1AFOA

Dimeric transmembrane domain of human glycophorin a, nmr, 20 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
40
structure length
40
Chain Sequence
VQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLYCOPHORIN A
publication title A transmembrane helix dimer: structure and implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Integral membrane protein
total genus 12
structure length 40
sequence length 40
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.70 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1afoA00
2J58A 1AFOA
chains in the Genus database with same CATH superfamily
2Q1KA 3P7KA 1PP9D 3AE9C 4W7YA 3H1ID 1GDTA 1FZGA 1FOSF 2K9JB 3HE5A 5KAIE 4QMAA 4N3YB 5KJ7A 2IBZG 2QJPC 2UWJE 5KKZC 2L91A 3OJAB 4EIJA 1BE3G 1L4AC 5AVTB 1DEEG 3ABVC 3HE5B 2KB7P 3II6A 1Q81Q 3U1AA 2YXRB 1CW5A 2I1JA 1AV1A 3AEEC 2V7QH 3AE2C 1LWUC 3TK1A 1LNQA 1XTCC 4B86A 2YKPA 3KHUA 4W80A 4HJGH 1Q90D 5TISE 1VDFA 2FYUK 1RF1A 4IL6H 2FYUE 2E5YA 3VMAA 3CWBD 1N7SD 1JY3N 3Q1MA 2B9BA 5B5EH 3H1KE 3KZIE 2G3AA 3D70A 1RH5B 1GW3A 1RF1B 1R8EA 5GTHH 1QEXA 2FYNC 1FDIA 2VRSA 1SP4A 2WMMA 1SQQG 3KDPB 2N1TD 3H1JG 2JEEA 2IPPA 2JR8A 1VQOP 2ITAA 4GKGA 5C39A 1QGKB 1X8YA 1L0LK 1L4AA 1L0LE 5BU5A 1SQXG 2J59M 2KOGA 3VMZA 3RGUA 1CZQA 4OGQD 1DX7A 1PGQA 4UB6E 1JMBA 2QJPB 5KKZB 1N7LA 1L4AB 1L0NG 4BXLA 4OGQC 1M56D 4PD4E 3CX5D 2D2CC 4GIFA 3MUDC 2WPQA 1RY3A 1NU1J 4RKUJ 1KORA 4JQ0D 5AW5B 3C9IA 4NPDA 3B5ND 3L70E 1NU1D 2KLUA 2WPRA 3WMM0 2Z5IA 2KXPB 2Y0DA 3H1HG 3RL0C 3QWOC 2I1KA 2WSFJ 2WSCJ 3OW2O 2G8YA 3RBZA 4NPFX 2Y9YA 1EQ7A 1LTIC 2W90A 1BCCJ 4Z1MH 2WVRA 1PZQA 3TGUJ 1H0TA 1KILC 3H1LE 3L75G 3D6YA 1SQBK 5KLVG 1GZLA 1UIIA 1BCCD 2FYNB 2Q6QA 2P7JA 3TGUD 1MFZA 3V6IA 3TNUA 4I6MC 1H0TB 4N78E 4JF7A 4IL6E 1VQ4P 2E43A 1IFJA 2YIUC 3L72E 5AW8B 3BRVB 3JSVC 4IOIH 3TNUB 3MUDA 1YBKA 2K37A 3KYQA 2FXPA 1HBWA 3NTNA 1NJIQ 1TU3F 5K5GB 4TLFA 1FOSE 3MP7B 3HRNA 2D2CB 1BSNA 4UB8E 1U7MA 3SWYA 3P8MC 2M5AA 1Y47A 1EXIA 1ZMEC 5B66E 2O01N 4HH2A 1MKMA 4YTPC 1LTJB 3R4YA 3VP8A 2KNCA 1M1JC 2M5AB 1Q86Q 5CJ4A 3KQGA 1X0TA 2P67A 2FKWB 3RL0B 1KILA 4EOTA 4N6JA 1QLED 1RF0C 1NAFA 2K88A 2KZJA 3F89A 1NTZK 2KNCB 2JJLA 5E79E 2FYUJ 1VL2A 2HR3A 3VYIA 2GA1A 1KILB 2AXCA 1JEKA 3WUVA 1UIXA 1PIXA 3PH0A 3H1KJ 3CX5H 2FYUD 3AE1C 4ZKPA 3L73E 1ZR4A 3EFFK 2R3SA 2MJZA 3HD7C 1G2CA 3H1KD 3IAOA 5KTBA 2YIUB 5APXA 1NTMG 1HH0A 4DCKA 3M0DC 1LTSC 5M1BA 1LTTC 3G9RA 3A3YB 1VF5D 3CCSP 1L0LJ 2XNXA 1ZOYC 1N73C 1ZN5A 3HE4A 1VF5C 4M3LA 5H2FE 1YI2P 1FDOA 3EFGA 2Q5UA 4A7PA 2WSCH 1L0LD 1IK7A 1G1JA 1M1JA 1CSBA 1YJWP 2KP8A 2NPSB 1RF0A 1FJPA 1S5LH 1RQUA 3M9BA 3JC22 5AW4B 3M9QA 5APWA 1LP1A 2J58A 4PD4D 3IFMA 1M1JB 4PV1C 3V2RA 2E76D 3L70J 3CC7P 1ZV8A 2AEMA 1IC2A 4IL6X 3HUSC 1N2DC 1EZVG 1LTGC 3GF3A 1BGYE 3CD6P 3LIDA 1KTMA 1LP1B 3L70D 3HD7A 2E75D 1Y8AA 4BRYA 2B87A 5KAIH 1LTBC 3M0DA 3AE6C 3H1LJ 3HD7B 1QVGO 3AE3C 2B87B 5APUA 1N73A 1SS1A 1FZCC 3H1LD 3BASA 1EC5A 3RL0g 1IZNB 2K1AA 3S4RA 2QM8A 3L72J 3VN0A 1N73B 1IFIA 4N78D 3RK2C 1NOHA 1VF5B 1S3JA 1SLQA 1SVFA 1T3UA 1CI6B 3L72D 5CBOA 1W2EA 4H13D 4I1LA 3FXDA 4YPCA 5TISH 3HUSA 1K73Q 1JUNA 2ZYDA 2NZ2A 1W5CE 1IO4A 1NGMB 1IFMA 1OX3A 1SQVG 4PV1B 3KZIH 3HUSB 3KPEA 2XDJA 2WPSA 3MTUE 3D71A 2QEXP 1JCDA 2P10A 1W2BO 1YTZI 4OWFA 2Q3IA 1PP9G 3PP5A 3T97A 2OYIA 2A45H 3OA7A 1S5LE 4ZNCA 1J1DC 3H1IG 1FZCA 1S4XA 4U3FE 1HGZA 3GW6A 3LIEA 2Z5HA 3G6EP 4WY4C 4UB6H 1AVOA 3C1LA 3T97B 1AFOA 2OYIB 5APVA 3L73J 2YO2A 1FZCB 1LGHB 1EDLA 4PD4H 1SQPE 5KAFH 2Y9ZA 3L73D 3L71E 2DW3A 4AYCA 1ZLLA 1M8OB 3RK2B 2KYVA 4JYBA 1JB0J 1YIJP 5APTA 1YJ9P 3CL3D 2BASA 1VQ9P 1N8RQ 1BDCA 4GOEA 1X22A 1HWTC 3PLNA 3CWBG 1OWAA 1KQLA 4JYCA 1DD3A 1KZUB 1VQ7P 3BCCE 1E5WA 2IX7C 3UIAA 1KD1Q 1J2JB 1WT6A 3L35A 4C7NA 1BGYJ 4WY4A 1MV8A 1USDA 1P84H 1VQ5P 4OVNF 3B8EB 3WUUA 3MZWB 1J1DB 2FYZA 1J1EC 3IF4A 