA 1LT9C 1M1JB 2GM4A 4XA4A 3U1CA 1N73B 3HE4B 4I2LC 3G3ZA 1G2CB 1IO4A 1J1DC 2FKWB 1GDTA 1L4AD 1GU5A 1LTJA 1LTTC 1XTGB 1XTCC 2HLOA 3V4WA 5CCGC 2M8RA 4GIFA 2N1TA 1IFJA 2YMYA 1KFMA 2NPSD 3WMM0 1L0LK 1RF0C 3GHGA 1FOSE 2A45G 1KZUB 2WITA 3VOPA 1URQC 3HUSA 5KTBA 1VDFA 1CW5A 2MJZA 1NKZB 3I5CA 3LIDA 4WY4C 3E1IA 5AVSB 2QM8A 3SWYA 4KHXA 3L36A 3KPEA 2POHA 3L37A 1J1DB 5CHXA 1QL2A 3M0DA 1JUNA 2OYHA 2WSCH 2HODA 3CLQA 3V4QA 2W27A 3P8CD 3PP5A 1PFIA 2HFED 5AW0B 4Y99C 2LKMA 2FYUK 3NFQA 1SFCC 1LGHB 1FZCC 1NOHA 1KILC 2JEEA 5AW4B 3BVHA 3IFMA 1RF1A 2HPCB 3RL0C 1URQB 1RY3A 4M3LA 5AW1B 5KJ7A 1NAFA 3L35A 1JCCA 3V2QA 2E42A 3EFGA 4IFMA 4WY4B 1FBMA 3M9HA 2J59M 2BASA 5APUA 1FZGA 1VPCA 5AVRB 1GW4A 1FZFA 1G1IA 3KQGA 1W2EA 4Y99B 2FFDC 1GK6A 1SFCB 1FZCB 2KB7P 1JTHA 3B5NA 3BATA 3M91A 1NU1K 1NKNA 2GUVA 1LTGC 1HGVA 2KOGA 3RL0B 1FZAA 3HE5B 4LLHA 1L4AC 3HD7D 5AVUB 5CCHA 3MGNA 1EQ7A 1FZBA 4LGDE 1E5WA 2XDJA 1RE4A 2OYIA 1A02F 1G1JA 3NXSA 5AVZB 3L4FA 3SWFA 1HGZA 2NPSC 2YNYA 2VRSA 2QM7A 1HTLC 2FFDB 2E43A 1ZV8A 1CSBA 1N7SA 1SQQK 1T3JA 5AW6B 3N4XA 4I1LA 1LTJC 5AVTB 2C0XA 3O8ZA 5APSA 1FZEA 1IFIA 1L4AB 1HH0A 3CI9A 2N1TC 1SQPK 2P67A 1CZQA 1M1JA 2NPSB 2ZXEB 3OAKA 2WT7B 3A5TA 1N73A 2WPSA 3HTKB 3H32B 1G2CA 3VMYA 1GZLA 1GL2D 3RK3D 3BASA 1LWUC 4ZKPA 4N78E 4AQRD 1JY2O 1HUCA 1JY3O 1NTMK 3A2AA 4W7ZA 3P8MC 4N78D 3TNUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GL2 B;  3RL0 C;  1URQ B;  1L4A A;  3RK3 B;  3KYQ A;  4OH8 B;  5KJ7 A;  1NHL A;  3RK2 C;  4WY4 B;  1SFC D;  2NPS A;  1KIL D;  1N7S D;  2N1T D;  3RL0 D;  3M0D C;  3RK2 D;  3HD7 C;  1SFC B;  1JTH A;  3B5N A;  3TSI A;  2WZ7 A;  2PP6 A;  1N7S B;  2N1T B;  2KOG A;  3RL0 B;  1GL2 A;  1URQ A;  3RK2 B;  1L4A C;  3HD7 D;  4WY4 A;  5KJ7 C;  4W7Y A;  5CCH A;  4LGD E;  2XDJ A;  2NPS C;  5CCG A;  1L4A D;  3P8C E;  1KIL B;  5KJ7 D;  3HD7 B;  1SFC A;  1XTG B;  5CCG C;  2M8R A;  1N7S A;  1T3J A;  2N1T A;  2YMY A;  2NPS D;  3B5N C;  2HG5 D;  1GL2 C;  3VOP A;  1L4A B;  1URQ C;  3RK3 C;  2H8P D;  2N1T C;  5CCG D;  4WY4 C;  4W80 A;  5CCH C;  3B5N D;  1HVV A;  2NPS B;  3HTK B;  1GL2 D;  1URQ D;  3RK3 D;  1KIL A;  3HD7 A;  3PP5 A;  2HFE D;  4N78 E;  4WY4 D;  5CCH D;  1SFC C;  1JTH B;  3B5N B;  4W7Z A;  1KIL C;  4JF7 A;  1N7S C; 
#chains in the Genus database with same CATH topology
