2WSEJ

Improved model of plant photosystem i
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
42
structure length
42
Chain Sequence
MRDFKTYLSVAPVLSTLWFGSLAGLLIEINRFFPDALTFPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT3G54890
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
total genus 2
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2wseJ00
1Q90D 4H13B 2O01J 4Y28J 2ZT9B 3C8VA 4PV1B 2WPVB 1ZRTE 1S5LX 2K9YA 2WSFJ 2E76B 4H0LB 4IL6X 2QSIA 4I7ZB 2E74B 3LW5J 4H44B 2QJPC 4RKUJ 2D2CB 5KLIC 5L8RJ 1VF5B 1JB0J 2YIUC 2WSCJ 2WSEJ 5KKZC 2E75B 2QJYC 4OGQB 4KT0J 2QIWA 2FYNC 2QJKC
chains in the Genus database with same CATH superfamily
4WBAA 3RK3C 1KILB 4XA4A 1LTGC 3ITKA 2A06D 4PD4E 4IFMA 5AW1B 5APVA 4W80A 1Q90D 4HKZH 3G4SP 4OGQC 4YTPC 4D6TD 5KJ7A 3LIDA 4WY4C 4N3YB 1VQ9P 3L73D 5KAIH 2NRGA 4JPZB 1EZVD 4Y28J 3HRNA 3C8VA 5TISH 1PPJD 4ZKUA 1IFPA 3BVHA 3VMZA 2IZ1A 1IO4A 1L0ND 2JWDA 1N73A 2Q9IA 1HBWA 2ITAA 1XTGB 3G6EP 1NU1E 2B9BA 3L74D 3L70E 1JY2P 1NU1J 3MP7B 3NFQA 1M8OB 3L4FA 2KYVA 2NPSA 1KYOH 4HH2A 1CI6B 2M3EA 3CC2P 1XTCC 3L36A 1S3JA 2C0WA 3V6IA 4I7ZC 4NPDA 1WRGA 3EQ2A 1NTZG 1VQLP 2IYPA 1UIXA 2HPCB 4GDOA 2IBZG 5KLVG 2OTJP 3BASA 2ZVNB 3CWBJ 3Q5SA 4I6MC 2KNCA 1SQPD 1JY3O 4H13C 3CCRP 1NTME 5B5EH 3I5CA 2BEQD 1NTMJ 1URQC 1ZMEC 3D70A 1NJIQ 1LNQA 1VF5C 2AEFA 3IFMA 2JEEA 2V7QJ 4I2LC 5DJUB 3HE4B 2K3RA 3L72D 2W27A 2M3BA 5E79E 1G2CA 1GL2D 1K73Q 3B5ND 1BGYE 1FZFA 1NU1K 1GMJA 5CCHD 1BGYJ 2YKOA 2WITA 2J58A 1BCCE 1RF1A 3CX5E 4JBZA 1BCCJ 1KFMA 3ABVC 3M06A 1FS0E 1W2EA 1EZVI 2W83C 3JCUH 3GLMA 1AFOA 1HJBA 4C7RA 1WMKA 2AXTE 1YBKA 3A7OA 1JNMA 3AEAC 1SFCD 1ZR4A 5KJ7C 1NWQA 1BE3G 4Y99B 1SQBE 1K8AQ 3SFEC 2OYHA 1SQBJ 3VMAA 3AECC 1FZCA 1MZ9A 4KT0J 1YJNP 3VP9A 1N86A 1L4AC 5AW0B 2QM7A 3A5TA 5K5GB 3OW2O 2A45I 2QJKB 1GTWA 2KIKA 3PHLA 5H2FE 1PP9D 2WSCJ 3B71A 2R5DA 4IL6E 3CCLP 3JC22 1N73C 3KHUA 1EDKA 1T2KC 2OARA 1M1JA 3II6A 3M9HA 1ZLLA 2BASA 3V4WA 1VQ5P 2NPSC 1DEEG 4IFDK 1KILD 1KV4A 1AQTA 4XFJA 1USDA 3L75G 3CXHD 2PP6A 1JY2O 3M9QA 3AE1C 3A0BH 2E42A 4OGQD 5AW8B 1SQQD 2HODA 1H0TB 4WY4D 2IX7C 4K3AA 4C7NB 1SQXD 3CXHH 3LW5J 1HWTC 2AEMA 3T97A 3KZIH 1LWUA 2H89C 1IZNB 1J1DB 2JO1A 1N8RQ 1VQ4P 5GTHH 4DOJA 2Z5HA 3C1LA 4ASWA 2PRRA 1RY3A 1SQVE 4PJ0H 1LGHB 3G3ZA 1S9KD 2YO2A 1TU3F 1S5LH 2E74C 4U3FG 3GW6A 2B88A 3GG2A 2ZFCA 2ZYDA 3H1HG 3H1KG 3D6YA 2KUBA 4AYCA 2BCCJ 2B87A 1JCCA 3FGAD 3VMXA 4UB8H 3O6QA 2A06E 1GW3A 3HTKB 5APTA 3HUSA 1AV1A 5CBNA 1K9MQ 4KJMA 1NHLA 2PGDA 4WWIA 3SWKA 1A02J 1NAYA 4D6TE 1NOHA 4WB4A 4B86A 3L73E 5TISE 3H6PA 1MFTA 2WQYC 2G8YA 2QRXA 1IK9A 3V5BA 1JMMA 1IC2A 2E75C 3S9OA 1EZVE 2H43A 4R4MA 5AW9B 1OVUA 1PPJE 5APUA 2Q3EA 1OFCX 2C9LY 3R2PA 4UB6E 1J1EB 1L0NE 3KYQA 1IJDB 1L0NJ 1FZCC 1VF5D 1NYHA 3TGUE 2FYUJ 3AE2C 2OYIA 2LXCB 3NMDA 3HD7A 1LP1B 3CXHI 3L74E 3MIWA 1N7SA 4LLHA 3L74J 4YXWH 4YXDC 4O9BA 1L0LK 1T8ZA 1M1JC 3P7KA 3PRJA 1KORA 2PAJA 1NTKD 3B5NB 1PGQA 1MUUA 2WWWA 2IFNA 2XV5A 2Y9YA 3S1KA 1X22A 3H25A 1Y9BA 4HB1A 5CJ4A 2FXMA 2YIUB 4NPEA 5B5EE 1LTIC 5KJ7D 1S72P 1NU1G 2YKQA 1LJ2A 2I8DA 2N1TA 1SQPE 3SFDC 1SQPJ 1EDLA 4ZKPA 2N9YB 2WSEH 4EOTA 