2KB7P

Hybrid solution and solid-state nmr structure of monomeric phospholamban in lipid bilayers
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
53
structure length
53
Chain Sequence
AMEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFALILIFLLLIAIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Phospholamban
publication title Structure and topology of monomeric phospholamban in lipid membranes determined by a hybrid solution and solid-state NMR approach.
pubmed doi rcsb
source organism Escherichia coli
total genus 20
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2kb7P00
1ZLLA 1FJKA 1N7LA 2KYVA 2M3BA 2HYNA 1FJPA 2KB7P
chains in the Genus database with same CATH superfamily
1LTJC 4PJ0E 4R4LA 1AV1A 5KLVK 1OXZA 1N7SB 1IZNB 1JCDA 1Q81Q 1NTZE 1R5LA 2HPCB 1JOCA 1P84I 3H1KG 3W67A 1MKMA 1G1IA 2D2CB 3CPWO 1RY3A 1ZW0A 2Y9ZA 1G1JA 5TJHA 3RL0g 1SVFA 2KLVA 1L0NE 1NTKE 4GODA 3CCMP 3L73E 2KI7B 2JP3A 2IDBA 5AVXB 1VL2A 3Q1MA 2KP8A 4YPCA 4HB1A 1FZEA 5AVTB 3H1HE 2A06E 5EFWB 3SSUA 3U1AA 4XFJA 1FDIA 2IBZG 3IR9A 1N8RQ 1LTSC 1N7SA 1R8EA 5AW5B 1RF1C 3VN0A 1MZ9A 1S1CX 2KOGA 2WTYA 1KILC 4GT1A 2GUVA 4JYCA 3P8MC 4D6TG 3H1HD 1K9MQ 4RJTA 3N7NA 3ITKA 3EQ2A 1M90Q 1X22A 1PIXA 5KJ7C 3A5TA 3OA7A 1ZRTD 5CJ0A 2QA4P 4ZKUA 5B66E 5CCGD 1VQ9P 1BGYG 5AW8B 2ZJSE 1S3JA 2K37A 3MTUE 2KLUA 1VQKP 1EZVG 5M1BA 3CC7P 4JYBA 1X9VA 4IFDK 2KXPB 2OYIC 3Q5SA 4LGDE 5KLVE 1XTGB 3L75D 4PD4H 3CCLP 1LT9B 1SQXJ 3Q2YA 1FU1A 1JY2O 3WUTA 2JJLA 3FGAD 4AYCA 1FZFA 1L0LG 5CJ4A 3AEEC 1X0TA 4I7ZC 3ABVC 3TYYA 1CW5A 1GZLA 1T8ZA 2L5GB 3I55P 2NPSC 2QM7A 3BVHA 1XTCC 1YTZI 2BEZF 2HODB 4NPFX 3AE6C 2JWDA 3JSVC 3GMAA 1KORA 4DZOA 4NPDA 2WSCH 1HF9A 1PGPA 1NTMJ 1SQVJ 2W6AA 1LT9A 1AFOA 1SQXK 2N9BA 1ZXGA 1LTJA 1H0TB 3H1IJ 2O1KA 3C8VA 1H89A 1LTBC 5AW2B 1K05A 1VQ6P 2WVRA 2KS1B 1ZOYC 2O3JA 1JB0J 1DD4A 1BCCG 1KILB 3H1LD 3CL3D 1VQNP 3RK2C 3WUUA 1BE3J 3P8CE 3PH0A 2N1TC 4MN4C 3RL0D 2E75C 1USEA 1KTMA 1L0LJ 2A45H 1NKNA 3CXHD 2Q3EA 3PLNA 3MD0A 2FYUK 3P8CD 2RH0A 1VPCA 1NTZG 1HH0A 1EZVI 1QEXA 1RF1A 3KPEA 2RN0A 1CZQA 2POHA 2G3AA 1KILA 2KIKA 5BU5A 5E79H 1GW3A 1PV3A 1L0NG 1NTKG 2QRXA 2XDJA 3L73G 2CPSA 1VQOP 3IF4A 5GTHH 3MGNA 1KB9I 5KJ7A 3V2NA 2E74D 3SWFA 1R5SA 3B5NC 3H1HG 2A06G 2NPSB 4H0LC 2E76D 3D70A 5H2FE 1GK6A 4L76A 1BCCJ 1L2PA 4C7NA 1SQXE 3CXHH 2OYIA 2R3CA 1W2BO 3A0BH 1D7MA 4EYYQ 4PV1C 5AVZB 4UB6H 2LKMA 2B87A 2QM8A 2ZXEB 1YHQP 3KXDA 4WY4B 1YJWP 1M1JA 3PP5A 1LT1A 1MUUA 5APYA 5AVWB 1SQQK 2NPSA 3G71P 3LW5H 3H1JD 1URQC 3RK2B 1NVOA 5APSA 1FZBA 1GD2E 2GM4A 2E75B 5KLVG 1NHLA 2PAJA 1DEEG 1EDKA 4LC1A 3RK3B 1JO5A 1LTAC 1QVFO 2JR8A 1EDJA 3VP9A 3HRNA 1JY2N 1A02J 4UB8E 1PGOA 3H6PA 5H2FH 4XA4A 3CCRP 1T2KD 3P32A 2D2CC 3H1HJ 2FYUD 5CMZA 2ZYDA 1LTIC 4U7JA 1JMMA 4TLFA 1LP1A 4JF7A 1L4AD 1EXJA 3O8ZA 2WITA 2UWJE 1DEBA 1IFPA 1Q86Q 4GDOA 1OVUA 3VMYA 2N1TA 3KZIE 1SQPK 3H32B 3L74D 4N78E 1RE3C 2WSCJ 3B5NB 3HD7A 2WSEH 5GTIH 1GL2D 1JY3O 4H44C 1YI2P 5AVQB 5CCHC 3L4FA 3RK3E 2PFXA 1M1KQ 1IC2A 3Q3DA 2OARA 5AW4B 1U7JA 1NAYA 2M5AB 3V5BA 4LLHA 1SQBK 1BDCA 1HUCA 3IAOA 4H13D 2WSFH 2C0WA 4UB8H 4U3FE 3M9BA 2M3BA 3AE5C 2W6JH 1YYCA 4WB4A 1FZCC 3B5NA 1EXIA 2R5BA 1SQQD 1KQFB 3MP7B 5AW0B 4EIJA 1DD3A 3TDKA 3A2AA 4OGQD 5KAFH 2WMMA 2E5YA 4U3FD 1K73Q 3PJSK 3GW6A 1IK9A 1IFMA 1PGJA 3PRJA 5AVRB 1M57D 2WWWA 2KK7A 2V4HA 4JBZA 2YXRB 2XKMA 1KYOE 4DJGA 3A7OA 3SWYA 3GG2A 2OTJP 2FY8A 3H1LJ 1A02F 1ZLLA 1JNMA 2W27A 2IPPA 2O01N 1PL5A 4C46A 2KB7P 1SQPE 2YO3A 1MFZA 2A45I 2ZFCA 2YO2A 1KYOD 1FJPA 1NU1K 1URQA 1HWTC 1KV4A 1PPJE 2M3EA 1SQXG 1YITP 4I2LC 3V2RA 4PD4E 3CI9A 1LTGC 3OJAB 2V7QH 1SQPD 2HLOA 4EDFA 1KC8Q 3VMXA 3CCJP 2E76C 1PPJD 1ZV8A 2HPCA 4PD4D 4H44B 3L72D 5KTBA 3BATA 2CK3H 2KZJA 1NYHA 1VF5C 3L36A 1SQBE 1ZRTE 1OFCX 2KSEA 3CWBD 2P67A 3H25A 5B5EE 1ZP0C 1T3JA 3TNUB 1NTMG 1SQVG 3U1CA 2ZXXA 3LW5J 3CXHI 