 1QGK B;  3FXD A;  3KYQ A;  5C39 A;  4WWI A;  1M57 D;  1BGY D;  4H13 B;  1ZR4 A;  3H1K G;  4IFF A;  1RF1 C;  2WWW A;  4EOT A;  3CWB D;  1Q2N A;  5AW5 B;  3L74 J;  3H1I D;  2K88 A;  1HJ0 A;  3L73 G;  2HPC A;  1EDL A;  3WUU A;  2WSS H;  1T2K D;  2KLV A;  3SFD C;  2QJY C;  4EI2 A;  3AE8 C;  2ZYD A;  2B87 A;  2O01 H;  3AEE C;  2BEZ F;  1WT6 A;  1H0T A;  3H1L E;  3AE7 C;  4OWF A;  1KIL B;  4L75 A;  3P7K A;  1L0L E;  3KZI E;  1ZME C;  4AYC A;  2PRR A;  2C9N Y;  3TYY A;  1YQ4 C;  2RMZ A;  1H8A A;  2JWA A;  2QJY B;  5DJT B;  1ZP0 C;  1OIP A;  1HVV A;  3CXH D;  2JO1 A;  1VF5 C;  4HYT B;  3TK1 A;  5B66 H;  3WUT A;  2WTY A;  1NTZ K;  3A0B E;  5H2F E;  2C9L Y;  1FJK A;  2CPB A;  3GHG C;  2Y0D A;  3MTU E;  5BVZ A;  4RES B;  4IOI H;  4DOJ A;  2UWJ E;  2NPS A;  1AFO A;  1N7S D;  1VF5 B;  3PH0 A;  1SQQ G;  1DEB A;  5CJ4 A;  2Q3I A;  3GMA A;  1X8Y A;  2V4H A;  3M0D C;  1YYC A;  1S3J A;  5KKZ C;  1LTS C;  1VQL P;  3VP8 A;  5AW3 B;  1NU1 D;  4N3Y B;  1LT9 A;  3GHG B;  3TDK A;  1JCD A;  2WSF J;  1KFN A;  4L73 A;  1NGM B;  3FX0 A;  3CX5 H;  3L71 G;  1DH3 A;  2O1K A;  1N7L A;  1YTZ I;  3VN0 A;  2R5B A;  2R5D A;  3WU2 E;  1AVO A;  1SQB J;  2KIK A;  5KKZ B;  2A06 D;  5AVV B;  4D6T J;  1K73 Q;  1MZ9 A;  4DJG A;  1BE3 D;  3NTN A;  1OVV A;  1NYH A;  1SQP E;  1QEX A;  1CI6 A;  1EDJ A;  1J1E C;  1SVF A;  3R4Y A;  2R3C A;  1FE6 A;  1RE3 C;  3H1K D;  2W6B A;  3A0H E;  3HD7 A;  1ZN5 A;  1PV3 A;  1VQ7 P;  1S9K D;  4WY4 D;  1IFD A;  2V7Q J;  2KSJ A;  1X0T A;  1NTM D;  4EIJ A;  2JP3 A;  2CK3 H;  1KIL E;  4I6M C;  1Q90 D;  3TGU G;  3L73 D;  1J1E B;  1KQL A;  4I7Z B;  1PP9 E;  3B8E B;  4NPE A;  1S2E A;  2L5G B;  3MP7 B;  2Q5U A;  1EZV D;  4N6J A;  3CPW O;  1SQB E;  2B89 A;  4D6T E;  1Q86 Q;  5APQ A;  4YPC A;  5CBO A;  3OA7 A;  5APY A;  2CPS A;  2R44 A;  3LW5 J;  5APV A;  2B9B A;  4K3A A;  3D71 A;  3HE4 B;  1NTZ G;  1KB9 H;  5KLV J;  1LTJ A;  4H44 C;  4JPZ B;  1T6A A;  2YMY A;  1KFM A;  1LP1 B;  3WMM 0;  1FOS E;  4MN4 C;  1KZU B;  2Q1K A;  1FDI A;  2ZT9 C;  1PZQ A;  2FXO A;  4UB8 E;  5AVS B;  3WU2 H;  3L36 A;  2POH A;  2OYH A;  3S4R A;  2B88 A;  2ZYA A;  3QWO C;  2W27 A;  3P8C D;  3PP5 A;  1PFI A;  2HFE D;  4H44 B;  2LKM A;  2FYU K;  1SFC C;  1FZC C;  4IL6 X;  5B5E E;  2KS1 B;  3BCC G;  1RY3 A;  5KJ7 A;  2ZT9 B;  3V2Q A;  1HF9 A;  3EFG A;  1KB9 I;  1DD3 A;  2K3R A;  3K5B A;  3A0H H;  4QMA A;  1FZG A;  1VPC A;  3H1J G;  4EYY Q;  1E79 H;  3CCL P;  1AVY A;  1SFC B;  1FZC B;  5E79 E;  1JTH A;  2D2C C;  5KLV E;  1NU1 K;  1NKN A;  4KJM A;  4RO0 A;  1HGV A;  2XND H;  2KNC A;  2YMK A;  4LLH A;  1L4A C;  3E7K A;  5CCH A;  3ZDM A;  2E75 D;  3CCQ P;  1FZB A;  2XDJ A;  1RQV A;  