2WSEJ

Improved model of plant photosystem i
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
42
structure length
42
Chain Sequence
b'MRDFKTYLSVAPVLSTLWFGSLAGLLIEINRFFPDALTFPFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT3G54890
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
total genus 2
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2wseJ00
1JB0J 2WPVB 1Q90D 4IL6X 4RKUJ 2QJYC 5L8RJ 2K9YA 4OGQB 2FYNC 5KKZC 2YIUC 3C8VA 2WSFJ 4Y28J 2O01J 4I7ZB 2WSEJ 2ZT9B 2E75B 2QSIA 4H0LB 2QJKC 3LW5J 1ZRTE 5KLIC 2E76B 2E74B 2WSCJ 4KT0J 2QJPC 4H44B 4PV1B 2QIWA 2D2CB 4H13B 1VF5B 1S5LX
chains in the Genus database with same CATH superfamily
3L36A 1LP1B 1Q7YQ 2Z5HA 1BE3E 2B87A 4GOFA 1PPJD 3LIEA 3AE5C 5CJ0A 1L0LK 1NVOA 1ZRTE 3CXHD 1S2EA 2IFMA 3L70G 1SS1A 4Z1MH 2AXTE 1R5LA 1KTMA 3EWKA 3B5NC 1M90Q 1LT1A 3M91A 3RL0B 3VP9A 2KNCB 3O6QA 2FY8A 2E76B 2B9BA 1NWQA 1SFCC 3AE6C 4BRYB 4L74A 1JTHB 1MKMA 3A0BE 3HTKA 4PV1C 1Q86Q 3E1IA 1LTJA 1OW8A 3OW2O 3SWKA 3RK3B 1D7MA 3B71A 4KJMA 1BGYE 1NOHA 1U7JA 1GK6A 3RK2C 3V6IA 2W83C 3CL3D 1U57A 2JP3A 2LXCB 2PFXA 5AW8B 2PP6A 5B66H 2H88C 1VQ4P 1R5SA 1W2EA 2AEMA 1Q82Q 3AE9C 3RL0g 1RQUA 3JC22 1T2KC 1PP9E 2PGDA 3WU2H 2IDBA 2QG4A 1IFIA 3L73G 1AFOA 2E75B 1PPJG 3A0HH 1N73C 2FFDB 2OYIB 3W68A 1NTKD 3FX0A 2A06D 2KB7P 3L72E 5M1BA 2P2UA 1NTZK 1N7SC 1JY2P 3H1LG 3MD0A 1PIXA 3KZIE 3P8MC 3TK1A 2WPQA 4PD4E 2UWJE 1N7LA 1H0TA 1RE4C 3HD7A 2P1JA 2N9YB 5BU8B 1EDIA 2YIUC 4HYTB 4PD4D 2FXMA 1H88A 1JMBA 2RKLA 5C39A 2N9BA 1S5LE 4ZKPA 1CI6B 3CXHH 2NPSD 5KJ7A 1SQVG 2O01N 4RKUJ 1YQ3C 3L74G 2QJKB 1KILB 3H1HE 3I5CA 4EDFA 1KB9E 1YYCA 2N1TA 3G4SP 3GF7A 2AXTH 1URQA 2O3JA 3GW6A 2NZ2A 3H1HD 5CCHA 2FYNC 2OYHC 1NTKJ 1QVFO 3KHUA 1SQQG 1BCCE 2ZVOB 2HR3A 2QE7H 1L4AD 2R44A 3PLNA 5CCHD 4N6JA 3F89A 1FZEA 1OVVA 3R4YA 1NTKG 2ZVNB 1BCCD 2A06G 3CCJP 4WY4A 1NYHA 3AEBC 1RH5B 1ZR4A 1PFIA 3CXHI 1L0LE 2ZT9D 1KC8Q 2KSEA 2PRRA 4GKGA 3GHGA 1E5WA 3AE7C 1LGHB 1GL2D 1SQPG 1KD1Q 1FZCC 1VDFA 1NAYA 2XNXA 2WZ7A 4DJGA 2QM7A 1DH3A 2P67A 4UB6E 3H1HJ 4LGDE 3CWBE 1IFPA 1FJKA 2C9NY 2D2CB 2FXPA 3GF3A 1LT9A 1PV3A 3CPWO 1YJWP 3KZIH 2E5YA 4PD4H 5KLVD 4RESB 1T6AA 3CWBD 2ZXEB 3KYQA 3AE8C 1AQTA 1EZVD 3HE5B 1BCCJ 3CC4P 2YO2A 1QGKB 4WVZA 2NPSC 1M7LA 1SVFA 1VQ9P 3NFQA 3V2RA 3A5TA 1RF1B 5GTIE 1QX8A 5DJTB 3VOPA 1S5LH 3L37A 2H89C 5EFWB 2RH0A 5H2FE 1SQVK 1FZGA 1OW6A 1G1IA 2MKVA 4JQ0D 4B86A 2WT7B 4UB8E 1N86A 2ZYAA 2FXOA 2G8YA 3MTUE 5APTA 2M5AB 2WMMA 3OAKA 2BASA 5E79E 1LP1A 1M1JB 1NTZE 1KZUB 2KUBA 1L4AC 1GU4A 2J59M 5APQA 3KQGA 3QH9A 1YHQP 3P7KA 2Q9IA 3Q5PA 3FXDA 1UIXA 3CI9A 1NTZD 2NRGA 1FDOA 3VMAA 2P58A 1GU5A 2ZT9C 1YQ4C 5KLVJ 4KT0J 3CWBJ 3CCQP 1NTKK 2IYOA 2KNCA 4OVNF 2A45G 1PZQA 3C8VA 4ZKUA 2E42A 2CPBA 1GL2C 4BRYA 1DEEG 1JTHA 2E43A 1TU3F 5GTHE 5KLVG 2E5TA 4KHXA 1EZVG 3L70E 1YITP 4H44B 1NU1G 2KIKA 1HH0A 4NPFX 2KZJA 4EI2A 3LW5H 4L73A 2Q3EA 1VQ6P 1JEKA 3HUSB 4K3AA 1Q81Q 1LTGC 1SQPK 5CHXA 3L70D 2AEJA 4W80A 3P32A 2GM4A 1E79H 3M06A 1L0ND 2QIWA 4GOEA 1Q90D 5KKZC 1HTLC 4UB6H 5CBOA 2XKMA 1QLED 2Y9YA 1HVVA 4H0LB 1VL2A 3CX5E 1KQLA 2ZAEB 1NTZJ 3M0DC 1JY3N 3A2AA 4K35A 2IZ0A 