3M06A 2GUSA 1SQBD 1KYOH 1DIPA 5KKZB 3H1IG 5KLIC 2ZT9D 3ZDMA 3KHUA 3L75E 3M0AA 2L91A 4HYTB 2QG4A 3PHLA 1RE3A 4IL6H 1S5LH 2K1AA 1FZCB 5TISE 4DT0A 3TGUE 2OGUA 4KHXA 2ITAA 1YJNP 3R4YA 2Q9IA 1N7SD 1HBWA 5CCHA 1BE3G 3FWLA 3RL0B 2PGDA 1IFDA 1Q82Q 1SFCC 3II6A 3G9RA 3HUSC 4CPGA 4A7PA 3AECC 3GF3A 3TGUD 3RBZA 3V2PA 3SWKA 1KD1Q 1Q7YQ 1NU1E 3AEDC 3H1JJ 3BRVB 2P7JA 1OZHA 2QSIA 2K3RA 5AVUB 3NTNA 5B5EH 2B88A 1VQ7P 2WSEJ 1JY3N 2R32A 2BCCE 1NU1D 2H89C 3AE2C 5AVSB 3L35A 1GU4A 4W7ZA 1VQ8P 5E79E 3H1LE 3BCCD 1YQ4C 2C0XA 2FYUJ 5GTHE 4RKUJ 2KSJA 3F5HA 1CI6B 2E76B 4WY4C 5TISH 2O01H 2BCCD 2JEEA 1ZN5A 4W7YA 1GU5A 1FDOA 2KYVA 2N9YB 3AE9C 2P58A 1VF5B 3Q5RA 2WSFJ 2XNDH 1KFNA 5APTA 4I6MC 1LWUB 2LR2A 1WMKA 3OW2O 3C1LA 3CXHE 2HODA 1TU3F 1J1DB 4C7RA 1PFIA 2E42A 3A0BE 2XZRA 3L74J 4QMAA 2YKQA 4DOJA 4ASWA 4UB6E 2Z5HA 1NH4A 2WPVB 1VQMP 5KLIB 3KDPB 3RK3C 1QL2A 1OW6A 3WU2E 1N86A 2E43A 1FDMA 3T97B 1H0TA 4GOFA 4B86A 1HGVA 3BASA 2KS1A 3HE5B 2H43A 3B71A 3K5BA 3CC4P 3RBXA 1SFCB 1SQPG 3HUSB 5APXA 2GA1A 4L75A 1M7LA 1BDDA 3NXSA 1PPJG 2K88A 1BSNA 1PP9E 3LIEA 4IFFA 1VQPP 2PP6A 2Q6QA 4AQRD 1SQQJ 2Q3IA 2OYHB 3USSA 3HE4B 1FAVA 2FFDC 3I56P 2V7QJ 4U3FJ 1L4AB 2IZ1A 4YXDC 3GHGC 2FBWC 5APUA 1PP9D 1EDIA 3KYQA 4L74A 1N2DC 3AEFC 1SQBG 3E1RA 1SFCA 3H1KD 3TK1A 1KILD 2H8PD 3WU2H 3H1JE 2LXCB 3EWKA 4OVNF 4L73A 4BWNA 2Q1KA 1HJ0A 1EDLA 3L75G 2XV5A 1JCCA 5GTIE 3TF5A 1ZMEC 5KJ7D 1LGHB 3QWOC 3TGUG 3HTKB 3VP8A 1OX3A 3NMDA 1NWQA 1DX7A 1W5CE 3I5CA 4W80A 2FYUE 1RH5B 1SQPJ 1JY2P 1AA0A 2IBZD 3VTPC 5CCGC 1OMIA 2ZT9C 2P10A 4HKZH 3L72J 2C9NY 4D6TD 3CWBJ 3L37A 4WY4A 2K9JB 1EQ7A 1NJIQ 2IFNA 1H8AA 2IYPA 3AEGC 2A45G 4HH2A 4I1LA 1KYOI 3L74E 4EI2A 1JMBA 3E7KA 3SFEC 5KAFE 1USDA 3V4WA 1Q90D 1SQBJ 4ASVA 1N73B 1BGYD 3HTKA 2YMYA 2NPSD 2BCCG 4R4MA 3CCQP 3CX5D 4PD4I 3H1LG 1KZUB 1KFMA 3JC22 3M91A 3C9IA 2FFDB 2WT7B 2P2UA 3FXEA 2R3SA 3L75J 1OVRA 3CCEP 2JDIH 3AE8C 1NTKK 2B9BA 3GHGB 1AVYA 2AEJA 3CMEP 2O01J 4KT0J 1OWAA 3TGUJ 4N3YB 1OVVA 1IFIA 2Q5UA 1NKZB 1GMJA 2MJZA 3E1IA 3AEBC 1SQQE 4NPEA 3TSIA 1S2EA 2I1JA 1QVGO 1HTLC 1W2EA 5KKZC 2QVAA 2QJYC 5AVYB 3RK2D 3H32A 3D6ZA 2N1TD 2WPRA 3L70E 1IJDB 3JCUH 1HVVA 4IFMA 2E75D 2YKOA 1JUNA 2AXCA 1H88A 2FFDA 4BRYB 4GOEA 3CX5H 1SS1A 3CCUP 1NU1J 2W90A 3V4QA 2W8ZA 3CCSP 1X8YA 1S72P 1SLQA 3HD7D 3RL0C 3M0DC 1E5WA 3L70D 3G3ZA 2ZT9B 2QJKB 2M5AA 3IN6A 2BCCJ 1AQ5A 1FBMA 3VMZA 2QEXP 2XU6A 1KB9H 2WPSA 1Y9BA 3EFFK 2O1JA 1PP9G 3VOPA 1Q2NA 1YIJP 3N4XA 3MIWA 1GDTA 4IL6E 1S5LE 2LXBA 5CBNA 2C9LY 2KZIA 2G8YA 2OYOA 2AXTH 1YTZT 4BRYA 3AE1C 4JQ0D 2W6BA 1IFNA 2FXOA 1PGQA 2ZYGA 3B5ND 4ZMDA 2WZ7A 3L72E 2FXPA 4H0LD 1E79H 4YTPC 2M0BA 3CWBE 1NO4A 5CCGA 2E74C 1QX8A 1YBKA 1NTZD 2WQYC 3CMAP 1DH3A 3H1JG 1LNQA 4PV1D 3S4RA 2NRGA 1VQ5P 4WWIA 2H7HA 2Z4EA 4GIFA 1LTTC 3MUDC 1L0ND 1GK4A 3VYIA 1NTKD 2ZYAA 1LWUC 4KJMA 4N6JA 2VRSA 3L73D 1FZAA 1Y8AA 2WPQA 1J1DC 1J2JB 1UIXA 3OAKA 5AW7B 3A3YB 3B4SA 2YNYA 2A06D 2BEQD 4OH8B 2FYUG 3Q5PA 2QJYB 1KQSO 3A0HE 2ZVNB 1URQD 3VMAA 2RMZA 3G6EP 4PJ0H 1PP9J 3CLQA 1OIPA 5APQA 2I8DA 3O6QB 1JEKA 2OTKE 1NGMB 2OTLP 3H1KJ 5KAIE 1VDFA 2HG5D 3L74G 2YIUC 3G4SP 3SFDC 2D2CD 2H88C 1G2CB 1PZQA 2RKLA 3TNUA 3LIDA 2KNCB 1FOSF 2B89A 4M3LA 1WT6A 2E5TA 2QIWA 1T2KC 2R44A 3F89A 1P84E 2XNXA 3L71E 2OYHC 1LTJB 1JY3P 2CPBA 4DCKA 1FZCA 1FE6A 1L4AC 3BCCE 1M1JC 5KLVD 2Y0EA 2J58A 1K8AQ 2NZ2A 2YXQB 5APWA 3D71A 1FOSE 3O6QA 4YXWH 3BRTB 3RGUA 1P84D 3L71D 2K9YA 2FXMA 5BU8B 4H44D 2DW3A 3M0DA 3A0HH 4D6TJ 2E74B 1G2CA 5C39A 5CCHD 2KNCA 1SQQG 4Z1MH 2JO1A 1GL2C 5APVA 4U3FG 5B66H 1KQGB 5CHXA 1BGYJ 5KAIH 3L70G 1GW4A 2HFED 1RF1B 2IBZI 4IOIH 3D6YA 2IX7C 1IK7A 2IYOA 1J1EC 3NFQA 4H13C 3AE7C 3V6IA 1P84H 1K04A 1NAFA 2SPZA 1OW7A 1S9KE 1UIIA 1CI6A 4XE5B 1KN7A 2JWAA 2Y9YA 1NTMK 4OGQC 1SQVK 4BXLA 1VQLP 1SP4A 3HD7C 1QL1A 2FYZA 2KUBA 2BASA 2ZAEB 3MUDA 3M9HA 3CCVP 1RF0C 1LWUA 3P7KA 4C7NB 