1AFOA

Dimeric transmembrane domain of human glycophorin a, nmr, 20 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
40
structure length
40
Chain Sequence
VQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A transmembrane helix dimer: structure and implications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Integral membrane protein
molecule keywords GLYCOPHORIN A
total genus 12
structure length 40
sequence length 40
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.70 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1afoA00
1AFOA 2J58A
chains in the Genus database with same CATH superfamily
1SQQK 3M0AA 1S5LX 3CCRP 1T6AA 3RGUA 1EDJA 4U3FE 3E1IA 2ZFCA 1NVOA 5M1BA 4KJMA 5CBNA 1HBWA 1FZFA 1OW8A 1ZR4A 4U7JA 4LGDE 2YO3A 3T97A 1N73A 1VQ4P 1OX3A 3CD6P 1LTJB 2ZXXA 2WSFH 2Y9YA 3L75D 3M0DA 4U3FG 2Q7CA 2M5AB 3CC4P 2A45I 1BE3J 2FKWB 2ZXEB 3H1HD 4OWFA 4UB8H 1ZOYC 2O3JA 4WY4A 1JY2P 1MZ9A 1SQXJ 2PAJA 3B5NC 1SQVK 2IZ0A 1PGOA 3F5HA 4OGQB 4ZKUA 1VQ5P 1KD1Q 1FJKA 3MD0A 2FYUD 3L70D 4RKUJ 4DZOA 5KAIE 1SLQA 3A5TA 1L0ND 3VMZA 1JY2O 1NTZK 3RBXA 4LC1A 1CZQA 3H1IG 3SWYA 1JY3P 2M3EA 1HJ0A 3BASA 3KZIE 3L75J 2C9LY 2WSEJ 1JEKA 1X0TA 1Y9BA 2WSFJ 1NTMK 1QLED 2K9JB 4JPZB 2A06E 1RE4A 3A0BE 3L72E 3BCCJ 1U57A 3R4YA 1EC5A 2KLVA 2L5GB 2V4HA 3LIEA 2JO1A 4C7NB 3O6QA 2IFNA 2AXTH 2POHA 4BRYB 2E74C 1YJNP 3CLQA 3CWBG 3RL0C 1PPJD 3VTPC 4N78D 1KB9D 3GMAA 1EZVD 1OZHA 1W5CE 2E75C 2FYUK 3H32B 3NFQA 2BCCJ 1JO5A 3HUSB 1UIIA 2OQQA 3L73J 2WT7B 2OGUA 1PP9D 3TF5A 1VQNP 2FYZA 1KILE 1NKZB 1KILD 2ZVOB 1P84E 3GW6A 5AVUB 3CWBE 1IFNA 3HD7D 3ZDMA 3BATA 4WVZA 3L4FA 2RH0A 3BRVB 1VQ9P 1LP1A 1SQXE 4I7ZC 4BWNA 2ZT9C 2K37A 2RKLA 5B5EE 1AJYA 1HUCA 1KFMA 1PIXA 1FZCA 2WZ7A 3GHGC 2BCCE 1KB9I 1PV3A 1SQXG 2V7QH 3G6EP 1RE3C 3SFEC 5BVZA 3I55P 2YIUB 1PP9J 1SQXK 2OYHC 1IK7A 1KTMA 3AEFC 1VF5C 4BRYA 4WB4A 1RF0A 3CCJP 1ZRTD 4D6TD 1SQPE 1LNQA 2NPSB 3AECC 4L76A 1YTZT 1T2KD 1FOSE 3EWKA 3U1CA 1KFNA 1FDIA 2N1TB 3HRNA 5KAFE 1KB9E 1MFTA 2WMMA 3VYIA 3CCVP 2Z5HA 4ZKPA 3F89A 3D70A 3L73G 3N7NA 1RHZB 4L75A 3HE5A 1ZR2A 1OIPA 1GD2E 1N7SD 1EXIA 1VQ6P 1IFDA 1P84D 1SP4A 2MJZA 1IFJA 1AVOA 3BCCE 3B8EB 1JTHA 3CWBD 3L71J 3TGUE 3CMAP 4NPEA 2Y0CA 2E74D 3WU2H 3WU2E 3H1JJ 2OTJP 4PJ0H 1SQXD 2AEMA 1HH0A 2E76B 1SQPJ 2XDJA 4RESB 4BXLA 2KP8A 5KJ7D 2H43A 1M1JA 1J2JB 1KB9H 2FYUJ 2JWAA 2QJPC 2I1JA 3L70J 4L74A 5AW9B 1N7LA 2QJKB 3A0HH 1LT9C 1SQBE 2KB7P 5AVTB 4EYYQ 1L2PA 1USEA 3KYQA 3M9QA 4NPDA 1A02J 3HD7C 3CWBJ 3L36A 1MKMA 1NTZG 3L71D 1XTGB 3L74D 3L74E 3H1JD 3PH0A 2ZT9D 3KZIH 3RL0g 1GTWA 4YXDC 1FZAA 1N8RQ 1SQPD 2HR3A 2OARA 2Q3EA 3EQ2A 4TT3H 2W6BA 3H1ID 3H1IE 1OW6A 2HPCB 3IF4A 3UIAA 2N9YB 4U3FJ 4N3YB 3KPEA 5B5EH 1JMMA 2JJLA 1L4AA 2MKVA 2WSCH 1DD4A 3JCUE 2W6JH 2E42A 1IC2A 4DJGA 1QEXA 2R3CA 3H32A 5AW3B 1T2KC 2E76C 1RF1C 2H7HA 1R5LA 3L74J 1FZCB 3C1LA 2K88A 2P2UA 3QH9A 1E79H 4H13B 1DIPA 3CXHD 2KYVA 1T3JA 1NYHA 3CXHE 4JF7A 4M3LA 1DD3A 1SQQG 4W7ZA 3OW2O 1GW3A 1K04A 3RK3D 3B71A 3V2RA 3CCLP 1HF9A 4I2LC 3NMDA 3FXDA 1NU1D 1OWAA 3HUSA 3MTUE 1Q82Q 1JOCA 1YJ9P 2N1TC 3P8MC 2N9BA 2E5TA 4JYCA 1G2CA 2JEEA 1DEBA 2XNXA 3OA7A 1KQLA 2HODB 2KUBA 5APTA 1VL2A 3KXDA 1ZXGA 2OYHB 1M7LA 2YIUC 3TSIA 4IFMA 2A06D 3V2QA 1G1JA 1JY3O 4IFDK 1L0LJ 3LIDA 1W2EA 4PV1B 3L37A 1Q86Q 5BU5A 1NTKE 3PTZA 3H1LJ 2ZT9B 3Q5RA 2KNCA 3GLMA 4I7ZB 5EFWB 5CCHC 1VQLP 2XNDH 1VDFA 1S5LH 3D6ZA 1X79B 1NU1K 3U1AA 1RH5B 1SS1A 3LW5J 2WPQA 2JP3A 3O6QB 4H13C 5AW7B 1IFMA 1R8EA 3G9RA 3S1KA 2R5BA 1FAVA 1S4XA 2B87A 2WSEH 4HKZH 1L4AC 3MGNA 1BCCG 1YBKA 4Y28J 4H44D 3MIWA 3AE9C 2J5UA 1YQ3C 2YXQB 4HB1A 5KLIC 1FZCC 5KLVK 5AW4B 1VQMP 2AXTE 2GA1A 4ZMDA 3RK3E 5APQA 2E76D 5KJ7A 1NAYA 1OXZA 3RL0B 2QSIA 1ZLLA 4XE5B 3P8CD 2E74B 2YO2A 5KKZB 1JTHB 1SFCD 4WWIA 3V2NA 1SFCA 1KYOH 2QE7H 1WMKA 2Z5IA 1N7SB 1NOHA 3CX5H 1Y8AA 2WSSH 