5AVZ B;  2VRS A;  1HTL C;  1KV4 A;  3H1H J;  2AEM A;  2E43 A;  4H0L C;  4CPG A;  2YIU C;  3E1R A;  3FWN A;  5AW6 B;  3S9O A;  1MKM A;  2WQY C;  5APS A;  3VMA A;  1FZE A;  1L4A B;  1Q7Y Q;  2N1T C;  3O6Q B;  3H1I G;  3RK3 E;  1CZQ A;  1M1J A;  3FWL A;  3OAK A;  1OFC X;  4GOE A;  3H32 B;  1OW8 A;  3BAS A;  3L71 J;  4H0L B;  3RL0 g;  2E5Y A;  2YIU B;  4ZKP A;  2V7Q H;  5DJU B;  1SQV D;  2ZAE B;  1NTM K;  4W7Z A;  4N78 D;  3TNU B;  3L75 J;  2QEX P;  4PD4 H;  1LTB C;  4OH8 B;  2IYP A;  1JO5 A;  2YKO A;  1X79 B;  1S5L H;  3S1K A;  3AE2 C;  2N1T D;  1SP4 A;  1K9M Q;  1KOR A;  3BRV B;  4AUW A;  1NTZ D;  3H1H E;  1VQM P;  4BWN A;  1KYO D;  1URQ A;  3N7N A;  1VQP P;  4C7N B;  2H43 A;  3VMZ A;  3VYI A;  4WVZ A;  1IFM A;  3LW5 H;  4ASW A;  2FYU G;  1PP9 G;  5E79 H;  1YJN P;  2G8Y A;  2E74 C;  2WPV B;  5M1B A;  3M0A A;  1PPJ G;  3CC4 P;  1GL2 C;  3T97 A;  1IK9 A;  2H8P D;  3L75 E;  1FAV A;  3W67 A;  2Z4E A;  3B5N D;  3U1A A;  2XV5 A;  1K8A Q;  2FFD A;  1Z56 A;  4O9B A;  1PGO A;  2ZVN B;  2E74 B;  3H1J D;  3G6E P;  1RHZ B;  1MUU A;  1GL2 B;  4EDF A;  4BRY B;  5TIS H;  1HJB A;  1IFP A;  3HUS C;  4JYB A;  5KAF E;  1N2D C;  3D6Y A;  4XE5 B;  2WT7 A;  2Y9Z A;  4ASV A;  1YIT P;  1BE3 G;  1S1C X;  2WPR A;  2PGD A;  5CMZ A;  4IFD K;  2I1K A;  1T2K C;  2JR8 A;  1L0N J;  3GF3 A;  2WZ7 A;  3Q3D A;  5GTH H;  2QVA A;  1MFZ A;  2E5T A;  3AE6 C;  4HH2 A;  5AW7 B;  3HUS B;  1BDD A;  1D7M A;  2O3J A;  2P7J A;  2QIW A;  3CX5 E;  1ZRT E;  2M0B A;  3W68 A;  1JY2 N;  1NTM G;  5CCG A;  3G9R A;  3IAO A;  5KLI C;  3CC2 P;  1N86 A;  2IDB A;  1AA0 A;  1OWA A;  3MIW A;  1SQX J;  1WRG A;  4PV1 D;  1EXJ A;  2Y9Y A;  1RF1 B;  2LR2 A;  2QSI A;  4U3F G;  2WSE H;  2WPQ A;  1NTK K;  5CCG D;  1EZV G;  3L72 J;  1BSH A;  1SQP D;  3H25 A;  2HYN A;  5AVQ B;  5KLI B;  1KIL A;  4GDO A;  1SQV K;  3EQ2 A;  3Q1M A;  4GOF A;  1JOC A;  1OW6 A;  4LC1 A;  1LTI C;  1BGY J;  1N7S C;  2M5A B;  1L0N E;  1VQ5 P;  2P1J A;  2OTL P;  3M9Q A;  3KXD A;  3ABV C;  3CMA P;  3A3Y B;  1KIL D;  3CWB J;  2P2U A;  3RL0 D;  4A7P A;  3H1I J;  2KZI A;  2JWD A;  2ITA A;  2IX7 C;  2IZ1 A;  2FYU D;  4WBA A;  4OVN F;  1PP9 D;  3FXE A;  3L74 E;  2XZR A;  3CD6 P;  1FJP A;  1N7S B;  1GK4 A;  2KSE A;  3V2P A;  1SQX E;  2K9J B;  4GT1 A;  5KAF H;  1OVU A;  2M3E A;  1SQB D;  3MD0 A;  1PPJ D;  5AVY B;  1IFN A;  1LT9 C;  1OW7 A;  3G71 P;  4XA4 A;  3U1C A;  1IO4 A;  1G2C B;  3L72 E;  1W5C E;  2J5U A;  1KB9 E;  1GMJ A;  3CCR P;  1XTG B;  1XTC