1AFOA

Dimeric transmembrane domain of human glycophorin a, nmr, 20 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
40
structure length
40
Chain Sequence
VQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLYCOPHORIN A
publication title A transmembrane helix dimer: structure and implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Integral membrane protein
total genus 12
structure length 40
sequence length 40
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.70 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1afoA00
1AFOA 2J58A
chains in the Genus database with same CATH superfamily
2PAJA 1URQB 2G3AA 1SS1A 2J5UA 1JB0J 3RK2D 2YIUB 3MTUE 2ITAA 3TNUA 1QEXA 3B5NB 3L71D 1LTJA 5AW7B 2KUBA 1DD3A 3W67A 2HPCB 4WY4A 3NXSA 3RL0g 3CX5H 2O3JA 3C1LA 1Q86Q 1USDA 1IFIA 2IBZI 1K04A 1JO5A 1LWUA 5GTIE 2YMKA 4D6TJ 1KILA 1KB9I 1ZR2A 1FZGA 2IZ1A 2QM8A 1K8AQ 3H1KE 2R3SA 2KNCB 5M1BA 5AW9B 2K9YA 1H88A 1HGZA 2E76B 1BGYG 5H2FE 1JY2O 5L8RJ 4I7ZB 3A7OA 1VQ6P 2LXBA 1RF1C 3WUTA 2ZXEB 1LGHB 1SQPG 4CPGA 1L4AA 3N4XA 4GOEA 2OYIC 1SQPK 2ZXXA 5APXA 2K9JB 3H1LJ 4Y28J 1IC2A 1NTKJ 2HR3A 1KQGB 4EI2A 2H88C 5TJHA 3RK3C 2IPPA 2Q7CA 3RK3D 2I1JA 3PP5A 5APYA 3CXHH 4L75A 2YXQB 2KB7P 4C46A 2ZAEB 1NYHA 3H1KD 4HKZH 2Z4EA 1USEA 2FYNB 3PHLA 2V7QH 3F89A 5GTHE 3V2QA 2QIWA 3AEFC 4HYTB 3TDKA 3NFQA 3CX5I 3TSIA 3AE6C 1FZEA 1EXJA 3VOPA 4R4MA 3NMDA 2MKVA 4WWIA 2PFXA 2KZIA 4RJTA 3GHGA 3VYIA 1NAFA 1VDFA 1GD2E 2P67A 3V5BA 3MZWB 3FGAD 1DEEG 2JR8A 2XV5A 1PP9D 2O01N 2ZYGA 3L72E 1K05A 2LR2A 1VL2A 1FDOA 3H6PA 1SQQE 1Y8AA 1FJKA 5KLVG 3USSA 2P58A 2E74B 1MV8A 1NAYA 5KLVK 3JCUH 3RGUA 3AECC 4RESB 1VQMP 2KP8A 4H13C 1KQSO 2IX7C 1JTHA 4C7NB 1ZW0A 4H13D 1NGMB 2Q9IA 2RMZA 4W7ZA 1FAVA 3MIWA 3O6QA 4OGQB 1HJ0A 1ZXGA 4A7PA 1NTMG 4BWNA 3EQ2A 3A0BH 2XZRA 1KV4A 1K73Q 2RN0A 4PD4D 4B86A 1EQ7A 2KS1A 2E75C 3CCRP 2OYHC 3KZIE 3L36A 2JEEA 3CCMP 3H1IE 1KORA 2ZFCA 3MD0A 3CXHI 1WRGA 2E75D 1AQ5A 3D71A 1X8YA 1HVVA 1SQQD 2NPSA 2P10A 3UIAA 4L76A 1N2DC 1A02J 1JY2N 3WMM0 1S5LX 5B5EH 2YO3A 1H0TB 1NVOA 2QE7H 2MJZA 1XTCC 1IFMA 3S1KA 3H1KJ 3KYQA 2KXPB 4IOIH 1M56D 3H1ID 4KHXA 2WITA 3HTKA 1Q81Q 3T97A 1RQUA 2ZVNB 1FDIA 2FYUD 5APUA 2N1TB 1LT9B 4JBZA 1A02F 3TGUG 1PP9J 1N7SB 3D6YA 3A5TA 5APTA 2WSEH 4IL6X 4IFMA 4UB6H 3R2PA 3V2PA 1Q7YQ 4HJGH 1YIJP 4U3FG 1LTIC 4EDFA 1GL2B 4MN4C 1GU4A 2QEXP 1KYOH 4DT0A 1EDLA 1S5LH 1CW5A 3L73E 2OTKE 4ASVA 1NTZE 1NTKG 3H1JE 4W80A 3A0HH 1M1KQ 3RBZA 1PGPA 2WPSA 1ZLLA 2FFDC 3MP7B 2ZJSE 2R3CA 3HD7C 3P32A 1YI2P 3V4QA 2KLUA 2WMMA 5CMZA 2P7JA 3M06A 3HD7D 2YNYA 3H1LE 1BE3J 1RHZB 1SQBE 1SQQJ 2IZ0A 1QVGO 3VMZA 4EOTA 1OWAA 2C9NY 3KPEA 3SSUA 3S4RA 3L71G 1AJYA 3H32A 5CBOA 1J1EC 3AE8C 3AE3C 4IL6H 2BEQD 3L73D 1SFCA 1NTZD 3BCCE 3H1JD 3HUSB 1G2CA 1HUCA 1JEKA 3WU2E 5APVA 5TISH 1SQXE 2AXTH 1RE3A 5CJ0A 2YMYA 1GK4A 1SFCB 1IFDA 3AEEC 4H0LB 3RL0B 1LP1B 2FXOA 2R5BA 1G1JA 2AEFA 2N9YB 3H1IJ 3CWBE 2BEZF 1GDTA 2R5DA 3H1LD 4YXWH 3FWLA 3PH0A 1UIIA 1SQBD 1SQVK 1KYOI 1E5WA 2FYUJ 3RK2B 1URQA 2QJKC 1MUUA 2WVRA 4UB8E 1GU5A 2M3EA 5KTBA 4H44B 1NO4A 3BCCD 1AVYA 3FXEA 2UWJE 1FE6A 2ZYDA 3U1AA 3B5NA 1RE3C 5KAIE 1FZCC 1BCCE 3BVHA 4IFDK 1SQXD 1FOSE 2IDBA 1P84E 2Q3EA 5AVTB 1JY2P 5KAFE 2HPCA 3AEDC 1EZVE 2PRRA 5AW3B 3L4FA 5E79E 3L75E 3CWBD 3G4SP 2XKMA 2KYVA 1S1CX 4JYCA 1QGKB 3IN6A 2JP3A 1VQ8P 3L70E 1RE4A 4XA4A 4LGDE 3E1IA 4ASWA 3H1KG 3MHVA 2BASA 5K5GB 3B5NC 3WUVA 1OXZA 1JY3N 4PJ0E 1JMMA 1NKNA 1OIPA 4GKGA 3B5ND 1BCCD 1KILE 3H1HE 2KNCA 2FYZA 3SWYA 2Q5UA 2IFMA 2J59M 4Y99C 1U7MA 3AE4C 1EC5A 1T6AA 3GF3A 1P84D 4AYCA 3RK3E 1LTJC 3WUUA 1EZVD 3PTZA 2JJLA 3L73J 2B89A 1PPJE 1NTZJ 3LIEA 3G71P 3L75D 2J58A 1KTMA 3H1JJ 3U59A 1RF1B 1L0ND 4WY4C 2P2UA 2HG5D 2OYIB 1RE4C 2K9JA 2AEJA 4WY4D 5AW6B 3L70D 2PP6A 4BRYB 1L0LE 1LWUC 1JNMA 3OA7A 2O1KA 4YXDC 1KILC 1SQBJ 2IFNA 1AVOA 