2WSEJ

Improved model of plant photosystem i
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
42
structure length
42
Chain Sequence
MRDFKTYLSVAPVLSTLWFGSLAGLLIEINRFFPDALTFPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords AT3G54890
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
total genus 2
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2wseJ00
1Q90D 2FYNC 2YIUC 2D2CB 3LW5J 2WSEJ 4KT0J 2QJPC 4Y28J 1ZRTE 2E76B 4H13B 2ZT9B 2QJYC 2WPVB 3C8VA 4H0LB 2E74B 1S5LX 4RKUJ 1VF5B 5L8RJ 1JB0J 5KLIC 4PV1B 5KKZC 2QJKC 2WSFJ 4OGQB 2WSCJ 4I7ZB 2E75B 4IL6X 2QIWA 2QSIA 2K9YA 2O01J 4H44B
chains in the Genus database with same CATH superfamily
1EZVI 5APXA 5B5EE 2P58A 1X9VA 3BRTB 3B4SA 3WMM0 2Q7CA 2O3JA 1PPJD 3GHGA 4ZKPA 4EIJA 1NTZD 4M3LA 5DJTB 5AW1B 2CK3H 1SQVE 2K3RA 4IL6H 3ZDMA 1EDIA 1LTGC 3P8CD 4NPEA 1NTMD 1YBKA 1SQBJ 5APYA 2O1KA 1S5LE 2LKMA 3U59A 3CX5D 2QVAA 1AFOA 4BWNA 1EDLA 4N6JA 1S1CX 2E76B 3CXHI 1SQQJ 4AUWA 1KQLA 1S4XA 1SQPE 3A0BH 1JMMA 2QG4A 2FYZA 3H1JJ 5AW3B 2H88C 3OW2O 3AEBC 3RK3D 1RF0A 1T2KC 2I1JA 3LIEA 1MFZA 4HB1A 5KAFE 1ZRTE 5GTIE 2FXPA 2N9YB 3B5NA 1RQUA 2CPBA 2KS1B 2FYUG 1AA0A 3B8EB 3Q5PA 3K5BA 3U1AA 2FXMA 1U7JA 3RL0D 4R4MA 2N1TB 1VF5D 3AEFC 4W7ZA 2MKVA 3H1LE 5BVZA 1KTMA 1DX7A 3CCSP 5AVRB 1L0LE 1H88A 3F5HA 4IL6E 1SQXG 2ZT9D 2AEJA 3AE4C 4EOTA 2A06E 1KILA 1FZBA 1Q2NA 4EI2A 2XU6A 5CBOA 3GW6A 1SVFA 1J2JB 1OX3A 2QJKB 1NH4A 4WY4A 2KNCA 1KORA 1KMIZ 2KIKA 2M3BA 4MN4C 2B89A 1MKMA 4I2LC 1GK4A 4QMAA 1BGYG 2KYVA 1NTMJ 4OGQB 2W27A 3H1HG 1NTKG 2D2CD 3CXHH 1Q90D 3BRVB 1IFNA 4WY4B 1URQA 1P84I 2KNCB 3R2PA 3HD7C 5APSA 1YJWP 2L91A 2R5BA 1VDFA 3IF4A 2OYHC 3L75G 1JY2N 1X22A 3T97A 1N7SD 1NU1K 2YNYA 4ASWA 2OTJP 4IOIH 5APTA 1AJYA 2GA1A 2JP3A 3VMXA 1EZVE 1BE3E 1URQB 3FWLA 5AVWB 5KJ7A 5BU8B 2I8DA 2FYUJ 5APUA 5CCGC 2G8YA 1L4AB 3HTKA 4JBZA 2HYNA 3PRJA 1QX8A 2JJLA 1HF9A 2WSFJ 2ZAEB 1LWUC 1GTWA 3WUUA 2E5YA 2WMMA 1PGJA 1S9KD 3SWFA 1N7LA 4YXDC 1JCDA 3L73E 4L74A 3EWKA 2H43A 3IR9A 3SFEC 1G1JA 2B87A 1JTHB 3CXHE 4D6TG 1VQKP 3H1IG 3SWKA 1J1EB 2JEEA 5KLVD 1SS1A 2B88A 4PV1D 1VQ4P 5AVYB 3RGUA 3EFGA 1SQVK 1BCCE 1PL5A 1L0NG 3CX5I 4HKZH 1P84H 5CCHC 2WSEJ 2FFDC 1M8OB 2ZYGA 3H1HJ 1S2EA 3CCJP 1VQ7P 2HPCA 3G9RA 1SFCC 4I7ZC 3MZWB 2BCCE 1QEXA 2RH0A 2Z4EA 2IBZD 4H44D 3W68A 2QEXP 3M9BA 4WB4A 1OVUA 3H1KE 1SQPK 5AW0B 1T3UA 3GLMA 4H0LC 1QGKB 4IFDK 3KZIE 1KYOD 3L70G 3BASA 1OXZA 3PJSK 2WT7B 2K9JB 2MJZA 2P1JA 4Y99C 2Q5UA 3M9HA 4I1LA 1LNQA 4YXWH 4U3FD 1LGHB 3L71G 1U7MA 1DEEG 1SQBE 2J59M 3TGUD 1T2KD 3CCRP 3RK3B 1T6AA 2NPSC 3O6QA 1N73B 1JY2P 2PGDA 1KC8Q 4N3YB 3CD6P 3PLNA 2JKVA 1QL1A 3PP5A 3VMAA 2HODB 2LR2A 4H13C 1G2CB 1G1IA 1LP1B 3JC22 1Y9BA 3RL0B 3I55P 1KILD 1RF1C 1FE6A 1ZW0A 4D6TJ 5KLVJ 3CX5H 5B66H 4JYCA 4XA4A 3HUSB 4EDFA 5K5GB 1LT9B 1FDIA 1FOSF 3CWBE 2QJYC 2G3AA 1NKZB 1NO4A 4WWIA 3D70A 1M57D 1D7MA 3GF3A 4XE5B 1PZQA 1JY3N 1NYHA 4LC1A 2IFMA 1SQQG 5CJ0A 5AVZB 1GL2A 1OWAA 2XV5A 3H1JG 2J58A 1M1JB 2XNDH 3OJAB 2YXRB 4OVNF 3G71P 1XTCC 2OYIB 3JCUE 1DH3A 2FXOA 3IFMA 4BXLA 3Q2YA 2JWDA 1HH0A 3HD7D 1J1DB 3JSVC 4AYCA 3Q1MA 1GL2B 1LTJB 5GTHH 4C46A 1K8AQ 4U3FJ 