C;  1FS0 E;  2NPS D;  3AE3 C;  2PFX A;  1L0L K;  1RF0 C;  3GHG A;  4JBZ A;  2WIT A;  3V6I A;  2Q3E A;  1BGY E;  1CW5 A;  2MJZ A;  1NKZ B;  1YQ3 C;  2H88 C;  3LID A;  3MZW B;  4WY4 C;  3L70 J;  3Q2Y A;  4KHX A;  1QL2 A;  3M0D A;  1JUN A;  3CLQ A;  3CWB E;  4L74 A;  1NOH A;  3BVH A;  5AW4 B;  3IFM A;  5AW1 B;  1P84 D;  4IFM A;  4WY4 B;  2J59 M;  1W2E A;  1NU1 J;  1NAY A;  3CX5 I;  1NTK G;  2GUV A;  3AEF C;  3PJS K;  1ZW0 A;  1FZA A;  2BCC J;  3HE5 B;  5KLV D;  3HD7 D;  1EQ7 A;  1PL5 A;  4LGD E;  1E5W A;  1SQV G;  1Q81 Q;  1BCC J;  1RE4 A;  1A02 F;  4U3F D;  3SWF A;  2YNY A;  4HJG H;  1KTM A;  3L70 E;  1BE3 J;  2IBZ I;  1TU3 F;  3CC7 P;  1CSB A;  5EFW B;  3Q5S A;  1LTJ C;  5AVT B;  4TLF A;  1IFI A;  2GA1 A;  1SQP K;  3H1K J;  3EFF K;  5CBN A;  1AQT A;  2WVR A;  3HTK B;  3VMY A;  1U7J A;  3RK3 D;  1LWU C;  1NTM J;  1HUC A;  1LP1 A;  3L73 J;  1VQ8 P;  3P8M C;  1NU1 E;  1W2B O;  3V5B A;  4PD4 E;  3P32 A;  1NJI Q;  2BCC E;  3CCS P;  3H1L G;  1LT1 A;  1S5L E;  4Z1M H;  2KLU A;  1FDM A;  1DEE G;  2OAR A;  1WMK A;  1LWU B;  1DX7 A;  3Q5P A;  1BCC E;  1L0L G;  2Z5I A;  3RK2 D;  5APX A;  2A06 E;  3USS A;  3CL3 D;  2AXC A;  3PTZ A;  2E75 C;  1LTA C;  3II6 A;  3GW6 A;  2KS1 A;  4UB6 E;  2A45 H;  1KD1 Q;  1SQB K;  1GU4 A;  1OXZ A;  3AE9 C;  1L2P A;  2H7H A;  3JCU H;  4ZMD A;  2AEF A;  3H1K E;  3OJA B;  5KJ7 D;  1SFC A;  1FZC A;  2E76 D;  2I1J A;  2XKM A;  2O01 N;  3ITK A;  4JYC A;  4GOD A;  1Y8A A;  3L73 E;  2N9B A;  3CXH H;  1GD2 E;  3M06 A;  2AXT H;  3L75 D;  1SQQ J;  1J2J B;  1OZH A;  2D2C B;  4GKG A;  2WSC J;  2A45 I;  2L91 A;  5CCH D;  4L76 A;  2PAJ A;  3B4S A;  1M8O B;  2N9Y B;  2WSE J;  1L4A A;  3AED C;  1NTK D;  1NHL A;  5TIS E;  3O6Q A;  4NPF X;  3H32 A;  2SPZ A;  1X9V A;  5APW A;  3TSI A;  3CXH I;  4NPD A;  3TNU A;  1SQP G;  2N1T B;  5KLV K;  5GTH E;  1Y47 A;  1BDC A;  1VQO P;  1QVG O;  4DZO A;  1JY3 N;  3P8C E;  1H88 A;  3CX5 D;  2HOD B;  1ZRT D;  2IZ0 A;  4UB6 H;  1SQQ E;  2GUS A;  4HKZ H;  2XU6 A;  1JEK A;  3B5N C;  2HG5 D;  3NMD A;  4C7N A;  4C7R A;  4KT0 J;  1AQ5 A;  2OGU A;  3TGU J;  2M3B A;  1SLQ A;  2Z5H A;  3CCM P;  2OYI C;  1URQ D;  4PD4 I;  2YKQ A;  3L71 E;  1NWQ A;  4DT0 A;  3H1L D;  1SQB G;  2YO3 A;  4D6T G;  2Q7C A;  3VP9 A;  3MUD A;  1OVR A;  3HRN A;  3B5N B;  1L0L D;  1SS1 A;  4WB4 A;  2W6J H;  3EWK A;  4XFJ A;  3SSU A;  1X22 A;  1K05 A;  1L0N D;  1RQU A;  1LNQ A;  1JY2 P;  4YXD C;  3PLN A;  1NO4 A;  2ZVO B;  5L8R J;  2OYI B;  2FXP A;  