4ZNCA 2FFDA 1PL5A 3L73E 3RK3C 5DJUB 1URQB 5CBOA 4PD4E 3HE4A 2KK7A 1EZVI 2KSEA 1BE3D 2PGDA 2WPSA 3CCQP 2KSJA 1E5WA 2Y0EA 3L75G 4D6TE 4U3FD 1YITP 3K5BA 5KAIH 2LKMA 3FXEA 1X9VA 1BCCJ 4GOFA 3TYYA 2IBZI 1LTGC 2NPSD 1GL2A 2NRGA 3MUDC 5KTBA 3WUUA 3SSUA 1VQKP 1KQSO 2WVRA 4OGQC 3CL3D 1LWUB 1LGHB 1KN7A 3CXHI 2UWJE 1MV8A 3L75E 5GTHH 1KMIZ 1T8ZA 3CC7P 5KLVJ 1LTJC 1URQD 2JDIH 3RBZA 2BEQD 2FYUE 3L70E 3H1KE 2BEZF 4HJGH 1RE3A 1XTCC 2Y0DA 3TNUA 3W68A 4JBZA 1NTZJ 4Y99B 3IFMA 5AVZB 1Q90D 5AW2B 4EIJA 5CCHD 2KIKA 1SFCB 2B87B 3M91A 3HTKB 2JKVA 1NU1J 2HG5D 3PP5A 3RL0D 1KILB 2WITA 1L0NE 2WT7A 2SPZA 2IBZG 2FYNC 1DH3A 4IL6H 3BRTB 2IPPA 1YHQP 1AA0A 1ZN5A 4K35A 3H6PA 1FE6A 2FYNB 4H44B 4PD4H 2ZJSE 1L0NG 1IK9A 2ZYDA 1M57D 5AW8B 5KLVD 1GU4A 1KILC 2AEFA 4DOJA 1M90Q 1PFIA 2B89A 2NPSA 1ZP0C 3CCUP 1ZW0A 2OYHA 1SFCC 5CJ4A 4GKGA 3FX0A 2W90A 3Q5PA 2GUVA 3L72G 3VN0A 4Y99C 2W8ZA 3D6YA 1JY3N 2K9JA 3OAKA 4PV1D 2WQYC 2YKQA 1LTIC 2A06G 1SQQE 2FXPA 1OW7A 1YTZI 3I5CA 1FZGA 1DX7A 1LWUC 2ZYAA 1X22A 1PGJA 1VQPP 4H0LC 1JCCA 3MUDA 2XKMA 5CHXA 4XA4A 3HD7A 5B66E 3S4RA 1YQ4C 1FU1A 1Q2NA 4OGQD 1J1DC 1OVRA 3CMEP 2LR2A 1N73C 3GF7A 4W7YA 1HVVA 1BE3G 1K05A 2C9NY 1GDTA 1URQC 3V4QA 1H0TA 1M56D 2CK3H 2NZ2A 2YXRB 3RK3B 3S9OA 1N7SC 3HTKA 4K3AA 3CX5E 3FWNA 1HTLC 2XU6A 4H13D 2YMYA 1GK4A 5KKZC 2A45G 4PD4I 1OFCX 2VRSA 4AYCA 2O01H 4A7PA 3CXHH 5AVXB 1PPJE 1S2EA 3KDPB 1BCCE 4IOIH 3VMAA 3V4WA 1S9KE 1KQGB 4HYTB 1NTME 5TISH 1NTMD 2A45H 2M3BA 5H2FE 1SQQD 3B5NA 4EI2A 3Q2YA 2V7QJ 2QEXP 5KLIB 1YI2P 1L4AB 1S5LE 1MFZA 1T3UA 1GL2D 3CI9A 5E79H 1U7JA 3PHLA 2KI7B 2PP6A 5GTHE 1QVGO 4MN4C 4C46A 3H1HJ 3ITKA 1J1EC 1L0LG 3WUTA 1BGYD 1M1JB 1NTZD 3AE2C 1NTZE 3P7KA 2IBZD 2QRXA 3PRJA 3A2AA 4PV1C 5APXA 1SVFA 2IDBA 3MP7B 4L73A 3TDKA 3T97B 4GT1A 5CCGC 3L71E 4XFJA 2Y9ZA 1IFPA 1NO4A 2HLOA 4R4MA 3V5BA 1JNMA 2Q9IA 3CCEP 4H0LD 5TJHA 5AVRB 1EDIA 2AXCA 2JR8A 1HJBA 1VPCA 3LW5H 4HH2A 1Y47A 1LTAC 3AE3C 1UIXA 4IL6E 3A0BH 5APSA 1BGYJ 3CCMP 5B66H 2GUSA 1L0NK 3RK2C 3L71G 1EDKA 5AVYB 1GW4A 1D7MA 4OH8B 1IO4A 1FDMA 3NTNA 1DEEG 1GK6A 1FOSF 2ZAEB 5KLVG 2E43A 1NH4A 5AW1B 3V6IA 1N2DC 5AW6B 3TGUD 2FYUG 1SQVD 3H1HG 2P58A 1OMIA 2P10A 1LTTC 2IFMA 3EFGA 3L70G 3H25A 1W2BO 1GMJA 1N86A 1LTBC 1FZBA 1OVVA 2N1TD 2O01N 2OYOA 1AQTA 2R32A 1NU1G 1JMBA 2IBZE 3GHGA 2OTKE 1RF1B 4GDOA 4NPFX 4RJTA 4Z1MH 2Z4EA 4KHXA 4EDFA 1LP1B 3P32A 3Q3DA 2QJYC 1X8YA 1AVYA 1GU5A 1NU1E 3N4XA 3H1HE 1RF0C 1NWQA 2FFDC 1IFIA 1BSNA 1QL2A 1SQBD 3MHVA 2J58A 2WSCJ 4OVNF 2KOGA 2PFXA 1Z56A 2C0XA 5APYA 1SQPK 3VMXA 1CI6B 1FS0E 1SQVJ 3M9BA 3P8CE 3ABVC 3GG2A 2ZYGA 2AEJA 1CI6A 2P67A 3R2PA 1LT1A 1NJIQ 2L91A 1KQFB 1NTKG 4AUWA 3A3YB 3HD7B 1SQVG 1PP9G 1LT9B 1HGZA 1RY3A 3AE6C 3H1KJ 3H1LG 1S72P 1JUNA 2QJKC 2ZVNB 4WY4B 2I1KA 2WPVB 3CCSP 1KC8Q 1NTMJ 1S3JA 2CPBA 3M0DC 2QJPB 5AW0B 3SFDC 3Q5SA 2OYIC 3E1RA 5L8RJ 3G4SP 1SQVE 2E5YA 3SWKA 1FZEA 1KYOE 2FY8A 2RMZA 1S1CX 2H88C 3RK2D 1VQ7P 3CC2P 3B4SA 4KT0J 1MUUA 3BCCD 2KS1A 5AW5B 1SQBK 4R4LA 1CSBA 1PGQA 2YNYA 1BDDA 1PZQA 3H1KD 3W67A 5KAFH 2WTYA 2M0BA 2FXOA 3II6A 4GOEA 3TNUB 1YYCA 3AE5C 5H2FH 3SWFA 1VQ8P 4B86A 2OYIB 3C9IA 2IYPA 2K9YA 3AEAC 5C39A 3WMM0 1LTJA 1RE4C 3I56P 2BCCD 2NPSC 1R5SA 2WPRA 2WWWA 3KHUA 3L73D 2XZRA 4WY4C 4D6TG 2CPSA 1VF5B 2XV5A 2YKOA 4IFFA 5AVQB 1IJDB 2R5DA 3EFFK 1ZMEC 4ASWA 5DJTB 1H8AA 3CX5I 2YMKA 2FBWC 3TGUG 3GHGB 4AQRD 2O1KA 3WUVA 2R3SA 2B88A 3H1IJ 1BDCA 1M1KQ 4IL6X 1L0LE 5BU8B 1NTKD 4CPGA 1FC2C 2LXBA 2N1TA 1K9MQ 1GZLA 2IX7C 2P7JA 1KYOD 1G1IA 1JB0J 2C0WA 3TGUJ 1EZVE 3VP9A 1NGMB 2FFDB 1AFOA 3HE5B 1KZUB 2Q5UA 3Q1MA 2QJYB 1H88A 1HGVA 1JY2N 1VF5D 1L0LK 2OTLP 3L72J 1SQBG 3HUSC 4D6TJ 2J59M 3VMYA 2E75B 2W6AA 1TU3F 1M8OB 5CMZA 3FGAD 3VP8A 2QM8A 3PJSK 1N7SA 1SQBJ 1QX8A 1LWUA 3BCCG 4EOTA 3L74G 2JWDA 4UB6E 3H1KG 4JQ0D 3JSVC 2RN0A 1IZNB 3A7OA 5APWA 1QGKB 5KLVE 3RK2B 2KZJA 