1AFOA

Dimeric transmembrane domain of human glycophorin a, nmr, 20 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
40
structure length
40
Chain Sequence
VQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A transmembrane helix dimer: structure and implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Integral membrane protein
molecule keywords GLYCOPHORIN A
total genus 12
structure length 40
sequence length 40
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.70 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1afoA00
1AFOA 2J58A
chains in the Genus database with same CATH superfamily
2Q1KA 2P1JA 3JSVC 1KN7A 1K05A 1OX3A 3FWNA 3K5BA 3RL0C 4GT1A 1KILD 3AEFC 4HJGH 5KLVE 3MUDC 1VQNP 3L75J 1BE3G 3B5NB 3GF7A 4DOJA 5AVYB 2J59M 2M3EA 2Y0EA 1N2DC 4AQRD 1YJWP 1HTLC 2R5BA 2WPVB 1VF5D 1FDIA 1Y9BA 3PHLA 4U3FE 3V4WA 2K1AA 2WVRA 1GW3A 2G3AA 3A0HH 5AVQB 5E79H 1N7SD 4TT3H 1S1CX 3MP7B 5GTIE 1ZRTD 3V2NA 3H1KE 1NHLA 1DD4A 4RKUJ 1LT9C 5AW2B 5TJHA 1MKMA 1NTMD 5APXA 3P8CD 3RK3B 4EIJA 2R3SA 3SWFA 1N73B 3O6QB 1NTMK 3L73J 3P7KA 2K9JB 2IDBA 1PIXA 2BCCG 3L74G 3L75E 3S9OA 1KD1Q 3H1JD 3S4RA 2Q5UA 3CCSP 2M5AB 1GL2D 5AVWB 2FYUK 1L0LE 2W90A 1LTGC 1VF5C 3AE2C 1N73A 1EXIA 1DX7A 2D2CB 1DIPA 2K9JA 1HWTC 1LTJA 1ZN5A 1PP9G 1RE3C 2NPSA 4HB1A 5AW5B 5DJUB 2P2UA 4L73A 1YHQP 3G9RA 4OH8B 4IL6X 2IBZI 2IPPA 1JY2O 1T3JA 3N4XA 2PGDA 2C0XA 4I1LA 2IZ1A 1JNMA 2JR8A 2FFDA 1KILC 5KLVJ 1GU4A 1AQTA 3SFDC 1YJ9P 1NYHA 2DW3A 3EFFK 2NPSC 2WSCJ 4DT0A 3H1HE 3M9QA 3CC7P 1MZ9A 2JEEA 3H1KG 4EYYQ 4EOTA 3SWYA 3B4SA 4ASVA 4IFFA 2WSEJ 1RF1B 1L4AC 4Y99C 5APUA 1L0NG 1HBWA 1E79H 4N78E 2P58A 3HE4A 3RGUA 3M06A 3VP8A 5H2FE 1KYOE 1IJDB 1SQVE 2IZ0A 1LWUC 4H44B 3OW2O 3RL0B 1CSBA 2A45I 2FYUG 3BRTB 5CBOA 1Q82Q 3AEBC 4WB4A 5APSA 3BRVB 1NTKE 1LT9B 2YMKA 3MUDA 1VQ8P 1JY3P 1L0NK 1BE3D 4R4LA 1PP9E 2JDIH 3HE4B 5B66E 2PFXA 2BEQD 2O1JA 2YKQA 4GOEA 1SQQE 3Q5SA 4PV1D 4D6TG 2L91A 2LXCB 3F5HA 1KQSO 5B5EH 1NTZG 2YXQB 1N7LA 1VPCA 3HTKB 2PAJA 2QJKC 1SQVK 3UIAA 1KTMA 1CI6A 2XKMA 4JYCA 1P84E 2XZRA 3PJSK 2H8PD 2Y9YA 2M0BA 2QJPB 4O9BA 1SVFA 3U1AA 3V4QA 3H1HG 3H1LJ 3MTUE 2OGUA 4OVNF 4W80A 3A0BH 3A2AA 2E74D 1ZV8A 1GU5A 1VQ5P 3U1CA 3FWLA 4ASWA 1X79B 2SPZA 1VL2A 1QX8A 1QEXA 1H0TB 2HFED 3AEDC 5APWA 3H1ID 2E76C 3BCCE 1HVVA 3AECC 4GOFA 2JKVA 3P32A 2IYPA 1LJ2A 5E79E 5H2FH 3T97B 1NKZB 3TSIA 4H0LB 1AV1A 2E5YA 2Q9IA 1KILE 1M1KQ 1G1JA 3BATA 4W7ZA 1BDDA 3ABVC 5KLVD 2E42A 1KB9H 3AEGC 1RF1C 1EZVD 2IFNA 1D7MA 3AE6C 3L73E 4JF7A 3CMAP 3EQ2A 1G2CB 3CCLP 5KJ7C 1W2EA 3PRJA 3Q1MA 1EDIA 2YKOA 5M1BA 2Z4EA 2A45H 1W5CE 3CWBJ 4CPGA 1EZVG 4WBAA 1EDJA 3W68A 1NVOA 2I1JA 3FX0A 4UB6H 2WZ7A 1RQVA 3CCRP 2OYOA 3KZIH 4M3LA 1IZNB 4GODA 4H13C 1LTSC 1NTME 4A7PA 2YMYA 2QM8A 3P8CE 1OW7A 1URQD 3PP5A 5CJ4A 3V5BA 2HLOA 4RO0A 1YTZT 3CX5I 1BCCG 1E5WA 3CC2P 4QMAA 1HH0A 1J1DC 1SQBE 1Q90D 2E75D 2FYUD 3HE5B 1JB0J 3JC22 2N9YB 4I6MC 5APTA 1Z56A 1ZOYC 2KUBA 3A0HE 1GK6A 1JMMA 3A3YB 3CWBE 2WPQA 3HD7C 3M0DC 4NPDA 4PD4H 1VQ6P 4EDFA 3TGUD 1N7SC 2GUVA 1WMKA 2KI7B 3L70G 2MKVA 2E76D 3D6ZA 2HYNA 1BCCD 2QJKB 2WWWA 1IO4A 2FBWC 3D71A 1IFIA 3AE7C 3CCEP 1JMBA 2AEMA 3FXDA 3AE1C 3TF5A 1SQQK 2HG5D 2QJPC 1SQXK 1YTZI 1KYOH 1X9VA 2E75C 2WSEH 2YXRB 2ZYAA 2ZYGA 3C1LA 3FXEA 1L0NE 3IR9A 4IL6E 4WVZA 1N73C 1NTKK 5DJTB 1NGMB 4UB6E 3HD7D 1P84H 2WTYA 3B71A 3L71E 2A06E 1QLED 1RE4C 1Q7YQ 1VQ9P 2V7QJ 2Y0DA 4L75A 2OQQA 1JCDA 2ZT9B 3H25A 4HKZH 1PFIA 4H13D 1KFNA 1NAYA 1ZLLA 3MGNA 1FZCA 4Z1MH 1URQC 1PZQA 1LWUA 1URQA 3TK1A 4H0LC 1BGYJ 3L72E 4D6TE 1ZMEC 3RK2C 4TLFA 1YQ3C 2O01J 3VN0A 2E43A 1NTKD 2M3BA 1PPJD 4WY4C 3RL0g 1DH3A 1BDCA 4OWFA 5AW8B 4YXDC 1SQXD 1SQQD 1EZVI 1KILB 1DEEG 1PGJA 4U3FJ 1IC2A 4GKGA 5CMZA 5GTIH 4ZMDA 4PV1B 1NU1J 3HUSA 3GMAA 1URQB 4OGQC 2ZYDA 5AW3B 1YJNP 1U7JA 3A7OA 3WMM0 2ZVNB 1X22A 2FXMA 2OARA 