1JNM A;  1NTZ J;  1N73 C;  1PIX A;  1M1K Q;  2FYN C;  2RKL A;  2QJK C;  1YIJ P;  2Y0C A;  1GL2 A;  4RKU J;  4BRY A;  2WMM A;  3L74 D;  2KXP B;  4ZKU A;  1USE A;  1Y9B A;  1KQS O;  2QA4 P;  2QJP C;  1IJD B;  1LJ2 A;  3PHL A;  2OYO A;  1R8E A;  3TGU E;  1KQG B;  4PV1 C;  3C8V A;  2GM4 A;  1N73 B;  4I2L C;  2FKW B;  1JMB A;  2FYN B;  1LTT C;  2QJK B;  3V4W A;  5CCG C;  1IFJ A;  1KB9 D;  4OGQ D;  3BCC J;  3VOP A;  4R4M A;  1YHQ P;  2QJP B;  3HUS A;  1EZV I;  3I5C A;  3E1I A;  4PV1 B;  2QM8 A;  3SWY A;  5TJH A;  3H1J J;  3KPE A;  5CHX A;  2WSC H;  5KLV G;  1NTZ E;  4H13 D;  1YJ9 P;  3F89 A;  3GG2 A;  3WUV A;  1M56 D;  3PRJ A;  1KYO E;  1KIL C;  2QRX A;  1RF1 A;  3D6Z A;  2HPC B;  3RL0 C;  2IBZ E;  3RGU A;  2AEJ A;  1JCC A;  4ZNC A;  2KI7 B;  1FBM A;  3M9H A;  4PJ0 H;  1MFT A;  2BAS A;  2B87 B;  5AVR B;  1GW4 A;  2W8Z A;  1S5L X;  1H0T B;  3I56 P;  1GK6 A;  5K5G B;  3BAT A;  1FC2 C;  1R5L A;  1LTG C;  2M5A A;  2KOG A;  3RL0 B;  3CCU P;  1YBK A;  2RN0 A;  3IN6 A;  5GTI H;  2JDI H;  5AVU B;  3BCC E;  3C1L A;  1G1J A;  3L4F A;  1VQN P;  1HGZ A;  2NPS C;  1FDO A;  3H1J E;  2G3A A;  3B71 A;  3AEC C;  3L70 D;  1N7S A;  1T3J A;  4I1L A;  2K9J A;  4BXL A;  4D6T D;  1SQP J;  3AE5 C;  1YI2 P;  2NPS B;  2ZXE B;  3A5T A;  1G2C A;  1GZL A;  3H1H G;  4IL6 H;  1YJW P;  1JY2 O;  1K04 A;  3A2A A;  1VF5 D;  3AEB C;  1LT9 B;  1L0N K;  1AV1 A;  1QL1 A;  4YXW H;  1R5S A;  4PD4 D;  2FYU J;  3VMX A;  1AJY A;  1N8R Q;  1PP9 J;  3Q5R A;  2BCC D;  3H1I E;  5AVX B;  3LIE A;  3GF7 A;  1KYO H;  2KYV A;  4TT3 H;  3QH9 A;  3HD7 C;  2IPP A;  1BCC D;  2ZJS E;  3AEA C;  3AE1 C;  1RF0 A;  2PP6 A;  1FOS F;  4RJT A;  3L75 G;  4Y28 J;  3U59 A;  2KK7 A;  2JJL A;  1SQX K;  4WY4 A;  1U57 A;  1BSN A;  1EDI A;  3V2N A;  5KAI E;  1CI6 B;  1IC2 A;  3JCU E;  5AW2 B;  2O1J A;  3SWK A;  3TF5 A;  1UII A;  1PGQ A;  3G4S P;  4I7Z C;  3HD7 B;  1RE4 C;  1VQ9 P;  3KZI H;  5APT A;  4HB1 A;  2FBW C;  4C46 A;  3V2R A;  3HE5 A;  3RK3 C;  2Y0E A;  1RE3 A;  3CXH E;  3OW2 O;  1H89 A;  1JMM A;  1M7L A;  1NVO A;  5AW8 B;  1KYO I;  4W80 A;  1IZN B;  2FXM A;  2AXT E;  3MHV A;  2Q9I A;  2K37 A;  2FYU E;  3A7O A;  3D70 A;  1QVF O;  1EC5 A;  2OTJ P;  5CJ0 A;  3H6P A;  3A0B H;  3BRT B;  5BU5 A;  5H2F H;  4JF7 A;  2YO2 A;  3RK3 B;  2YKP A;  2KP8 A;  3SFE C;  3UIA A;  1PPJ E;  3RK2 C;  3HE4 A;  1A02 J;  2FY8 A;  3HTK A;  5AVW B;  3CCE P;  1HBW A;  2FYZ A;  2NZ2 A;  1YTZ T;  2OYH C;  1VQ6 P;  1LTJ B;  3CME P;  2W90 A;  2IYO