1SFCB 5KLVD 5BU8B 1L4AD 1LWUC 1YYCA 1IK7A 1QLED 4HYTB 5C39A 1HJ0A 2E5YA 2HFED 3KQGA 4A7PA 1W2BO 4L76A 3L72E 2GUVA 1K04A 2FYUK 2QE7H 3L72J 1LTJA 2O01H 2QSIA 2M5AA 3JCUE 4H44B 2ZYGA 3CWBG 3BCCD 4AUWA 3RK3B 4DJGA 2Z4EA 4I1LA 1LTAC 3QWOC 1KD1Q 1LT1A 4QMAA 3HUSC 1QL1A 4BRYA 1U7MA 1FOSE 4OVNF 1X0TA 2FY8A 1U7JA 4OGQB 1QVGO 3OJAB 2ZXXA 4WY4B 2Q5UA 1EDJA 5GTIH 2YO3A 3CC7P 1SQPK 1YJWP 1BE3D 1HUCA 2E76C 2H88C 3U59A 2KXPB 1OMIA 3GF7A 1PP9E 1A02F 2IFMA 3H1JD 1JUNA 2OYIC 1D7MA 2J5UA 3HD7C 3FXDA 4JF7A 1N7SC 1JB0J 3A0BE 1KYOD 5KKZC 1FZAA 3OAKA 3TGUD 1KILE 1CZQA 1SQBG 2FXPA 2WVRA 3VP8A 4KHXA 3CXHE 1VQKP 1M90Q 2QA4P 2WPQA 3L70J 2J59M 4I7ZB 2IBZI 2QJPC 3KZIE 4GIFA 1SQQE 5AVSB 3CMEP 3A0HH 1YHQP 2LKMA 5KAFH 1SQQJ 1SQXE 5CHXA 2M0BA 5GTHE 3P32A 3MUDA 3V2QA 4PJ0E 1S5LE 5KLIC 1PV3A 3FWLA 2N1TC 4H0LC 4BXLA 2P2UA 2W8ZA 2VRSA 4H13B 5AVTB 1NH4A 1S9KE 1FZGA 2L5GB 3S4RA 1URQB 2W90A 4PV1C 4UB8E 1H89A 4GOEA 1VF5B 4MN4C 3D6ZA 3H1ID 3AE6C 4C7NA 3AEDC 1ZRTD 1SLQA 3RL0g 4U3FD 1LTBC 1S5LX 2V4HA 4RESB 2KZJA 3E7KA 1LTJC 3HE5A 3VN0A 3P8CD 2HYNA 1KN7A 2K9JA 3A2AA 4NPFX 1AVOA 1FJKA 3N4XA 3H1LD 3I56P 2LR2A 1BDDA 2DW3A 3IN6A 5AW7B 2YXQB 1RE3A 3RBZA 3CCSP 1FDMA 3G9RA 5DJTB 1L0LG 1PGPA 4W7ZA 1YJ9P 1OXZA 1OW6A 2BCCG 2KSEA 5CCGD 2WPSA 1FU1A 2O1JA 3WU2E 5CBOA 1KYOI 1R8EA 3FXEA 3JSVC 3TNUB 3AE3C 3QH9A 1L4AB 4DZOA 4HJGH 3FWNA 1RQVA 3Q5PA 1Q7YQ 3CC4P 4Z1MH 1KQLA 2WT7A 1N73B 3CPWO 1VPCA 1Y8AA 3B4SA 2ZYAA 4N78D 3G71P 1T3UA 1SP4A 1NTKE 1NTMK 2N9BA 3RK2C 1LT9A 1NTKJ 4PD4H 2NPSB 4H44D 2FYNC 1KQSO 5CMZA 2ZVOB 3RK3D 1VQNP 4YPCA 1PFIA 2FYUG 1KB9D 2RMZA 1IFJA 3GHGA 3CD6P 2OGUA 1NTZE 2FBWC 1AVYA 1QEXA 3CCVP 1KB9H 1EXIA 2IBZE 2WSFJ 3MUDC 5KLVE 3VTPC 2R3SA 1Q2NA 5L8RJ 1GL2A 2E76D 1NVOA 3L71G 3AEFC 1VQMP 2QVAA 1YIJP 1GU5A 4W7YA 4EI2A 2ZJSE 1N7LA 2KNCB 2D2CC 3GF3A 2O01J 3CCEP 2O01N 2QEXP 2GUSA 4K35A 2E74B 1GD2E 1N7SD 1SQBK 2LXBA 4EYYQ 2R5BA 1SQVJ 3BCCE 3PP5A 2MKVA 3BCCJ 1SQPG 2AXCA 2JP3A 3P8MC 2Y0EA 2XKMA 5AVWB 1S4XA 2SPZA 2OQQA 2ZT9C 1G2CB 2FFDA 4R4LA 3CWBD 5APSA 1S2EA 1NTKK 2FXOA 4C46A 5GTIE 1H8AA 1Q82Q 4WVZA 2O3JA 5KAIE 3VMYA 1VQOP 1JTHA 1RE3C 3L72G 1RF1C 1YQ4C 2ZXEB 3RL0B 2RH0A 4H0LD 1RE4A 4D6TJ 2E75B 4PD4I 2ZAEB 1OW7A 2IDBA 2KS1A 5APWA 1BE3E 1IFIA 3L73J 3FX0A 1KQGB 3RL0C 1KILA 3H1JE 5EFWB 5B66H 3H1JJ 4H13D 4PV1D 2XNDH 1FZCB 1YI2P 1NKZB 1VQ6P 1GK6A 2OYHC 1URQD 1KYOE 3AE7C 1KB9I 1KQFB 3TGUJ 5APQA 3A0HE 3KXDA 4DT0A 4JYCA 5KAFE 1JEKA 3CX5H 1FDIA 3CLQA 1M1JB 4LGDE 1SQVK 5APYA 1EXJA 1LT9C 3PLNA 3AEEC 3TK1A 4L73A 2MJZA 3KPEA 2AXTH 1M1KQ 2JDIH 3K5BA 3U1CA 2Q3IA 2IPPA 3TSIA 4L74A 4IFFA 1HGVA 5KTBA 3GHGC 3V4QA 2HODB 3M0AA 2JWAA 5APXA 1L2PA 2QM8A 1BSHA 1ZOYC 1LTSC 1NTZD 4GOFA 5AVQB 2Q7CA 1FJPA 3M91A 3T97B 1Y47A 3L70G 3H32B 1LWUB 1GL2C 1DEBA 1CI6A 2QJYC 2WSCH 2IBZD 3H1IE 4IL6H 3H1IJ 2YNYA 2RN0A 1ZW0A 1ZRTE 3PTZA 4U3FE 2W6JH 1DD4A 3MTUE 2IYOA 1YITP 1NAFA 1IFNA 3P8CE 2HPCA 1MFZA 3H1KE 1L0NK 1T2KD 3H1LE 2WSSH 2NZ2A 5AW6B 4RJTA 3H1LJ 2M8RA 2Q1KA 2B87B 2CPBA 2NPSD 3M9BA 2KI7B 3RBXA 1JM0A 3LW5H 3O6QB 1P84H 2FFDC 1H88A 3TF5A 1AA0A 3HUSB 1DD3A 3BATA 4L75A 1M7LA 1NTMG 5AVXB 2K1AA 2YXRB 