1AFOA

Dimeric transmembrane domain of human glycophorin a, nmr, 20 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
40
structure length
40
Chain Sequence
b'VQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLYCOPHORIN A
publication title A transmembrane helix dimer: structure and implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Integral membrane protein
total genus 12
structure length 40
sequence length 40
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.70 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1afoA00
2J58A 1AFOA
chains in the Genus database with same CATH superfamily
1X22A 2FFDA 1LTJC 2QE7H 2HG5D 2IFMA 1QGKB 1K04A 1VQ5P 1N7SA 2QM7A 3E7KA 1JY3O 2O01J 3G3ZA 4LLHA 3SWFA 1UIIA 1NTMK 2OTLP 2E76D 1AVOA 1OFCX 1OZHA 4WY4A 5KKZC 1JCDA 1LT9C 3NTNA 2ZYDA 2QVAA 1P84H 1FZGA 2FBWC 3H1KJ 4UB8E 2Y0CA 1MFTA 5EFWB 1VQLP 3A0HE 3IN6A 1DD3A 2Z5IA 2LR2A 3SFEC 3TNUA 1ZRTD 3H1LE 4KHXA 1VF5B 3RL0B 2AXTE 1EDJA 1SS1A 1NTZD 1JUNA 1SFCA 2M0BA 2B87B 2E75D 3IR9A 3CMEP 5KLVD 1GU4A 4OGQC 2E74D 1OVRA 3AE8C 3EFFK 1VQNP 5E79H 2M3BA 5H2FE 4OVNF 2P10A 1NTKG 5APQA 2O1KA 1SLQA 1JMMA 1L0LK 2N1TA 4DOJA 3Q5SA 1DEBA 3CC4P 3S9OA 3H1KD 3PLNA 3AEBC 1NKZB 1JM0A 1FE6A 4GOEA 3NXSA 4N78D 1ZR4A 1T6AA 2QRXA 4WVZA 2W6AA 1E79H 1HTLC 4BWNA 4OGQD 3RK3D 4UB6H 1IK9A 4K3AA 4ASWA 1NO4A 4RKUJ 1BDCA 2IFNA 3M0DC 1GU5A 1KILB 1LGHB 4D6TG 2R44A 1ZN5A 1BCCJ 1VL2A 3B5NA 1SQVK 2IBZI 3CL3D 2NZ2A 1YTZI 1Q2NA 1ZW0A 1FZEA 4IL6X 3MUDA 1FOSF 3V4QA 2POHA 5AVSB 2JR8A 1NTKE 2FFDC 3FWNA 4RJTA 2W6BA 1KTMA 1EC5A 2BASA 1RQUA 1JEKA 1VQ7P 1JTHB 3SWYA 5CBOA 1NWQA 4PJ0H 5AW0B 2B9BA 1YYCA 4WY4C 1QX8A 1UIXA 5KTBA 1SQXG 2L5GB 4WB4A 1KFMA 1KZUB 2Q9IA 4H0LB 3GG2A 4M3LA 2Y9YA 3LIDA 1CSBA 2DW3A 3VMYA 3TK1A 3T97B 1AFOA 1ZXGA 2HODB 3KXDA 3Q5PA 1RE4C 4B86A 2M5AB 1NU1J 1N7SD 4D6TE 1YTZT 2V7QH 4RESB 4IFFA 1G1IA 2YMYA 1PIXA 1R5SA 1KILE 2AEFA 1FU1A 4L76A 4YPCA 1H8AA 1S5LH 2IPPA 1SFCC 2QJKC 4L74A 2KXPB 1T8ZA 4BRYB 2FYNB 1U7JA 3CX5D 1IO4A 2ZT9C 3OAKA 1PPJD 1EZVG 1S5LX 2HLOA 1RE3C 1YJ9P 1EXJA 1SVFA 3OJAB 1OVVA 1KN7A 1RF0C 1SQPG 1NGMB 3H1LJ 2YIUC 3OA7A 2I1JA 3M9HA 1LTSC 1EDIA 1MUUA 2FKWB 3HD7B 3QH9A 1BDDA 1VQ4P 1JY2N 2OYIB 1SQXE 2BCCG 4L75A 4JF7A 1P84E 1RY3A 3GHGB 2MKVA 1NU1D 5BU8B 1SQBG 2WSEJ 5AVZB 3CWBG 3VP8A 1L0NG 1JY2P 1GL2A 4Y28J 2WQYC 4N6JA 3AE4C 3CCLP 4CPGA 3JCUE 2HFED 2N1TD 2XNXA 2PRRA 1MFZA 2JKVA 1L4AC 1M57D 5KAFH 3G71P 3B5NC 4GODA 2YXQB 2WWWA 1JO5A 3TSIA 1BE3G 3D70A 1IK7A 3MUDC 5CBNA 1EZVE 1JTHA 1M90Q 2OGUA 2WPRA 4HJGH 2ZFCA 1FS0E 2A06G 5APXA 3L71G 2C0XA 3BRTB 3CXHD 4NPDA 2R32A 1MKMA 2SPZA 1LTBC 2Y0DA 5M1BA 1KYOD 2BCCE 3M0AA 1CZQA 2JWAA 3RK2B 3SSUA 4XFJA 3Q3DA 5AW9B 3T97A 1FDMA 3PH0A 1OMIA 4XE5B 2RH0A 2M5AA 3L70J 3CI9A 1L0NE 1NTKJ 3FGAD 1VF5C 2Q1KA 3RL0C 2P2UA 2P7JA 5TJHA 4IL6E 5KJ7C 2W8ZA 1KC8Q 1A02F 2YO2A 4DT0A 1YHQP 4PD4E 3CCQP 1KQFB 3MP7B 4BRYA 1TU3F 1N86A 3G6EP 2XKMA 4GT1A 2J58A 2XDJA 3M91A 5CCGA 5TISH 3P8CE 3JC22 1LJ2A 1ZP0C 1KB9D 2A06E 2NRGA 3L71E 1AVYA 3HD7A 2OYIA 4D6TJ 1ZLLA 2WPQA 2AEJA 4PJ0E 2A45G 1LTAC 5AW1B 3GHGA 5B66H 1A02J 3WMM0 1YBKA 3L70D 3FXEA 1NTKD 3GF7A 1PZQA 2KLVA 5AVWB 5KAIH 3PJSK 1VQ8P 3GMAA 4C7NB 1NOHA 2YKOA 1J2JB 2WSFJ 1L0LE 4L73A 3NMDA 3H1JD 2WSSH 1KV4A 3BCCG 3VMAA 2RN0A 3CCSP 3LW5J 3H1HG 1KILC 1L4AB 3V2QA 3CX5I 1OXZA 1QL2A 3D6ZA 2GM4A 1M8OB 3L73G 4HB1A 1SQXJ 1S5LE 2KSEA 3D6YA 3TF5A 3I56P 1WRGA 5B5EH 1LTGC 2KYVA 2KI7B 1QEXA 5GTIH 4QMAA 3PP5A 2G3AA 2QA4P 1SQVE 3VTPC 4JQ0D 1GL2D 3KPEA 2E5TA 4YTPC 1RE4A 1JY3N 3HE5B 3CCJP 3H1IG 2O01H 3F89A 2HPCB 4U3FD 5CMZA 5AVTB 5L8RJ 1S9KD 4H0LC 1Q82Q 1RH5B 3HUSB 3L72D 3NFQA 1OW6A 3BCCE 2WT7B 2JO1A 1BGYE 3H1HE 3N4XA 2G8YA 3I55P 1JY3P 2YKQA 3OW2O 2ZVOB 1GK6A 3AE6C 1SQPJ 3E1RA 4H13B 4MN4C 3L73E 3AEGC 3CCVP 2BCCJ 1RHZB 1RE3A 1KQSO 3CXHI 5KAFE 1RF0A 