1IK7A 2Y0CA 4BRYA 1FZCB 1FJKA 3RK2B 1ZLLA 4U7JA 3TGUJ 2IYOA 3L72G 4DOJA 3L72D 3C9IA 1RE4A 2O01H 4K35A 4PV1C 2GM4A 1YTZT 1PGPA 5CCGD 3BCCD 1T3JA 1K04A 3GHGC 1YQ4C 4BRYB 3VOPA 1N8RQ 1YQ3C 4DCKA 2YXQB 1PPJG 2JDIH 3LW5H 4L73A 1GW4A 2KP8A 1EDJA 4B86A 2HG5D 1NTZG 1RH5B 4GOEA 3D6YA 2H89C 3AEAC 1PV3A 1NU1D 1YHQP 2Q3EA 4H44C 3P32A 1NTMG 2ZVOB 2FYUE 4PD4E 3I5CA 3RBXA 2IX7C 3M06A 1KV4A 1K9MQ 5C39A 2IBZI 1JUNA 4TT3H 2KS1A 1RF0C 3Q5RA 2WWWA 4C7NA 1KYOI 3B5NC 2OGUA 3AEDC 2FKWB 3A7OA 5AVXB 1SQXE 3CMAP 1R5SA 2N1TA 5CCHD 1OW7A 4C7RA 4EYYQ 2E42A 5E79E 1IZNB 4GKGA 1EQ7A 1SFCD 2ZYDA 2DW3A 4R4LA 1PGOA 2Q1KA 2P7JA 2AEMA 1JEKA 2PFXA 4C7NB 2YO3A 3CPWO 5APWA 1USEA 1JY3P 3CC4P 4H0LD 2H7HA 3KHUA 1HGVA 4I6MC 1BGYE 1SQVD 2W83C 1KILC 1Q86Q 3S9OA 3H1HE 1NTKE 1YTZI 3TF5A 2M0BA 3L72J 1FU1A 3M0DA 1OIPA 1TU3F 1KB9I 1WRGA 2C0XA 2R5DA 2OARA 3L75E 3GF7A 1YI2P 2WSCJ 3A0HH 3Q5SA 1SQPD 1Q81Q 2NPSD 1NU1J 1NTZJ 2ZXXA 3N7NA 3C1LA 3A0BE 1ZRTD 1VQPP 1URQC 3SSUA 2YKQA 4RJTA 3FWNA 3ITKA 1FC2C 3PH0A 4H13D 4UB6H 4KT0J 3CI9A 2XZRA 1JB0J 1YYCA 1M7LA 1S9KE 3PHLA 3WU2H 1L4AA 2BEZF 3H1LD 2IFNA 3NXSA 1JOCA 1UIXA 3TNUB 5KJ7C 1X8YA 2E74C 4OH8B 4WBAA 2A06D 4W7YA 2YKPA 4JF7A 3L74G 1USDA 4D6TE 3H1IE 2KSEA 3L74D 4RESB 1IK9A 1J1EC 3V2QA 2V4HA 2KXPB 1L2PA 2Y0DA 5CMZA 3QWOC 3MD0A 1JTHA 5H2FH 3A0HE 1L0NE 1SQVJ 4CPGA 1PIXA 2E5TA 1KB9H 2WZ7A 1AQTA 1OW6A 1GDTA 3D6ZA 3V2PA 1HWTC 2QM8A 1FOSE 3IAOA 3HD7B 3AE1C 1KQSO 3ABVC 3KYQA 4N78E 4UB6E 5KLVG 1WT6A 4Y28J 1ZV8A 1CI6A 3V2RA 1DEBA 1SQPJ 4HH2A 3L70E 5AVVB 1ZXGA 5KAIH 1RQVA 1PP9G 3WU2E 2J5UA 3VP8A 1PP9D 2M5AB 1EZVD 2E76D 1BE3D 2K88A 3VN0A 3PTZA 2YIUC 1H0TB 1CSBA 3KXDA 1GW3A 3L71E 1LJ2A 1S5LX 2WT7A 2K9JA 3L36A 1CI6B 2IBZG 1LWUB 2LXCB 1KFNA 4LLHA 2POHA 1H89A 2W6AA 2QE7H 5H2FE 1SQXK 2IZ1A 2Q9IA 5CBNA 2ZXEB 4JQ0D 2NZ2A 2ZFCA 3L73D 1KB9E 4ZMDA 2HLOA 1N73A 1YITP 3L74J 4A7PA 2FYNB 3CC2P 3CXHD 3BVHA 4U3FG 1OVRA 1S3JA 3B5ND 2SPZA 3M9QA 1JMBA 2FY8A 3TGUG 2HODA 3L4FA 1FS0E 1AV1A 2WSSH 1G2CA 1LP1A 4GDOA 2WSCH 1Y47A 2I1KA 2FFDB 1NTKK 5KAIE 1YJ9P 3HUSA 1RE3A 1L0LK 1LT9A 3AE8C 5KLIB 3TDKA 1PFIA 1SFCB 4I7ZB 2WVRA 2E75C 1SQQE 4IL6X 3MUDA 1P84E 2M3EA 1DD4A 2K9YA 2JO1A 3V2NA 1NVOA 3H1JE 3EFFK 1GZLA 2BCCD 1IO4A 2E43A 2YMKA 3TSIA 3B71A 1K05A 3H32B 2KLUA 3AECC 4H0LB 4RKUJ 3CCUP 1VF5B 4OGQD 3H1KD 3LIDA 2ZYAA 2QM7A 5AVTB 2K1AA 4YPCA 3FGAD 1PP9J 1M1JA 4WY4D 3HE4A 2Q6QA 4Y99B 2QJPC 2ZT9B 1DD3A 1BE3J 1GL2C 1MFTA 2K37A 2OYIA 3RBZA 5TISH 1MUUA 2QRXA 5DJUB 3L72E 1SQBD 2O1JA 3KQGA 4IFMA 4HYTB 2V7QJ 2NPSB 1LTJA 5B5EH 5APVA 2LXBA 1URQD 3HE4B 1IJDB 3CL3D 1FZCA 2Y0EA 3MHVA 3AE2C 5CHXA 1ZR4A 2W8ZA 1EDKA 3HE5A 2OTKE 2N9BA 1N7SA 1KFMA 3CCEP 3L73J 2M8RA 1FZAA 2RKLA 2D2CB 2KZIA 2WSFH 2KSJA 4H13B 1RHZB 3EQ2A 1PPJE 1RF1B 1NTZE 2W90A 1HUCA 5KKZB 3G4SP 1RE4C 2QSIA 3P8CE 1N86A 1NAFA 1NTME 1AVOA 3VMYA 1VQ8P 5KJ7D 3H6PA 3HE5B 2KI7B 2QJYB 1L0NK 2E74D 1N7SB 3CX5E 2KUBA 3CWBD 5B66E 4LGDE 2KZJA 1GK6A 3VTPC 1NJIQ 3BCCG 1YIJP 2R32A 2E76C 5GTIH 3OAKA 2BCCJ 2WITA 3RK3E 2WSEH 1JNMA 1JY2O 3SWYA 1NU1G 3VYIA 2XDJA 3H1KJ 3F89A 3FXEA 2W6BA 1VQNP 2WPVB 2R44A 3FX0A 3M0AA 5AW8B 2RMZA 5AVQB 