2YIUB 1S9KD 4TT3H 1N73C 3U59A 2OYIB 5BVZA 3CX5I 1YJ9P 3S9OA 3L72G 5AW6B 3KQGA 4O9BA 2M8RA 2B87B 4OWFA 3CWBG 3QH9A 3IFMA 3GF7A 3H1KE 4RESB 1LJ2A 4ZKPA 1HJBA 3T97A 2WSSH 4I7ZB 1KILE 2JKVA 1M1JB 2I1KA 2YMKA 3WMM0 1NOHA 2Q7CA 1MFTA 1RE4C 3HE5A 3L70J 1L0LK 3AE4C 4WBAA 1U7MA 1QGKB 1ZR2A 5L8RJ 2HR3A 3WUVA 3HUSA 1ZR4A 1VF5D 2IZ0A 1RQUA 3MZWB 1AVOA 5AW9B 1N7LA 1GL2B 2FKWB 3W68A 1QLED 1GTWA 2IBZE 2FYNC 1WRGA 2OYHA 1SQXD 4Y99C 3HE4A 1U57A 1JTHB 1L4AA 3PTZA 2W83C 4D6TE 1VQ4P 1T3UA 1OW8A 1LP1B 1NTZJ 1J1EB 2QE7H 4H13B 5AW1B 3V2QA 5AW3B 1IO4A 2QJKC 2AEFA 1NTME 1SQVE 2HYNA 2QJPC 2N1TB 1Y47A 3H1IE 1BGYE 3FWNA 1L0NJ 1SFCD 1NTKJ 3AEAC 1GL2A 2IFMA 3L73J 4OGQB 1FZGA 1EZVE 1NU1G 3L71G 3JCUE 3EFGA 3HD7B 1N7SC 1BSHA 1S4XA 1NTMD 1SQVD 3CX5E 2PRRA 3GLMA 4HJGH 3B8EB 3MHVA 1JTHA 3BCCG 3H1ID 2P1JA 1BE3E 1FJKA 2R5DA 1EZVD 1NTZK 3S1KA 1AQTA 1HGZA 1CSBA 1KB9E 1L0LE 5DJTB 1X79B 4AUWA 4IL6X 1S5LX 1BE3D 3CC2P 3AE3C 1L0NK 1M56D 2K9JA 1AJYA 3FX0A 4GKGA 1IFJA 2AXTE 4H0LB 1KB9D 5DJUB 1L0LD 5AVVB 1EC5A 4WY4D 1KQLA 1RF0A 4ZNCA 3CD6P 1RHZB 1FS0E 1N73A 2ZVOB 5CBOA 4RO0A 4N78D 2OQQA 3FXDA 2Y0CA 4JPZB 4PV1B 4WVZA 1MV8A 2MKVA 2YKPA 5KLVJ 2FYNB 4Y99B 2Z5IA 3L71J 1Z56A 2WT7A 1BCCE 1M8OB 3RK3D 3M9QA 1T6AA 2AEMA 3GHGA 5K5GB 1RE4A 3BCCJ 4K3AA 1URQB 2J5UA 2Y0DA 1RQVA 1FC2C 1JM0A 2J59M 1BCCD 2QJPB 1YQ3C 4EOTA 3R2PA 3UIAA 4K35A 1LT9C 3KZIH 1KMIZ 4Y28J
chains in the Genus database with same CATH topology
4M3LA 1LTJC 5CMZA 1SFCB 1WT6A 5KLVK 1OXZA 1N7SB 3HUSB 1LTIC 1T2KC 1JCDA 5APXA 1JMMA 2HPCB 2XNXA 1JOCA 1M7LA 4JF7A 1G1IA 1L4AD 3NXSA 2OYHC 1LTJB 3O8ZA 2WITA 1JY3P 2CPBA 1RY3A 3LIEA 1FZCA 4IFFA 1L4AC 1G1JA 1DEBA 1M1JC 2PP6A 1SVFA 4AQRD 2J58A 2KLVA 3VMYA 5APWA 1FOSE 2N1TA 2Q3IA 2OYHB 1SQPK 3HE4B 1FAVA 3BRTB 2FFDC 3H32B 1L4AB 4N78E 5AVXB 2FXMA 5BU8B 3GHGC 1RE3C 5APUA 3B5NB 3M0DA 2KP8A 3HD7A 2WSEH 3KYQA 1G2CA 1FZEA 5AVTB 1GL2D 1N2DC 1JY3O 5CCHD 5AVQB 3U1AA 1SFCA 1GL2C 3IR9A 1LTSC 5CCHC 1N7SA 3L4FA 5APVA 3TK1A 1KILD 1IC2A 2H8PD 5AW5B 2OARA 1RF1C 5CHXA 3VN0A 5AW4B 1MZ9A 2KOGA 2WTYA 1KILC 4GT1A 2GUVA 4JYCA 3P8MC 3V5BA 4LLHA 1GW4A 1SQBK 2HFED 1HUCA 2XV5A 1RF1B 1JCCA 3N7NA 2WSFH 2C0WA 2IX7C 3EQ2A 3M9BA 2M3BA 5KJ7D 1J1EC 3NFQA 1LGHB 1YYCA 4WB4A 3HTKB 3VP8A 3NMDA 5KJ7C 1FZCC 3A5TA 3B5NA 3OA7A 3I5CA 1NWQA 1DX7A 5CJ0A 4W80A 2R5BA 4ZKUA 5CCGD 1NAFA 1JY2P 5AW8B 5AW0B 4EIJA 1S9KE 3VTPC 3A2AA 3MTUE 1CI6A 5CCGC 4XE5B 4JYBA 1X9VA 1NTMK 1SQVK 1IK9A 2C9NY 4IFDK 1IFMA 1SP4A 2OYIC 3HD7C 5AVRB 2WWWA 1QL1A 2FYZA 4LGDE 2BASA 3MUDA 3M9HA 3L37A 1RF0C 4WY4A 1LWUA 1EQ7A 3P7KA 1H8AA 1XTGB 2IFNA 4C7NB 1S9KD 2A45G 2XKMA 4HH2A 1N73C 1LT9B 4I1LA 3U59A 3A7OA 1FU1A 3SWYA 1JY2O 2OYIB 2JJLA 5BVZA 1A02F 4AYCA 1ZLLA 1FZFA 1JNMA 2W27A 2IPPA 3V4WA 5AW6B 5CJ4A 3KQGA 1N73B 3HTKA 2YMYA 4O9BA 2M8RA 3TYYA 2NPSD 4C46A 2KB7P 2YO3A 1MFZA 1CW5A 2A45I 1GZLA 2ZFCA 3IFMA 2YO2A 1T8ZA 4RESB 4ZKPA 1FJPA 1NU1K 2L5GB 3T97A 1HJBA 1URQA 2NPSC 1HWTC 2QM7A 3BVHA 4I2LC 3V2RA 3WMM0 1M1JB 2I1KA 3CI9A 1NOHA 1XTCC 1LTGC 2Q7CA 1YTZI 1RE4C 1KZUB 2HODB 1KFMA 3M91A 3C9IA 3HE5A 3OJAB 1L0LK 2FFDB 4WBAA 2WT7B 2P2UA 1ZR2A 2HLOA 1NTKK 4DZOA 3GHGB 2WSCH 3VMXA 3HUSA 1ZR4A 2W6AA 1LT9A 1AFOA 1ZV8A 2HPCA 1SQXK 1OWAA 2N9BA 4N3YB 5KTBA 3BATA 1LTJA 5AW9B 1IFIA 2O1KA 3L36A 1N7LA 1GL2B 2Q5UA 1NKZB 1LTBC 2FKWB 5AW2B 1H89A 2MJZA 3E1IA 1GTWA 2P67A 3TSIA 2I1JA 1T3JA 1WRGA 1HTLC 1W2EA 2OYHA 4Y99C 3TNUB 3HE4A 5AVYB 1KILB 1JTHB 3RK2D 3H32A 3U1CA 1L4AA 3CL3D 2N1TD 2WPRA 3M06A 2GUSA 1T3UA 3RK2C 1IJDB 1HVVA 4IFMA 2YKOA 1JUNA 3P8CE 1H88A 2FFDA 1J1EB 3V4QA 3M0AA 2N1TC 4HYTB 5AW1B 3V2QA 3RL0D 5AW3B 1X8YA 1IO4A 1RE3A 1SLQA 3HD7D 1FZCB 3RL0C 4KHXA 2HYNA 2A45H 3M0DC 1E5WA 2N1TB 1NKNA 3G3ZA 2Q9IA 1SFCD 3MD0A 2FYUK 3P8CD 1N7SD 1GL2A 1FBMA 1AQ5A 3VMZA 1HBWA 2IFMA 2XU6A 5CCHA 3RL0B 1VPCA 1FZGA 1IFDA 2WPSA 1HH0A 1SFCC 3EFGA 