3L72D 4YPCA 5GTIE 4PD4D 5APVA 2QA4P 1K73Q 3H1JE 2DW3A 2B9BA 1KYOI 1NTKK 5KJ7C 2QG4A 3HE4B 3U59A 1URQA 2KS1B 3AE4C 3M9HA 2HYNA 4N78E 4WY4D 3AE8C 5AVWB 1L0LD 2H89C 1BSHA 4JYBA 2Q1KA 3AE1C 2KNCB 2R44A 3B5NB 3H1JG 4UB6H 5CJ0A 1PP9E 2P1JA 4GIFA 3AEDC 5AVVB 1M1JC 3IR9A 3G3ZA 1J1EB 4PJ0E 4QMAA 1VQOP 3MZWB 3KQGA 5E79E 3AEBC 1WRGA 3FWLA 4UB8E 1LT9A 1P84H 1Q7YQ 4WBAA 2D2CD 3O8ZA 1Q81Q 1NHLA 1G2CB 2Q6QA 3PLNA 3G71P 2KXPB 3AEGC 4RO0A 1H0TB 1U7MA 2GM4A 3NXSA 2QIWA 2H8PD 5TISE 4O9BA 4I6MC 5AVSB 1SQQJ 1EQ7A 3M06A 1KORA 2IZ1A 1L0NJ 2ITAA 3AEEC 3H1LE 3JCUH 5GTIH 1CW5A 1NTMG 1ZRTE 3TK1A 2K3RA 1GL2C 2D2CB 1JM0A 1LJ2A 1USDA 1WT6A 3CX5D 1QL1A 2W27A 3JC22 2W83C 4N6JA 5CCGA 1A02F 2BCCG 2KLUA 2QM7A 4C7NA 1S9KD 2HODA 4C7RA 5APUA 1NTKJ 1RF1A 1BE3E 4DT0A 3D71A 1BCCD 3CPWO 1YJWP 3A0HE 3GF3A 1ZV8A 1BGYG 3B5ND 3QWOC 5K5GB 1J1DB 1N73B 1FJPA 1LTSC 2HFED 3IN6A 4GODA 5CCGD 3USSA 4DCKA 1P84I 3AE7C 3E7KA 3OJAB 2QVAA 1SQPG 4YXWH 2Q3IA 4H0LB 2LXCB 4TLFA 3BVHA 2FXMA 1PPJG 1NKNA 1RQVA 1EZVG 2KZIA 1BGYE 2I8DA 2O01J 1FBMA 4LLHA 2IYOA 1FDOA 3C8VA 2M5AA 1EXJA 1AQ5A 1JCDA 1KILA 3H1LD 3IAOA 1YIJP 2YKPA 2O1JA 2G8YA 4W80A 1KV4A 1OVUA 1NAFA 2M8RA 1PGPA 2G3AA 4YTPC 2BASA 4ASVA 2K1AA 1QVFO 1GL2B 2D2CC 4I1LA 3VOPA 2PRRA 2HPCA 1L4AD 1H89A 1EDLA 1AV1A 2E75D 3L35A 4H44C 1K8AQ 2OYIA 1RQUA 3V2PA 5CCHA 1HWTC
chains in the Genus database with same CATH topology
1SQQK 3E1IA 2ZFCA 1FZFA 1ZR4A 4LGDE 2YO3A 3T97A 1N73A 1LTJB 3M0DA 2WSFH 1HBWA 2Q7CA 2A45I 2FKWB 2ZXEB 1HWTC 4WY4A 1JY2P 1MZ9A 2PAJA 3B5NC 4ZKUA 1SQVK 1FJKA 3MD0A 4DZOA 1SLQA 3A5TA 3VMZA 1JY2O 1NTZK 4LC1A 1CZQA 3SWYA 1JY3P 3BASA 2C9LY 1NTMK 1RE4A 2KLVA 2L5GB 3LIEA 4C7NB 2IFNA 2POHA 3CLQA 3RL0C 3VTPC 4N78D 3H32B 2FYUK 3NFQA 1JO5A 3HUSB 2WT7B 2FYZA 1NKZB 1KILD 5AVUB 1IFNA 3HD7D 3BATA 3L4FA 3BRVB 1HUCA 1KFMA 1FZCA 2WZ7A 3GHGC 1RE3C 5BVZA 1SQXK 2OYHC 4WB4A 1RF0A 2NPSB 1YTZT 1T2KD 1FOSE 3U1CA 1KFNA 2N1TB 3VYIA 3HRNA 2Z5HA 4ZKPA 3N7NA 1ZR2A 3HE5A 1GD2E 1N7SD 1IFDA 1SP4A 2MJZA 1IFJA 3B8EB 1JTHA 1HH0A 2XDJA 4RESB 2KP8A 5KJ7D 1M1JA 1J2JB 1H88A 2I1JA 5AW9B 1N7LA 1LT9C 2KB7P 5AVTB 3M9QA 3KYQA 1A02J 3HD7C 3L36A 1XTGB 1GTWA 1FZAA 2OARA 3EQ2A 2W6BA 2HPCB 3UIAA 4N3YB 3KPEA 1JMMA 2JJLA 1L4AA 2WSCH 2E42A 1IC2A 2R3CA 3H32A 5AW3B 1T2KC 1RF1C 2H7HA 1FZCB 2P2UA 2KYVA 1T3JA 4JF7A 4M3LA 4W7ZA 1GW3A 3RK3D 3V2RA 4I2LC 3NMDA 1OWAA 3HUSA 3MTUE 1JOCA 2N1TC 3P8MC 2N9BA 4JYCA 1G2CA 2JEEA 1DEBA 2XNXA 3OA7A 1KQLA 2HODB 5APTA 2OYHB 1M7LA 3TSIA 4IFMA 3V2QA 1G1JA 1JY3O 4IFDK 3LIDA 1W2EA 3L37A 5BU5A 5CCHC 1VDFA 1X79B 1NU1K 3U1AA 2WPQA 5AW7B 1IFMA 2R5BA 1FAVA 2WSEH 1L4AC 3MGNA 3MIWA 5KLVK 5AW4B 5APQA 5KJ7A 1OXZA 3RL0B 1ZLLA 4XE5B 3P8CD 2YO2A 1JTHB 1SFCD 3V2NA 1SFCA 2Z5IA 1N7SB 1NOHA 2FFDA 3RK3C 1URQB 3HE4A 2WPSA 2KSJA 1E5WA 2LKMA 1X9VA 3TYYA 1LTGC 2NPSD 1GL2A 5KTBA 3CL3D 1LWUB 1LGHB 1MV8A 1T8ZA 1LTJC 1URQD 3TNUA 1RE3A 1XTCC 2H43A 4Y99B 5AW2B 3IFMA 5AVZB 4EIJA 5CCHD 1SFCB 3M91A 3HTKB 2HG5D 3PP5A 3RL0D 1KILB 2WITA 2WT7A 1DH3A 3BRTB 2IPPA 1ZN5A 3H6PA 2E43A 1IK9A 5AW8B 1GU4A 1KILC 4DOJA 1PFIA 2NPSA 2OYHA 1SFCC 5CJ4A 4GKGA 2GUVA 3VN0A 4Y99C 1JY3N 3OAKA 2YKQA 1LTIC 1YTZI 3I5CA 1FZGA 1DX7A 1LWUC 1JCCA 3MUDA 2XKMA 5CHXA 4XA4A 3HD7A 1FU1A 1J1DC 1N73C 4W7YA 1HVVA 2C9NY 1GDTA 1URQC 3V4QA 3RK3B 1N7SC 3HTKA 1HTLC 2XU6A 2YMYA 1GK4A 2A45G 4AYCA 2VRSA 2O01H 5AVXB 3KDPB 3V4WA 1S9KE 4HYTB 2A45H 2M3BA 3B5NA 1L4AB 1MFZA 1T3UA 1GL2D 3CI9A 2PP6A 4C46A 1J1EC 1M1JB 3P7KA 3A2AA 5APXA 1SVFA 4GT1A 5CCGC 1NO4A 2HLOA 3V5BA 2Q9IA 1JNMA 5AVRB 1HJBA 1VPCA 3LW5H 4HH2A 1LTAC 5APSA 2GUSA 1L0NK 3RK2C 5AVYB 1GW4A 4OH8B 1IO4A 1FDMA 3NTNA 1FOSF 1GK6A 1NH4A 5AW1B 1N2DC 5AW6B 3EFGA 1LTTC 2IFMA 1N86A 1LTBC 1FZBA 2N1TD 3M0AA 1FZCC 2R32A 1RF1B 3GHGA 2Z4EA 4KHXA 3P32A 1X8YA 1GU5A 3N4XA 1RF0C 1NWQA 2FFDC 1IFIA 1QL2A 2J58A 2KOGA 