1X0TA 2FYNC 2KP8A 3H6PA 4N3YB 1KYOI 4H0LD 3HTKB 1SQBJ 3USSA 3TGUG 5CCGC 4HKZH 3CWBJ 3CCEP 1L0NJ 4PV1B 3KZIE 3L75E 3PTZA 1AQTA 1JMBA 1FJKA 2WITA 1DD4A 4AUWA 4W80A 3HD7C 1YITP 2OYIC 3H1IE 2O01N 4R4MA 1SQQG 1L2PA 3JSVC 4IFMA 4C7NA 1Y9BA 3GHGC 1Q81Q 1EZVD 5AVVB 1BE3J 1FDIA 2E76B 4NPEA 1RQVA 1SQPD 1LWUB 1NU1K 1L4AA 1GW3A 2IBZE 3W68A 2KZJA 3L71J 5APWA 1VQPP 3MIWA 1KB9I 2IZ0A 5KLIB 1SQBD 1H89A 1HWTC 1ZOYC 3V5BA 1QL1A 3CWBD 1CW5A 1L0ND 2YO3A 5AW2B 1JB0J 3TGUE 5AW8B 5TISE 2XV5A 2O1JA 1SP4A 2YNYA 3L74J 2WPVB 1FBMA 1Z56A 2QJYB 2R5BA 4C7RA 5GTHE 2YKPA 2ZYAA 1WMKA 1OVUA 2H43A 2QEXP 4PD4D 2E75B 1ZR2A 1U57A 3HE5A 5AW4B 1VQ9P 1XTCC 2HPCA 1NTZG 2E74B 1SQQE 1BE3D 3HUSA 3F5HA 3RK2C 5B66E 5KLVG 5CCHA 3CX5H 5KJ7A 1CI6B 1BCCD 4HYTB 2A06D 3L71D 3CCMP 5AVQB 2B87A 1PV3A 3AE9C 1LTIC 1GMJA 2KLUA 1URQB 2H89C 2O3JA 1NAFA 1IFNA 1N73B 2P58A 4WY4D 1S1CX 3ITKA 1FZCB 1VQ6P 4BXLA 3AECC 3BRVB 3RK3B 2FYUG 3N7NA 3HTKA 1VQMP 2FXPA 3L74D 2ZAEB 3O6QB 1EDKA 5B5EE 1KORA 3BCCJ 4C46A 3H1HJ 3M9QA 1NTZE 4UB8H 3PHLA 1SFCD 4LC1A 2HYNA 3L73J 3A0HH 3MTUE 2OTJP 1EXIA 5KLVE 2ZT9D 1NTMG 5AVYB 1KILA 1EDLA 5CJ4A 1NKNA 1LWUA 2WSCJ 1K9MQ 1USEA 1LP1B 3U1CA 1YJWP 2KUBA 1NTKK 2M8RA 2AXTH 2NPSC 1MZ9A 1S3JA 4EIJA 1X8YA 3FWLA 3CXHH 2WVRA 1VQOP 1AA0A 3V2RA 2Q3IA 1KYOH 3A3YB 5APSA 1DX7A 2XU6A 2C0WA 4TT3H 3PRJA 1OWAA 1NJIQ 2FYUE 2LXCB 4N78E 1FZFA 5E79E 2WSEH 3H1IJ 3H1LD 1M1JB 1FAVA 5H2FH 2E42A 1M7LA 3VMZA 2QSIA 3BCCD 2K3RA 3RK3E 3M06A 3I5CA 3H1HD 3BATA 3LIEA 3R2PA 3U59A 3RGUA 2ZVNB 1EZVI 3L73D 1L4AD 2WMMA 2BEQD 2GA1A 3B5ND 2HODA 2QG4A 3WUUA 3VYIA 1NTME 4UB6E 3MHVA 4EDFA 1N7LA 1L0LG 1Y47A 3WUVA 3HUSC 1QVFO 1Q90D 2E5YA 4KT0J 5CCHC 3AE3C 3CLQA 3S1KA 2KB7P 1URQA 2Q6QA 3TGUJ 1KB9H 1DEEG 2Q7CA 3Q5RA 1GDTA 2ZXEB 2KOGA 1EQ7A 3S4RA 1FZCA 4H13C 2Z4EA 1T2KC 1GD2E 4W7ZA 2C9NY 1SQXK 1SQQJ 2P1JA 4GKGA 3KHUA 4PD4I 3O6QA 1NYHA 4WBAA 2L91A 1NAYA 1VF5D 2Y0EA 2KZIA 3RL0D 1FJPA 2HR3A 1VDFA 5KJ7D 2RKLA 4PV1C 3WUTA 4I6MC 1J1EB 1SQVG 4RO0A 2N1TB 3RBZA 1GTWA 1JCCA 5AW3B 2JP3A 1W2EA 2W27A 3TDKA 3AEFC 3BASA 5AVRB 1R8EA 1HJ0A 1GK4A 1Q7YQ 5BU5A 1PGQA 3IFMA 3TGUD 2NPSB 1IFMA 4JYCA 3GLMA 3CX5E 2E76C 1BGYG 1OIPA 1LWUC 3VN0A 1K73Q 3FXDA 2FXOA 1IFPA 1SQPK 1QLED 1AV1A 2Z5HA 1Y8AA 2H7HA 4O9BA 1SQQD 2QIWA 4I7ZB 3KQGA 1D7MA 1M1JA 1S2EA 5KLIC 3P32A 5AVUB 1VPCA 1FOSE 2WSFH 3H32B 4D6TD 2M3EA 5KLVJ 1SQBK 3E1IA 3LW5H 1NU1E 1NVOA 1IC2A 4OH8B 3L75G 1U7MA 3CC2P 5AW7B 3CPWO 2IYOA 2BEZF 1KILD 4U7JA 1L0NK 1DH3A 3KYQA 3A2AA 1HJBA 2LXBA 2OARA 2GUSA 1LTTC 2QJYC 1S4XA 4I2LC 2H88C 3M9BA 3SFDC 2I8DA 2E75C 4DZOA 3CCRP 1T3UA 4R4LA 3HE4B 2E74C 2H8PD 1ZMEC 2D2CB 2A45I 3WU2H 2FYUJ 2N9YB 4H44B 2MJZA 2UWJE 3AE1C 2IBZG 2PFXA 4KJMA 2Q3EA 3CC7P 2VRSA 3D71A 3IAOA 1SQXD 1BSHA 3JCUH 1URQC 3O8ZA 3L37A 1P84D 3A0BH 4Y99B 3CXHE 1N73C 3EFGA 3P7KA 4IOIH 1KYOE 1FZCC 2PGDA 1PP9G 3RK3C 1NH4A 5AW5B 2OQQA 1YJNP 1NTMJ 1MV8A 2WPSA 3L70G 1HGZA 1PGPA 2QJPC 2OYHB 3QWOC 3V2NA 3RL0g 3H1JG 3AEAC 3VP9A 1URQD 2JWDA 5APTA 4DCKA 2FYUD 1PGOA 1Q86Q 2XZRA 1HGVA 2K88A 1AJYA 2KK7A 2NPSA 1G1JA 2LKMA 1IFJA 2R3CA 1OW8A 1RF1C 1X9VA 1HH0A 1FZAA 5CCGD 2FY8A 2CPSA 4ZKUA 1J1DB 2BCCD 1GZLA 4IL6H 1KB9E 3ZDMA 1GL2B 3BVHA 5DJTB 2K9JB 3HD7D 4PD4H 2OYOA 1LTJB 1T3JA 3L4FA 1PP9E 3A5TA 1LT1A 1NTMD 2W90A 4WWIA 4JBZA 3H32A 3AE2C 3L70E 4OWFA 1M1JC 1WT6A 2K1AA 5CJ0A 3H25A 1L0LJ 4U3FG 2Q5UA 3V6IA 1N7SC 5KKZB 1LT9B 3L72G 1R5LA 3AE7C 3H1JE 1IJDB 2V7QJ 3CCUP 3G9RA 3HE4A 4EOTA 1ZV8A 3B8EB 4ASVA 2KSJA 3P8CD 2J59M 5APVA 2WT7A 4AQRD 5KAIE 3G4SP 1HVVA 2ZXXA 1LNQA 1IFIA 3RBXA 3GF3A 3C8VA 1M1KQ 2E43A 3VMXA 2KNCB 2ZYGA 5APUA 3UIAA 1SQVJ 3H1KG 3GW6A 2YMKA 4OGQB 2B89A 2R5DA 1PFIA 3TYYA 2Y9ZA 1M56D 1JY2O 3HRNA 1H0TB 2W83C 3RK2D 2QJPB 1L0LD 3K5BA 3U1AA 2J5UA 4YXDC 1YIJP 2AXCA 2RMZA 3IF4A 1G2CB 4U3FE 2OYHA 3MGNA 3Q1MA 1S9KE 5DJUB 5GTIE 4GOFA 