3II6A 3HD7B 1RF1A 1N7SC 3KPEA 3HUSC 2O1JA 1CZQA 2POHA 3B8EB 3VOPA 1KILA 1JTHA 3V2PA 5BU5A 3N4XA 3MIWA 1GDTA 2P1JA 2C9LY 1FOSF 1GW3A 1FJKA 2R5DA 1YTZT 2XDJA 1NTZK 2CPSA 3BRVB 2W6BA 1IFNA 2P7JA 1HGZA 3MGNA 3B5ND 1CSBA 2WZ7A 5KJ7A 5AVUB 3V2NA 3NTNA 1X79B 3SWFA 4AUWA 3B5NC 2NPSB 1JY3N 2R32A 1NO4A 1GK6A 5CCGA 1L0NK 5AVSB 3L35A 1DH3A 1GU4A 4C7NA 4W7ZA 4GKGA 1IFJA 2OYIA 2R3CA 5AVVB 4WY4D 2C0XA 1KQLA 1RF0A 2H7HA 2Z4EA 4GIFA 2KSJA 1LTTC 1CI6B 5AVZB 1GK4A 3VYIA 1N73A 4WY4C 1LWUC 2O01H 2JEEA 4W7YA 1ZN5A 4N6JA 1GU5A 2LKMA 2VRSA 1FZAA 2WPQA 1J1DC 1J2JB 2KYVA 4N78D 3OAKA 5AW7B 2QM8A 2ZXEB 1MV8A 3A3YB 1KFNA 5APTA 4I6MC 4WY4B 1LWUB 1M1JA 2YKPA 3PP5A 2YNYA 2HODA 4OH8B 1J1DB 4C7RA 4Y99B 1PFIA 1MUUA 5APYA 5AVWB 1SQQK 1URQD 2Z5IA 2E42A 1Z56A 2NPSA 2WT7A 2XZRA 3RK3D 3M9QA 3LW5H 2YKQA 4DOJA 1URQC 3GHGA 2Z5HA 1RE4A 3RK2B 1NH4A 5APSA 3KDPB 3RK3C 3CLQA 1QL2A 5APQA 1FZBA 1N86A 1GD2E 2E43A 2GM4A 1FDMA 1NHLA 1URQB 2PAJA 4B86A 1HGVA 4LC1A 1VDFA 3RK3B 2HG5D 2J59M 1JO5A 3BASA 4EOTA 1LTAC 3R2PA 3UIAA 3HE5B 3HRNA 3VP9A 1JY2N 2H43A 1LT9C 1G2CB 1A02J 3H6PA 3TNUA 4XA4A 3LIDA 1T2KD 3P32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZLL A;  1FJK A;  1N7L A;  2KYV A;  2M3B A;  2HYN A;  1FJP A;  2KB7 P; 
#chains in the Genus database with same CATH topology
 1LTJ C;  4PJ0 E;  4R4L A;  1AV1 A;  5KLV K;  1OXZ A;  1N7S B;  1IZN B;  1JCD A;  1Q81 Q;  1NTZ E;  1R5L A;  2HPC B;  1JOC A;  1P84 I;  3H1K G;  3W67 A;  1MKM A;  1G1I A;  2D2C B;  3CPW O;  1RY3 A;  1ZW0 A;  2Y9Z A;  1G1J A;  5TJH A;  3RL0 g;  1SVF A;  2KLV A;  1L0N E;  1NTK E;  4GOD A;  3CCM P;  3L73 E;  2KI7 B;  2JP3 A;  2IDB A;  5AVX B;  1VL2 A;  3Q1M A;  2KP8 A;  4YPC A;  4HB1 A;  1FZE A;  5AVT B;  3H1H E;  2A06 E;  5EFW B;  3SSU A;  3U1A A;  4XFJ A;  1FDI A;  2IBZ G;  3IR9 A;  1N8R Q;  1LTS C;  1N7S A;  1R8E A;  5AW5 B;  1RF1 C;  3VN0 A;  1MZ9 A;  1S1C X;  2KOG A;  2WTY A;  1KIL C;  4GT1 A;  2GUV A;  4JYC A;  3P8M C;  4D6T G;  3H1H D;  1K9M Q;  4RJT A;  3N7N A;  3ITK A;  3EQ2 A;  1M90 Q;  1X22 A;  1PIX A;  5KJ7 C;  3A5T A;  3OA7 A;  1ZRT D;  5CJ0 A;  2QA4 P;  4ZKU A;  5B66 E;  5CCG D;  1VQ9 P;  1BGY G;  5AW8 B;  2ZJS E;  1S3J A;  2K37 A;  3MTU E;  2KLU A;  1VQK P;  1EZV G;  5M1B A;  3CC7 P;  4JYB A;  1X9V A;  4IFD K;  2KXP B;  2OYI C;  3Q5S A;  4LGD E;  5KLV E;  1XTG B;  3L75 D;  4PD4 H;  3CCL P;  1LT9 B;  1SQX J;  3Q2Y A;  1FU1 A;  1JY2 O;  3WUT A;  2JJL A;  3FGA D;  4AYC A;  1FZF A;  1L0L G;  5CJ4 A;  3AEE C;  1X0T A;  4I7Z C;  3ABV C;  3TYY A;  1CW5 A;  1GZL A;  1T8Z A;  2L5G B;  3I55 P;  2NPS C;  2QM7 A;  3BVH A;  1XTC C;  1YTZ I;  2BEZ F;  2HOD B;  4NPF X;  3AE6 C;  2JWD A;  3JSV C;  3GMA A;  1KOR A;  4DZO A;  4NPD A;  2WSC H;  1HF9 A;  1PGP A;  1NTM J;  1SQV J;  2W6A A;  1LT9 A;  1AFO A;  1SQX K;  2N9B A;  1ZXG A;  1LTJ A;  1H0T B;  3H1I J;  2O1K A;  3C8V A;  1H89 A;  1LTB C;  5AW2 B;  1K05 A;  1VQ6 P;  2WVR A;  2KS1 B;  1ZOY C;  2O3J A;  1JB0 J;  1DD4 A;  1BCC G;  1KIL B;  3H1L D;  3CL3 D;  1VQN P;  3RK2 C;  3WUU A;  1BE3 J;  3P8C E;  3PH0 A;  2N1T C;  4MN4 C;  3RL0 D;  2E75 C;  1USE A;  1KTM A;  1L0L J;  2A45 H;  1NKN A;  3CXH D;  2Q3E A;  3PLN A;  3MD0 A;  2FYU K;  3P8C D;  2RH0 A;  1VPC A;  1NTZ G;  1HH0 A;  1EZV I;  1QEX A;  1RF1 A;  3KPE A;  2RN0 A;  1CZQ A;  2POH A;  2G3A A;  1KIL A;  2KIK A;  5BU5 A;  5E79 H;  1GW3 A;  1PV3 A;  1L0N G;  1NTK G;  2QRX A;  2XDJ A;  3L73 G;  2CPS A;  1VQO P;  3IF4 A;  5GTH H;  3MGN A;  1KB9 I;  5KJ7 A;  3V2N A;  2E74 D;  3SWF A;  1R5S A;  3B5N C;  3H1H G;  2A06 G;  2NPS B;  4H0L C;  2E76 D;  3D70 A;  5H2F E;  1GK6 A;  4L76 A;  1BCC J;  1L2P A;  4C7N A;  1SQX E;  3CXH H;  2OYI A;  2R3C A;  1W2B O;  3A0B H;  1D7M A;  4EYY Q;  4PV1 C;  5AVZ B;  4UB6 H;  2LKM A;  2B87 A;  2QM8 A;  2ZXE B;  1YHQ P;  