2PP6A 1BGYD 4LGDE 3RK3E 4C7NB 1KFNA 2HFED 4WY4B 1N7SC 1FZAA 1JY2P 3I5CA 3V2PA 2Q9IA 3SSUA 1QVFO 1T6AA 3N4XA 4LLHA 2OYHC 4KHXA 4UB8H 3GMAA 5B66H 2N1TC 4AQRD 1QX8A 1SFCD 1NU1G 1KYOI 2FY8A 1JNMA 3SFDC 5CJ0A 1G1IA 1JO5A 1S5LX 1SFCC 2OARA 3R2PA 1LWUA 2R44A 5KAFE 3CMEP 1GTWA 5E79H 1NTKK 2FFDC 3QH9A 1NTKE 3Q5SA 5CCHD 1URQD 2A06E 4IFDK 4DT0A 1LWUB 2KUBA 5AVQB 2QG4A 1E79H 1LT9C 3AE4C 3B5NC 1BCCG 1GU5A 2LR2A 1N7SA 3TGUG 1YJNP 2QVAA 3G3ZA 1MUUA 1R5SA 2WSEH 2H43A 2KI7B 3CCRP 2OYHA 3PRJA 2KK7A 3AEBC 1N7SB 3RBXA 4U3FJ 1OMIA 3L4FA 3Q5PA 2N1TA 1X9VA 3AE7C 5H2FH 3E7KA 2W6JH 2OYHB 4H44D 1JOCA 4U3FD 1MZ9A 1P84E 1SQPJ 2N1TB 1SFCA 2Q7CA 2ZYAA 3L71J 1T2KD 3IN6A 1SQPD 2FFDA 5APYA 1NWQA 5KLVJ 2FBWC 1XTGB 3A0HH 1EZVI 1OVVA 3L71D 4OGQB 2B89A 2JP3A 2FXMA 4K3AA 1S9KE 3S1KA 1LT9A 3B5NA 3BVHA 2FFDB 5AVZB 5AVRB 2OTKE 2R5DA 2BEQD 2LXCB 1NAYA 1LT9B 3B5NB 1JY3P 3FWLA 2FYUG 3BCCJ 3FWNA 2KIKA 4WVZA 2W6AA 2H8PD 1IFDA 1KB9H 3H1KG 3AEDC 3BCCD 5AVVB 1VQNP 2QJKC 3H32A 1QL2A 5GTIE 3MIWA 4GODA 2I8DA 1KC8Q 4Y99C 3L74E 4ASVA 4D6TE 3M91A 2CK3H 2ZFCA 3BRTB 3H32B 5CMZA 1M7LA 1S2EA 4Y28J 2A45G 1ZXGA 3RK3D 1EDJA 1L0LG 3VP9A 2BCCE 3B71A 3RK3C 3CXHH 5AW0B 1PPJE 2KLVA 4I7ZC 1G2CB 1M90Q 3O8ZA 4XA4A 4YXDC 3M0AA 1A02F 2ZT9D 1S72P 3TYYA 5AVUB 4RO0A 3BATA 3SWFA 4XE5B 3A5TA 3L70G 1VQMP 2H7HA 1Q82Q 2JO1A 1NTMJ 1N86A 3HE4B 1K8AQ 4PJ0H 1HJBA 3P8CE 4C7RA 1NTKJ 4R4MA 1VQLP 1Q7YQ 1FZEA 1LTAC 5AVYB 1FZFA 3V5BA 3A0HE 4EDFA 2IBZE 1NTKD 1PL5A 2E76C 4BWNA 1BE3E 2A06D 2JKVA 2QJKB 4GOFA 3P32A 2XKMA 4Y99B 4LC1A 1BSHA 1NKNA 1SQBG 2OQQA 2P2UA 2IFNA 2W27A 1MFTA 4H0LD 5CCGD 4KJMA 1OW8A 3CMAP 2E75C 1KQSO 1GU4A 1K04A 2HG5D 2GUVA 2OGUA 3L72G 4BRYB 3W68A 3MGNA 1KB9E 2LKMA 2XU6A 4ASWA 2PAJA 2K9YA 3C8VA 2YO3A 1OVUA 1PGPA 3USSA 3AEAC 4I7ZB 2PRRA 2E74D 1T8ZA 3CC4P 3M9HA 1YHQP 4R4LA 4HYTB 1EXJA 1P84D 2AEJA 2E74C 5DJTB 1JY2N 1SQQK 1FJKA 1U7JA 3AECC 1SQQE 2RMZA 3H1JE 2IZ1A 2PFXA 4H13C 1FDMA 2WZ7A 3CXHE 2POHA 2YNYA 1IK9A 2PGDA 1OIPA 5AW1B 1SQXK 1SQXE 5EFWB 3AEFC 1EDKA 1S9KD 3MHVA 2KSEA 3NFQA 4C46A 1NHLA 3PTZA 2HODA 4DOJA 2O01H 1L0NK 4ZMDA 2E76B 1NTZG 5KJ7D 2ZVOB 1L0NE 1PGJA 3A0BH 1KMIZ 1OZHA 1AQTA 4EYYQ 3CX5I 2HYNA 3JCUE 2LXBA 1KILE 2CPBA 2HODB 3SWKA 1Z56A 4PJ0E 3AEGC 3L73G 4EI2A 2E75B 3L74J 1RE4C 1FZBA 4D6TJ 4JBZA 2Y0EA 2W8ZA 3H1HE 3L74D 5CBNA 1DH3A 2QSIA 1FC2C 1SQPK 1WMKA 3F5HA 2W83C 1KN7A 4D6TD 2WSEJ 2MKVA 2BCCJ 3PJSK 1RE3C 5KLVK 3S9OA 2B88A 1ZRTE 1GD2E 4GDOA 3L75E 5KLVE 2BCCD 3MD0A 1D7MA 1PPJD 5AVSB 4H13B 1YTZT 2ZXXA 3AE5C 3E1IA 2P58A 1L4AD 2IDBA 3Q3DA 5APQA 2YXQB 1BGYG 1FAVA 1OVRA 1OW6A 1KFMA 3O6QA 5CHXA 4XFJA 2OTLP 2C0WA 3CCJP 2O1KA 1ZR2A 2AXTH 2IFMA 1RE4A 3VMXA 3P8CD 2JWAA 1VPCA 1AA0A 1BE3J 1DEBA 3W67A 2M8RA 3O6QB 1PGOA 1DIPA 2IBZD 3CWBJ 2QRXA 2WITA 3CCUP 3VTPC 4CPGA 1BE3D 4DZOA 2W6BA 1KYOE 3GHGC 2HPCA 1AQ5A 1RE3A 3PHLA 3A0BE 2YKQA 2YMKA 5KLIC 3NXSA 2HPCB 3L36A 2ZXEB 4WWIA 1DD4A 4IFFA 2FXOA 1FU1A 1KB9D 1K9MQ 1VQPP 4YXWH 3N7NA 1LJ2A 4TT3H 2WTYA 1IFNA 3V2NA 3HTKA 5L8RJ 1NTMK 5BU8B 3WU2H 1SQQJ 1NTME 3OAKA 3H1JJ 1T3JA 3VMYA 5GTIH 4MN4C 2IYPA 2K3RA 3K5BA 2D2CD 4GT1A 4K35A 2NRGA 2XV5A 3HTKB 1SQQD 3H1JD 1SQXJ 2C0XA 1OW7A 2IYOA 5CCHC 3CXHD 1URQC 5BVZA 1JTHA 2A45I 2GM4A 2SPZA 3CCLP 1SQXD 1L0NJ 3U59A 3GHGA 4U3FG 1Q2NA 2YMYA 3IR9A 1J1EB 1LTJC 5AW6B 3RL0D 1AVYA 2WQYC 3GLMA 1JTHB 1L0ND 3EQ2A 1OFCX 1YQ4C 2IZ0A 3KXDA 2C9LY 3NMDA 3GHGB 4PD4I 2XZRA 3LW5J 1NKZB 1HUCA 1SQPG 2H89C 1EZVE 4AUWA 5AW7B 1FE6A 1KILD 2ZJSE 2AXTE 2Q3EA 3Q5RA 3L71G 1JCCA 3SFEC 2YKOA 3H1HJ 1HJ0A 4RESB 5KLIB 3L37A 2KZIA 4H44C 1SQBE 1IJDB 2WT7A 3H25A 1FBMA 3H1HD 2BEZF 1VQ8P 2R32A 3L75J 2N9YB 2AEFA 1T2KC 1M57D 1SFCB 2WT7B 5B5EE 1GK4A 2QIWA 1H88A 1ZRTD 5CCHA 3L75D 5KLVD 1URQA 4L75A 1A02J 2RKLA 3BCCG 5GTHE 3TF5A 4I2LC 2JDIH 3CC2P 1LTJA 2NPSD 1URQB 1P84I 4WBAA 1PV3A 1M1KQ 2L5GB 