4N78E

The wave regulatory complex links diverse receptors to the actin cytoskeleton
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
67
structure length
67
Chain Sequence
DPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Cytoplasmic FMR1-interacting protein 1
total genus 31
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2013-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4n78E01
1L4AD 3HD7B 1URQA 3P8CE 3B5NC 5KJ7A 3B5NB 5CCGA 5CCGD 1NHLA 5KJ7D 1L4AC 2N1TA 1URQD 1JTHB 2WZ7A 3B5NA 5KJ7C 1URQB 4LGDE 3KYQA 4WY4B 3VOPA 1N7SD 1SFCD 3RK2B 1L4AB 3RL0C 1L4AA 3M0DC 4W7YA 1GL2B 2HFED 1N7SC 1SFCC 4JF7A 3B5ND 4W80A 4WY4C 3HD7A 2PP6A 2NPSB 3RK3B 3RL0D 2N1TC 1GL2D 1HVVA 1N7SB 1SFCB 4WY4A 3RK2D 2NPSA 2M8RA 2KOGA 4WY4D 3RL0B 3RK2C 1KILC 1GL2A 2HG5D 1N7SA 1SFCA 1KILD 2H8PD 1T3JA 2NPSD 3RK3D 4W7ZA 2N1TD 1KILA 1GL2C 3HD7C 3PP5A 1JTHA 2N1TB 3HD7D 5CCHC 1XTGB 4N78E 2NPSC 3RK3C 1KILB 2YMYA 5CCHD 5CCGC 3HTKB 1URQC 3TSIA 5CCHA 4OH8B 2XDJA
chains in the Genus database with same CATH superfamily
3Q5RA 2R5DA 2WMMA 4CPGA 1EC5A 1RE4C 1YHQP 4JYCA 3D70A 3AEGC 3HD7B 1PP9J 2IYPA 3B5NC 1HGZA 3P8CE 3GHGB 4PD4H 4RKUJ 4OH8B 2XV5A 2YMKA 3L74D 5GTHH 5CCGA 1LTJA 1RF1B 1L4AC 1NTMD 1NTZG 2AEMA 2FYZA 3V4QA 3I56P 1SS1A 2I8DA 3M0AA 1L0LJ 2IX7C 2M5AA 4NPEA 3TNUB 5CBNA 3KQGA 2YXQB 3AEFC 1NKNA 2KS1A 1AVOA 1FDMA 4EIJA 1YQ3C 3VMZA 2AXTE 5L8RJ 1MUUA 1VQPP 5KLVE 1YIJP 4BWNA 3TF5A 1HF9A 5APYA 3MD0A 1YI2P 1S5LE 3BCCE 1L4AB 3MHVA 5KLVG 3HRNA 2KK7A 1N7LA 2N9BA 1R5LA 1LWUC 1JEKA 2PGDA 2C9NY 1FZCA 1OWAA 5BU8B 4L76A 2OGUA 5AW2B 4Z1MH 3L74J 1M1JB 1MFTA 1NO4A 1SQVD 2KSEA 5TISH 1UIIA 2Q7CA 3HE4A 2YNYA 1LWUA 2N9YB 3AEDC 4L75A 4BRYA 4OGQC 5KKZB 1P84I 1HJBA 1Y47A 1AV1A 4R4MA 1PPJG 3KXDA 3FGAD 4W80A 1GMJA 2ZXXA 4WY4C 5AVUB 4DT0A 4R4LA 4YXWH 3QH9A 4ZKPA 1S2EA 4JYBA 1HWTC 1EZVE 2OYHC 2NPSB 3RK3B 2IZ0A 4IL6X 3SWFA 4K35A 5AW7B 5AW5B 1QVGO 4YTPC 1KV4A 5EFWB 3EQ2A 3RL0D 2N1TC 3O8ZA 2QJYB 1AQTA 1HVVA 1KB9I 2RN0A 2WQYC 2HR3A 2XU6A 2YKOA 3PTZA 1BSHA 2JWAA 2O1KA 3SWYA 2E5YA 3EWKA 1VQ5P 2K37A 3H1JJ 3VN0A 3CWBD 1WRGA 2A06E 1J1EB 1J1EC 3IF4A 3WU2E 3CMAP 1KORA 4TLFA 2H89C 3OA7A 1T3UA 1GU4A 1PGOA 3A0HE 2Q6QA 3HUSB 5KLVJ 2OYIC 3NTNA 1ZRTE 4Y28J 3H25A 3M0DA 3GF7A 3AECC 1L0NJ 1NGMB 1XTCC 2Y0EA 3RL0B 1LTJB 3Q3DA 1NTKK 3AEEC 1JY2N 4GDOA 1NVOA 1KB9E 4C46A 1ZRTD 3PJSK 1M1KQ 5CJ4A 2OYHB 1NAYA 1RQVA 3L72D 1N7SA 1SFCA 2JDIH 2YIUB 1GTWA 1KILD 2H8PD 1VQOP 1EZVI 1IFIA 2LR2A 2QE7H 3L4FA 3L70J 2E74B 2QJPB 1LT9B 1OW6A 3WUTA 1FE6A 4W7ZA 1GZLA 3CC4P 1NTZK 3G3ZA 2E42A 1FDOA 3M9HA 1KTMA 1KILA 1L0LG 1M1JC 2IFNA 2IYOA 4JBZA 3CPWO 2XKMA 1NH4A 3O6QB 2KZIA 2O01H 3EFGA 1DH3A 1CI6B 1LWUB 2R3SA 4KJMA 3D71A 2R44A 3M9BA 3I55P 2Y9ZA 1RQUA 1SLQA 3A2AA 5AW3B 1BGYE 2HODA 3CLQA 2WT7A 1FOSF 1AFOA 1KYOD 3H1IE 1HH0A 2E5TA 3N7NA 2QA4P 1M57D 5AVVB 1BGYG 3GF3A 1BE3J 4JQ0D 2O3JA 1Q2NA 5K5GB 3H1LG 2WSEJ 3QWOC 5AW0B 1MZ9A 2ZT9C 1OFCX 2KLVA 3TK1A 1ZR4A 1R8EA 2WVRA 3H6PA 3ITKA 2KNCB 5CJ0A 4A7PA 3L73G 1FU1A 1HGVA 2XDJA 1N8RQ 2KB7P 1YJWP 3BCCJ 1ZOYC 3VMAA 3CCUP 1OVVA 1PV3A 2FBWC 3GHGC 2YKPA 3B5NB 3EFFK 3AE7C 4ZKUA 1Y8AA 2Z4EA 1X9VA 2A45G 2C0XA 3CX5H 1JY3O 3P7KA 1NHLA 4HJGH 5KJ7D 5C39A 1WT6A 2A06D 4D6TJ 2FXPA 5GTIE 4GOEA 3L75G 3MZWB 3O6QA 3CCSP 1JTHB 3HUSA 2GUVA 1N86A 2WZ7A 4PV1D 3B5NA 3W67A 2AEJA 1IFPA 2FYUE 3OAKA 4LGDE 3Q5SA 3U1CA 1MFZA 2KI7B 3C9IA 3C1LA 4O9BA 1K8AQ 4MN4C 1IFNA 3L73E 3V5BA 1LTAC 2Y0DA 2FFDB 2W6BA 1VF5C 3CWBE 3RL0C 1L4AA 2JP3A 2UWJE 2O01J 5B66H 4KT0J 1FZEA 1AJYA 1SQQJ 1OIPA 3AEBC 1SQBK 1SQVJ 2WSSH 3LIDA 5AVZB 4LLHA 1M7LA 1G1IA 1LJ2A 1NAFA 3LW5J 3S9OA 2Q3EA 3HE5B 1KQGB 1LTTC 1YTZI 2R3CA 1KQLA 1M56D 1QEXA 2O01N 3CCMP 1Q7YQ 3H1JG 1EDKA 3NFQA 1L0NE 4UB6H 2G8YA 4EYYQ 3D6YA 2WSEH 1RF1A 4NPFX 2C0WA 2XZRA 1NTKJ 2JKVA 4EDFA 2WWWA 2ZJSE 4I6MC 4OGQD 3V2NA 1BDDA 1X79B 1PL5A 1FZAA 1RF0A 2RH0A 2PP6A 3CL3D 3CX5E 3HD7A 4D6TG 1FZGA 3VMXA 1BSNA 1S3JA 3BRVB 2FYUG 4I7ZB 5KAFE 2IFMA 3NXSA 1EXJA 1VQ6P 