3KXD A;  4WY4 B;  1YJW P;  1M1J A;  3PP5 A;  1LT1 A;  1MUU A;  5APY A;  5AVW B;  1SQQ K;  2NPS A;  3G71 P;  3LW5 H;  3H1J D;  1URQ C;  3RK2 B;  1NVO A;  5APS A;  1FZB A;  1GD2 E;  2GM4 A;  2E75 B;  5KLV G;  1NHL A;  2PAJ A;  1DEE G;  1EDK A;  4LC1 A;  3RK3 B;  1JO5 A;  1LTA C;  1QVF O;  2JR8 A;  1EDJ A;  3VP9 A;  3HRN A;  1JY2 N;  1A02 J;  4UB8 E;  1PGO A;  3H6P A;  5H2F H;  4XA4 A;  3CCR P;  1T2K D;  3P32 A;  2D2C C;  3H1H J;  2FYU D;  5CMZ A;  2ZYD A;  1LTI C;  4U7J A;  1JMM A;  4TLF A;  1LP1 A;  4JF7 A;  1L4A D;  1EXJ A;  3O8Z A;  2WIT A;  2UWJ E;  1DEB A;  1IFP A;  1Q86 Q;  4GDO A;  1OVU A;  3VMY A;  2N1T A;  3KZI E;  1SQP K;  3H32 B;  3L74 D;  4N78 E;  1RE3 C;  2WSC J;  3B5N B;  3HD7 A;  2WSE H;  5GTI H;  1GL2 D;  1JY3 O;  4H44 C;  1YI2 P;  5AVQ B;  5CCH C;  3L4F A;  3RK3 E;  2PFX A;  1M1K Q;  1IC2 A;  3Q3D A;  2OAR A;  5AW4 B;  1U7J A;  1NAY A;  2M5A B;  3V5B A;  4LLH A;  1SQB K;  1BDC A;  1HUC A;  3IAO A;  4H13 D;  2WSF H;  2C0W A;  4UB8 H;  4U3F E;  3M9B A;  2M3B A;  3AE5 C;  2W6J H;  1YYC A;  4WB4 A;  1FZC C;  3B5N A;  1EXI A;  2R5B A;  1SQQ D;  1KQF B;  3MP7 B;  5AW0 B;  4EIJ A;  1DD3 A;  3TDK A;  3A2A A;  4OGQ D;  5KAF H;  2WMM A;  2E5Y A;  4U3F D;  1K73 Q;  3PJS K;  3GW6 A;  1IK9 A;  1IFM A;  1PGJ A;  3PRJ A;  5AVR B;  1M57 D;  2WWW A;  2KK7 A;  2V4H A;  4JBZ A;  2YXR B;  2XKM A;  1KYO E;  4DJG A;  3A7O A;  3SWY A;  3GG2 A;  2OTJ P;  2FY8 A;  3H1L J;  1A02 F;  1ZLL A;  1JNM A;  2W27 A;  2IPP A;  2O01 N;  1PL5 A;  4C46 A;  2KB7 P;  1SQP E;  2YO3 A;  1MFZ A;  2A45 I;  2ZFC A;  2YO2 A;  1KYO D;  1FJP A;  1NU1 K;  1URQ A;  1HWT C;  1KV4 A;  1PPJ E;  2M3E A;  1SQX G;  1YIT P;  4I2L C;  3V2R A;  4PD4 E;  3CI9 A;  1LTG C;  3OJA B;  2V7Q H;  1SQP D;  2HLO A;  4EDF A;  1KC8 Q;  3VMX A;  3CCJ P;  2E76 C;  1PPJ D;  1ZV8 A;  2HPC A;  4PD4 D;  4H44 B;  3L72 D;  5KTB A;  3BAT A;  2CK3 H;  2KZJ A;  1NYH A;  1VF5 C;  3L36 A;  1SQB E;  1ZRT E;  1OFC X;  2KSE A;  3CWB D;  2P67 A;  3H25 A;  5B5E E;  1ZP0 C;  1T3J A;  3TNU B;  1NTM G;  1SQV G;  3U1C A;  2ZXX A;  3LW5 J;  3CXH I;  3M06 A;  2GUS A;  1SQB D;  1KYO H;  1DIP A;  5KKZ B;  3H1I G;  5KLI C;  2ZT9 D;  3ZDM A;  3KHU A;  3L75 E;  3M0A A;  2L91 A;  4HYT B;  2QG4 A;  3PHL A;  1RE3 A;  4IL6 H;  1S5L H;  2K1A A;  1FZC B;  5TIS E;  4DT0 A;  3TGU E;  2OGU A;  4KHX A;  2ITA A;  1YJN P;  3R4Y A;  2Q9I A;  1N7S D;  1HBW A;  5CCH A;  1BE3 G;  3FWL A;  3RL0 B;  2PGD A;  1IFD A;  1Q82 Q;  1SFC C;  3II6 A;  3G9R A;  3HUS C;  4CPG A;  4A7P A;  3AEC C;  3GF3 A;  3TGU D;  3RBZ A;  3V2P A;  3SWK A;  1KD1 Q;  1Q7Y Q;  1NU1 E;  3AED C;  3H1J J;  3BRV B;  2P7J A;  1OZH A;  2QSI A;  2K3R A;  5AVU B;  3NTN A;  5B5E H;  2B88 A;  1VQ7 P;  2WSE J;  1JY3 N;  2R32 A;  2BCC E;  1NU1 D;  2H89 C;  3AE2 C;  5AVS B;  3L35 A;  1GU4 A;  4W7Z A;  1VQ8 P;  5E79 E;  3H1L E;  3BCC D;  1YQ4 C;  2C0X A;  2FYU J;  5GTH E;  4RKU J;  2KSJ A;  3F5H A;  1CI6 B;  2E76 B;  4WY4 C;  5TIS H;  2O01 H;  2BCC D;  2JEE A;  1ZN5 A;  4W7Y A;  1GU5 A;  1FDO A;  2KYV A;  2N9Y B;  3AE9 C;  2P58 A;  1VF5 B;  3Q5R A;  2WSF J;  2XND H;  1KFN A;  5APT A;  4I6M C;  1LWU B;  2LR2 A;  1WMK A;  3OW2 O;  3C1L A;  3CXH E;  2HOD A;  1TU3 F;  1J1D B;  4C7R A;  1PFI A;  2E42 A;  3A0B E;  2XZR A;  3L74 J;  4QMA A;  2YKQ A;  4DOJ A;  4ASW A;  4UB6 E;  2Z5H A;  1NH4 A;  2WPV B;  1VQM P;  5KLI B;  3KDP B;  3RK3 C;  1QL2 A;  1OW6 A;  3WU2 E;  1N86 A;  2E43 A;  1FDM A;  3T97 B;  1H0T A;  4GOF A;  4B86 A;  1HGV A;  3BAS A;  2KS1 A;  3HE5 B;  2H43 A;  3B71 A;  3K5B A;  3CC4 P;  3RBX A;  1SFC B;  1SQP G;  3HUS B;  5APX A;  2GA1 A;  4L75 A;  1M7L A;  1BDD A;  3NXS A;  1PPJ G;  2K88 A;  1BSN A;  1PP9 E;  3LIE A;  4IFF A;  1VQP P;  2PP6 A;  2Q6Q A;  4AQR D;  1SQQ J;  2Q3I A;  2OYH B;  3USS A;  3HE4 