1FZBA 1ZRTE 2AEMA 1BGYJ 2I1KA 3L72E 4AYCA 1HF9A 1FC2C 1IFDA 1J1EC 2A45H 4HH2A 2N1TC 4TLFA 4LGDE 2IDBA 1IZNB 4GIFA 2B88A 2CK3H 1RF1B 1USDA 1W2BO 1P84I 3W67A 1OX3A 2KS1B 3WU2E 1W5CE 3II6A 1S72P 2OTKE 3B4SA 1SQVD 2KIKA 1AQ5A 3L75J 2K9JA 2IYPA 1HBWA 1YI2P 3H1KE 1PL5A 1LTJA 1XTGB 4JYBA 3VOPA 3A0BE 1E5WA 3B71A 4I7ZC 4ZMDA 2FFDB 1KQLA 2WSCH 1SQQK 1KQGB 1N7SB 2IZ1A 1BGYD 3R4YA 2IX7C 3CD6P 1LT9A 1X79B 2NPSD 3EWKA 2GUVA 3C1LA 1BCCG 1GW4A 3KZIH 1SQPE 4DJGA 1KMIZ 4WY4B 2YXRB 3V4WA 3V2PA 3AE5C 3MD0A 1HUCA 3SWKA 5BVZA 1N8RQ 1CI6A 2WZ7A 1NHLA 3ABVC 4JPZB 5CHXA 1PP9J 2D2CC 2K37A 1SQBE 2CPBA 2ZJSE 2QM8A 4IFDK 4H44C 1PPJG 3L75D 3TNUB 5C39A 1N73A 2R3SA 3CWBE 2KNCA 4EYYQ 3L74G 1FDOA 3H1ID 4A7PA 2XNDH 1N2DC 4YXWH 3CMAP 3H1JJ 1H0TA 2JDIH 4Y99C 1SFCB 3AEDC 5AW6B 1KD1Q 1K05A 2JJLA 2QJKB 3EQ2A 1NTZK 2PAJA 2ZT9B 2N9BA 1G2CA 3FX0A 5K5GB 1BE3E 2IBZD 1NU1G 5KLVK 4K35A 2D2CD 3L35A 5CCHD 4I1LA 1K8AQ 2C9LY 4H44D 2YIUB 1BCCE 4EI2A 1YQ3C 2OYHC 3KDPB 1JOCA 3AEEC 5GTHH 2JEEA 4W7YA 1JNMA 1BSNA 4H13D 1T2KD 1PGJA 4GDOA 1YQ4C 1PP9D 1RF1A 4ZKPA 1LP1A 2K9YA 3P8MC 4XA4A 2V4HA 3C9IA 2KS1A 2FYUK 3M0DA 3MZWB 3Q2YA 1PPJE 4ZNCA 1QVGO 1DIPA 5APYA 2WTYA 3H1LG 2ITAA 4Z1MH 2W6JH 4U3FJ 3L74E 1KFNA 2PP6A 3A7OA 4PV1D 1J1DC 3L72J 4NPFX 1OW7A 5AVXB 2P67A 2FXMA 1GL2C 1VQKP 1NTZJ 2FYZA 3L36A 3B5NB 1H88A
chains in the Genus database with same CATH topology
2FFDA 1LTJC 2HG5D 2IFMA 3RK2B 3BRVB 2XZRA 1HGVA 5AW9B 3RK3B 1N7SA 2QM7A 3T97A 3N7NA 1JY3O 2NPSA 3HTKA 1FDMA 1G1JA 2LKMA 3G3ZA 4LLHA 4XE5B 3SWFA 1IFJA 2R3CA 1NTMK 3CI9A 1RF1C 1X9VA 1HH0A 1FZAA 5CCGD 2CPSA 4ZKUA 1J1DB 3RL0C 2P2UA 4WY4A 2P7JA 1JCDA 1LT9C 1GZLA 4C46A 5KJ7C 3NTNA 1GL2B 1A02F 2YO2A 3BVHA 3HD7D 3M9QA 1FZGA 1LTJB 1T3JA 3L4FA 1SFCD 4LC1A 3A5TA 2HYNA 1N86A 3MTUE 3H32A 2XKMA 2Z5IA 4GT1A 2J58A 5AVYB 1KILA 2XDJA 3TNUA 3M91A 5CCGA 5CJ4A 1M1JC 1NKNA 1LWUA 3P8CE 1WT6A 3U1CA 5CJ0A 1NTKK 2Q5UA 4KHXA 2M8RA 3RL0B 1N7SC 1LT9B 2NPSC 1MZ9A 4EIJA 1X8YA 3HD7A 1IJDB 2OYIA 1ZLLA 2WPQA 1JUNA 1SFCA 2A45G 3V2RA 2Q3IA 3IR9A 3HE4A 1LTAC 3A3YB 5APSA 5AW1B 4EOTA 1DX7A 2XU6A 2C0WA 1ZV8A 1GU4A 3GHGA 3B8EB 1A02J 3WMM0 1OWAA 2KSJA 3P8CD 2J59M 4N78E 1FZFA 2WSEH 5APVA 2WT7A 2KLVA 5AVWB 4AQRD 2M3BA 1M1JB 1HVVA 1FAVA 4C7NB 5APQA 1NOHA 2E42A 1M7LA 2YKOA 1J2JB 3VMZA 3M06A 2O1KA 3I5CA 1IFIA 1SLQA 1JMMA 1L0LK 3NMDA 2N1TA 4DOJA 1DEBA 3BATA 3LIEA 3R2PA 3U59A 1KILC 2E43A 1L4AB 3V2QA 3VMXA 1OXZA 5APUA 1NKZB 1QL2A 3UIAA 2GM4A 3NXSA 1L4AD 4N78D 1ZR4A 2R5DA 2W6AA 1PFIA 3TYYA 3B5ND 2HODA 3HRNA 1JY2O 3VYIA 1HTLC 3RK2D 3RK3D 3U1AA 1IK9A 1N7LA 1NO4A 3HUSC 1WRGA 1G2CB 2OYHA 3MGNA 1S9KE 1LTGC 2KYVA 5CCHC 3PP5A 2IFNA 1FZBA 3M0DC 1GU5A 3CLQA 1KILB 2KB7P 1URQA 2I1KA 4AYCA 1LGHB 2Q7CA 1ZN5A 1GDTA 1IFDA 2ZXEB 2KOGA 1J1EC 1EQ7A 1FZCA 2A45H 3B5NA 4HH2A 3VTPC 1SQVK 2N1TC 1GL2D 2Z4EA 3KPEA 1T2KC 3CL3D 1YTZI 4LGDE 1GD2E 1FZEA 4W7ZA 1RE4A 1JY3N 3HE5B 3MUDA 1FOSF 2O01H 3V4QA 4GIFA 2C9NY 1SQXK 2HPCB 2POHA 5AVSB 1RF1B 5CMZA 5AVTB 1S9KD 2FFDC 2P1JA 3HUSB 4GKGA 2W6BA 2BASA 3NFQA 3II6A 2WT7B 4WBAA 1JTHB 3SWYA 3RL0D 3N4XA 1FJPA 1NWQA 1JY3P 2YKQA 1VDFA 5KJ7D 1AQ5A 1GK6A 4I6MC 1J1EB 5AW0B 2N1TB 1HBWA 1LTJA 1XTGB 1GTWA 1JCCA 1YYCA 5AW3B 4JYBA 4WY4C 5KTBA 1W2EA 3VOPA 2W27A 2L5GB 4WB4A 1KFMA 3BASA 5AVRB 1RE3A 1KZUB 1E5WA 2Q9IA 1GK4A 4M3LA 2FFDB 1RF0A 5BU5A 1KQLA 2WSCH 3LIDA 1CSBA 1SQQK 3VMYA 5APTA 3TK1A 1N7SB 2KP8A 3H6PA 4N3YB 1AFOA 3IFMA 2NPSB 2HODB 3HTKB 1IFMA 4JYCA 2IX7C 1RE4C 1LT9A 4B86A 1N7SD 1X79B 5CCGC 2NPSD 2GUVA 1LWUC 1YTZT 4RESB 4IFFA 1GW4A 3VN0A 1G1IA 2YMYA 1SQPK 1FJKA 4WY4B 3V4WA 3V2PA 2WITA 1FU1A 2Z5HA 1H8AA 4AUWA 4W80A 3MD0A 1HUCA 2H7HA 4O9BA 3HD7C 5BVZA 2IPPA 2OYIC 1CI6A 2WZ7A 1SFCC 3KQGA 1NHLA 1FZCB 1M1JA 4IFMA 4C7NA 1T8ZA 3P32A 5AVUB 1IO4A 1VPCA 5CHXA 1FOSE 2WSFH 3GHGC 3OAKA 3H32B 5AVVB 2CPBA 2QM8A 