1Q90D 1KB9H 2KYVA 3IAOA 1JCCA 5APTA 1QVFO 1GW4A 1KQSO 1Z56A 2WSCH 2ZXEB 1IK7A 3H1JD 1PIXA 2R32A 1ZP0C 4WY4A 1S4XA 2A45I 3A0BH 3CXHH 2L91A 2W27A 2YKQA 2HLOA 2M8RA 3L37A 2HPCA 1NTZD 1RH5B 2W90A 4N3YB 2CK3H 3BCCD 4EI2A 2KZJA 1CW5A 5APVA 1DX7A 1QL2A 3H1HG 1RE3C 3A0BE 4ASVA 3G6EP 2KP8A 3TNUA 3TGUG 3R4YA 2QM8A 2WSFJ 5H2FE 1HBWA 1JNMA 3H1JE 4WVZA 3B71A 3BASA 3CX5I 3W68A 4C7RA 3CCVP 3CC7P 1RHZB 1JY3P 2E43A 1H0TB 1FAVA 2B87A 1GL2A 3L35A 2FYNC 2J59M 1KFMA 4H0LD 2HG5D 2QRXA 4RESB 1G2CA 2KSJA 3LW5H 1EXIA 1DD3A 1WMKA 3H1IJ 1EZVD 1FBMA 2BCCG 1T3JA 1SQXJ 1FS0E 3H1HD 4H0LB 1IFJA 4H13B 4IFDK 1U7MA 2C9LY 3RGUA 4H44B 2ZVOB 3HTKA 4I1LA 2Z5IA 1J1DB 1J1DC 4UB6E 2R5BA 3H32A 2ZVNB 3WMM0 1JB0J 2OYHA 1L0LE 1SQBD 1SQXG 2B89A 3VYIA 1GL2C 4H13C 3HD7C 3S1KA 1JMMA 2LXBA 2V4HA 2M5AB 1JY2P 1PPJE 3VTPC 1NOHA 3AE2C 3CXHE 1RF1C 1N73B 2LKMA 2I1JA 3L70D 2FYNB 2IPPA 5KAFH 5CCHC 3H1KE 3KDPB 2WSCJ 4PV1C 5BVZA 2YO2A 4GKGA 5AVXB 5KLIC 1FZFA 3CCLP 5APWA 1T2KC 3CXHD 1S5LX 1ZR2A 2P10A 1VQKP 1Y9BA 3M91A 1FZBA 3F89A 3JSVC 1URQC 3H1LJ 1SQBG 5APQA 1YQ4C 2BEQD 1KB9D 1QX8A 1RE3A 2E75D 1BGYJ 1GW3A 2Q5UA 2ZYDA 2PRRA 1KD1Q 1PP9D 3H1LE 4IL6H 1SQBJ 1JY3N 1SQVK 2ZT9D 3AE1C 2Q9IA 1H0TA 1NTMG 2KS1B 1OX3A 4L74A 5AW6B 5H2FH 3MUDA 2E76D 4XFJA 3V6IA 5B66E 1KYOH 5B5EE 1OW7A 5KJ7A 1LTBC 1ZXGA 3IFMA 3SFEC 2IBZE 4DCKA 1EDJA 4IOIH 2P2UA 4KHXA 1NTZE 4C7NA 1URQD 1VPCA 3L71G 2AXTH 2E76B 3B8EB 1S9KD 1YITP 2IBZG 1X8YA 1YBKA 2ITAA 2K9JB 3BRTB 3L72J 4ZNCA 2H43A 2DW3A 2QM7A 3HE4B 3MUDC 4BRYB 5GTHE 5KJ7C 3Q5PA 4M3LA 5E79H 2FY8A 1S9KE 1GD2E 3KYQA 1KQFB 5AW9B 4EOTA 3FWLA 1ZMEC 1JO5A 1LT9A 2IBZI 1USEA 2E76C 1W5CE 1NTKE 2KUBA 3MIWA 3MTUE 4Y99B 5DJTB 1UIXA 4UB8H 1SQVG 2K88A 3Q1MA 2BCCJ 2QVAA 5APXA 1G2CB 3L71D 2KXPB 1DEBA 2H88C 2QEXP 2B87B 2OTLP 1SQPE 1LT1A 3AE8C 4HYTB 1GU5A 1AA0A 2PFXA 3V2RA 2WT7B 2HFED 1DIPA 3MGNA 1VF5B 4RO0A 2FFDC 3GG2A 2W8ZA 1BCCE 1K04A 4HKZH 1ZW0A 2NRGA 1SQQE 4OWFA 1BGYD 1LTGC 1OXZA 3B5ND 3PRJA 4JF7A 4PD4D 1RE4A 2M3EA 2OQQA 3JCUE 3U1AA 4WB4A 1DD4A 3PLNA 5KLIB 1KN7A 1BCCD 2YXRB 1S1CX 3TGUD 3CCRP 1R5SA 1NTKD 4OVNF 2AXCA 1L0LD 1SQBE 1SQXK 2HYNA 2V7QH 2CPBA 3B4SA 3KZIE 4IFFA 1IFMA 1RF0C 3L71E 2FXOA 2GA1A 1SQPG 4K3AA 3A0HH 2I1KA 1N7SB 1JMBA 1SFCB 2QJKB 3BATA 2NPSA 3RK2D 3RL0g 2KIKA 1HTLC 4U3FJ 1YTZT 4H44C 2J5UA 4TT3H 5AW8B 2BEZF 2WPVB 3T97A 3KPEA 4ZMDA 1EZVG 2BCCD 2WPSA 2IZ1A 3F5HA 4H13D 3VP9A 4C7NB 5CHXA 2ZT9B 5E79E 2QJKC 2H7HA 1Q86Q 3CCQP 1BE3G 2ZFCA 1VDFA 3OW2O 1NTKG 1SQQG 4YXDC 3A5TA 2J58A 4HB1A 3P32A 3AE4C 1KC8Q 4AYCA 1IC2A 5GTIH 1LP1A 5AW1B 1KFNA 1IZNB 3E7KA 2MKVA 1IJDB 3RK2C 2SPZA 2P1JA 1PGQA 1QGKB 1M90Q 1RY3A 3AE3C 4HH2A 5AVYB 1J2JB 1LTSC 1OVUA 3L70G 3M06A 2A45H 1IFDA 1M8OB 1NU1E 2KLUA 2KNCA 2M3BA 3I5CA 3UIAA 2BASA 1K73Q 1FC2C 4IL6E 2FXMA 3P8MC 3Q2YA 4D6TD 1D7MA 2B88A 2CPSA 4U7JA 3S4RA 1P84H 1YJ9P 3E1RA 2WSFH 3D6ZA 1SQQD 4ASWA 3R2PA 3C8VA 4IFMA 5KTBA 2N1TD 1L2PA 3KZIH 1NJIQ 2QJPC 2E75B 3PHLA 2ZYAA 1NTZJ 3NMDA 4WBAA 2GUSA 1VQLP 3FX0A 2D2CB 3TGUE 1N73A 2K9JA 1VQ9P 1OVRA 1BCCG 1FDIA 1KYOE 3H1ID 2IDBA 3HD7D 3L73J 1SVFA 3H1KD 1VF5D 4N78D 4PD4I 3VMYA 1ZN5A 3TYYA 2G3AA 3CI9A 3AE9C 4QMAA 3RK3E 3RBZA 1JUNA 1ZV8A 3L75J 5CCHD 5CCGC 2GM4A 1YYCA 4PJ0H 4GODA 2JWDA 3HTKB 3L72E 3L73D 3OJAB 4UB8E 5APUA 3AEAC 3AE6C 1SQVE 3SSUA 3TSIA 5CCHA 1T2KD 1K9MQ 2POHA 2OYIB 1LTIC 1FOSE 1EDLA 1NTMK 4GT1A 4PJ0E 1H88A 3KHUA 1SQPK 2Q1KA 3BCCG 3A3YB 3II6A 3ZDMA 4GIFA 2D2CC 3H1HE 1SQPJ 1JY2O 3USSA 1L4AD 2A06G 1U7JA 1URQA 2E75C 2RMZA 1VQ4P 4WWIA 4DJGA 1VL2A 2O1JA 2B9BA 5AVTB 5CCGD 2JJLA 2WTYA 2BCCE 3N4XA 2QJYC 3JCUH 2QIWA 3IN6A 2N1TA 2WITA 4DZOA 5AW4B 3CCJP 2FYUD 3RBXA 3SFDC 2P58A 1GDTA 1H8AA 3L36A 1ZLLA 2WPRA 1G1JA 1URQB 4I2LC 2HPCB 2D2CD 5AVRB 1OMIA 1SP4A 4WY4B 1BCCJ 5TJHA 3VOPA 3V2QA 1N7SD 1LGHB 1SFCD 2ZYGA 3AE5C 3L74E 3MP7B 3RK2B 3G71P 2JO1A 1BDCA 5DJUB 3CWBG 2FYUK 1P84D 2NZ2A 4OGQB 1Q82Q 3P8CD 3CC2P 5B5EH 4AUWA 3L74G 3LIEA 3M0DC 5APSA 1L0NG 1N73C 3L72G 5AVWB 4PD4E 4BXLA 4NPDA 3GW6A 