A;  2IFM A;  1KN7 A;  2IBZ G;  2XNX A;  3RK2 B;  4U3F J;  2ZFC A;  1FU1 A;  1HWT C;  5KJ7 C;  2Q6Q A;  4K35 A;  1S72 P;  3VTP C;  2ZYG A;  2E76 C;  1LWU A;  3M9B A;  2OYH B;  1BE3 E;  1L0N G;  2NRG A;  4B86 A;  3H1H D;  1SQQ D;  1MV8 A;  1GW3 A;  3IF4 A;  3RBX A;  1NH4 A;  5KAI H;  1P84 E;  4H44 D;  3JC2 2;  2E76 B;  5CCH C;  3KDP B;  1VL2 A;  2IFN A;  3IR9 A;  1S9K E;  3L74 G;  1PGP A;  2E75 B;  1DD4 A;  2ZT9 D;  1NTM E;  1GTW A;  1UIX A;  1T3U A;  1SQX G;  3L71 D;  3FGA D;  1JTH B;  3C9I A;  4R4L A;  2J58 A;  2KNC B;  1ZLL A;  2BEQ D;  1USD A;  3CCJ P;  4U7J A;  1ZR2 A;  1SFC D;  3F5H A;  3L72 G;  4U3F E;  2WSF H;  1JY3 P;  2KUB A;  1ZOY C;  1M1J C;  2OQQ A;  1EZV E;  2W6A A;  5AW9 B;  1QX8 A;  3R2P A;  2C0W A;  1BGY G;  5BU8 B;  2R32 A;  3I55 P;  2K9Y A;  2ZXX A;  1T8Z A;  4W7Y A;  1JB0 J;  2LXB A;  2D2C D;  3CWB G;  1M1J B;  2O01 J;  3AE4 C;  1KQF B;  3G3Z A;  3KHU A;  1IK7 A;  1J1D C;  1GDT A;  1L4A D;  3TGU D;  3RBZ A;  2I8D A;  1GU5 A;  3JSV C;  2P10 A;  2YXR B;  2HLO A;  2M8R A;  4GIF A;  2N1T A;  1OMI A;  2A45 G;  2R3S A;  1URQ C;  2QG4 A;  4H0L D;  5KTB A;  1VDF A;  4UB8 H;  2YXQ B;  2JKV A;  4JQ0 D;  1PGJ A;  3L37 A;  1J1D B;  2HOD A;  3V4Q A;  5AW0 B;  4Y99 C;  3NFQ A;  1LGH B;  1P84 H;  1NTK J;  1VQK P;  2JEE A;  5B5E H;  1URQ B;  1VQ4 P;  4M3L A;  1NAF A;  3CCV P;  2OTK E;  3L35 A;  3MUD C;  2HR3 A;  2E42 A;  1RH5 B;  1M90 Q;  2IBZ D;  4PJ0 E;  1SQV J;  5APU A;  3L70 G;  1FZF A;  1G1I A;  2DW3 A;  3KQG A;  4Y99 B;  2FFD C;  1S4X A;  2QE7 H;  2KB7 P;  3B5N A;  3M91 A;  1ZXG A;  1EXI A;  3GLM A;  2H89 C;  5GTI E;  2MKV A;  3T97 B;  2KZJ A;  3MGN A;  2OYI A;  3NXS A;  4OGQ C;  3BCC D;  1P84 I;  2QM7 A;  4DCK A;  2FFD B;  1NU1 G;  1ZV8 A;  5B66 E;  1SQQ K;  1EDK A;  1U7M A;  3N4X A;  2C0X A;  3O8Z A;  2BCC G;  1SQX D;  1NTK E;  1HH0 A;  3CI9 A;  2E74 D;  4H13 C;  2P67 A;  1BCC G;  4OGQ B;  3H1L J;  2LXC B;  1KMI Z;  2WT7 B;  1N73 A;  2WPS A;  2A06 G;  1KC8 Q;  2RH0 A;  1GL2 D;  1SQV E;  3L72 D;  1L0L J;  4IL6 E;  1JM0 A;  1OX3 A;  4N78 E;  4AQR D;  2W83 C;  2K1A A;  1JY3 O;  1DIP A;  2P58 A;  3AEG C;  4YTP C;  1Q82 Q;  1QLE D; 
#chains in the Genus database with same CATH homology