1AJYA 5CJ0A 1EC5A 1L0LD 1U57A 2HG5D 3C9IA 1GW4A 2Y9ZA 3HE4A 1VQPP 1YTZT 1RE4C 2D2CD 3CCQP 2BCCD 3F5HA 2E76B 1VDFA 1KILC 1BGYG 3CI9A 2I1JA 1BCCG 4LC1A 1HH0A 1GDTA 2KZIA 4GT1A 2P58A 2OYIB 2E74D 4N78E 3OA7A 1J2JB 1VQ8P 3HD7B 3L37A 1PP9J 1N7SB 2WZ7A 5KKZB 1JOCA 3VYIA 3RK3E 2ZT9D 4RKUJ 1AQ5A 4OWFA 3TNUA 2XZRA 1CSBA 2K37A 1KB9E 1L4AA 2JJLA 3CCMP 1HF9A 1CW5A 2QJPB 1QVFO 4OH8B 1PL5A 2R44A 2FYUD 4AQRD 1JY3N 1GK4A 3B8EB 1SQXJ 3L75D 5AW2B 2GA1A 4UB6H 1BSNA 3WUVA 3RL0D 5KLIB 2R3CA 3V2RA 2CK3H 5BU5A 1NTKG 2E75D 2N1TB 3N7NA 4H0LB 5AVRB 4XE5B 1OVRA 3Q3DA 4N6JA 2L91A 1P84I 2JR8A 3CCUP 2FKWB 3L71D 4PV1B 2WPVB 4ZMDA 2A45H 2XDJA 2Y0DA 1PZQA 2Z5IA 4JQ0D 1H0TA 2XNXA 1RHZB 2Y0CA 2P1JA 3MZWB 1LTJB 5AVVB 3CWBE 2M5AB 1GZLA 3H1HD 3H1KD 1G1IA 2OTKE 4RO0A 5B66E 4BRYB 3L35A 1SQVG 3BCCG 1HVVA 2KLVA 3AE5C 1JMBA 5AW4B 2O1KA 1EDIA 3ZDMA 1SQQK 4TLFA 3I55P 1SQXK 2KP8A 2I1KA 1BDCA 1FAVA 1HGZA 1FBMA 1EQ7A 3R4YA 1RF0A 3HTKA 3V2NA 1VQ7P 2YMYA 2A06G 3WUTA 1JO5A 3F89A 3V2PA 2W6BA 1Z56A 1ZR2A 3AEBC 2PFXA 2POHA 1M57D 1FZBA 4D6TG 1JY2N 3KDPB 4ASVA 1PIXA 3L73G 4PD4D 1YTZI 3RK2B 2HR3A 1FOSF 2FYNB 1RH5B 4CPGA 3BRTB 1EZVG 1YQ3C 3H1JG 1NKNA 4Y99C 1PPJG 1NGMB 3W68A 1L0NG 3TDKA 3MGNA 2KOGA 2OTLP 3NTNA 3TGUG 2R32A 1LP1A 2WSEJ 2P10A 2OYOA 3WMM0 1NTZJ 3L74G 4IOIH 2QJKC 1GU4A 1Q81Q 4GODA 1DX7A 2CPSA 3Q2YA 1QX8A 3AE8C 5KLVJ 2D2CB 2E43A 1NU1D 4DCKA 2A45G 3L70D 3B5NA 5CCHA 3E1RA 2JKVA 2K88A 3AEGC 5M1BA 3SWYA 1T6AA 1P84E 4IL6X 1USEA 3CCJP 2H8PD 3HD7D 2IZ0A 1PGOA 5CCGA 1JCDA 3M0DA 4BWNA 2KLUA 1WT6A 3H32A 3EWKA 2ZT9B 3HE5B 2C0XA 2YKPA 3PH0A 1SFCA 2XU6A 2K9JB 3H1IG 1IFDA 3SWFA 1J1DC 2B89A 3PJSK 1KMIZ 1L0LE 1RQUA 2KB7P 1L0LJ 1RF1B 1MKMA 1NO4A 2K9YA 3E1IA 2BCCE 1NTMD 2WMMA 3Q1MA 3H1LG 1OIPA 2KSJA 1E5WA 3BRVB 1IFMA 1KFNA 4JYBA 1FZEA 1NTZK 2N1TD 1X9VA 1R5LA 5AVUB 1OVVA 5AVYB 3U1AA 1BE3J 1ZN5A 3IF4A 5AW3B 5KLVK 1QGKB 2OYHB 1X79B 1S1CX 2V7QH 3AE4C 1RF0C 5AW5B 3TYYA 1BGYD 1MV8A 3UIAA 1ZXGA 2RKLA 4ZNCA 1BCCD 2GM4A 1DH3A 3CX5D 2WT7B 1OW8A 5E79H 3MHVA 1LTTC 2YMKA 1KTMA 4WY4A 3RGUA 1PGJA 3CMAP 1G1JA 1KC8Q 1LT9B 2WTYA 4EDFA 2C9NY 3NXSA 2BEZF 2FYUE 3W67A 3AE9C 1ZP0C 5AVZB 1X8YA 2FYZA 1J1EC 1Q86Q 1SQBD 3L75E 3GHGB 3L75J 3WU2H 1FC2C 1PP9G 3MD0A 1K05A 5BVZA 1DIPA 1UIIA 3LIEA 2QIWA 1SVFA 3O8ZA 1VL2A 3CL3D 1T3JA 3L71E 1GL2B 3L71J 2QJYB 1R5SA 2Q6QA 3D71A 2AEJA 4U7JA 1KZUB 4EIJA 3B5NC 3SSUA 5H2FH 1FE6A 3EFGA 5CCHC 2QG4A 1SQQG 1ZV8A 1SQXG 3IAOA 2P7JA 1OWAA 2UWJE 4U3FJ 1M56D 1JY3P 2YIUC 5TJHA 3Q5RA 3EFFK 4GKGA 2G3AA 3H1HE 5CCGC 3M0DC 3RK2D 4M3LA 3H1HJ 3H1KJ 1E79H 1OZHA 1P84D 2HLOA 2H7HA 2FFDB 1SFCC 2WSFH 3VOPA 1HTLC 1URQA 4TT3H 1JTHB 3USSA 1FDOA 1QL2A 3WUUA 3A3YB 1SQVD 2P67A 3IR9A 2WPRA 1OX3A 1W5CE 1SS1A 3CX5I 2KS1B 2KK7A 2W6AA 1N2DC 3GMAA 4H44C 2E5TA
chains in the Genus database with same CATH topology