3AE9C 3C8VA 1LT1A 5KAFH 3EFGA 1ZW0A 3A5TA 3L75G 3GHGB 2BEZF 2NPSD 2QSIA 2IYOA 2W83C 5AW9B 3WU2E 3I55P 3L71G 3SWKA 2AEFA 1J1DB 2N1TC 1L0LG 1Y47A 2WSFH 2BCCD 5KKZC 2P10A 3G71P 5B5EE 3M0DA 2P7JA 5AW1B 2WPRA 3HD7A 1QVGO 2FKWB 1FOSE 3GHGA 3F89A 2FY8A 1JCCA 1LGHB 2E74B 4NPFX 4H44C 1KORA 2RMZA 3H1JE 2WPSA 1EZVE 1S4XA 2KNCA 1T3UA 2HPCA 2BCCJ 2HR3A 1SQBK 4WY4A 5AVZB 1VF5B 3CCVP 3H1IJ 3M9BA 1PPJG 2QA4P 1OWAA 4NPEA 1XTGB 2GUSA 1WT6A 2K9YA 1J2JB 2C9LY 3Q3DA 1A02F 3B5ND 1YI2P 3FGAD 1QL2A 2LR2A 4YXWH 2IBZG 3Q5RA 1SP4A 2AXTH 2HPCB 3CX5D 3QWOC 4IL6H 4WY4B 1M8OB 2WMMA 3ITKA 4JYBA 5BU8B 2KLUA 2CPBA 1NU1D 2JWDA 1H89A 3WU2H 1NTMJ 3E1IA 1OW6A 1SQBD 2FYUE 2XDJA 3AE8C 1SQQJ 2QM7A 1SQXJ 2KZIA 1Q2NA 1YIJP 3SSUA 1T2KC 2QG4A 3TNUB 4LC1A 3OA7A 3RK2B 4YTPC 1NTKJ 5AW0B 1S2EA 1L4AA 1SLQA 2WITA 3TYYA 2Y0CA 3KZIE 2QRXA 1CW5A 3CPWO 1PGPA 3IN6A 3GHGC 1PGOA 3T97A 3H1JG 2I1KA 1KYOD 3MHVA 1IFDA 4W7YA 1VQLP 2K37A 2ZJSE 2C9NY 1RHZB 2R5DA 2KS1A 2FXOA 1ZXGA 2BASA 3L74E 2OTLP 5L8RJ 3TGUG 2FFDC 1FDMA 2IFMA 2A06G 1HGZA 1PP9D 3LIEA 2YO3A 5AW7B 3CXHD 3W67A 5GTHE 4DCKA 3M0AA 3RBXA 2OYIB 4JBZA 2N1TB 3CI9A 4DZOA 3WUVA 3RK3E 4D6TJ 1AFOA 3R2PA 1RY3A 2IBZD 3BCCG 4C7NB 3NTNA 1BCCJ 4IFMA 2W6AA 1HUCA 4BRYB 3CCUP 1S9KD 1IFMA 2OYIA 1R5LA 1M1JC 2YNYA 3USSA 3L36A 3E1RA 3I5CA 1M7LA 1WRGA 5C39A 4C7NA 3G4SP 1XTCC 3L70J 2O1KA 3RL0D 2CK3H 1M56D 3H1LD 4U7JA 1N86A 3PTZA 3MD0A 1JY3O 1LTJB 2XNDH 2V4HA 1AJYA 2V7QH 4UB8E 2IX7C 2VRSA 1RF0A 1M90Q 3CCMP 1RE4A 5CJ0A 3CXHI 2QIWA 3L73D 3S1KA 1UIIA 3AEEC 1EC5A 2KSJA 3R4YA 1U57A 1SS1A 3E7KA 3O6QA 4K35A 3V6IA 2AXTE 2NRGA 1QL1A 3WUTA 4ZNCA 1SQBJ 3CMEP 2WSFJ 1BSNA 2ZXXA 1S5LX 1NWQA 4PD4E 3NMDA 1NO4A 1OXZA 3CWBG 3L72G 3OAKA 4JPZB 2M5AA 3VOPA 4Y28J 5AVSB 5CCHA 1IK7A 1FZAA 2LXBA 5CCHC 1JEKA 3IF4A 3ZDMA 5CHXA 1L0LK 4WWIA 1N7SA 2NPSB 2POHA 3MZWB 1K04A 2NZ2A 2Z5HA 1GW4A 1JY2P 3M9HA 4H44D 3CC4P 3VMZA 1X0TA 1MFTA 3OJAB 1IFNA 5TISH 1HGVA 2FFDB 1JY3N 1KQGB 2R32A 1GMJA 3CWBD 4HYTB 1CZQA 2PP6A 1YQ4C 1LT9A 3PLNA 1ZR2A 3NXSA 2JO1A 2XU6A 3LIDA 1N7SB 1S72P 1BGYE 3L72J 1GTWA 2QE7H 1GDTA 1FS0E 5AVRB 1AA0A 1M1JB 3CD6P 5K5GB 2OYIC 1EDLA 3O8ZA 4OGQB 2G8YA 2KSEA 3CX5E 2N9BA 3GG2A 3NFQA 5CCGC 1RF1A 4AYCA 1FZEA 1S5LH 1CI6B 3JCUH 1LP1A 3C9IA 3L37A 5APYA 1OIPA 3GLMA 2E75B 1GD2E 1NU1E 3M91A 1NU1K 3L71J 1MFZA 2XNXA 1M1JA 3AE3C 1Y8AA 4LLHA 1BE3J 4PJ0E 1KQFB 3L71D 1L2PA 3BVHA 1LP1B 1FZGA 1SQPD 2ZT9C 3B5NC 3EWKA 3QH9A 3VMYA 3PH0A 2L5GB 3D6YA 2PRRA 4KHXA 1RE3A 2AXCA 1OVUA 2KLVA 1LTJC 2KXPB 2OTKE 3KHUA 4U3FD 1SQPG 1SQVJ 1U7MA 2XV5A 3HTKA 3L72D 4R4MA 5KAFE 3SFEC 1VQ4P 4MN4C 1FDOA 1ZRTE 1AVYA 1JOCA 1KQLA 3H1KD 1BGYG 3AE4C 1EDKA 1G2CA 2E76B 3CXHE 3L74J 3V2PA 5KTBA 1VQOP 2RN0A 1HJ0A 2AEJA 1JY2N 4XA4A 1KB9D 2KP8A 1NOHA 3L75D 2YO2A 3RK3D 3HUSC 2W6JH 4U3FG 3P8MC 3KYQA 1NU1G 4XE5B 4DJGA 1H0TA 2KYVA 3KDPB 3H6PA 1S9KE 3I56P 4B86A 1KV4A 1SQQG 2UWJE 3CL3D 1GK4A 3GF3A 3GW6A 1YYCA 1NKNA 1NTZE 2Q3EA 2ZFCA 3U59A 1FU1A 3KQGA 4I2LC 4PJ0H 2YIUB 5EFWB 2D2CD 3MIWA 1TU3F 2BCCE 2MJZA 1S3JA 2WT7B 2HODA 3VMAA 3H1JJ 1L0LJ 3H1LE 1NJIQ 3AE5C 4N3YB 2E74C 1R8EA 4RESB 3IAOA 3TGUJ 4C7RA 2I8DA 1GZLA 2YIUC 5AVTB 3RK2D 2B87A 3VTPC 2WT7A 3H32B 1L4AD 1OVRA 2HODB 3L70D 1GL2B 3CCJP 1VQ7P 4N78D 1LTIC 2W6BA 4N6JA 4RJTA 1IFPA 4ZKPA 1H88A 2FYUJ 1RQUA 2B88A 2C0WA 2KZJA 1OFCX 3BASA 2H89C 2WSSH 3H1IG 1J1EB 3HE5A 3IFMA 4JQ0D 4PD4D 1FJPA 2ZXEB 3L73G 1PV3A 2B87B 2GA1A 2E5TA 3H32A 3V2RA 2OYHC 3KPEA 1GL2A 1K9MQ 1GL2C 5KJ7D 1FE6A 5KAIE 4BXLA 3A0BE 3TDKA 1NTZJ 1AVOA 3CCQP 1FZFA 2YKPA 3N7NA 1SQPK 4C46A 5KLVK 2FYNB 4I7ZB 3JCUE 2W8ZA 1JO5A 1KC8Q 1NTMG 1FZBA 1QGKB 1PP9J 2ZAEB 3H1HJ 1SFCD 1SQXG 2QJYB 3H1LG 3B8EB 2KB7P 1P84D 1R5SA 2Q3IA 1N8RQ 2KK7A 4L76A 1NTKG 3L4FA 1KYOI 5AW4B 1FOSF 2R3CA 5AVVB 1T8ZA 3HUSB 5B66H 1W2BO 2FYNC 4I7ZC 5KLVG 2JJLA 3L74D 3WUUA 1KZUB 4HH2A 