 1LTB C;  3KYQ A;  1LT9 B;  4OH8 B;  3V5B A;  3P32 A;  1L0N K;  1QL1 A;  1JO5 A;  1ZR4 A;  2YKO A;  4IFF A;  1RF1 C;  1X79 B;  3VMX A;  2N1T D;  2WWW A;  1FDM A;  2OAR A;  1LWU B;  5AVX B;  3LIE A;  4EOT A;  1DX7 A;  1SP4 A;  2KYV A;  2Z5I A;  5AW5 B;  3RK2 D;  5APX A;  3CL3 D;  3BRV B;  3HD7 C;  2IPP A;  4AUW A;  1LTA C;  1RF0 A;  2PP6 A;  1FOS F;  2HPC A;  3II6 A;  1URQ A;  2A45 H;  3N7N A;  1SQB K;  1GU4 A;  3U59 A;  4C7N B;  2JJL A;  1T2K D;  2H43 A;  1SQX K;  1OXZ A;  2KLV A;  4WY4 A;  3VMZ A;  3VYI A;  1IFM A;  2H7H A;  3LW5 H;  3V2N A;  1CI6 B;  1IC2 A;  5AW2 B;  2O01 H;  2O1J A;  1WT6 A;  3OJA B;  1KIL B;  5KJ7 D;  3HD7 B;  1RE4 C;  1SFC A;  3P7K A;  1FZC A;  3M0A A;  5APT A;  2I1J A;  2XKM A;  4C46 A;  4AYC A;  2C9N Y;  3V2R A;  3HE5 A;  4JYC A;  3TYY A;  1GL2 C;  3RK3 C;  3T97 A;  2N9B A;  1H8A A;  1IK9 A;  2H8P D;  1RE3 A;  1H89 A;  1JMM A;  1GD2 E;  1M7L A;  5AW8 B;  1FAV A;  3M06 A;  4W80 A;  2FXM A;  2Z4E A;  3B5N D;  1HVV A;  3U1A A;  2XV5 A;  2Q9I A;  4HYT B;  1J2J B;  4GKG A;  3TK1 A;  2FFD A;  1Z56 A;  4O9B A;  3A7O A;  2A45 I;  5CCH D;  2PAJ A;  5CJ0 A;  3H6P A;  2WTY A;  1NTZ K;  3BRT B;  5BU5 A;  4JF7 A;  2C9L Y;  1MUU A;  2YO2 A;  1GL2 B;  1L4A A;  3RK3 B;  2YKP A;  2KP8 A;  3UIA A;  1FJK A;  2CPB A;  3GHG C;  1NHL A;  1HJB A;  3RK2 C;  3MTU E;  3HE4 A;  3HUS C;  5BVZ A;  1A02 J;  4RES B;  4DOJ A;  4JYB A;  1N2D C;  2NPS A;  4XE5 B;  2WT7 A;  3HTK A;  5AVW B;  1AFO A;  1N7S D;  3H32 A;  1HBW A;  2WPR A;  2FYZ A;  1DEB A;  5CJ4 A;  2Q3I A;  5CMZ A;  4IFD K;  1YTZ T;  1X8Y A;  3M0D C;  1YYC A;  2I1K A;  1X9V A;  1T2K C;  2OYH C;  1LTJ B;  5APW A;  1LTS C;  3TSI A;  2WZ7 A;  3VP8 A;  2IFM A;  3TNU A;  2N1T B;  5AW3 B;  5KLV K;  4N3Y B;  2XNX A;  1LT9 A;  3GHG B;  1MFZ A;  3RK2 B;  4HH2 A;  2ZFC A;  1JCD A;  1FU1 A;  5AW7 B;  3HUS B;  1HWT C;  5KJ7 C;  1KFN A;  3VTP C;  2P7J A;  1DH3 A;  2O1K A;  1N7L A;  1JY2 N;  1YTZ I;  5CCG A;  1LWU A;  3VN0 A;  4DZO A;  1JY3 N;  2R5B A;  2R5D A;  3M9B A;  3P8C E;  2OYH B;  1H88 A;  2HOD B;  1N86 A;  1OWA A;  3MIW A;  5AVV B;  1MZ9 A;  2GUS A;  1WRG A;  4B86 A;  2XU6 A;  3B5N C;  2HG5 D;  3NMD A;  3NTN A;  1MV8 A;  1GW3 A;  1RF1 B;  4C7N A;  4C7R A;  1AQ5 A;  1NH4 A;  2WSE H;  2M3B A;  2WPQ A;  1NTK K;  5CCG D;  1CI6 A;  5CCH C;  1SLQ A;  2Z5H A;  3KDP B;  1J1E C;  1SVF A;  2IFN A;  2R3C A;  3IR9 A;  2HYN A;  1S9K E;  1RE3 C;  5AVQ B;  2OYI C;  1URQ D;  2YKQ A;  1NWQ A;  1KIL A;  2W6B A;  3HD7 A;  1ZN5 A;  2YO3 A;  1SQV K;  3EQ2 A;  1S9K D;  1GTW A;  4WY4 D;  1IFD A;  2Q7C A;  1T3U A;  2KSJ A;  3VP9 A;  1JOC A;  3MUD A;  3HRN A;  1JTH B;  3B5N B;  3C9I A;  4LC1 A;  1LTI C;  2J58 A;  1N7S C;  4WB4 A;  4EIJ A;  1ZLL A;  2P1J A;  3M9Q A;  4I6M C;  