1K04A 1WMKA 1KQGB 1NYHA 1VF5D 2FXPA 2H89C 1VL2A 3AE2C 1ZRTE 1MKMA 1EXIA 1NGMB 2JO1A 2K9YA 2WSFJ 2QSIA 3AEAC 3G9RA 3Q1MA 4I7ZB 4H44B 3RK3E 2QJPC 2ZT9D 4H13D 4RKUJ 4PV1D 1DD4A 1UIXA 3D71A 5L8RJ 3IN6A 3SFEC 2E76D 4GDOA 2WSEJ 2P10A 1OW6A 3AECC 3AEFC 1TU3F 2E74C 4KT0J 4U7JA 4YXDC 2D2CC 2QJKC 1Q90D 3GF3A 2O01J 3AE7C 1HF9A 2NZ2A 1KQFB 3Q5SA 4OGQC 3IAOA 4YTPC 1R8EA 3Q2YA 1KORA 3D6YA 3AE8C 2E74B 4H13C 1S1CX 3AE4C 1PL5A 3AE3C 2D2CB 5KLIC 3AE5C 1PV3A 1FDIA 2YIUC 2WSCJ 3B71A 4H0LC 3Q5RA 2BEQD 3FGAD 4OGQB 2G3AA 1EXJA 3O6QA 1ZMEC 3D70A 3H25A 1Y9BA 1RQVA 2MKVA 1VF5C 3Q5PA 4H13B 2JP3A 4Y28J 4Z1MH 3C8VA 1OW8A 3AEEC 2YMKA 3AEGC 1KTMA 5M1BA 2V7QJ 2E75D 3R4YA 4H0LB 4IL6X 1AJYA 3Q3DA 2OQQA 2ZT9C 4PV1C 1VF5B 3SFDC 4XFJA 3D6ZA 1U57A 4R4LA 3AE6C 2E76C 2H88C 3AEDC 2WQYC 1OMIA 2G8YA 3AE1C 2BEZF 3AEBC 3GF7A 4H44D 4TT3H 2FYNC 2D2CD 3RL0g 3AE9C 3EWKA 1ZP0C 2ZT9B 1FDOA 1GMJA 4PV1B 2WPVB 1S5LX 2E75C 1IK7A 2E76B 1PIXA 4OGQD 3S9OA 3ABVC 1ZOYC 1KMIZ 4R4MA 3LW5J 1YQ4C 2J5UA 1HJ0A 3T97B 1K05A 1DIPA 1JB0J 2FBWC 4H0LD 5KKZC 3GLMA 2E75B 2QJYC 1YQ3C 4I7ZC 3GMAA 4H44C 1OW7A 1KILE 2QIWA 2E74D 2IDBA 1RQUA 1DD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q90 D;  4H13 B;  2O01 J;  4Y28 J;  2ZT9 B;  3C8V A;  4PV1 B;  2WPV B;  1ZRT E;  1S5L X;  2K9Y A;  2WSF J;  2E76 B;  4H0L B;  4IL6 X;  2QSI A;  4I7Z B;  2E74 B;  3LW5 J;  4H44 B;  2QJP C;  4RKU J;  2D2C B;  5KLI C;  5L8R J;  1VF5 B;  1JB0 J;  2YIU C;  2WSC J;  2WSE J;  5KKZ C;  2E75 B;  2QJY C;  4OGQ B;  4KT0 J;  2QIW A;  2FYN C;  2QJK C; 
#chains in the Genus database with same CATH topology
 4WBA A;  3RK3 C;  1KIL B;  4XA4 A;  1LTG C;  3ITK A;  2A06 D;  4PD4 E;  4IFM A;  5AW1 B;  5APV A;  4W80 A;  1Q90 D;  4HKZ H;  3G4S P;  4OGQ C;  4YTP C;  4D6T D;  5KJ7 A;  3LID A;  4WY4 C;  4N3Y B;  1VQ9 P;  3L73 D;  5KAI H;  2NRG A;  4JPZ B;  1EZV D;  4Y28 J;  3HRN A;  3C8V A;  5TIS H;  1PPJ D;  4ZKU A;  1IFP A;  3BVH A;  3VMZ A;  2IZ1 A;  1IO4 A;  1L0N D;  2JWD A;  1N73 A;  2Q9I A;  1HBW A;  2ITA A;  1XTG B;  3G6E P;  1NU1 E;  2B9B A;  3L74 D;  3L70 E;  1JY2 P;  1NU1 J;  3MP7 B;  3NFQ A;  1M8O B;  3L4F A;  2KYV A;  2NPS A;  1KYO H;  4HH2 A;  1CI6 B;  2M3E A;  3CC2 P;  1XTC C;  3L36 A;  1S3J A;  2C0W A;  3V6I A;  4I7Z C;  4NPD A;  1WRG A;  3EQ2 A;  1NTZ G;  1VQL P;  2IYP A;  1UIX A;  2HPC B;  4GDO A;  2IBZ G;  5KLV G;  2OTJ P;  3BAS A;  2ZVN B;  3CWB J;  3Q5S A;  4I6M C;  2KNC A;  1SQP D;  1JY3 O;  4H13 C;  3CCR P;  1NTM E;  5B5E H;  3I5C A;  2BEQ D;  1NTM J;  1URQ C;  1ZME C;  3D70 A;  1NJI Q;  1LNQ A;  1VF5 C;  2AEF A;  3IFM A;  2JEE A;  2V7Q J;  4I2L C;  5DJU B;  3HE4 B;  2K3R A;  3L72 D;  2W27 A;  2M3B A;  5E79 E;  1G2C A;  1GL2 D;  1K73 Q;  3B5N D;  1BGY E;  1FZF A;  1NU1 K;  1GMJ A;  5CCH D;  1BGY J;  2YKO A;  2WIT A;  2J58 A;  1BCC E;  1RF1 A;  3CX5 E;  4JBZ A;  1BCC J;  1KFM A;  3ABV C;  3M06 A;  1FS0 E;  1W2E A;  1EZV I;  2W83 C;  3JCU H;  3GLM A;  1AFO A;  1HJB A;  4C7R A;  1WMK A;  2AXT E;  1YBK A;  3A7O A;  1JNM A;  3AEA C;  1SFC D;  1ZR4 A;  5KJ7 C;  1NWQ A;  1BE3 G;  4Y99 B;  1SQB E;  1K8A Q;  3SFE C;  2OYH A;  1SQB J;  3VMA A;  3AEC C;  1FZC A;  1MZ9 A;  4KT0 J;  1YJN P;  3VP9 A;  1N86 A;  1L4A C;  5AW0 B;  2QM7 A;  3A5T A;  5K5G B;  3OW2 O;  2A45 I;  2QJK B;  1GTW A;  2KIK A;  3PHL A;  5H2F E;  1PP9 D;  2WSC J;  3B71 A;  2R5D A;  4IL6 E;  3CCL P;  3JC2 2;  1N73 C;  3KHU A;  