1PL5A 4IOIH 1EXJA 4KT0J 2LKMA 1NH4A 5KJ7A 3H1KJ 1JTHB 2N1TD 3H1IE 3BCCD 2O01H 1FZCB 1IFJA 2ZVOB 4PV1C 3D70A 1AQ5A 1L0NJ 3CX5H 3CLQA 4YPCA 3Q2YA 1LWUB 2RKLA 3LW5J 1KB9I 4BWNA 1FBMA 1SFCB 1SQPE 2K3RA 5CCHD 1OW8A 2IBZE 1HJBA 1JTHA 4UB8H 2Q7CA 5KAIH 1L0LD 4PD4I 1PGQA 1S5LE 1KILA 1T6AA 2B9BA 3G3ZA 2RH0A 2WQYC 3BCCJ 2GM4A 1FAVA 3II6A 1YBKA 3G6EP 1SFCA 5BU5A 1EQ7A 1KMIZ 1K8AQ 2OYHA 5KKZB 2H7HA 1VQMP 1DEBA 2B89A 4AUWA 1A02J 1KB9E 1FJKA 4EI2A 5APVA 5CCGA 2CPSA 1QVFO 1J1EC 2ZT9D 4H0LD 3H1HD 1USEA 2Y9ZA 1P84I 2OYHB 4WY4D 1DD3A 3CXHH 1ZR4A 1JUNA 4LGDE 3HD7B 1VDFA 3HRNA 2FYZA 4XFJA 2WSCH 3TGUE 1USDA 1NTZD 1ZP0C 2R44A 4K3AA 5TISE 2QVAA 1Q81Q 1RF0C 2FXPA 2KIKA 4L74A 2H43A 1SQVD 2A45G 5KLIC 1G1IA 1BCCE 1MUUA 2KNCB 2OTJP 1JM0A 1LTTC 1SQBG 1KFMA 2QJYC 5AW6B 3TNUA 1LNQA 1M57D 1NAFA 2J58A 3L35A 3AEAC 4IFDK 2JP3A 1NTZK 3RBZA 2W27A 3RK3C 1SQVG 1SQPJ 1BE3E 2KOGA 1L0ND 2QEXP 1LTAC 3V2QA 1LTBC 5CCGD 1Q86Q 1FZCC 1X8YA 2K88A 4KJMA 1FC2C 2J5UA 1BSHA 1HF9A 3VMXA 4ZKUA 5BVZA 3L70E 2KS1B 4H13B 5KLIB 1SFCC 2A06D 2H88C 1H8AA 1RH5B 2O01N 2P67A 1VQKP 4OGQD 1MV8A 2M8RA 4GIFA 2D2CC 3LW5H 3KXDA 1BGYD 1UIXA 5GTHH 4GDOA 3Q5PA 5APQA 5CBNA 1VQPP 2N1TA 2Q6QA 3VP9A 4D6TD 2O3JA 1OMIA 1L4AB 4Y99B 1PPJE 1IK9A 1YITP 1K73Q 1OVVA 3VYIA 3B5NA 1OZHA 2ITAA 2JWAA 1SQXE 5AVUB 4BRYA 1T2KD 5AVXB 2Z5IA
chains in the Genus database with same CATH topology
2P1JA 3RL0C 4GT1A 1KILD 3B5NB 4DOJA 5AVYB 2J59M 1N2DC 4AQRD 1HTLC 2R5BA 4C46A 3V4WA 5AVQB 1GW3A 1N7SD 3V2NA 1NHLA 1LT9C 5AW2B 3SWFA 5APXA 3RK3B 3P8CD 1N73B 4EIJA 1NTMK 3P7KA 2Q5UA 1GL2D 5AVWB 2FYUK 1DX7A 1LTGC 1N73A 1HWTC 1LTJA 1ZN5A 2NPSA 1RE3C 5AW5B 2P2UA 4OH8B 2IPPA 1JY2O 1T3JA 3N4XA 4I1LA 2C0XA 1JNMA 2FFDA 1KILC 1GU4A 2NPSC 3M9QA 1MZ9A 2JEEA 4EOTA 3SWYA 1RF1B 4IFFA 1L4AC 4Y99C 5APUA 1HBWA 4N78E 3HE4A 3M06A 3VP8A 1IJDB 1LWUC 3RL0B 1CSBA 2A45I 3BRTB 5APSA 3BRVB 3MUDA 1LT9B 1JY3P 1L0NK 3HE4B 2O1JA 2YKQA 3HTKB 1N7LA 1VPCA 2PAJA 1SQVK 3UIAA 1CI6A 2XKMA 4JYCA 2XZRA 4O9BA 2H8PD 3V4QA 1GTWA 1SVFA 3U1AA 3MTUE 4W80A 3A2AA 1ZV8A 1GU5A 3U1CA 1X79B 2HFED 5APWA 1HVVA 3P32A 3TSIA 1NKZB 2Q9IA 2E42A 1G1JA 3BATA 4W7ZA 1RF1C 2IFNA 4JF7A 3EQ2A 1G2CB 5KJ7C 1W2EA 2YKOA 2Z4EA 2A45H 4WBAA 2I1JA 2WZ7A 4M3LA 1LTSC 2YMYA 2QM8A 3P8CE 1URQD 3PP5A 5CJ4A 3V5BA 2HLOA 1YTZT 1E5WA 1HH0A 1J1DC 3HE5B 4I6MC 5APTA 1Z56A 1GK6A 1JMMA 3A3YB 3HD7C 2WPQA 3M0DC 1N7SC 2GUVA 1IO4A 2HYNA 2WWWA 1IFIA 1SQQK 2HG5D 1SQXK 1YTZI 5AVVB 1X9VA 4N6JA 2WSEH 3IR9A 1N73C 1NTKK 3HD7D 2WTYA 1RE4C 1JCDA 1PFIA 1KFNA 1ZLLA 3MGNA 1FZCA 1URQC 1LWUA 1URQA 3TK1A 2E43A 3RK2C 3VN0A 2M3BA 4WY4C 1DH3A 5AW8B 1KILB 5CMZA 1IC2A 4GKGA 3HUSA 1URQB 5AW3B 3A7OA 3WMM0 2OARA 2FXMA 3EFGA 3A5TA 3GHGB 2NPSD 5AW9B 1J1DB 2N1TC 2WSFH 3M0DA 2P7JA 5AW1B 2WPRA 3HD7A 2FKWB 1FOSE 3GHGA 1JCCA 1LGHB 2WPSA 1T3UA 2HPCA 4WY4A 1SQBK 5AVZB 3M9BA 1OWAA 1XTGB 2GUSA 1WT6A 1J2JB 2C9LY 1A02F 3B5ND 1QL2A 1SP4A 2HPCB 4WY4B 4JYBA 5BU8B 2CPBA 1H89A 3E1IA 2XDJA 2QM7A 1T2KC 3TNUB 4LC1A 3OA7A 3RK2B 5AW0B 1SLQA 1L4AA 2WITA 3TYYA 1CW5A 3GHGC 2I1KA 2C9NY 4W7YA 1IFDA 2R5DA 2BASA 1FDMA 2FFDC 2IFMA 1HGZA 3LIEA 5AW7B 2YO3A 3M0AA 2OYIB 2N1TB 3CI9A 4DZOA 1AFOA 3R2PA 1RY3A 4C7NB 3NTNA 4IFMA 2W6AA 1HUCA 1S9KD 1IFMA 2OYIA 1M1JC 2YNYA 3L36A 3I5CA 1M7LA 1WRGA 4C7NA 1XTCC 2O1KA 3RL0D 1N86A 3MD0A 1JY3O 1LTJB 2IX7C 2VRSA 1RF0A 1RE4A 5CJ0A 2KSJA 1QL1A 1NWQA 3NMDA 1NO4A 1OXZA 3OAKA 3VOPA 5AVSB 5CCHA 1FZAA 5CCHC 5CHXA 1L0LK 1N7SA 2NPSB 2POHA 2Z5HA 1GW4A 1JY2P 3M9HA 3VMZA 3OJAB 1IFNA 1HGVA 2FFDB 1JY3N 2R32A 4HYTB 1CZQA 2PP6A 1LT9A 1ZR2A 3NXSA 2XU6A 3LIDA 1N7SB 1GDTA 5AVRB 1M1JB 2OYIC 3O8ZA 3NFQA 2N9BA 1RF1A 4AYCA 1FZEA 1CI6B 3C9IA 3L37A 5APYA 1GD2E 3M91A 1NU1K 1MFZA 2XNXA 1M1JA 4LLHA 3BVHA 1FZGA 3B5NC 3VMYA 2L5GB 4KHXA 1RE3A 3T97A 2KLVA 5CCGC 1LTJC 4WB4A 3HTKA 2XV5A 1JOCA 1KQLA 