1PP9E 2WPQA 4K35A 5KAIH 2DW3A 2O1JA 3TK1A 2E76C 1KILD 3H1HD 2Z5IA 5AW5B 3CCUP 2W6AA 5KAFH 1PFIA 2K1AA 3VP9A 1PPJD 2WZ7A 1T3JA 3BCCJ 3V2NA 4TLFA 2I8DA 2D2CB 3L72G 3II6A 1NOHA 2QSIA 4PV1B 1SQXJ 3S9OA 2JWAA 1SQQG 1L4AC 2SPZA 1L0LD 1L4AD 4PD4E 2VRSA 3EFFK 3CWBJ 1AV1A 4PJ0H 2QJPC 2IYPA 4RKUJ 5GTIH 5DJUB 3BRTB 1YBKA 3P8MC 3AE9C 1H8AA 2A45G 1BE3E 4H13B 4GIFA 4C7NA 1L2PA 4U7JA 5CCGA 3AE2C 2B9BA 3FX0A 1Q2NA 3CLQA 2W6JH 2QG4A 4NPEA 1HH0A 1NH4A 4DZOA 1M8OB 3H1IG 3VMAA 1BCCJ 1NWQA 5H2FH 3VN0A 1JM0A 1IK9A 3GHGC 1YHQP 1OW6A 2E75B 2OYHB 1NTMK 3L75J 2E74C 1GW4A 2YKOA 1L0NJ 1N73B 2W27A 1UIXA 1PIXA 2E74D 1DH3A 2HLOA 3OW2O 3Q5SA 1JUNA 2C0XA 1BE3D 3FWNA 4L73A 3L70J 5KLVE 1JMBA 4OGQC 2WTYA 3IFMA 3B8EB 2KOGA 1AFOA 5AVWB 2FYUE 1IFJA 2N9BA 3JC22 4OGQD 2WSCJ 3PLNA 4JF7A 5CCHA 1H0TA 1M7LA 1FZBA 2JKVA 1FS0E 1IK7A 5GTHH 2Z5HA 3H1HJ 4YTPC 1YTZT 2A06E 2YO2A 1FOSF 1G1IA 1GMJA 1IFPA 1NHLA 2B87B 1YQ3C 3O8ZA 3V4WA 1U57A 3K5BA 3V2RA 1JY3P 3CCLP 3E1RA 2KLVA 2W8ZA 1OZHA 2H89C 2K37A 4PD4H 3KHUA 3D6ZA 4GDOA 3AEAC 5APWA 4GODA 1VF5C 2CPBA 2N1TA 2NPSC 2QM7A 1LT9A 2OQQA 4D6TG 2QVAA 5KLVD 1J1DC 1ZR4A 1VF5D 1DEBA 1N7SA 2WSFH 5CCHC 3AEBC 3SFDC 1L0LJ 2NPSD 3MUDA 3HE5B 3P8CE 4IFFA 3SFEC 3L73G 3CMEP 5CCHD 3F5HA 4JPZB 1YTZI 1NTZG 3EWKA 2IBZE 2HODB 3CMAP 1NTZK 3H1JG 2WT7B 1GL2A 1BSNA 4O9BA 4ZMDA 5KLIC 2NZ2A 3NTNA 3Q5PA 5AW0B 1KZUB 2A06D 3VP8A 2A45H 4JYBA 1M1JB 1PGOA 2QJYB 3PJSK 5KJ7A 2GM4A 1KB9E 3L74E 1VQ4P 3CCJP 3KQGA 1EXIA 4EYYQ 1LT9C 3H1LG 1EDKA 2K3RA 2FFDB 3KZIH 1N7SC 1NTKK 1SQBG 1T8ZA 5AW2B 2CK3H 4OWFA 3SWFA 1SQBK 3HD7B 1AQTA 1JY3O 1N7SD 1PZQA 4W7YA 3P8CD 1SVFA 3VTPC 3GF7A 4ZKPA 3HE4B 1BSHA 2IBZD 2GA1A 2LKMA 3BCCG 3PRJA 3GLMA 1LJ2A 2E5TA 3A2AA 5AVVB 4DOJA 1T2KC 1SQXG 2R44A 3M9QA 1LTGC 3AE5C 2GUVA 1K9MQ 2AEMA 3HUSA 1T2KD 1KB9D 2W6BA 3L74D 2M5AB 1VQ9P 1LP1A 2KI7B 2LXCB 1E79H 1N7LA 1RF0A 1X22A 3CX5E 3LW5J 5AW4B 5AW8B 5KKZC 3A3YB 3IF4A 3JSVC 2FBWC 1NU1E 2FKWB 2A45I 3CI9A 3C8VA 2WWWA 3L37A 1BCCG 1GK6A 5KLVJ 5C39A 1VQ5P 3RBXA 3CCEP 2Q3IA 1Y9BA 1ZMEC 5BVZA 1EZVG 1OVVA 1SFCC 1Q90D 2Y0DA 3L75G 1FC2C 4H0LC 2RH0A 2OTJP 1FZCB 3I5CA 2E42A 1WT6A 3C9IA 2M3BA 1HF9A 1SFCD 3BATA 2GUSA 3BRVB 4XE5B 3I55P 3CCVP 3CX5D 3L70G 1X79B 3TYYA 1BDDA 2WPRA 2G8YA 1FU1A 1YJNP 5EFWB 2C0WA 3KXDA 1KQFB 2WPVB 2H7HA 1RQVA 1NU1D 4LC1A 2ZT9C 2JWDA 1L0NE 1OFCX 1SQVE 1H89A 4H44C 1CI6B 3H1HG 2XNXA 1HJBA 2ZT9D 3CXHE 2BCCE 3M9HA 4H44D 4LLHA 1URQC 2O01J 2YKQA 4I2LC 2PGDA 1T3UA 4GT1A 2Y0CA 1S3JA 1SP4A 2YIUC 4R4LA 1PPJG 3P7KA 1URQD 3LIDA 4Y99B 1DD4A 3TNUB 1OX3A 4Z1MH 3Q1MA 1S9KE 5AVUB 1LTJB 3WU2H 1IFNA 1RF1A 1KFMA 2V4HA 3L74J 1L0LG 2FY8A 2OYIA 4WY4B 1L0LK 1R5LA 5AVSB 3CCSP 4K3AA 1PP9G 4BRYA 3I56P 1SQVD 1QLED 1YQ4C 1VQOP 2C9LY 1LTTC 2YKPA 5CBNA 1LWUB 3CXHD 2BCCD 2KSJA 4HH2A 3JCUE 1TU3F 3TGUJ 1KILB 1JCDA 4TT3H 4UB8H 3RK3B 2Y0EA 4DJGA 2L91A 1VQLP 2B88A 1S9KD 4U3FJ 1J2JB 3Q2YA 3G6EP 3A0BE 1VPCA 5CHXA 2JDIH 3AE1C 1FDMA 1QX8A 4I7ZC 1W2EA 1P84H 2XDJA 2E76D 1R5SA 3B4SA 3VMYA 2RKLA 1M90Q 2E43A 4RO0A 5E79H 4KT0J 4YPCA 1L4AB 1BGYE 1BE3G 3CC2P 4WBAA 1PV3A 1KC8Q 4AUWA 1SQPE 1RY3A 1SQQK 1KMIZ 3CCQP 1PGQA 4DCKA 1LNQA 2QJPB 2KZJA 2W83C 3N7NA 1WMKA 1RH5B 1NU1J 5B5EE 2WSCH 4N6JA 2OARA 4L74A 1MFZA 2FYNC 3R4YA 2D2CC 2HYNA 1YYCA 3L71J 1W2BO 4PV1C 2D2CD 3ITKA 3G9RA 2W90A 4QMAA 5B66E 3CD6P 4OH8B 4PV1D 1GZLA 2NRGA 4ZNCA 1ZOYC 1HTLC 3QH9A 1BGYD 2OYHA 1GW3A 3GHGB 1HGVA 1FBMA 4ZKUA 4JQ0D 1N73A 1ZN5A 3OAKA 1SQPD 2OTLP 1DIPA 1CZQA 2FYUG 1YJWP 1OW8A 1MZ9A 2M8RA 4KJMA 5APQA 2FYUK 2OGUA 3EFGA 2H8PD 5AVXB 1JOCA 3CC4P 4BXLA 1SLQA 2IYOA 3GW6A 4UB6E 1NJIQ 1SQVJ 2QA4P 1MKMA 3TF5A 1P84I 1X9VA 1JTHB 2A06G 2BCCJ 3G3ZA 3M0AA 3AEGC 5CCGC 2FXMA 1EZVI 4WB4A 4XFJA 3M9BA 2KK7A 3QWOC 1KYOE 3O6QB 1S5LE 2V7QJ 5AVRB 5CCGD 5APSA 2KSEA 3D70A 1GTWA 2B87A 3L72D 3KDPB 3CC7P 3A0HE 1XTGB 2Y9YA 