1ZR2 A;  1SFC D;  1J1E B;  3A3Y B;  1JY2 P;  1KQL A;  1KIL D;  2WSF H;  1NO4 A;  1JY3 P;  2P2U A;  2OYI B;  1M1J C;  3RL0 D;  3B8E B;  1JNM A;  1N73 C;  2W6A A;  5AW9 B;  2L5G B;  2IX7 C;  4WBA A;  2Q5U A;  3R2P A;  2XZR A;  2C0W A;  4N6J A;  1FJP A;  1N7S B;  5BU8 B;  1GL2 A;  1GK4 A;  2R32 A;  3V2P A;  4ZKU A;  4GT1 A;  5APQ A;  1T8Z A;  3MD0 A;  3OA7 A;  4W7Y A;  5APY A;  5AVY B;  2CPS A;  1IJD B;  5APV A;  1IFN A;  1LT9 C;  1M1J B;  2GM4 A;  4XA4 A;  3U1C A;  1N73 B;  3HE4 B;  4I2L C;  3G3Z A;  1G2C B;  1IO4 A;  1J1D C;  2FKW B;  1GDT A;  1L4A D;  1GU5 A;  1LTJ A;  1LTT C;  1XTG B;  1XTC C;  2HLO A;  3V4W A;  5CCG C;  2M8R A;  4GIF A;  2N1T A;  1IFJ A;  2YMY A;  1KFM A;  2NPS D;  3WMM 0;  1L0L K;  1RF0 C;  3GHG A;  1FOS E;  2A45 G;  1KZU B;  2WIT A;  3VOP A;  1URQ C;  3HUS A;  5KTB A;  1VDF A;  1CW5 A;  2MJZ A;  1NKZ B;  3I5C A;  3LID A;  4WY4 C;  3E1I A;  5AVS B;  2QM8 A;  3SWY A;  4KHX A;  3L36 A;  3KPE A;  2POH A;  3L37 A;  1J1D B;  5CHX A;  1QL2 A;  3M0D A;  1JUN A;  2OYH A;  2WSC H;  2HOD A;  3CLQ A;  3V4Q A;  2W27 A;  3P8C D;  3PP5 A;  1PFI A;  2HFE D;  5AW0 B;  4Y99 C;  2LKM A;  2FYU K;  3NFQ A;  1SFC C;  1LGH B;  1FZC C;  1NOH A;  1KIL C;  2JEE A;  5AW4 B;  3BVH A;  3IFM A;  1RF1 A;  2HPC B;  3RL0 C;  1URQ B;  1RY3 A;  4M3L A;  5AW1 B;  5KJ7 A;  1NAF A;  3L35 A;  1JCC A;  3V2Q A;  2E42 A;  3EFG A;  4IFM A;  4WY4 B;  1FBM A;  3M9H A;  2J59 M;  2BAS A;  5APU A;  1FZG A;  1VPC A;  5AVR B;  1GW4 A;  1FZF A;  1G1I A;  3KQG A;  1W2E A;  4Y99 B;  2FFD C;  1GK6 A;  1SFC B;  1FZC B;  2KB7 P;  1JTH A;  3B5N A;  3BAT A;  3M91 A;  1NU1 K;  1NKN A;  2GUV A;  1LTG C;  1HGV A;  2KOG A;  3RL0 B;  1FZA A;  3HE5 B;  4LLH A;  1L4A C;  3HD7 D;  5AVU B;  5CCH A;  3MGN A;  1EQ7 A;  1FZB A;  4LGD E;  1E5W A;  2XDJ A;  1RE4 A;  2OYI A;  1A02 F;  1G1J A;  3NXS A;  5AVZ B;  3L4F A;  3SWF A;  1HGZ A;  2NPS C;  2YNY A;  2VRS A;  2QM7 A;  1HTL C;  2FFD B;  2E43 A;  1ZV8 A;  1CSB A;  1N7S A;  1SQQ K;  1T3J A;  5AW6 B;  3N4X A;  4I1L A;  1LTJ C;  5AVT B;  2C0X A;  3O8Z A;  5APS A;  1FZE A;  1IFI A;  1L4A B;  1HH0 A;  3CI9 A;  2N1T C;  1SQP K;  2P67 A;  1CZQ A;  1M1J A;  2NPS B;  2ZXE B;  3OAK A;  2WT7 B;  3A5T A;  1N73 A;  2WPS A;  3HTK B;  3H32 B;  1G2C A;  3VMY A;  1GZL A;  1GL2 D;  3RK3 D;  3BAS A;  1LWU C;  4ZKP A;  4N78 E;  4AQR D;  1JY2 O;  1HUC A;  1JY3 O;  1NTM K;  3A2A A;  4W7Z A;  3P8M C;  4N78 D;  3TNU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...