4N78E

The wave regulatory complex links diverse receptors to the actin cytoskeleton
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
67
structure length
67
Chain Sequence
DPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic FMR1-interacting protein 1
publication title The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 31
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2013-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4n78E01
5KJ7A 2M8RA 1XTGB 4N78E 3B5NA 1GL2A 1L4AB 3RK3C 3TSIA 2N1TC 1KILA 3RK3D 2N1TD 4W80A 1N7SA 3RL0B 3VOPA 2YMYA 3B5NB 1GL2B 3RL0C 5CCHA 4WY4A 3RL0D 5CCGA 1URQA 1NHLA 5KJ7C 1KILB 5KJ7D 3B5NC 1GL2C 3B5ND 1SFCA 1GL2D 1N7SB 3HD7A 1L4AC 3HTKB 1L4AD 4WY4B 2PP6A 1URQB 2KOGA 4W7YA 2NPSA 5CCHC 4WY4C 1SFCB 2N1TA 5CCHD 1URQC 4WY4D 3HD7B 3RK2B 1URQD 1T3JA 3P8CE 4W7ZA 1KILC 3HD7C 1KILD 3HD7D 2WZ7A 1JTHA 1N7SC 2NPSB 1N7SD 3KYQA 2N1TB 2HFED 2NPSC 4JF7A 5CCGC 2NPSD 2H8PD 5CCGD 1HVVA 4OH8B 1L4AA 2XDJA 1JTHB 1SFCC 1SFCD 2HG5D 3RK2C 3M0DC 3RK2D 3PP5A 4LGDE 3RK3B
chains in the Genus database with same CATH superfamily
4A7PA 3M91A 1KFMA 4U3FD 1N73A 1PFIA 2XKMA 1HGZA 2YMKA 3CXHH 2N1TD 4YXDC 3USSA 2BCCE 3L36A 2WWWA 3L70G 1EXJA 5AW4B 3GF7A 4WY4A 2D2CC 2FFDC 1IFIA 2GUVA 3A5TA 1VQ7P 5KJ7D 2E42A 2P7JA 4WBAA 2P2UA 1M8OB 5AW0B 2E75B 3C8VA 1PGOA 1PP9G 1LTJC 4W7YA 5AVTB 3B71A 1NAYA 2OGUA 2Q9IA 4GODA 1KQLA 3BCCJ 3D6ZA 3L70E 1OW6A 5AVSB 1BE3E 2K9JA 1L0ND 3CX5I 5AVXB 1EDJA 2QEXP 2L91A 2K9YA 1NTZJ 4JPZB 2QJPC 4CPGA 2ZYAA 3JCUH 1VPCA 2BCCD 5TISE 1WMKA 3D6YA 3KZIH 1RE3A 4UB8H 4JYCA 1X79B 1SVFA 2ZAEB 4EI2A 2YKOA 1L0LG 5KAIE 4H13C 1YTZT 5DJTB 3BRVB 4GOFA 1VQMP 2OTLP 3BASA 2RH0A 4UB6H 3V2PA 2YMYA 3H1HG 1FAVA 5CBOA 5CCGA 2R5DA 1URQA 2IZ1A 2KNCA 4RKUJ 1BCCG 1P84H 1JNMA 2PFXA 2FYZA 3WU2E 3L70D 4D6TE 1SQBK 5AVQB 3T97B 2KI7B 3CCRP 3Q1MA 1JOCA 2IYOA 3IAOA 1DEEG 2AXTH 5KKZC 1DEBA 1PP9D 4IL6H 3CMAP 2YO3A 1YJWP 3TDKA 2VRSA 1KILE 2FYNC 2W83C 3A0BH 2ZT9C 1EZVG 3SFDC 1QL2A 4H0LB 2E75D 2YNYA 1SQPK 5KLVJ 3S9OA 2HFED 2UWJE 3H1IE 3MHVA 1LGHB 2JR8A 5AW7B 1L4AA 2O01N 1AVOA 2QIWA 2HG5D 3M0DC 1IFPA 1YJ9P 1FZBA 2KS1B 1FZCB 1M7LA 1SQXK 2Q3IA 3VMYA 4Y28J 1RF0A 3TSIA 2FYUG 3HE4A 3VP9A 4PJ0E 3TNUB 1VL2A 1SQVJ 1PGPA 1PV3A 4Y99B 1L0LD 1AFOA 3AE9C 3MTUE 3HD7A 1FZGA 4HKZH 1GW4A 2ZYDA 2LXCB 3H1HD 3MP7B 3KDPB 3MUDC 3CI9A 3RK2B 1NAFA 2XNXA 3VMZA 3I56P 2FYUE 2R44A 1LTSC 4RJTA 1H0TB 1NTKG 3H1JE 1JO5A 5CCGC 3SSUA 1LTBC 3BCCG 4U7JA 2FXOA 5AVVB 1YITP 1RY3A 3CCEP 3QH9A 3CMEP 4I1LA 3OJAB 2G8YA 2E74B 1NTZG 1FZEA 3IFMA 4OWFA 3L72E 1USDA 3CXHE 4WB4A 1M90Q 1YQ4C 5TISH 3L35A 1RQVA 3KQGA 2W27A 5KLIB 3AE1C 1BE3J 3N4XA 3CC4P 4DZOA 3FWLA 1SFCA 1GL2D 3H1KE 5CJ4A 1LNQA 2FYUD 3TGUJ 4BRYA 1AQTA 1L4AC 4LLHA 1SQBE 1ZR2A 4N6JA 2JWDA 1LTTC 1NTZE 3H1JD 1SQQK 1EXIA 2C0WA 2MJZA 2I8DA 3P8CE 1IFDA 2QJKC 3WU2H 4KHXA 2WZ7A 2A45G 1CW5A 3S1KA 3R2PA 1IK7A 3AE3C 3H32A 5H2FE 4IOIH 1S2EA 2B87B 3FX0A 1OVVA 1T2KD 3W68A 3JCUE 1LWUB 3PHLA 3CXHD 2J5UA 2NPSD 4H0LC 1FZAA 1KB9I 3MGNA 2K1AA 2QE7H 1FOSE 1IK9A 2G3AA 3H6PA 3Q5SA 3RK2D 4YTPC 1PZQA 4D6TJ 4DCKA 2FFDA 3D71A 3SWFA 5KLVG 3BCCD 4ZMDA 2KXPB 2JJLA 3GF3A 1FZCC 3O6QB 4ASWA 1N7SA 3SWKA 1LTJA 2FBWC 1NTZD 1AJYA 3RL0D 2W90A 1NHLA 1MFZA 1Q7YQ 1J2JB 2E5TA 3P8CD 3B5ND 3EWKA 2E74D 3H1IJ 3HUSB 2P10A 3CX5H 1CZQA 4AYCA 5GTHH 4NPEA 5KLVE 4PJ0H 4C46A 1JM0A 2HODA 2AXTE 2N1TA 2WPVB 4IFFA 2WMMA 1G1JA 2H43A 1JY3N 2KSJA 2LXBA 4RESB 4IFDK 3A0BE 2IBZI 2IZ0A 1NTME 3IN6A 4XA4A 2N9YB 1MKMA 2C0XA 1NYHA 1H88A 4OH8B 4LC1A 1JCCA 1SFCC 1VQPP 2XU6A 2BCCG 1YJNP 4XFJA 2WSCH 4EOTA 1SQVE 2JP3A 1RH5B 1CI6B 4ZKPA 1JY3P 3L74J 4JBZA 3FGAD 4N78E 1MZ9A 3L37A 3PH0A 1IFNA 1NJIQ 1QVGO 1DH3A 1LT9B 2HLOA 4GIFA 3C1LA 5KLVD 1HJBA 2WSCJ 2WPRA 1S4XA 4K35A 1QX8A 1KB9E 5KLIC 2QM8A 3H1JJ 1KFNA 3EQ2A 3L73E 3O8ZA 5AVZB 4C7NA 2JO1A 3N7NA 1FU1A 1A02F 1M57D 1J1DB 1BE3G 2ZVNB 2YKPA 2XZRA 1FC2C 4Z1MH 4I6MC 5CCHD 3G4SP 3HRNA 3VTPC 4I2LC 2M5AA 1VF5D 2YO2A 3P32A 3TGUG 3WUVA 