2K3RA 1NWQA 3CWBJ 1N2DC 3GLMA 1T6AA 4W7YA 3CXHI 2PAJA 4GOFA 1JM0A 1GL2B 5KAIE 1EDIA 2ZAEB 2YO3A 2Y9YA 1PPJD 1S72P 1T8ZA 2OARA 3L71J 3L75E 1HJ0A 1SQPD 1N7SC 1SFCC 3FXEA 4U3FG 4YPCA 2OTJP 1JCDA 2K1AA 1FJKA 1MV8A 2WPQA 3CX5D 4H0LC 3WUVA 2JR8A 1CZQA 3WU2H 1H89A 1M1JA 1E79H 4B86A 2AEFA 3CMEP 1X0TA 3H32B 4D6TE 3GHGA 1OW8A 1L0ND 2E74D 1U57A 1DEEG 1BE3D 1KILE 5AVQB 3TDKA 1PFIA 3L75D 1LNQA 3PH0A 2W6AA 5KLVD 3IR9A 1GL2D 2JEEA 2FYUJ 1NYHA 2MJZA 4RJTA 4XA4A 1X22A 1E5WA 2OYIA 1KYOI 2W6JH 3GMAA 1NU1K 4N6JA 4U3FD 5M1BA 5TISE 1YJNP 1CSBA 1VQ8P 4JPZB 2KOGA 1NTME 2P7JA 3CD6P 1SQQK 1LT9C 2P67A 2IBZD 2E74C 1VQMP 1NU1D 1GK6A 1QLED 3K5BA 1AVYA 1CI6A 1VQNP 1FJPA 4H44D 2Z5HA 4DOJA 3V2PA 3U59A 1EQ7A 1K05A 2YIUC 5AVSB 3SWKA 1TU3F 3A7OA 3V4WA 4WY4D 5KLVK 2V7QJ 2LXCB 3H1LD 1PZQA 4U3FE 4Y99C 1PP9E 2K9YA 3WUUA 4LC1A 2Y0CA 2XNXA 1NKZB 1L0NK 1KILC 1KMIZ 1LTJC 2RKLA 4I7ZC 3VP8A 2Q3IA 5BU5A 2L5GB 3H1IG 2XNDH 1OZHA 3HUSC 1FZCB 2QSIA 1W2EA 2W83C 3FWNA 5KAIH 1AQ5A 1Q81Q 1NU1G 2NPSD 3FXDA 3RK3D 2FFDA 1KZUB 3ABVC 4AQRD 2QG4A 2OYOA 1SQXE 3E1IA 1A02F 1NU1J 2HODB 4L73A 3BVHA 2FKWB 1LP1B 5CMZA 1A02J 3PP5A 4XE5B 1IO4A 1BE3E 1FZCC 1JTHA 2N1TB 3G9RA 5CBOA 1W2BO 1SQXD 3H1HJ 1L0LK 1GK4A 1HUCA 1IK9A 1MKMA 1QL1A 3HE5A 1XTGB 4N78E 1S5LH 2NPSC 3JC22 1KILB 3M9QA 3RK3C 3L70E 2M0BA 3CCEP 3T97B 2YMYA 1VQ7P 1P84E 1JOCA 3H1KJ 3H1KG 3TGUJ 1PP9G 1NTMJ 4PV1B 3G4SP 2VRSA 5KKZC 1PGPA 1USDA 2OTKE 1PGJA
chains in the Genus database with same CATH topology
2R5DA 1RE4C 4JYCA 3HD7B 3P8CE 3B5NC 1HGZA 3GHGB 2XV5A 5CCGA 1LTJA 1RF1B 1L4AC 2FYZA 3V4QA 3M0AA 2IX7C 3TNUB 3KQGA 1NKNA 1FDMA 4EIJA 3VMZA 1MUUA 5APYA 3MD0A 1L4AB 3HRNA 1N7LA 2N9BA 2C9NY 1LWUC 1FZCA 1OWAA 5BU8B 5AW2B 1M1JB 1NO4A 2Q7CA 3HE4A 2YNYA 1LWUA 1HJBA 5AVUB 4W80A 4WY4C 4ZKPA 4JYBA 1HWTC 2OYHC 2NPSB 3RK3B 3SWFA 5AW7B 5AW5B 3EQ2A 3RL0D 2N1TC 3O8ZA 1HVVA 2XU6A 2YKOA 2O1KA 3SWYA 3VN0A 1WRGA 1J1EB 1J1EC 3OA7A 1T3UA 1GU4A 2OYIC 3HUSB 3NTNA 3M0DA 1XTCC 3RL0B 1LTJB 1NTKK 1JY2N 4C46A 5CJ4A 2OYHB 1N7SA 1SFCA 1GTWA 1KILD 2H8PD 1IFIA 3L4FA 1LT9B 4W7ZA 1GZLA 1NTZK 3G3ZA 2E42A 3M9HA 1KILA 1M1JC 2IFNA 2XKMA 1NH4A 2O01H 3EFGA 1DH3A 1CI6B 1LWUB 3M9BA 1SLQA 3A2AA 5AW3B 2HODA 3CLQA 2WT7A 1FOSF 1AFOA 1HH0A 3N7NA 5AVVB 5AW0B 1MZ9A 1ZR4A 2KLVA 3TK1A 4IFDK 3H6PA 5CJ0A 2XDJA 1HGVA 1FU1A 2KB7P 3GHGC 2YKPA 3B5NB 2Z4EA 4ZKUA 1X9VA 2A45G 2C0XA 3P7KA 1JY3O 1NHLA 5KJ7D 1WT6A 1JTHB 3HUSA 2GUVA 1N86A 2WZ7A 3B5NA 3OAKA 4LGDE 1MFZA 3C9IA 4O9BA 1IFNA 3V5BA 1LTAC 2FFDB 2W6BA 3RL0C 1L4AA 1FZEA 1SQBK 3LIDA 5AVZB 4LLHA 1M7LA 1G1IA 1NAFA 3HE5B 1LTTC 1YTZI 2R3CA 1KQLA 3NFQA 2WSEH 1RF1A 2C0WA 2XZRA 2WWWA 4I6MC 3U1CA 3V2NA 4C7NA 1X79B 1ZR2A 3HD7A 1FZAA 1RF0A 2PP6A 3CL3D 1FZGA 3VMXA 3BRVB 2IFMA 3NXSA 2KYVA 5APTA 1JCCA 1GW4A 1Z56A 2WSCH 2ZXEB 2R32A 4WY4A 2A45I 2W27A 2HPCA 2YKQA 2HLOA 2M8RA 3L37A 4N3YB 1DX7A 5APVA 1QL2A 1RE3C 2KP8A 3TNUA 2QM8A 1HBWA 1JNMA 3BASA 4C7RA 1JY3P 2E43A 1FAVA 1GL2A 3L35A 2J59M 1KFMA 2HG5D 4RESB 1G2CA 2KSJA 3LW5H 1FBMA 1T3JA 1IFJA 2C9LY 3HTKA 4I1LA 2Z5IA 1J1DB 1J1DC 3WMM0 2R5BA 3H32A 2OYHA 1RF1C 3VYIA 1GL2C 3HD7C 1JMMA 1JY2P 3VTPC 1NOHA 1N73B 2LKMA 2I1JA 2IPPA 5CCHC 3KDPB 5BVZA 2YO2A 4GKGA 5AVXB 1FZFA 5APWA 1T2KC 3M91A 1FZBA 1URQC 5APQA 1RE3A 2Q5UA 1GW3A 1SQVK 1JY3N 2Q9IA 5AW6B 3MUDA 5KJ7A 1LTBC 3IFMA 2P2UA 4KHXA 1URQD 1VPCA 1S9KD 3B8EB 1X8YA 3BRTB 2H43A 2QM7A 3HE4B 5KJ7C 4M3LA 1S9KE 1GD2E 3KYQA 5AW9B 4EOTA 1JO5A 1LT9A 3MIWA 3MTUE 4Y99B 5APXA 1G2CB 1DEBA 4HYTB 1GU5A 3V2RA 2WT7B 2HFED 3MGNA 2FFDC 1LTGC 1OXZA 3B5ND 4JF7A 3U1AA 1RE4A 4WB4A 1SQXK 2HYNA 2CPBA 4IFFA 1IFMA 1RF0C 2WTYA 2I1KA 1N7SB 1SFCB 3RK2D 3BATA 2NPSA 1HTLC 1YTZT 5AW8B 3T97A 3KPEA 2WPSA 4C7NB 3VP9A 5CHXA 2H7HA 2ZFCA 1VDFA 3A5TA 2J58A 3P32A 4AYCA 1IC2A 5AW1B 1KFNA 3RK2C 1IJDB 1FOSE 2P1JA 1RY3A 4HH2A 5AVYB 1J2JB 1LTSC 3M06A 2A45H 1IFDA 3I5CA 3UIAA 2M3BA 2BASA 2FXMA 3P8MC 2CPSA 2WSFH 3R2PA 4IFMA 5KTBA 2N1TD 3NMDA 4WBAA 2GUSA 1N73A 3HD7D 1SVFA 4N78D 3VMYA 1ZN5A 