1EDK A;  1T2K C;  2OAR A;  1M1J A;  3II6 A;  3M9H A;  1ZLL A;  2BAS A;  3V4W A;  1VQ5 P;  2NPS C;  1DEE G;  4IFD K;  1KIL D;  1KV4 A;  1AQT A;  4XFJ A;  1USD A;  3L75 G;  3CXH D;  2PP6 A;  1JY2 O;  3M9Q A;  3AE1 C;  3A0B H;  2E42 A;  4OGQ D;  5AW8 B;  1SQQ D;  2HOD A;  1H0T B;  4WY4 D;  2IX7 C;  4K3A A;  4C7N B;  1SQX D;  3CXH H;  3LW5 J;  1HWT C;  2AEM A;  3T97 A;  3KZI H;  1LWU A;  2H89 C;  1IZN B;  1J1D B;  2JO1 A;  1N8R Q;  1VQ4 P;  5GTH H;  4DOJ A;  2Z5H A;  3C1L A;  4ASW A;  2PRR A;  1RY3 A;  1SQV E;  4PJ0 H;  1LGH B;  3G3Z A;  1S9K D;  2YO2 A;  1TU3 F;  1S5L H;  2E74 C;  4U3F G;  3GW6 A;  2B88 A;  3GG2 A;  2ZFC A;  2ZYD A;  3H1H G;  3H1K G;  3D6Y A;  2KUB A;  4AYC A;  2BCC J;  2B87 A;  1JCC A;  3FGA D;  3VMX A;  4UB8 H;  3O6Q A;  2A06 E;  1GW3 A;  3HTK B;  5APT A;  3HUS A;  1AV1 A;  5CBN A;  1K9M Q;  4KJM A;  1NHL A;  2PGD A;  4WWI A;  3SWK A;  1A02 J;  1NAY A;  4D6T E;  1NOH A;  4WB4 A;  4B86 A;  3L73 E;  5TIS E;  3H6P A;  1MFT A;  2WQY C;  2G8Y A;  2QRX A;  1IK9 A;  3V5B A;  1JMM A;  1IC2 A;  2E75 C;  3S9O A;  1EZV E;  2H43 A;  4R4M A;  5AW9 B;  1OVU A;  1PPJ E;  5APU A;  2Q3E A;  1OFC X;  2C9L Y;  3R2P A;  4UB6 E;  1J1E B;  1L0N E;  3KYQ A;  1IJD B;  1L0N J;  1FZC C;  1VF5 D;  1NYH A;  3TGU E;  2FYU J;  3AE2 C;  2OYI A;  2LXC B;  3NMD A;  3HD7 A;  1LP1 B;  3CXH I;  3L74 E;  3MIW A;  1N7S A;  4LLH A;  3L74 J;  4YXW H;  4YXD C;  4O9B A;  1L0L K;  1T8Z A;  1M1J C;  3P7K A;  3PRJ A;  1KOR A;  2PAJ A;  1NTK D;  3B5N B;  1PGQ A;  1MUU A;  2WWW A;  2IFN A;  2XV5 A;  2Y9Y A;  3S1K A;  1X22 A;  3H25 A;  1Y9B A;  4HB1 A;  5CJ4 A;  2FXM A;  2YIU B;  4NPE A;  5B5E E;  1LTI C;  5KJ7 D;  1S72 P;  1NU1 G;  2YKQ A;  1LJ2 A;  2I8D A;  2N1T A;  1SQP E;  3SFD C;  1SQP J;  1EDL A;  4ZKP A;  2N9Y B;  2WSE H;  4EOT A;  1SFC B;  5KLV D;  5BU8 B;  1L4A D;  1LWU C;  1YYC A;  1IK7 A;  1QLE D;  4HYT B;  5C39 A;  1HJ0 A;  2E5Y A;  2HFE D;  3KQG A;  4A7P A;  1W2B O;  4L76 A;  3L72 E;  2GUV A;  1K04 A;  2FYU K;  2QE7 H;  3L72 J;  1LTJ A;  2O01 H;  2QSI A;  2M5A A;  3JCU E;  4H44 B;  2ZYG A;  3CWB G;  3BCC D;  4AUW A;  3RK3 B;  4DJG A;  2Z4E A;  4I1L A;  1LTA C;  3QWO C;  1KD1 Q;  1LT1 A;  4QMA A;  3HUS C;  1QL1 A;  4BRY A;  1U7M A;  1FOS E;  4OVN F;  1X0T A;  2FY8 A;  1U7J A;  4OGQ B;  1QVG O;  3OJA B;  2ZXX A;  4WY4 B;  2Q5U A;  1EDJ A;  5GTI H;  2YO3 A;  3CC7 P;  1SQP K;  1YJW P;  1BE3 D;  1HUC A;  2E76 C;  2H88 C;  3U59 A;  2KXP B;  1OMI A;  3GF7 A;  1PP9 E;  1A02 F;  2IFM A;  3H1J D;  1JUN A;  2OYI C;  1D7M A;  2J5U A;  3HD7 C;  3FXD A;  4JF7 A;  1N7S C;  1JB0 J;  3A0B E;  1KYO D;  5KKZ C;  1FZA A;  3OAK A;  3TGU D;  1KIL E;  1CZQ A;  1SQB G;  2FXP A;  2WVR A;  3VP8 A;  4KHX A;  3CXH E;  1VQK P;  1M90 Q;  2QA4 P;  2WPQ A;  3L70 J;  2J59 M;  4I7Z B;  2IBZ I;  2QJP C;  3KZI E;  4GIF A;  1SQQ E;  5AVS B;  3CME P;  3A0H H;  1YHQ P;  2LKM A;  5KAF H;  1SQQ J;  1SQX E;  5CHX A;  2M0B A;  5GTH E;  3P32 A;  3MUD A;  3V2Q A;  4PJ0 E;  1S5L E;  5KLI C;  1PV3 A;  3FWL A;  2N1T C;  4H0L C;  4BXL A;  2P2U A;  2W8Z A;  2VRS A;  4H13 