1Z56A 2C0XA 5APYA 1SQPK 3VMXA 1CI6B 3P8CE 3M9BA 3R2PA 1CI6A 2P67A 4AUWA 3A3YB 3HD7B 1LT9B 1HGZA 1RY3A 1JUNA 4WY4B 2I1KA 2CPBA 3M0DC 5AW0B 2OYIC 1FZEA 3RK2D 1MUUA 5AW5B 1SQBK 1CSBA 2YNYA 2WTYA 3II6A 3SWFA 3TNUB 1YYCA 4B86A 2OYIB 3C9IA 3WMM0 1LTJA 1RE4C 2WPRA 2NPSC 4WY4C 2WWWA 2XZRA 2CPSA 2XV5A 2YKOA 4IFFA 5AVQB 1IJDB 2R5DA 1H8AA 3GHGB 4AQRD 2O1KA 5BU8B 2N1TA 1GZLA 2IX7C 2P7JA 1G1IA 1AFOA 2C0WA 2FFDB 3VP9A 3HE5B 1KZUB 2Q5UA 1HGVA 1JY2N 1L0LK 3HUSC 2J59M 3VMYA 2W6AA 5CMZA 3VP8A 2QM8A 1N7SA 1LWUA 4EOTA 5APWA 3A7OA 3RK2B 5APVA 1NTKK 5KJ7C 3HE4B 3U59A 1URQA 3M9HA 2HYNA 4N78E 4WY4D 5AVWB 4JYBA 3B5NB 5CJ0A 2P1JA 4GIFA 5AVVB 1M1JC 3IR9A 3G3ZA 1J1EB 3KQGA 1WRGA 1LT9A 4WBAA 3O8ZA 1NHLA 1G2CB 2GM4A 3NXSA 2H8PD 4O9BA 4I6MC 5AVSB 1EQ7A 3M06A 1CW5A 3TK1A 1GL2C 1WT6A 1A02F 1QL1A 2W27A 4N6JA 5CCGA 4C7NA 2QM7A 1S9KD 2HODA 4C7RA 5APUA 1RF1A 1N73B 1ZV8A 3B5ND 1J1DB 1FJPA 1LTSC 2HFED 5CCGD 3OJAB 2Q3IA 3BVHA 2FXMA 1NKNA 4LLHA 1FBMA 1AQ5A 1JCDA 1KILA 2YKPA 2O1JA 4W80A 1NAFA 2M8RA 2BASA 1GL2B 4I1LA 3VOPA 2HPCA 1L4AD 1H89A 3L35A 2OYIA 3V2PA 5CCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AFO A;  2J58 A; 
#chains in the Genus database with same CATH topology
 1SQQ K;  3M0A A;  1S5L X;  3CCR P;  1T6A A;  3RGU A;  1EDJ A;  4U3F E;  3E1I A;  2ZFC A;  1NVO A;  5M1B A;  4KJM A;  5CBN A;  1HBW A;  1FZF A;  1OW8 A;  1ZR4 A;  4U7J A;  4LGD E;  2YO3 A;  3T97 A;  1N73 A;  1VQ4 P;  1OX3 A;  3CD6 P;  1LTJ B;  2ZXX A;  2WSF H;  2Y9Y A;  3L75 D;  3M0D A;  4U3F G;  2Q7C A;  2M5A B;  3CC4 P;  2A45 I;  1BE3 J;  2FKW B;  2ZXE B;  3H1H D;  4OWF A;  4UB8 H;  1ZOY C;  2O3J A;  4WY4 A;  1JY2 P;  1MZ9 A;  1SQX J;  2PAJ A;  3B5N C;  1SQV K;  2IZ0 A;  1PGO A;  3F5H A;  4OGQ B;  4ZKU A;  1VQ5 P;  1KD1 Q;  1FJK A;  3MD0 A;  2FYU D;  3L70 D;  4RKU J;  4DZO A;  5KAI E;  1SLQ A;  3A5T A;  1L0N D;  3VMZ A;  1JY2 O;  1NTZ K;  3RBX A;  4LC1 A;  1CZQ A;  3H1I G;  3SWY A;  1JY3 P;  2M3E A;  1HJ0 A;  3BAS A;  3KZI E;  3L75 J;  2C9L Y;  2WSE J;  1JEK A;  1X0T A;  1Y9B A;  2WSF J;  1NTM K;  1QLE D;  2K9J B;  4JPZ B;  2A06 E;  1RE4 A;  3A0B E;  3L72 E;  3BCC J;  1U57 A;  3R4Y A;  1EC5 A;  2KLV A;  2L5G B;  2V4H A;  3LIE A;  2JO1 A;  4C7N B;  3O6Q A;  2IFN A;  2AXT H;  2POH A;  4BRY B;  2E74 C;  1YJN P;  3CLQ A;  3CWB G;  3RL0 C;  1PPJ D;  3VTP C;  4N78 D;  1KB9 D;  3GMA A;  1EZV D;  1OZH A;  1W5C E;  2E75 C;  2FYU K;  3H32 B;  3NFQ A;  2BCC J;  1JO5 A;  3HUS B;  1UII A;  2OQQ A;  3L73 J;  2WT7 B;  2OGU A;  1PP9 D;  3TF5 A;  1VQN P;  2FYZ A;  1KIL E;  1NKZ B;  1KIL D;  2ZVO B;  1P84 E;  3GW6 A;  5AVU B;  3CWB E;  1IFN A;  3HD7 D;  3ZDM A;  3BAT A;  4WVZ A;  3L4F A;  2RH0 A;  3BRV B;  1VQ9 P;  1LP1 A;  1SQX E;  4I7Z C;  4BWN A;  2ZT9 C;  2K37 A;  2RKL A;  5B5E E;  1AJY A;  1HUC A;  1KFM A;  1PIX A;  1FZC A;  2WZ7 A;  3GHG C;  2BCC E;  1KB9 I;  1PV3 A;  1SQX G;  2V7Q H;  3G6E P;  1RE3 C;  3SFE C;  5BVZ A;  3I55 P;  2YIU B;  1PP9 J;  1SQX K;  2OYH C;  1IK7 A;  1KTM A;  3AEF C;  1VF5 C;  4BRY A;  4WB4 A;  1RF0 A;  3CCJ P;  1ZRT D;  4D6T D;  1SQP E;  1LNQ A;  2NPS B;  3AEC C;  4L76 A;  1YTZ T;  1T2K D;  1FOS E;  3EWK A;  3U1C A;  1KFN A;  1FDI A;  2N1T B;  3HRN A;  5KAF E;  1KB9 E;  1MFT A;  2WMM A;  3VYI A;  3CCV P;  2Z5H A;  4ZKP A;  3F89 A;  3D70 A;  3L73 G;  3N7N A;  1RHZ B;  4L75 A;  3HE5 A;  1ZR2 A;  1OIP A;  1GD2 E;  1N7S D;  1EXI A;  1VQ6 P;  1IFD A;  1P84 D;  1SP4 A;  2MJZ A;  1IFJ A;  1AVO A;  3BCC E;  3B8E B;  1JTH A;  3CWB D;  3L71 J;  3TGU E;  3CMA P;  4NPE A;  2Y0C A;  2E74 D;  3WU2 H;  3WU2 E;  3H1J J;  2OTJ P;  4PJ0 H;  1SQX D;  2AEM A;  1HH0 A;  2E76 B;  1SQP J;  2XDJ A;  4RES B;  4BXL A;  2KP8 A;  5KJ7 D;  2H43 A;  1M1J A;  1J2J B;  1KB9 H;  2FYU J;  2JWA A;  2QJP C;  2I1J A;  3L70 J;  4L74 