1N73C 2WQYC 1YITP 1NTME 2KS1B 2ZVOB 3E7KA 1LT1A 5BU5A 5AW1B 1VF5B 1VQNP 3MGNA 2IBZG 2NPSB 1N86A 2Q6QA 1HWTC 1J1DB 3HE5A 3GMAA 4NPDA 1ZRTE 1AA0A 2HFED 2YXRB 1VQPP 2HODA 1BDCA 1LTSC 2WT7A 4NPFX 2H43A 1KYOD 3L74G 4IL6E 3OJAB 5B66H 1EDJA 1Z56A 5KLIB 1IO4A 4HB1A 1M1JA 1ZV8A 1M57D 5TISE 1EDIA 4M3LA 2AXTE 3Q5RA 2WSSH 1NTMD 3CPWO 1S72P 3LW5H 2FFDA 3HTKB 4I1LA 3HD7A 3T97B 1BGYJ 1KFNA 1KN7A 4AQRD 3BASA 2N1TC 2XNDH 4D6TE 1ZRTD 2OYOA 3HE4A 2M0BA 1SQPJ 2N1TD 3Q3DA 3H25A 1QL1A 3MUDC 3IR9A 1N8RQ 4OVNF 1NKZB 3M0DA 1M1JC 1U7JA 2FXPA 1VQ7P 3TGUE 2QJYC 1PGJA 1GL2C 2Q1KA 3U1CA 3ABVC 3FXDA 1QVFO 3IAOA 2ZYAA 2CPSA 2R32A 1GL2D 3VMXA 1KD1Q 1JCCA 2M5AA 2JO1A 4U3FE 5KJ7C 1CSBA 1J1EB 2Y9ZA 1FZFA 1SQXK 4PD4I 2POHA 1FJPA 3B71A 4N78E 1OVRA 5KJ7D 3L72J 1HBWA 5AVZB 3L35A 1NU1G 1S4XA 3AE7C 3SWKA 1NTKE 1W5CE 3CWBG 4I6MC 1NU1K 2QRXA 2WSFJ 1S2EA 5AVYB 4EIJA 5BU8B 4D6TD 3HRNA 1OW7A 5KKZB 4WVZA 4C7RA 1D7MA 3M0DC 1VQKP 1IJDB 3ZDMA 3GG2A 2L5GB 2O01H 1Q82Q 2WSEJ 4GOFA 3TGUD 1OMIA 1FZAA 1QL2A 3H32B 3V6IA 1R8EA 1MFTA 1KQLA 1FZCA 1ZP0C 2KIKA 3HUSC 2QJKB 4U3FD 1X0TA 1G2CB 3L71E 5DJTB 1LTBC 2K88A 4N78D 1KB9H 1Y47A 2E5YA 2XU6A 3RL0C 1PL5A 1DX7A 1NTKD 1L0NG 2P1JA 1SQVG 1RF0C 1L0NK 1IZNB 2I1KA 4H0LD 3RL0D 4N3YB 1NTMJ 2BCCG 1OVUA 3W68A 1YJ9P 5AVQB 1LTAC 5CJ4A 1CI6A 2ZT9B 3CL3D 2AXCA 3RK2C 3M91A
chains in the Genus database with same CATH topology
2PAJA 3IFMA 3B8EB 2KOGA 3VMYA 1AFOA 5AVWB 2E43A 2WPSA 1URQB 1IFJA 2N9BA 1ZLLA 2FFDC 4JF7A 3RK2D 5CCHA 1L4AB 1M7LA 3MTUE 2R3CA 3HD7C 3P32A 1FZBA 3V4QA 4WBAA 5CMZA 2P7JA 3TNUA 3B5NB 2Z5HA 1LTJA 5AW7B 4AUWA 3M06A 3HD7D 2YNYA 1RY3A 1YTZT 1SQQK 2YO2A 1FOSF 1G1IA 1NHLA 3N7NA 3O8ZA 3VMZA 4EOTA 1OWAA 3V4WA 2HPCB 2C9NY 3V2RA 1JY3P 4WY4A 2KLVA 2WSCH 4N6JA 3NXSA 3KPEA 3H32A 2OARA 1MFZA 1J1EC 5APWA 2HYNA 1YYCA 1SFCA 1IFIA 2CPBA 2N1TA 2NPSC 2QM7A 1LT9A 3HUSB 1G2CA 1HUCA 1JO5A 1LWUA 1J1DC 1ZR4A 1DEBA 1N7SA 2WSFH 5CCHC 4OH8B 2NPSD 5APVA 3MUDA 3HE5B 1GZLA 3P8CE 1KILA 1RE3A 5CJ0A 2YMYA 1GK4A 4IFFA 1SFCB 1IFDA 1HTLC 5CCHD 3RL0B 1YTZI 2OYHA 2HODB 1GW3A 3GHGB 1ZR2A 1FZGA 2R5BA 1NTZK 1HGVA 2WT7B 1G1JA 1GL2A 4O9BA 1FBMA 4ZKUA 2QM8A 3NTNA 1N73A 1ZN5A 5AW0B 3OAKA 1KZUB 1GDTA 2R5DA 1CZQA 3VP8A 1MZ9A 2M8RA 2A45H 5AW9B 5APQA 4JYBA 2FYUK 1H88A 1M1JB 1HGZA 3EFGA 2H8PD 1SQVK 5AVXB 5KJ7A 2GM4A 1JOCA 1JY2O 1E5WA 1SLQA 3A7OA 3RK2B 3KQGA 1RF1C 2ZXEB 1URQA 1LGHB 1MUUA 1LT9C 1X9VA 1JTHB 1L4AA 3N4XA 1GU5A 2OYIC 1SQPK 5KTBA 3G3ZA 2FFDB 3M0AA 5CCGC 2FXMA 4WB4A 1N7SC 1NTKK 5AW2B 1T8ZA 1NO4A 5APXA 3M9BA 3SWFA 1SQBK 3HD7B 1IC2A 3U1AA 3B5NA 1RE3C 1JY3O 5AVRB 5CCGD 1FZCC 5APSA 1N7SD 3BVHA 4IFDK 3RK3C 4W7YA 3P8CD 1SVFA 3VTPC 2IPPA 1GTWA 1FOSE 5AVTB 1JY2P 3KDPB 4ZKPA 3HE4B 2Q7CA 1XTGB 2HPCA 5AW3B 3RK3D 2I1JA 2LKMA 1N73C 3PP5A 3L4FA 5APYA 2KB7P 4C46A 3A2AA 5AVVB 4DOJA 1T2KC 2Z4EA 3M9QA 2XKMA 1LTGC 2GUVA 2KYVA 5BU5A 3V2QA 5AW1B 3MGNA 4HYTB 4JYCA 3NFQA 3HUSA 1T2KD 2NPSB 1N86A 3TSIA 2W6BA 1RE4A 1HWTC 4XA4A 1J1DB 3HE5A 1FZEA 4LGDE 3E1IA 3VOPA 3NMDA 2BASA 2HFED 3B5NC 2HODA 1OXZA 3GHGA 1JY3N 1JMMA 1LTSC 1NAFA 1NKNA 3VYIA 1VDFA 2WT7A 1GD2E 1N7LA 1RF0A 2P67A 3V5BA 2H43A 4GKGA 3B5ND 3OJAB 1Z56A 2XV5A 2FYZA 5AW4B 5AW8B 2Q5UA 2IFMA 2J59M 4Y99C 3SWYA 1IO4A 1M1JA 3A3YB 1ZV8A 4AYCA 1LTJC 3H6PA 1FJKA 2JJLA 4M3LA 3LIEA 1MV8A 2FKWB 2A45I 5KLVK 3CI9A 4RESB 2J58A 2KP8A 3U59A 2WWWA 3L37A 1RF1B 2IX7C 1GK6A 1JTHA 4WY4C 3LW5H 2P2UA 2FFDA 2HG5D 2OYIB 4C7NB 1RE4C 3HTKB 2Q3IA 4I1LA 3HD7A 5BVZA 2Q9IA 4W7ZA 1FAVA 3MIWA 4WY4D 5AW6B 1KFNA 1SFCC 4AQRD 3BASA 2N1TC 1FZCB 3I5CA 2PP6A 2E42A 1WT6A 3C9IA 1LWUC 2M3BA 3EQ2A 3OA7A 1JNMA 2XZRA 3HE4A 1SFCD 3BATA 2N1TD 1QL1A 2O1KA 2GUSA 3BRVB 1KILC 4XE5B 3IR9A 4B86A 2IFNA 2WPQA 1X79B 1EQ7A 2O1JA 1NKZB 2OYHC 3M0DA 1M1JC 2JEEA 3L36A 3TK1A 3TYYA 2WPRA 1KILD 1FU1A 2Z5IA 5AW5B 2ZFCA 1GL2C 3MD0A 