4IFDK 1SQBK 3E1IA 3TNUB 3LW5H 2HLOA 1RE3C 1LWUB 1N73A 1NU1K 1SVFA 1L4AA 3OJAB 1IC2A 4OH8B 1GW3A 1RF0C 5AW7B 1KILD 1L0NK 1DH3A 3KYQA 3OA7A 3A2AA 1HJBA 2I1JA 2OARA 3M9HA 1H88A 2GUSA 1LTTC 1LTSC 1N2DC 4I2LC 1MUUA 3M9BA 5APWA 2FKWB 3HD7B 1JY2N 2OYIB 4DZOA 4Y99C 1SFCB 1T3UA 3MIWA 5AW6B 2JJLA 3HE4B 4JF7A 3EQ2A 1RY3A 1NTZK 2PAJA 2H8PD 3GHGB 2N9BA 1H89A 1G2CA 1HWTC 2A45I 5BU8B 3V5BA 1QL1A 1CW5A 2YO3A 2MJZA 5AVZB 5AW2B 5KLVK 3L35A 5AW8B 3VP8A 5CCHD 4I1LA 1JY2P 2XV5A 2O1JA 2C9LY 1GL2A 1SP4A 2YNYA 2VRSA 4N6JA 1FBMA 1Z56A 2OYHC 3KDPB 1JOCA 2R5BA 4C7RA 2JEEA 4W7YA 2YKPA 1URQC 1JNMA 2H43A 3O8ZA 2HFED 2N1TD 2XNXA 3L37A 1ZR2A 3HE5A 4Y99B 1MFZA 5AW4B 1T2KD 1N73C 1L4AC 1XTCC 2HPCA 3EFGA 1RF1A 3P7KA 4ZKPA 1FZCC 3B5NC 3HUSA 2WWWA 3P8MC 3RK2C 4XA4A 1JO5A 3TSIA 3RK3C 3C9IA 1NH4A 5AW5B 5CCHA 2FYUK 3M0DA 5KJ7A 1CI6B 1MV8A 2WPSA 4HYTB 1HGZA 1JTHA 5APYA 2WPRA 2WTYA 5AVQB 2ZFCA 2OYHB 5APXA 1LTIC 2C0XA 1KFNA 3V2NA 3BRTB 2PP6A 3A7OA 1J1DC 2R32A 1URQB 1LTBC 1NAFA 1IFNA 5AVXB 1N73B 2P67A 4WY4D 2FXMA 3VP9A 3M0AA 1GL2C 1URQD 2FYZA 3L36A 3B5NB 1CZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J58 A;  1AFO A; 
#chains in the Genus database with same CATH topology
 1X22 A;  2FFD A;  1LTJ C;  2QE7 H;  2HG5 D;  2IFM A;  1QGK B;  1K04 A;  1VQ5 P;  1N7S A;  2QM7 A;  3E7K A;  1JY3 O;  2O01 J;  3G3Z A;  4LLH A;  3SWF A;  1UII A;  1NTM K;  2OTL P;  2E76 D;  1AVO A;  1OFC X;  1OZH A;  4WY4 A;  5KKZ C;  1JCD A;  1LT9 C;  3NTN A;  2ZYD A;  2QVA A;  1P84 H;  1FZG A;  2FBW C;  3H1K J;  4UB8 E;  2Y0C A;  1MFT A;  5EFW B;  1VQL P;  3A0H E;  3IN6 A;  1DD3 A;  2Z5I A;  2LR2 A;  3SFE C;  3TNU A;  1ZRT D;  3H1L E;  4KHX A;  1VF5 B;  3RL0 B;  2AXT E;  1EDJ A;  1SS1 A;  1NTZ D;  1JUN A;  1SFC A;  2M0B A;  2B87 B;  2E75 D;  3IR9 A;  3CME P;  5KLV D;  1GU4 A;  4OGQ C;  2E74 D;  1OVR A;  3AE8 C;  3EFF K;  1VQN P;  5E79 H;  2M3B A;  5H2F E;  4OVN F;  2P10 A;  1NTK G;  5APQ A;  2O1K A;  1SLQ A;  1JMM A;  1L0L K;  2N1T A;  4DOJ A;  3Q5S A;  1DEB A;  3CC4 P;  3S9O A;  3H1K D;  3PLN A;  3AEB C;  1NKZ B;  1JM0 A;  1FE6 A;  4GOE A;  3NXS A;  4N78 D;  1ZR4 A;  1T6A A;  2QRX A;  4WVZ A;  2W6A A;  1E79 H;  1HTL C;  4BWN A;  4OGQ D;  3RK3 D;  4UB6 H;  1IK9 A;  4K3A A;  4ASW A;  1NO4 A;  4RKU J;  1BDC A;  2IFN A;  3M0D C;  1GU5 A;  1KIL B;  1LGH B;  4D6T G;  2R44 A;  1ZN5 A;  1BCC J;  1VL2 A;  3B5N A;  1SQV K;  2IBZ I;  3CL3 D;  2NZ2 A;  1YTZ I;  1Q2N A;  1ZW0 A;  1FZE A;  4IL6 X;  3MUD A;  1FOS F;  3V4Q A;  2POH A;  5AVS B;  2JR8 A;  1NTK E;  2FFD C;  3FWN A;  4RJT A;  2W6B A;  1KTM A;  1EC5 A;  2BAS A;  1RQU A;  1JEK A;  1VQ7 P;  1JTH B;  3SWY A;  5CBO A;  1NWQ A;  4PJ0 H;  5AW0 B;  2B9B A;  1YYC A;  4WY4 C;  1QX8 A;  1UIX A;  5KTB A;  1SQX G;  2L5G B;  4WB4 A;  1KFM A;  1KZU B;  2Q9I A;  4H0L B;  3GG2 A;  4M3L A;  2Y9Y A;  3LID A;  1CSB A;  2DW3 A;  3VMY A;  3TK1 A;  3T97 B;  1AFO A;  1ZXG A;  2HOD B;  3KXD A;  3Q5P A;  1RE4 C;  4B86 A;  2M5A B;  1NU1 J;  1N7S D;  4D6T E;  1YTZ T;  2V7Q H;  4RES B;  4IFF A;  1G1I A;  2YMY A;  1PIX A;  1R5S A;  1KIL E;  2AEF A;  1FU1 A;  4L76 A;  4YPC A;  1H8A A;  1S5L H;  2IPP A;  1SFC C;  2QJK C;  4L74 A;  2KXP B;  1T8Z A;  4BRY B;  2FYN B;  1U7J A;  3CX5 D;  1IO4 A;  2ZT9 C;  3OAK A;  1PPJ D;  1EZV G;  1S5L X;  2HLO A;  1RE3 C;  1YJ9 P;  1EXJ A;  1SVF A;  3OJA B;  1OVV A;  1KN7 A;  1RF0 C;  1SQP G;  1NGM B;  3H1L J;  2YIU C;  3OA7 A;  2I1J A;  3M9H A;  1LTS C;  1EDI A;  1MUU A;  2FKW B;  3HD7 B;  3QH9 A;  1BDD A;  1VQ4 P;  1JY2 N;  2OYI B;  1SQX E;  2BCC G;  4L75 A;  4JF7 A;  1P84 E;  1RY3 A;  3GHG B;  2MKV A;  1NU1 D;  5BU8 B;  1SQB G;  2WSE J;  5AVZ B;  3CWB G;  3VP8 A;  1L0N G;  1JY2 P;  1GL2 A;  4Y28 J;  2WQY C;  4N6J A;  3AE4 C;  3CCL P;  4CPG A;  3JCU E;  2HFE D;  