2WQYC 3L72J 1MFTA 1K04A 3M0DA 2GUSA 1LP1B 1SQVD 4GT1A 1N7SC 2ZFCA 1DX7A 2C9NY 1UIXA 1S9KD 3MIWA 4L73A 3BVHA 5E79E 1WT6A 1S3JA 1K8AQ 2Q7CA 2H89C 2XDJA 3H1KJ 1AVYA 1H8AA 3MD0A 1Z56A 1SQBJ 1KB9D 1AA0A 4DOJA 1NU1K 3GHGB 5H2FH 3A0HE 2CPSA 1FDMA 3AEEC 2CK3H 3L73D 2WT7B 3TGUE 3KPEA 2N1TC 4I7ZB 3CL3D 1OXZA 1YYCA 2IBZE 4JYBA 1Q90D 1L2PA 4D6TG 3RBZA 3MUDA 1VQ8P 1EZVI 1EQ7A 3HE5B 5AVYB 5L8RJ 5KJ7C 1NO4A 1KILB 5APWA 1GK6A 2FKWB 2WSEH 1RF1B 1SQPJ 2OYHB 1PL5A 1T6AA 2QG4A 4TT3H 5K5GB 1KYOI 2WITA 1GU4A 4HJGH 3FXEA 1G2CB 2Q3EA 3HUSC 1HTLC 4NPDA 3FWNA 4M3LA 1ZRTE 2QJYC 2FXPA 3H25A 2NRGA 4WY4D 2AEFA 3L71E 2W6AA 2Y0CA 1QVFO 2WSEJ 3H1IG 1X0TA 1BE3D 1NTKK 3VMAA 1T3UA 2R5BA 1OMIA 3GW6A 3KYQA 5KAFE 3A2AA 1FDIA 2POHA 2GA1A 3TGUD 3BATA 2PGDA 5EFWB 1YTZI 2HPCB 3V5BA 3U1AA 3U1CA 4R4LA 4OGQD 1IJDB 1M1JB 3VN0A 5BVZA 3CWBE 3HE4B 4IL6X 1QLED 1ZV8A 2R3SA 3LW5H 3VOPA 1FBMA 1LT9C 3H1LE 3L74G 1GL2B 3T97A 2RKLA 3L71D 1GD2E 1DD4A 4NPFX 3BRTB 4DJGA 1NTMJ 4OVNF 4D6TD 3CX5E 5GTHE 3LW5J 1BSNA 2JWAA 4H44D 4XE5B 2XV5A 3OAKA 2QM7A 1KB9H 3H1JG 4PV1B 3CCMP 1URQD 1QEXA 5AVWB 5AW5B 1ZMEC 1JY2O 1IFJA 1EC5A 3AEGC 1KILD 3L74E 2NPSB 4ZNCA 3LIEA 2E75C 2V4HA 2NZ2A 1U7MA 3JSVC 2E76D 1NKNA 3H1ID 4JF7A 3AE6C 1KYOE 2KS1A 1FZCA 1NKZB 2KYVA 3L72G 1PGQA 3KXDA 3L73J 1ZOYC 2KZJA 2ZXEB 2OQQA 1N7LA 2OYIB 5KTBA 1BDDA 1Q2NA 1NU1E 3TNUA 2E5YA 5E79H 1SQQJ 1DD3A 2KB7P 3RBXA 3GHGC 3CX5D 3C9IA 2O01H 1GK4A 1HH0A 3H1KG 1JB0J 1KORA 3RL0B 4I7ZC 2A45I 1HJ0A 1SQBG 3B5NB 5M1BA 2OARA 3VP8A 1N2DC 3F89A 1PPJE 4PD4I 3A0HH 1VQ9P 3AECC 5B66H 4BXLA 3RK3E 1KQGB 2WSFH 2O01J 3HTKB 2FXMA 2OYHC 3L74D 3FXDA 4MN4C 1W2BO 4YXWH 3WMM0 2QRXA 1CSBA 2ZVOB 1H0TA 1MUUA 3M0AA 1LJ2A 2V7QH 2KLVA 2M3EA 1A02J 1DIPA 1HF9A 2N9BA 3HD7D 1FZFA 2WSFJ 1L0NK 3JC22 3WUTA 2H8PD 3V4QA 3PTZA 5APXA 1OFCX 2L5GB 1M56D 2V7QJ 1PGJA 1JTHB 4PV1D 2AEJA 1AQ5A 1QL1A 1USEA 2M8RA 5KAFH 1X9VA 1D7MA 1SQPE 3L72D 2P58A 2A06E 3RK3D 1M1JC 1VQ4P 3L71J 2Y9YA 1OW7A 2YKQA 2ZYGA 3K5BA 2KP8A 1NWQA 3B8EB 1YHQP 1SQXE 3AEBC 1X22A 1EDIA 1GL2C 3H1KD 3CCVP 1Y8AA 1OVUA 5CBNA 1SQBD 2KZIA 2QJPB 2PRRA 1VF5B 3CC7P 1S5LH 3L75J 2ITAA 4GOEA 3CCJP 2B87A 1NTMG 1KV4A 1Q86Q 4Y99C 3TF5A 1LWUA 1JCDA 3CWBJ 1NGMB 5AW1B 4PD4E 3ITKA 1SQVG 4H13B 1KC8Q 3U59A 1SQPD 1T2KC 3M06A 3H1LJ 2NPSC 2A06D 5GTIE 1HVVA 2KUBA 3M9HA 3RK2C 5CJ0A 3O6QA 4GDOA 3E7KA 3PP5A 1KTMA 2WPQA 2CPBA 5APTA 5KJ7A 1K73Q 3W67A 1VQ5P 4U3FE 2W6BA 1KYOH 1OX3A 3L73G 2B88A 2LKMA 2P67A 3Q2YA 4ZKUA 2Z4EA 3P7KA 3AE2C 4AQRD 3HUSA 1RQUA 5KKZB 1HGVA 2BASA 3RL0C 1N73B 2IYPA 2D2CD 1L0LK 1YIJP 5TJHA 3B5NC 2E74C 1VQNP 4N3YB 5B5EE 1JMBA 1TU3F 3G3ZA 1GMJA 2I1KA 4WY4B 1ZR4A 1LTIC 3SWYA 1Q81Q 5C39A 3F5HA 1NU1J 3D70A 1X8YA 3CD6P 2YXQB 1RE4A 2ZJSE 4YPCA 5BU5A 3TYYA 3ZDMA 2HYNA 2YIUB 4TLFA 1M1KQ 1SQQE 4RO0A 3IR9A 4BWNA 1CI6A 1NTMD 1Y9BA 1MV8A 2OTKE 1OW8A 2AXCA 3GMAA 3GLMA 2K9JB 5APVA 4OGQB 1KN7A 2FY8A 1LT9A 5APYA 3AE7C 2IBZG 1KMIZ 2KIKA 3IF4A 3CCUP 4N78D 4QMAA 1QGKB 2Y0EA 1VDFA 4H13D 3S4RA 3CC2P 1LWUC 1NVOA 1PIXA 2E43A 1NTKJ 1FJKA 1SLQA 1N86A 2K3RA 2JKVA 5B66E 3AEFC 3CCQP 2FYUK 3L71G 4H44B 2KK7A 5CHXA 1YI2P 3PRJA 3EFFK 1FDOA 5BU8B 2PP6A 1URQB 1LP1A 1SQQD 2KNCB 1VQ6P 3VMXA 5CCHC 2RN0A 1VF5C 1IZNB 1BSHA 1PP9E 2E76B 2M3BA 2YXRB 2I1JA 1HUCA 1FS0E 2IPPA 2GM4A 2KLUA 3PJSK 3A7OA 2ZT9D 3L75G 2K37A 1IO4A 2Z5IA 1BGYJ 2Y0DA 3GHGA 1S72P 1KZUB 1HBWA 1SQXJ 3CWBG 5DJUB 2WT7A 2A45H 4JQ0D 1J1EB 2IFMA 2B9BA 4PD4H 3H1LG 4ASVA 1L4AB 3HE5A 4WWIA 1KILA 5GTIH 3Q3DA 2AEMA 2DW3A 1RF1A 3II6A 3G6EP 2OYHA 1RE4C 2IBZD 1WRGA 3OA7A 1NTZK 2MKVA 3L75E 4R4MA 4C7RA 4HH2A 4KT0J 2IFNA 1G2CA 5APUA 2QJKB 5AW2B 1ZW0A 1KD1Q 1L0LE 5APQA 1YBKA 1N73C 1SP4A 2OYOA 5CMZA 3CXHI 5AW6B 3P8MC 1XTCC 1IC2A 1GU5A 3H1HE 2KOGA 2O3JA 1ZRTD 1S5LE 1JMMA 1OVRA 2J58A 4WY4C 1G1IA 1BCCE 3M9QA 3HD7B 1T3JA 1N8RQ 3NMDA 5B5EH 1JY3O 4W7ZA 4U3FJ 1JUNA 2HPCA 1NH4A 2H7HA 2QSIA 3V6IA 2J59M 2YIUC 1YQ3C 1J1DC 4EDFA 1NU1G 1LTAC 3V2QA 5CCGD 1M1JA 2R32A 4L75A 4WVZA 3SFEC 1EZVE 3L75D 3AE5C 1KQSO 