B;  5AVT B;  1NH4 A;  1S9K E;  1FZG A;  2L5G B;  3S4R A;  1URQ B;  2W90 A;  4PV1 C;  4UB8 E;  1H89 A;  4GOE A;  1VF5 B;  4MN4 C;  3D6Z A;  3H1I D;  3AE6 C;  4C7N A;  3AED C;  1ZRT D;  1SLQ A;  3RL0 g;  4U3F D;  1LTB C;  1S5L X;  2V4H A;  4RES B;  2KZJ A;  3E7K A;  1LTJ C;  3HE5 A;  3VN0 A;  3P8C D;  2HYN A;  1KN7 A;  2K9J A;  3A2A A;  4NPF X;  1AVO A;  1FJK A;  3N4X A;  3H1L D;  3I56 P;  2LR2 A;  1BDD A;  2DW3 A;  3IN6 A;  5AW7 B;  2YXQ B;  1RE3 A;  3RBZ A;  3CCS P;  1FDM A;  3G9R A;  5DJT B;  1L0L G;  1PGP A;  4W7Z A;  1YJ9 P;  1OXZ A;  1OW6 A;  2BCC G;  2KSE A;  5CCG D;  2WPS A;  1FU1 A;  2O1J A;  3WU2 E;  5CBO A;  1KYO I;  1R8E A;  3FXE A;  3JSV C;  3TNU B;  3AE3 C;  3QH9 A;  1L4A B;  4DZO A;  4HJG H;  3FWN A;  1RQV A;  3Q5P A;  1Q7Y Q;  3CC4 P;  4Z1M H;  1KQL A;  2WT7 A;  1N73 B;  3CPW O;  1VPC A;  1Y8A A;  3B4S A;  2ZYA A;  4N78 D;  3G71 P;  1T3U A;  1SP4 A;  1NTK E;  1NTM K;  2N9B A;  3RK2 C;  1LT9 A;  1NTK J;  4PD4 H;  2NPS B;  4H44 D;  2FYN C;  1KQS O;  5CMZ A;  2ZVO B;  3RK3 D;  1VQN P;  4YPC A;  1PFI A;  2FYU G;  1KB9 D;  2RMZ A;  1IFJ A;  3GHG A;  3CD6 P;  2OGU A;  1NTZ E;  2FBW C;  1AVY A;  1QEX A;  3CCV P;  1KB9 H;  1EXI A;  2IBZ E;  2WSF J;  3MUD C;  5KLV E;  3VTP C;  2R3S A;  1Q2N A;  5L8R J;  1GL2 A;  2E76 D;  1NVO A;  3L71 G;  3AEF C;  1VQM P;  2QVA A;  1YIJ P;  1GU5 A;  4W7Y A;  4EI2 A;  2ZJS E;  1N7L A;  2KNC B;  2D2C C;  3GF3 A;  2O01 J;  3CCE P;  2O01 N;  2QEX P;  2GUS A;  4K35 A;  2E74 B;  1GD2 E;  1N7S D;  1SQB K;  2LXB A;  4EYY Q;  2R5B A;  1SQV J;  3BCC E;  3PP5 A;  2MKV A;  3BCC J;  1SQP G;  2AXC A;  2JP3 A;  3P8M C;  2Y0E A;  2XKM A;  5AVW B;  1S4X A;  2SPZ A;  2OQQ A;  2ZT9 C;  1G2C B;  2FFD A;  4R4L A;  3CWB D;  5APS A;  1S2E A;  1NTK K;  2FXO A;  4C46 A;  5GTI E;  1H8A A;  1Q82 Q;  4WVZ A;  2O3J A;  5KAI E;  3VMY A;  1VQO P;  1JTH A;  1RE3 C;  3L72 G;  1RF1 C;  1YQ4 C;  2ZXE B;  3RL0 B;  2RH0 A;  4H0L D;  1RE4 A;  4D6T J;  2E75 B;  4PD4 I;  2ZAE B;  1OW7 A;  2IDB A;  2KS1 A;  5APW A;  1BE3 E;  1IFI A;  3L73 J;  3FX0 A;  1KQG B;  3RL0 C;  1KIL A;  3H1J E;  5EFW B;  5B66 H;  3H1J J;  4H13 D;  4PV1 D;  2XND H;  1FZC B;  1YI2 P;  1NKZ B;  1VQ6 P;  1GK6 A;  2OYH C;  1URQ D;  1KYO E;  3AE7 C;  1KB9 I;  1KQF B;  3TGU J;  5APQ A;  3A0H E;  3KXD A;  4DT0 A;  4JYC A;  5KAF E;  1JEK A;  3CX5 H;  1FDI A;  3CLQ A;  1M1J B;  4LGD E;  1SQV K;  5APY A;  1EXJ A;  1LT9 C;  3PLN A;  3AEE C;  3TK1 A;  4L73 A;  2MJZ A;  3KPE A;  2AXT H;  1M1K Q;  2JDI H;  3K5B A;  3U1C A;  2Q3I A;  2IPP A;  3TSI A;  4L74 A;  4IFF A;  1HGV A;  5KTB A;  3GHG C;  3V4Q A;  2HOD B;  3M0A A;  2JWA A;  5APX A;  1L2P A;  2QM8 A;  1BSH A;  1ZOY C;  1LTS C;  1NTZ D;  4GOF A;  5AVQ B;  2Q7C A;  1FJP A;  3M91 A;  3T97 B;  1Y47 A;  3L70 G;  3H32 B;  1LWU B;  1GL2 C;  1DEB A;  1CI6 A;  2QJY C;  2WSC H;  2IBZ D;  3H1I E;  4IL6 H;  3H1I J;  2YNY A;  2RN0 A;  1ZW0 A;  1ZRT E;  3PTZ A;  4U3F E;  2W6J H;  1DD4 A;  3MTU E;  2IYO A;  1YIT P;  1NAF A;  1IFN A;  3P8C E;  2HPC A;  1MFZ A;  3H1K E;  1L0N K;  1T2K D;  3H1L E;  2WSS H;  