3TYYA 3CI9A 1JUNA 1ZV8A 5CCHD 5CCGC 2GM4A 1YYCA 3HTKB 3OJAB 5APUA 3TSIA 1PFIA 1CW5A 5CCHA 1T2KD 2OYIB 2POHA 1LTIC 1NTMK 4GT1A 1H88A 1SQPK 3A3YB 3II6A 4GIFA 1JY2O 1L4AD 1URQA 2O1JA 5AVTB 5CCGD 2JJLA 3N4XA 2N1TA 2WITA 4DZOA 5AW4B 1GDTA 1H8AA 3L36A 1ZLLA 2WPRA 1G1JA 1URQB 4I2LC 2HPCB 5AVRB 1SP4A 4WY4B 3VOPA 3V2QA 1N7SD 1LGHB 1SFCD 3RK2B 4AUWA 2FYUK 3P8CD 3LIEA 3M0DC 5APSA 1N73C 5AVWB 1NWQA 1N2DC 4W7YA 2PAJA 1GL2B 2YO3A 1T8ZA 2OARA 1N7SC 1SFCC 1JCDA 1FJKA 1MV8A 2WPQA 1CZQA 1H89A 1M1JA 4B86A 3H32B 3GHGA 5AVQB 2W6AA 3IR9A 1GL2D 2JEEA 2MJZA 4XA4A 1E5WA 2OYIA 1NU1K 4N6JA 1CSBA 2KOGA 2P7JA 1SQQK 1LT9C 2P67A 1GK6A 1CI6A 1FJPA 2Z5HA 4DOJA 3V2PA 3U59A 1EQ7A 5AVSB 3V4WA 3A7OA 4WY4D 5KLVK 4Y99C 4LC1A 2XNXA 1NKZB 1L0NK 1KILC 3VP8A 1LTJC 2Q3IA 5BU5A 2L5GB 3HUSC 1FZCB 1W2EA 1AQ5A 2NPSD 3RK3D 2FFDA 1KZUB 4AQRD 3E1IA 1A02F 2HODB 3BVHA 2FKWB 1A02J 5CMZA 3PP5A 4XE5B 1IO4A 1FZCC 1JTHA 2N1TB 1L0LK 1GK4A 1HUCA 1IK9A 1QL1A 3HE5A 1XTGB 4N78E 2NPSC 3RK3C 1KILB 3M9QA 2YMYA 1JOCA 2VRSA 4OH8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L4A D;  3HD7 B;  1URQ A;  3P8C E;  3B5N C;  5KJ7 A;  3B5N B;  5CCG A;  5CCG D;  1NHL A;  5KJ7 D;  1L4A C;  2N1T A;  1URQ D;  1JTH B;  2WZ7 A;  3B5N A;  5KJ7 C;  1URQ B;  4LGD E;  3KYQ A;  4WY4 B;  3VOP A;  1N7S D;  1SFC D;  3RK2 B;  1L4A B;  3RL0 C;  1L4A A;  3M0D C;  4W7Y A;  1GL2 B;  2HFE D;  1N7S C;  1SFC C;  4JF7 A;  3B5N D;  4W80 A;  4WY4 C;  3HD7 A;  2PP6 A;  2NPS B;  3RK3 B;  3RL0 D;  2N1T C;  1GL2 D;  1HVV A;  1N7S B;  1SFC B;  4WY4 A;  3RK2 D;  2NPS A;  2M8R A;  2KOG A;  4WY4 D;  3RL0 B;  3RK2 C;  1KIL C;  1GL2 A;  2HG5 D;  1N7S A;  1SFC A;  1KIL D;  2H8P D;  1T3J A;  2NPS D;  3RK3 D;  4W7Z A;  2N1T D;  1KIL A;  1GL2 C;  3HD7 C;  3PP5 A;  1JTH A;  2N1T B;  3HD7 D;  5CCH C;  1XTG B;  4N78 E;  2NPS C;  3RK3 C;  1KIL B;  2YMY A;  5CCH D;  5CCG C;  3HTK B;  1URQ C;  3TSI A;  5CCH A;  4OH8 B;  2XDJ A; 
#chains in the Genus database with same CATH topology
 3Q5R A;  2R5D A;  2WMM A;  4CPG A;  1EC5 A;  1RE4 C;  1YHQ P;  4JYC A;  3D70 A;  3AEG C;  3HD7 B;  1PP9 J;  2IYP A;  3B5N C;  1HGZ A;  3P8C E;  3GHG B;  4PD4 H;  4RKU J;  4OH8 B;  2XV5 A;  2YMK A;  3L74 D;  5GTH H;  5CCG A;  1LTJ A;  1RF1 B;  1L4A C;  1NTM D;  1NTZ G;  2AEM A;  2FYZ A;  3V4Q A;  3I56 P;  1SS1 A;  2I8D A;  3M0A A;  1L0L J;  2IX7 C;  2M5A A;  4NPE A;  3TNU B;  5CBN A;  3KQG A;  2YXQ B;  3AEF C;  1NKN A;  2KS1 A;  1AVO A;  1FDM A;  4EIJ A;  1YQ3 C;  3VMZ A;  2AXT E;  5L8R J;  1MUU A;  1VQP P;  5KLV E;  1YIJ P;  4BWN A;  3TF5 A;  1HF9 A;  5APY A;  3MD0 A;  1YI2 P;  1S5L E;  3BCC E;  1L4A B;  3MHV A;  5KLV G;  3HRN A;  2KK7 A;  1N7L A;  2N9B A;  1R5L A;  1LWU C;  1JEK A;  2PGD A;  2C9N Y;  1FZC A;  1OWA A;  5BU8 B;  4L76 A;  2OGU A;  5AW2 B;  4Z1M H;  3L74 J;  1M1J B;  1MFT A;  1NO4 A;  1SQV D;  2KSE A;  5TIS H;  1UII A;  2Q7C A;  3HE4 A;  2YNY A;  1LWU A;  2N9Y B;  3AED C;  4L75 A;  4BRY A;  4OGQ C;  5KKZ B;  1P84 I;  1HJB A;  1Y47 A;  1AV1 A;  4R4M A;  1PPJ G;  3KXD A;  3FGA D;  4W80 A;  1GMJ A;  2ZXX A;  4WY4 C;  5AVU B;  4DT0 A;  4R4L A;  4YXW H;  3QH9 A;  4ZKP A;  1S2E A;  4JYB A;  1HWT C;  1EZV E;  2OYH C;  2NPS B;  3RK3 B;  2IZ0 A;  4IL6 X;  3SWF A;  4K35 A;  5AW7 B;  5AW5 B;  1QVG O;  4YTP C;  1KV4 A;  5EFW B;  3EQ2 A;  3RL0 D;  2N1T C;  3O8Z A;  2QJY B;  1AQT A;  1HVV A;  1KB9 I;  2RN0 A;  2WQY C;  2HR3 A;  2XU6 A;  2YKO A;  3PTZ A;  1BSH A;  2JWA A;  2O1K A;  3SWY A;  2E5Y A;  3EWK A;  1VQ5 P;  2K37 A;  3H1J J;  3VN0 A;  3CWB D;  1WRG A;  2A06 E;  1J1E B;  1J1E C;  3IF4 A;  3WU2 E;  3CMA P;  1KOR A;  4TLF A;  2H89 C;  3OA7 A;  1T3U A;  1GU4 A;  1PGO A;  3A0H E;  2Q6Q A;  3HUS B;  5KLV J;  2OYI C;  3NTN A;  1ZRT E;  4Y28 J;  3H25 A;  3M0D A;  3GF7 A;  3AEC C;  1L0N J;  1NGM B;  1XTC C;  2Y0E A;  3RL0 B;  1LTJ B;  3Q3D A;  1NTK K;  3AEE C;  1JY2 N;  4GDO A;  1NVO A;  1KB9 E;  4C46 A;  1ZRT D;  3PJS K;  1M1K Q;  