A;  5AW9 B;  1N7L A;  2QJK B;  3A0H H;  1LT9 C;  1SQB E;  2KB7 P;  5AVT B;  4EYY Q;  1L2P A;  1USE A;  3KYQ A;  3M9Q A;  4NPD A;  1A02 J;  3HD7 C;  3CWB J;  3L36 A;  1MKM A;  1NTZ G;  3L71 D;  1XTG B;  3L74 D;  3L74 E;  3H1J D;  3PH0 A;  2ZT9 D;  3KZI H;  3RL0 g;  1GTW A;  4YXD C;  1FZA A;  1N8R Q;  1SQP D;  2HR3 A;  2OAR A;  2Q3E A;  3EQ2 A;  4TT3 H;  2W6B A;  3H1I D;  3H1I E;  1OW6 A;  2HPC B;  3IF4 A;  3UIA A;  2N9Y B;  4U3F J;  4N3Y B;  3KPE A;  5B5E H;  1JMM A;  2JJL A;  1L4A A;  2MKV A;  2WSC H;  1DD4 A;  3JCU E;  2W6J H;  2E42 A;  1IC2 A;  4DJG A;  1QEX A;  2R3C A;  3H32 A;  5AW3 B;  1T2K C;  2E76 C;  1RF1 C;  2H7H A;  1R5L A;  3L74 J;  1FZC B;  3C1L A;  2K88 A;  2P2U A;  3QH9 A;  1E79 H;  4H13 B;  1DIP A;  3CXH D;  2KYV A;  1T3J A;  1NYH A;  3CXH E;  4JF7 A;  4M3L A;  1DD3 A;  1SQQ G;  4W7Z A;  3OW2 O;  1GW3 A;  1K04 A;  3RK3 D;  3B71 A;  3V2R A;  3CCL P;  1HF9 A;  4I2L C;  3NMD A;  3FXD A;  1NU1 D;  1OWA A;  3HUS A;  3MTU E;  1Q82 Q;  1JOC A;  1YJ9 P;  2N1T C;  3P8M C;  2N9B A;  2E5T A;  4JYC A;  1G2C A;  2JEE A;  1DEB A;  2XNX A;  3OA7 A;  1KQL A;  2HOD B;  2KUB A;  5APT A;  1VL2 A;  3KXD A;  1ZXG A;  2OYH B;  1M7L A;  2YIU C;  3TSI A;  4IFM A;  2A06 D;  3V2Q A;  1G1J A;  1JY3 O;  4IFD K;  1L0L J;  3LID A;  1W2E A;  4PV1 B;  3L37 A;  1Q86 Q;  5BU5 A;  1NTK E;  3PTZ A;  3H1L J;  2ZT9 B;  3Q5R A;  2KNC A;  3GLM A;  4I7Z B;  5EFW B;  5CCH C;  1VQL P;  2XND H;  1VDF A;  1S5L H;  3D6Z A;  1X79 B;  1NU1 K;  3U1A A;  1RH5 B;  1SS1 A;  3LW5 J;  2WPQ A;  2JP3 A;  3O6Q B;  4H13 C;  5AW7 B;  1IFM A;  1R8E A;  3G9R A;  3S1K A;  2R5B A;  1FAV A;  1S4X A;  2B87 A;  2WSE H;  4HKZ H;  1L4A C;  3MGN A;  1BCC G;  1YBK A;  4Y28 J;  4H44 D;  3MIW A;  3AE9 C;  2J5U A;  1YQ3 C;  2YXQ B;  4HB1 A;  5KLI C;  1FZC C;  5KLV K;  5AW4 B;  1VQM P;  2AXT E;  2GA1 A;  4ZMD A;  3RK3 E;  5APQ A;  2E76 D;  5KJ7 A;  1NAY A;  1OXZ A;  3RL0 B;  2QSI A;  1ZLL A;  4XE5 B;  3P8C D;  2E74 B;  2YO2 A;  5KKZ B;  1JTH B;  1SFC D;  4WWI A;  3V2N A;  1SFC A;  1KYO H;  2QE7 H;  1WMK A;  2Z5I A;  1N7S B;  1NOH A;  3CX5 H;  1Y8A A;  2WSS H;  4ZNC A;  2FFD A;  1PL5 A;  3L73 E;  3RK3 C;  5DJU B;  1URQ B;  5CBO A;  4PD4 E;  3HE4 A;  2KK7 A;  1EZV I;  2KSE A;  1BE3 D;  2PGD A;  2WPS A;  3CCQ P;  2KSJ A;  1E5W A;  2Y0E A;  3L75 G;  4D6T E;  4U3F D;  1YIT P;  3K5B A;  5KAI H;  2LKM A;  3FXE A;  1X9V A;  1BCC J;  4GOF A;  3TYY A;  2IBZ I;  1LTG C;  2NPS D;  1GL2 A;  2NRG A;  3MUD C;  5KTB A;  3WUU A;  3SSU A;  1VQK P;  1KQS O;  2WVR A;  4OGQ C;  3CL3 D;  1LWU B;  1LGH B;  1KN7 A;  3CXH I;  2UWJ E;  1MV8 A;  3L75 E;  5GTH H;  1KMI Z;  1T8Z A;  3CC7 P;  5KLV J;  1LTJ C;  1URQ D;  2JDI H;  3RBZ A;  2BEQ D;  2FYU E;  3L70 E;  3H1K E;  2BEZ F;  4HJG H;  1RE3 A;  1XTC C;  2Y0D A;  3TNU A;  3W68 A;  4JBZ A;  1NTZ J;  4Y99 B;  3IFM A;  5AVZ B;  1Q90 D;  5AW2 B;  4EIJ A;  5CCH D;  2KIK A;  1SFC B;  2B87 B;  3M91 A;  3HTK B;  2JKV A;  1NU1 J;  2HG5 D;  3PP5 A;  3RL0 D;  1KIL B;  2WIT A;  1L0N E;  2WT7 A;  2SPZ A;  2IBZ G;  2FYN C;  1DH3 A;  4IL6 H;  3BRT B;  2IPP A;  1YHQ P;  1AA0 A;  1ZN5 A;  4K35 A;  3H6P A;  1FE6 A;  2FYN B;  4H44 B;  4PD4 H;  2ZJS E;  1L0N G;  1IK9 A;  2ZYD A;  1M57 D;  5AW8 B;  5KLV D;  1GU4 A;  1KIL C;  2AEF A;  4DOJ A;  1M90 Q;  1PFI A;  2B89 A;  2NPS A;  1ZP0 C;  3CCU P;  1ZW0 A;  2OYH A;  1SFC C;  5CJ4 A;  4GKG A;  3FX0 A;  2W90 A;  3Q5P A;  2GUV A;  3L72 G;  3VN0 A;  4Y99 C;  2W8Z A;  3D6Y A;  1JY3 N;  2K9J A;  3OAK A;  4PV1 D;  2WQY C;  2YKQ A;  1LTI C;  2A06 G;  1SQQ E;  2FXP A;  1OW7 A;  1YTZ I;  3I5C A;  1FZG A;  1DX7 A;  1LWU C;  2ZYA A;  1X22 A;  1PGJ A;  1VQP P;  4H0L C;  1JCC A;  3MUD A;  2XKM A;  5CHX A;  4XA4 A;  3HD7 A;  5B66 E;  3S4R A;  1YQ4 C;  1FU1 A;  1Q2N A;  