1G2CA 3V2PA 5KTBA 4XA4A 1JY2N 2KP8A 1NOHA 2YO2A 3RK3D 3HUSC 3P8MC 3KYQA 4XE5B 2KYVA 3KDPB 3H6PA 1S9KE 4B86A 3CL3D 1GK4A 1YYCA 1NKNA 2ZFCA 3U59A 1FU1A 3KQGA 4I2LC 3MIWA 2MJZA 2WT7B 2HODA 4N3YB 4RESB 4C7RA 1GZLA 3RK2D 3VTPC 2WT7A 3H32B 1L4AD 2HODB 1GL2B 4N78D 1LTIC 2W6BA 1H88A 4ZKPA 2C0WA 3BASA 3HE5A 1J1EB 3IFMA 1FJPA 2ZXEB 2OYHC 3V2RA 3H32A 3KPEA 1GL2A 1GL2C 5KJ7D 1FZFA 2YKPA 3N7NA 1SQPK 5KLVK 1JO5A 1FZBA 1SFCD 3B8EB 2KB7P 2Q3IA 3L4FA 5AW4B 1FOSF 2R3CA 1T8ZA 3HUSB 2JJLA 1KZUB 4HH2A 2LKMA 1NH4A 5KJ7A 1JTHB 2N1TD 2O01H 1FZCB 1IFJA 1AQ5A 3CLQA 1LWUB 1FBMA 1SFCB 5CCHD 1HJBA 1JTHA 2Q7CA 1KILA 3G3ZA 2GM4A 1FAVA 3II6A 1SFCA 5BU5A 1EQ7A 2H7HA 2OYHA 1DEBA 4AUWA 1A02J 1FJKA 5APVA 5CCGA 2CPSA 1J1EC 2OYHB 4WY4D 1ZR4A 1JUNA 4LGDE 3HD7B 1VDFA 3HRNA 2FYZA 2WSCH 1RF0C 2H43A 2A45G 1G1IA 1MUUA 1LTTC 3TNUA 1KFMA 5AW6B 4IFDK 1NAFA 3L35A 2J58A 1NTZK 2W27A 3RK3C 1FZCC 2KOGA 1LTAC 3V2QA 1LTBC 5CCGD 1X8YA 3VMXA 4ZKUA 5BVZA 1SFCC 1H8AA 2P67A 1MV8A 2M8RA 4GIFA 3LW5H 5APQA 2N1TA 3VP9A 1L4AB 4Y99B 1IK9A 3VYIA 3B5NA 5AVTB 5AVUB 1T2KD 5AVXB 2Z5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AFO A;  2J58 A; 
#chains in the Genus database with same CATH topology
 2Q1K A;  2P1J A;  3JSV C;  1KN7 A;  1K05 A;  1OX3 A;  3FWN A;  3K5B A;  3RL0 C;  4GT1 A;  1KIL D;  3AEF C;  4HJG H;  5KLV E;  3MUD C;  1VQN P;  3L75 J;  1BE3 G;  3B5N B;  3GF7 A;  4DOJ A;  5AVY B;  2J59 M;  2M3E A;  2Y0E A;  1N2D C;  4AQR D;  1YJW P;  1HTL C;  2R5B A;  2WPV B;  1VF5 D;  1FDI A;  1Y9B A;  3PHL A;  4U3F E;  3V4W A;  2K1A A;  2WVR A;  1GW3 A;  2G3A A;  3A0H H;  5AVQ B;  5E79 H;  1N7S D;  4TT3 H;  1S1C X;  3MP7 B;  5GTI E;  1ZRT D;  3V2N A;  3H1K E;  1NHL A;  1DD4 A;  4RKU J;  1LT9 C;  5AW2 B;  5TJH A;  1MKM A;  1NTM D;  5APX A;  3P8C D;  3RK3 B;  4EIJ A;  2R3S A;  3SWF A;  1N73 B;  3O6Q B;  1NTM K;  3L73 J;  3P7K A;  2K9J B;  2IDB A;  1PIX A;  2BCC G;  3L74 G;  3L75 E;  3S9O A;  1KD1 Q;  3H1J D;  3S4R A;  2Q5U A;  3CCS P;  2M5A B;  1GL2 D;  5AVW B;  2FYU K;  1L0L E;  2W90 A;  1LTG C;  1VF5 C;  3AE2 C;  1N73 A;  1EXI A;  1DX7 A;  2D2C B;  1DIP A;  2K9J A;  1HWT C;  1LTJ A;  1ZN5 A;  1PP9 G;  1RE3 C;  2NPS A;  4HB1 A;  5AW5 B;  5DJU B;  2P2U A;  4L73 A;  1YHQ P;  3G9R A;  4OH8 B;  4IL6 X;  2IBZ I;  2IPP A;  1JY2 O;  1T3J A;  3N4X A;  2PGD A;  2C0X A;  4I1L A;  2IZ1 A;  1JNM A;  2JR8 A;  2FFD A;  1KIL C;  5KLV J;  1GU4 A;  1AQT A;  3SFD C;  1YJ9 P;  1NYH A;  2DW3 A;  3EFF K;  2NPS C;  2WSC J;  4DT0 A;  3H1H E;  3M9Q A;  3CC7 P;  1MZ9 A;  2JEE A;  3H1K G;  4EYY Q;  4EOT A;  3SWY A;  3B4S A;  4ASV A;  4IFF A;  2WSE J;  1RF1 B;  1L4A C;  4Y99 C;  5APU A;  1L0N G;  1HBW A;  1E79 H;  4N78 E;  2P58 A;  3HE4 A;  3RGU A;  3M06 A;  3VP8 A;  5H2F E;  1KYO E;  1IJD B;  1SQV E;  2IZ0 A;  1LWU C;  4H44 B;  3OW2 O;  3RL0 B;  1CSB A;  2A45 I;  2FYU G;  3BRT B;  5CBO A;  1Q82 Q;  3AEB C;  4WB4 A;  5APS A;  3BRV B;  1NTK E;  1LT9 B;  2YMK A;  3MUD A;  1VQ8 P;  1JY3 P;  1L0N K;  1BE3 D;  4R4L A;  1PP9 E;  2JDI H;  3HE4 B;  5B66 E;  2PFX A;  2BEQ D;  2O1J A;  2YKQ A;  4GOE A;  1SQQ E;  3Q5S A;  4PV1 D;  4D6T G;  2L91 A;  2LXC B;  3F5H A;  1KQS O;  5B5E H;  1NTZ G;  2YXQ B;  1N7L A;  1VPC A;  3HTK B;  2PAJ A;  2QJK C;  1SQV K;  3UIA A;  1KTM A;  1CI6 A;  2XKM A;  4JYC A;  1P84 E;  2XZR A;  3PJS K;  2H8P D;  2Y9Y A;  2M0B A;  2QJP B;  4O9B A;  1SVF A;  3U1A A;  3V4Q A;  3H1H G;  3H1L J;  3MTU E;  2OGU A;  4OVN F;  4W80 A;  3A0B H;  3A2A A;  2E74 D;  1ZV8 A;  1GU5 A;  1VQ5 P;  3U1C A;  3FWL A;  4ASW A;  1X79 B;  2SPZ A;  1VL2 A;  1QX8 A;  1QEX A;  1H0T B;  2HFE D;  3AED C;  5APW A;  3H1I D;  2E76 C;  3BCC E;  1HVV A;  3AEC C;  4GOF A;  2JKV A;  3P32 A;  2IYP A;  1LJ2 A;  5E79 E;  5H2F H;  3T97 B;  1NKZ B;  3TSI A;  4H0L B;  