3U1CA 1WRGA 2W6AA 2C0WA 1AQ5A 1X8YA 1HVVA 2CPSA 1PFIA 2NPSA 2R32A 3UIAA 2H7HA 1GL2D 3VP9A 3VMXA 1JCCA 4LC1A 1N2DC 2WZ7A 1T3JA 1H89A 1CI6B 3V2NA 5KJ7C 1CSBA 1J1EB 1A02J 1FZFA 1JY2N 1SQXK 2XNXA 1HJBA 3II6A 2POHA 1NOHA 1FJPA 3M9HA 4N78E 4LLHA 3WMM0 1URQC 2YKQA 5KJ7D 4I2LC 1T3UA 1L4AC 2YO3A 4GT1A 1HBWA 5AVZB 1SP4A 3L35A 4I6MC 1NU1K 3P7KA 1URQD 5AVYB 4EIJA 2MJZA 1L4AD 1XTCC 5BU8B 3LIDA 1IFMA 4Y99B 3TNUB 2VRSA 3HRNA 1S9KE 5AVUB 1LTJB 4C7RA 3M0DC 3KYQA 1IFNA 1IJDB 3BRTB 3P8MC 2L5GB 1RF1A 1H8AA 1KFMA 2A45G 2O01H 4KHXA 1FZAA 4GIFA 2OYIA 4C7NA 2WITA 3HTKA 4WY4B 1L0LK 1QL2A 5CCGA 3T97A 5AVSB 3H32B 3CLQA 1HH0A 1KQLA 1FZCA 1NH4A 3HUSC 5APUA 4DZOA 2N1TB 2C9LY 1LT9B 1A02F 1LTTC 2YKPA 1G2CB 1LWUB 1NWQA 2KSJA 1N7SB 4HH2A 3A5TA 5APTA 1LTBC 4N78D 3VN0A 2WSEH 4IFMA 2XU6A 1KILB 3RL0C 1DX7A 1IK9A 2WTYA 3R2PA 3GHGC 3V2PA 1JCDA 2P1JA 3RK3B 2OYHB 1NTMK 1RF0C 1L0NK 2I1KA 3RL0D 1LTIC 1GW4A 1GL2B 4N3YB 2YKOA 1GU4A 1S9KD 1N73B 2W27A 1J2JB 5AVQB 1CW5A 1LTAC 5CJ4A 1DH3A 1VPCA 2HLOA 5CHXA 1CI6A 1JUNA 1FDMA 3CL3D 2C0XA 4W80A 1W2EA 2XDJA 3RK2C 3M91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AFO A;  2J58 A; 
#chains in the Genus database with same CATH topology
 2PAJ A;  1URQ B;  2G3A A;  1SS1 A;  2J5U A;  1JB0 J;  3RK2 D;  2YIU B;  3MTU E;  2ITA A;  3TNU A;  1QEX A;  3B5N B;  3L71 D;  1LTJ A;  5AW7 B;  2KUB A;  1DD3 A;  3W67 A;  2HPC B;  4WY4 A;  3NXS A;  3RL0 g;  3CX5 H;  2O3J A;  3C1L A;  1Q86 Q;  1USD A;  1IFI A;  2IBZ I;  1K04 A;  1JO5 A;  1LWU A;  5GTI E;  2YMK A;  4D6T J;  1KIL A;  1KB9 I;  1ZR2 A;  1FZG A;  2IZ1 A;  2QM8 A;  1K8A Q;  3H1K E;  2R3S A;  2KNC B;  5M1B A;  5AW9 B;  2K9Y A;  1H88 A;  1HGZ A;  2E76 B;  1BGY G;  5H2F E;  1JY2 O;  5L8R J;  4I7Z B;  3A7O A;  1VQ6 P;  2LXB A;  1RF1 C;  3WUT A;  2ZXE B;  1LGH B;  1SQP G;  4CPG A;  1L4A A;  3N4X A;  4GOE A;  2OYI C;  1SQP K;  2ZXX A;  5APX A;  2K9J B;  3H1L J;  4Y28 J;  1IC2 A;  1NTK J;  2HR3 A;  1KQG B;  4EI2 A;  2H88 C;  5TJH A;  3RK3 C;  2IPP A;  2Q7C A;  3RK3 D;  2I1J A;  3PP5 A;  5APY A;  3CXH H;  4L75 A;  2YXQ B;  2KB7 P;  4C46 A;  2ZAE B;  1NYH A;  3H1K D;  4HKZ H;  2Z4E A;  1USE A;  2FYN B;  3PHL A;  2V7Q H;  3F89 A;  5GTH E;  3V2Q A;  2QIW A;  3AEF C;  4HYT B;  3TDK A;  3NFQ A;  3CX5 I;  3TSI A;  3AE6 C;  1FZE A;  1EXJ A;  3VOP A;  4R4M A;  3NMD A;  2MKV A;  4WWI A;  2PFX A;  2KZI A;  4RJT A;  3GHG A;  3VYI A;  1NAF A;  1VDF A;  1GD2 E;  2P67 A;  3V5B A;  3MZW B;  3FGA D;  1DEE G;  2JR8 A;  2XV5 A;  1PP9 D;  2O01 N;  2ZYG A;  3L72 E;  1K05 A;  2LR2 A;  1VL2 A;  1FDO A;  3H6P A;  1SQQ E;  1Y8A A;  1FJK A;  5KLV G;  3USS A;  2P58 A;  2E74 B;  1MV8 A;  1NAY A;  5KLV K;  3JCU H;  3RGU A;  3AEC C;  4RES B;  1VQM P;  2KP8 A;  4H13 C;  1KQS O;  2IX7 C;  1JTH A;  4C7N B;  1ZW0 A;  4H13 D;  1NGM B;  2Q9I A;  2RMZ A;  4W7Z A;  1FAV A;  3MIW A;  3O6Q A;  4OGQ B;  1HJ0 A;  1ZXG A;  4A7P A;  1NTM G;  4BWN A;  3EQ2 A;  3A0B H;  2XZR A;  1KV4 A;  1K73 Q;  2RN0 A;  4PD4 D;  4B86 A;  1EQ7 A;  2KS1 A;  2E75 C;  3CCR P;  2OYH C;  3KZI E;  3L36 A;  2JEE A;  3CCM P;  3H1I E;  1KOR A;  2ZFC A;  3MD0 A;  3CXH I;  1WRG A;  2E75 D;  1AQ5 A;  3D71 A;  1X8Y A;  1HVV A;  1SQQ D;  2NPS A;  2P10 A;  3UIA A;  4L76 A;  1N2D C;  1A02 J;  1JY2 N;  3WMM 0;  1S5L X;  5B5E H;  2YO3 A;  1H0T B;  1NVO A;  2QE7 H;  2MJZ A;  1XTC C;  1IFM A;  3S1K A;  3H1K J;  3KYQ A;  2KXP B;  4IOI H;  1M56 D;  3H1I D;  4KHX A;  2WIT A;  3HTK A;  1Q81 Q;  3T97 A;  1RQU A;  2ZVN B;  1FDI A;  2FYU D;  5APU A;  2N1T B;  1LT9 B;  4JBZ A;  1A02 F;  3TGU G;  1PP9 J;  1N7S B;  3D6Y A;  3A5T A;  5APT A;  2WSE H;  4IL6 X;  4IFM A;  4UB6 H;  3R2P A;  3V2P A;  1Q7Y Q;  4HJG H;  1YIJ P;  4U3F G;  1LTI C;  4EDF A;  1GL2 B;  4MN4 C;  1GU4 A;  2QEX P;  1KYO H;  4DT0 A;  