2N1T D;  2XNX A;  2PRR A;  1MFZ A;  2JKV A;  1L4A C;  1M57 D;  5KAF H;  3G71 P;  3B5N C;  4GOD A;  2YXQ B;  2WWW A;  1JO5 A;  3TSI A;  1BE3 G;  3D70 A;  1IK7 A;  3MUD C;  5CBN A;  1EZV E;  1JTH A;  1M90 Q;  2OGU A;  2WPR A;  4HJG H;  2ZFC A;  1FS0 E;  2A06 G;  5APX A;  3L71 G;  2C0X A;  3BRT B;  3CXH D;  4NPD A;  2R32 A;  1MKM A;  2SPZ A;  1LTB C;  2Y0D A;  5M1B A;  1KYO D;  2BCC E;  3M0A A;  1CZQ A;  2JWA A;  3RK2 B;  3SSU A;  4XFJ A;  3Q3D A;  5AW9 B;  3T97 A;  1FDM A;  3PH0 A;  1OMI A;  4XE5 B;  2RH0 A;  2M5A A;  3L70 J;  3CI9 A;  1L0N E;  1NTK J;  3FGA D;  1VF5 C;  2Q1K A;  3RL0 C;  2P2U A;  2P7J A;  5TJH A;  4IL6 E;  5KJ7 C;  2W8Z A;  1KC8 Q;  1A02 F;  2YO2 A;  4DT0 A;  1YHQ P;  4PD4 E;  3CCQ P;  1KQF B;  3MP7 B;  4BRY A;  1TU3 F;  1N86 A;  3G6E P;  2XKM A;  4GT1 A;  2J58 A;  2XDJ A;  3M91 A;  5CCG A;  5TIS H;  3P8C E;  3JC2 2;  1LJ2 A;  1ZP0 C;  1KB9 D;  2A06 E;  2NRG A;  3L71 E;  1AVY A;  3HD7 A;  2OYI A;  4D6T J;  1ZLL A;  2WPQ A;  2AEJ A;  4PJ0 E;  2A45 G;  1LTA C;  5AW1 B;  3GHG A;  5B66 H;  1A02 J;  3WMM 0;  1YBK A;  3L70 D;  3FXE A;  1NTK D;  3GF7 A;  1PZQ A;  2KLV A;  5AVW B;  5KAI H;  3PJS K;  1VQ8 P;  3GMA A;  4C7N B;  1NOH A;  2YKO A;  1J2J B;  2WSF J;  1L0L E;  4L73 A;  3NMD A;  3H1J D;  2WSS H;  1KV4 A;  3BCC G;  3VMA A;  2RN0 A;  3CCS P;  3LW5 J;  3H1H G;  1KIL C;  1L4A B;  3V2Q A;  3CX5 I;  1OXZ A;  1QL2 A;  3D6Z A;  2GM4 A;  1M8O B;  3L73 G;  4HB1 A;  1SQX J;  1S5L E;  2KSE A;  3D6Y A;  3TF5 A;  3I56 P;  1WRG A;  5B5E H;  1LTG C;  2KYV A;  2KI7 B;  1QEX A;  5GTI H;  4QMA A;  3PP5 A;  2G3A A;  2QA4 P;  1SQV E;  3VTP C;  4JQ0 D;  1GL2 D;  3KPE A;  2E5T A;  4YTP C;  1RE4 A;  1JY3 N;  3HE5 B;  3CCJ P;  3H1I G;  2O01 H;  3F89 A;  2HPC B;  4U3F D;  5CMZ A;  5AVT B;  5L8R J;  1S9K D;  4H0L C;  1Q82 Q;  1RH5 B;  3HUS B;  3L72 D;  3NFQ A;  1OW6 A;  3BCC E;  2WT7 B;  2JO1 A;  1BGY E;  3H1H E;  3N4X A;  2G8Y A;  3I55 P;  1JY3 P;  2YKQ A;  3OW2 O;  2ZVO B;  1GK6 A;  3AE6 C;  1SQP J;  3E1R A;  4H13 B;  4MN4 C;  3L73 E;  3AEG C;  3CCV P;  2BCC J;  1RHZ B;  1RE3 A;  1KQS O;  3CXH I;  5KAF E;  1RF0 A;  1X0T A;  2FYN C;  2KP8 A;  3H6P A;  4N3Y B;  1KYO I;  4H0L D;  3HTK B;  1SQB J;  3USS A;  3TGU G;  5CCG C;  4HKZ H;  3CWB J;  3CCE P;  1L0N J;  4PV1 B;  3KZI E;  3L75 E;  3PTZ A;  1AQT A;  1JMB A;  1FJK A;  2WIT A;  1DD4 A;  4AUW A;  4W80 A;  3HD7 C;  1YIT P;  2OYI C;  3H1I E;  2O01 N;  4R4M A;  1SQQ G;  1L2P A;  3JSV C;  4IFM A;  4C7N A;  1Y9B A;  3GHG C;  1Q81 Q;  1EZV D;  5AVV B;  1BE3 J;  1FDI A;  2E76 B;  4NPE A;  1RQV A;  1SQP D;  1LWU B;  1NU1 K;  1L4A A;  1GW3 A;  2IBZ E;  3W68 A;  2KZJ A;  3L71 J;  5APW A;  1VQP P;  3MIW A;  1KB9 I;  2IZ0 A;  5KLI B;  1SQB D;  1H89 A;  1HWT C;  1ZOY C;  3V5B A;  1QL1 A;  3CWB D;  1CW5 A;  1L0N D;  2YO3 A;  5AW2 B;  1JB0 J;  3TGU E;  5AW8 B;  5TIS E;  2XV5 A;  2O1J A;  1SP4 A;  2YNY A;  3L74 J;  2WPV B;  1FBM A;  1Z56 A;  2QJY B;  2R5B A;  4C7R A;  5GTH E;  2YKP A;  2ZYA A;  1WMK A;  1OVU A;  2H43 A;  2QEX P;  4PD4 D;  2E75 B;  1ZR2 A;  1U57 A;  3HE5 A;  5AW4 B;  1VQ9 P;  1XTC C;  2HPC A;  1NTZ G;  2E74 B;  1SQQ E;  1BE3 D;  3HUS A;  3F5H A;  3RK2 C;  5B66 E;  5KLV G;  5CCH A;  3CX5 H;  5KJ7 A;  1CI6 B;  1BCC D;  4HYT B;  2A06 D;  3L71 D;  3CCM P;  5AVQ B;  2B87 A;  1PV3 A;  3AE9 C;  1LTI C;  1GMJ A;  2KLU A;  1URQ B;  2H89 C;  2O3J A;  1NAF A;  1IFN A;  1N73 B;  2P58 A;  4WY4 D;  1S1C X;  3ITK A;  1FZC B;  1VQ6 P;  4BXL A;  3AEC C;  3BRV B;  3RK3 B;  2FYU G;  3N7N A;  3HTK A;  1VQM P;  2FXP A;  3L74 D;  2ZAE B;  3O6Q B;  1EDK A;  5B5E E;  1KOR A;  3BCC J;  4C46 A;  3H1H J;  3M9Q A;  1NTZ E;  4UB8 H;  3PHL A;  1SFC D;  4LC1 A;  2HYN A;  3L73 J;  3A0H H;  3MTU E;  2OTJ P;  1EXI A;  5KLV E;  2ZT9 D;  1NTM