3AE5C 4RO0A 2BASA 2R3CA 2VRSA 3N4XA 1OZHA 3WUVA 5BU5A 2N1TC 5EFWB 1HBWA 3P8MC 5GTHE 3R4YA 4PV1B 1HGZA 1MV8A 1HTLC 1SLQA 2ZVNB 4L76A 2KOGA 2PAJA 2WQYC 1H8AA 1FZGA 3GHGB 1KZUB 5M1BA 1PGQA 1KQFB 1W2EA 3KPEA 2IZ0A 3UIAA 2QJKC 3V6IA 2W6JH 1HVVA 2O01N 2A45G 4H44B 3CCMP 3M0DC 1A02F 1SQVG 2HR3A 1FZEA 1SQBK 1QLED 3S1KA 4GT1A 1JO5A 1YJNP 2GUVA 4DT0A 4OGQC 1BSNA 2FYUD 3CWBJ 2YO2A 4IFFA 2XNXA 4PD4D 3KDPB 3BATA 1A02J 4WY4C 1OFCX 1SP4A 5AW2B 3RL0g 3BCCJ 2OYOA 1SQQK 2RN0A 1ZR2A 1LTAC 3VMZA 1HJ0A 3B5NB 1GD2E 1S72P 1SQPG 1NKNA 2WTYA 3MTUE 1QVFO 1SQXD 2FBWC 3L74E 3IN6A 2V7QH 3A3YB 2E75D 4KHXA 3GMAA 1LTIC 3TNUA 4JPZB 2KLVA 2GUSA 2ITAA 3TK1A 1L4AC 3V4WA 1IC2A 1KYOH 2QA4P 1AVYA 3I56P 1JCCA 5TJHA 1KILB 2AXCA 1R8EA 1FDOA 2UWJE 2C0WA 1BGYD 2KB7P 3TYYA 2Z5HA 3H1LG 3H1HD 1NTKD 4PJ0H 1Y8AA 1L0LG 1VQMP 1L0LD 1GL2D 2A06G 4TLFA 3MP7B 2C9NY 1X0TA 1OVVA 4GIFA 3II6A 3RK2D 5KLVE 1BDCA 1N2DC 2XKMA 4OWFA 3L75D 3HD7A 1NTZK 1PP9E 3FXDA 1KD1Q 5AW6B 3W67A 2OYHA 5AW9B 1NTMK 3AE9C 2Z5IA 1ZMEC 1IFJA 4DZOA 1VQ9P 1X79B 1QL2A 5AW7B 1LTTC 2M5AA 3T97B 1QVGO 2IBZE 3V4QA 1GU5A 3KZIH 3Q3DA 4AQRD 1JY3O 3G6EP 2L5GB 1FAVA 2YMYA 2YKOA 1H0TA 5CCGA 3A2AA 2OYHB 3D71A 2IYPA 1IFIA 1KYOE 1FJPA 3AE6C 1BDDA 3A5TA 5KTBA 4NPDA 2E74B 1LWUA 1SQXJ 3HTKB 2P2UA 1EC5A 4KJMA 2KK7A 4PJ0E 1EZVG 1BE3G 3NTNA 2CPSA 3NFQA 1M1KQ 2O01J 4U3FE 2FYUK 1M90Q 2FYNC 4D6TD 5CJ4A 3H1ID 1W2BO 1R5LA 3WUTA 1MZ9A 1HJBA 3GG2A 3C8VA 3TGUE 2Y9YA 3G3ZA 1LT1A 2R3SA 4ZNCA 2BEQD 4UB8H 2PRRA 3RK3C 1L0ND 1NWQA 1BGYJ 3LW5J 1IFDA 2B87B 1N73C 1BSHA 2ZJSE 2IDBA 1NTKJ 4O9BA 2Q3IA 2OTLP 3H1LJ 1CZQA 3L35A 2JR8A 3L73G 1GU4A 5KLIC 1L0LJ 5CCHA 1KN7A 3E1RA 1EXJA 1XTGB 2P67A 3QH9A 2FFDA 1JM0A 1VQOP 2WPRA 1KILE 4N78D 2N1TD 4DJGA 3O8ZA 2OQQA 2A45I 3RL0C 3L75J 1E79H 1SFCA 4W80A 1VF5C 1GMJA 1VL2A 2WPSA 3OA7A 2P10A 3HUSC 3L70D 1DIPA 1AQ5A 1RE3C 2HPCB 1VQ5P 2WPQA 3MGNA 1LT9C 4PD4I 1BCCG 3H32A 4L75A 5L8RJ 1NGMB 3CCQP 2YIUB 3MUDC 2ZT9C 1BCCD 4WVZA 3M91A 1FBMA 4YTPC 3L37A 3L71D 2QIWA 3AEEC 2BCCG 4HJGH 3JCUH 1Q7YQ 1M1JC 3H1KG 1FZFA 1Q82Q 4UB8E 1RY3A 2NPSA 1NOHA 4GOFA 2OYIC 3CCVP 2C9LY 3CCLP 2D2CC 1IFPA 1KB9D 5APQA 3S4RA 3H25A 1ZOYC 1WMKA 3USSA 1KQGB 1J1DC 3H1IJ 3O6QB 1LTJC 3V5BA 4XFJA 2AXTH 5AW5B 5KKZC 3SFDC 4ZKUA 2H8PD 3E7KA 1SQBG 1M56D 1FZCC 3RK2C 3NMDA 1K73Q 1RF1A 1IFMA 1N7SC 1ZN5A 1L0NJ 4ASVA 3BCCE 4K3AA 4GODA 2E75B 1LTSC 2HFED 2A45H 5AVUB 1UIIA 2B9BA 1L4AD 2AEFA 1SQQD 3CMEP 1P84D 2PP6A 4JYBA 1VQ6P 1VQLP 3H1JD 1OW8A 5KLVK 2JWAA 1NU1E 1Z56A 5AVSB 4PD4H 3VP9A 1E5WA 3CLQA 1S5LH 1FDMA 3L70J 3U1CA 1W5CE 2QJPB 3CWBG 4Z1MH 1VPCA 3AE3C 2IPPA 1NHLA 1BCCJ 2Y9ZA 1EXIA 3P7KA 1LTBC 2NRGA 1ZP0C 5AW4B 1U57A 3L71J 4NPFX 5KAFH 1CW5A 3AE7C 3CC7P 3E1IA 2AXTE 5E79H 3HRNA 1OMIA 1T8ZA 5TISE 3MIWA 3AEGC 1NAYA
chains in the Genus database with same CATH topology