1EDL A;  1S5L H;  1CW5 A;  3L73 E;  2OTK E;  4ASV A;  1NTZ E;  1NTK G;  3H1J E;  4W80 A;  3A0H H;  1M1K Q;  3RBZ A;  1PGP A;  2WPS A;  1ZLL A;  2FFD C;  3MP7 B;  2ZJS E;  2R3C A;  3HD7 C;  3P32 A;  1YI2 P;  3V4Q A;  2KLU A;  2WMM A;  5CMZ A;  2P7J A;  3M06 A;  3HD7 D;  2YNY A;  3H1L E;  1BE3 J;  1RHZ B;  1SQB E;  1SQQ J;  2IZ0 A;  1QVG O;  3VMZ A;  4EOT A;  1OWA A;  2C9N Y;  3KPE A;  3SSU A;  3S4R A;  3L71 G;  1AJY A;  3H32 A;  5CBO A;  1J1E C;  3AE8 C;  3AE3 C;  4IL6 H;  2BEQ D;  3L73 D;  1SFC A;  1NTZ D;  3BCC E;  3H1J D;  3HUS B;  1G2C A;  1HUC A;  1JEK A;  3WU2 E;  5APV A;  5TIS H;  1SQX E;  2AXT H;  1RE3 A;  5CJ0 A;  2YMY A;  1GK4 A;  1SFC B;  1IFD A;  3AEE C;  4H0L B;  3RL0 B;  1LP1 B;  2FXO A;  2R5B A;  1G1J A;  2AEF A;  2N9Y B;  3H1I J;  3CWB E;  2BEZ F;  1GDT A;  2R5D A;  3H1L D;  4YXW H;  3FWL A;  3PH0 A;  1UII A;  1SQB D;  1SQV K;  1KYO I;  1E5W A;  2FYU J;  3RK2 B;  1URQ A;  2QJK C;  1MUU A;  2WVR A;  4UB8 E;  1GU5 A;  2M3E A;  5KTB A;  4H44 B;  1NO4 A;  3BCC D;  1AVY A;  3FXE A;  2UWJ E;  1FE6 A;  2ZYD A;  3U1A A;  3B5N A;  1RE3 C;  5KAI E;  1FZC C;  1BCC E;  3BVH A;  4IFD K;  1SQX D;  1FOS E;  2IDB A;  1P84 E;  2Q3E A;  5AVT B;  1JY2 P;  5KAF E;  2HPC A;  3AED C;  1EZV E;  2PRR A;  5AW3 B;  3L4F A;  5E79 E;  3L75 E;  3CWB D;  3G4S P;  2XKM A;  2KYV A;  1S1C X;  4JYC A;  1QGK B;  3IN6 A;  2JP3 A;  1VQ8 P;  3L70 E;  1RE4 A;  4XA4 A;  4LGD E;  3E1I A;  4ASW A;  3H1K G;  3MHV A;  2BAS A;  5K5G B;  3B5N C;  3WUV A;  1OXZ A;  1JY3 N;  4PJ0 E;  1JMM A;  1NKN A;  1OIP A;  4GKG A;  3B5N D;  1BCC D;  1KIL E;  3H1H E;  2KNC A;  2FYZ A;  3SWY A;  2Q5U A;  2IFM A;  2J59 M;  4Y99 C;  1U7M A;  3AE4 C;  1EC5 A;  1T6A A;  3GF3 A;  1P84 D;  4AYC A;  3RK3 E;  1LTJ C;  3WUU A;  1EZV D;  3PTZ A;  2JJL A;  3L73 J;  2B89 A;  1PPJ E;  1NTZ J;  3LIE A;  3G71 P;  3L75 D;  2J58 A;  1KTM A;  3H1J J;  3U59 A;  1RF1 B;  1L0N D;  4WY4 C;  2P2U A;  2HG5 D;  2OYI B;  1RE4 C;  2K9J A;  2AEJ A;  4WY4 D;  5AW6 B;  3L70 D;  2PP6 A;  4BRY B;  1L0L E;  1LWU C;  1JNM A;  3OA7 A;  2O1K A;  4YXD C;  1KIL C;  1SQB J;  2IFN A;  1AVO A;  1PP9 E;  2WPQ A;  4K35 A;  5KAI H;  2DW3 A;  2O1J A;  3TK1 A;  2E76 C;  1KIL D;  3H1H D;  2Z5I A;  5AW5 B;  3CCU P;  2W6A A;  5KAF H;  1PFI A;  2K1A A;  3VP9 A;  1PPJ D;  2WZ7 A;  1T3J A;  3BCC J;  3V2N A;  4TLF A;  2I8D A;  2D2C B;  3L72 G;  3II6 A;  1NOH A;  2QSI A;  4PV1 B;  1SQX J;  3S9O A;  2JWA A;  1SQQ G;  1L4A C;  2SPZ A;  1L0L D;  1L4A D;  4PD4 E;  2VRS A;  3EFF K;  3CWB J;  1AV1 A;  4PJ0 H;  2QJP C;  2IYP A;  4RKU J;  5GTI H;  5DJU B;  3BRT B;  1YBK A;  3P8M C;  3AE9 C;  1H8A A;  2A45 G;  1BE3 E;  4H13 B;  4GIF A;  4C7N A;  1L2P A;  4U7J A;  5CCG A;  3AE2 C;  2B9B A;  3FX0 A;  1Q2N A;  3CLQ A;  2W6J H;  2QG4 A;  4NPE A;  1HH0 A;  1NH4 A;  4DZO A;  1M8O B;  3H1I G;  3VMA A;  1BCC J;  1NWQ A;  5H2F H;  3VN0 A;  1JM0 A;  1IK9 A;  3GHG C;  1YHQ P;  1OW6 A;  2E75 B;  2OYH B;  1NTM K;  3L75 J;  2E74 C;  1GW4 A;  2YKO A;  1L0N J;  1N73 B;  2W27 A;  1UIX A;  1PIX A;  2E74 D;  1DH3 A;  2HLO A;  3OW2 O;  3Q5S A;  1JUN A;  2C0X A;  1BE3 D;  3FWN A;  4L73 A;  3L70 J;  5KLV E;  1JMB A;  4OGQ C;  2WTY A;  3IFM A;  3B8E B;  2KOG A;  1AFO A;  5AVW B;  2FYU E;  1IFJ A;  2N9B A;  3JC2 2;  4OGQ D;  2WSC J;  3PLN A;  4JF7 A;  5CCH A;  1H0T A;  1M7L A;  1FZB A;  2JKV A;  1FS0 E;  1IK7 A;  5GTH H;  2Z5H A;  3H1H J;  4YTP C;  1YTZ T;  2A06 E;  2YO2 A;  1FOS F;  1G1I A;  1GMJ A;  1IFP A;  1NHL A;  2B87 B;  1YQ3 C;  3O8Z A;  3V4W A;  1U57 A;  3K5B A;  3V2R A;  1JY3 P;  3CCL P;  3E1R A;  2KLV A;  2W8Z A;  1OZH A;  2H89 C;  2K37 A;  4PD4 H;  3KHU A;  3D6Z A;  4GDO A;  3AEA C;  5APW A;  4GOD A;  1VF5 C;  2CPB A;  2N1T A;  2NPS C;  2QM7 A;  1LT9 A;  2OQQ A;  4D6T