2SPZA 3QWOC 1EDKA 4OGQC 3Q5PA 3RK3B 4O9BA 1XTGB 1Y47A 4L76A 1GL2A 3CWBD 1FJPA 1GW3A 1PPJG 4DT0A 2ZXXA 4B86A 2WVRA 3MZWB 3M9BA 3H1LD 5AW8B 5KLVK 3CCLP 3PLNA 1RE3C 1W5CE 1L0NJ 1BCCD 2PAJA 3AEAC 2BEZF 3KHUA 1VQOP 3A3YB 3AEDC 1R8EA 2LR2A 1LT1A 2BCCJ 1L4AD 3I5CA 1H89A 4H44C 2WTYA 1GZLA 1OIPA 2NPSA 1NTMK 1SFCB 2BEQD 2R3CA 3RGUA 3LIDA 1URQC 3CCSP 4HYTB 4BRYB 1FE6A 3E1IA 1UIIA 1KILC 1EZVD 1P84I 3V4WA 1RF1C 1SQVK 2WSSH 2E76C 1GDTA 2OYIA 1KYOD 2Y9ZA 2OTJP 1VQKP 1SQPG 4H0LD 1ZXGA 2A06G 2O1JA 4HB1A 4AUWA 1E5WA 1NTKE 3H32B 1FOSF 3L70J 1JEKA 4LGDE 5AW9B 1NU1D 3CLQA 1J1EC 3B5NA 3BCCE 1BGYG 1IFMA 2B89A 2JDIH 1SQXG 5KAIH 4W80A 1T8ZA 1OWAA 1PP9J 5AVRB 2D2CB 4KJMA 2FFDB 2C9LY 3HTKA 3TK1A 1E79H 1ZP0C 1PPJD 2IDBA 3UIAA 1KQFB 2HR3A 3NFQA 1VQLP 1N7SB 1RF0C 1LTJB 2K88A 3R4YA 1K9MQ 1U57A 5AW3B 2Q6QA 1EDLA 3E1RA 1BGYE 3NTNA 1S1CX 2JEEA 3OW2O 3NXSA 5AVUB 2M0BA 3HD7C 4IFMA 1NTKD 2H88C 2W8ZA 4GKGA 1JTHA 3KZIE 3AE8C 3GG2A 3WUUA 4UB8E 1GTWA 2HODB 2N1TB 1W2EA 5APSA 3G71P 2WPSA 1AV1A 4L74A 2Q1KA 1ZN5A 4U3FG 1L0LJ 2KSEA 4PV1C 1SFCD 2RMZA 3G9RA 4UB6E 1HWTC 3AE4C 4K3AA 2QVAA 1S5LX 1R5SA 3H1HJ 1R5LA 3RK3C 1P84E 1BCCJ 2QJYB 2Z5HA 4EIJA 1BDCA 4EYYQ 1BGYD 5CCHA 2P1JA 3B4SA 1SQXD 3V2RA 2OYIC 2W6JH 2Q5UA 3VYIA 4IL6E 2QA4P 3V2NA 1U7JA 2O1KA 1L0NG 1LTGC 1SQQG 4C7NB 2IX7C 1JY2N 2FYNB 3L4FA 2ZT9B 3Q5RA 3RL0g 3ABVC 4PD4D 1N7SD 1SS1A 1ZLLA 3I55P 2M5AB 1OZHA 1S9KE 1Q82Q 1P84D 1NOHA 3EFGA 1K05A 2XNDH 3CPWO 2FYUJ 1RHZB 1JY2P 1L0NE
chains in the Genus database with same CATH topology
3SWFA 3TNUA 3M91A 1KFMA 1N73A 1L4AB 1PFIA 2KB7P 2JJLA 3HE5A 2XKMA 1HGZA 1KILA 3GHGC 2N1TD 3C9IA 1FZCC 2O01H 1GK4A 1HH0A 1RF1A 3II6A 2OYHA 3L36A 1RE4C 1N7SA 2WWWA 3RL0B 1LTJA 1WRGA 3OA7A 2A45I 1NTZK 4C7RA 4HH2A 3B5NB 5AW4B 2IFNA 1G2CA 5APUA 4WY4A 2OARA 3RL0D 5AW2B 2FFDC 1NHLA 1IFIA 1N2DC 1MFZA 2GUVA 3VP8A 3A5TA 5KJ7D 1J2JB 5APQA 2E42A 2P7JA 4WBAA 3P8CD 3B5ND 2P2UA 1N73C 1SP4A 3HUSB 5AW0B 5CMZA 1CZQA 2WSFH 5AW6B 4AYCA 3P8MC 3HTKB 2FXMA 2OYHC 1XTCC 1IC2A 1GU5A 1LTJC 2KOGA 4W7YA 3WMM0 4C46A 1CSBA 1JMMA 1MUUA 5AVTB 2J58A 2HODA 4WY4C 1G1IA 2N1TA 3M0AA 4IFFA 3M9QA 3HD7B 1G1JA 2H43A 2Q9IA 1KQLA 1JY3N 1T3JA 2KLVA 3NMDA 1JY3O 4W7ZA 1A02J 2KSJA 2N9BA 4RESB 5AVSB 3HD7D 1FZFA 1JUNA 4IFDK 2HPCA 1NH4A 1L0NK 5AVXB 2H7HA 2J59M 4XA4A 1J1DC 1VPCA 1LTAC 2H8PD 3V4QA 3V2QA 2C0XA 5CCGD 1M1JA 2R32A 5APXA 2L5GB 1H88A 4OH8B 4LC1A 1JCCA 1JTHB 1SFCC 2XU6A 2WSCH 4EOTA 1CI6B 1RE3A 4ZKPA 1JY3P 1AQ5A 1QL1A 3RK3B 2M8RA 4O9BA 1XTGB 4N78E 1X9VA 1GL2A 1MZ9A 3L37A 4JYCA 1X79B 1IFNA 1FJPA 1SVFA 1GW3A 2YKOA 3RK3D 1DH3A 1YTZT 4B86A 1M1JC 1LT9B 2HLOA 3BRVB 2YKQA 3BASA 3M9BA 4GIFA 3V2PA 1HJBA 5AW8B 2KP8A 2YMYA 5KLVK 2WPRA 1NWQA 3B8EB 1RE3C 1FAVA 5CCGA 2R5DA 1URQA 2PAJA 2QM8A 1KFNA 3EQ2A 1GL2C 3A3YB 3O8ZA 5AVZB 4C7NA 1JNMA 2FYZA 3N7NA 1FU1A 1SQBK 1A02F 1L4AD 5AVQB 3I5CA 1H89A 1J1DB 2WTYA 1GZLA 2YKPA 2XZRA 1JOCA 2NPSA 1NTMK 4I6MC 1SFCB 2R3CA 5CCHD 3LIDA 3HRNA 1URQC 3VTPC 4HYTB 4I2LC 2YO2A 3P32A 1DEBA 4Y99C 1LWUA 1JCDA 2YO3A 3E1IA 1KILC 3M0DA 2GUSA 3V4WA 2VRSA 4GT1A 1RF1C 1SQVK 1N7SC 5AW1B 1QL2A 2ZFCA 1DX7A 2C9NY 3U59A 1GDTA 1S9KD 3MIWA 1T2KC 3BVHA 2YNYA 2OYIA 3M06A 1SQPK 1WT6A 2HFED 2NPSC 1LGHB 2Q7CA 1HVVA 5AW7B 1L4AA 2O1JA 3M9HA 2XDJA 4AUWA 2HG5D 3RK2C 5CJ0A 1H8AA 1E5WA 3M0DC 3MD0A 3H32B 3PP5A 1FOSF 1Z56A 2WPQA 4LGDE 2CPBA 5APTA 5AW9B 5KJ7A 3CLQA 1J1EC 1FZBA 4DOJA 1NU1K 3GHGB 1FZCB 1M7LA 1SQXK 2CPSA 3B5NA 1FDMA 1IFMA 2Q3IA 3VMYA 2WT7B 1RF0A 3TSIA 3KPEA 2N1TC 2W6BA 4W80A 3CL3D 1T8ZA 1OXZA 1YYCA 2LKMA 2P67A 1OWAA 3HE4A 4ZKUA 3VP9A 2Z4EA 3P7KA 5AVRB 4JYBA 3HUSA 4AQRD 2FFDB 2C9LY 3MUDA 3TNUB 3HTKA 1HGVA 3TK1A 1EQ7A 2BASA 3RL0C 1N73B 4Y99B 3HE5B 5AVYB 5KJ7C 1NO4A 1KILB 5APWA 1L0LK 1GK6A 2FKWB 2WSEH 3B5NC 1AFOA 3UIAA 1RF1B 2OYHB 3MTUE 3NFQA 4N3YB 1N7SB 1RF0C 3HD7A 1FZGA 1LTJB 1GW4A 3G3ZA 2WITA 1GU4A 2I1KA 1G2CB 5AW3B 4WY4B 1ZR4A 3HUSC 1HTLC 3KDPB 1LTIC 4M3LA 3CI9A 3SWYA 3NTNA 4WY4D 3RK2B 1NAFA 2XNXA 3VMZA 1X8YA 2W6AA 