5CJ4 A;  2OYH B;  1NAY A;  1RQV A;  3L72 D;  1N7S A;  1SFC A;  2JDI H;  2YIU B;  1GTW A;  1KIL D;  2H8P D;  1VQO P;  1EZV I;  1IFI A;  2LR2 A;  2QE7 H;  3L4F A;  3L70 J;  2E74 B;  2QJP B;  1LT9 B;  1OW6 A;  3WUT A;  1FE6 A;  4W7Z A;  1GZL A;  3CC4 P;  1NTZ K;  3G3Z A;  2E42 A;  1FDO A;  3M9H A;  1KTM A;  1KIL A;  1L0L G;  1M1J C;  2IFN A;  2IYO A;  4JBZ A;  3CPW O;  2XKM A;  1NH4 A;  3O6Q B;  2KZI A;  2O01 H;  3EFG A;  1DH3 A;  1CI6 B;  1LWU B;  2R3S A;  4KJM A;  3D71 A;  2R44 A;  3M9B A;  3I55 P;  2Y9Z A;  1RQU A;  1SLQ A;  3A2A A;  5AW3 B;  1BGY E;  2HOD A;  3CLQ A;  2WT7 A;  1FOS F;  1AFO A;  1KYO D;  3H1I E;  1HH0 A;  2E5T A;  3N7N A;  2QA4 P;  1M57 D;  5AVV B;  1BGY G;  3GF3 A;  1BE3 J;  4JQ0 D;  2O3J A;  1Q2N A;  5K5G B;  3H1L G;  2WSE J;  3QWO C;  5AW0 B;  1MZ9 A;  2ZT9 C;  1OFC X;  2KLV A;  3TK1 A;  1ZR4 A;  1R8E A;  2WVR A;  3H6P A;  3ITK A;  2KNC B;  5CJ0 A;  4A7P A;  3L73 G;  1FU1 A;  1HGV A;  2XDJ A;  1N8R Q;  2KB7 P;  1YJW P;  3BCC J;  1ZOY C;  3VMA A;  3CCU P;  1OVV A;  1PV3 A;  2FBW C;  3GHG C;  2YKP A;  3B5N B;  3EFF K;  3AE7 C;  4ZKU A;  1Y8A A;  2Z4E A;  1X9V A;  2A45 G;  2C0X A;  3CX5 H;  1JY3 O;  3P7K A;  1NHL A;  4HJG H;  5KJ7 D;  5C39 A;  1WT6 A;  2A06 D;  4D6T J;  2FXP A;  5GTI E;  4GOE A;  3L75 G;  3MZW B;  3O6Q A;  3CCS P;  1JTH B;  3HUS A;  2GUV A;  1N86 A;  2WZ7 A;  4PV1 D;  3B5N A;  3W67 A;  2AEJ A;  1IFP A;  2FYU E;  3OAK A;  4LGD E;  3Q5S A;  3U1C A;  1MFZ A;  2KI7 B;  3C9I A;  3C1L A;  4O9B A;  1K8A Q;  4MN4 C;  1IFN A;  3L73 E;  3V5B A;  1LTA C;  2Y0D A;  2FFD B;  2W6B A;  1VF5 C;  3CWB E;  3RL0 C;  1L4A A;  2JP3 A;  2UWJ E;  2O01 J;  5B66 H;  4KT0 J;  1FZE A;  1AJY A;  1SQQ J;  1OIP A;  3AEB C;  1SQB K;  1SQV J;  2WSS H;  3LID A;  5AVZ B;  4LLH A;  1M7L A;  1G1I A;  1LJ2 A;  1NAF A;  3LW5 J;  3S9O A;  2Q3E A;  3HE5 B;  1KQG B;  1LTT C;  1YTZ I;  2R3C A;  1KQL A;  1M56 D;  1QEX A;  2O01 N;  3CCM P;  1Q7Y Q;  3H1J G;  1EDK A;  3NFQ A;  1L0N E;  4UB6 H;  2G8Y A;  4EYY Q;  3D6Y A;  2WSE H;  1RF1 A;  4NPF X;  2C0W A;  2XZR A;  1NTK J;  2JKV A;  4EDF A;  2WWW A;  2ZJS E;  4I6M C;  4OGQ D;  3V2N A;  1BDD A;  1X79 B;  1PL5 A;  1FZA A;  1RF0 A;  2RH0 A;  2PP6 A;  3CL3 D;  3CX5 E;  3HD7 A;  4D6T G;  1FZG A;  3VMX A;  1BSN A;  1S3J A;  3BRV B;  2FYU G;  4I7Z B;  5KAF E;  2IFM A;  3NXS A;  1EXJ A;  1VQ6 P;  1Q90 D;  1KB9 H;  2KYV A;  3IAO A;  1JCC A;  5APT A;  1QVF O;  1GW4 A;  1KQS O;  1Z56 A;  2WSC H;  2ZXE B;  1IK7 A;  3H1J D;  1PIX A;  2R32 A;  1ZP0 C;  4WY4 A;  1S4X A;  2A45 I;  3A0B H;  3CXH H;  2L91 A;  2W27 A;  2YKQ A;  2HLO A;  2M8R A;  3L37 A;  2HPC A;  1NTZ D;  1RH5 B;  2W90 A;  4N3Y B;  2CK3 H;  3BCC D;  4EI2 A;  2KZJ A;  1CW5 A;  5APV A;  1DX7 A;  1QL2 A;  3H1H G;  1RE3 C;  3A0B E;  4ASV A;  3G6E P;  2KP8 A;  3TNU A;  3TGU G;  3R4Y A;  2QM8 A;  2WSF J;  5H2F E;  1HBW A;  1JNM A;  3H1J E;  4WVZ A;  3B71 A;  3BAS A;  3CX5 I;  3W68 A;  4C7R A;  3CCV P;  3CC7 P;  1RHZ B;  1JY3 P;  2E43 A;  1H0T B;  1FAV A;  2B87 A;  1GL2 A;  3L35 A;  2FYN C;  2J59 M;  1KFM A;  4H0L D;  2HG5 D;  2QRX A;  4RES B;  1G2C A;  2KSJ A;  3LW5 H;  1EXI A;  1DD3 A;  1WMK A;  3H1I J;  1EZV D;  1FBM A;  2BCC G;  1T3J A;  1SQX J;  1FS0 E;  3H1H D;  4H0L B;  1IFJ A;  4H13 B;  4IFD K;  1U7M A;  2C9L Y;  3RGU A;  4H44 B;  2ZVO B;  3HTK A;  4I1L A;  2Z5I A;  1J1D B;  1J1D C;  4UB6 E;  2R5B A;  3H32 A;  2ZVN B;  3WMM 0;  1JB0 J;  2OYH A;  1L0L E;  1SQB D;  1SQX G;  2B89 A;  3VYI A;  1GL2 C;  4H13 C;  3HD7 C;  3S1K A;  1JMM A;  2LXB A;  2V4H A;  2M5A B;  1JY2 P;  1PPJ E;  3VTP C;  1NOH A;  3AE2 C;  3CXH E;  1RF1 C;  1N73 B;  2LKM A;  2I1J A;  3L70 D;  2FYN B;  2IPP A;  5KAF H;  5CCH C;  3H1K E;  3KDP B;  2WSC J;  4PV1 C;  5BVZ A;  2YO2 A;  4GKG A;  5AVX B;  5KLI C;  1FZF A;  3CCL P;  5APW A;  1T2K C;  3CXH D;  1S5L X;  1ZR2 A;  2P10 A;  1VQK P;  1Y9B A;  3M91 A;  1FZB A;  3F89 A;  3JSV C;  1URQ C;  