G;  2QVA A;  5KLV D;  1J1D C;  1ZR4 A;  1VF5 D;  1DEB A;  1N7S A;  2WSF H;  5CCH C;  3AEB C;  3SFD C;  1L0L J;  2NPS D;  3MUD A;  3HE5 B;  3P8C E;  4IFF A;  3SFE C;  3L73 G;  3CME P;  5CCH D;  3F5H A;  4JPZ B;  1YTZ I;  1NTZ G;  3EWK A;  2IBZ E;  2HOD B;  3CMA P;  1NTZ K;  3H1J G;  2WT7 B;  1GL2 A;  1BSN A;  4O9B A;  4ZMD A;  5KLI C;  2NZ2 A;  3NTN A;  3Q5P A;  5AW0 B;  1KZU B;  2A06 D;  3VP8 A;  2A45 H;  4JYB A;  1M1J B;  1PGO A;  2QJY B;  3PJS K;  5KJ7 A;  2GM4 A;  1KB9 E;  3L74 E;  1VQ4 P;  3CCJ P;  3KQG A;  1EXI A;  4EYY Q;  1LT9 C;  3H1L G;  1EDK A;  2K3R A;  2FFD B;  3KZI H;  1N7S C;  1NTK K;  1SQB G;  1T8Z A;  5AW2 B;  2CK3 H;  4OWF A;  3SWF A;  1SQB K;  3HD7 B;  1AQT A;  1JY3 O;  1N7S D;  1PZQ A;  4W7Y A;  3P8C D;  1SVF A;  3VTP C;  3GF7 A;  4ZKP A;  3HE4 B;  1BSH A;  2IBZ D;  2GA1 A;  2LKM A;  3BCC G;  3PRJ A;  3GLM A;  1LJ2 A;  2E5T A;  3A2A A;  5AVV B;  4DOJ A;  1T2K C;  1SQX G;  2R44 A;  3M9Q A;  1LTG C;  3AE5 C;  2GUV A;  1K9M Q;  2AEM A;  3HUS A;  1T2K D;  1KB9 D;  2W6B A;  3L74 D;  2M5A B;  1VQ9 P;  1LP1 A;  2KI7 B;  2LXC B;  1E79 H;  1N7L A;  1RF0 A;  1X22 A;  3CX5 E;  3LW5 J;  5AW4 B;  5AW8 B;  5KKZ C;  3A3Y B;  3IF4 A;  3JSV C;  2FBW C;  1NU1 E;  2FKW B;  2A45 I;  3CI9 A;  3C8V A;  2WWW A;  3L37 A;  1BCC G;  1GK6 A;  5KLV J;  5C39 A;  1VQ5 P;  3RBX A;  3CCE P;  2Q3I A;  1Y9B A;  1ZME C;  5BVZ A;  1EZV G;  1OVV A;  1SFC C;  1Q90 D;  2Y0D A;  3L75 G;  1FC2 C;  4H0L C;  2RH0 A;  2OTJ P;  1FZC B;  3I5C A;  2E42 A;  1WT6 A;  3C9I A;  2M3B A;  1HF9 A;  1SFC D;  3BAT A;  2GUS A;  3BRV B;  4XE5 B;  3I55 P;  3CCV P;  3CX5 D;  3L70 G;  1X79 B;  3TYY A;  1BDD A;  2WPR A;  2G8Y A;  1FU1 A;  1YJN P;  5EFW B;  2C0W A;  3KXD A;  1KQF B;  2WPV B;  2H7H A;  1RQV A;  1NU1 D;  4LC1 A;  2ZT9 C;  2JWD A;  1L0N E;  1OFC X;  1SQV E;  1H89 A;  4H44 C;  1CI6 B;  3H1H G;  2XNX A;  1HJB A;  2ZT9 D;  3CXH E;  2BCC E;  3M9H A;  4H44 D;  4LLH A;  1URQ C;  2O01 J;  2YKQ A;  4I2L C;  2PGD A;  1T3U A;  4GT1 A;  2Y0C A;  1S3J A;  1SP4 A;  2YIU C;  4R4L A;  1PPJ G;  3P7K A;  1URQ D;  3LID A;  4Y99 B;  1DD4 A;  3TNU B;  1OX3 A;  4Z1M H;  3Q1M A;  1S9K E;  5AVU B;  1LTJ B;  3WU2 H;  1IFN A;  1RF1 A;  1KFM A;  2V4H A;  3L74 J;  1L0L G;  2FY8 A;  2OYI A;  4WY4 B;  1L0L K;  1R5L A;  5AVS B;  3CCS P;  4K3A A;  1PP9 G;  4BRY A;  3I56 P;  1SQV D;  1QLE D;  1YQ4 C;  1VQO P;  2C9L Y;  1LTT C;  2YKP A;  5CBN A;  1LWU B;  3CXH D;  2BCC D;  2KSJ A;  4HH2 A;  3JCU E;  1TU3 F;  3TGU J;  1KIL B;  1JCD A;  4TT3 H;  4UB8 H;  3RK3 B;  2Y0E A;  4DJG A;  2L91 A;  1VQL P;  2B88 A;  1S9K D;  4U3F J;  1J2J B;  3Q2Y A;  3G6E P;  3A0B E;  1VPC A;  5CHX A;  2JDI H;  3AE1 C;  1FDM A;  1QX8 A;  4I7Z C;  1W2E A;  1P84 H;  2XDJ A;  2E76 D;  1R5S A;  3B4S A;  3VMY A;  2RKL A;  1M90 Q;  2E43 A;  4RO0 A;  5E79 H;  4KT0 J;  4YPC A;  1L4A B;  1BGY E;  1BE3 G;  3CC2 P;  4WBA A;  1PV3 A;  1KC8 Q;  4AUW A;  1SQP E;  1RY3 A;  1SQQ K;  1KMI Z;  3CCQ P;  1PGQ A;  4DCK A;  1LNQ A;  2QJP B;  2KZJ A;  2W83 C;  3N7N A;  1WMK A;  1RH5 B;  1NU1 J;  5B5E E;  2WSC H;  4N6J A;  2OAR A;  4L74 A;  1MFZ A;  2FYN C;  3R4Y A;  2D2C C;  2HYN A;  1YYC A;  3L71 J;  1W2B O;  4PV1 C;  2D2C D;  3ITK A;  3G9R A;  2W90 A;  4QMA A;  5B66 E;  3CD6 P;  4OH8 B;  4PV1 D;  1GZL A;  2NRG A;  4ZNC A;  1ZOY C;  1HTL C;  3QH9 A;  1BGY D;  2OYH A;  1GW3 A;  3GHG B;  1HGV A;  1FBM A;  4ZKU A;  4JQ0 D;  1N73 A;  1ZN5 A;  3OAK A;  1SQP D;  2OTL P;  1DIP A;  1CZQ A;  2FYU G;  1YJW P;  1OW8 A;  1MZ9 A;  2M8R A;  4KJM A;  5APQ A;  2FYU K;  2OGU A;  3EFG A;  2H8P D;  5AVX B;  1JOC A;  3CC4 P;  4BXL A;  1SLQ A;  2IYO A;  3GW6 A;  4UB6 E;  1NJI Q;  1SQV J;  2QA4 P;  1MKM A;  3TF5 A;  1P84 I;  1X9V A;  1JTH B;  2A06 G;  2BCC J;  3G3Z A;  3M0A A;  