1AV1 A;  2E5Y A;  2Q9I A;  1KIL E;  1M1K Q;  1G1J A;  3BAT A;  4W7Z A;  1BDD A;  3ABV C;  5KLV D;  2E42 A;  1KB9 H;  3AEG C;  1RF1 C;  1EZV D;  2IFN A;  1D7M A;  3AE6 C;  3L73 E;  4JF7 A;  3CMA P;  3EQ2 A;  1G2C B;  3CCL P;  5KJ7 C;  1W2E A;  3PRJ A;  3Q1M A;  1EDI A;  2YKO A;  5M1B A;  2Z4E A;  2A45 H;  1W5C E;  3CWB J;  4CPG A;  1EZV G;  4WBA A;  1EDJ A;  3W68 A;  1NVO A;  2I1J A;  3FX0 A;  4UB6 H;  2WZ7 A;  1RQV A;  3CCR P;  2OYO A;  3KZI H;  4M3L A;  1IZN B;  4GOD A;  4H13 C;  1LTS C;  1NTM E;  4A7P A;  2YMY A;  2QM8 A;  3P8C E;  1OW7 A;  1URQ D;  3PP5 A;  5CJ4 A;  3V5B A;  2HLO A;  4RO0 A;  1YTZ T;  3CX5 I;  1BCC G;  1E5W A;  3CC2 P;  4QMA A;  1HH0 A;  1J1D C;  1SQB E;  1Q90 D;  2E75 D;  2FYU D;  3HE5 B;  1JB0 J;  3JC2 2;  2N9Y B;  4I6M C;  5APT A;  1Z56 A;  1ZOY C;  2KUB A;  3A0H E;  1GK6 A;  1JMM A;  3A3Y B;  3CWB E;  2WPQ A;  3HD7 C;  3M0D C;  4NPD A;  4PD4 H;  1VQ6 P;  4EDF A;  3TGU D;  1N7S C;  2GUV A;  1WMK A;  2KI7 B;  3L70 G;  2MKV A;  2E76 D;  3D6Z A;  2HYN A;  1BCC D;  2QJK B;  2WWW A;  1IO4 A;  2FBW C;  3D71 A;  1IFI A;  3AE7 C;  3CCE P;  1JMB A;  2AEM A;  3FXD A;  3AE1 C;  3TF5 A;  1SQQ K;  2HG5 D;  2QJP C;  1SQX K;  1YTZ I;  1KYO H;  1X9V A;  2E75 C;  2WSE H;  2YXR B;  2ZYA A;  2ZYG A;  3C1L A;  3FXE A;  1L0N E;  3IR9 A;  4IL6 E;  4WVZ A;  1N73 C;  1NTK K;  5DJT B;  1NGM B;  4UB6 E;  3HD7 D;  1P84 H;  2WTY A;  3B71 A;  3L71 E;  2A06 E;  1QLE D;  1RE4 C;  1Q7Y Q;  1VQ9 P;  2V7Q J;  2Y0D A;  4L75 A;  2OQQ A;  1JCD A;  2ZT9 B;  3H25 A;  4HKZ H;  1PFI A;  4H13 D;  1KFN A;  1NAY A;  1ZLL A;  3MGN A;  1FZC A;  4Z1M H;  1URQ C;  1PZQ A;  1LWU A;  1URQ A;  3TK1 A;  4H0L C;  1BGY J;  3L72 E;  4D6T E;  1ZME C;  3RK2 C;  4TLF A;  1YQ3 C;  2O01 J;  3VN0 A;  2E43 A;  1NTK D;  2M3B A;  1PPJ D;  4WY4 C;  3RL0 g;  1DH3 A;  1BDC A;  4OWF A;  5AW8 B;  4YXD C;  1SQX D;  1SQQ D;  1EZV I;  1KIL B;  1DEE G;  1PGJ A;  4U3F J;  1IC2 A;  4GKG A;  5CMZ A;  5GTI H;  4ZMD A;  4PV1 B;  1NU1 J;  3HUS A;  3GMA A;  1URQ B;  4OGQ C;  2ZYD A;  5AW3 B;  1YJN P;  1U7J A;  3A7O A;  3WMM 0;  2ZVN B;  1X22 A;  2FXM A;  2OAR A;  3AE9 C;  3C8V A;  1LT1 A;  5KAF H;  3EFG A;  1ZW0 A;  3A5T A;  3L75 G;  3GHG B;  2BEZ F;  2NPS D;  2QSI A;  2IYO A;  2W83 C;  5AW9 B;  3WU2 E;  3I55 P;  3L71 G;  3SWK A;  2AEF A;  1J1D B;  2N1T C;  1L0L G;  1Y47 A;  2WSF H;  2BCC D;  5KKZ C;  2P10 A;  3G71 P;  5B5E E;  3M0D A;  2P7J A;  5AW1 B;  2WPR A;  3HD7 A;  1QVG O;  2FKW B;  1FOS E;  3GHG A;  3F89 A;  2FY8 A;  1JCC A;  1LGH B;  2E74 B;  4NPF X;  4H44 C;  1KOR A;  2RMZ A;  3H1J E;  2WPS A;  1EZV E;  1S4X A;  2KNC A;  1T3U A;  2HPC A;  2BCC J;  2HR3 A;  1SQB K;  4WY4 A;  5AVZ B;  1VF5 B;  3CCV P;  3H1I J;  3M9B A;  1PPJ G;  2QA4 P;  1OWA A;  4NPE A;  1XTG B;  2GUS A;  1WT6 A;  2K9Y A;  1J2J B;  2C9L Y;  3Q3D A;  1A02 F;  3B5N D;  1YI2 P;  3FGA D;  1QL2 A;  2LR2 A;  4YXW H;  2IBZ G;  3Q5R A;  1SP4 A;  2AXT H;  2HPC B;  3CX5 D;  3QWO C;  4IL6 H;  4WY4 B;  1M8O B;  2WMM A;  3ITK A;  4JYB A;  5BU8 B;  2KLU A;  2CPB A;  1NU1 D;  2JWD A;  1H89 A;  3WU2 H;  1NTM J;  3E1I A;  1OW6 A;  1SQB D;  2FYU E;  2XDJ A;  3AE8 C;  1SQQ J;  2QM7 A;  1SQX J;  2KZI A;  1Q2N A;  1YIJ P;  3SSU A;  1T2K C;  2QG4 A;  3TNU B;  4LC1 A;  3OA7 A;  3RK2 B;  4YTP C;  1NTK J;  5AW0 B;  1S2E A;  1L4A A;  1SLQ A;  2WIT A;  3TYY A;  2Y0C A;  3KZI E;  2QRX A;  1CW5 A;  3CPW O;  1PGP A;  3IN6 A;  3GHG C;  1PGO A;  3T97 A;  3H1J G;  2I1K A;  1KYO D;  3MHV A;  1IFD A;  4W7Y A;  1VQL P;  2K37 A;  2ZJS E;  2C9N Y;  1RHZ B;  2R5D A;  2KS1 A;  2FXO A;  1ZXG A;  2BAS A;  3L74 E;  2OTL P;  5L8R J;  3TGU G;  2FFD C;  1FDM A;  2IFM A;  2A06 G;  1HGZ A;  1PP9 D;  3LIE A;  2YO3 A;  5AW7 B;  3CXH D;  3W67 A;  5GTH E;  4DCK A;  3M0A A;  3RBX