4OGQ D;  1J1D C;  1OVR A;  3CME P;  2LR2 A;  1N73 C;  3GF7 A;  4W7Y A;  1HVV A;  1BE3 G;  1K05 A;  2C9N Y;  1GDT A;  1URQ C;  3V4Q A;  1H0T A;  1M56 D;  2CK3 H;  2NZ2 A;  2YXR B;  3RK3 B;  3S9O A;  1N7S C;  3HTK A;  4K3A A;  3CX5 E;  3FWN A;  1HTL C;  2XU6 A;  4H13 D;  2YMY A;  1GK4 A;  5KKZ C;  2A45 G;  4PD4 I;  1OFC X;  2VRS A;  4AYC A;  2O01 H;  4A7P A;  3CXH H;  5AVX B;  1PPJ E;  1S2E A;  3KDP B;  1BCC E;  4IOI H;  3VMA A;  3V4W A;  1S9K E;  1KQG B;  4HYT B;  1NTM E;  5TIS H;  1NTM D;  2A45 H;  2M3B A;  5H2F E;  1SQQ D;  3B5N A;  4EI2 A;  3Q2Y A;  2V7Q J;  2QEX P;  5KLI B;  1YI2 P;  1L4A B;  1S5L E;  1MFZ A;  1T3U A;  1GL2 D;  3CI9 A;  5E79 H;  1U7J A;  3PHL A;  2KI7 B;  2PP6 A;  5GTH E;  1QVG O;  4MN4 C;  4C46 A;  3H1H J;  3ITK A;  1J1E C;  1L0L G;  3WUT A;  1BGY D;  1M1J B;  1NTZ D;  3AE2 C;  1NTZ E;  3P7K A;  2IBZ D;  2QRX A;  3PRJ A;  3A2A A;  4PV1 C;  5APX A;  1SVF A;  2IDB A;  3MP7 B;  4L73 A;  3TDK A;  3T97 B;  4GT1 A;  5CCG C;  3L71 E;  4XFJ A;  2Y9Z A;  1IFP A;  1NO4 A;  2HLO A;  4R4M A;  3V5B A;  1JNM A;  2Q9I A;  3CCE P;  4H0L D;  5TJH A;  5AVR B;  1EDI A;  2AXC A;  2JR8 A;  1HJB A;  1VPC A;  3LW5 H;  4HH2 A;  1Y47 A;  1LTA C;  3AE3 C;  1UIX A;  4IL6 E;  3A0B H;  5APS A;  1BGY J;  3CCM P;  5B66 H;  2GUS A;  1L0N K;  3RK2 C;  3L71 G;  1EDK A;  5AVY B;  1GW4 A;  1D7M A;  4OH8 B;  1IO4 A;  1FDM A;  3NTN A;  1DEE G;  1GK6 A;  1FOS F;  2ZAE B;  5KLV G;  2E43 A;  1NH4 A;  5AW1 B;  3V6I A;  1N2D C;  5AW6 B;  3TGU D;  2FYU G;  1SQV D;  3H1H G;  2P58 A;  1OMI A;  2P10 A;  1LTT C;  2IFM A;  3EFG A;  3L70 G;  3H25 A;  1W2B O;  1GMJ A;  1N86 A;  1LTB C;  1FZB A;  1OVV A;  2N1T D;  2O01 N;  2OYO A;  1AQT A;  2R32 A;  1NU1 G;  1JMB A;  2IBZ E;  3GHG A;  2OTK E;  1RF1 B;  4GDO A;  4NPF X;  4RJT A;  4Z1M H;  2Z4E A;  4KHX A;  4EDF A;  1LP1 B;  3P32 A;  3Q3D A;  2QJY C;  1X8Y A;  1AVY A;  1GU5 A;  1NU1 E;  3N4X A;  3H1H E;  1RF0 C;  1NWQ A;  2FFD C;  1IFI A;  1BSN A;  1QL2 A;  1SQB D;  3MHV A;  2J58 A;  2WSC J;  4OVN F;  2KOG A;  2PFX A;  1Z56 A;  2C0X A;  5APY A;  1SQP K;  3VMX A;  1CI6 B;  1FS0 E;  1SQV J;  3M9B A;  3P8C E;  3ABV C;  3GG2 A;  2ZYG A;  2AEJ A;  1CI6 A;  2P67 A;  3R2P A;  1LT1 A;  1NJI Q;  2L91 A;  1KQF B;  1NTK G;  4AUW A;  3A3Y B;  3HD7 B;  1SQV G;  1PP9 G;  1LT9 B;  1HGZ A;  1RY3 A;  3AE6 C;  3H1K J;  3H1L G;  1S72 P;  1JUN A;  2QJK C;  2ZVN B;  4WY4 B;  2I1K A;  2WPV B;  3CCS P;  1KC8 Q;  1NTM J;  1S3J A;  2CPB A;  3M0D C;  2QJP B;  5AW0 B;  3SFD C;  3Q5S A;  2OYI C;  3E1R A;  5L8R J;  3G4S P;  1SQV E;  2E5Y A;  3SWK A;  1FZE A;  1KYO E;  2FY8 A;  2RMZ A;  1S1C X;  2H88 C;  3RK2 D;  1VQ7 P;  3CC2 P;  3B4S A;  4KT0 J;  1MUU A;  3BCC D;  2KS1 A;  5AW5 B;  1SQB K;  4R4L A;  1CSB A;  1PGQ A;  2YNY A;  1BDD A;  1PZQ A;  3H1K D;  3W67 A;  5KAF H;  2WTY A;  2M0B A;  2FXO A;  3II6 A;  4GOE A;  3TNU B;  1YYC A;  3AE5 C;  5H2F H;  3SWF A;  1VQ8 P;  4B86 A;  2OYI B;  3C9I A;  2IYP A;  2K9Y A;  3AEA C;  5C39 A;  3WMM 0;  1LTJ A;  1RE4 C;  3I56 P;  2BCC D;  2NPS C;  1R5S A;  2WPR A;  2WWW A;  3KHU A;  3L73 D;  2XZR A;  4WY4 C;  4D6T G;  2CPS A;  1VF5 B;  2XV5 A;  2YKO A;  4IFF A;  5AVQ B;  1IJD B;  2R5D A;  3EFF K;  1ZME C;  4ASW A;  5DJT B;  1H8A A;  3CX5 I;  2YMK A;  2FBW C;  3TGU G;  3GHG B;  4AQR D;  2O1K A;  3WUV A;  2R3S A;  2B88 A;  3H1I J;  1BDC A;  1M1K Q;  4IL6 X;  1L0L E;  5BU8 B;  1NTK D;  4CPG A;  1FC2 C;  2LXB A;  2N1T A;  1K9M Q;  1GZL A;  2IX7 C;  2P7J A;  1KYO D;  1G1I A;  1JB0 J;  2C0W A;  3TGU J;  1EZV E;  3VP9 A;  1NGM B;  2FFD B;  1AFO A;  3HE5 B;  1KZU B;  2Q5U A;  3Q1M A;  2QJY B;  1H88 A;  1HGV A;  1JY2 N;  1VF5 D;  1L0L K;  2OTL P;  3L72 J;  1SQB G;  3HUS C;  4D6T J;  2J59 M;  3VMY A;  2E75 B;  2W6A A;  1TU3 F;  1M8O