2NZ2 A;  5AW6 B;  4RJT A;  3H1L J;  2M8R A;  2Q1K A;  2B87 B;  2CPB A;  2NPS D;  3M9B A;  2KI7 B;  3RBX A;  1JM0 A;  3LW5 H;  3O6Q B;  1P84 H;  2FFD C;  1H88 A;  3TF5 A;  1AA0 A;  3HUS B;  1DD3 A;  3BAT A;  4L75 A;  1M7L A;  1NTM G;  5AVX B;  2K1A A;  2YXR B;  1AJY A;  5CJ0 A;  1EC5 A;  1L0L D;  1U57 A;  2HG5 D;  3C9I A;  1GW4 A;  2Y9Z A;  3HE4 A;  1VQP P;  1YTZ T;  1RE4 C;  2D2C D;  3CCQ P;  2BCC D;  3F5H A;  2E76 B;  1VDF A;  1KIL C;  1BGY G;  3CI9 A;  2I1J A;  1BCC G;  4LC1 A;  1HH0 A;  1GDT A;  2KZI A;  4GT1 A;  2P58 A;  2OYI B;  2E74 D;  4N78 E;  3OA7 A;  1J2J B;  1VQ8 P;  3HD7 B;  3L37 A;  1PP9 J;  1N7S B;  2WZ7 A;  5KKZ B;  1JOC A;  3VYI A;  3RK3 E;  2ZT9 D;  4RKU J;  1AQ5 A;  4OWF A;  3TNU A;  2XZR A;  1CSB A;  2K37 A;  1KB9 E;  1L4A A;  2JJL A;  3CCM P;  1HF9 A;  1CW5 A;  2QJP B;  1QVF O;  4OH8 B;  1PL5 A;  2R44 A;  2FYU D;  4AQR D;  1JY3 N;  1GK4 A;  3B8E B;  1SQX J;  3L75 D;  5AW2 B;  2GA1 A;  4UB6 H;  1BSN A;  3WUV A;  3RL0 D;  5KLI B;  2R3C A;  3V2R A;  2CK3 H;  5BU5 A;  1NTK G;  2E75 D;  2N1T B;  3N7N A;  4H0L B;  5AVR B;  4XE5 B;  1OVR A;  3Q3D A;  4N6J A;  2L91 A;  1P84 I;  2JR8 A;  3CCU P;  2FKW B;  3L71 D;  4PV1 B;  2WPV B;  4ZMD A;  2A45 H;  2XDJ A;  2Y0D A;  1PZQ A;  2Z5I A;  4JQ0 D;  1H0T A;  2XNX A;  1RHZ B;  2Y0C A;  2P1J A;  3MZW B;  1LTJ B;  5AVV B;  3CWB E;  2M5A B;  1GZL A;  3H1H D;  3H1K D;  1G1I A;  2OTK E;  4RO0 A;  5B66 E;  4BRY B;  3L35 A;  1SQV G;  3BCC G;  1HVV A;  2KLV A;  3AE5 C;  1JMB A;  5AW4 B;  2O1K A;  1EDI A;  3ZDM A;  1SQQ K;  4TLF A;  3I55 P;  1SQX K;  2KP8 A;  2I1K A;  1BDC A;  1FAV A;  1HGZ A;  1FBM A;  1EQ7 A;  3R4Y A;  1RF0 A;  3HTK A;  3V2N A;  1VQ7 P;  2YMY A;  2A06 G;  3WUT A;  1JO5 A;  3F89 A;  3V2P A;  2W6B A;  1Z56 A;  1ZR2 A;  3AEB C;  2PFX A;  2POH A;  1M57 D;  1FZB A;  4D6T G;  1JY2 N;  3KDP B;  4ASV A;  1PIX A;  3L73 G;  4PD4 D;  1YTZ I;  3RK2 B;  2HR3 A;  1FOS F;  2FYN B;  1RH5 B;  4CPG A;  3BRT B;  1EZV G;  1YQ3 C;  3H1J G;  1NKN A;  4Y99 C;  1PPJ G;  1NGM B;  3W68 A;  1L0N G;  3TDK A;  3MGN A;  2KOG A;  2OTL P;  3NTN A;  3TGU G;  2R32 A;  1LP1 A;  2WSE J;  2P10 A;  2OYO A;  3WMM 0;  1NTZ J;  3L74 G;  4IOI H;  2QJK C;  1GU4 A;  1Q81 Q;  4GOD A;  1DX7 A;  2CPS A;  3Q2Y A;  1QX8 A;  3AE8 C;  5KLV J;  2D2C B;  2E43 A;  1NU1 D;  4DCK A;  2A45 G;  3L70 D;  3B5N A;  5CCH A;  3E1R A;  2JKV A;  2K88 A;  3AEG C;  5M1B A;  3SWY A;  1T6A A;  1P84 E;  4IL6 X;  1USE A;  3CCJ P;  2H8P D;  3HD7 D;  2IZ0 A;  1PGO A;  5CCG A;  1JCD A;  3M0D A;  4BWN A;  2KLU A;  1WT6 A;  3H32 A;  3EWK A;  2ZT9 B;  3HE5 B;  2C0X A;  2YKP A;  3PH0 A;  1SFC A;  2XU6 A;  2K9J B;  3H1I G;  1IFD A;  3SWF A;  1J1D C;  2B89 A;  3PJS K;  1KMI Z;  1L0L E;  1RQU A;  2KB7 P;  1L0L J;  1RF1 B;  1MKM A;  1NO4 A;  2K9Y A;  3E1I A;  2BCC E;  1NTM D;  2WMM A;  3Q1M A;  3H1L G;  1OIP A;  2KSJ A;  1E5W A;  3BRV B;  1IFM A;  1KFN A;  4JYB A;  1FZE A;  1NTZ K;  2N1T D;  1X9V A;  1R5L A;  5AVU B;  1OVV A;  5AVY B;  3U1A A;  1BE3 J;  1ZN5 A;  3IF4 A;  5AW3 B;  5KLV K;  1QGK B;  2OYH B;  1X79 B;  1S1C X;  