3H1L J;  1SQB G;  5APQ A;  1YQ4 C;  2BEQ D;  1KB9 D;  1QX8 A;  1RE3 A;  2E75 D;  1BGY J;  1GW3 A;  2Q5U A;  2ZYD A;  2PRR A;  1KD1 Q;  1PP9 D;  3H1L E;  4IL6 H;  1SQB J;  1JY3 N;  1SQV K;  2ZT9 D;  3AE1 C;  2Q9I A;  1H0T A;  1NTM G;  2KS1 B;  1OX3 A;  4L74 A;  5AW6 B;  5H2F H;  3MUD A;  2E76 D;  4XFJ A;  3V6I A;  5B66 E;  1KYO H;  5B5E E;  1OW7 A;  5KJ7 A;  1LTB C;  1ZXG A;  3IFM A;  3SFE C;  2IBZ E;  4DCK A;  1EDJ A;  4IOI H;  2P2U A;  4KHX A;  1NTZ E;  4C7N A;  1URQ D;  1VPC A;  3L71 G;  2AXT H;  2E76 B;  3B8E B;  1S9K D;  1YIT P;  2IBZ G;  1X8Y A;  1YBK A;  2ITA A;  2K9J B;  3BRT B;  3L72 J;  4ZNC A;  2H43 A;  2DW3 A;  2QM7 A;  3HE4 B;  3MUD C;  4BRY B;  5GTH E;  5KJ7 C;  3Q5P A;  4M3L A;  5E79 H;  2FY8 A;  1S9K E;  1GD2 E;  3KYQ A;  1KQF B;  5AW9 B;  4EOT A;  3FWL A;  1ZME C;  1JO5 A;  1LT9 A;  2IBZ I;  1USE A;  2E76 C;  1W5C E;  1NTK E;  2KUB A;  3MIW A;  3MTU E;  4Y99 B;  5DJT B;  1UIX A;  4UB8 H;  1SQV G;  2K88 A;  3Q1M A;  2BCC J;  2QVA A;  5APX A;  1G2C B;  3L71 D;  2KXP B;  1DEB A;  2H88 C;  2QEX P;  2B87 B;  2OTL P;  1SQP E;  1LT1 A;  3AE8 C;  4HYT B;  1GU5 A;  1AA0 A;  2PFX A;  3V2R A;  2WT7 B;  2HFE D;  1DIP A;  3MGN A;  1VF5 B;  4RO0 A;  2FFD C;  3GG2 A;  2W8Z A;  1BCC E;  1K04 A;  4HKZ H;  1ZW0 A;  2NRG A;  1SQQ E;  4OWF A;  1BGY D;  1LTG C;  1OXZ A;  3B5N D;  3PRJ A;  4JF7 A;  4PD4 D;  1RE4 A;  2M3E A;  2OQQ A;  3JCU E;  3U1A A;  4WB4 A;  1DD4 A;  3PLN A;  5KLI B;  1KN7 A;  1BCC D;  2YXR B;  1S1C X;  3TGU D;  3CCR P;  1R5S A;  1NTK D;  4OVN F;  2AXC A;  1L0L D;  1SQB E;  1SQX K;  2HYN A;  2V7Q H;  2CPB A;  3B4S A;  3KZI E;  4IFF A;  1IFM A;  1RF0 C;  3L71 E;  2FXO A;  2GA1 A;  1SQP G;  4K3A A;  3A0H H;  2I1K A;  1N7S B;  1JMB A;  1SFC B;  2QJK B;  3BAT A;  2NPS A;  3RK2 D;  3RL0 g;  2KIK A;  1HTL C;  4U3F J;  1YTZ T;  4H44 C;  2J5U A;  4TT3 H;  5AW8 B;  2BEZ F;  2WPV B;  3T97 A;  3KPE A;  4ZMD A;  1EZV G;  2BCC D;  2WPS A;  2IZ1 A;  3F5H A;  4H13 D;  3VP9 A;  4C7N B;  5CHX A;  2ZT9 B;  5E79 E;  2QJK C;  2H7H A;  1Q86 Q;  3CCQ P;  1BE3 G;  2ZFC A;  1VDF A;  3OW2 O;  1NTK G;  1SQQ G;  4YXD C;  3A5T A;  2J58 A;  4HB1 A;  3P32 A;  3AE4 C;  1KC8 Q;  4AYC A;  1IC2 A;  5GTI H;  1LP1 A;  5AW1 B;  1KFN A;  1IZN B;  3E7K A;  2MKV A;  1IJD B;  3RK2 C;  2SPZ A;  2P1J A;  1PGQ A;  1QGK B;  1M90 Q;  1RY3 A;  3AE3 C;  4HH2 A;  5AVY B;  1J2J B;  1LTS C;  1OVU A;  3L70 G;  3M06 A;  2A45 H;  1IFD A;  1M8O B;  1NU1 E;  2KLU A;  2KNC A;  2M3B A;  3I5C A;  3UIA A;  2BAS A;  1K73 Q;  1FC2 C;  4IL6 E;  2FXM A;  3P8M C;  3Q2Y A;  4D6T D;  1D7M A;  2B88 A;  2CPS A;  4U7J A;  3S4R A;  1P84 H;  1YJ9 P;  3E1R A;  2WSF H;  3D6Z A;  1SQQ D;  4ASW A;  3R2P A;  3C8V A;  4IFM A;  5KTB A;  2N1T D;  1L2P A;  3KZI H;  1NJI Q;  2QJP C;  2E75 B;  3PHL A;  2ZYA A;  1NTZ J;  3NMD A;  4WBA A;  2GUS A;  1VQL P;  3FX0 A;  2D2C B;  3TGU E;  1N73 A;  2K9J A;  1VQ9 P;  1OVR A;  1BCC G;  1FDI A;  1KYO E;  3H1I D;  2IDB A;  3HD7 D;  3L73 J;  1SVF A;  3H1K D;  1VF5 D;  4N78 D;  4PD4 I;  3VMY A;  1ZN5 A;  3TYY A;  2G3A A;  3CI9 A;  3AE9 C;  4QMA A;  3RK3 E;  3RBZ A;  1JUN A;  1ZV8 A;  3L75 J;  5CCH D;  5CCG C;  2GM4 A;  1YYC A;  4PJ0 H;  4GOD A;  2JWD A;  3HTK B;  3L72 E;  3L73 D;  3OJA B;  4UB8 E;  5APU A;  3AEA C;  3AE6 C;  1SQV E;  3SSU A;  3TSI A;  5CCH A;  1T2K D;  1K9M Q;  2POH A;  2OYI B;  1LTI C;  1FOS E;  1EDL A;  1NTM K;  4GT1 A;  4PJ0 E;  1H88 A;  3KHU A;  1SQP K;  2Q1K A;  3BCC G;  3A3Y B;  3II6 A;  3ZDM A;  4GIF A;  2D2C C;  3H1H E;  1SQP J;  1JY2 O;  3USS A;  1L4A D;  2A06 G;  1U7J A;  1URQ A;  2E75 C;  2RMZ A;  1VQ4 P;  4WWI A;  4DJG A;  1VL2 A;  2O1J A;  2B9B A;  5AVT B;  5CCG D;  2JJL A;  2WTY A;  2BCC E;  3N4X A;  2QJY C;  3JCU H;  2QIW A;  3IN6 A;  2N1T A;  2WIT A;  4DZO A;  5AW4 B;  3CCJ P;  2FYU D;  3RBX A;  3SFD C;  2P58 A;  1GDT A;  1H8A A;  3L36 A;  1ZLL A;  2WPR A;  1G1J A;  1URQ B;  4I2L C;  2HPC B;  