A;  2OYI B;  4JBZ A;  2N1T B;  3CI9 A;  4DZO A;  3WUV A;  3RK3 E;  4D6T J;  1AFO A;  3R2P A;  1RY3 A;  2IBZ D;  3BCC G;  4C7N B;  3NTN A;  1BCC J;  4IFM A;  2W6A A;  1HUC A;  4BRY B;  3CCU P;  1S9K D;  1IFM A;  2OYI A;  1R5L A;  1M1J C;  2YNY A;  3USS A;  3L36 A;  3E1R A;  3I5C A;  1M7L A;  1WRG A;  5C39 A;  4C7N A;  3G4S P;  1XTC C;  3L70 J;  2O1K A;  3RL0 D;  2CK3 H;  1M56 D;  3H1L D;  4U7J A;  1N86 A;  3PTZ A;  3MD0 A;  1JY3 O;  1LTJ B;  2XND H;  2V4H A;  1AJY A;  2V7Q H;  4UB8 E;  2IX7 C;  2VRS A;  1RF0 A;  1M90 Q;  3CCM P;  1RE4 A;  5CJ0 A;  3CXH I;  2QIW A;  3L73 D;  3S1K A;  1UII A;  3AEE C;  1EC5 A;  2KSJ A;  3R4Y A;  1U57 A;  1SS1 A;  3E7K A;  3O6Q A;  4K35 A;  3V6I A;  2AXT E;  2NRG A;  1QL1 A;  3WUT A;  4ZNC A;  1SQB J;  3CME P;  2WSF J;  1BSN A;  2ZXX A;  1S5L X;  1NWQ A;  4PD4 E;  3NMD A;  1NO4 A;  1OXZ A;  3CWB G;  3L72 G;  3OAK A;  4JPZ B;  2M5A A;  3VOP A;  4Y28 J;  5AVS B;  5CCH A;  1IK7 A;  1FZA A;  2LXB A;  5CCH C;  1JEK A;  3IF4 A;  3ZDM A;  5CHX A;  1L0L K;  4WWI A;  1N7S A;  2NPS B;  2POH A;  3MZW B;  1K04 A;  2NZ2 A;  2Z5H A;  1GW4 A;  1JY2 P;  3M9H A;  4H44 D;  3CC4 P;  3VMZ A;  1X0T A;  1MFT A;  3OJA B;  1IFN A;  5TIS H;  1HGV A;  2FFD B;  1JY3 N;  1KQG B;  2R32 A;  1GMJ A;  3CWB D;  4HYT B;  1CZQ A;  2PP6 A;  1YQ4 C;  1LT9 A;  3PLN A;  1ZR2 A;  3NXS A;  2JO1 A;  2XU6 A;  3LID A;  1N7S B;  1S72 P;  1BGY E;  3L72 J;  1GTW A;  2QE7 H;  1GDT A;  1FS0 E;  5AVR B;  1AA0 A;  1M1J B;  3CD6 P;  5K5G B;  2OYI C;  1EDL A;  3O8Z A;  4OGQ B;  2G8Y A;  2KSE A;  3CX5 E;  2N9B A;  3GG2 A;  3NFQ A;  5CCG C;  1RF1 A;  4AYC A;  1FZE A;  1S5L H;  1CI6 B;  3JCU H;  1LP1 A;  3C9I A;  3L37 A;  5APY A;  1OIP A;  3GLM A;  2E75 B;  1GD2 E;  1NU1 E;  3M91 A;  1NU1 K;  3L71 J;  1MFZ A;  2XNX A;  1M1J A;  3AE3 C;  1Y8A A;  4LLH A;  1BE3 J;  4PJ0 E;  1KQF B;  3L71 D;  1L2P A;  3BVH A;  1LP1 B;  1FZG A;  1SQP D;  2ZT9 C;  3B5N C;  3EWK A;  3QH9 A;  3VMY A;  3PH0 A;  2L5G B;  3D6Y A;  2PRR A;  4KHX A;  1RE3 A;  2AXC A;  1OVU A;  2KLV A;  1LTJ C;  2KXP B;  2OTK E;  3KHU A;  4U3F D;  1SQP G;  1SQV J;  1U7M A;  2XV5 A;  3HTK A;  3L72 D;  4R4M A;  5KAF E;  3SFE C;  1VQ4 P;  4MN4 C;  1FDO A;  1ZRT E;  1AVY A;  1JOC A;  1KQL A;  3H1K D;  1BGY G;  3AE4 C;  1EDK A;  1G2C A;  2E76 B;  3CXH E;  3L74 J;  3V2P A;  5KTB A;  1VQO P;  2RN0 A;  1HJ0 A;  2AEJ A;  1JY2 N;  4XA4 A;  1KB9 D;  2KP8 A;  1NOH A;  3L75 D;  2YO2 A;  3RK3 D;  3HUS C;  2W6J H;  4U3F G;  3P8M C;  3KYQ A;  1NU1 G;  4XE5 B;  4DJG A;  1H0T A;  2KYV A;  3KDP B;  3H6P A;  1S9K E;  3I56 P;  4B86 A;  1KV4 A;  1SQQ G;  2UWJ E;  3CL3 D;  1GK4 A;  3GF3 A;  3GW6 A;  1YYC A;  1NKN A;  1NTZ E;  2Q3E A;  2ZFC A;  3U59 A;  1FU1 A;  3KQG A;  4I2L C;  4PJ0 H;  2YIU B;  5EFW B;  2D2C D;  3MIW A;  1TU3 F;  2BCC E;  2MJZ A;  1S3J A;  2WT7 B;  2HOD A;  3VMA A;  3H1J J;  1L0L J;  3H1L E;  1NJI Q;  3AE5 C;  4N3Y B;  2E74 C;  1R8E A;  4RES B;  3IAO A;  3TGU J;  4C7R A;  2I8D A;  1GZL A;  2YIU C;  5AVT B;  3RK2 D;  2B87 A;  3VTP C;  2WT7 A;  3H32 B;  1L4A D;  1OVR A;  2HOD B;  3L70 D;  1GL2 B;  3CCJ P;  1VQ7 P;  4N78 D;  1LTI C;  2W6B A;  4N6J A;  4RJT A;  1IFP A;  4ZKP A;  1H88 A;  2FYU J;  1RQU A;  2B88 A;  2C0W A;  2KZJ A;  1OFC X;  3BAS A;  2H89 C;  2WSS H;  3H1I G;  1J1E B;  3HE5 A;  3IFM A;  4JQ0 D;  4PD4 D;  1FJP A;  2ZXE B;  3L73 G;  1PV3 A;  2B87 B;  2GA1 A;  2E5T A;  3H32 A;  3V2R A;  2OYH C;  3KPE A;  1GL2 A;  1K9M Q;  1GL2 C;  5KJ7 D;  1FE6 A;  5KAI E;  4BXL A;  3A0B E;  3TDK A;  1NTZ J;  1AVO A;  3CCQ P;  1FZF A;  2YKP A;  3N7N A;  1SQP K;  4C46 A;  5KLV K;  2FYN B;  4I7Z B;  3JCU E;  2W8Z A;  1JO5 A;  1KC8 Q;  1NTM G;  1FZB A;  1QGK B;  1PP9 J;  2ZAE B;  3H1H J;  1SFC D;  1SQX G;  2QJY B;  3H1L G;  3B8E B;  