3AEG C;  5CCG C;  2FXM A;  1EZV I;  4WB4 A;  4XFJ A;  3M9B A;  2KK7 A;  3QWO C;  1KYO E;  3O6Q B;  1S5L E;  2V7Q J;  5AVR B;  5CCG D;  5APS A;  2KSE A;  3D70 A;  1GTW A;  2B87 A;  3L72 D;  3KDP B;  3CC7 P;  3A0H E;  1XTG B;  2Y9Y A;  1N73 C;  2WQY C;  1YIT P;  1NTM E;  2KS1 B;  2ZVO B;  3E7K A;  1LT1 A;  5BU5 A;  5AW1 B;  1VF5 B;  1VQN P;  3MGN A;  2IBZ G;  2NPS B;  1N86 A;  2Q6Q A;  1HWT C;  1J1D B;  3HE5 A;  3GMA A;  4NPD A;  1ZRT E;  1AA0 A;  2HFE D;  2YXR B;  1VQP P;  2HOD A;  1BDC A;  1LTS C;  2WT7 A;  4NPF X;  2H43 A;  1KYO D;  3L74 G;  4IL6 E;  3OJA B;  5B66 H;  1EDJ A;  1Z56 A;  5KLI B;  1IO4 A;  4HB1 A;  1M1J A;  1ZV8 A;  1M57 D;  5TIS E;  1EDI A;  4M3L A;  2AXT E;  3Q5R A;  2WSS H;  1NTM D;  3CPW O;  1S72 P;  3LW5 H;  2FFD A;  3HTK B;  4I1L A;  3HD7 A;  3T97 B;  1BGY J;  1KFN A;  1KN7 A;  4AQR D;  3BAS A;  2N1T C;  2XND H;  4D6T E;  1ZRT D;  2OYO A;  3HE4 A;  2M0B A;  1SQP J;  2N1T D;  3Q3D A;  3H25 A;  1QL1 A;  3MUD C;  3IR9 A;  1N8R Q;  4OVN F;  1NKZ B;  3M0D A;  1M1J C;  1U7J A;  2FXP A;  1VQ7 P;  3TGU E;  2QJY C;  1PGJ A;  1GL2 C;  2Q1K A;  3U1C A;  3ABV C;  3FXD A;  1QVF O;  3IAO A;  2ZYA A;  2CPS A;  2R32 A;  1GL2 D;  3VMX A;  1KD1 Q;  1JCC A;  2M5A A;  2JO1 A;  4U3F E;  5KJ7 C;  1CSB A;  1J1E B;  2Y9Z A;  1FZF A;  1SQX K;  4PD4 I;  2POH A;  1FJP A;  3B71 A;  4N78 E;  1OVR A;  5KJ7 D;  3L72 J;  1HBW A;  5AVZ B;  3L35 A;  1NU1 G;  1S4X A;  3AE7 C;  3SWK A;  1NTK E;  1W5C E;  3CWB G;  4I6M C;  1NU1 K;  2QRX A;  2WSF J;  1S2E A;  5AVY B;  4EIJ A;  5BU8 B;  4D6T D;  3HRN A;  1OW7 A;  5KKZ B;  4WVZ A;  4C7R A;  1D7M A;  3M0D C;  1VQK P;  1IJD B;  3ZDM A;  3GG2 A;  2L5G B;  2O01 H;  1Q82 Q;  2WSE J;  4GOF A;  3TGU D;  1OMI A;  1FZA A;  1QL2 A;  3H32 B;  3V6I A;  1R8E A;  1MFT A;  1KQL A;  1FZC A;  1ZP0 C;  2KIK A;  3HUS C;  2QJK B;  4U3F D;  1X0T A;  1G2C B;  3L71 E;  5DJT B;  1LTB C;  2K88 A;  4N78 D;  1KB9 H;  1Y47 A;  2E5Y A;  2XU6 A;  3RL0 C;  1PL5 A;  1DX7 A;  1NTK D;  1L0N G;  2P1J A;  1SQV G;  1RF0 C;  1L0N K;  1IZN B;  2I1K A;  4H0L D;  3RL0 D;  4N3Y B;  1NTM J;  2BCC G;  1OVU A;  3W68 A;  1YJ9 P;  5AVQ B;  1LTA C;  5CJ4 A;  1CI6 A;  2ZT9 B;  3CL3 D;  2AXC A;  3RK2 C;  3M91 A; 
#chains in the Genus database with same CATH homology
 2PAJ A;  3IFM A;  3B8E B;  2KOG A;  3VMY A;  1AFO A;  5AVW B;  2E43 A;  2WPS A;  1URQ B;  1IFJ A;  2N9B A;  1ZLL A;  2FFD C;  4JF7 A;  3RK2 D;  5CCH A;  1L4A B;  1M7L A;  3MTU E;  2R3C A;  3HD7 C;  3P32 A;  1FZB A;  3V4Q A;  4WBA A;  5CMZ A;  2P7J A;  3TNU A;  3B5N B;  2Z5H A;  1LTJ A;  5AW7 B;  4AUW A;  3M06 A;  3HD7 D;  2YNY A;  1RY3 A;  1YTZ T;  1SQQ K;  2YO2 A;  1FOS F;  1G1I A;  1NHL A;  3N7N A;  3O8Z A;  3VMZ A;  4EOT A;  1OWA A;  3V4W A;  2HPC B;  2C9N Y;  3V2R A;  1JY3 P;  4WY4 A;  2KLV A;  2WSC H;  4N6J A;  3NXS A;  3KPE A;  3H32 A;  2OAR A;  1MFZ A;  1J1E C;  5APW A;  2HYN A;  1YYC A;  1SFC A;  1IFI A;  2CPB A;  2N1T A;  2NPS C;  2QM7 A;  1LT9 A;  3HUS B;  1G2C A;  1HUC A;  1JO5 A;  1LWU A;  1J1D C;  1ZR4 A;  1DEB A;  1N7S A;  2WSF H;  5CCH C;  4OH8 B;  2NPS D;  5APV A;  3MUD A;  3HE5 B;  1GZL A;  3P8C E;  1KIL A;  1RE3 A;  5CJ0 A;  2YMY A;  1GK4 A;  4IFF A;  1SFC B;  1IFD A;  1HTL C;  5CCH D;  3RL0 B;  1YTZ I;  2OYH A;  2HOD B;  1GW3 A;  3GHG B;  1ZR2 A;  1FZG A;  2R5B A;  1NTZ K;  1HGV A;  2WT7 B;  1G1J A;  1GL2 A;  4O9B A;  1FBM A;  4ZKU A;  2QM8 A;  3NTN A;  1N73 A;  1ZN5 A;  5AW0 B;  3OAK A;  1KZU B;  1GDT A;  2R5D A;  1CZQ A;  3VP8 A;  1MZ9 A;  2M8R A;  2A45 H;  5AW9 B;  5APQ A;  4JYB A;  2FYU K;  1H88 A;  1M1J B;  1HGZ A;  3EFG A;  2H8P D;  1SQV K;  5AVX B;  5KJ7 A;  2GM4 A;  1JOC A;  1JY2 O;  1E5W A;  1SLQ A;  3A7O A;  3RK2 B;  3KQG A;  1RF1 C;  2ZXE B;  1URQ A;  1LGH B;  1MUU A;  1LT9 