B;  1FAV A;  2FFD C;  3I56 P;  2V7Q J;  4U3F J;  1L4A B;  2IZ1 A;  4YXD C;  3GHG C;  2FBW C;  5APU A;  1PP9 D;  1EDI A;  3KYQ A;  4L74 A;  1N2D C;  3AEF C;  1SQB G;  3E1R A;  1SFC A;  3H1K D;  3TK1 A;  1KIL D;  2H8P D;  3WU2 H;  3H1J E;  2LXC B;  3EWK A;  4OVN F;  4L73 A;  4BWN A;  2Q1K A;  1HJ0 A;  1EDL A;  3L75 G;  2XV5 A;  1JCC A;  5GTI E;  3TF5 A;  1ZME C;  5KJ7 D;  1LGH B;  3QWO C;  3TGU G;  3HTK B;  3VP8 A;  1OX3 A;  3NMD A;  1NWQ A;  1DX7 A;  1W5C E;  3I5C A;  4W80 A;  2FYU E;  1RH5 B;  1SQP J;  1JY2 P;  1AA0 A;  2IBZ D;  3VTP C;  5CCG C;  1OMI A;  2ZT9 C;  2P10 A;  4HKZ H;  3L72 J;  2C9N Y;  4D6T D;  3CWB J;  3L37 A;  4WY4 A;  2K9J B;  1EQ7 A;  1NJI Q;  2IFN A;  1H8A A;  2IYP A;  3AEG C;  2A45 G;  4HH2 A;  4I1L A;  1KYO I;  3L74 E;  4EI2 A;  1JMB A;  3E7K A;  3SFE C;  5KAF E;  1USD A;  3V4W A;  1Q90 D;  1SQB J;  4ASV A;  1N73 B;  1BGY D;  3HTK A;  2YMY A;  2NPS D;  2BCC G;  4R4M A;  3CCQ P;  3CX5 D;  4PD4 I;  3H1L G;  1KZU B;  1KFM A;  3JC2 2;  3M91 A;  3C9I A;  2FFD B;  2WT7 B;  2P2U A;  3FXE A;  2R3S A;  3L75 J;  1OVR A;  3CCE P;  2JDI H;  3AE8 C;  1NTK K;  2B9B A;  3GHG B;  1AVY A;  2AEJ A;  3CME P;  2O01 J;  4KT0 J;  1OWA A;  3TGU J;  4N3Y B;  1OVV A;  1IFI A;  2Q5U A;  1NKZ B;  1GMJ A;  2MJZ A;  3E1I A;  3AEB C;  1SQQ E;  4NPE A;  3TSI A;  1S2E A;  2I1J A;  1QVG O;  1HTL C;  1W2E A;  5KKZ C;  2QVA A;  2QJY C;  5AVY B;  3RK2 D;  3H32 A;  3D6Z A;  2N1T D;  2WPR A;  3L70 E;  1IJD B;  3JCU H;  1HVV A;  4IFM A;  2E75 D;  2YKO A;  1JUN A;  2AXC A;  1H88 A;  2FFD A;  4BRY B;  4GOE A;  3CX5 H;  1SS1 A;  3CCU P;  1NU1 J;  2W90 A;  3V4Q A;  2W8Z A;  3CCS P;  1X8Y A;  1S72 P;  1SLQ A;  3HD7 D;  3RL0 C;  3M0D C;  1E5W A;  3L70 D;  3G3Z A;  2ZT9 B;  2QJK B;  2M5A A;  3IN6 A;  2BCC J;  1AQ5 A;  1FBM A;  3VMZ A;  2QEX P;  2XU6 A;  1KB9 H;  2WPS A;  1Y9B A;  3EFF K;  2O1J A;  1PP9 G;  3VOP A;  1Q2N A;  1YIJ P;  3N4X A;  3MIW A;  1GDT A;  4IL6 E;  1S5L E;  2LXB A;  5CBN A;  2C9L Y;  2KZI A;  2G8Y A;  2OYO A;  2AXT H;  1YTZ T;  4BRY A;  3AE1 C;  4JQ0 D;  2W6B A;  1IFN A;  2FXO A;  1PGQ A;  2ZYG A;  3B5N D;  4ZMD A;  2WZ7 A;  3L72 E;  2FXP A;  4H0L D;  1E79 H;  4YTP C;  2M0B A;  3CWB E;  1NO4 A;  5CCG A;  2E74 C;  1QX8 A;  1YBK A;  1NTZ D;  2WQY C;  3CMA P;  1DH3 A;  3H1J G;  1LNQ A;  4PV1 D;  3S4R A;  2NRG A;  1VQ5 P;  4WWI A;  2H7H A;  2Z4E A;  4GIF A;  1LTT C;  3MUD C;  1L0N D;  1GK4 A;  3VYI A;  1NTK D;  2ZYA A;  1LWU C;  4KJM A;  4N6J A;  2VRS A;  3L73 D;  1FZA A;  1Y8A A;  2WPQ A;  1J1D C;  1J2J B;  1UIX A;  3OAK A;  5AW7 B;  3A3Y B;  3B4S A;  2YNY A;  2A06 D;  2BEQ D;  4OH8 B;  2FYU G;  3Q5P A;  2QJY B;  1KQS O;  3A0H E;  2ZVN B;  1URQ D;  3VMA A;  2RMZ A;  3G6E P;  4PJ0 H;  1PP9 J;  3CLQ A;  1OIP A;  5APQ A;  2I8D A;  3O6Q B;  1JEK A;  2OTK E;  1NGM B;  2OTL P;  3H1K J;  5KAI E;  1VDF A;  2HG5 D;  3L74 G;  2YIU C;  3G4S P;  3SFD C;  2D2C D;  2H88 C;  1G2C B;  1PZQ A;  2RKL A;  3TNU A;  3LID A;  2KNC B;  1FOS F;  2B89 A;  4M3L A;  1WT6 A;  2E5T A;  2QIW A;  1T2K C;  2R44 A;  3F89 A;  1P84 E;  2XNX A;  3L71 E;  2OYH C;  1LTJ B;  1JY3 P;  2CPB A;  4DCK A;  1FZC A;  1FE6 A;  1L4A C;  3BCC E;  1M1J C;  5KLV D;  2Y0E A;  2J58 A;  1K8A Q;  2NZ2 A;  2YXQ B;  5APW A;  3D71 A;  1FOS E;  3O6Q A;  4YXW H;  3BRT B;  3RGU A;  1P84 D;  3L71 D;  2K9Y A;  2FXM A;  5BU8 B;  4H44 D;  2DW3 A;  3M0D A;  3A0H H;  4D6T J;  2E74 B;  1G2C A;  5C39 A;  5CCH D;  2KNC A;  1SQQ G;  4Z1M H;  2JO1 A;  1GL2 C;  5APV A;  4U3F G;  5B66 H;  1KQG B;  5CHX A;  1BGY J;  5KAI H;  3L70 G;  1GW4 A;  2HFE D;  1RF1 B;  2IBZ I;  4IOI H;  3D6Y A;  2IX7 C;  1IK7 A;  2IYO A;  1J1E C;  3NFQ A;  4H13 C;  3AE7 C;  3V6I A;  1P84 H;  1K04 A;  1NAF A;  2SPZ A;  1OW7 A;  1S9K E;  1UII A;  1CI6 A;  4XE5 B;  1KN7 A;  