2KB7 P;  1P84 D;  1R5S A;  2Q3I A;  1N8R Q;  2KK7 A;  4L76 A;  1NTK G;  3L4F A;  1KYO I;  5AW4 B;  1FOS F;  2R3C A;  5AVV B;  1T8Z A;  3HUS B;  5B66 H;  1W2B O;  2FYN C;  4I7Z C;  5KLV G;  2JJL A;  3L74 D;  3WUU A;  1KZU B;  4HH2 A;  1PL5 A;  4IOI H;  1EXJ A;  4KT0 J;  2LKM A;  1NH4 A;  5KJ7 A;  3H1K J;  1JTH B;  2N1T D;  3H1I E;  3BCC D;  2O01 H;  1FZC B;  1IFJ A;  2ZVO B;  4PV1 C;  3D70 A;  1AQ5 A;  1L0N J;  3CX5 H;  3CLQ A;  4YPC A;  3Q2Y A;  1LWU B;  2RKL A;  3LW5 J;  1KB9 I;  4BWN A;  1FBM A;  1SFC B;  1SQP E;  2K3R A;  5CCH D;  1OW8 A;  2IBZ E;  1HJB A;  1JTH A;  4UB8 H;  2Q7C A;  5KAI H;  1L0L D;  4PD4 I;  1PGQ A;  1S5L E;  1KIL A;  1T6A A;  2B9B A;  3G3Z A;  2RH0 A;  2WQY C;  3BCC J;  2GM4 A;  1FAV A;  3II6 A;  1YBK A;  3G6E P;  1SFC A;  5BU5 A;  1EQ7 A;  1KMI Z;  1K8A Q;  2OYH A;  5KKZ B;  2H7H A;  1VQM P;  1DEB A;  2B89 A;  4AUW A;  1A02 J;  1KB9 E;  1FJK A;  4EI2 A;  5APV A;  5CCG A;  2CPS A;  1QVF O;  1J1E C;  2ZT9 D;  4H0L D;  3H1H D;  1USE A;  2Y9Z A;  1P84 I;  2OYH B;  4WY4 D;  1DD3 A;  3CXH H;  1ZR4 A;  1JUN A;  4LGD E;  3HD7 B;  1VDF A;  3HRN A;  2FYZ A;  4XFJ A;  2WSC H;  3TGU E;  1USD A;  1NTZ D;  1ZP0 C;  2R44 A;  4K3A A;  5TIS E;  2QVA A;  1Q81 Q;  1RF0 C;  2FXP A;  2KIK A;  4L74 A;  2H43 A;  1SQV D;  2A45 G;  5KLI C;  1G1I A;  1BCC E;  1MUU A;  2KNC B;  2OTJ P;  1JM0 A;  1LTT C;  1SQB G;  1KFM A;  2QJY C;  5AW6 B;  3TNU A;  1LNQ A;  1M57 D;  1NAF A;  2J58 A;  3L35 A;  3AEA C;  4IFD K;  2JP3 A;  1NTZ K;  3RBZ A;  2W27 A;  3RK3 C;  1SQV G;  1SQP J;  1BE3 E;  2KOG A;  1L0N D;  2QEX P;  1LTA C;  3V2Q A;  1LTB C;  5CCG D;  1Q86 Q;  1FZC C;  1X8Y A;  2K88 A;  4KJM A;  1FC2 C;  2J5U A;  1BSH A;  1HF9 A;  3VMX A;  4ZKU A;  5BVZ A;  3L70 E;  2KS1 B;  4H13 B;  5KLI B;  1SFC C;  2A06 D;  2H88 C;  1H8A A;  1RH5 B;  2O01 N;  2P67 A;  1VQK P;  4OGQ D;  1MV8 A;  2M8R A;  4GIF A;  2D2C C;  3LW5 H;  3KXD A;  1BGY D;  1UIX A;  5GTH H;  4GDO A;  3Q5P A;  5APQ A;  5CBN A;  1VQP P;  2N1T A;  2Q6Q A;  3VP9 A;  4D6T D;  2O3J A;  1OMI A;  1L4A B;  4Y99 B;  1PPJ E;  1IK9 A;  1YIT P;  1K73 Q;  1OVV A;  3VYI A;  3B5N A;  1OZH A;  2ITA A;  2JWA A;  1SQX E;  5AVU B;  4BRY A;  1T2K D;  5AVX B;  2Z5I A; 
#chains in the Genus database with same CATH homology
 2P1J A;  3RL0 C;  4GT1 A;  1KIL D;  3B5N B;  4DOJ A;  5AVY B;  2J59 M;  1N2D C;  4AQR D;  1HTL C;  2R5B A;  4C46 A;  3V4W A;  5AVQ B;  1GW3 A;  1N7S D;  3V2N A;  1NHL A;  1LT9 C;  5AW2 B;  3SWF A;  5APX A;  3RK3 B;  3P8C D;  1N73 B;  4EIJ A;  1NTM K;  3P7K A;  2Q5U A;  1GL2 D;  5AVW B;  2FYU K;  1DX7 A;  1LTG C;  1N73 A;  1HWT C;  1LTJ A;  1ZN5 A;  2NPS A;  1RE3 C;  5AW5 B;  2P2U A;  4OH8 B;  2IPP A;  1JY2 O;  1T3J A;  3N4X A;  4I1L A;  2C0X A;  1JNM A;  2FFD A;  1KIL C;  1GU4 A;  2NPS C;  3M9Q A;  1MZ9 A;  2JEE A;  4EOT A;  3SWY A;  1RF1 B;  4IFF A;  1L4A C;  4Y99 C;  5APU A;  1HBW A;  4N78 E;  3HE4 A;  3M06 A;  3VP8 A;  1IJD B;  1LWU C;  3RL0 B;  1CSB A;  2A45 I;  3BRT B;  5APS A;  3BRV B;  3MUD A;  1LT9 B;  1JY3 P;  1L0N K;  3HE4 B;  2O1J A;  2YKQ A;  3HTK B;  1N7L A;  1VPC A;  2PAJ A;  1SQV K;  3UIA A;  1CI6 A;  2XKM A;  4JYC A;  2XZR A;  4O9B A;  2H8P D;  3V4Q A;  1GTW A;  1SVF A;  3U1A A;  3MTU E;  4W80 A;  3A2A A;  1ZV8 A;  1GU5 A;  3U1C A;  1X79 B;  2HFE D;  5APW A;  1HVV A;  3P32 A;  3TSI A;  1NKZ B;  2Q9I A;  2E42 A;  1G1J A;  3BAT A;  4W7Z A;  1RF1 C;  2IFN A;  4JF7 A;  3EQ2 A;  1G2C B;  5KJ7 C;  1W2E A;  2YKO A;  2Z4E A;  2A45 H;  4WBA A;  2I1J A;  2WZ7 A;  4M3L A;  1LTS C;  2YMY A;  2QM8 A;  3P8C E;  1URQ D;  3PP5 A;  5CJ4 A;  3V5B A;  2HLO A;  1YTZ T;  1E5W A;  1HH0 A;  1J1D C;  3HE5 B;  4I6M C;  5APT A;  1Z56 A;  1GK6 A;  1JMM A;  3A3Y B;  3HD7 C;  2WPQ A;  3M0D C;  1N7S C;  2GUV A;  