1NO4A 3A7OA 2ZAEB 2NPSC 4ZKUA 3E1RA 5DJUB 3V4QA 3WU2E 1GMJA 2QJYC 3M06A 1RHZB 3AE8C 1VQ6P 5AW9B 1SQVK 1SQVE 3CCEP 3G4SP 1HVVA 3A2AA 4DJGA 1KQGB 3ITKA 3CCVP 1R5LA 2KS1A 3V2QA 5AVXB 4OH8B 1YYCA 1NTZE 1YQ3C 2O1JA 5AVWB 3D6ZA 2O01J 1L2PA 3CCMP 4IFMA 2KSJA 2KS1B 2WWWA 4H44B 1EDIA 1PP9E 3HD7D 1PFIA 1JY2O 1KYOD 2RN0A 1AJYA 3H1IE 3CI9A 2E5TA 1NH4A 4U7JA 2C9NY 1WRGA 3ZDMA 1BDDA 5TJHA 1ZW0A 1NTKG 1OXZA 2A06G 2ZT9C 3JCUH 4L76A 2Y0CA 2NPSA 2HLOA 1GL2D 2WSFH 3LW5H 3GF7A 2XNDH 4RJTA 2QA4P 1NTMD 1GL2C 2R3CA 3CPWO 4PV1D 3GG2A 2QJYB 2H88C 4HB1A 4JPZB 1KQFB 3H1LG 3CWBE 4L73A 2OTJP 1LT1A 5APSA 1H89A 1NVOA 1K05A 3Q2YA 2M3EA 3G71P 1IFPA 4H0LC 5CCGC 3H6PA 1Y9BA 1VQKP 2ZVNB 3RK3B 2N9BA 1JM0A 1EZVD 2V7QJ 1H8AA 1SQBJ 3V4WA 2QE7H 2IBZI 2OYIC 3I55P 1USEA 3TSIA 1S1CX 1HTLC 2P1JA 1SQBD 3CLQA 1CI6A 3RK2D 1GL2A 2ZT9B 3CX5E 1HGVA 1KV4A 3EWKA 1ZP0C 2Z4EA 2V4HA 1GL2B 3I56P 1NU1K 1KB9I 1X79B 4WB4A 2CPSA 2R5BA 1NU1E 2M3BA 1KYOH 4HKZH 2O3JA 1HF9A 2RH0A 2WSSH 3L74G 1YITP 5KJ7C 2J5UA 1GW4A 5CCGA 4D6TG 1JY3O 3U1CA 3B4SA 1SQVJ 5AW3B 3VOPA 2M0BA 2WPVB 2ZYGA 3FXEA 1RQVA 4H0LB 4KT0J 1BCCE 2BCCG 4O9BA 3TDKA 1FS0E 1SQVD 3CXHI 3WUTA 1NTZJ 3TGUE 4WY4D 1NYHA 1PPJG 2GUSA 1GK6A 4NPEA 2E42A 1U57A 1JMMA 2OYOA 4L74A 3FGAD 3FX0A 1PP9J 1NTZD 1QL1A 1RF1C 2JWDA 3H1IJ 4W7ZA 2E74B 3CCQP 2QM7A 5AW2B 2K9JA
chains in the Genus database with same CATH topology
3P7KA 2W6AA 2H8PD 4GT1A 1IFDA 1LTBC 2XV5A 3M0DA 3HTKB 4W7YA 3HD7B 5AVVB 2C0XA 3H32A 1QL2A 1GDTA 3MIWA 1FZGA 1FOSF 3HE5A 5CCHC 5APUA 1N73A 1URQC 4Y99C 5BVZA 1JTHA 2A45I 2GM4A 1FZCC 3BASA 3U59A 3GHGA 4N3YB 3M91A 5KJ7A 2ZFCA 2QM8A 3BRTB 3OJAB 2YMYA 3IR9A 3H32B 1J1EB 5CMZA 4EIJA 1M7LA 3VN0A 1LTJC 1L4AC 5AW6B 3RL0D 5AVTB 3HE5B 2A45G 2KB7P 3RK3D 1N73B 1IFIA 1JTHB 3II6A 4N78D 3EQ2A 3RK2C 1NOHA 3VP9A 1SLQA 1SVFA 3U1AA 1T3UA 2C9LY 3NMDA 1CI6B 3GHGB 2XZRA 3RK3C 1NKZB 1W2EA 1HUCA 4I1LA 5AW0B 1CW5A 2I1JA 4AUWA 5AW7B 2KLVA 1KILD 1G2CB 3HUSA 1JUNA 1LWUC 3TK1A 1XTCC 1JCCA 4B86A 1IO4A 3O8ZA 2YKPA 2YKOA 4RESB 3L37A 4XA4A 1IFMA 4W80A 3M0AA 1A02F 1VDFA 2FYUK 1RF1A 3TYYA 5AVUB 1IJDB 3HUSB 3BATA 2WT7A 3KPEA 2XDJA 1N7SD 1FBMA 3SWFA 1JY3N 4XE5B 2WPSA 3MTUE 3A5TA 2H7HA 1N86A 2R32A 3HE4B 1JCDA 1HJBA 1T2KC 1GW3A 1RF1B 1SFCB 3P8CE 4C7RA 1YTZI 2WT7B 1FZEA 2Q3IA 1LTAC 3PP5A 3T97A 1GK4A 5AVYB 1H88A 1FZFA 2A45H 3V5BA 2OYIA 5CCHA 2VRSA 1URQA 3OA7A 1J1DC 1SP4A 1FZCA 1A02J 3KDPB 2N1TD 1HGZA 2JEEA 2IPPA 3LIEA 4GKGA 2Z5HA 4I2LC 1X8YA 4WY4C 3P32A 1L0LK 1LTJA 1L4AA 1AFOA 2OYIB 5APVA 5BU5A 2XKMA 2NPSD 1URQB 4Y99B 2J59M 2KOGA 4LC1A 4WBAA 2YO2A 1NKNA 1FZCB 1LGHB 3VMZA 2P2UA 1CZQA 2L5GB 1DX7A 1NO4A 3A7OA 2IFNA 2W27A 2NPSC 4ZKUA 5CCGD 1N7LA 3V4QA 1L4AB 3M06A 1GU4A 5AW9B 2HG5D 1SQVK 2GUVA 4AYCA 1ZLLA 4GIFA 3RK2B 2WPQA 1RY3A 3MGNA 1HVVA 3A2AA 2LKMA 2KYVA 2XU6A 2PAJA 2YO3A 5AW5B 3C9IA 4JYBA 3B5ND 3V2QA 5AVXB 4OH8B 1YYCA 5APTA 1T8ZA 3M9HA 3CL3D 2BASA 2O1JA 5AVWB 4HYTB 4IFMA 2KSJA 2WPRA 3WMM0 1HWTC 2WWWA 2Z5IA 1OWAA 3RL0C 3HD7D 1PFIA 1JY2O 1JY2N 2I1KA 1KQLA 4JYCA 1SQQK 1FJKA 1KZUB 3CI9A 1EQ7A 1LTIC 1NH4A 1E5WA 2IX7C 3UIAA 1J2JB 1FDMA 2C9NY 1WT6A 2WZ7A 2POHA 2YNYA 3L35A 1IK9A 1WRGA 5AW1B 1KILC 4C7NA 1SQXK 4WY4A 1MV8A 1SQBK 1GZLA 3B8EB 2P7JA 1S9KD 1J1DB 3NFQA 2FYZA 4C46A 1MFZA 1OXZA 1J1EC 1NHLA 2HODA 3TNUA 2PP6A 4DOJA 4LGDE 2O01H 1L0NK 4I6MC 5KJ7D 4C7NB 4N78E 4JF7A 2NPSA 1KFNA 2HFED 2HLOA 4WY4B 2E43A 1IFJA 1GL2D 1N7SC 1FZAA 1JY2P 3I5CA 3V2PA 2WSFH 3LW5H 5AW8B 2Q9IA 2HYNA 3BRVB 2CPBA 2HODB 3TNUB 1GL2C 3MUDA 1Z56A 3N4XA 4LLHA 2OYHC 4KHXA 2R3CA 3KYQA 1HBWA 3NTNA 1RE4C 1FOSE 1FZBA 3HRNA 2N1TC 4AQRD 3SWYA 3P8MC 1DH3A 1SQPK 1SFCD 5APSA 1JNMA 1H89A 4HH2A 5CJ0A 1G1IA 1LTJB 1JO5A 3VP8A 1SFCC 2OARA 3R2PA 1LWUA 1M1JC 1RE3C 5CCGC 3H6PA 5KLVK 5CJ4A 3KQGA 2P67A 2FKWB 1GD2E 1GTWA 3RL0B 1KILA 4EOTA 4N6JA 1NTKK 2FFDC 