G;  5AVY B;  1KIL A;  1EDL A;  5CJ4 A;  1NKN A;  1LWU A;  2WSC J;  1K9M Q;  1USE A;  1LP1 B;  3U1C A;  1YJW P;  2KUB A;  1NTK K;  2M8R A;  2AXT H;  2NPS C;  1MZ9 A;  1S3J A;  4EIJ A;  1X8Y A;  3FWL A;  3CXH H;  2WVR A;  1VQO P;  1AA0 A;  3V2R A;  2Q3I A;  1KYO H;  3A3Y B;  5APS A;  1DX7 A;  2XU6 A;  2C0W A;  4TT3 H;  3PRJ A;  1OWA A;  1NJI Q;  2FYU E;  2LXC B;  4N78 E;  1FZF A;  5E79 E;  2WSE H;  3H1I J;  3H1L D;  1M1J B;  1FAV A;  5H2F H;  2E42 A;  1M7L A;  3VMZ A;  2QSI A;  3BCC D;  2K3R A;  3RK3 E;  3M06 A;  3I5C A;  3H1H D;  3BAT A;  3LIE A;  3R2P A;  3U59 A;  3RGU A;  2ZVN B;  1EZV I;  3L73 D;  1L4A D;  2WMM A;  2BEQ D;  2GA1 A;  3B5N D;  2HOD A;  2QG4 A;  3WUU A;  3VYI A;  1NTM E;  4UB6 E;  3MHV A;  4EDF A;  1N7L A;  1L0L G;  1Y47 A;  3WUV A;  3HUS C;  1QVF O;  1Q90 D;  2E5Y A;  4KT0 J;  5CCH C;  3AE3 C;  3CLQ A;  3S1K A;  2KB7 P;  1URQ A;  2Q6Q A;  3TGU J;  1KB9 H;  1DEE G;  2Q7C A;  3Q5R A;  1GDT A;  2ZXE B;  2KOG A;  1EQ7 A;  3S4R A;  1FZC A;  4H13 C;  2Z4E A;  1T2K C;  1GD2 E;  4W7Z A;  2C9N Y;  1SQX K;  1SQQ J;  2P1J A;  4GKG A;  3KHU A;  4PD4 I;  3O6Q A;  1NYH A;  4WBA A;  2L91 A;  1NAY A;  1VF5 D;  2Y0E A;  2KZI A;  3RL0 D;  1FJP A;  2HR3 A;  1VDF A;  5KJ7 D;  2RKL A;  4PV1 C;  3WUT A;  4I6M C;  1J1E B;  1SQV G;  4RO0 A;  2N1T B;  3RBZ A;  1GTW A;  1JCC A;  5AW3 B;  2JP3 A;  1W2E A;  2W27 A;  3TDK A;  3AEF C;  3BAS A;  5AVR B;  1R8E A;  1HJ0 A;  1GK4 A;  1Q7Y Q;  5BU5 A;  1PGQ A;  3IFM A;  3TGU D;  2NPS B;  1IFM A;  4JYC A;  3GLM A;  3CX5 E;  2E76 C;  1BGY G;  1OIP A;  1LWU C;  3VN0 A;  1K73 Q;  3FXD A;  2FXO A;  1IFP A;  1SQP K;  1QLE D;  1AV1 A;  2Z5H A;  1Y8A A;  2H7H A;  4O9B A;  1SQQ D;  2QIW A;  4I7Z B;  3KQG A;  1D7M A;  1M1J A;  1S2E A;  5KLI C;  3P32 A;  5AVU B;  1VPC A;  1FOS E;  2WSF H;  3H32 B;  4D6T D;  2M3E A;  5KLV J;  1SQB K;  3E1I A;  3LW5 H;  1NU1 E;  1NVO A;  1IC2 A;  4OH8 B;  3L75 G;  1U7M A;  3CC2 P;  5AW7 B;  3CPW O;  2IYO A;  2BEZ F;  1KIL D;  4U7J A;  1L0N K;  1DH3 A;  3KYQ A;  3A2A A;  1HJB A;  2LXB A;  2OAR A;  2GUS A;  1LTT C;  2QJY C;  1S4X A;  4I2L C;  2H88 C;  3M9B A;  3SFD C;  2I8D A;  2E75 C;  4DZO A;  3CCR P;  1T3U A;  4R4L A;  3HE4 B;  2E74 C;  2H8P D;  1ZME C;  2D2C B;  2A45 I;  3WU2 H;  2FYU J;  2N9Y B;  4H44 B;  2MJZ A;  2UWJ E;  3AE1 C;  2IBZ G;  2PFX A;  4KJM A;  2Q3E A;  3CC7 P;  2VRS A;  3D71 A;  3IAO A;  1SQX D;  1BSH A;  3JCU H;  1URQ C;  3O8Z A;  3L37 A;  1P84 D;  3A0B H;  4Y99 B;  3CXH E;  1N73 C;  3EFG A;  3P7K A;  4IOI H;  1KYO E;  1FZC C;  2PGD A;  1PP9 G;  3RK3 C;  1NH4 A;  5AW5 B;  2OQQ A;  1YJN P;  1NTM J;  1MV8 A;  2WPS A;  3L70 G;  1HGZ A;  1PGP A;  2QJP C;  2OYH B;  3QWO C;  3V2N A;  3RL0 g;  3H1J G;  3AEA C;  3VP9 A;  1URQ D;  2JWD A;  5APT A;  4DCK A;  2FYU D;  1PGO A;  1Q86 Q;  2XZR A;  1HGV A;  2K88 A;  1AJY A;  2KK7 A;  2NPS A;  1G1J A;  2LKM A;  1IFJ A;  2R3C A;  1OW8 A;  1RF1 C;  1X9V A;  1HH0 A;  1FZA A;  5CCG D;  2FY8 A;  2CPS A;  4ZKU A;  1J1D B;  2BCC D;  1GZL A;  4IL6 H;  1KB9 E;  3ZDM A;  1GL2 B;  3BVH A;  5DJT B;  2K9J B;  3HD7 D;  4PD4 H;  2OYO A;  1LTJ B;  1T3J A;  3L4F A;  1PP9 E;  3A5T A;  1LT1 A;  1NTM D;  2W90 A;  4WWI A;  4JBZ A;  3H32 A;  3AE2 C;  3L70 E;  4OWF A;  1M1J C;  1WT6 A;  2K1A A;  5CJ0 A;  3H25 A;  1L0L J;  4U3F G;  2Q5U A;  3V6I A;  1N7S C;  5KKZ B;  1LT9 B;  3L72 G;  1R5L A;  3AE7 C;  3H1J E;  1IJD B;  2V7Q J;  3CCU P;  3G9R A;  3HE4 A;  4EOT A;  1ZV8 A;  3B8E B;  4ASV A;  2KSJ A;  3P8C D;  2J59 M;  5APV A;  2WT7 A;  4AQR D;  5KAI E;  3G4S P;  1HVV A;  2ZXX A;  1LNQ A;  1IFI A;  3RBX A;  3GF3 A;  3C8V A;  1M1K Q;  2E43 A;  3VMX A;  2KNC B;  2ZYG A;  5APU A;  3UIA A;  1SQV J;  3H1K G;  3GW6 A;  2YMK A;  4OGQ B;  2B89 A;  2R5D A;  1PFI A;  3TYY A;  