2FFDA 2QA4P 2OYIA 3CX5D 3BCCG 3V2PA 1IK9A 4I7ZC 2AEFA 2B89A 1LTAC 3P8CE 1RE3A 1FDIA 3SWYA 2ITAA 3TSIA 3C1LA 3D70A 4IL6X 2JWAA 2POHA 5GTIH 2LR2A 3H32B 1GDTA 4BWNA 1EC5A 1DX7A 3L73E 5H2FH 3P8CD 1PPJE 1VQPP 1KYOD 3ZDMA 5TISE 3V4WA 4YPCA 2W6BA 3RBXA 1AA0A 4YTPC 1JNMA 2A45I 3L70J 4UB8H 1K8AQ 3PH0A 3CC2P 3L73D 1CI6A 3MUDA 1ZR2A 1L0NJ 5E79H 1IFMA 1J1DB 3H1LE 2KK7A 4ASVA 1PL5A 2Z5IA 4IOIH 1EZVI 4C7NB 1M56D 5KLIC 1YJNP 1KILA 1L0NG 3H1LD 4H13D 1VF5D 1K04A 3VMYA 3II6A 2JDIH 1T8ZA 1LJ2A 3H1IG 3D6YA 4XE5B 3B5NB 2WVRA 1SQVE 3TNUB 4CPGA 2Z4EA 1CW5A 4L76A 4IFFA 5KLVK 5GTHH 2J5UA 4EIJA 2R32A 1SFCB 5APSA 3GG2A 1OMIA 3WUTA 3USSA 1SQVD 2OTLP 1X8YA 4PV1B 1VQLP 2HPCB 1FE6A 3L74D 2PAJA 1GK4A 2XDJA 2H43A 1SQQE 3SFDC 3RK2B 3L73J 4A7PA 2RN0A 5AW9B 2W90A 3BASA 2ZYGA 1KQGB 1VQOP 2WSSH 4PJ0E 4I2LC 1NTKE 1SQQD 2A06E 1WT6A 3CX5H 3KXDA 1R8EA 3H1LJ 5AW3B 2K9JB 3OA7A 3D6ZA 3AEDC 4N78D 4Y99C 1J1EC 2E74C 3L71J 1SQBD 4GDOA 2O01J 1LWUC 1N73B 3W67A 1VQ8P 3EQ2A 1J1EB 2OQQA 1KMIZ 4C7RA 3BVHA 1SQPE 5AVTB 1NAFA 2BCCD 3G3ZA 3L71G 3H1JD 1N7SB 3HE5A 3M9QA 1OVUA 1SQVJ 3BATA 5AVWB 3D71A 2GA1A 2DW3A 5AW5B 3L74J 5TISH 3T97B 1SQPD 3UIAA 2V4HA 3HD7D 1RF1A 1RF0A 2YIUB 1JCCA 3IN6A 4H13C 3PTZA 1VF5C 1JOCA 5AW1B 3TF5A 2Q5UA 5AW7B 3CX5I 2M0BA 1T3UA 1SQQJ 5KJ7D 1IO4A 5APWA 5APXA 2WT7A 2H7HA 2M5AA 1L0NK 2O01H 3L75G 1IZNB 1M1JA 3CCVP 4W7YA 2N1TD 3OJAB 3PRJA 4DCKA 2Y9ZA 1KN7A 1BGYG 3CLQA 3AEGC 1S72P 1URQD 1KYOI 1SQBJ 1P84D 4LC1A 2FYNB 2OYHB 1LTJC 2QVAA 3FGAD 5CMZA 1NTMG 2YMKA 2BCCJ 3H1JJ 3HE4B 1X22A 1X79B 3K5BA 1SQBG 3MP7B 1OVRA 3HRNA 1ZXGA 2YXQB 1ZW0A 3VTPC 3G6EP 1DIPA 1SQPJ 5AVSB 4WY4D 2BCCG 1EDKA 3IFMA 3I56P 4HJGH 2H8PD 3H1JG 4M3LA 1Q2NA 4HB1A 3CD6P 1KQSO 1ZP0C 1OIPA 3AE3C 5AVQB 2Q1KA 3AE2C 3CMAP 1USEA 3HUSA 2JKVA 2Q7CA 4PJ0H 1FOSF 1NHLA 1FAVA 2K9YA 1GW4A 1KQFB 3AE1C 2J58A 1M8OB 3CCLP 5KLVE 1FZCB 5CCGA 2HG5D 1EZVE 4WBAA 1LNQA 1FU1A 1Y8AA 1JCDA 2KXPB 3B8EB 2GUSA 2OTJP 1FZBA 3VYIA 3HD7C 1CSBA 1NU1D 5AVVB 2V7QJ 3Q2YA 3IAOA 2HODB 2P10A 5TJHA 2Q3IA 4ZMDA 4OGQD 2NPSB 2JO1A 4IFDK 1NGMB 5KJ7C 3CC7P 4AQRD 1YIJP 3H32A 3PP5A 1MFZA 3G71P 2FYUG 3N4XA 2N1TC 2XV5A 2ZYDA 3MHVA 2LXBA 3BCCE 1HGZA 1AVOA 2K88A 1URQC 3A7OA 4IFMA 1MUUA 5CCHC 4GIFA 3NMDA 3Q3DA 3S4RA 1NH4A 1ZV8A 3U1AA 4C7NA 3BCCD 1SQQK 3MZWB 2HLOA 4NPDA 3E7KA 1L4AB 2V7QH 1VPCA 2G3AA 1ZOYC 2QJPC 1BDDA 2I8DA 2OGUA 2R3SA 1NTMK 4WY4C 1NU1J 1QVGO 1RHZB 3RGUA 3VN0A 1SQBK 1VQNP 2ZT9B 3B5NA 3TNUA 3M9HA 3PJSK 3RL0D 2M3EA 3GHGC 2YMYA 3H1KG 1S5LX 4D6TG 2O1JA 3FXEA 2E76D 1GL2B 1SFCA 1L0NE 1SQXD 4OH8B 2KZIA 2KS1B 5AVZB 2HPCA 3O8ZA 1IFDA 2WITA 2FBWC 4I1LA 3TGUG 3I55P 2AXCA 3RK3D 1QEXA 3H1IE 1P84I 3CCUP 2A45H 3VMXA 1MV8A 2WSFJ 3WMM0 3H1ID 2MJZA 3BCCJ 4W7ZA 1VQMP 2IBZD 1LT9C 2R5BA 1JY3O 1JY2N 5KKZB 4XA4A 2K37A 3PHLA 2K9JA 1FJPA 5APUA 1WMKA 4OGQC 4OWFA 2WSEJ 2KSJA 4NPEA 2KOGA 4AUWA 1FDMA 4DOJA 3CCSP 2GUVA 2E75D 2JJLA 1KYOE 1N73A 2WPVB 2M3BA 1EDLA 4JYCA 2KLUA 1H8AA 1HF9A 4I7ZB 1S1CX 1SQXJ 1N7SA 2M8RA 3VP8A 3CCEP 1GW3A 1EXIA 2JEEA 2WSFH 5AVXB 1RE4A 3Q5SA 2HFED 3T97A 1NKNA 5KAFE 2L5GB 1GTWA 1AQ5A 2Y0DA 2WPSA 1S4XA 4MN4C 1G2CB 1SQXG 4N3YB 