2JEEA 1RE4A 3NXSA 5AVUB 5BU5A 3HD7C 4IFMA 3TYYA 1LTSC 1NTKK 2HYNA 4GKGA 1T3UA 1JTHA 2R5BA 1GTWA 2HODB 3KYQA 2N1TB 1JO5A 3A2AA 3IR9A 1CI6A 2POHA 1W2EA 5APSA 2WPSA 1MV8A 3BATA 5CCGC 1LTBC 1ZN5A 5AVVB 5APVA 1YTZI 1RY3A 2HPCB 1SFCD 3V5BA 1LT9A 3U1AA 1HWTC 5APYA 3U1CA 4I1LA 3OJAB 1IJDB 1FZEA 3IFMA 4N78D 1M1JB 3VN0A 5BVZA 3RK3C 3HE4B 4WB4A 1VDFA 1ZV8A 3L35A 1LWUC 3LW5H 3KQGA 2W27A 2Z5HA 3VOPA 4EIJA 1FBMA 1LT9C 2E43A 1FJKA 1GL2B 3N4XA 3T97A 5CCHA 2P1JA 1SLQA 4DZOA 1N86A 1GD2E 3V2RA 2OYIC 2Q5UA 3BRTB 1SFCA 3VYIA 1GL2D 5CJ4A 2FYUK 5CHXA 3V2NA 1L4AC 4LLHA 1ZR2A 2O1KA 5BU8B 4N6JA 1LTTC 2PP6A 1URQB 1SQQK 4XE5B 3VMXA 1LTGC 5CCHC 2XV5A 3OAKA 2QM7A 4C7NB 2C0WA 2IX7C 1URQD 2MJZA 1JY2N 5AVWB 3P8CE 1IFDA 3L4FA 5AW5B 1JY2O 1IFJA 1KILD 2M3BA 4KHXA 2WZ7A 2A45G 2I1JA 1HUCA 1CW5A 2IPPA 2GM4A 2NPSB 3R2PA 1N7SD 3A7OA 3LIEA 3H32A 1IO4A 2Z5IA 1ZLLA 1NKNA 1S9KE 1T2KD 4JF7A 1LWUB 2NPSD 3GHGA 1FZCA 1NOHA 3EFGA 1FZAA 1KZUB 3MGNA 1NKZB 2KYVA 1HBWA 1FOSE 1IK9A 2WT7A 2A45H 3H6PA 2ZXEB 1J1EB 3RK2D 2IFMA 1N7LA 2OYIB 5KTBA 1JY2P 2FFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJ7 A;  2M8R A;  1XTG B;  4N78 E;  3B5N A;  1GL2 A;  1L4A B;  3RK3 C;  3TSI A;  2N1T C;  1KIL A;  3RK3 D;  2N1T D;  4W80 A;  1N7S A;  3RL0 B;  3VOP A;  2YMY A;  3B5N B;  1GL2 B;  3RL0 C;  5CCH A;  4WY4 A;  3RL0 D;  5CCG A;  1URQ A;  1NHL A;  5KJ7 C;  1KIL B;  5KJ7 D;  3B5N C;  1GL2 C;  3B5N D;  1SFC A;  1GL2 D;  1N7S B;  3HD7 A;  1L4A C;  3HTK B;  1L4A D;  4WY4 B;  2PP6 A;  1URQ B;  2KOG A;  4W7Y A;  2NPS A;  5CCH C;  4WY4 C;  1SFC B;  2N1T A;  5CCH D;  1URQ C;  4WY4 D;  3HD7 B;  3RK2 B;  1URQ D;  1T3J A;  3P8C E;  4W7Z A;  1KIL C;  3HD7 C;  1KIL D;  3HD7 D;  2WZ7 A;  1JTH A;  1N7S C;  2NPS B;  1N7S D;  3KYQ A;  2N1T B;  2HFE D;  2NPS C;  4JF7 A;  5CCG C;  2NPS D;  2H8P D;  5CCG D;  1HVV A;  4OH8 B;  1L4A A;  2XDJ A;  1JTH B;  1SFC C;  1SFC D;  2HG5 D;  3RK2 C;  3M0D C;  3RK2 D;  3PP5 A;  4LGD E;  3RK3 B; 
#chains in the Genus database with same CATH topology
 4A7P A;  3M91 A;  1KFM A;  4U3F D;  1N73 A;  1PFI A;  2XKM A;  1HGZ A;  2YMK A;  3CXH H;  2N1T D;  4YXD C;  3USS A;  2BCC E;  3L36 A;  2WWW A;  3L70 G;  1EXJ A;  5AW4 B;  3GF7 A;  4WY4 A;  2D2C C;  2FFD C;  1IFI A;  2GUV A;  3A5T A;  1VQ7 P;  5KJ7 D;  2E42 A;  2P7J A;  4WBA A;  2P2U A;  1M8O B;  5AW0 B;  2E75 B;  3C8V A;  1PGO A;  1PP9 G;  1LTJ C;  4W7Y A;  5AVT B;  3B71 A;  1NAY A;  2OGU A;  2Q9I A;  4GOD A;  1KQL A;  3BCC J;  3D6Z A;  3L70 E;  1OW6 A;  5AVS B;  1BE3 E;  2K9J A;  1L0N D;  3CX5 I;  5AVX B;  1EDJ A;  2QEX P;  2L91 A;  2K9Y A;  1NTZ J;  4JPZ B;  2QJP C;  4CPG A;  2ZYA A;  3JCU H;  1VPC A;  2BCC D;  5TIS E;  1WMK A;  3D6Y A;  3KZI H;  1RE3 A;  4UB8 H;  4JYC A;  1X79 B;  1SVF A;  2ZAE B;  4EI2 A;  2YKO A;  1L0L G;  5KAI E;  4H13 C;  1YTZ T;  5DJT B;  3BRV B;  4GOF A;  1VQM P;  2OTL P;  3BAS A;  2RH0 A;  4UB6 H;  3V2P A;  2YMY A;  3H1H G;  1FAV A;  5CBO A;  5CCG A;  2R5D A;  1URQ A;  2IZ1 A;  2KNC A;  4RKU J;  1BCC G;  1P84 H;  1JNM A;  2PFX A;  2FYZ A;  3WU2 E;  3L70 D;  4D6T E;  1SQB K;  5AVQ B;  3T97 B;  2KI7 B;  3CCR P;  3Q1M A;  1JOC A;  2IYO A;  3IAO A;  1DEE G;  2AXT H;  5KKZ C;  1DEB A;  1PP9 D;  4IL6 H;  3CMA P;  2YO3 A;  1YJW P;  3TDK A;  2VRS A;  1KIL E;  2FYN C;  2W83 C;  3A0B H;  2ZT9 C;  1EZV G;  3SFD C;  1QL2 A;  4H0L B;  2E75 D;  2YNY A;  1SQP K;  5KLV J;  3S9O A;  2HFE D;  2UWJ E;  3H1I E;  3MHV A;  1LGH B;  2JR8 A;  5AW7 B;  1L4A A;  2O01 N;  1AVO A;  2QIW A;  2HG5 D;  3M0D C;  1IFP A;  1YJ9 P;  1FZB A;  2KS1 B;  1FZC B;  1M7L A;  1SQX K;  2Q3I A;  3VMY A;  4Y28 J;  1RF0 A;  3TSI A;  2FYU G;  3HE4 A;  3VP9 A;  4PJ0 E;  3TNU B;  1VL2 A;  1SQV J;  1PGP A;  1PV3 A;  4Y99 B;  1L0L D;  1AFO A;  3AE9 C;  3MTU E;  3HD7 A;  1FZG A;  4HKZ H;  1GW4 A;  2ZYD A;  2LXC B;  3H1H D;  3MP7 B;  3KDP B;  3MUD C;  3CI9 A;  3RK2 B;  1NAF A;  2XNX A;  3VMZ A;  3I56 P;  2FYU E;  2R44 A;  1LTS C;  