2Y9Z A;  1M56 D;  1JY2 O;  3HRN A;  1H0T B;  2W83 C;  3RK2 D;  2QJP B;  1L0L D;  3K5B A;  3U1A A;  2J5U A;  4YXD C;  1YIJ P;  2AXC A;  2RMZ A;  3IF4 A;  1G2C B;  4U3F E;  2OYH A;  3MGN A;  3Q1M A;  1S9K E;  5DJU B;  5GTI E;  4GOF A;  1FZB A;  1ZRT E;  2AEM A;  1BGY J;  2I1K A;  3L72 E;  4AYC A;  1HF9 A;  1FC2 C;  1IFD A;  1J1E C;  2A45 H;  4HH2 A;  2N1T C;  4TLF A;  4LGD E;  2IDB A;  1IZN B;  4GIF A;  2B88 A;  2CK3 H;  1RF1 B;  1USD A;  1W2B O;  1P84 I;  3W67 A;  1OX3 A;  2KS1 B;  3WU2 E;  1W5C E;  3II6 A;  1S72 P;  2OTK E;  3B4S A;  1SQV D;  2KIK A;  1AQ5 A;  3L75 J;  2K9J A;  2IYP A;  1HBW A;  1YI2 P;  3H1K E;  1PL5 A;  1LTJ A;  1XTG B;  4JYB A;  3VOP A;  3A0B E;  1E5W A;  3B71 A;  4I7Z C;  4ZMD A;  2FFD B;  1KQL A;  2WSC H;  1SQQ K;  1KQG B;  1N7S B;  2IZ1 A;  1BGY D;  3R4Y A;  2IX7 C;  3CD6 P;  1LT9 A;  1X79 B;  2NPS D;  3EWK A;  2GUV A;  3C1L A;  1BCC G;  1GW4 A;  3KZI H;  1SQP E;  4DJG A;  1KMI Z;  4WY4 B;  2YXR B;  3V4W A;  3V2P A;  3AE5 C;  3MD0 A;  1HUC A;  3SWK A;  5BVZ A;  1N8R Q;  1CI6 A;  2WZ7 A;  1NHL A;  3ABV C;  4JPZ B;  5CHX A;  1PP9 J;  2D2C C;  2K37 A;  1SQB E;  2CPB A;  2ZJS E;  2QM8 A;  4IFD K;  4H44 C;  1PPJ G;  3L75 D;  3TNU B;  5C39 A;  1N73 A;  2R3S A;  3CWB E;  2KNC A;  4EYY Q;  3L74 G;  1FDO A;  3H1I D;  4A7P A;  2XND H;  1N2D C;  4YXW H;  3CMA P;  3H1J J;  1H0T A;  2JDI H;  4Y99 C;  1SFC B;  3AED C;  5AW6 B;  1KD1 Q;  1K05 A;  2JJL A;  2QJK B;  3EQ2 A;  1NTZ K;  2PAJ A;  2ZT9 B;  2N9B A;  1G2C A;  3FX0 A;  5K5G B;  1BE3 E;  2IBZ D;  1NU1 G;  5KLV K;  4K35 A;  2D2C D;  3L35 A;  5CCH D;  4I1L A;  1K8A Q;  2C9L Y;  4H44 D;  2YIU B;  1BCC E;  4EI2 A;  1YQ3 C;  2OYH C;  3KDP B;  1JOC A;  3AEE C;  5GTH H;  2JEE A;  4W7Y A;  1JNM A;  1BSN A;  4H13 D;  1T2K D;  1PGJ A;  4GDO A;  1YQ4 C;  1PP9 D;  1RF1 A;  4ZKP A;  1LP1 A;  2K9Y A;  3P8M C;  4XA4 A;  2V4H A;  3C9I A;  2KS1 A;  2FYU K;  3M0D A;  3MZW B;  3Q2Y A;  1PPJ E;  4ZNC A;  1QVG O;  1DIP A;  5APY A;  2WTY A;  3H1L G;  2ITA A;  4Z1M H;  2W6J H;  4U3F J;  3L74 E;  1KFN A;  2PP6 A;  3A7O A;  4PV1 D;  1J1D C;  3L72 J;  4NPF X;  1OW7 A;  5AVX B;  2P67 A;  2FXM A;  1GL2 C;  1VQK P;  1NTZ J;  2FYZ A;  3L36 A;  3B5N B;  1H88 A; 
#chains in the Genus database with same CATH homology
 2FFD A;  1LTJ C;  2HG5 D;  2IFM A;  3RK2 B;  3BRV B;  2XZR A;  1HGV A;  5AW9 B;  3RK3 B;  1N7S A;  2QM7 A;  3T97 A;  3N7N A;  1JY3 O;  2NPS A;  3HTK A;  1FDM A;  1G1J A;  2LKM A;  3G3Z A;  4LLH A;  4XE5 B;  3SWF A;  1IFJ A;  2R3C A;  1NTM K;  3CI9 A;  1RF1 C;  1X9V A;  1HH0 A;  1FZA A;  5CCG D;  2CPS A;  4ZKU A;  1J1D B;  3RL0 C;  2P2U A;  4WY4 A;  2P7J A;  1JCD A;  1LT9 C;  1GZL A;  4C46 A;  5KJ7 C;  3NTN A;  1GL2 B;  1A02 F;  2YO2 A;  3BVH A;  3HD7 D;  3M9Q A;  1FZG A;  1LTJ B;  1T3J A;  3L4F A;  1SFC D;  4LC1 A;  3A5T A;  2HYN A;  1N86 A;  3MTU E;  3H32 A;  2XKM A;  2Z5I A;  4GT1 A;  2J58 A;  5AVY B;  1KIL A;  2XDJ A;  3TNU A;  3M91 A;  5CCG A;  5CJ4 A;  1M1J C;  1NKN A;  1LWU A;  3P8C E;  1WT6 A;  3U1C A;  5CJ0 A;  1NTK K;  2Q5U A;  4KHX A;  2M8R A;  3RL0 B;  1N7S C;  1LT9 B;  2NPS C;  1MZ9 A;  4EIJ A;  1X8Y A;  3HD7 A;  1IJD B;  2OYI A;  1ZLL A;  2WPQ A;  1JUN A;  1SFC A;  2A45 G;  3V2R A;  2Q3I A;  3IR9 A;  3HE4 A;  1LTA C;  3A3Y B;  5APS A;  5AW1 B;  4EOT A;  1DX7 A;  2XU6 A;  2C0W A;  1ZV8 A;  1GU4 A;  3GHG A;  3B8E B;  1A02 J;  3WMM 0;  1OWA A;  2KSJ A;  3P8C D;  2J59 M;  4N78 E;  1FZF A;  2WSE H;  5APV A;  2WT7 A;  2KLV A;  5AVW B;  4AQR D;  2M3B A;  1M1J B;  1HVV A;  1FAV A;  4C7N B;  5APQ A;  1NOH A;  2E42 A;  1M7L A;  2YKO A;  1J2J B;  3VMZ A;  3M06 A;  2O1K A;  3I5C A;  1IFI A;  1SLQ A;  1JMM A;  1L0L K;  3NMD A;  2N1T A;  4DOJ A;  1DEB A;  3BAT A;  3LIE A;  3R2P A;  3U59 A;  1KIL C;  