1JUNA 1YJ9P 4XFJA 1S3JA 5B5EE 2WSCJ 2Y0EA 4U3FD 3SSUA 3H1IJ 1H89A 1XTGB 3Q1MA 3L71E 2WSEH 1CZQA 4WWIA 3U59A 1YTZT 1IJDB 5CBNA 4YXWH 4RO0A 5KLIB 5AW0B 1NJIQ 2R3CA 1KILD 3RL0C 5BVZA 3L71D 1K73Q 2ZFCA 2JR8A 1OWAA 4HKZH 1BE3D 5APVA 2E76C 3M9BA 2IBZG 1EDJA 1AJYA 1L2PA 1ZRTD 3L74E 1S9KE 2OYHA 3RK3C 1NU1K 3ABVC 3GMAA 1BSHA 3HE4A 1VQKP 1UIIA 3L75E 1S9KD 1XTCC 2WSCH 2BEZF 2K3RA 2IZ1A 2OYOA 3L75D 1ZMEC 2YXRB 2I1KA 2C0WA 4N78E 3NTNA 1NTME 3MIWA 1BGYD 4U3FJ 5KAIE 1SQBE 1IC2A 2XU6A 2E75C 3GLMA 1PGPA 3AEEC 2FFDC 2ZXXA 1NTMD 2OYIC 4YXDC 1IK7A 2BCCE 4U3FG 1FZCA 3SFEC 3H1JE 1BE3J 2OTKE 2QSIA 1RE3C 2B88A 4Y99B 1PP9D 3JCUE 1IFJA 2CPSA 2E74B 2QEXP 1FOSE 1KYOH 1YTZI 1LTTC 3L35A 4O9BA 1LWUB 2D2CD 1BE3G 1JY3P 4ASWA 1HUCA 4R4MA 3AECC 1FZAA 3IF4A 2HODA 1IFNA 1FZFA 3L72D 1N8RQ 2IBZI 3V5BA 5KAFH 1JB0J 3MUDC 2NPSA 4JPZB 3AEAC 1SQXK 3L75J 1DEBA 4EOTA 2WPRA 3S9OA 4AYCA 5B5EH 2QJKC 2P7JA 1KILC 3R2PA 1BGYJ 2B87B 2R5DA 3H6PA 2YKOA 4H13B 1VF5B 3IR9A 1P84E 1HJ0A 3FWLA 2W8ZA 1LTSC 3LIDA 3NXSA 1NTMJ 1KFMA 1QL1A 3N7NA 5AW6B 3O6QB 4TT3H 1W2BO 1L4AA 1BDCA 1PP9J 4DZOA 1MFTA 1OFCX 1G1JA 1KB9D 3Q5RA 2FYZA 2FYUE 2RMZA 4Y28J 2IFNA 1RY3A 2IPPA 2IYPA 3EFFK 3HTKB 1OW7A 1GD2E 3JSVC 3MGNA 1LTJB 3A0BH 1X9VA 1J2JB 3FWNA 2W6AA 1PP9G 2FYUD 2LKMA 3A3YB 3L72J 4BXLA 1JMMA 3ITKA 4GODA 1HJBA 2KYVA 3V4QA 1GL2A 4IL6E 2ZJSE 2KS1A 4HH2A 3L72G 5KTBA 1YBKA 1K05A 4H44D 1KV4A 2WTYA 3V2QA 2CK3H 1L0LD 5KAIH 4JBZA 2SPZA 2L91A 3S1KA 1RQVA 1KFNA 1ZLLA 1OXZA 2KLVA 3H1KE 1NU1E 4D6TE 1PGOA 1EXJA 5L8RJ 2D2CC 1M1KQ 1Y9BA 3JCUH 5CCGD 4LLHA 3H1KD 4D6TD 3TGUE 2I1JA 1DD3A 4TLFA 4H0LD 1X0TA 2C0XA 4C46A 5APYA 1H0TB 1AVYA 2QJYC 3M0DA 4WB4A 2KI7B 3HD7B 3H1HG 2QRXA 3TDKA 1AV1A 2FYUJ 1JM0A 3TGUD 3WUUA 1RF1C 1NO4A 1RF0C 1FC2C 2QJYB 3RBZA 3E1RA 2YKQA 1QL2A 1BSNA 4JYBA 1DD4A 2YNYA 1Y47A 2JWDA 2YKPA 1BCCG 2HYNA 2K1AA 3CMEP 5BU5A 1PGJA 2BEQD 4ZNCA 3VMZA 1L0LJ 1LTIC 1M1JC 1P84H 2N1TB 2WWWA 1G2CA 1MZ9A 1JO5A 1GZLA 1KB9H 1PGQA 5AVRB 1URQB 4U7JA 3LW5J 3KPEA 3TYYA 1L0LG 1HGVA 3QWOC 5CJ4A 4I6MC 3M0AA 3H1KJ 4D6TJ 3G9RA 2O1KA 4PD4I 4RJTA 4R4LA 1VQ5P 1SQXE 2QJPB 3U1CA 3WUVA 1Z56A 3BRTB 4WY4B 5AW2B 3TGUJ 5AW4B 1OX3A 2KP8A 3RK3E 1EQ7A 1U7MA 3BRVB 4H44C 1SP4A 2W6JH 3B5ND 3L4FA 1NKZB 3SWFA 3GHGB 4IL6H 2Y0CA 3HUSC 3CWBG 2FKWB 1N2DC 4QMAA 1FS0E 3F5HA 1OZHA 1SFCD 4EYYQ 2IBZE 4JF7A 3KDPB 1KB9I 4PV1D 2XNDH 1T3JA 5DJUB 3C9IA 5CCGC 2Q6QA 2VRSA 4DT0A 3CCRP 5B66E 4H0LC 5K5GB 3CCMP 3RK2D 1LTBC 1ZN5A 1JY2O 2W27A 3WU2E 3B4SA 2QM8A 1W5CE 1LT9B 1A02J 1HWTC 1M57D 2WQYC 3A0HE 5AVYB 2OARA 3H25A 1T2KD 1FBMA 4L75A 4OGQB 1K9MQ 1USDA 2C9LY 2IX7C 3AEFC 1VQ7P 1NTZG 3V2NA 1LWUA 3EFGA 1A02F 1YI2P 2XZRA 2FYUK 2E74D 4GT1A 1WRGA 1GMJA 1SLQA 4U3FE 1HBWA 3AE4C 1N7SD 1KORA 1J1DC 5AVUB 2YO3A 3CXHE 1KILE
chains in the Genus database with same CATH topology