C;  1X9V A;  1JTH B;  1L4A A;  3N4X A;  1GU5 A;  2OYI C;  1SQP K;  5KTB A;  3G3Z A;  2FFD B;  3M0A A;  5CCG C;  2FXM A;  4WB4 A;  1N7S C;  1NTK K;  5AW2 B;  1T8Z A;  1NO4 A;  5APX A;  3M9B A;  3SWF A;  1SQB K;  3HD7 B;  1IC2 A;  3U1A A;  3B5N A;  1RE3 C;  1JY3 O;  5AVR B;  5CCG D;  1FZC C;  5APS A;  1N7S D;  3BVH A;  4IFD K;  3RK3 C;  4W7Y A;  3P8C D;  1SVF A;  3VTP C;  2IPP A;  1GTW A;  1FOS E;  5AVT B;  1JY2 P;  3KDP B;  4ZKP A;  3HE4 B;  2Q7C A;  1XTG B;  2HPC A;  5AW3 B;  3RK3 D;  2I1J A;  2LKM A;  1N73 C;  3PP5 A;  3L4F A;  5APY A;  2KB7 P;  4C46 A;  3A2A A;  5AVV B;  4DOJ A;  1T2K C;  2Z4E A;  3M9Q A;  2XKM A;  1LTG C;  2GUV A;  2KYV A;  5BU5 A;  3V2Q A;  5AW1 B;  3MGN A;  4HYT B;  4JYC A;  3NFQ A;  3HUS A;  1T2K D;  2NPS B;  1N86 A;  3TSI A;  2W6B A;  1RE4 A;  1HWT C;  4XA4 A;  1J1D B;  3HE5 A;  1FZE A;  4LGD E;  3E1I A;  3VOP A;  3NMD A;  2BAS A;  2HFE D;  3B5N C;  2HOD A;  1OXZ A;  3GHG A;  1JY3 N;  1JMM A;  1LTS C;  1NAF A;  1NKN A;  3VYI A;  1VDF A;  2WT7 A;  1GD2 E;  1N7L A;  1RF0 A;  2P67 A;  3V5B A;  2H43 A;  4GKG A;  3B5N D;  3OJA B;  1Z56 A;  2XV5 A;  2FYZ A;  5AW4 B;  5AW8 B;  2Q5U A;  2IFM A;  2J59 M;  4Y99 C;  3SWY A;  1IO4 A;  1M1J A;  3A3Y B;  1ZV8 A;  4AYC A;  1LTJ C;  3H6P A;  1FJK A;  2JJL A;  4M3L A;  3LIE A;  1MV8 A;  2FKW B;  2A45 I;  5KLV K;  3CI9 A;  4RES B;  2J58 A;  2KP8 A;  3U59 A;  2WWW A;  3L37 A;  1RF1 B;  2IX7 C;  1GK6 A;  1JTH A;  4WY4 C;  3LW5 H;  2P2U A;  2FFD A;  2HG5 D;  2OYI B;  4C7N B;  1RE4 C;  3HTK B;  2Q3I A;  4I1L A;  3HD7 A;  5BVZ A;  2Q9I A;  4W7Z A;  1FAV A;  3MIW A;  4WY4 D;  5AW6 B;  1KFN A;  1SFC C;  4AQR D;  3BAS A;  2N1T C;  1FZC B;  3I5C A;  2PP6 A;  2E42 A;  1WT6 A;  3C9I A;  1LWU C;  2M3B A;  3EQ2 A;  3OA7 A;  1JNM A;  2XZR A;  3HE4 A;  1SFC D;  3BAT A;  2N1T D;  1QL1 A;  2O1K A;  2GUS A;  3BRV B;  1KIL C;  4XE5 B;  3IR9 A;  4B86 A;  2IFN A;  2WPQ A;  1X79 B;  1EQ7 A;  2O1J A;  1NKZ B;  2OYH C;  3M0D A;  1M1J C;  2JEE A;  3L36 A;  3TK1 A;  3TYY A;  2WPR A;  1KIL D;  1FU1 A;  2Z5I A;  5AW5 B;  2ZFC A;  1GL2 C;  3MD0 A;  3U1C A;  1WRG A;  2W6A A;  2C0W A;  1AQ5 A;  1X8Y A;  1HVV A;  2CPS A;  1PFI A;  2NPS A;  2R32 A;  3UIA A;  2H7H A;  1GL2 D;  3VP9 A;  3VMX A;  1JCC A;  4LC1 A;  1N2D C;  2WZ7 A;  1T3J A;  1H89 A;  1CI6 B;  3V2N A;  5KJ7 C;  1CSB A;  1J1E B;  1A02 J;  1FZF A;  1JY2 N;  1SQX K;  2XNX A;  1HJB A;  3II6 A;  2POH A;  1NOH A;  1FJP A;  3M9H A;  4N78 E;  4LLH A;  3WMM 0;  1URQ C;  2YKQ A;  5KJ7 D;  4I2L C;  1T3U A;  1L4A C;  2YO3 A;  4GT1 A;  1HBW A;  5AVZ B;  1SP4 A;  3L35 A;  4I6M C;  1NU1 K;  3P7K A;  1URQ D;  5AVY B;  4EIJ A;  2MJZ A;  1L4A D;  1XTC C;  5BU8 B;  3LID A;  1IFM A;  4Y99 B;  3TNU B;  2VRS A;  3HRN A;  1S9K E;  5AVU B;  1LTJ B;  4C7R A;  3M0D C;  3KYQ A;  1IFN A;  1IJD B;  3BRT B;  3P8M C;  2L5G B;  1RF1 A;  1H8A A;  1KFM A;  2A45 G;  2O01 H;  4KHX A;  1FZA A;  4GIF A;  2OYI A;  4C7N A;  2WIT A;  3HTK A;  4WY4 B;  1L0L K;  1QL2 A;  5CCG A;  3T97 A;  5AVS B;  3H32 B;  3CLQ A;  1HH0 A;  1KQL A;  1FZC A;  1NH4 A;  3HUS C;  5APU A;  4DZO A;  2N1T B;  2C9L Y;  1LT9 B;  1A02 F;  1LTT C;  2YKP A;  1G2C B;  1LWU B;  1NWQ A;  2KSJ A;  1N7S B;  4HH2 A;  3A5T A;  5APT A;  1LTB C;  4N78 D;  3VN0 A;  2WSE H;  4IFM A;  2XU6 A;  1KIL B;  3RL0 C;  1DX7 A;  1IK9 A;  2WTY A;  3R2P A;  3GHG C;  3V2P A;  1JCD A;  2P1J A;  3RK3 B;  2OYH B;  1NTM K;  1RF0 C;  1L0N K;  2I1K A;  3RL0 D;  1LTI C;  1GW4 A;  1GL2 B;  4N3Y B;  2YKO A;  1GU4 A;  1S9K D;  1N73 B;  2W27 A;  1J2J B;  5AVQ B;  1CW5 A;  1LTA C;  5CJ4 A;  1DH3 A;  1VPC A;  2HLO A;  5CHX A;  1CI6 A;  1JUN A;  1FDM A;  3CL3 D;  2C0X A;  4W80 A;  1W2E A;  2XDJ A;  3RK2 C;  3M91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...