4Y28J 2D2CB 2WSEJ 4KT0J 4H13C 4H13B 4R4MA 2OQQA 2FBWC 1VF5D 1Y9BA 1VF5C 3AEFC 3T97B 1AJYA 1GMJA 1RQVA 1VL2A 2JP3A 3G9RA 3IN6A 3Q3DA 3R4YA 2MKVA 1JB0J 4PV1C 2J5UA 3AE8C 4PV1B 1KTMA 4R4LA 2E75D 4I7ZC 2P10A 1DIPA 4I7ZB 2E75C 3GMAA 2E75B 4IL6X 2QSIA 1DD4A 4H44D 2K9YA 2JO1A 3D71A 1FDIA 2BEZF 2WQYC 2E76D 5L8RJ 1NGMB 2ZT9D 3AE4C 1K04A 2YIUC 2G8YA 2ZT9C 3AE6C 5M1BA 1YQ4C 2YMKA 2QJYC 1UIXA 1K05A 2G3AA 3B71A 4H0LD 2E74D 3GLMA 3AECC 4H0LC 2E74C 4H0LB 1KQFB 2E74B 1S5LX 1YQ3C 4RKUJ 1OW8A 4YTPC 1VF5B 3D70A 4OGQD 3S9OA 1R8EA 1FDOA 1HF9A 2QJKC 2WSFJ 3D6YA 2QIWA 3GF3A 2H89C 3AEAC 1PV3A 1KORA 1KMIZ 1NYHA 3AEEC 3FGAD 4H44C 2O01J 4H44B 2FYNC 2E76C 2QJPC 1S1CX 1TU3F 2E76B 4YXDC 2ZT9B 1DD3A 4Z1MH 1MKMA 3AE3C 3EWKA 3C8VA 3RK3E 2NZ2A 3SFEC 3GF7A 1EXIA 4OGQC 4OGQB 2WSCJ 2BEQD 2H88C 1PIXA 1ZP0C 3AEBC 1OW6A 3Q5SA 2D2CD 1U57A 2D2CC 1Q90D 3Q2YA 3LW5J 2V7QJ 3O6QA 3H25A 1ZRTE 4TT3H 3D6ZA 2FXPA 1ZOYC 1WMKA 2IDBA 2WPVB 1KQGB 3AE7C 3Q5RA 3IAOA 3RL0g 1RQUA 4PV1D 3Q1MA 3AE1C 1OMIA 3AE5C 4XFJA 5KLIC 1HJ0A 5KKZC 3AE2C 3AEGC 3AEDC 3SFDC 3ABVC 3Q5PA 1EXJA 1PL5A 1IK7A 3AE9C 1ZMEC 1OW7A 1KILE 4GDOA 4U7JA 4H13D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q90 D;  2FYN C;  2YIU C;  2D2C B;  3LW5 J;  2WSE J;  4KT0 J;  2QJP C;  4Y28 J;  1ZRT E;  2E76 B;  4H13 B;  2ZT9 B;  2QJY C;  2WPV B;  3C8V A;  4H0L B;  2E74 B;  1S5L X;  4RKU J;  1VF5 B;  5L8R J;  1JB0 J;  5KLI C;  4PV1 B;  5KKZ C;  2QJK C;  2WSF J;  4OGQ B;  2WSC J;  4I7Z B;  2E75 B;  4IL6 X;  2QIW A;  2QSI A;  2K9Y A;  2O01 J;  4H44 B; 
#chains in the Genus database with same CATH topology
 1EZV I;  5APX A;  5B5E E;  2P58 A;  1X9V A;  3BRT B;  3B4S A;  3WMM 0;  2Q7C A;  2O3J A;  1PPJ D;  3GHG A;  4ZKP A;  4EIJ A;  1NTZ D;  4M3L A;  5DJT B;  5AW1 B;  2CK3 H;  1SQV E;  2K3R A;  4IL6 H;  3ZDM A;  1EDI A;  1LTG C;  3P8C D;  4NPE A;  1NTM D;  1YBK A;  1SQB J;  5APY A;  2O1K A;  1S5L E;  2LKM A;  3U59 A;  3CX5 D;  2QVA A;  1AFO A;  4BWN A;  1EDL A;  4N6J A;  1S1C X;  2E76 B;  3CXH I;  1SQQ J;  4AUW A;  1KQL A;  1S4X A;  1SQP E;  3A0B H;  1JMM A;  2QG4 A;  2FYZ A;  3H1J J;  5AW3 B;  2H88 C;  3OW2 O;  3AEB C;  3RK3 D;  1RF0 A;  1T2K C;  2I1J A;  3LIE A;  1MFZ A;  4HB1 A;  5KAF E;  1ZRT E;  5GTI E;  2FXP A;  2N9Y B;  3B5N A;  1RQU A;  2CPB A;  2KS1 B;  2FYU G;  1AA0 A;  3B8E B;  3Q5P A;  3K5B A;  3U1A A;  2FXM A;  1U7J A;  3RL0 D;  4R4M A;  2N1T B;  1VF5 D;  3AEF C;  4W7Z A;  2MKV A;  3H1L E;  5BVZ A;  1KTM A;  1DX7 A;  3CCS P;  5AVR B;  1L0L E;  1H88 A;  3F5H A;  4IL6 E;  1SQX G;  2ZT9 D;  2AEJ A;  3AE4 C;  4EOT A;  2A06 E;  1KIL A;  1FZB A;  1Q2N A;  4EI2 A;  2XU6 A;  5CBO A;  3GW6 A;  1SVF A;  1J2J B;  1OX3 A;  2QJK B;  1NH4 A;  4WY4 A;  2KNC A;  1KOR A;  1KMI Z;  2KIK A;  2M3B A;  4MN4 C;  2B89 A;  1MKM A;  4I2L C;  1GK4 A;  4QMA A;  1BGY G;  2KYV A;  1NTM J;  4OGQ B;  2W27 A;  3H1H G;  1NTK G;  2D2C D;  3CXH H;  1Q90 D;  3BRV B;  1IFN A;  4WY4 B;  1URQ A;  1P84 I;  2KNC B;  3R2P A;  3HD7 C;  5APS A;  1YJW P;  2L91 A;  2R5B A;  1VDF A;  3IF4 A;  2OYH C;  3L75 G;  1JY2 N;  1X22 A;  3T97 A;  1N7S D;  1NU1 K;  2YNY A;  4ASW A;  2OTJ P;  4IOI H;  5APT A;  1AJY A;  2GA1 A;  2JP3 A;  3VMX A;  1EZV E;  1BE3 E;  1URQ B;  3FWL A;  5AVW B;  5KJ7 A;  5BU8 B;  2I8D A;  2FYU J;  5APU A;  5CCG C;  2G8Y A;  1L4A B;  3HTK A;  4JBZ A;  2HYN A;  3PRJ A;  1QX8 A;  2JJL A;  1HF9 A;  2WSF J;  2ZAE