4RJT A;  1H0T B;  1NTK G;  3H1J E;  1JO5 A;  5CCG C;  3SSU A;  1LTB C;  3BCC G;  4U7J A;  2FXO A;  5AVV B;  1YIT P;  1RY3 A;  3CCE P;  3QH9 A;  3CME P;  4I1L A;  3OJA B;  2G8Y A;  2E74 B;  1NTZ G;  1FZE A;  3IFM A;  4OWF A;  3L72 E;  1USD A;  3CXH E;  4WB4 A;  1M90 Q;  1YQ4 C;  5TIS H;  3L35 A;  1RQV A;  3KQG A;  2W27 A;  5KLI B;  3AE1 C;  1BE3 J;  3N4X A;  3CC4 P;  4DZO A;  3FWL A;  1SFC A;  1GL2 D;  3H1K E;  5CJ4 A;  1LNQ A;  2FYU D;  3TGU J;  4BRY A;  1AQT A;  1L4A C;  4LLH A;  1SQB E;  1ZR2 A;  4N6J A;  2JWD A;  1LTT C;  1NTZ E;  3H1J D;  1SQQ K;  1EXI A;  2C0W A;  2MJZ A;  2I8D A;  3P8C E;  1IFD A;  2QJK C;  3WU2 H;  4KHX A;  2WZ7 A;  2A45 G;  1CW5 A;  3S1K A;  3R2P A;  1IK7 A;  3AE3 C;  3H32 A;  5H2F E;  4IOI H;  1S2E A;  2B87 B;  3FX0 A;  1OVV A;  1T2K D;  3W68 A;  3JCU E;  1LWU B;  3PHL A;  3CXH D;  2J5U A;  2NPS D;  4H0L C;  1FZA A;  1KB9 I;  3MGN A;  2K1A A;  2QE7 H;  1FOS E;  1IK9 A;  2G3A A;  3H6P A;  3Q5S A;  3RK2 D;  4YTP C;  1PZQ A;  4D6T J;  4DCK A;  2FFD A;  3D71 A;  3SWF A;  5KLV G;  3BCC D;  4ZMD A;  2KXP B;  2JJL A;  3GF3 A;  1FZC C;  3O6Q B;  4ASW A;  1N7S A;  3SWK A;  1LTJ A;  2FBW C;  1NTZ D;  1AJY A;  3RL0 D;  2W90 A;  1NHL A;  1MFZ A;  1Q7Y Q;  1J2J B;  2E5T A;  3P8C D;  3B5N D;  3EWK A;  2E74 D;  3H1I J;  3HUS B;  2P10 A;  3CX5 H;  1CZQ A;  4AYC A;  5GTH H;  4NPE A;  5KLV E;  4PJ0 H;  4C46 A;  1JM0 A;  2HOD A;  2AXT E;  2N1T A;  2WPV B;  4IFF A;  2WMM A;  1G1J A;  2H43 A;  1JY3 N;  2KSJ A;  2LXB A;  4RES B;  4IFD K;  3A0B E;  2IBZ I;  2IZ0 A;  1NTM E;  3IN6 A;  4XA4 A;  2N9Y B;  1MKM A;  2C0X A;  1NYH A;  1H88 A;  4OH8 B;  4LC1 A;  1JCC A;  1SFC C;  1VQP P;  2XU6 A;  2BCC G;  1YJN P;  4XFJ A;  2WSC H;  4EOT A;  1SQV E;  2JP3 A;  1RH5 B;  1CI6 B;  4ZKP A;  1JY3 P;  3L74 J;  4JBZ A;  3FGA D;  4N78 E;  1MZ9 A;  3L37 A;  3PH0 A;  1IFN A;  1NJI Q;  1QVG O;  1DH3 A;  1LT9 B;  2HLO A;  4GIF A;  3C1L A;  5KLV D;  1HJB A;  2WSC J;  2WPR A;  1S4X A;  4K35 A;  1QX8 A;  1KB9 E;  5KLI C;  2QM8 A;  3H1J J;  1KFN A;  3EQ2 A;  3L73 E;  3O8Z A;  5AVZ B;  4C7N A;  2JO1 A;  3N7N A;  1FU1 A;  1A02 F;  1M57 D;  1J1D B;  1BE3 G;  2ZVN B;  2YKP A;  2XZR A;  1FC2 C;  4Z1M H;  4I6M C;  5CCH D;  3G4S P;  3HRN A;  3VTP C;  4I2L C;  2M5A A;  1VF5 D;  2YO2 A;  3P32 A;  3TGU G;  3WUV A;  2WQY C;  3L72 J;  1MFT A;  1K04 A;  3M0D A;  2GUS A;  1LP1 B;  1SQV D;  4GT1 A;  1N7S C;  2ZFC A;  1DX7 A;  2C9N Y;  1UIX A;  1S9K D;  3MIW A;  4L73 A;  3BVH A;  5E79 E;  1WT6 A;  1S3J A;  1K8A Q;  2Q7C A;  2H89 C;  2XDJ A;  3H1K J;  1AVY A;  1H8A A;  3MD0 A;  1Z56 A;  1SQB J;  1KB9 D;  1AA0 A;  4DOJ A;  1NU1 K;  3GHG B;  5H2F H;  3A0H E;  2CPS A;  1FDM A;  3AEE C;  2CK3 H;  3L73 D;  2WT7 B;  3TGU E;  3KPE A;  2N1T C;  4I7Z B;  3CL3 D;  1OXZ A;  1YYC A;  2IBZ E;  4JYB A;  1Q90 D;  1L2P A;  4D6T G;  3RBZ A;  3MUD A;  1VQ8 P;  1EZV I;  1EQ7 A;  3HE5 B;  5AVY B;  5L8R J;  5KJ7 C;  1NO4 A;  1KIL B;  5APW A;  1GK6 A;  2FKW B;  2WSE H;  1RF1 B;  1SQP J;  2OYH B;  1PL5 A;  1T6A A;  2QG4 A;  4TT3 H;  5K5G B;  1KYO I;  2WIT A;  1GU4 A;  4HJG H;  3FXE A;  1G2C B;  2Q3E A;  3HUS C;  1HTL C;  4NPD A;  3FWN A;  4M3L A;  1ZRT E;  2QJY C;  2FXP A;  3H25 A;  2NRG A;  4WY4 D;  2AEF A;  3L71 E;  2W6A A;  2Y0C A;  1QVF O;  2WSE J;  3H1I G;  1X0T A;  1BE3 D;  1NTK K;  3VMA A;  1T3U A;  2R5B A;  1OMI A;  3GW6 A;  3KYQ A;  5KAF E;  3A2A A;  1FDI A;  2POH A;  2GA1 A;  3TGU D;  3BAT A;  2PGD A;  5EFW B;  1YTZ I;  2HPC B;  3V5B A;  3U1A A;  3U1C A;  4R4L A;  4OGQ D;  1IJD B;  1M1J B;  3VN0 A;  5BVZ A;  3CWB E;  3HE4 B;  4IL6 X;  1QLE D;  1ZV8 A;  2R3S A;  3LW5 H;  3VOP A;  1FBM A;  1LT9 C;  3H1L E;  3L74 G;  1GL2 B;  3T97 A;  2RKL A;  3L71 D;  1GD2 E;  1DD4 A;  4NPF X;  3BRT B;  4DJG A;  1NTM J;  4OVN F;  4D6T D;  3CX5 E;  5GTH E;  3LW5 J;  1BSN A;  2JWA A;  4H44 D;  4XE5 B;  2XV5 A;  3OAK A;  2QM7 A;  1KB9 H;  3H1J G;  4PV1 B;  3CCM P;  1URQ D;  1QEX A;  5AVW B;  5AW5 B;  1ZME C;  1JY2 O;  1IFJ A;  1EC5 A;  3AEG C;  1KIL D;  3L74 E;  2NPS B;  4ZNC A;  3LIE A;  2E75 C;  2V4H A;  2NZ2 A;  1U7M A;  3JSV C;  2E76 D;  1NKN A;  3H1I D;  4JF7 A;  3AE6 C;  1KYO E;  2KS1 A;  1FZC A;  1NKZ B;  2KYV A;  3L72 G;  1PGQ A;  3KXD A;  3L73 J;  1ZOY C;  2KZJ A;  2ZXE B;  2OQQ A;  1N7L A;  2OYI B;  5KTB A;  1BDD A;  1Q2N A;  1NU1 E;  3TNU A;  2E5Y A;  5E79 H;  1SQQ J;  1DD3 A;  2KB7 P;  3RBX A;  3GHG C;  3CX5 D;  3C9I A;  2O01 H;  1GK4 A;  1HH0 A;  3H1K G;  1JB0 J;  1KOR A;  3RL0 B;  4I7Z C;  2A45 I;  1HJ0 A;  1SQB G;  3B5N B;  5M1B A;  2OAR A;  3VP8 A;  1N2D C;  3F89 A;  1PPJ E;  4PD4 I;  3A0H H;  1VQ9 P;  3AEC C;  5B66 H;  4BXL A;  3RK3 E;  1KQG B;  2WSF H;  2O01 J;  3HTK B;  2FXM A;  2OYH C;  3L74 D;  3FXD A;  4MN4 C;  1W2B O;  4YXW H;  3WMM 0;  2QRX A;  1CSB A;  2ZVO B;  1H0T A;  1MUU A;  3M0A A;  1LJ2 A;  2V7Q H;  2KLV A;  2M3E A;  1A02 J;  1DIP A;  1HF9 A;  2N9B A;  3HD7 D;  1FZF A;  2WSF J;  1L0N K;  3JC2 2;  3WUT A;  2H8P D;  3V4Q A;  3PTZ A;  5APX A;  1OFC X;  2L5G B;  1M56 D;  2V7Q J;  1PGJ A;  1JTH B;  4PV1 D;  2AEJ A;  1AQ5 A;  1QL1 A;  1USE A;  2M8R A;  5KAF H;  1X9V A;  1D7M A;  1SQP E;  3L72 D;  2P58 A;  2A06 E;  3RK3 D;  1M1J C;  1VQ4 P;  3L71 J;  2Y9Y A;  1OW7 A;  2YKQ A;  2ZYG A;  3K5B A;  2KP8 A;  1NWQ A;  3B8E B;  1YHQ P;  1SQX E;  3AEB C;  1X22 A;  1EDI A;  1GL2 C;  3H1K D;  3CCV P;  1Y8A A;  1OVU A;  5CBN A;  1SQB D;  2KZI A;  2QJP B;  2PRR A;  1VF5 B;  3CC7 P;  1S5L H;  3L75 J;  2ITA A;  4GOE A;  3CCJ P;  2B87 A;  1NTM G;  1KV4 A;  1Q86 Q;  4Y99 C;  3TF5 A;  1LWU A;  1JCD A;  3CWB J;  1NGM B;  5AW1 B;  4PD4 E;  3ITK A;  1SQV G;  4H13 B;  1KC8 Q;  3U59 A;  1SQP D;  1T2K C;  3M06 A;  3H1L J;  2NPS C;  2A06 D;  5GTI E;  1HVV A;  2KUB A;  3M9H A;  3RK2 C;  5CJ0 A;  3O6Q A;  4GDO A;  3E7K A;  3PP5 A;  1KTM A;  2WPQ A;  2CPB A;  5APT A;  5KJ7 A;  1K73 Q;  3W67 A;  1VQ5 P;  4U3F E;  2W6B A;  1KYO H;  1OX3 A;  3L73 G;  2B88 A;  2LKM A;  2P67 A;  3Q2Y A;  4ZKU A;  2Z4E A;  3P7K A;  3AE2 C;  4AQR D;  3HUS A;  1RQU A;  5KKZ B;  1HGV A;  2BAS A;  3RL0 C;  1N73 B;  2IYP A;  2D2C D;  1L0L K;  1YIJ P;  5TJH A;  3B5N C;  2E74 C;  1VQN P;  4N3Y B;  5B5E E;  1JMB A;  1TU3 F;  3G3Z A;  1GMJ A;  2I1K A;  4WY4 B;  1ZR4 A;  1LTI C;  3SWY A;  1Q81 Q;  5C39 A;  3F5H A;  1NU1 J;  3D70 A;  1X8Y A;  3CD6 P;  2YXQ B;  1RE4 A;  2ZJS E;  4YPC A;  5BU5 A;  3TYY A;  3ZDM A;  2HYN A;  2YIU B;  4TLF A;  1M1K Q;  1SQQ E;  4RO0 A;  3IR9 A;  4BWN A;  1CI6 A;  1NTM D;  1Y9B A;  1MV8 A;  2OTK E;  1OW8 A;  2AXC A;  3GMA A;  3GLM A;  2K9J B;  5APV A;  4OGQ B;  1KN7 A;  2FY8 A;  1LT9 A;  5APY A;  3AE7 C;  2IBZ G;  1KMI Z;  2KIK A;  3IF4 A;  3CCU P;  4N78 D;  4QMA A;  1QGK B;  2Y0E A;  1VDF A;  4H13 D;  3S4R A;  3CC2 P;  1LWU C;  1NVO A;  1PIX A;  2E43 A;  1NTK J;  1FJK A;  1SLQ A;  1N86 A;  2K3R A;  2JKV A;  5B66 E;  3AEF C;  3CCQ P;  2FYU K;  3L71 G;  4H44 B;  2KK7 A;  5CHX A;  1YI2 P;  3PRJ A;  3EFF K;  1FDO A;  5BU8 B;  2PP6 A;  1URQ B;  1LP1 A;  1SQQ D;  2KNC B;  1VQ6 P;  3VMX A;  5CCH C;  2RN0 A;  1VF5 C;  1IZN B;  1BSH A;  1PP9 E;  2E76 B;  2M3B A;  2YXR B;  2I1J A;  1HUC A;  1FS0 E;  2IPP A;  2GM4 A;  2KLU A;  3PJS K;  3A7O A;  2ZT9 D;  3L75 G;  2K37 A;  1IO4 A;  2Z5I A;  1BGY J;  2Y0D A;  3GHG A;  1S72 P;  1KZU B;  1HBW A;  1SQX J;  3CWB G;  5DJU B;  2WT7 A;  2A45 H;  4JQ0 D;  1J1E B;  2IFM A;  2B9B A;  4PD4 H;  3H1L G;  4ASV A;  1L4A B;  3HE5 A;  4WWI A;  1KIL A;  5GTI H;  3Q3D A;  2AEM A;  2DW3 A;  1RF1 A;  3II6 A;  3G6E P;  2OYH A;  1RE4 C;  2IBZ D;  1WRG A;  3OA7 A;  1NTZ K;  2MKV A;  3L75 E;  4R4M A;  4C7R A;  4HH2 A;  4KT0 J;  2IFN A;  1G2C A;  5APU A;  2QJK B;  5AW2 B;  1ZW0 A;  1KD1 Q;  1L0L E;  5APQ A;  1YBK A;  1N73 C;  1SP4 A;  2OYO A;  5CMZ A;  3CXH I;  5AW6 B;  3P8M C;  1XTC C;  1IC2 A;  1GU5 A;  3H1H E;  2KOG A;  2O3J A;  1ZRT D;  1S5L E;  1JMM A;  