2E43 A;  1L4A B;  3V2Q A;  3VMX A;  1OXZ A;  5APU A;  1NKZ B;  1QL2 A;  3UIA A;  2GM4 A;  3NXS A;  1L4A D;  4N78 D;  1ZR4 A;  2R5D A;  2W6A A;  1PFI A;  3TYY A;  3B5N D;  2HOD A;  3HRN A;  1JY2 O;  3VYI A;  1HTL C;  3RK2 D;  3RK3 D;  3U1A A;  1IK9 A;  1N7L A;  1NO4 A;  3HUS C;  1WRG A;  1G2C B;  2OYH A;  3MGN A;  1S9K E;  1LTG C;  2KYV A;  5CCH C;  3PP5 A;  2IFN A;  1FZB A;  3M0D C;  1GU5 A;  3CLQ A;  1KIL B;  2KB7 P;  1URQ A;  2I1K A;  4AYC A;  1LGH B;  2Q7C A;  1ZN5 A;  1GDT A;  1IFD A;  2ZXE B;  2KOG A;  1J1E C;  1EQ7 A;  1FZC A;  2A45 H;  3B5N A;  4HH2 A;  3VTP C;  1SQV K;  2N1T C;  1GL2 D;  2Z4E A;  3KPE A;  1T2K C;  3CL3 D;  1YTZ I;  4LGD E;  1GD2 E;  1FZE A;  4W7Z A;  1RE4 A;  1JY3 N;  3HE5 B;  3MUD A;  1FOS F;  2O01 H;  3V4Q A;  4GIF A;  2C9N Y;  1SQX K;  2HPC B;  2POH A;  5AVS B;  1RF1 B;  5CMZ A;  5AVT B;  1S9K D;  2FFD C;  2P1J A;  3HUS B;  4GKG A;  2W6B A;  2BAS A;  3NFQ A;  3II6 A;  2WT7 B;  4WBA A;  1JTH B;  3SWY A;  3RL0 D;  3N4X A;  1FJP A;  1NWQ A;  1JY3 P;  2YKQ A;  1VDF A;  5KJ7 D;  1AQ5 A;  1GK6 A;  4I6M C;  1J1E B;  5AW0 B;  2N1T B;  1HBW A;  1LTJ A;  1XTG B;  1GTW A;  1JCC A;  1YYC A;  5AW3 B;  4JYB A;  4WY4 C;  5KTB A;  1W2E A;  3VOP A;  2W27 A;  2L5G B;  4WB4 A;  1KFM A;  3BAS A;  5AVR B;  1RE3 A;  1KZU B;  1E5W A;  2Q9I A;  1GK4 A;  4M3L A;  2FFD B;  1RF0 A;  5BU5 A;  1KQL A;  2WSC H;  3LID A;  1CSB A;  1SQQ K;  3VMY A;  5APT A;  3TK1 A;  1N7S B;  2KP8 A;  3H6P A;  4N3Y B;  1AFO A;  3IFM A;  2NPS B;  2HOD B;  3HTK B;  1IFM A;  4JYC A;  2IX7 C;  1RE4 C;  1LT9 A;  4B86 A;  1N7S D;  1X79 B;  5CCG C;  2NPS D;  2GUV A;  1LWU C;  1YTZ T;  4RES B;  4IFF A;  1GW4 A;  3VN0 A;  1G1I A;  2YMY A;  1SQP K;  1FJK A;  4WY4 B;  3V4W A;  3V2P A;  2WIT A;  1FU1 A;  2Z5H A;  1H8A A;  4AUW A;  4W80 A;  3MD0 A;  1HUC A;  2H7H A;  4O9B A;  3HD7 C;  5BVZ A;  2IPP A;  2OYI C;  1CI6 A;  2WZ7 A;  1SFC C;  3KQG A;  1NHL A;  1FZC B;  1M1J A;  4IFM A;  4C7N A;  1T8Z A;  3P32 A;  5AVU B;  1IO4 A;  1VPC A;  5CHX A;  1FOS E;  2WSF H;  3GHG C;  3OAK A;  3H32 B;  5AVV B;  2CPB A;  2QM8 A;  4IFD K;  1SQB K;  3E1I A;  3TNU B;  3LW5 H;  2HLO A;  1RE3 C;  1LWU B;  1N73 A;  1NU1 K;  1SVF A;  1L4A A;  3OJA B;  1IC2 A;  4OH8 B;  1GW3 A;  1RF0 C;  5AW7 B;  1KIL D;  1L0N K;  1DH3 A;  3KYQ A;  3OA7 A;  3A2A A;  1HJB A;  2I1J A;  2OAR A;  3M9H A;  1H88 A;  2GUS A;  1LTT C;  1LTS C;  1N2D C;  4I2L C;  1MUU A;  3M9B A;  5APW A;  2FKW B;  3HD7 B;  1JY2 N;  2OYI B;  4DZO A;  4Y99 C;  1SFC B;  1T3U A;  3MIW A;  5AW6 B;  2JJL A;  3HE4 B;  4JF7 A;  3EQ2 A;  1RY3 A;  1NTZ K;  2PAJ A;  2H8P D;  3GHG B;  2N9B A;  1H89 A;  1G2C A;  1HWT C;  2A45 I;  5BU8 B;  3V5B A;  1QL1 A;  1CW5 A;  2YO3 A;  2MJZ A;  5AVZ B;  5AW2 B;  5KLV K;  3L35 A;  5AW8 B;  3VP8 A;  5CCH D;  4I1L A;  1JY2 P;  2XV5 A;  2O1J A;  2C9L Y;  1GL2 A;  1SP4 A;  2YNY A;  2VRS A;  4N6J A;  1FBM A;  1Z56 A;  2OYH C;  3KDP B;  1JOC A;  2R5B A;  4C7R A;  2JEE A;  4W7Y A;  2YKP A;  1URQ C;  1JNM A;  2H43 A;  3O8Z A;  2HFE D;  2N1T D;  2XNX A;  3L37 A;  1ZR2 A;  3HE5 A;  4Y99 B;  1MFZ A;  5AW4 B;  1T2K D;  1N73 C;  1L4A C;  1XTC C;  2HPC A;  3EFG A;  1RF1 A;  3P7K A;  4ZKP A;  1FZC C;  3B5N C;  3HUS A;  2WWW A;  3P8M C;  3RK2 C;  4XA4 A;  1JO5 A;  3TSI A;  3RK3 C;  3C9I A;  1NH4 A;  5AW5 B;  5CCH A;  2FYU K;  3M0D A;  5KJ7 A;  1CI6 B;  1MV8 A;  2WPS A;  4HYT B;  1HGZ A;  1JTH A;  5APY A;  2WPR A;  2WTY A;  5AVQ B;  2ZFC A;  2OYH B;  5APX A;  1LTI C;  2C0X A;  1KFN A;  3V2N A;  3BRT B;  2PP6 A;  3A7O A;  1J1D C;  2R32 A;  1URQ B;  1LTB C;  1NAF A;  1IFN A;  5AVX B;  1N73 B;  2P67 A;  4WY4 D;  2FXM A;  3VP9 A;  3M0A A;  1GL2 C;  1URQ D;  2FYZ A;  3L36 A;  3B5N B;  1CZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...