3RK3B 1RF0C 1NAFA 2N9BA 3MD0A 5CCHD 1URQD 5AVSB 1NTZK 4IFDK 1LWUB 1H8AA 2JJLA 3V4WA 1YTZT 5AVQB 3E1IA 2OYIC 3VYIA 1LT9C 3B5NC 1KILB 3TSIA 1GU5A 1L4AD 1HTLC 1N7SA 2P1JA 3G3ZA 1MUUA 5APQA 3CLQA 1CI6A 2WSEH 4ZKPA 3RK2D 1FAVA 2H43A 1ZR4A 1GL2A 1KFMA 5CHXA 2MJZA 3HD7C 2OYHA 1G2CA 1HGVA 2C0WA 2O1KA 1ZR2A 1N7SB 5KTBA 2IFMA 1RE4A 5APXA 3VMXA 3P8CD 1HH0A 1VPCA 3L4FA 2N1TA 3M0DC 1DEBA 1LTSC 2Z4EA 1LTTC 1X9VA 2M8RA 1GL2B 1NU1K 3A3YB 1X79B 4WB4A 2OYHB 2CPSA 2R5BA 2M3BA 1JOCA 2XNXA 2WITA 3VTPC 1N73C 1ZN5A 1MZ9A 4DZOA 2W6BA 3HE4A 4M3LA 2N1TB 3EFGA 2Q5UA 1SFCA 2Q7CA 2WSCH 3GHGC 2HPCA 5KJ7C 1G1JA 1AQ5A 1M1JA 1GW4A 1RE3A 5CCGA 1T2KD 1CSBA 1JY3O 2KP8A 3U1CA 2NPSB 2FFDA 5APYA 1RF0A 5AW3B 3VOPA 1NWQA 1FJPA 1XTGB 3M9BA 2YKQA 5AW4B 3M9QA 3NXSA 5APWA 2HPCB 2FXMA 3L36A 2J58A 2ZXEB 3IFMA 1M1JB 4IFFA 4O9BA 3V2RA 1S9KE 1FU1A 1LT9A 1ZV8A 3B5NA 1IC2A 3BVHA 3HUSC 1N2DC 4WY4D 2FFDB 1LTGC 5AVZB 5AVRB 2GUSA 1GK6A 2E42A 3N7NA 2R5DA 3LIDA 1JMMA 2WTYA 1IFNA 1QL1A 3HTKA 3V2NA 1RF1C 1LT9B 1NTMK 3B5NB 3HD7A 5BU8B 1JY3P 4W7ZA 3OAKA 1T3JA 2QM7A 3VMYA 5AW2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J58 A;  1AFO A; 
#chains in the Genus database with same CATH topology
 2Q1K A;  3P7K A;  1PP9 D;  3AE9 C;  4W7Y A;  3H1I D;  1GDT A;  1FZG A;  1FOS F;  2K9J B;  3HE5 A;  5KAI E;  4QMA A;  4N3Y B;  5KJ7 A;  2IBZ G;  2QJP C;  2UWJ E;  5KKZ C;  2L91 A;  3OJA B;  4EIJ A;  1BE3 G;  1L4A C;  5AVT B;  1DEE G;  3ABV C;  3HE5 B;  2KB7 P;  3II6 A;  1Q81 Q;  3U1A A;  2YXR B;  1CW5 A;  2I1J A;  1AV1 A;  3AEE C;  2V7Q H;  3AE2 C;  1LWU C;  3TK1 A;  1LNQ A;  1XTC C;  4B86 A;  2YKP A;  3KHU A;  4W80 A;  4HJG H;  1Q90 D;  5TIS E;  1VDF A;  2FYU K;  1RF1 A;  4IL6 H;  2FYU E;  2E5Y A;  3VMA A;  3CWB D;  1N7S D;  1JY3 N;  3Q1M A;  2B9B A;  5B5E H;  3H1K E;  3KZI E;  2G3A A;  3D70 A;  1RH5 B;  1GW3 A;  1RF1 B;  1R8E A;  5GTH H;  1QEX A;  2FYN C;  1FDI A;  2VRS A;  1SP4 A;  2WMM A;  1SQQ G;  3KDP B;  2N1T D;  3H1J G;  2JEE A;  2IPP A;  2JR8 A;  1VQO P;  2ITA A;  4GKG A;  5C39 A;  1QGK B;  1X8Y A;  1L0L K;  1L4A A;  1L0L E;  5BU5 A;  1SQX G;  2J59 M;  2KOG A;  3VMZ A;  3RGU A;  1CZQ A;  4OGQ D;  1DX7 A;  1PGQ A;  4UB6 E;  1JMB A;  2QJP B;  5KKZ B;  1N7L A;  1L4A B;  1L0N G;  4BXL A;  4OGQ C;  1M56 D;  4PD4 E;  3CX5 D;  2D2C C;  4GIF A;  3MUD C;  2WPQ A;  1RY3 A;  1NU1 J;  4RKU J;  1KOR A;  4JQ0 D;  5AW5 B;  3C9I A;  4NPD A;  3B5N D;  3L70 E;  1NU1 D;  2KLU A;  2WPR A;  3WMM 0;  2Z5I A;  2KXP B;  2Y0D A;  3H1H G;  3RL0 C;  3QWO C;  2I1K A;  2WSF J;  2WSC J;  3OW2 O;  2G8Y A;  3RBZ A;  4NPF X;  2Y9Y A;  1EQ7 A;  1LTI C;  2W90 A;  1BCC J;  4Z1M H;  2WVR A;  1PZQ A;  3TGU J;  1H0T A;  1KIL C;  3H1L E;  3L75 G;  3D6Y A;  1SQB K;  5KLV G;  1GZL A;  1UII A;  1BCC D;  2FYN B;  2Q6Q A;  2P7J A;  3TGU D;  1MFZ A;  3V6I A;  3TNU A;  4I6M C;  1H0T B;  4N78 E;  4JF7 A;  4IL6 E;  1VQ4 P;  2E43 A;  1IFJ A;  2YIU C;  3L72 E;  5AW8 B;  3BRV B;  3JSV C;  4IOI H;  3TNU B;  3MUD A;  1YBK A;  2K37 A;  3KYQ A;  2FXP A;  1HBW A;  3NTN A;  1NJI Q;  1TU3 F;  5K5G B;  4TLF A;  1FOS E;  3MP7 B;  3HRN A;  2D2C B;  1BSN A;  4UB8 E;  1U7M A;  3SWY A;  3P8M C;  2M5A A;  1Y47 A;  1EXI A;  1ZME C;  5B66 E;  2O01 N;  4HH2 A;  1MKM A;  4YTP C;  1LTJ B;  3R4Y A;  3VP8 A;  2KNC A;  1M1J C;  2M5A B;  1Q86 Q;  5CJ4 A;  3KQG A;  1X0T A;  2P67 A;  2FKW B;  3RL0 B;  1KIL A;  4EOT A;  4N6J A;  1QLE D;  1RF0 C;  1NAF A;  2K88 A;  2KZJ A;  3F89 A;  1NTZ K;  2KNC B;  2JJL A;  5E79 E;  2FYU J;  1VL2 A;  2HR3 A;  3VYI A;  2GA1 A;  1KIL B;  2AXC A;  1JEK A;  3WUV A;  1UIX A;  1PIX A;  3PH0 A;  3H1K J;  3CX5 H;  2FYU D;  3AE1 C;  4ZKP A;  3L73 E;  1ZR4 A;  3EFF K;  2R3S A;  2MJZ A;  3HD7 C;  1G2C A;  3H1K D;  3IAO A;  5KTB A;  2YIU B;  5APX A;  1NTM G;  