B;  5CMZ A;  3FGA D;  3VP8 A;  2QM8 A;  3PJS K;  1N7S A;  1SQB J;  1QX8 A;  1LWU A;  3BCC G;  4EOT A;  3L74 G;  2JWD A;  4UB6 E;  3H1K G;  4JQ0 D;  3JSV C;  2RN0 A;  1IZN B;  3A7O A;  5APW A;  1QGK B;  5KLV E;  3RK2 B;  2KZJ A;  3L72 D;  4YPC A;  5GTI E;  4PD4 D;  5APV A;  2QA4 P;  1K73 Q;  3H1J E;  2DW3 A;  2B9B A;  1KYO I;  1NTK K;  5KJ7 C;  2QG4 A;  3HE4 B;  3U59 A;  1URQ A;  2KS1 B;  3AE4 C;  3M9H A;  2HYN A;  4N78 E;  4WY4 D;  3AE8 C;  5AVW B;  1L0L D;  2H89 C;  1BSH A;  4JYB A;  2Q1K A;  3AE1 C;  2KNC B;  2R44 A;  3B5N B;  3H1J G;  4UB6 H;  5CJ0 A;  1PP9 E;  2P1J A;  4GIF A;  3AED C;  5AVV B;  1M1J C;  3IR9 A;  3G3Z A;  1J1E B;  4PJ0 E;  4QMA A;  1VQO P;  3MZW B;  3KQG A;  5E79 E;  3AEB C;  1WRG A;  3FWL A;  4UB8 E;  1LT9 A;  1P84 H;  1Q7Y Q;  4WBA A;  2D2C D;  3O8Z A;  1Q81 Q;  1NHL A;  1G2C B;  2Q6Q A;  3PLN A;  3G71 P;  2KXP B;  3AEG C;  4RO0 A;  1H0T B;  1U7M A;  2GM4 A;  3NXS A;  2QIW A;  2H8P D;  5TIS E;  4O9B A;  4I6M C;  5AVS B;  1SQQ J;  1EQ7 A;  3M06 A;  1KOR A;  2IZ1 A;  1L0N J;  2ITA A;  3AEE C;  3H1L E;  3JCU H;  5GTI H;  1CW5 A;  1NTM G;  1ZRT E;  3TK1 A;  2K3R A;  1GL2 C;  2D2C B;  1JM0 A;  1LJ2 A;  1USD A;  1WT6 A;  3CX5 D;  1QL1 A;  2W27 A;  3JC2 2;  2W83 C;  4N6J A;  5CCG A;  1A02 F;  2BCC G;  2KLU A;  2QM7 A;  4C7N A;  1S9K D;  2HOD A;  4C7R A;  5APU A;  1NTK J;  1RF1 A;  1BE3 E;  4DT0 A;  3D71 A;  1BCC D;  3CPW O;  1YJW P;  3A0H E;  3GF3 A;  1ZV8 A;  1BGY G;  3B5N D;  3QWO C;  5K5G B;  1J1D B;  1N73 B;  1FJP A;  1LTS C;  2HFE D;  3IN6 A;  4GOD A;  5CCG D;  3USS A;  4DCK A;  1P84 I;  3AE7 C;  3E7K A;  3OJA B;  2QVA A;  1SQP G;  4YXW H;  2Q3I A;  4H0L B;  2LXC B;  4TLF A;  3BVH A;  2FXM A;  1PPJ G;  1NKN A;  1RQV A;  1EZV G;  2KZI A;  1BGY E;  2I8D A;  2O01 J;  1FBM A;  4LLH A;  2IYO A;  1FDO A;  3C8V A;  2M5A A;  1EXJ A;  1AQ5 A;  1JCD A;  1KIL A;  3H1L D;  3IAO A;  1YIJ P;  2YKP A;  2O1J A;  2G8Y A;  4W80 A;  1KV4 A;  1OVU A;  1NAF A;  2M8R A;  1PGP A;  2G3A A;  4YTP C;  2BAS A;  4ASV A;  2K1A A;  1QVF O;  1GL2 B;  2D2C C;  4I1L A;  3VOP A;  2PRR A;  2HPC A;  1L4A D;  1H89 A;  1EDL A;  1AV1 A;  2E75 D;  3L35 A;  4H44 C;  1K8A Q;  2OYI A;  1RQU A;  3V2P A;  5CCH A;  1HWT C; 
#chains in the Genus database with same CATH homology
 1SQQ K;  3E1I A;  2ZFC A;  1FZF A;  1ZR4 A;  4LGD E;  2YO3 A;  3T97 A;  1N73 A;  1LTJ B;  3M0D A;  2WSF H;  1HBW A;  2Q7C A;  2A45 I;  2FKW B;  2ZXE B;  1HWT C;  4WY4 A;  1JY2 P;  1MZ9 A;  2PAJ A;  3B5N C;  4ZKU A;  1SQV K;  1FJK A;  3MD0 A;  4DZO A;  1SLQ A;  3A5T A;  3VMZ A;  1JY2 O;  1NTZ K;  4LC1 A;  1CZQ A;  3SWY A;  1JY3 P;  3BAS A;  2C9L Y;  1NTM K;  1RE4 A;  2KLV A;  2L5G B;  3LIE A;  4C7N B;  2IFN A;  2POH A;  3CLQ A;  3RL0 C;  3VTP C;  4N78 D;  3H32 B;  2FYU K;  3NFQ A;  1JO5 A;  3HUS B;  2WT7 B;  2FYZ A;  1NKZ B;  1KIL D;  5AVU B;  1IFN A;  3HD7 D;  3BAT A;  3L4F A;  3BRV B;  1HUC A;  1KFM A;  1FZC A;  2WZ7 A;  3GHG C;  1RE3 C;  5BVZ A;  1SQX K;  2OYH C;  4WB4 A;  1RF0 A;  2NPS B;  1YTZ T;  1T2K D;  1FOS E;  3U1C A;  1KFN A;  2N1T B;  3VYI A;  3HRN A;  2Z5H A;  4ZKP A;  3N7N A;  1ZR2 A;  3HE5 A;  1GD2 E;  1N7S D;  1IFD A;  1SP4 A;  2MJZ A;  1IFJ A;  3B8E B;  1JTH A;  1HH0 A;  2XDJ A;  4RES B;  2KP8 A;  5KJ7 D;  1M1J A;  1J2J B;  1H88 A;  2I1J A;  5AW9 B;  1N7L A;  1LT9 C;  2KB7 P;  5AVT B;  3M9Q A;  3KYQ A;  1A02 J;  3HD7 C;  3L36 A;  1XTG B;  1GTW A;  1FZA A;  2OAR A;  3EQ2 A;  2W6B A;  2HPC B;  3UIA A;  4N3Y B;  3KPE A;  1JMM A;  2JJL A;  1L4A A;  2WSC H;  2E42 A;  1IC2 A;  2R3C A;  3H32 A;  5AW3 B;  1T2K C;  1RF1 C;  2H7H A;  1FZC B;  2P2U A;  2KYV A;  1T3J A;  4JF7 A;  4M3L A;  4W7Z A;  1GW3 A;  3RK3 D;  3V2R A;  4I2L C;  3NMD A;  1OWA A;  3HUS A;  3MTU E;  1JOC A;  2N1T C;  3P8M C;  