1OVR A;  2J58 A;  4WY4 C;  1G1I A;  1BCC E;  3M9Q A;  3HD7 B;  1T3J A;  1N8R Q;  3NMD A;  5B5E H;  1JY3 O;  4W7Z A;  4U3F J;  1JUN A;  2HPC A;  1NH4 A;  2H7H A;  2QSI A;  3V6I A;  2J59 M;  2YIU C;  1YQ3 C;  1J1D C;  4EDF A;  1NU1 G;  1LTA C;  3V2Q A;  5CCG D;  1M1J A;  2R32 A;  4L75 A;  4WVZ A;  3SFE C;  1EZV E;  3L75 D;  3AE5 C;  1KQS O;  2SPZ A;  3QWO C;  1EDK A;  4OGQ C;  3Q5P A;  3RK3 B;  4O9B A;  1XTG B;  1Y47 A;  4L76 A;  1GL2 A;  3CWB D;  1FJP A;  1GW3 A;  1PPJ G;  4DT0 A;  2ZXX A;  4B86 A;  2WVR A;  3MZW B;  3M9B A;  3H1L D;  5AW8 B;  5KLV K;  3CCL P;  3PLN A;  1RE3 C;  1W5C E;  1L0N J;  1BCC D;  2PAJ A;  3AEA C;  2BEZ F;  3KHU A;  1VQO P;  3A3Y B;  3AED C;  1R8E A;  2LR2 A;  1LT1 A;  2BCC J;  1L4A D;  3I5C A;  1H89 A;  4H44 C;  2WTY A;  1GZL A;  1OIP A;  2NPS A;  1NTM K;  1SFC B;  2BEQ D;  2R3C A;  3RGU A;  3LID A;  1URQ C;  3CCS P;  4HYT B;  4BRY B;  1FE6 A;  3E1I A;  1UII A;  1KIL C;  1EZV D;  1P84 I;  3V4W A;  1RF1 C;  1SQV K;  2WSS H;  2E76 C;  1GDT A;  2OYI A;  1KYO D;  2Y9Z A;  2OTJ P;  1VQK P;  1SQP G;  4H0L D;  1ZXG A;  2A06 G;  2O1J A;  4HB1 A;  4AUW A;  1E5W A;  1NTK E;  3H32 B;  1FOS F;  3L70 J;  1JEK A;  4LGD E;  5AW9 B;  1NU1 D;  3CLQ A;  1J1E C;  3B5N A;  3BCC E;  1BGY G;  1IFM A;  2B89 A;  2JDI H;  1SQX G;  5KAI H;  4W80 A;  1T8Z A;  1OWA A;  1PP9 J;  5AVR B;  2D2C B;  4KJM A;  2FFD B;  2C9L Y;  3HTK A;  3TK1 A;  1E79 H;  1ZP0 C;  1PPJ D;  2IDB A;  3UIA A;  1KQF B;  2HR3 A;  3NFQ A;  1VQL P;  1N7S B;  1RF0 C;  1LTJ B;  2K88 A;  3R4Y A;  1K9M Q;  1U57 A;  5AW3 B;  2Q6Q A;  1EDL A;  3E1R A;  1BGY E;  3NTN A;  1S1C X;  2JEE A;  3OW2 O;  3NXS A;  5AVU B;  2M0B A;  3HD7 C;  4IFM A;  1NTK D;  2H88 C;  2W8Z A;  4GKG A;  1JTH A;  3KZI E;  3AE8 C;  3GG2 A;  3WUU A;  4UB8 E;  1GTW A;  2HOD B;  2N1T B;  1W2E A;  5APS A;  3G71 P;  2WPS A;  1AV1 A;  4L74 A;  2Q1K A;  1ZN5 A;  4U3F G;  1L0L J;  2KSE A;  4PV1 C;  1SFC D;  2RMZ A;  3G9R A;  4UB6 E;  1HWT C;  3AE4 C;  4K3A A;  2QVA A;  1S5L X;  1R5S A;  3H1H J;  1R5L A;  3RK3 C;  1P84 E;  1BCC J;  2QJY B;  2Z5H A;  4EIJ A;  1BDC A;  4EYY Q;  1BGY D;  5CCH A;  2P1J A;  3B4S A;  1SQX D;  3V2R A;  2OYI C;  2W6J H;  2Q5U A;  3VYI A;  4IL6 E;  2QA4 P;  3V2N A;  1U7J A;  2O1K A;  1L0N G;  1LTG C;  1SQQ G;  4C7N B;  2IX7 C;  1JY2 N;  2FYN B;  3L4F A;  2ZT9 B;  3Q5R A;  3RL0 g;  3ABV C;  4PD4 D;  1N7S D;  1SS1 A;  1ZLL A;  3I55 P;  2M5A B;  1OZH A;  1S9K E;  1Q82 Q;  1P84 D;  1NOH A;  3EFG A;  1K05 A;  2XND H;  3CPW O;  2FYU J;  1RHZ B;  1JY2 P;  1L0N E; 
#chains in the Genus database with same CATH homology
 3SWF A;  3TNU A;  3M91 A;  1KFM A;  1N73 A;  1L4A B;  1PFI A;  2KB7 P;  2JJL A;  3HE5 A;  2XKM A;  1HGZ A;  1KIL A;  3GHG C;  2N1T D;  3C9I A;  1FZC C;  2O01 H;  1GK4 A;  1HH0 A;  1RF1 A;  3II6 A;  2OYH A;  3L36 A;  1RE4 C;  1N7S A;  2WWW A;  3RL0 B;  1LTJ A;  1WRG A;  3OA7 A;  2A45 I;  1NTZ K;  4C7R A;  4HH2 A;  3B5N B;  5AW4 B;  2IFN A;  1G2C A;  5APU A;  4WY4 A;  2OAR A;  3RL0 D;  5AW2 B;  2FFD C;  1NHL A;  1IFI A;  1N2D C;  1MFZ A;  2GUV A;  3VP8 A;  3A5T A;  5KJ7 D;  1J2J B;  5APQ A;  2E42 A;  2P7J A;  4WBA A;  3P8C D;  3B5N D;  2P2U A;  1N73 C;  1SP4 A;  3HUS B;  5AW0 B;  5CMZ A;  1CZQ A;  2WSF H;  5AW6 B;  4AYC A;  3P8M C;  3HTK B;  2FXM A;  2OYH C;  1XTC C;  1IC2 A;  1GU5 A;  1LTJ C;  2KOG A;  4W7Y A;  3WMM 0;  4C46 A;  1CSB A;  1JMM A;  1MUU A;  5AVT B;  2J58 A;  2HOD A;  4WY4 C;  1G1I A;  2N1T A;  3M0A A;  4IFF A;  3M9Q A;  3HD7 B;  1G1J A;  2H43 A;  2Q9I A;  1KQL A;  1JY3 N;  1T3J A;  2KLV A;  3NMD A;  1JY3 O;  4W7Z A;  1A02 J;  2KSJ A;  2N9B A;  4RES B;  5AVS B;  3HD7 D;  1FZF A;  1JUN A;  4IFD K;  2HPC A;  1NH4 A;  1L0N K;  5AVX B;  2H7H A;  2J59 M;  4XA4 A;  1J1D C;  1VPC A;  1LTA C;  2H8P D;  3V4Q A;  3V2Q A;  2C0X A;  5CCG D;  1M1J A;  2R32 A;  5APX A;  2L5G B;  1H88 A;  4OH8 B;  4LC1 A;  1JCC A;  1JTH B;  1SFC C;  2XU6 A;  2WSC H;  