B;  1LWU C;  1GTW A;  3WUU A;  2E5Y A;  2WMM A;  1PGJ A;  1S9K D;  3SWF A;  1N7L A;  4YXD C;  1JCD A;  3L73 E;  4L74 A;  3EWK A;  2H43 A;  3IR9 A;  3SFE C;  1G1J A;  2B87 A;  1JTH B;  3CXH E;  4D6T G;  1VQK P;  3H1I G;  3SWK A;  1J1E B;  2JEE A;  5KLV D;  1SS1 A;  2B88 A;  4PV1 D;  1VQ4 P;  5AVY B;  3RGU A;  3EFG A;  1SQV K;  1BCC E;  1PL5 A;  1L0N G;  3CX5 I;  4HKZ H;  1P84 H;  5CCH C;  2WSE J;  2FFD C;  1M8O B;  2ZYG A;  3H1H J;  1S2E A;  3CCJ P;  1VQ7 P;  2HPC A;  3G9R A;  1SFC C;  4I7Z C;  3MZW B;  2BCC E;  1QEX A;  2RH0 A;  2Z4E A;  2IBZ D;  4H44 D;  3W68 A;  2QEX P;  3M9B A;  4WB4 A;  1OVU A;  3H1K E;  1SQP K;  5AW0 B;  1T3U A;  3GLM A;  4H0L C;  1QGK B;  4IFD K;  3KZI E;  1KYO D;  3L70 G;  3BAS A;  1OXZ A;  3PJS K;  2WT7 B;  2K9J B;  2MJZ A;  2P1J A;  4Y99 C;  2Q5U A;  3M9H A;  4I1L A;  1LNQ A;  4YXW H;  4U3F D;  1LGH B;  3L71 G;  1U7M A;  1DEE G;  1SQB E;  2J59 M;  3TGU D;  1T2K D;  3CCR P;  3RK3 B;  1T6A A;  2NPS C;  3O6Q A;  1N73 B;  1JY2 P;  2PGD A;  1KC8 Q;  4N3Y B;  3CD6 P;  3PLN A;  2JKV A;  1QL1 A;  3PP5 A;  3VMA A;  2HOD B;  2LR2 A;  4H13 C;  1G2C B;  1G1I A;  1LP1 B;  3JC2 2;  1Y9B A;  3RL0 B;  3I55 P;  1KIL D;  1RF1 C;  1FE6 A;  1ZW0 A;  4D6T J;  5KLV J;  3CX5 H;  5B66 H;  4JYC A;  4XA4 A;  3HUS B;  4EDF A;  5K5G B;  1LT9 B;  1FDI A;  1FOS F;  3CWB E;  2QJY C;  2G3A A;  1NKZ B;  1NO4 A;  4WWI A;  3D70 A;  1M57 D;  1D7M A;  3GF3 A;  4XE5 B;  1PZQ A;  1JY3 N;  1NYH A;  4LC1 A;  2IFM A;  1SQQ G;  5CJ0 A;  5AVZ B;  1GL2 A;  1OWA A;  2XV5 A;  3H1J G;  2J58 A;  1M1J B;  2XND H;  3OJA B;  2YXR B;  4OVN F;  3G71 P;  1XTC C;  2OYI B;  3JCU E;  1DH3 A;  2FXO A;  3IFM A;  4BXL A;  3Q2Y A;  2JWD A;  1HH0 A;  3HD7 D;  1J1D B;  3JSV C;  4AYC A;  3Q1M A;  1GL2 B;  1LTJ B;  5GTH H;  4C46 A;  1K8A Q;  4U3F J;  1IK7 A;  2Y0C A;  4BRY A;  1FZC B;  1FJK A;  3RK2 B;  1ZLL A;  4U7J A;  3TGU J;  2IYO A;  3L72 G;  4DOJ A;  3L72 D;  3C9I A;  1RE4 A;  2O01 H;  4K35 A;  4PV1 C;  2GM4 A;  1YTZ T;  1PGP A;  5CCG D;  3BCC D;  1T3J A;  1K04 A;  3GHG C;  1YQ4 C;  4BRY B;  3VOP A;  1N8R Q;  1YQ3 C;  4DCK A;  2YXQ B;  1PPJ G;  2JDI H;  3LW5 H;  4L73 A;  1GW4 A;  2KP8 A;  1EDJ A;  4B86 A;  2HG5 D;  1NTZ G;  1RH5 B;  4GOE A;  3D6Y A;  2H89 C;  3AEA C;  1PV3 A;  1NU1 D;  1YHQ P;  2Q3E A;  4H44 C;  3P32 A;  1NTM G;  2ZVO B;  2FYU E;  4PD4 E;  3I5C A;  3RBX A;  2IX7 C;  3M06 A;  1KV4 A;  1K9M Q;  5C39 A;  2IBZ I;  1JUN A;  4TT3 H;  2KS1 A;  1RF0 C;  3Q5R A;  2WWW A;  4C7N A;  1KYO I;  3B5N C;  2OGU A;  3AED C;  2FKW B;  3A7O A;  5AVX B;  1SQX E;  3CMA P;  1R5S A;  2N1T A;  5CCH D;  1OW7 A;  4C7R A;  4EYY Q;  2E42 A;  5E79 E;  1IZN B;  4GKG A;  1EQ7 A;  1SFC D;  2ZYD A;  2DW3 A;  4R4L A;  1PGO A;  2Q1K A;  2P7J A;  2AEM A;  1JEK A;  2PFX A;  4C7N B;  2YO3 A;  3CPW O;  5APW A;  1USE A;  1JY3 P;  3CC4 P;  4H0L D;  2H7H A;  3KHU A;  1HGV A;  4I6M C;  1BGY E;  1SQV D;  2W83 C;  1KIL C;  1Q86 Q;  3S9O A;  3H1H E;  1NTK E;  1YTZ I;  3TF5 A;  2M0B A;  3L72 J;  1FU1 A;  3M0D A;  1OIP A;  1TU3 F;  1KB9 I;  1WRG A;  2C0X A;  2R5D A;  2OAR