1HH0 A;  4DCK A;  3M0D C;  1LTS C;  5M1B A;  1LTT C;  3G9R A;  3A3Y B;  1VF5 D;  3CCS P;  1L0L J;  2XNX A;  1ZOY C;  1N73 C;  1ZN5 A;  3HE4 A;  1VF5 C;  4M3L A;  5H2F E;  1YI2 P;  1FDO A;  3EFG A;  2Q5U A;  4A7P A;  2WSC H;  1L0L D;  1IK7 A;  1G1J A;  1M1J A;  1CSB A;  1YJW P;  2KP8 A;  2NPS B;  1RF0 A;  1FJP A;  1S5L H;  1RQU A;  3M9B A;  3JC2 2;  5AW4 B;  3M9Q A;  5APW A;  1LP1 A;  2J58 A;  4PD4 D;  3IFM A;  1M1J B;  4PV1 C;  3V2R A;  2E76 D;  3L70 J;  3CC7 P;  1ZV8 A;  2AEM A;  1IC2 A;  4IL6 X;  3HUS C;  1N2D C;  1EZV G;  1LTG C;  3GF3 A;  1BGY E;  3CD6 P;  3LID A;  1KTM A;  1LP1 B;  3L70 D;  3HD7 A;  2E75 D;  1Y8A A;  4BRY A;  2B87 A;  5KAI H;  1LTB C;  3M0D A;  3AE6 C;  3H1L J;  3HD7 B;  1QVG O;  3AE3 C;  2B87 B;  5APU A;  1N73 A;  1SS1 A;  1FZC C;  3H1L D;  3BAS A;  1EC5 A;  3RL0 g;  1IZN B;  2K1A A;  3S4R A;  2QM8 A;  3L72 J;  3VN0 A;  1N73 B;  1IFI A;  4N78 D;  3RK2 C;  1NOH A;  1VF5 B;  1S3J A;  1SLQ A;  1SVF A;  1T3U A;  1CI6 B;  3L72 D;  5CBO A;  1W2E A;  4H13 D;  4I1L A;  3FXD A;  4YPC A;  5TIS H;  3HUS A;  1K73 Q;  1JUN A;  2ZYD A;  2NZ2 A;  1W5C E;  1IO4 A;  1NGM B;  1IFM A;  1OX3 A;  1SQV G;  4PV1 B;  3KZI H;  3HUS B;  3KPE A;  2XDJ A;  2WPS A;  3MTU E;  3D71 A;  2QEX P;  1JCD A;  2P10 A;  1W2B O;  1YTZ I;  4OWF A;  2Q3I A;  1PP9 G;  3PP5 A;  3T97 A;  2OYI A;  2A45 H;  3OA7 A;  1S5L E;  4ZNC A;  1J1D C;  3H1I G;  1FZC A;  1S4X A;  4U3F E;  1HGZ A;  3GW6 A;  3LIE A;  2Z5H A;  3G6E P;  4WY4 C;  4UB6 H;  1AVO A;  3C1L A;  3T97 B;  1AFO A;  2OYI B;  5APV A;  3L73 J;  2YO2 A;  1FZC B;  1LGH B;  1EDL A;  4PD4 H;  1SQP E;  5KAF H;  2Y9Z A;  3L73 D;  3L71 E;  2DW3 A;  4AYC A;  1ZLL A;  1M8O B;  3RK2 B;  2KYV A;  4JYB A;  1JB0 J;  1YIJ P;  5APT A;  1YJ9 P;  3CL3 D;  2BAS A;  1VQ9 P;  1N8R Q;  1BDC A;  4GOE A;  1X22 A;  1HWT C;  3PLN A;  3CWB G;  1OWA A;  1KQL A;  4JYC A;  1DD3 A;  1KZU B;  1VQ7 P;  3BCC E;  1E5W A;  2IX7 C;  3UIA A;  1KD1 Q;  1J2J B;  1WT6 A;  3L35 A;  4C7N A;  1BGY J;  4WY4 A;  1MV8 A;  1USD A;  1P84 H;  1VQ5 P;  4OVN F;  3B8E B;  3WUU A;  3MZW B;  1J1D B;  2FYZ A;  1J1E C;  3IF4 A;  2PP6 A;  1BGY D;  4LGD E;  3RK3 E;  4C7N B;  1KFN A;  2HFE D;  4WY4 B;  1N7S C;  1FZA A;  1JY2 P;  3I5C A;  3V2P A;  2Q9I A;  3SSU A;  1QVF O;  1T6A A;  3N4X A;  4LLH A;  2OYH C;  4KHX A;  4UB8 H;  3GMA A;  5B66 H;  2N1T C;  4AQR D;  1QX8 A;  1SFC D;  1NU1 G;  1KYO I;  2FY8 A;  1JNM A;  3SFD C;  5CJ0 A;  1G1I A;  1JO5 A;  1S5L X;  1SFC C;  2OAR A;  3R2P A;  1LWU A;  2R44 A;  5KAF E;  3CME P;  1GTW A;  5E79 H;  1NTK K;  2FFD C;  3QH9 A;  1NTK E;  3Q5S A;  5CCH D;  1URQ D;  2A06 E;  4IFD K;  4DT0 A;  1LWU B;  2KUB A;  5AVQ B;  2QG4 A;  1E79 H;  1LT9 C;  3AE4 C;  3B5N C;  1BCC G;  1GU5 A;  2LR2 A;  1N7S A;  3TGU G;  1YJN P;  2QVA A;  3G3Z A;  1MUU A;  1R5S A;  2WSE H;  2H43 A;  2KI7 B;  3CCR P;  2OYH A;  3PRJ A;  2KK7 A;  3AEB C;  1N7S B;  3RBX A;  4U3F J;  1OMI A;  3L4F A;  3Q5P A;  2N1T A;  1X9V A;  3AE7 C;  5H2F H;  3E7K A;  2W6J H;  2OYH B;  4H44 D;  1JOC A;  4U3F D;  1MZ9 A;  1P84 E;  1SQP J;  2N1T B;  1SFC A;  2Q7C A;  2ZYA A;  3L71 J;  1T2K D;  3IN6 A;  1SQP D;  2FFD A;  5APY A;  1NWQ A;  5KLV J;  2FBW C;  1XTG B;  3A0H H;  1EZV I;  1OVV A;  3L71 D;  4OGQ B;  2B89 A;  2JP3 A;  2FXM A;  4K3A A;  1S9K E;  3S1K A;  1LT9 A;  3B5N A;  3BVH A;  2FFD B;  5AVZ B;  5AVR B;  2OTK E;  2R5D A;  2BEQ D;  2LXC B;  1NAY A;  1LT9 B;  3B5N B;  1JY3 P;  3FWL A;  2FYU G;  3BCC J;  3FWN A;  2KIK A;  4WVZ A;  2W6A A;  2H8P D;  1IFD A;  1KB9 H;  3H1K G;  3AED C;  3BCC D;  5AVV B;  1VQN P;  2QJK C;  3H32 A;  1QL2 A;  5GTI E;  3MIW A;  4GOD A;  2I8D A;  1KC8 Q;  4Y99 C;  3L74 E;  4ASV A;  4D6T E;  3M91 A;  2CK3 H;  2ZFC A;  3BRT B;  3H32 B;  5CMZ A;  1M7L A;  1S2E A;  4Y28 J;  2A45 G;  1ZXG A;  3RK3 D;  1EDJ A;  1L0L G;  3VP9 A;  2BCC E;  3B71 A;  3RK3 C;  3CXH H;  5AW0 B;  1PPJ E;  2KLV A;  4I7Z C;  1G2C B;  1M90 Q;  3O8Z A;  4XA4 A;  4YXD C;  3M0A A;  1A02 F;  2ZT9 D;  1S72 P;  3TYY A;  5AVU B;  4RO0 A;  3BAT A;  3SWF A;  4XE5 B;  3A5T A;  3L70 G;  1VQM P;  2H7H A;  1Q82 Q;  2JO1 A;  1NTM J;  1N86 A;  3HE4 B;  1K8A Q;  4PJ0 H;  1HJB A;  3P8C E;  4C7R A;  1NTK J;  4R4M A;  1VQL P;  1Q7Y Q;  1FZE A;  1LTA C;  5AVY B;  1FZF A;  3V5B A;  3A0H E;  4EDF A;  2IBZ E;  1NTK D;  1PL5 A;  2E76 C;  4BWN A;  1BE3 E;  2A06 D;  2JKV A;  2QJK B;  4GOF A;  3P32 A;  2XKM A;  4Y99 B;  4LC1 A;  1BSH A;  1NKN A;  1SQB G;  2OQQ A;  2P2U A;  2IFN A;  2W27 A;  1MFT A;  4H0L D;  5CCG D;  4KJM A;  1OW8 A;  3CMA P;  2E75 C;  1KQS O;  1GU4 A;  1K04 A;  2HG5 D;  2GUV A;  2OGU A;  3L72 G;  4BRY B;  3W68 A;  3MGN A;  1KB9 E;  2LKM A;  2XU6 A;  4ASW A;  2PAJ A;  2K9Y A;  3C8V A;  2YO3 A;  1OVU A;  1PGP A;  3USS A;  3AEA C;  4I7Z B;  2PRR A;  2E74 D;  1T8Z A;  3CC4 P;  3M9H A;  1YHQ P;  4R4L A;  4HYT B;  1EXJ A;  1P84 D;  2AEJ A;  2E74 C;  5DJT B;  1JY2 N;  1SQQ K;  1FJK A;  1U7J A;  3AEC C;  1SQQ E;  2RMZ A;  3H1J E;  2IZ1 A;  2PFX A;  4H13 C;  1FDM A;  2WZ7 A;  3CXH E;  2POH A;  2YNY A;  1IK9 A;  2PGD A;  1OIP A;  5AW1 B;  1SQX K;  1SQX E;  5EFW B;  3AEF C;  1EDK A;  1S9K D;  3MHV A;  2KSE A;  3NFQ A;  4C46 A;  1NHL A;  3PTZ A;  2HOD A;  4DOJ A;  2O01 H;  1L0N K;  4ZMD A;  2E76 B;  1NTZ G;  5KJ7 D;  2ZVO B;  1L0N E;  1PGJ A;  3A0B H;  1KMI Z;  1OZH A;  1AQT A;  4EYY Q;  3CX5 I;  2HYN A;  3JCU E;  2LXB A;  1KIL E;  2CPB A;  2HOD B;  3SWK A;  1Z56 A;  4PJ0 E;  3AEG C;  3L73 G;  4EI2 A;  2E75 B;  3L74 J;  1RE4 C;  1FZB A;  4D6T J;  4JBZ A;  2Y0E A;  2W8Z A;  3H1H E;  3L74 D;  5CBN A;  1DH3 A;  2QSI A;  1FC2 C;  1SQP K;  1WMK A;  3F5H A;  2W83 C;  1KN7 A;  4D6T D;  2WSE J;  2MKV A;  2BCC J;  3PJS K;  1RE3 C;  5KLV K;  3S9O A;  2B88 A;  1ZRT E;  1GD2 E;  4GDO A;  3L75 E;  5KLV E;  2BCC D;  3MD0 A;  1D7M A;  1PPJ D;  5AVS B;  4H13 B;  1YTZ T;  2ZXX A;  3AE5 C;  3E1I A;  2P58 A;  1L4A D;  2IDB A;  3Q3D A;  5APQ A;  2YXQ B;  1BGY G;  1FAV A;  1OVR A;  1OW6 A;  1KFM A;  3O6Q A;  5CHX A;  4XFJ A;  2OTL P;  2C0W A;  3CCJ P;  2O1K A;  1ZR2 A;  2AXT H;  2IFM A;  1RE4 A;  3VMX A;  3P8C D;  2JWA A;  1VPC A;  1AA0 A;  1BE3 J;  1DEB A;  3W67 A;  2M8R A;  3O6Q B;  1PGO A;  1DIP A;  2IBZ D;  3CWB J;  2QRX A;  2WIT A;  3CCU P;  3VTP C;  4CPG A;  1BE3 D;  4DZO A;  2W6B A;  1KYO E;  3GHG C;  2HPC A;  1AQ5 A;  1RE3 A;  3PHL A;  3A0B E;  2YKQ A;  2YMK A;  5KLI C;  3NXS A;  2HPC B;  3L36 A;  2ZXE B;  4WWI A;  1DD4 A;  4IFF A;  2FXO A;  1FU1 A;  1KB9 D;  1K9M Q;  1VQP P;  4YXW H;  3N7N A;  1LJ2 A;  4TT3 H;  2WTY A;  1IFN A;  3V2N A;  3HTK A;  5L8R J;  1NTM K;  5BU8 B;  3WU2 H;  1SQQ J;  1NTM E;  3OAK A;  3H1J J;  1T3J A;  3VMY A;  5GTI H;  4MN4 C;  2IYP A;  2K3R A;  3K5B A;  2D2C D;  4GT1 A;  4K35 A;  2NRG A;  2XV5 A;  3HTK B;  1SQQ D;  3H1J D;  1SQX J;  2C0X A;  1OW7 A;  2IYO A;  5CCH C;  3CXH D;  1URQ C;  5BVZ A;  1JTH A;  2A45 I;  2GM4 A;  2SPZ A;  3CCL P;  1SQX D;  1L0N J;  3U59 A;  3GHG A;  4U3F G;  1Q2N A;  2YMY A;  3IR9 A;  1J1E B;  1LTJ C;  5AW6 B;  3RL0 D;  1AVY A;  2WQY C;  3GLM A;  1JTH B;  1L0N D;  3EQ2 A;  1OFC X;  1YQ4 C;  2IZ0 A;  3KXD A;  2C9L Y;  3NMD A;  3GHG B;  4PD4 I;  2XZR A;  3LW5 J;  1NKZ B;  1HUC A;  1SQP G;  2H89 C;  1EZV E;  4AUW A;  5AW7 B;  1FE6 A;  1KIL D;  2ZJS E;  2AXT E;  2Q3E A;  3Q5R A;  3L71 G;  1JCC A;  3SFE C;  2YKO A;  3H1H J;  1HJ0 A;  4RES B;  5KLI B;  3L37 A;  2KZI A;  4H44 C;  1SQB E;  1IJD B;  2WT7 A;  3H25 A;  1FBM A;  3H1H D;  2BEZ F;  1VQ8 P;  2R32 A;  3L75 J;  2N9Y B;  2AEF A;  1T2K C;  1M57 D;  1SFC B;  2WT7 B;  