2E76C 2NZ2A 3D70A 3GF3A 4IL6X 3IN6A 2K9YA 1PV3A 1DD4A 2IDBA 1VF5C 4H13C 2FYNC 4PV1D 1KQFB 2D2CD 3AE1C 3C8VA 1AJYA 1WMKA 4OGQC 3AE5C 4R4MA 3AECC 2WSEJ 3SFDC 2E75B 3AE8C 1TU3F 2G3AA 1ZRTE 1ZOYC 2BEQD 3ABVC 3GMAA 4H0LC 2QJPC 2E75D 4H44B 4YTPC 1KQGB 4Z1MH 1JB0J 2WPVB 1KTMA 3R4YA 1K05A 4H44D 3AEAC 5M1BA 3EWKA 1HF9A 1NYHA 4I7ZB 3AEBC 1PIXA 1S1CX 2ZT9B 3O6QA 3S9OA 4U7JA 2QJKC 1R8EA 1PL5A 2H89C 1RQVA 3AEGC 3LW5J 2BEZF 5KLIC 2E76B 2WQYC 1EXIA 2ZT9D 3D6ZA 3AEDC 2V7QJ 1OW6A 3Q2YA 3AE6C 2QIWA 4H13B 1VF5B 1ZMEC 1S5LX 3Q5SA 3H25A 2E74C 1MKMA 1EXJA 1Q90D 2E76D 3IAOA 3FGAD 2MKVA 5L8RJ 4OGQB 4PV1C 1HJ0A 2P10A 2D2CC 4H13D 3G9RA 1VF5D 2YIUC 5KKZC 2YMKA 2G8YA 1K04A 1OW8A 4R4LA 3AE7C 4GDOA 1Y9BA 2O01J 4OGQD 3B71A 3AEFC 2JO1A 1NGMB 4H0LB 1VL2A 4XFJA 2FBWC 2OQQA 1KMIZ 2WSCJ 2E75C 1DD3A 3D6YA 4H0LD 3GLMA 3AEEC 1DIPA 4TT3H 2E74D 3Q1MA 3RK3E 4RKUJ 4YXDC 2QJYC 4H44C 3Q5RA 1IK7A 1U57A 1GMJA 3Q5PA 2JP3A 1YQ3C 1UIXA 3SFEC 2WSFJ 4Y28J 3D71A 3AE4C 2J5UA 2QSIA 3T97B 1FDOA 2H88C 1OW7A 1KORA 1ZP0C 3GF7A 4I7ZC 3AE3C 2ZT9C 2E74B 3AE2C 1OMIA 1YQ4C 4KT0J 1KILE 3AE9C 3RL0g 4PV1B 2D2CB 1RQUA 1FDIA 3Q3DA 2FXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB0 J;  2WPV B;  1Q90 D;  4IL6 X;  4RKU J;  2QJY C;  5L8R J;  2K9Y A;  4OGQ B;  2FYN C;  5KKZ C;  2YIU C;  3C8V A;  2WSF J;  4Y28 J;  2O01 J;  4I7Z B;  2WSE J;  2ZT9 B;  2E75 B;  2QSI A;  4H0L B;  2QJK C;  3LW5 J;  1ZRT E;  5KLI C;  2E76 B;  2E74 B;  2WSC J;  4KT0 J;  2QJP C;  4H44 B;  4PV1 B;  2QIW A;  2D2C B;  4H13 B;  1VF5 B;  1S5L X; 
#chains in the Genus database with same CATH topology
 3L36 A;  1LP1 B;  1Q7Y Q;  2Z5H A;  1BE3 E;  2B87 A;  4GOF A;  1PPJ D;  3LIE A;  3AE5 C;  5CJ0 A;  1L0L K;  1NVO A;  1ZRT E;  3CXH D;  1S2E A;  2IFM A;  3L70 G;  1SS1 A;  4Z1M H;  2AXT E;  1R5L A;  1KTM A;  3EWK A;  3B5N C;  1M90 Q;  1LT1 A;  3M91 A;  3RL0 B;  3VP9 A;  2KNC B;  3O6Q A;  2FY8 A;  2E76 B;  2B9B A;  1NWQ A;  1SFC C;  3AE6 C;  4BRY B;  4L74 A;  1JTH B;  1MKM A;  3A0B E;  3HTK A;  4PV1 C;  1Q86 Q;  3E1I A;  1LTJ A;  1OW8 A;  3OW2 O;  3SWK A;  3RK3 B;  1D7M A;  3B71 A;  4KJM A;  1BGY E;  1NOH A;  1U7J A;  1GK6 A;  3RK2 C;  3V6I A;  2W83 C;  3CL3 D;  1U57 A;  2JP3 A;  2LXC B;  2PFX A;  5AW8 B;  2PP6 A;  5B66 H;  2H88 C;  1VQ4 P;  1R5S A;  1W2E A;  2AEM A;  1Q82 Q;  3AE9 C;  3RL0 g;  1RQU A;  3JC2 2;  1T2K C;  1PP9 E;  2PGD A;  3WU2 H;  2IDB A;  2QG4 A;  1IFI A;  3L73 G;  1AFO A;  2E75 B;  1PPJ G;  3A0H H;  1N73 C;  2FFD B;  2OYI B;  3W68 A;  1NTK D;  3FX0 A;  2A06 D;  2KB7 P;  3L72 E;  5M1B A;  2P2U A;  1NTZ K;  1N7S C;  1JY2 P;  3H1L G;  3MD0 A;  1PIX A;  3KZI E;  3P8M C;  3TK1 A;  2WPQ A;  4PD4 E;  2UWJ E;  1N7L A;  1H0T A;  1RE4 C;  3HD7 A;  2P1J A;  2N9Y B;  5BU8 B;  1EDI A;  2YIU C;  4HYT B;  4PD4 D;  2FXM A;  1H88 A;  1JMB A;  2RKL A;  5C39 A;  2N9B A;  1S5L E;  4ZKP A;  1CI6 B;  3CXH H;  2NPS D;  5KJ7 A;  1SQV G;  2O01 N;  4RKU J;  1YQ3 C;  3L74 G;  2QJK B;  1KIL B;  3H1H E;  3I5C A;  4EDF A;  1KB9 E;  1YYC A;  2N1T A;  3G4S P;  3GF7 A;  2AXT H;  1URQ A;  2O3J A;  3GW6 A;  2NZ2 A;  3H1H D;  5CCH A;  2FYN C;  2OYH C;  1NTK J;  1QVF O;  3KHU A;  1SQQ G;  1BCC E;  2ZVO B;  2HR3 A;  2QE7 H;  1L4A D;  2R44 A;  3PLN A;  5CCH D;  4N6J A;  3F89 A;  1FZE A;  1OVV A;  3R4Y A;  1NTK G;  2ZVN B;  1BCC D;  2A06 G;  3CCJ P;  4WY4 A;  1NYH A;  3AEB C;  1RH5 B;  1ZR4 A;  1PFI A;  3CXH