2JWA A;  2Y9Y A;  1NTM K;  4OGQ C;  1SQV K;  4BXL A;  1VQL P;  1SP4 A;  3HD7 C;  1QL1 A;  2FYZ A;  2KUB A;  2BAS A;  2ZAE B;  3MUD A;  3M9H A;  3CCV P;  1RF0 C;  1LWU A;  3P7K A;  4C7N B;  2YIU B;  1S9K D;  4TT3 H;  1N73 C;  3U59 A;  2OYI B;  5BVZ A;  3CX5 I;  1YJ9 P;  3S9O A;  3L72 G;  5AW6 B;  3KQG A;  4O9B A;  2M8R A;  2B87 B;  4OWF A;  3CWB G;  3QH9 A;  3IFM A;  3GF7 A;  3H1K E;  4RES B;  1LJ2 A;  4ZKP A;  1HJB A;  3T97 A;  2WSS H;  4I7Z B;  1KIL E;  2JKV A;  1M1J B;  2I1K A;  2YMK A;  3WMM 0;  1NOH A;  2Q7C A;  1MFT A;  1RE4 C;  3HE5 A;  3L70 J;  1L0L K;  3AE4 C;  4WBA A;  1U7M A;  1QGK B;  1ZR2 A;  5L8R J;  2HR3 A;  3WUV A;  3HUS A;  1ZR4 A;  1VF5 D;  2IZ0 A;  1RQU A;  3MZW B;  1AVO A;  5AW9 B;  1N7L A;  1GL2 B;  2FKW B;  3W68 A;  1QLE D;  1GTW A;  2IBZ E;  2FYN C;  1WRG A;  2OYH A;  1SQX D;  4Y99 C;  3HE4 A;  1U57 A;  1JTH B;  1L4A A;  3PTZ A;  2W83 C;  4D6T E;  1VQ4 P;  1T3U A;  1OW8 A;  1LP1 B;  1NTZ J;  1J1E B;  2QE7 H;  4H13 B;  5AW1 B;  3V2Q A;  5AW3 B;  1IO4 A;  2QJK C;  2AEF A;  1NTM E;  1SQV E;  2HYN A;  2QJP C;  2N1T B;  1Y47 A;  3H1I E;  1BGY E;  3FWN A;  1L0N J;  1SFC D;  1NTK J;  3AEA C;  1GL2 A;  2IFM A;  3L73 J;  4OGQ B;  1FZG A;  1EZV E;  1NU1 G;  3L71 G;  3JCU E;  3EFG A;  3HD7 B;  1N7S C;  1BSH A;  1S4X A;  1NTM D;  1SQV D;  3CX5 E;  2PRR A;  3GLM A;  4HJG H;  3B8E B;  3MHV A;  1JTH A;  3BCC G;  3H1I D;  2P1J A;  1BE3 E;  1FJK A;  2R5D A;  1EZV D;  1NTZ K;  3S1K A;  1AQT A;  1HGZ A;  1CSB A;  1KB9 E;  1L0L E;  5DJT B;  1X79 B;  4AUW A;  4IL6 X;  1S5L X;  1BE3 D;  3CC2 P;  3AE3 C;  1L0N K;  1M56 D;  2K9J A;  1AJY A;  3FX0 A;  4GKG A;  1IFJ A;  2AXT E;  4H0L B;  1KB9 D;  5DJU B;  1L0L D;  5AVV B;  1EC5 A;  4WY4 D;  1KQL A;  1RF0 A;  4ZNC A;  3CD6 P;  1RHZ B;  1FS0 E;  1N73 A;  2ZVO B;  5CBO A;  4RO0 A;  4N78 D;  2OQQ A;  3FXD A;  2Y0C A;  4JPZ B;  4PV1 B;  4WVZ A;  1MV8 A;  2MKV A;  2YKP A;  5KLV J;  2FYN B;  4Y99 B;  2Z5I A;  3L71 J;  1Z56 A;  2WT7 A;  1BCC E;  1M8O B;  3RK3 D;  3M9Q A;  1T6A A;  2AEM A;  3GHG A;  5K5G B;  1RE4 A;  3BCC J;  4K3A A;  1URQ B;  2J5U A;  2Y0D A;  1RQV A;  1FC2 C;  1JM0 A;  2J59 M;  1BCC D;  2QJP B;  1YQ3 C;  4EOT A;  3R2P A;  3UIA A;  4K35 A;  1LT9 C;  3KZI H;  1KMI Z;  4Y28 J; 
#chains in the Genus database with same CATH homology
 4M3L A;  1LTJ C;  5CMZ A;  1SFC B;  1WT6 A;  5KLV K;  1OXZ A;  1N7S B;  3HUS B;  1LTI C;  1T2K C;  1JCD A;  5APX A;  1JMM A;  2HPC B;  2XNX A;  1JOC A;  1M7L A;  4JF7 A;  1G1I A;  1L4A D;  3NXS A;  2OYH C;  1LTJ B;  3O8Z A;  2WIT A;  1JY3 P;  2CPB A;  1RY3 A;  3LIE A;  1FZC A;  4IFF A;  1L4A C;  1G1J A;  1DEB A;  1M1J C;  2PP6 A;  1SVF A;  4AQR D;  2J58 A;  2KLV A;  3VMY A;  5APW A;  1FOS E;  2N1T A;  2Q3I A;  2OYH B;  1SQP K;  3HE4 B;  1FAV A;  3BRT B;  2FFD C;  3H32 B;  1L4A B;  4N78 E;  5AVX B;  2FXM A;  5BU8 B;  3GHG C;  1RE3 C;  5APU A;  3B5N B;  3M0D A;  2KP8 A;  3HD7 A;  2WSE H;  3KYQ A;  1G2C A;  1FZE A;  5AVT B;  1GL2 D;  1N2D C;  1JY3 O;  5CCH D;  5AVQ B;  3U1A A;  1SFC A;  1GL2 C;  3IR9 A;  1LTS C;  5CCH C;  1N7S A;  3L4F A;  5APV A;  3TK1 A;  1KIL D;  1IC2 A;  2H8P D;  5AW5 B;  2OAR A;  1RF1 C;  5CHX A;  3VN0 A;  5AW4 B;  1MZ9 A;  2KOG A;  2WTY A;  1KIL C;  4GT1 A;  2GUV A;  4JYC A;  3P8M C;  3V5B A;  4LLH A;  1GW4 A;  1SQB K;  2HFE D;  1HUC A;  2XV5 A;  1RF1 B;  1JCC A;  3N7N A;  2WSF H;  2C0W A;  2IX7 C;  3EQ2 A;  3M9B A;  2M3B A;  5KJ7 D;  1J1E C;  3NFQ A;  1LGH B;  1YYC A;  4WB4 A;  3HTK B;  3VP8 A;  3NMD A;  5KJ7 C;  1FZC C;  3A5T A;  3B5N A;  3OA7 A;  3I5C A;  1NWQ A;  1DX7 A;  5CJ0 A;  4W80 A;  2R5B A;  4ZKU A;  5CCG D;  1NAF A;  1JY2 P;  5AW8 B;  5AW0 B;  4EIJ A;  1S9K E;  3VTP C;  3A2A A;  3MTU E;  1CI6 A;  5CCG C;  4XE5 B;  4JYB A;  1X9V A;  1NTM K;  1SQV K;  