4EOT A;  1CI6 B;  1RE3 A;  4ZKP A;  1JY3 P;  1AQ5 A;  1QL1 A;  3RK3 B;  2M8R A;  4O9B A;  1XTG B;  4N78 E;  1X9V A;  1GL2 A;  1MZ9 A;  3L37 A;  4JYC A;  1X79 B;  1IFN A;  1FJP A;  1SVF A;  1GW3 A;  2YKO A;  3RK3 D;  1DH3 A;  1YTZ T;  4B86 A;  1M1J C;  1LT9 B;  2HLO A;  3BRV B;  2YKQ A;  3BAS A;  3M9B A;  4GIF A;  3V2P A;  1HJB A;  5AW8 B;  2KP8 A;  2YMY A;  5KLV K;  2WPR A;  1NWQ A;  3B8E B;  1RE3 C;  1FAV A;  5CCG A;  2R5D A;  1URQ A;  2PAJ A;  2QM8 A;  1KFN A;  3EQ2 A;  1GL2 C;  3A3Y B;  3O8Z A;  5AVZ B;  4C7N A;  1JNM A;  2FYZ A;  3N7N A;  1FU1 A;  1SQB K;  1A02 F;  1L4A D;  5AVQ B;  3I5C A;  1H89 A;  1J1D B;  2WTY A;  1GZL A;  2YKP A;  2XZR A;  1JOC A;  2NPS A;  1NTM K;  4I6M C;  1SFC B;  2R3C A;  5CCH D;  3LID A;  3HRN A;  1URQ C;  3VTP C;  4HYT B;  4I2L C;  2YO2 A;  3P32 A;  1DEB A;  4Y99 C;  1LWU A;  1JCD A;  2YO3 A;  3E1I A;  1KIL C;  3M0D A;  2GUS A;  3V4W A;  2VRS A;  4GT1 A;  1RF1 C;  1SQV K;  1N7S C;  5AW1 B;  1QL2 A;  2ZFC A;  1DX7 A;  2C9N Y;  3U59 A;  1GDT A;  1S9K D;  3MIW A;  1T2K C;  3BVH A;  2YNY A;  2OYI A;  3M06 A;  1SQP K;  1WT6 A;  2HFE D;  2NPS C;  1LGH B;  2Q7C A;  1HVV A;  5AW7 B;  1L4A A;  2O1J A;  3M9H A;  2XDJ A;  4AUW A;  2HG5 D;  3RK2 C;  5CJ0 A;  1H8A A;  1E5W A;  3M0D C;  3MD0 A;  3H32 B;  3PP5 A;  1FOS F;  1Z56 A;  2WPQ A;  4LGD E;  2CPB A;  5APT A;  5AW9 B;  5KJ7 A;  3CLQ A;  1J1E C;  1FZB A;  4DOJ A;  1NU1 K;  3GHG B;  1FZC B;  1M7L A;  1SQX K;  2CPS A;  3B5N A;  1FDM A;  1IFM A;  2Q3I A;  3VMY A;  2WT7 B;  1RF0 A;  3TSI A;  3KPE A;  2N1T C;  2W6B A;  4W80 A;  3CL3 D;  1T8Z A;  1OXZ A;  1YYC A;  2LKM A;  2P67 A;  1OWA A;  3HE4 A;  4ZKU A;  3VP9 A;  2Z4E A;  3P7K A;  5AVR B;  4JYB A;  3HUS A;  4AQR D;  2FFD B;  2C9L Y;  3MUD A;  3TNU B;  3HTK A;  1HGV A;  3TK1 A;  1EQ7 A;  2BAS A;  3RL0 C;  1N73 B;  4Y99 B;  3HE5 B;  5AVY B;  5KJ7 C;  1NO4 A;  1KIL B;  5APW A;  1L0L K;  1GK6 A;  2FKW B;  2WSE H;  3B5N C;  1AFO A;  3UIA A;  1RF1 B;  2OYH B;  3MTU E;  3NFQ A;  4N3Y B;  1N7S B;  1RF0 C;  3HD7 A;  1FZG A;  1LTJ B;  1GW4 A;  3G3Z A;  2WIT A;  1GU4 A;  2I1K A;  1G2C B;  5AW3 B;  4WY4 B;  1ZR4 A;  3HUS C;  1HTL C;  3KDP B;  1LTI C;  4M3L A;  3CI9 A;  3SWY A;  3NTN A;  4WY4 D;  3RK2 B;  1NAF A;  2XNX A;  3VMZ A;  1X8Y A;  2W6A A;  2JEE A;  1RE4 A;  3NXS A;  5AVU B;  5BU5 A;  3HD7 C;  4IFM A;  3TYY A;  1LTS C;  1NTK K;  2HYN A;  4GKG A;  1T3U A;  1JTH A;  2R5B A;  1GTW A;  2HOD B;  3KYQ A;  2N1T B;  1JO5 A;  3A2A A;  3IR9 A;  1CI6 A;  2POH A;  1W2E A;  5APS A;  2WPS A;  1MV8 A;  3BAT A;  5CCG C;  1LTB C;  1ZN5 A;  5AVV B;  5APV A;  1YTZ I;  1RY3 A;  2HPC B;  1SFC D;  3V5B A;  1LT9 A;  3U1A A;  1HWT C;  5APY A;  3U1C A;  4I1L A;  3OJA B;  1IJD B;  1FZE A;  3IFM A;  4N78 D;  1M1J B;  3VN0 A;  5BVZ A;  3RK3 C;  3HE4 B;  4WB4 A;  1VDF A;  1ZV8 A;  3L35 A;  1LWU C;  3LW5 H;  3KQG A;  2W27 A;  2Z5H A;  3VOP A;  4EIJ A;  1FBM A;  1LT9 C;  2E43 A;  1FJK A;  1GL2 B;  3N4X A;  3T97 A;  5CCH A;  2P1J A;  1SLQ A;  4DZO A;  1N86 A;  1GD2 E;  3V2R A;  2OYI C;  2Q5U A;  3BRT B;  1SFC A;  3VYI A;  1GL2 D;  5CJ4 A;  2FYU K;  5CHX A;  3V2N A;  1L4A C;  4LLH A;  1ZR2 A;  2O1K A;  5BU8 B;  4N6J A;  1LTT C;  2PP6 A;  1URQ B;  1SQQ K;  4XE5 B;  3VMX A;  1LTG C;  5CCH C;  2XV5 A;  3OAK A;  2QM7 A;  4C7N B;  2C0W A;  2IX7 C;  1URQ D;  2MJZ A;  1JY2 N;  5AVW B;  3P8C E;  1IFD A;  3L4F A;  5AW5 B;  1JY2 O;  1IFJ A;  1KIL D;  2M3B A;  4KHX A;  2WZ7 A;  2A45 G;  2I1J A;  1HUC A;  1CW5 A;  2IPP A;  2GM4 A;  2NPS B;  3R2P A;  1N7S D;  3A7O A;  3LIE A;  3H32 A;  1IO4 A;  2Z5I A;  1ZLL A;  1NKN A;  1S9K E;  1T2K D;  4JF7 A;  1LWU B;  2NPS D;  3GHG A;  1FZC A;  1NOH A;  3EFG A;  1FZA A;  1KZU B;  3MGN A;  1NKZ B;  2KYV A;  1HBW A;  1FOS E;  1IK9 A;  2WT7 A;  2A45 H;  3H6P A;  2ZXE B;  1J1E B;  3RK2 D;  2IFM A;  1N7L A;  2OYI B;  5KTB A;  1JY2 P;  2FFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...