I;  1L0L E;  2ZT9 D;  1KC8 Q;  2KSE A;  2PRR A;  4GKG A;  3GHG A;  1E5W A;  3AE7 C;  1LGH B;  1GL2 D;  1SQP G;  1KD1 Q;  1FZC C;  1VDF A;  1NAY A;  2XNX A;  2WZ7 A;  4DJG A;  2QM7 A;  1DH3 A;  2P67 A;  4UB6 E;  3H1H J;  4LGD E;  3CWB E;  1IFP A;  1FJK A;  2C9N Y;  2D2C B;  2FXP A;  3GF3 A;  1LT9 A;  1PV3 A;  3CPW O;  1YJW P;  3KZI H;  2E5Y A;  4PD4 H;  5KLV D;  4RES B;  1T6A A;  3CWB D;  2ZXE B;  3KYQ A;  3AE8 C;  1AQT A;  1EZV D;  3HE5 B;  1BCC J;  3CC4 P;  2YO2 A;  1QGK B;  4WVZ A;  2NPS C;  1M7L A;  1SVF A;  1VQ9 P;  3NFQ A;  3V2R A;  3A5T A;  1RF1 B;  5GTI E;  1QX8 A;  5DJT B;  3VOP A;  1S5L H;  3L37 A;  2H89 C;  5EFW B;  2RH0 A;  5H2F E;  1SQV K;  1FZG A;  1OW6 A;  1G1I A;  2MKV A;  4JQ0 D;  4B86 A;  2WT7 B;  4UB8 E;  1N86 A;  2ZYA A;  2FXO A;  2G8Y A;  3MTU E;  5APT A;  2M5A B;  2WMM A;  3OAK A;  2BAS A;  5E79 E;  1LP1 A;  1M1J B;  1NTZ E;  1KZU B;  2KUB A;  1L4A C;  1GU4 A;  2J59 M;  5APQ A;  3KQG A;  3QH9 A;  1YHQ P;  3P7K A;  2Q9I A;  3Q5P A;  3FXD A;  1UIX A;  3CI9 A;  1NTZ D;  2NRG A;  1FDO A;  3VMA A;  2P58 A;  1GU5 A;  2ZT9 C;  1YQ4 C;  5KLV J;  4KT0 J;  3CWB J;  3CCQ P;  1NTK K;  2IYO A;  2KNC A;  4OVN F;  2A45 G;  1PZQ A;  3C8V A;  4ZKU A;  2E42 A;  2CPB A;  1GL2 C;  4BRY A;  1DEE G;  1JTH A;  2E43 A;  1TU3 F;  5GTH E;  5KLV G;  2E5T A;  4KHX A;  1EZV G;  3L70 E;  1YIT P;  4H44 B;  1NU1 G;  2KIK A;  1HH0 A;  4NPF X;  2KZJ A;  4EI2 A;  3LW5 H;  4L73 A;  2Q3E A;  1VQ6 P;  1JEK A;  3HUS B;  4K3A A;  1Q81 Q;  1LTG C;  1SQP K;  5CHX A;  3L70 D;  2AEJ A;  4W80 A;  3P32 A;  2GM4 A;  1E79 H;  3M06 A;  1L0N D;  2QIW A;  4GOE A;  1Q90 D;  5KKZ C;  1HTL C;  4UB6 H;  5CBO A;  2XKM A;  1QLE D;  2Y9Y A;  1HVV A;  4H0L B;  1VL2 A;  3CX5 E;  1KQL A;  2ZAE B;  1NTZ J;  3M0D C;  1JY3 N;  3A2A A;  4K35 A;  2IZ0 A;  2FFD A;  2QA4 P;  2OYI A;  3CX5 D;  3BCC G;  3V2P A;  1IK9 A;  4I7Z C;  2AEF A;  2B89 A;  1LTA C;  3P8C E;  1RE3 A;  1FDI A;  3SWY A;  2ITA A;  3TSI A;  3C1L A;  3D70 A;  4IL6 X;  2JWA A;  2POH A;  5GTI H;  2LR2 A;  3H32 B;  1GDT A;  4BWN A;  1EC5 A;  1DX7 A;  3L73 E;  5H2F H;  3P8C D;  1PPJ E;  1VQP P;  1KYO D;  3ZDM A;  5TIS E;  3V4W A;  4YPC A;  2W6B A;  3RBX A;  1AA0 A;  4YTP C;  1JNM A;  2A45 I;  3L70 J;  4UB8 H;  1K8A Q;  3PH0 A;  3CC2 P;  3L73 D;  1CI6 A;  3MUD A;  1ZR2 A;  1L0N J;  5E79 H;  1IFM A;  1J1D B;  3H1L E;  2KK7 A;  4ASV A;  1PL5 A;  2Z5I A;  4IOI H;  1EZV I;  4C7N B;  1M56 D;  5KLI C;  1YJN P;  1KIL A;  1L0N G;  3H1L D;  4H13 D;  1VF5 D;  1K04 A;  3VMY A;  3II6 A;  2JDI H;  1T8Z A;  1LJ2 A;  3H1I G;  3D6Y A;  4XE5 B;  3B5N B;  2WVR A;  1SQV E;  3TNU B;  4CPG A;  2Z4E A;  1CW5 A;  4L76 A;  4IFF A;  5KLV K;  5GTH H;  2J5U A;  4EIJ A;  2R32 A;  1SFC B;  5APS A;  3GG2 A;  1OMI A;  3WUT A;  3USS A;  1SQV D;  2OTL P;  1X8Y A;  4PV1 B;  1VQL P;  2HPC B;  1FE6 A;  3L74 D;  2PAJ A;  1GK4 A;  2XDJ A;  2H43 A;  1SQQ E;  3SFD C;  3RK2 B;  3L73 J;  4A7P A;  2RN0 A;  5AW9 B;  2W90 A;  3BAS A;  2ZYG A;  1KQG B;  1VQO P;  2WSS H;  4PJ0 E;  4I2L C;  1NTK E;  1SQQ D;  2A06 E;  1WT6 A;  3CX5 H;  3KXD