5B5E E;  1GK4 A;  2QIW A;  1H88 A;  1ZRT D;  5CCH A;  3L75 D;  5KLV D;  1URQ A;  4L75 A;  1A02 J;  2RKL A;  3BCC G;  5GTH E;  3TF5 A;  4I2L C;  2JDI H;  3CC2 P;  1LTJ A;  2NPS D;  1URQ B;  1P84 I;  4WBA A;  1PV3 A;  1M1K Q;  2L5G B;  1NO4 A;  3A7O A;  2ZAE B;  2NPS C;  4ZKU A;  3E1R A;  5DJU B;  3V4Q A;  3WU2 E;  1GMJ A;  2QJY C;  3M06 A;  1RHZ B;  3AE8 C;  1VQ6 P;  5AW9 B;  1SQV K;  1SQV E;  3CCE P;  3G4S P;  1HVV A;  3A2A A;  4DJG A;  1KQG B;  3ITK A;  3CCV P;  1R5L A;  2KS1 A;  3V2Q A;  5AVX B;  4OH8 B;  1YYC A;  1NTZ E;  1YQ3 C;  2O1J A;  5AVW B;  3D6Z A;  2O01 J;  1L2P A;  3CCM P;  4IFM A;  2KSJ A;  2KS1 B;  2WWW A;  4H44 B;  1EDI A;  1PP9 E;  3HD7 D;  1PFI A;  1JY2 O;  1KYO D;  2RN0 A;  1AJY A;  3H1I E;  3CI9 A;  2E5T A;  1NH4 A;  4U7J A;  2C9N Y;  1WRG A;  3ZDM A;  1BDD A;  5TJH A;  1ZW0 A;  1NTK G;  1OXZ A;  2A06 G;  2ZT9 C;  3JCU H;  4L76 A;  2Y0C A;  2NPS A;  2HLO A;  1GL2 D;  2WSF H;  3LW5 H;  3GF7 A;  2XND H;  4RJT A;  2QA4 P;  1NTM D;  1GL2 C;  2R3C A;  3CPW O;  4PV1 D;  3GG2 A;  2QJY B;  2H88 C;  4HB1 A;  4JPZ B;  1KQF B;  3H1L G;  3CWB E;  4L73 A;  2OTJ P;  1LT1 A;  5APS A;  1H89 A;  1NVO A;  1K05 A;  3Q2Y A;  2M3E A;  3G71 P;  1IFP A;  4H0L C;  5CCG C;  3H6P A;  1Y9B A;  1VQK P;  2ZVN B;  3RK3 B;  2N9B A;  1JM0 A;  1EZV D;  2V7Q J;  1H8A A;  1SQB J;  3V4W A;  2QE7 H;  2IBZ I;  2OYI C;  3I55 P;  1USE A;  3TSI A;  1S1C X;  1HTL C;  2P1J A;  1SQB D;  3CLQ A;  1CI6 A;  3RK2 D;  1GL2 A;  2ZT9 B;  3CX5 E;  1HGV A;  1KV4 A;  3EWK A;  1ZP0 C;  2Z4E A;  2V4H A;  1GL2 B;  3I56 P;  1NU1 K;  1KB9 I;  1X79 B;  4WB4 A;  2CPS A;  2R5B A;  1NU1 E;  2M3B A;  1KYO H;  4HKZ H;  2O3J A;  1HF9 A;  2RH0 A;  2WSS H;  3L74 G;  1YIT P;  5KJ7 C;  2J5U A;  1GW4 A;  5CCG A;  4D6T G;  1JY3 O;  3U1C A;  3B4S A;  1SQV J;  5AW3 B;  3VOP A;  2M0B A;  2WPV B;  2ZYG A;  3FXE A;  1RQV A;  4H0L B;  4KT0 J;  1BCC E;  2BCC G;  4O9B A;  3TDK A;  1FS0 E;  1SQV D;  3CXH I;  3WUT A;  1NTZ J;  3TGU E;  4WY4 D;  1NYH A;  1PPJ G;  2GUS A;  1GK6 A;  4NPE A;  2E42 A;  1U57 A;  1JMM A;  2OYO A;  4L74 A;  3FGA D;  3FX0 A;  1PP9 J;  1NTZ D;  1QL1 A;  1RF1 C;  2JWD A;  3H1I J;  4W7Z A;  2E74 B;  3CCQ P;  2QM7 A;  5AW2 B;  2K9J A; 
#chains in the Genus database with same CATH homology
 3P7K A;  2W6A A;  2H8P D;  4GT1 A;  1IFD A;  1LTB C;  2XV5 A;  3M0D A;  3HTK B;  4W7Y A;  3HD7 B;  5AVV B;  2C0X A;  3H32 A;  1QL2 A;  1GDT A;  3MIW A;  1FZG A;  1FOS F;  3HE5 A;  5CCH C;  5APU A;  1N73 A;  1URQ C;  4Y99 C;  5BVZ A;  1JTH A;  2A45 I;  2GM4 A;  1FZC C;  3BAS A;  3U59 A;  3GHG A;  4N3Y B;  3M91 A;  5KJ7 A;  2ZFC A;  2QM8 A;  3BRT B;  3OJA B;  2YMY A;  3IR9 A;  3H32 B;  1J1E B;  5CMZ A;  4EIJ A;  1M7L A;  3VN0 A;  1LTJ C;  1L4A C;  5AW6 B;  3RL0 D;  5AVT B;  3HE5 B;  2A45 G;  2KB7 P;  3RK3 D;  1N73 B;  1IFI A;  1JTH B;  3II6 A;  4N78 D;  3EQ2 A;  3RK2 C;  1NOH A;  3VP9 A;  1SLQ A;  1SVF A;  3U1A A;  1T3U A;  2C9L Y;  3NMD A;  1CI6 B;  3GHG B;  2XZR A;  3RK3 C;  1NKZ B;  1W2E A;  1HUC A;  4I1L A;  5AW0 B;  1CW5 A;  2I1J A;  4AUW A;  5AW7 B;  2KLV A;  1KIL D;  1G2C B;  3HUS A;  1JUN A;  1LWU C;  3TK1 A;  1XTC C;  1JCC A;  4B86 A;  1IO4 A;  3O8Z A;  2YKP A;  2YKO A;  4RES B;  3L37 A;  4XA4 A;  1IFM A;  4W80 A;  3M0A A;  1A02 F;  1VDF A;  2FYU K;  1RF1 A;  3TYY A;  5AVU B;  1IJD B;  3HUS B;  3BAT A;  2WT7 A;  3KPE A;  2XDJ A;  1N7S D;  1FBM A;  3SWF A;  1JY3 N;  4XE5 B;  2WPS A;  3MTU E;  3A5T A;  2H7H A;  1N86 A;  2R32 A;  3HE4 B;  1JCD A;  1HJB A;  1T2K C;  1GW3 A;  1RF1 B;  1SFC B;  3P8C E;  4C7R A;  1YTZ I;  2WT7 B;  1FZE A;  2Q3I A;  1LTA C;  3PP5 A;  3T97 A;  1GK4 A;  5AVY B;  1H88 A;  1FZF A;  2A45 H;  3V5B A;  2OYI A;  5CCH A;  2VRS A;  1URQ A;  3OA7 A;  1J1D C;  1SP4 A;  1FZC A;  1A02 