A;  3L75 E;  3GF7 A;  1YI2 P;  2WSC J;  3A0H H;  3Q5S A;  1SQP D;  1Q81 Q;  2NPS D;  1NU1 J;  1NTZ J;  2ZXX A;  3N7N A;  3C1L A;  3A0B E;  1ZRT D;  1VQP P;  1URQ C;  3SSU A;  2YKQ A;  4RJT A;  3FWN A;  3ITK A;  1FC2 C;  3PH0 A;  4H13 D;  4UB6 H;  4KT0 J;  3CI9 A;  2XZR A;  1JB0 J;  1YYC A;  1M7L A;  1S9K E;  3PHL A;  3WU2 H;  1L4A A;  2BEZ F;  3H1L D;  2IFN A;  3NXS A;  1JOC A;  1UIX A;  3TNU B;  5KJ7 C;  1X8Y A;  2E74 C;  4OH8 B;  4WBA A;  2A06 D;  4W7Y A;  2YKP A;  4JF7 A;  3L74 G;  1USD A;  4D6T E;  3H1I E;  2KSE A;  3L74 D;  4RES B;  1IK9 A;  1J1E C;  3V2Q A;  2V4H A;  2KXP B;  1L2P A;  2Y0D A;  5CMZ A;  3QWO C;  3MD0 A;  1JTH A;  5H2F H;  3A0H E;  1L0N E;  1SQV J;  4CPG A;  1PIX A;  2E5T A;  1KB9 H;  2WZ7 A;  1AQT A;  1OW6 A;  1GDT A;  3D6Z A;  3V2P A;  1HWT C;  2QM8 A;  1FOS E;  3IAO A;  3HD7 B;  3AE1 C;  1KQS O;  3ABV C;  3KYQ A;  4N78 E;  4UB6 E;  5KLV G;  1WT6 A;  4Y28 J;  1ZV8 A;  1CI6 A;  3V2R A;  1DEB A;  1SQP J;  4HH2 A;  3L70 E;  5AVV B;  1ZXG A;  5KAI H;  1RQV A;  1PP9 G;  3WU2 E;  2J5U A;  3VP8 A;  1PP9 D;  2M5A B;  1EZV D;  2E76 D;  1BE3 D;  2K88 A;  3VN0 A;  3PTZ A;  2YIU C;  1H0T B;  1CSB A;  3KXD A;  1GW3 A;  3L71 E;  1LJ2 A;  1S5L X;  2WT7 A;  2K9J A;  3L36 A;  1CI6 B;  2IBZ G;  1LWU B;  2LXC B;  1KFN A;  4LLH A;  2POH A;  1H89 A;  2W6A A;  2QE7 H;  5H2F E;  1SQX K;  2IZ1 A;  2Q9I A;  5CBN A;  2ZXE B;  4JQ0 D;  2NZ2 A;  2ZFC A;  3L73 D;  1KB9 E;  4ZMD A;  2HLO A;  1N73 A;  1YIT P;  3L74 J;  4A7P A;  2FYN B;  3CC2 P;  3CXH D;  3BVH A;  4U3F G;  1OVR A;  1S3J A;  3B5N D;  2SPZ A;  3M9Q A;  1JMB A;  2FY8 A;  3TGU G;  2HOD A;  3L4F A;  1FS0 E;  1AV1 A;  2WSS H;  1G2C A;  1LP1 A;  4GDO A;  2WSC H;  1Y47 A;  2I1K A;  2FFD B;  1NTK K;  5KAI E;  1YJ9 P;  3HUS A;  1RE3 A;  1L0L K;  1LT9 A;  3AE8 C;  5KLI B;  3TDK A;  1PFI A;  1SFC B;  4I7Z B;  2WVR A;  2E75 C;  1SQQ E;  4IL6 X;  3MUD A;  1P84 E;  2M3E A;  1DD4 A;  2K9Y A;  2JO1 A;  3V2N A;  1NVO A;  3H1J E;  3EFF K;  1GZL A;  2BCC D;  1IO4 A;  2E43 A;  2YMK A;  3TSI A;  3B71 A;  1K05 A;  3H32 B;  2KLU A;  3AEC C;  4H0L B;  4RKU J;  3CCU P;  1VF5 B;  4OGQ D;  3H1K D;  3LID A;  2ZYA A;  2QM7 A;  5AVT B;  2K1A A;  4YPC A;  3FGA D;  1PP9 J;  1M1J A;  4WY4 D;  3HE4 A;  2Q6Q A;  4Y99 B;  2QJP C;  2ZT9 B;  1DD3 A;  1BE3 J;  1GL2 C;  1MFT A;  2K37 A;  2OYI A;  3RBZ A;  5TIS H;  1MUU A;  2QRX A;  5DJU B;  3L72 E;  1SQB D;  2O1J A;  3KQG A;  4IFM A;  4HYT B;  2V7Q J;  2NPS B;  1LTJ A;  5B5E H;  5APV A;  2LXB A;  1URQ D;  3HE4 B;  1IJD B;  3CL3 D;  1FZC A;  2Y0E A;  3MHV A;  3AE2 C;  5CHX A;  1ZR4 A;  2W8Z A;  1EDK A;  3HE5 A;  2OTK E;  2N9B A;  1N7S A;  1KFM A;  3CCE P;  3L73 J;  2M8R A;  1FZA A;  2RKL A;  2D2C B;  2KZI A;  2WSF H;  2KSJ A;  4H13 B;  1RHZ B;  3EQ2 A;  1PPJ E;  1RF1 B;  1NTZ E;  2W90 A;  1HUC A;  5KKZ B;  3G4S P;  1RE4 C;  2QSI A;  3P8C E;  1N86 A;  1NAF A;  1NTM E;  1AVO A;  3VMY A;  1VQ8 P;  5KJ7 D;  3H6P A;  3HE5 B;  2KI7 B;  2QJY B;  1L0N K;  2E74 D;  1N7S B;  3CX5 E;  2KUB A;  3CWB D;  5B66 E;  4LGD E;  2KZJ A;  1GK6 A;  3VTP C;  