A;  1R8E A;  3H1L J;  5AW3 B;  2K9J B;  3OA7 A;  3D6Z A;  3AED C;  4N78 D;  4Y99 C;  1J1E C;  2E74 C;  3L71 J;  1SQB D;  4GDO A;  2O01 J;  1LWU C;  1N73 B;  3W67 A;  1VQ8 P;  3EQ2 A;  1J1E B;  2OQQ A;  1KMI Z;  4C7R A;  3BVH A;  1SQP E;  5AVT B;  1NAF A;  2BCC D;  3G3Z A;  3L71 G;  3H1J D;  1N7S B;  3HE5 A;  3M9Q A;  1OVU A;  1SQV J;  3BAT A;  5AVW B;  3D71 A;  2GA1 A;  2DW3 A;  5AW5 B;  3L74 J;  5TIS H;  3T97 B;  1SQP D;  3UIA A;  2V4H A;  3HD7 D;  1RF1 A;  1RF0 A;  2YIU B;  1JCC A;  3IN6 A;  4H13 C;  3PTZ A;  1VF5 C;  1JOC A;  5AW1 B;  3TF5 A;  2Q5U A;  5AW7 B;  3CX5 I;  2M0B A;  1T3U A;  1SQQ J;  5KJ7 D;  1IO4 A;  5APW A;  5APX A;  2WT7 A;  2H7H A;  2M5A A;  1L0N K;  2O01 H;  3L75 G;  1IZN B;  1M1J A;  3CCV P;  4W7Y A;  2N1T D;  3OJA B;  3PRJ A;  4DCK A;  2Y9Z A;  1KN7 A;  1BGY G;  3CLQ A;  3AEG C;  1S72 P;  1URQ D;  1KYO I;  1SQB J;  1P84 D;  4LC1 A;  2FYN B;  2OYH B;  1LTJ C;  2QVA A;  3FGA D;  5CMZ A;  1NTM G;  2YMK A;  2BCC J;  3H1J J;  3HE4 B;  1X22 A;  1X79 B;  3K5B A;  1SQB G;  3MP7 B;  1OVR A;  3HRN A;  1ZXG A;  2YXQ B;  1ZW0 A;  3VTP C;  3G6E P;  1DIP A;  1SQP J;  5AVS B;  4WY4 D;  2BCC G;  1EDK A;  3IFM A;  3I56 P;  4HJG H;  2H8P D;  3H1J G;  4M3L A;  1Q2N A;  4HB1 A;  3CD6 P;  1KQS O;  1ZP0 C;  1OIP A;  3AE3 C;  5AVQ B;  2Q1K A;  3AE2 C;  3CMA P;  1USE A;  3HUS A;  2JKV A;  2Q7C A;  4PJ0 H;  1FOS F;  1NHL A;  1FAV A;  2K9Y A;  1GW4 A;  1KQF B;  3AE1 C;  2J58 A;  1M8O B;  3CCL P;  5KLV E;  1FZC B;  5CCG A;  2HG5 D;  1EZV E;  4WBA A;  1LNQ A;  1FU1 A;  1Y8A A;  1JCD A;  2KXP B;  3B8E B;  2GUS A;  2OTJ P;  1FZB A;  3VYI A;  3HD7 C;  1CSB A;  1NU1 D;  5AVV B;  2V7Q J;  3Q2Y A;  3IAO A;  2HOD B;  2P10 A;  5TJH A;  2Q3I A;  4ZMD A;  4OGQ D;  2NPS B;  2JO1 A;  4IFD K;  1NGM B;  5KJ7 C;  3CC7 P;  4AQR D;  1YIJ P;  3H32 A;  3PP5 A;  1MFZ A;  3G71 P;  2FYU G;  3N4X A;  2N1T C;  2XV5 A;  2ZYD A;  3MHV A;  2LXB A;  3BCC E;  1HGZ A;  1AVO A;  2K88 A;  1URQ C;  3A7O A;  4IFM A;  1MUU A;  5CCH C;  4GIF A;  3NMD A;  3Q3D A;  3S4R A;  1NH4 A;  1ZV8 A;  3U1A A;  4C7N A;  3BCC D;  1SQQ K;  3MZW B;  2HLO A;  4NPD A;  3E7K A;  1L4A B;  2V7Q H;  1VPC A;  2G3A A;  1ZOY C;  2QJP C;  1BDD A;  2I8D A;  2OGU A;  2R3S A;  1NTM K;  4WY4 C;  1NU1 J;  1QVG O;  1RHZ B;  3RGU A;  3VN0 A;  1SQB K;  1VQN P;  2ZT9 B;  3B5N A;  3TNU A;  3M9H A;  3PJS K;  3RL0 D;  2M3E A;  3GHG C;  2YMY A;  3H1K G;  1S5L X;  4D6T G;  2O1J A;  3FXE A;  2E76 D;  1GL2 B;  1SFC A;  1L0N E;  1SQX D;  4OH8 B;  2KZI A;  2KS1 B;  5AVZ B;  2HPC A;  3O8Z A;  1IFD A;  2WIT A;  2FBW C;  4I1L A;  3TGU G;  3I55 P;  2AXC A;  3RK3 D;  1QEX A;  3H1I E;  1P84 I;  3CCU P;  2A45 H;  3VMX A;  1MV8 A;  2WSF J;  3WMM 0;  3H1I D;  2MJZ A;  3BCC J;  4W7Z A;  1VQM P;  2IBZ D;  1LT9 C;  2R5B A;  1JY3 O;  1JY2 N;  5KKZ B;  4XA4 A;  2K37 A;  3PHL A;  2K9J A;  1FJP A;  5APU A;  1WMK A;  4OGQ C;  4OWF A;  2WSE J;  2KSJ A;  4NPE A;  2KOG A;  4AUW A;  1FDM A;  4DOJ A;  3CCS P;  2GUV A;  2E75 D;  2JJL A;  1KYO E;  1N73 A;  2WPV B;  2M3B A;  1EDL A;  4JYC A;  2KLU A;  1H8A A;  