2D2C D;  5AVR B;  1OMI A;  1SP4 A;  4WY4 B;  1BCC J;  5TJH A;  3VOP A;  3V2Q A;  1N7S D;  1LGH B;  1SFC D;  2ZYG A;  3AE5 C;  3L74 E;  3MP7 B;  3RK2 B;  3G71 P;  2JO1 A;  1BDC A;  5DJU B;  3CWB G;  2FYU K;  1P84 D;  2NZ2 A;  4OGQ B;  1Q82 Q;  3P8C D;  3CC2 P;  5B5E H;  4AUW A;  3L74 G;  3LIE A;  3M0D C;  5APS A;  1L0N G;  1N73 C;  3L72 G;  5AVW B;  4PD4 E;  4BXL A;  4NPD A;  3GW6 A;  2K3R A;  1NWQ A;  3CWB J;  1N2D C;  3GLM A;  1T6A A;  4W7Y A;  3CXH I;  2PAJ A;  4GOF A;  1JM0 A;  1GL2 B;  5KAI E;  1EDI A;  2ZAE B;  2YO3 A;  2Y9Y A;  1PPJ D;  1S72 P;  1T8Z A;  2OAR A;  3L71 J;  3L75 E;  1HJ0 A;  1SQP D;  1N7S C;  1SFC C;  3FXE A;  4U3F G;  4YPC A;  2OTJ P;  1JCD A;  2K1A A;  1FJK A;  1MV8 A;  2WPQ A;  3CX5 D;  4H0L C;  3WUV A;  2JR8 A;  1CZQ A;  3WU2 H;  1H89 A;  1M1J A;  1E79 H;  4B86 A;  2AEF A;  3CME P;  1X0T A;  3H32 B;  4D6T E;  3GHG A;  1OW8 A;  1L0N D;  2E74 D;  1U57 A;  1DEE G;  1BE3 D;  1KIL E;  5AVQ B;  3TDK A;  1PFI A;  3L75 D;  1LNQ A;  3PH0 A;  2W6A A;  5KLV D;  3IR9 A;  1GL2 D;  2JEE A;  2FYU J;  1NYH A;  2MJZ A;  4RJT A;  4XA4 A;  1X22 A;  1E5W A;  2OYI A;  1KYO I;  2W6J H;  3GMA A;  1NU1 K;  4N6J A;  4U3F D;  5M1B A;  5TIS E;  1YJN P;  1CSB A;  1VQ8 P;  4JPZ B;  2KOG A;  1NTM E;  2P7J A;  3CD6 P;  1SQQ K;  1LT9 C;  2P67 A;  2IBZ D;  2E74 C;  1VQM P;  1NU1 D;  1GK6 A;  1QLE D;  3K5B A;  1AVY A;  1CI6 A;  1VQN P;  1FJP A;  4H44 D;  2Z5H A;  4DOJ A;  3V2P A;  3U59 A;  1EQ7 A;  1K05 A;  2YIU C;  5AVS B;  3SWK A;  1TU3 F;  3A7O A;  3V4W A;  4WY4 D;  5KLV K;  2V7Q J;  2LXC B;  3H1L D;  1PZQ A;  4U3F E;  4Y99 C;  1PP9 E;  2K9Y A;  3WUU A;  4LC1 A;  2Y0C A;  2XNX A;  1NKZ B;  1L0N K;  1KIL C;  1KMI Z;  1LTJ C;  2RKL A;  4I7Z C;  3VP8 A;  2Q3I A;  5BU5 A;  2L5G B;  3H1I G;  2XND H;  1OZH A;  3HUS C;  1FZC B;  2QSI A;  1W2E A;  2W83 C;  3FWN A;  5KAI H;  1AQ5 A;  1Q81 Q;  1NU1 G;  2NPS D;  3FXD A;  3RK3 D;  2FFD A;  1KZU B;  3ABV C;  4AQR D;  2QG4 A;  2OYO A;  1SQX E;  3E1I A;  1A02 F;  1NU1 J;  2HOD B;  4L73 A;  3BVH A;  2FKW B;  1LP1 B;  5CMZ A;  1A02 J;  3PP5 A;  4XE5 B;  1IO4 A;  1BE3 E;  1FZC C;  1JTH A;  2N1T B;  3G9R A;  5CBO A;  1W2B O;  1SQX D;  3H1H J;  1L0L K;  1GK4 A;  1HUC A;  1IK9 A;  1MKM A;  1QL1 A;  3HE5 A;  1XTG B;  4N78 E;  1S5L H;  2NPS C;  3JC2 2;  1KIL B;  3M9Q A;  3RK3 C;  3L70 E;  2M0B A;  3CCE P;  3T97 B;  2YMY A;  1VQ7 P;  1P84 E;  1JOC A;  3H1K J;  3H1K G;  3TGU J;  1PP9 G;  1NTM J;  4PV1 B;  3G4S P;  2VRS A;  5KKZ C;  1PGP A;  1USD A;  2OTK E;  1PGJ A; 
#chains in the Genus database with same CATH homology
 2R5D A;  1RE4 C;  4JYC A;  3HD7 B;  3P8C E;  3B5N C;  1HGZ A;  3GHG B;  2XV5 A;  5CCG A;  1LTJ A;  1RF1 B;  1L4A C;  2FYZ A;  3V4Q A;  3M0A A;  2IX7 C;  3TNU B;  3KQG A;  1NKN A;  1FDM A;  4EIJ A;  3VMZ A;  1MUU A;  5APY A;  3MD0 A;  1L4A B;  3HRN A;  1N7L A;  2N9B A;  2C9N Y;  1LWU C;  1FZC A;  1OWA A;  5BU8 B;  5AW2 B;  1M1J B;  1NO4 A;  2Q7C A;  3HE4 A;  2YNY A;  1LWU A;  1HJB A;  5AVU B;  4W80 A;  4WY4 C;  4ZKP A;  4JYB A;  1HWT C;  2OYH C;  2NPS B;  3RK3 B;  3SWF A;  5AW7 B;  5AW5 B;  3EQ2 A;  3RL0 D;  2N1T C;  3O8Z A;  1HVV A;  2XU6 A;  2YKO A;  2O1K A;  3SWY A;  3VN0 A;  1WRG A;  1J1E B;  1J1E C;  3OA7 A;  1T3U A;  1GU4 A;  2OYI C;  3HUS B;  3NTN A;  3M0D A;  1XTC C;  3RL0 B;  1LTJ B;  1NTK K;  1JY2 N;  4C46 A;  5CJ4 A;  2OYH B;  1N7S A;  1SFC A;  1GTW A;  1KIL D;  2H8P D;  1IFI A;  3L4F A;  1LT9 B;  4W7Z A;  1GZL A;  1NTZ K;  3G3Z A;  2E42 A;  3M9H A;  1KIL A;  1M1J C;  2IFN A;  2XKM A;  1NH4 A;  2O01 H;  3EFG A;  1DH3 A;  1CI6 B;  1LWU B;  3M9B A;  1SLQ A;  3A2A A;  5AW3 B;  2HOD A;  3CLQ A;  2WT7 A;  1FOS F;  1AFO A;  1HH0 A;  3N7N A;  5AVV B;  5AW0 B;  1MZ9 A;  1ZR4 A;  2KLV A;  3TK1 A;  4IFD K;  3H6P A;  5CJ0 A;  2XDJ A;  1HGV A;  1FU1 A;  2KB7 P;  3GHG C;  2YKP A;  3B5N B;  2Z4E A;  4ZKU A;  1X9V A;  2A45 G;  2C0X A;  3P7K A;  1JY3 O;  1NHL