1NJI Q;  3BCC G;  1YIJ P;  2R32 A;  2E76 C;  5GTI H;  3OAK A;  2BCC J;  2WIT A;  3RK3 E;  2WSE H;  1JNM A;  1JY2 O;  3SWY A;  1NU1 G;  3VYI A;  2XDJ A;  3H1K J;  3F89 A;  3FXE A;  2W6B A;  1VQN P;  2WPV B;  2R44 A;  3FX0 A;  3M0A A;  5AW8 B;  2RMZ A;  5AVQ B;  3AE5 C;  4RO0 A;  2BAS A;  2R3C A;  2VRS A;  3N4X A;  1OZH A;  3WUV A;  5BU5 A;  2N1T C;  5EFW B;  1HBW A;  3P8M C;  5GTH E;  3R4Y A;  4PV1 B;  1HGZ A;  1MV8 A;  1HTL C;  1SLQ A;  2ZVN B;  4L76 A;  2KOG A;  2PAJ A;  2WQY C;  1H8A A;  1FZG A;  3GHG B;  1KZU B;  5M1B A;  1PGQ A;  1KQF B;  1W2E A;  3KPE A;  2IZ0 A;  3UIA A;  2QJK C;  3V6I A;  2W6J H;  1HVV A;  2O01 N;  2A45 G;  4H44 B;  3CCM P;  3M0D C;  1A02 F;  1SQV G;  2HR3 A;  1FZE A;  1SQB K;  1QLE D;  3S1K A;  4GT1 A;  1JO5 A;  1YJN P;  2GUV A;  4DT0 A;  4OGQ C;  1BSN A;  2FYU D;  3CWB J;  2YO2 A;  4IFF A;  2XNX A;  4PD4 D;  3KDP B;  3BAT A;  1A02 J;  4WY4 C;  1OFC X;  1SP4 A;  5AW2 B;  3RL0 g;  3BCC J;  2OYO A;  1SQQ K;  2RN0 A;  1ZR2 A;  1LTA C;  3VMZ A;  1HJ0 A;  3B5N B;  1GD2 E;  1S72 P;  1SQP G;  1NKN A;  2WTY A;  3MTU E;  1QVF O;  1SQX D;  2FBW C;  3L74 E;  3IN6 A;  2V7Q H;  3A3Y B;  2E75 D;  4KHX A;  3GMA A;  1LTI C;  3TNU A;  4JPZ B;  2KLV A;  2GUS A;  2ITA A;  3TK1 A;  1L4A C;  3V4W A;  1IC2 A;  1KYO H;  2QA4 P;  1AVY A;  3I56 P;  1JCC A;  5TJH A;  1KIL B;  2AXC A;  1R8E A;  1FDO A;  2UWJ E;  2C0W A;  1BGY D;  2KB7 P;  3TYY A;  2Z5H A;  3H1L G;  3H1H D;  1NTK D;  4PJ0 H;  1Y8A A;  1L0L G;  1VQM P;  1L0L D;  1GL2 D;  2A06 G;  4TLF A;  3MP7 B;  2C9N Y;  1X0T A;  1OVV A;  4GIF A;  3II6 A;  3RK2 D;  5KLV E;  1BDC A;  1N2D C;  2XKM A;  4OWF A;  3L75 D;  3HD7 A;  1NTZ K;  1PP9 E;  3FXD A;  1KD1 Q;  5AW6 B;  3W67 A;  2OYH A;  5AW9 B;  1NTM K;  3AE9 C;  2Z5I A;  1ZME C;  1IFJ A;  4DZO A;  1VQ9 P;  1X79 B;  1QL2 A;  5AW7 B;  1LTT C;  2M5A A;  3T97 B;  1QVG O;  2IBZ E;  3V4Q A;  1GU5 A;  3KZI H;  3Q3D A;  4AQR D;  1JY3 O;  3G6E P;  2L5G B;  1FAV A;  2YMY A;  2YKO A;  1H0T A;  5CCG A;  3A2A A;  2OYH B;  3D71 A;  2IYP A;  1IFI A;  1KYO E;  1FJP A;  3AE6 C;  1BDD A;  3A5T A;  5KTB A;  4NPD A;  2E74 B;  1LWU A;  1SQX J;  3HTK B;  2P2U A;  1EC5 A;  4KJM A;  2KK7 A;  4PJ0 E;  1EZV G;  1BE3 G;  3NTN A;  2CPS A;  3NFQ A;  1M1K Q;  2O01 J;  4U3F E;  2FYU K;  1M90 Q;  2FYN C;  4D6T D;  5CJ4 A;  3H1I D;  1W2B O;  1R5L A;  3WUT A;  1MZ9 A;  1HJB A;  3GG2 A;  3C8V A;  3TGU E;  2Y9Y A;  3G3Z A;  1LT1 A;  2R3S A;  4ZNC A;  2BEQ D;  4UB8 H;  2PRR A;  3RK3 C;  1L0N D;  1NWQ A;  1BGY J;  3LW5 J;  1IFD A;  2B87 B;  1N73 C;  1BSH A;  2ZJS E;  2IDB A;  1NTK J;  4O9B A;  2Q3I A;  2OTL P;  3H1L J;  1CZQ A;  3L35 A;  2JR8 A;  3L73 G;  1GU4 A;  5KLI C;  1L0L J;  5CCH A;  1KN7 A;  3E1R A;  1EXJ A;  1XTG B;  2P67 A;  3QH9 A;  2FFD A;  1JM0 A;  1VQO P;  2WPR A;  1KIL E;  4N78 D;  2N1T D;  4DJG A;  3O8Z A;  2OQQ A;  2A45 I;  3RL0 C;  3L75 J;  1E79 H;  1SFC A;  4W80 A;  1VF5 C;  1GMJ A;  1VL2 A;  2WPS A;  3OA7 A;  2P10 A;  3HUS C;  3L70 D;  1DIP A;  1AQ5 A;  1RE3 C;  2HPC B;  1VQ5 P;  2WPQ A;  3MGN A;  1LT9 C;  4PD4 I;  1BCC G;  