1HF9 A;  4I7Z B;  1S1C X;  1SQX J;  1N7S A;  2M8R A;  3VP8 A;  3CCE P;  1GW3 A;  1EXI A;  2JEE A;  2WSF H;  5AVX B;  1RE4 A;  3Q5S A;  2HFE D;  3T97 A;  1NKN A;  5KAF E;  2L5G B;  1GTW A;  1AQ5 A;  2Y0D A;  2WPS A;  1S4X A;  4MN4 C;  1G2C B;  1SQX G;  4N3Y B;  1JUN A;  1YJ9 P;  4XFJ A;  1S3J A;  5B5E E;  2WSC J;  2Y0E A;  4U3F D;  3SSU A;  3H1I J;  1H89 A;  1XTG B;  3Q1M A;  3L71 E;  2WSE H;  1CZQ A;  4WWI A;  3U59 A;  1YTZ T;  1IJD B;  5CBN A;  4YXW H;  4RO0 A;  5KLI B;  5AW0 B;  1NJI Q;  2R3C A;  1KIL D;  3RL0 C;  5BVZ A;  3L71 D;  1K73 Q;  2ZFC A;  2JR8 A;  1OWA A;  4HKZ H;  1BE3 D;  5APV A;  2E76 C;  3M9B A;  2IBZ G;  1EDJ A;  1AJY A;  1L2P A;  1ZRT D;  3L74 E;  1S9K E;  2OYH A;  3RK3 C;  1NU1 K;  3ABV C;  3GMA A;  1BSH A;  3HE4 A;  1VQK P;  1UII A;  3L75 E;  1S9K D;  1XTC C;  2WSC H;  2BEZ F;  2K3R A;  2IZ1 A;  2OYO A;  3L75 D;  1ZME C;  2YXR B;  2I1K A;  2C0W A;  4N78 E;  3NTN A;  1NTM E;  3MIW A;  1BGY D;  4U3F J;  5KAI E;  1SQB E;  1IC2 A;  2XU6 A;  2E75 C;  3GLM A;  1PGP A;  3AEE C;  2FFD C;  2ZXX A;  1NTM D;  2OYI C;  4YXD C;  1IK7 A;  2BCC E;  4U3F G;  1FZC A;  3SFE C;  3H1J E;  1BE3 J;  2OTK E;  2QSI A;  1RE3 C;  2B88 A;  4Y99 B;  1PP9 D;  3JCU E;  1IFJ A;  2CPS A;  2E74 B;  2QEX P;  1FOS E;  1KYO H;  1YTZ I;  1LTT C;  3L35 A;  4O9B A;  1LWU B;  2D2C D;  1BE3 G;  1JY3 P;  4ASW A;  1HUC A;  4R4M A;  3AEC C;  1FZA A;  3IF4 A;  2HOD A;  1IFN A;  1FZF A;  3L72 D;  1N8R Q;  2IBZ I;  3V5B A;  5KAF H;  1JB0 J;  3MUD C;  2NPS A;  4JPZ B;  3AEA C;  1SQX K;  3L75 J;  1DEB A;  4EOT A;  2WPR A;  3S9O A;  4AYC A;  5B5E H;  2QJK C;  2P7J A;  1KIL C;  3R2P A;  1BGY J;  2B87 B;  2R5D A;  3H6P A;  2YKO A;  4H13 B;  1VF5 B;  3IR9 A;  1P84 E;  1HJ0 A;  3FWL A;  2W8Z A;  1LTS C;  3LID A;  3NXS A;  1NTM J;  1KFM A;  1QL1 A;  3N7N A;  5AW6 B;  3O6Q B;  4TT3 H;  1W2B O;  1L4A A;  1BDC A;  1PP9 J;  4DZO A;  1MFT A;  1OFC X;  1G1J A;  1KB9 D;  3Q5R A;  2FYZ A;  2FYU E;  2RMZ A;  4Y28 J;  2IFN A;  1RY3 A;  2IPP A;  2IYP A;  3EFF K;  3HTK B;  1OW7 A;  1GD2 E;  3JSV C;  3MGN A;  1LTJ B;  3A0B H;  1X9V A;  1J2J B;  3FWN A;  2W6A A;  1PP9 G;  2FYU D;  2LKM A;  3A3Y B;  3L72 J;  4BXL A;  1JMM A;  3ITK A;  4GOD A;  1HJB A;  2KYV A;  3V4Q A;  1GL2 A;  4IL6 E;  2ZJS E;  2KS1 A;  4HH2 A;  3L72 G;  5KTB A;  1YBK A;  1K05 A;  4H44 D;  1KV4 A;  2WTY A;  3V2Q A;  2CK3 H;  1L0L D;  5KAI H;  4JBZ A;  2SPZ A;  2L91 A;  3S1K A;  1RQV A;  1KFN A;  1ZLL A;  1OXZ A;  2KLV A;  3H1K E;  1NU1 E;  4D6T E;  1PGO A;  1EXJ A;  5L8R J;  2D2C C;  1M1K Q;  1Y9B A;  3JCU H;  5CCG D;  4LLH A;  3H1K D;  4D6T D;  3TGU E;  2I1J A;  1DD3 A;  4TLF A;  4H0L D;  1X0T A;  2C0X A;  4C46 A;  5APY A;  1H0T B;  1AVY A;  2QJY C;  3M0D A;  4WB4 A;  2KI7 B;  3HD7 B;  3H1H G;  2QRX A;  3TDK A;  1AV1 A;  2FYU J;  1JM0 A;  3TGU D;  3WUU A;  1RF1 C;  1NO4 A;  1RF0 C;  1FC2 C;  2QJY B;  3RBZ A;  3E1R A;  2YKQ A;  1QL2 A;  1BSN A;  4JYB A;  1DD4 A;  2YNY A;  1Y47 A;  2JWD A;  2YKP A;  1BCC G;  2HYN A;  2K1A A;  3CME P;  5BU5 A;  1PGJ A;  2BEQ D;  4ZNC A;  3VMZ A;  1L0L J;  