1IK9 A;  2C9N Y;  4IFD K;  1IFM A;  1SP4 A;  2OYI C;  3HD7 C;  5AVR B;  2WWW A;  1QL1 A;  2FYZ A;  4LGD E;  2BAS A;  3MUD A;  3M9H A;  3L37 A;  1RF0 C;  4WY4 A;  1LWU A;  1EQ7 A;  3P7K A;  1H8A A;  1XTG B;  2IFN A;  4C7N B;  1S9K D;  2A45 G;  2XKM A;  4HH2 A;  1N73 C;  1LT9 B;  4I1L A;  3U59 A;  3A7O A;  1FU1 A;  3SWY A;  1JY2 O;  2OYI B;  2JJL A;  5BVZ A;  1A02 F;  4AYC A;  1ZLL A;  1FZF A;  1JNM A;  2W27 A;  2IPP A;  3V4W A;  5AW6 B;  5CJ4 A;  3KQG A;  1N73 B;  3HTK A;  2YMY A;  4O9B A;  2M8R A;  3TYY A;  2NPS D;  4C46 A;  2KB7 P;  2YO3 A;  1MFZ A;  1CW5 A;  2A45 I;  1GZL A;  2ZFC A;  3IFM A;  2YO2 A;  1T8Z A;  4RES B;  4ZKP A;  1FJP A;  1NU1 K;  2L5G B;  3T97 A;  1HJB A;  1URQ A;  2NPS C;  1HWT C;  2QM7 A;  3BVH A;  4I2L C;  3V2R A;  3WMM 0;  1M1J B;  2I1K A;  3CI9 A;  1NOH A;  1XTC C;  1LTG C;  2Q7C A;  1YTZ I;  1RE4 C;  1KZU B;  2HOD B;  1KFM A;  3M91 A;  3C9I A;  3HE5 A;  3OJA B;  1L0L K;  2FFD B;  4WBA A;  2WT7 B;  2P2U A;  1ZR2 A;  2HLO A;  1NTK K;  4DZO A;  3GHG B;  2WSC H;  3VMX A;  3HUS A;  1ZR4 A;  2W6A A;  1LT9 A;  1AFO A;  1ZV8 A;  2HPC A;  1SQX K;  1OWA A;  2N9B A;  4N3Y B;  5KTB A;  3BAT A;  1LTJ A;  5AW9 B;  1IFI A;  2O1K A;  3L36 A;  1N7L A;  1GL2 B;  2Q5U A;  1NKZ B;  1LTB C;  2FKW B;  5AW2 B;  1H89 A;  2MJZ A;  3E1I A;  1GTW A;  2P67 A;  3TSI A;  2I1J A;  1T3J A;  1WRG A;  1HTL C;  1W2E A;  2OYH A;  4Y99 C;  3TNU B;  3HE4 A;  5AVY B;  1KIL B;  1JTH B;  3RK2 D;  3H32 A;  3U1C A;  1L4A A;  3CL3 D;  2N1T D;  2WPR A;  3M06 A;  2GUS A;  1T3U A;  3RK2 C;  1IJD B;  1HVV A;  4IFM A;  2YKO A;  1JUN A;  3P8C E;  1H88 A;  2FFD A;  1J1E B;  3V4Q A;  3M0A A;  2N1T C;  4HYT B;  5AW1 B;  3V2Q A;  3RL0 D;  5AW3 B;  1X8Y A;  1IO4 A;  1RE3 A;  1SLQ A;  3HD7 D;  1FZC B;  3RL0 C;  4KHX A;  2HYN A;  2A45 H;  3M0D C;  1E5W A;  2N1T B;  1NKN A;  3G3Z A;  2Q9I A;  1SFC D;  3MD0 A;  2FYU K;  3P8C D;  1N7S D;  1GL2 A;  1FBM A;  1AQ5 A;  3VMZ A;  1HBW A;  2IFM A;  2XU6 A;  5CCH A;  3RL0 B;  1VPC A;  1FZG A;  1IFD A;  2WPS A;  1HH0 A;  1SFC C;  3EFG A;  3II6 A;  3HD7 B;  1RF1 A;  1N7S C;  3KPE A;  3HUS C;  2O1J A;  1CZQ A;  2POH A;  3B8E B;  3VOP A;  1KIL A;  1JTH A;  3V2P A;  5BU5 A;  3N4X A;  3MIW A;  1GDT A;  2P1J A;  2C9L Y;  1FOS F;  1GW3 A;  1FJK A;  2R5D A;  1YTZ T;  2XDJ A;  1NTZ K;  2CPS A;  3BRV B;  2W6B A;  1IFN A;  2P7J A;  1HGZ A;  3MGN A;  3B5N D;  1CSB A;  2WZ7 A;  5KJ7 A;  5AVU B;  3V2N A;  3NTN A;  1X79 B;  3SWF A;  4AUW A;  3B5N C;  2NPS B;  1JY3 N;  2R32 A;  1NO4 A;  1GK6 A;  5CCG A;  1L0N K;  5AVS B;  3L35 A;  1DH3 A;  1GU4 A;  4C7N A;  4W7Z A;  4GKG A;  1IFJ A;  2OYI A;  2R3C A;  5AVV B;  4WY4 D;  2C0X A;  1KQL A;  1RF0 A;  2H7H A;  2Z4E A;  4GIF A;  2KSJ A;  1LTT C;  1CI6 B;  5AVZ B;  1GK4 A;  3VYI A;  1N73 A;  4WY4 C;  1LWU C;  2O01 H;  2JEE A;  4W7Y A;  1ZN5 A;  4N6J A;  1GU5 A;  2LKM A;  2VRS A;  1FZA A;  2WPQ A;  1J1D C;  1J2J B;  2KYV A;  4N78 D;  3OAK A;  5AW7 B;  2QM8 A;  2ZXE B;  1MV8 A;  3A3Y B;  1KFN A;  5APT A;  4I6M C;  4WY4 B;  1LWU B;  1M1J A;  2YKP A;  3PP5 A;  2YNY A;  2HOD A;  4OH8 B;  1J1D B;  4C7R A;  4Y99 B;  1PFI A;  1MUU A;  5APY A;  5AVW B;  1SQQ K;  1URQ D;  2Z5I A;  2E42 A;  1Z56 A;  2NPS A;  2WT7 A;  2XZR A;  3RK3 D;  3M9Q A;  3LW5 H;  2YKQ A;  4DOJ A;  1URQ C;  3GHG A;  2Z5H A;  1RE4 A;  3RK2 B;  1NH4 A;  5APS A;  3KDP B;  3RK3 C;  3CLQ A;  1QL2 A;  5APQ A;  1FZB A;  1N86 A;  1GD2 E;  2E43 A;  2GM4 A;  1FDM A;  1NHL A;  1URQ B;  2PAJ A;  4B86 A;  1HGV A;  4LC1 A;  1VDF A;  3RK3 B;  2HG5 D;  2J59 M;  1JO5 A;  3BAS A;  4EOT A;  1LTA C;  3R2P A;  3UIA A;  3HE5 B;  3HRN A;  3VP9 A;  1JY2 N;  2H43 A;  1LT9 C;  1G2C B;  1A02 J;  3H6P A;  3TNU A;  4XA4 A;  3LID A;  1T2K D;  3P32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...