1IO4 A;  2HYN A;  2WWW A;  1IFI A;  1SQQ K;  2HG5 D;  1SQX K;  1YTZ I;  5AVV B;  1X9V A;  4N6J A;  2WSE H;  3IR9 A;  1N73 C;  1NTK K;  3HD7 D;  2WTY A;  1RE4 C;  1JCD A;  1PFI A;  1KFN A;  1ZLL A;  3MGN A;  1FZC A;  1URQ C;  1LWU A;  1URQ A;  3TK1 A;  2E43 A;  3RK2 C;  3VN0 A;  2M3B A;  4WY4 C;  1DH3 A;  5AW8 B;  1KIL B;  5CMZ A;  1IC2 A;  4GKG A;  3HUS A;  1URQ B;  5AW3 B;  3A7O A;  3WMM 0;  2OAR A;  2FXM A;  3EFG A;  3A5T A;  3GHG B;  2NPS D;  5AW9 B;  1J1D B;  2N1T C;  2WSF H;  3M0D A;  2P7J A;  5AW1 B;  2WPR A;  3HD7 A;  2FKW B;  1FOS E;  3GHG A;  1JCC A;  1LGH B;  2WPS A;  1T3U A;  2HPC A;  4WY4 A;  1SQB K;  5AVZ B;  3M9B A;  1OWA A;  1XTG B;  2GUS A;  1WT6 A;  1J2J B;  2C9L Y;  1A02 F;  3B5N D;  1QL2 A;  1SP4 A;  2HPC B;  4WY4 B;  4JYB A;  5BU8 B;  2CPB A;  1H89 A;  3E1I A;  2XDJ A;  2QM7 A;  1T2K C;  3TNU B;  4LC1 A;  3OA7 A;  3RK2 B;  5AW0 B;  1SLQ A;  1L4A A;  2WIT A;  3TYY A;  1CW5 A;  3GHG C;  2I1K A;  2C9N Y;  4W7Y A;  1IFD A;  2R5D A;  2BAS A;  1FDM A;  2FFD C;  2IFM A;  1HGZ A;  3LIE A;  5AW7 B;  2YO3 A;  3M0A A;  2OYI B;  2N1T B;  3CI9 A;  4DZO A;  1AFO A;  3R2P A;  1RY3 A;  4C7N B;  3NTN A;  4IFM A;  2W6A A;  1HUC A;  1S9K D;  1IFM A;  2OYI A;  1M1J C;  2YNY A;  3L36 A;  3I5C A;  1M7L A;  1WRG A;  4C7N A;  1XTC C;  2O1K A;  3RL0 D;  1N86 A;  3MD0 A;  1JY3 O;  1LTJ B;  2IX7 C;  2VRS A;  1RF0 A;  1RE4 A;  5CJ0 A;  2KSJ A;  1QL1 A;  1NWQ A;  3NMD A;  1NO4 A;  1OXZ A;  3OAK A;  3VOP A;  5AVS B;  5CCH A;  1FZA A;  5CCH C;  5CHX A;  1L0L K;  1N7S A;  2NPS B;  2POH A;  2Z5H A;  1GW4 A;  1JY2 P;  3M9H A;  3VMZ A;  3OJA B;  1IFN A;  1HGV A;  2FFD B;  1JY3 N;  2R32 A;  4HYT B;  1CZQ A;  2PP6 A;  1LT9 A;  1ZR2 A;  3NXS A;  2XU6 A;  3LID A;  1N7S B;  1GDT A;  5AVR B;  1M1J B;  2OYI C;  3O8Z A;  3NFQ A;  2N9B A;  1RF1 A;  4AYC A;  1FZE A;  1CI6 B;  3C9I A;  3L37 A;  5APY A;  1GD2 E;  3M91 A;  1NU1 K;  1MFZ A;  2XNX A;  1M1J A;  4LLH A;  3BVH A;  1FZG A;  3B5N C;  3VMY A;  2L5G B;  4KHX A;  1RE3 A;  3T97 A;  2KLV A;  5CCG C;  1LTJ C;  4WB4 A;  3HTK A;  2XV5 A;  1JOC A;  1KQL A;  1G2C A;  3V2P A;  5KTB A;  4XA4 A;  1JY2 N;  2KP8 A;  1NOH A;  2YO2 A;  3RK3 D;  3HUS C;  3P8M C;  3KYQ A;  4XE5 B;  2KYV A;  3KDP B;  3H6P A;  1S9K E;  4B86 A;  3CL3 D;  1GK4 A;  1YYC A;  1NKN A;  2ZFC A;  3U59 A;  1FU1 A;  3KQG A;  4I2L C;  3MIW A;  2MJZ A;  2WT7 B;  2HOD A;  4N3Y B;  4RES B;  4C7R A;  1GZL A;  3RK2 D;  3VTP C;  2WT7 A;  3H32 B;  1L4A D;  2HOD B;  1GL2 B;  4N78 D;  1LTI C;  2W6B A;  1H88 A;  4ZKP A;  2C0W A;  3BAS A;  3HE5 A;  1J1E B;  3IFM A;  1FJP A;  2ZXE B;  2OYH C;  3V2R A;  3H32 A;  3KPE A;  1GL2 A;  1GL2 C;  5KJ7 D;  1FZF A;  2YKP A;  3N7N A;  1SQP K;  5KLV K;  1JO5 A;  1FZB A;  1SFC D;  3B8E B;  2KB7 P;  2Q3I A;  3L4F A;  5AW4 B;  1FOS F;  2R3C A;  1T8Z A;  3HUS B;  2JJL A;  1KZU B;  4HH2 A;  2LKM A;  1NH4 A;  5KJ7 A;  1JTH B;  2N1T D;  2O01 H;  1FZC B;  1IFJ A;  1AQ5 A;  3CLQ A;  1LWU B;  1FBM A;  1SFC B;  5CCH D;  1HJB A;  1JTH A;  2Q7C A;  1KIL A;  3G3Z A;  2GM4 A;  1FAV A;  3II6 A;  1SFC A;  5BU5 A;  1EQ7 A;  2H7H A;  2OYH A;  1DEB A;  4AUW A;  1A02 J;  1FJK A;  5APV A;  5CCG A;  2CPS A;  1J1E C;  2OYH B;  4WY4 D;  1ZR4 A;  1JUN A;  4LGD E;  3HD7 B;  1VDF A;  3HRN A;  2FYZ A;  2WSC H;  1RF0 C;  2H43 A;  2A45 G;  1G1I A;  1MUU A;  1LTT C;  3TNU A;  1KFM A;  5AW6 B;  4IFD K;  1NAF A;  3L35 A;  2J58 A;  1NTZ K;  2W27 A;  3RK3 C;  1FZC C;  2KOG A;  1LTA C;  3V2Q A;  1LTB C;  5CCG D;  1X8Y A;  3VMX A;  4ZKU A;  5BVZ A;  1SFC C;  1H8A A;  2P67 A;  1MV8 A;  2M8R A;  4GIF A;  3LW5 H;  5APQ A;  2N1T A;  3VP9 A;  1L4A B;  4Y99 B;  1IK9 A;  3VYI A;  3B5N A;  5AVT B;  5AVU B;  1T2K D;  5AVX B;  2Z5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...