3H32 A;  4L75 A;  5L8R J;  1NGM B;  3CCQ P;  2YIU B;  3MUD C;  2ZT9 C;  1BCC D;  4WVZ A;  3M91 A;  1FBM A;  4YTP C;  3L37 A;  3L71 D;  2QIW A;  3AEE C;  2BCC G;  4HJG H;  3JCU H;  1Q7Y Q;  1M1J C;  3H1K G;  1FZF A;  1Q82 Q;  4UB8 E;  1RY3 A;  2NPS A;  1NOH A;  4GOF A;  2OYI C;  3CCV P;  2C9L Y;  3CCL P;  2D2C C;  1IFP A;  1KB9 D;  5APQ A;  3S4R A;  3H25 A;  1ZOY C;  1WMK A;  3USS A;  1KQG B;  1J1D C;  3H1I J;  3O6Q B;  1LTJ C;  3V5B A;  4XFJ A;  2AXT H;  5AW5 B;  5KKZ C;  3SFD C;  4ZKU A;  2H8P D;  3E7K A;  1SQB G;  1M56 D;  1FZC C;  3RK2 C;  3NMD A;  1K73 Q;  1RF1 A;  1IFM A;  1N7S C;  1ZN5 A;  1L0N J;  4ASV A;  3BCC E;  4K3A A;  4GOD A;  2E75 B;  1LTS C;  2HFE D;  2A45 H;  5AVU B;  1UII A;  2B9B A;  1L4A D;  2AEF A;  1SQQ D;  3CME P;  1P84 D;  2PP6 A;  4JYB A;  1VQ6 P;  1VQL P;  3H1J D;  1OW8 A;  5KLV K;  2JWA A;  1NU1 E;  1Z56 A;  5AVS B;  4PD4 H;  3VP9 A;  1E5W A;  3CLQ A;  1S5L H;  1FDM A;  3L70 J;  3U1C A;  1W5C E;  2QJP B;  3CWB G;  4Z1M H;  1VPC A;  3AE3 C;  2IPP A;  1NHL A;  1BCC J;  2Y9Z A;  1EXI A;  3P7K A;  1LTB C;  2NRG A;  1ZP0 C;  5AW4 B;  1U57 A;  3L71 J;  4NPF X;  5KAF H;  1CW5 A;  3AE7 C;  3CC7 P;  3E1I A;  2AXT E;  5E79 H;  3HRN A;  1OMI A;  1T8Z A;  5TIS E;  3MIW A;  3AEG C;  1NAY A; 
#chains in the Genus database with same CATH homology
 4Y28 J;  2D2C B;  2WSE J;  4KT0 J;  4H13 C;  4H13 B;  4R4M A;  2OQQ A;  2FBW C;  1VF5 D;  1Y9B A;  1VF5 C;  3AEF C;  3T97 B;  1AJY A;  1GMJ A;  1RQV A;  1VL2 A;  2JP3 A;  3G9R A;  3IN6 A;  3Q3D A;  3R4Y A;  2MKV A;  1JB0 J;  4PV1 C;  2J5U A;  3AE8 C;  4PV1 B;  1KTM A;  4R4L A;  2E75 D;  4I7Z C;  2P10 A;  1DIP A;  4I7Z B;  2E75 C;  3GMA A;  2E75 B;  4IL6 X;  2QSI A;  1DD4 A;  4H44 D;  2K9Y A;  2JO1 A;  3D71 A;  1FDI A;  2BEZ F;  2WQY C;  2E76 D;  5L8R J;  1NGM B;  2ZT9 D;  3AE4 C;  1K04 A;  2YIU C;  2G8Y A;  2ZT9 C;  3AE6 C;  5M1B A;  1YQ4 C;  2YMK A;  2QJY C;  1UIX A;  1K05 A;  2G3A A;  3B71 A;  4H0L D;  2E74 D;  3GLM A;  3AEC C;  4H0L C;  2E74 C;  4H0L B;  1KQF B;  2E74 B;  1S5L X;  1YQ3 C;  4RKU J;  1OW8 A;  4YTP C;  1VF5 B;  3D70 A;  4OGQ D;  3S9O A;  1R8E A;  1FDO A;  1HF9 A;  2QJK C;  2WSF J;  3D6Y A;  2QIW A;  3GF3 A;  2H89 C;  3AEA C;  1PV3 A;  1KOR A;  1KMI Z;  1NYH A;  3AEE C;  3FGA D;  4H44 C;  2O01 J;  4H44 B;  2FYN C;  2E76 C;  2QJP C;  1S1C X;  1TU3 F;  2E76 B;  4YXD C;  2ZT9 B;  1DD3 A;  4Z1M H;  1MKM A;  3AE3 C;  3EWK A;  3C8V A;  3RK3 E;  2NZ2 A;  3SFE C;  3GF7 A;  1EXI A;  4OGQ C;  4OGQ B;  2WSC J;  2BEQ D;  2H88 C;  1PIX A;  1ZP0 C;  3AEB C;  1OW6 A;  3Q5S A;  2D2C D;  1U57 A;  2D2C C;  1Q90 D;  3Q2Y A;  3LW5 J;  2V7Q J;  3O6Q A;  3H25 A;  1ZRT E;  4TT3 H;  3D6Z A;  2FXP A;  1ZOY C;  1WMK A;  2IDB A;  2WPV B;  1KQG B;  3AE7 C;  3Q5R A;  3IAO A;  3RL0 g;  1RQU A;  4PV1 D;  3Q1M A;  3AE1 C;  1OMI A;  3AE5 C;  4XFJ A;  5KLI C;  1HJ0 A;  5KKZ C;  3AE2 C;  3AEG C;  3AED C;  3SFD C;  3ABV C;  3Q5P A;  1EXJ A;  1PL5 A;  1IK7 A;  3AE9 C;  1ZME C;  1OW7 A;  1KIL E;  4GDO A;  4U7J A;  4H13 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...