2N9B A;  4JYC A;  1G2C A;  2JEE A;  1DEB A;  2XNX A;  3OA7 A;  1KQL A;  2HOD B;  5APT A;  2OYH B;  1M7L A;  3TSI A;  4IFM A;  3V2Q A;  1G1J A;  1JY3 O;  4IFD K;  3LID A;  1W2E A;  3L37 A;  5BU5 A;  5CCH C;  1VDF A;  1X79 B;  1NU1 K;  3U1A A;  2WPQ A;  5AW7 B;  1IFM A;  2R5B A;  1FAV A;  2WSE H;  1L4A C;  3MGN A;  3MIW A;  5KLV K;  5AW4 B;  5APQ A;  5KJ7 A;  1OXZ A;  3RL0 B;  1ZLL A;  4XE5 B;  3P8C D;  2YO2 A;  1JTH B;  1SFC D;  3V2N A;  1SFC A;  2Z5I A;  1N7S B;  1NOH A;  2FFD A;  3RK3 C;  1URQ B;  3HE4 A;  2WPS A;  2KSJ A;  1E5W A;  2LKM A;  1X9V A;  3TYY A;  1LTG C;  2NPS D;  1GL2 A;  5KTB A;  3CL3 D;  1LWU B;  1LGH B;  1MV8 A;  1T8Z A;  1LTJ C;  1URQ D;  3TNU A;  1RE3 A;  1XTC C;  2H43 A;  4Y99 B;  5AW2 B;  3IFM A;  5AVZ B;  4EIJ A;  5CCH D;  1SFC B;  3M91 A;  3HTK B;  2HG5 D;  3PP5 A;  3RL0 D;  1KIL B;  2WIT A;  2WT7 A;  1DH3 A;  3BRT B;  2IPP A;  1ZN5 A;  3H6P A;  2E43 A;  1IK9 A;  5AW8 B;  1GU4 A;  1KIL C;  4DOJ A;  1PFI A;  2NPS A;  2OYH A;  1SFC C;  5CJ4 A;  4GKG A;  2GUV A;  3VN0 A;  4Y99 C;  1JY3 N;  3OAK A;  2YKQ A;  1LTI C;  1YTZ I;  3I5C A;  1FZG A;  1DX7 A;  1LWU C;  1JCC A;  3MUD A;  2XKM A;  5CHX A;  4XA4 A;  3HD7 A;  1FU1 A;  1J1D C;  1N73 C;  4W7Y A;  1HVV A;  2C9N Y;  1GDT A;  1URQ C;  3V4Q A;  3RK3 B;  1N7S C;  3HTK A;  1HTL C;  2XU6 A;  2YMY A;  1GK4 A;  2A45 G;  4AYC A;  2VRS A;  2O01 H;  5AVX B;  3KDP B;  3V4W A;  1S9K E;  4HYT B;  2A45 H;  2M3B A;  3B5N A;  1L4A B;  1MFZ A;  1T3U A;  1GL2 D;  3CI9 A;  2PP6 A;  4C46 A;  1J1E C;  1M1J B;  3P7K A;  3A2A A;  5APX A;  1SVF A;  4GT1 A;  5CCG C;  1NO4 A;  2HLO A;  3V5B A;  2Q9I A;  1JNM A;  5AVR B;  1HJB A;  1VPC A;  3LW5 H;  4HH2 A;  1LTA C;  5APS A;  2GUS A;  1L0N K;  3RK2 C;  5AVY B;  1GW4 A;  4OH8 B;  1IO4 A;  1FDM A;  3NTN A;  1FOS F;  1GK6 A;  1NH4 A;  5AW1 B;  1N2D C;  5AW6 B;  3EFG A;  1LTT C;  2IFM A;  1N86 A;  1LTB C;  1FZB A;  2N1T D;  3M0A A;  1FZC C;  2R32 A;  1RF1 B;  3GHG A;  2Z4E A;  4KHX A;  3P32 A;  1X8Y A;  1GU5 A;  3N4X A;  1RF0 C;  1NWQ A;  2FFD C;  1IFI A;  1QL2 A;  2J58 A;  2KOG A;  1Z56 A;  2C0X A;  5APY A;  1SQP K;  3VMX A;  1CI6 B;  3P8C E;  3M9B A;  3R2P A;  1CI6 A;  2P67 A;  4AUW A;  3A3Y B;  3HD7 B;  1LT9 B;  1HGZ A;  1RY3 A;  1JUN A;  4WY4 B;  2I1K A;  2CPB A;  3M0D C;  5AW0 B;  2OYI C;  1FZE A;  3RK2 D;  1MUU A;  5AW5 B;  1SQB K;  1CSB A;  2YNY A;  2WTY A;  3II6 A;  3SWF A;  3TNU B;  1YYC A;  4B86 A;  2OYI B;  3C9I A;  3WMM 0;  1LTJ A;  1RE4 C;  2WPR A;  2NPS C;  4WY4 C;  2WWW A;  2XZR A;  2CPS A;  2XV5 A;  2YKO A;  4IFF A;  5AVQ B;  1IJD B;  2R5D A;  1H8A A;  3GHG B;  4AQR D;  2O1K A;  5BU8 B;  2N1T A;  1GZL A;  2IX7 C;  2P7J A;  1G1I A;  1AFO A;  2C0W A;  2FFD B;  3VP9 A;  3HE5 B;  1KZU B;  2Q5U A;  1HGV A;  1JY2 N;  1L0L K;  3HUS C;  2J59 M;  3VMY A;  2W6A A;  5CMZ A;  3VP8 A;  2QM8 A;  1N7S A;  1LWU A;  4EOT A;  5APW A;  3A7O A;  3RK2 B;  5APV A;  1NTK K;  5KJ7 C;  3HE4 B;  3U59 A;  1URQ A;  3M9H A;  2HYN A;  4N78 E;  4WY4 D;  5AVW B;  4JYB A;  3B5N B;  5CJ0 A;  2P1J A;  4GIF A;  5AVV B;  1M1J C;  3IR9 A;  3G3Z A;  1J1E B;  3KQG A;  1WRG A;  1LT9 A;  4WBA A;  3O8Z A;  1NHL A;  1G2C B;  2GM4 A;  3NXS A;  2H8P D;  4O9B A;  4I6M C;  5AVS B;  1EQ7 A;  3M06 A;  1CW5 A;  3TK1 A;  1GL2 C;  1WT6 A;  1A02 F;  1QL1 A;  2W27 A;  4N6J A;  5CCG A;  4C7N A;  2QM7 A;  1S9K D;  2HOD A;  4C7R A;  5APU A;  1RF1 A;  1N73 B;  1ZV8 A;  3B5N D;  1J1D B;  1FJP A;  1LTS C;  2HFE D;  5CCG D;  3OJA B;  2Q3I A;  3BVH A;  2FXM A;  1NKN A;  4LLH A;  1FBM A;  1AQ5 A;  1JCD A;  1KIL A;  2YKP A;  2O1J A;  4W80 A;  1NAF A;  2M8R A;  2BAS A;  1GL2 B;  4I1L A;  3VOP A;  2HPC A;  1L4A D;  1H89 A;  3L35 A;  2OYI A;  3V2P A;  5CCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...