J;  3KDP B;  2N1T D;  1HGZ A;  2JEE A;  2IPP A;  3LIE A;  4GKG A;  2Z5H A;  4I2L C;  1X8Y A;  4WY4 C;  3P32 A;  1L0L K;  1LTJ A;  1L4A A;  1AFO A;  2OYI B;  5APV A;  5BU5 A;  2XKM A;  2NPS D;  1URQ B;  4Y99 B;  2J59 M;  2KOG A;  4LC1 A;  4WBA A;  2YO2 A;  1NKN A;  1FZC B;  1LGH B;  3VMZ A;  2P2U A;  1CZQ A;  2L5G B;  1DX7 A;  1NO4 A;  3A7O A;  2IFN A;  2W27 A;  2NPS C;  4ZKU A;  5CCG D;  1N7L A;  3V4Q A;  1L4A B;  3M06 A;  1GU4 A;  5AW9 B;  2HG5 D;  1SQV K;  2GUV A;  4AYC A;  1ZLL A;  4GIF A;  3RK2 B;  2WPQ A;  1RY3 A;  3MGN A;  1HVV A;  3A2A A;  2LKM A;  2KYV A;  2XU6 A;  2PAJ A;  2YO3 A;  5AW5 B;  3C9I A;  4JYB A;  3B5N D;  3V2Q A;  5AVX B;  4OH8 B;  1YYC A;  5APT A;  1T8Z A;  3M9H A;  3CL3 D;  2BAS A;  2O1J A;  5AVW B;  4HYT B;  4IFM A;  2KSJ A;  2WPR A;  3WMM 0;  1HWT C;  2WWW A;  2Z5I A;  1OWA A;  3RL0 C;  3HD7 D;  1PFI A;  1JY2 O;  1JY2 N;  2I1K A;  1KQL A;  4JYC A;  1SQQ K;  1FJK A;  1KZU B;  3CI9 A;  1EQ7 A;  1LTI C;  1NH4 A;  1E5W A;  2IX7 C;  3UIA A;  1J2J B;  1FDM A;  2C9N Y;  1WT6 A;  2WZ7 A;  2POH A;  2YNY A;  3L35 A;  1IK9 A;  1WRG A;  5AW1 B;  1KIL C;  4C7N A;  1SQX K;  4WY4 A;  1MV8 A;  1SQB K;  1GZL A;  3B8E B;  2P7J A;  1S9K D;  1J1D B;  3NFQ A;  2FYZ A;  4C46 A;  1MFZ A;  1OXZ A;  1J1E C;  1NHL A;  2HOD A;  3TNU A;  2PP6 A;  4DOJ A;  4LGD E;  2O01 H;  1L0N K;  4I6M C;  5KJ7 D;  4C7N B;  4N78 E;  4JF7 A;  2NPS A;  1KFN A;  2HFE D;  2HLO A;  4WY4 B;  2E43 A;  1IFJ A;  1GL2 D;  1N7S C;  1FZA A;  1JY2 P;  3I5C A;  3V2P A;  2WSF H;  3LW5 H;  5AW8 B;  2Q9I A;  2HYN A;  3BRV B;  2CPB A;  2HOD B;  3TNU B;  1GL2 C;  3MUD A;  1Z56 A;  3N4X A;  4LLH A;  2OYH C;  4KHX A;  2R3C A;  3KYQ A;  1HBW A;  3NTN A;  1RE4 C;  1FOS E;  1FZB A;  3HRN A;  2N1T C;  4AQR D;  3SWY A;  3P8M C;  1DH3 A;  1SQP K;  1SFC D;  5APS A;  1JNM A;  1H89 A;  4HH2 A;  5CJ0 A;  1G1I A;  1LTJ B;  1JO5 A;  3VP8 A;  1SFC C;  2OAR A;  3R2P A;  1LWU A;  1M1J C;  1RE3 C;  5CCG C;  3H6P A;  5KLV K;  5CJ4 A;  3KQG A;  2P67 A;  2FKW B;  1GD2 E;  1GTW A;  3RL0 B;  1KIL A;  4EOT A;  4N6J A;  1NTK K;  2FFD C;  3RK3 B;  1RF0 C;  1NAF A;  2N9B A;  3MD0 A;  5CCH D;  1URQ D;  5AVS B;  1NTZ K;  4IFD K;  1LWU B;  1H8A A;  2JJL A;  3V4W A;  1YTZ T;  5AVQ B;  3E1I A;  2OYI C;  3VYI A;  1LT9 C;  3B5N C;  1KIL B;  3TSI A;  1GU5 A;  1L4A D;  1HTL C;  1N7S A;  2P1J A;  3G3Z A;  1MUU A;  5APQ A;  3CLQ A;  1CI6 A;  2WSE H;  4ZKP A;  3RK2 D;  1FAV A;  2H43 A;  1ZR4 A;  1GL2 A;  1KFM A;  5CHX A;  2MJZ A;  3HD7 C;  2OYH A;  1G2C A;  1HGV A;  2C0W A;  2O1K A;  1ZR2 A;  1N7S B;  5KTB A;  2IFM A;  1RE4 A;  5APX A;  3VMX A;  3P8C D;  1HH0 A;  1VPC A;  3L4F A;  2N1T A;  3M0D C;  1DEB A;  1LTS C;  2Z4E A;  1LTT C;  1X9V A;  2M8R A;  1GL2 B;  1NU1 K;  3A3Y B;  1X79 B;  4WB4 A;  2OYH B;  2CPS A;  2R5B A;  2M3B A;  1JOC A;  2XNX A;  2WIT A;  3VTP C;  1N73 C;  1ZN5 A;  1MZ9 A;  4DZO A;  2W6B A;  3HE4 A;  4M3L A;  2N1T B;  3EFG A;  2Q5U A;  1SFC A;  2Q7C A;  2WSC H;  3GHG C;  2HPC A;  5KJ7 C;  1G1J A;  1AQ5 A;  1M1J A;  1GW4 A;  1RE3 A;  5CCG A;  1T2K D;  1CSB A;  1JY3 O;  2KP8 A;  3U1C A;  2NPS B;  2FFD A;  5APY A;  1RF0 A;  5AW3 B;  3VOP A;  1NWQ A;  1FJP A;  1XTG B;  3M9B A;  2YKQ A;  5AW4 B;  3M9Q A;  3NXS A;  5APW A;  2HPC B;  2FXM A;  3L36 A;  2J58 A;  2ZXE B;  3IFM A;  1M1J B;  4IFF A;  4O9B A;  3V2R A;  1S9K E;  1FU1 A;  1LT9 A;  1ZV8 A;  3B5N A;  1IC2 A;  3BVH A;  3HUS C;  1N2D C;  4WY4 D;  2FFD B;  1LTG C;  5AVZ B;  5AVR B;  2GUS A;  1GK6 A;  2E42 A;  3N7N A;  2R5D A;  3LID A;  1JMM A;  2WTY A;  1IFN A;  1QL1 A;  3HTK A;  3V2N A;  1RF1 C;  1LT9 B;  1NTM K;  3B5N B;  3HD7 A;  5BU8 B;  1JY3 P;  4W7Z A;  3OAK A;  1T3J A;  2QM7 A;  3VMY A;  5AW2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...