2V7Q H;  3AE4 C;  1RF0 C;  5AW5 B;  3TYY A;  1BGY D;  1MV8 A;  3UIA A;  1ZXG A;  2RKL A;  4ZNC A;  1BCC D;  2GM4 A;  1DH3 A;  3CX5 D;  2WT7 B;  1OW8 A;  5E79 H;  3MHV A;  1LTT C;  2YMK A;  1KTM A;  4WY4 A;  3RGU A;  1PGJ A;  3CMA P;  1G1J A;  1KC8 Q;  1LT9 B;  2WTY A;  4EDF A;  2C9N Y;  3NXS A;  2BEZ F;  2FYU E;  3W67 A;  3AE9 C;  1ZP0 C;  5AVZ B;  1X8Y A;  2FYZ A;  1J1E C;  1Q86 Q;  1SQB D;  3L75 E;  3GHG B;  3L75 J;  3WU2 H;  1FC2 C;  1PP9 G;  3MD0 A;  1K05 A;  5BVZ A;  1DIP A;  1UII A;  3LIE A;  2QIW A;  1SVF A;  3O8Z A;  1VL2 A;  3CL3 D;  1T3J A;  3L71 E;  1GL2 B;  3L71 J;  2QJY B;  1R5S A;  2Q6Q A;  3D71 A;  2AEJ A;  4U7J A;  1KZU B;  4EIJ A;  3B5N C;  3SSU A;  5H2F H;  1FE6 A;  3EFG A;  5CCH C;  2QG4 A;  1SQQ G;  1ZV8 A;  1SQX G;  3IAO A;  2P7J A;  1OWA A;  2UWJ E;  4U3F J;  1M56 D;  1JY3 P;  2YIU C;  5TJH A;  3Q5R A;  3EFF K;  4GKG A;  2G3A A;  3H1H E;  5CCG C;  3M0D C;  3RK2 D;  4M3L A;  3H1H J;  3H1K J;  1E79 H;  1OZH A;  1P84 D;  2HLO A;  2H7H A;  2FFD B;  1SFC C;  2WSF H;  3VOP A;  1HTL C;  1URQ A;  4TT3 H;  1JTH B;  3USS A;  1FDO A;  1QL2 A;  3WUU A;  3A3Y B;  1SQV D;  2P67 A;  3IR9 A;  2WPR A;  1OX3 A;  1W5C E;  1SS1 A;  3CX5 I;  2KS1 B;  2KK7 A;  2W6A A;  1N2D C;  3GMA A;  4H44 C;  2E5T A; 
#chains in the Genus database with same CATH homology
 1K04 A;  1WMK A;  1KQG B;  1NYH A;  1VF5 D;  2FXP A;  2H89 C;  1VL2 A;  3AE2 C;  1ZRT E;  1MKM A;  1EXI A;  1NGM B;  2JO1 A;  2K9Y A;  2WSF J;  2QSI A;  3AEA C;  3G9R A;  3Q1M A;  4I7Z B;  4H44 B;  3RK3 E;  2QJP C;  2ZT9 D;  4H13 D;  4RKU J;  4PV1 D;  1DD4 A;  1UIX A;  3D71 A;  5L8R J;  3IN6 A;  3SFE C;  2E76 D;  4GDO A;  2WSE J;  2P10 A;  1OW6 A;  3AEC C;  3AEF C;  1TU3 F;  2E74 C;  4KT0 J;  4U7J A;  4YXD C;  2D2C C;  2QJK C;  1Q90 D;  3GF3 A;  2O01 J;  3AE7 C;  1HF9 A;  2NZ2 A;  1KQF B;  3Q5S A;  4OGQ C;  3IAO A;  4YTP C;  1R8E A;  3Q2Y A;  1KOR A;  3D6Y A;  3AE8 C;  2E74 B;  4H13 C;  1S1C X;  3AE4 C;  1PL5 A;  3AE3 C;  2D2C B;  5KLI C;  3AE5 C;  1PV3 A;  1FDI A;  2YIU C;  2WSC J;  3B71 A;  4H0L C;  3Q5R A;  2BEQ D;  3FGA D;  4OGQ B;  2G3A A;  1EXJ A;  3O6Q A;  1ZME C;  3D70 A;  3H25 A;  1Y9B A;  1RQV A;  2MKV A;  1VF5 C;  3Q5P A;  4H13 B;  2JP3 A;  4Y28 J;  4Z1M H;  3C8V A;  1OW8 A;  3AEE C;  2YMK A;  3AEG C;  1KTM A;  5M1B A;  2V7Q J;  2E75 D;  3R4Y A;  4H0L B;  4IL6 X;  1AJY A;  3Q3D A;  2OQQ A;  2ZT9 C;  4PV1 C;  1VF5 B;  3SFD C;  4XFJ A;  3D6Z A;  1U57 A;  4R4L A;  3AE6 C;  2E76 C;  2H88 C;  3AED C;  2WQY C;  1OMI A;  2G8Y A;  3AE1 C;  2BEZ F;  3AEB C;  3GF7 A;  4H44 D;  4TT3 H;  2FYN C;  2D2C D;  3RL0 g;  3AE9 C;  3EWK A;  1ZP0 C;  2ZT9 B;  1FDO A;  1GMJ A;  4PV1 B;  2WPV B;  1S5L X;  2E75 C;  1IK7 A;  2E76 B;  1PIX A;  4OGQ D;  3S9O A;  3ABV C;  1ZOY C;  1KMI Z;  4R4M A;  3LW5 J;  1YQ4 C;  2J5U A;  1HJ0 A;  3T97 B;  1K05 A;  1DIP A;  1JB0 J;  2FBW C;  4H0L D;  5KKZ C;  3GLM A;  2E75 B;  2QJY C;  1YQ3 C;  4I7Z C;  3GMA A;  4H44 C;  1OW7 A;  1KIL E;  2QIW A;  2E74 D;  2IDB A;  1RQU A;  1DD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...