1LTI C;  1M1J C;  1P84 H;  2N1T B;  2WWW A;  1G2C A;  1MZ9 A;  1JO5 A;  1GZL A;  1KB9 H;  1PGQ A;  5AVR B;  1URQ B;  4U7J A;  3LW5 J;  3KPE A;  3TYY A;  1L0L G;  1HGV A;  3QWO C;  5CJ4 A;  4I6M C;  3M0A A;  3H1K J;  4D6T J;  3G9R A;  2O1K A;  4PD4 I;  4RJT A;  4R4L A;  1VQ5 P;  1SQX E;  2QJP B;  3U1C A;  3WUV A;  1Z56 A;  3BRT B;  4WY4 B;  5AW2 B;  3TGU J;  5AW4 B;  1OX3 A;  2KP8 A;  3RK3 E;  1EQ7 A;  1U7M A;  3BRV B;  4H44 C;  1SP4 A;  2W6J H;  3B5N D;  3L4F A;  1NKZ B;  3SWF A;  3GHG B;  4IL6 H;  2Y0C A;  3HUS C;  3CWB G;  2FKW B;  1N2D C;  4QMA A;  1FS0 E;  3F5H A;  1OZH A;  1SFC D;  4EYY Q;  2IBZ E;  4JF7 A;  3KDP B;  1KB9 I;  4PV1 D;  2XND H;  1T3J A;  5DJU B;  3C9I A;  5CCG C;  2Q6Q A;  2VRS A;  4DT0 A;  3CCR P;  5B66 E;  4H0L C;  5K5G B;  3CCM P;  3RK2 D;  1LTB C;  1ZN5 A;  1JY2 O;  2W27 A;  3WU2 E;  3B4S A;  2QM8 A;  1W5C E;  1LT9 B;  1A02 J;  1HWT C;  1M57 D;  2WQY C;  3A0H E;  5AVY B;  2OAR A;  3H25 A;  1T2K D;  1FBM A;  4L75 A;  4OGQ B;  1K9M Q;  1USD A;  2C9L Y;  2IX7 C;  3AEF C;  1VQ7 P;  1NTZ G;  3V2N A;  1LWU A;  3EFG A;  1A02 F;  1YI2 P;  2XZR A;  2FYU K;  2E74 D;  4GT1 A;  1WRG A;  1GMJ A;  1SLQ A;  4U3F E;  1HBW A;  3AE4 C;  1N7S D;  1KOR A;  1J1D C;  5AVU B;  2YO3 A;  3CXH E;  1KIL E; 
#chains in the Genus database with same CATH homology
 2E76 C;  2NZ2 A;  3D70 A;  3GF3 A;  4IL6 X;  3IN6 A;  2K9Y A;  1PV3 A;  1DD4 A;  2IDB A;  1VF5 C;  4H13 C;  2FYN C;  4PV1 D;  1KQF B;  2D2C D;  3AE1 C;  3C8V A;  1AJY A;  1WMK A;  4OGQ C;  3AE5 C;  4R4M A;  3AEC C;  2WSE J;  3SFD C;  2E75 B;  3AE8 C;  1TU3 F;  2G3A A;  1ZRT E;  1ZOY C;  2BEQ D;  3ABV C;  3GMA A;  4H0L C;  2QJP C;  2E75 D;  4H44 B;  4YTP C;  1KQG B;  4Z1M H;  1JB0 J;  2WPV B;  1KTM A;  3R4Y A;  1K05 A;  4H44 D;  3AEA C;  5M1B A;  3EWK A;  1HF9 A;  1NYH A;  4I7Z B;  3AEB C;  1PIX A;  1S1C X;  2ZT9 B;  3O6Q A;  3S9O A;  4U7J A;  2QJK C;  1R8E A;  1PL5 A;  2H89 C;  1RQV A;  3AEG C;  3LW5 J;  2BEZ F;  5KLI C;  2E76 B;  2WQY C;  1EXI A;  2ZT9 D;  3D6Z A;  3AED C;  2V7Q J;  1OW6 A;  3Q2Y A;  3AE6 C;  2QIW A;  4H13 B;  1VF5 B;  1ZME C;  1S5L X;  3Q5S A;  3H25 A;  2E74 C;  1MKM A;  1EXJ A;  1Q90 D;  2E76 D;  3IAO A;  3FGA D;  2MKV A;  5L8R J;  4OGQ B;  4PV1 C;  1HJ0 A;  2P10 A;  2D2C C;  4H13 D;  3G9R A;  1VF5 D;  2YIU C;  5KKZ C;  2YMK A;  2G8Y A;  1K04 A;  1OW8 A;  4R4L A;  3AE7 C;  4GDO A;  1Y9B A;  2O01 J;  4OGQ D;  3B71 A;  3AEF C;  2JO1 A;  1NGM B;  4H0L B;  1VL2 A;  4XFJ A;  2FBW C;  2OQQ A;  1KMI Z;  2WSC J;  2E75 C;  1DD3 A;  3D6Y A;  4H0L D;  3GLM A;  3AEE C;  1DIP A;  4TT3 H;  2E74 D;  3Q1M A;  3RK3 E;  4RKU J;  4YXD C;  2QJY C;  4H44 C;  3Q5R A;  1IK7 A;  1U57 A;  1GMJ A;  3Q5P A;  2JP3 A;  1YQ3 C;  1UIX A;  3SFE C;  2WSF J;  4Y28 J;  3D71 A;  3AE4 C;  2J5U A;  2QSI A;  3T97 B;  1FDO A;  2H88 C;  1OW7 A;  1KOR A;  1ZP0 C;  3GF7 A;  4I7Z C;  3AE3 C;  2ZT9 C;  2E74 B;  3AE2 C;  1OMI A;  1YQ4 C;  4KT0 J;  1KIL E;  3AE9 C;  3RL0 g;  4PV1 B;  2D2C B;  1RQU A;  1FDI A;  3Q3D A;  2FXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...