A;  5KJ7 D;  1WT6 A;  1JTH B;  3HUS A;  2GUV A;  1N86 A;  2WZ7 A;  3B5N A;  3OAK A;  4LGD E;  1MFZ A;  3C9I A;  4O9B A;  1IFN A;  3V5B A;  1LTA C;  2FFD B;  2W6B A;  3RL0 C;  1L4A A;  1FZE A;  1SQB K;  3LID A;  5AVZ B;  4LLH A;  1M7L A;  1G1I A;  1NAF A;  3HE5 B;  1LTT C;  1YTZ I;  2R3C A;  1KQL A;  3NFQ A;  2WSE H;  1RF1 A;  2C0W A;  2XZR A;  2WWW A;  4I6M C;  3U1C A;  3V2N A;  4C7N A;  1X79 B;  1ZR2 A;  3HD7 A;  1FZA A;  1RF0 A;  2PP6 A;  3CL3 D;  1FZG A;  3VMX A;  3BRV B;  2IFM A;  3NXS A;  2KYV A;  5APT A;  1JCC A;  1GW4 A;  1Z56 A;  2WSC H;  2ZXE B;  2R32 A;  4WY4 A;  2A45 I;  2W27 A;  2HPC A;  2YKQ A;  2HLO A;  2M8R A;  3L37 A;  4N3Y B;  1DX7 A;  5APV A;  1QL2 A;  1RE3 C;  2KP8 A;  3TNU A;  2QM8 A;  1HBW A;  1JNM A;  3BAS A;  4C7R A;  1JY3 P;  2E43 A;  1FAV A;  1GL2 A;  3L35 A;  2J59 M;  1KFM A;  2HG5 D;  4RES B;  1G2C A;  2KSJ A;  3LW5 H;  1FBM A;  1T3J A;  1IFJ A;  2C9L Y;  3HTK A;  4I1L A;  2Z5I A;  1J1D B;  1J1D C;  3WMM 0;  2R5B A;  3H32 A;  2OYH A;  1RF1 C;  3VYI A;  1GL2 C;  3HD7 C;  1JMM A;  1JY2 P;  3VTP C;  1NOH A;  1N73 B;  2LKM A;  2I1J A;  2IPP A;  5CCH C;  3KDP B;  5BVZ A;  2YO2 A;  4GKG A;  5AVX B;  1FZF A;  5APW A;  1T2K C;  3M91 A;  1FZB A;  1URQ C;  5APQ A;  1RE3 A;  2Q5U A;  1GW3 A;  1SQV K;  1JY3 N;  2Q9I A;  5AW6 B;  3MUD A;  5KJ7 A;  1LTB C;  3IFM A;  2P2U A;  4KHX A;  1URQ D;  1VPC A;  1S9K D;  3B8E B;  1X8Y A;  3BRT B;  2H43 A;  2QM7 A;  3HE4 B;  5KJ7 C;  4M3L A;  1S9K E;  1GD2 E;  3KYQ A;  5AW9 B;  4EOT A;  1JO5 A;  1LT9 A;  3MIW A;  3MTU E;  4Y99 B;  5APX A;  1G2C B;  1DEB A;  4HYT B;  1GU5 A;  3V2R A;  2WT7 B;  2HFE D;  3MGN A;  2FFD C;  1LTG C;  1OXZ A;  3B5N D;  4JF7 A;  3U1A A;  1RE4 A;  4WB4 A;  1SQX K;  2HYN A;  2CPB A;  4IFF A;  1IFM A;  1RF0 C;  2WTY A;  2I1K A;  1N7S B;  1SFC B;  3RK2 D;  3BAT A;  2NPS A;  1HTL C;  1YTZ T;  5AW8 B;  3T97 A;  3KPE A;  2WPS A;  4C7N B;  3VP9 A;  5CHX A;  2H7H A;  2ZFC A;  1VDF A;  3A5T A;  2J58 A;  3P32 A;  4AYC A;  1IC2 A;  5AW1 B;  1KFN A;  3RK2 C;  1IJD B;  1FOS E;  2P1J A;  1RY3 A;  4HH2 A;  5AVY B;  1J2J B;  1LTS C;  3M06 A;  2A45 H;  1IFD A;  3I5C A;  3UIA A;  2M3B A;  2BAS A;  2FXM A;  3P8M C;  2CPS A;  2WSF H;  3R2P A;  4IFM A;  5KTB A;  2N1T D;  3NMD A;  4WBA A;  2GUS A;  1N73 A;  3HD7 D;  1SVF A;  4N78 D;  3VMY A;  1ZN5 A;  3TYY A;  3CI9 A;  1JUN A;  1ZV8 A;  5CCH D;  5CCG C;  2GM4 A;  1YYC A;  3HTK B;  3OJA B;  5APU A;  3TSI A;  1PFI A;  1CW5 A;  5CCH A;  1T2K D;  2OYI B;  2POH A;  1LTI C;  1NTM K;  4GT1 A;  1H88 A;  1SQP K;  3A3Y B;  3II6 A;  4GIF A;  1JY2 O;  1L4A D;  1URQ A;  2O1J A;  5AVT B;  5CCG D;  2JJL A;  3N4X A;  2N1T A;  2WIT A;  4DZO A;  5AW4 B;  1GDT A;  1H8A A;  3L36 A;  1ZLL A;  2WPR A;  1G1J A;  1URQ B;  4I2L C;  2HPC B;  5AVR B;  1SP4 A;  4WY4 B;  3VOP A;  3V2Q A;  1N7S D;  1LGH B;  1SFC D;  3RK2 B;  4AUW A;  2FYU K;  3P8C D;  3LIE A;  3M0D C;  5APS A;  1N73 C;  5AVW B;  1NWQ A;  1N2D C;  4W7Y A;  2PAJ A;  1GL2 B;  2YO3 A;  1T8Z A;  2OAR A;  1N7S C;  1SFC C;  1JCD A;  1FJK A;  1MV8 A;  2WPQ A;  1CZQ A;  1H89 A;  1M1J A;  4B86 A;  3H32 B;  3GHG A;  5AVQ B;  2W6A A;  3IR9 A;  1GL2 D;  2JEE A;  2MJZ A;  4XA4 A;  1E5W A;  2OYI A;  1NU1 K;  4N6J A;  1CSB A;  2KOG A;  2P7J A;  1SQQ K;  1LT9 C;  2P67 A;  1GK6 A;  1CI6 A;  1FJP A;  2Z5H A;  4DOJ A;  3V2P A;  3U59 A;  1EQ7 A;  5AVS B;  3V4W A;  3A7O A;  4WY4 D;  5KLV K;  4Y99 C;  4LC1 A;  2XNX A;  1NKZ B;  1L0N K;  1KIL C;  3VP8 A;  1LTJ C;  2Q3I A;  5BU5 A;  2L5G B;  3HUS C;  1FZC B;  1W2E A;  1AQ5 A;  2NPS D;  3RK3 D;  2FFD A;  1KZU B;  4AQR D;  3E1I A;  1A02 F;  2HOD B;  3BVH A;  2FKW B;  1A02 J;  5CMZ A;  3PP5 A;  4XE5 B;  1IO4 A;  1FZC C;  1JTH A;  2N1T B;  1L0L K;  1GK4 A;  1HUC A;  1IK9 A;  1QL1 A;  3HE5 A;  1XTG B;  4N78 E;  2NPS C;  3RK3 C;  1KIL B;  3M9Q A;  2YMY A;  1JOC A;  2VRS A;  4OH8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...