1NTZG

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 17
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1ntzG00
1BGYG 1BCCG 1P84H 3L71G 4PD4H 4U3FG 1SQXG 1PP9G 3CX5H 1L0NG 1NTKG 3H1LG 3CWBG 5KLVG 1PPJG 2FYUG 1SQPG 3L74G 3L75G 1KYOH 3H1KG 1SQBG 1NU1G 3L73G 3H1IG 3CXHH 3L72G 1NTZG 1EZVG 2IBZG 1BE3G 4D6TG 1NTMG 3L70G 3H1JG 1SQVG 1L0LG 3BCCG 1KB9H 2BCCG 2A06G 3H1HG 1SQQG 3TGUG
chains in the Genus database with same CATH superfamily
5E79E 3L75D 5KLIC 1Q82Q 2NRGA 3VP8A 3L72D 1S1CX 1L0LD 3GHGB 3II6A 4LC1A 1BSHA 2D2CD 3Q1MA 1ZV8A 3W68A 1QLED 3E1RA 5AVZB 1RQUA 1JMBA 1S5LE 3H1LE 2HPCA 1SQBG 3V4QA 4DT0A 1OX3A 1MUUA 1BE3G 2FBWC 1QVFO 1S5LX 1MFTA 1KTMA 5TISE 1IFIA 1IFDA 5C39A 2WTYA 1YIJP 1SQBD 1LT9C 2O1JA 3B4SA 4WB4A 2FFDC 4ASVA 2M8RA 4OH8B 2I1JA 3GHGA 1GMJA 3G6EP 3T97B 5AVUB 2K9JA 2YKQA 4WY4A 2Z4EA 3H1HE 3CCMP 1H8AA 1JY2N 1CI6A 5AVWB 1RE3A 5KLVG 1YITP 3GMAA 2YNYA 2ITAA 3TGUE 1EC5A 1FDMA 4W80A 3I55P 4HJGH 1N73B 4NPDA 2GA1A 2B87B 5APUA 1OMIA 3HD7B 2M3BA 3GW6A 3TNUB 3WUVA 3V2QA 1VQPP 3T97A 1FZFA 1HVVA 5AVQB 3H32B 1AVYA 2W27A 2P2UA 1BGYJ 1NYHA 1SQPK 3A0BH 3AECC 1YTZI 4R4LA 2FYUG 3G9RA 1VPCA 3CWBJ 5KLIB 3V2RA 1VQ9P 1WT6A 1DH3A 1EZVE 1GU4A 1N7LA 4N3YB 3IFMA 1CZQA 1VL2A 4KJMA 2RKLA 2QJYB 2ZXEB 3IAOA 1LP1B 1N73A 2GM4A 2HODB 1JY3N 2B87A 2C0WA 1S9KE 3HD7A 2OYHC 1AV1A 2A45H 4XE5B 1RF1B 3H32A 5CBOA 3H1LD 3CCLP 3CX5H 2AXTH 2P1JA 3B5NB 3BRVB 2GUVA 4H0LD 1NTKE 4GDOA 1D7MA 2OTKE 4GOEA 2K3RA 1RE4C 3AE6C 2FXMA 4PD4E 1FOSE 1VQ7P 1LT9B 4JQ0D 2JR8A 2W83C 3A7OA 1R8EA 4IL6H 1OW6A 1GW3A 4OWFA 1LP1A 1SQXJ 2L5GB 1VQ8P 2ZT9D 3A0HE 3EFFK 3AE2C 3H1HD 3MUDC 3SSUA 1J1DC 3H1JJ 3LW5J 4DOJA 1SQXE 1U57A 2D2CC 2QM7A 4GT1A 3B5NA 3V5BA 1AFOA 5TJHA 1IZNB 1AA0A 3USSA 3TGUD 3H1JE 1LT9A 2NPSD 1JCDA 4UB6E 5B66E 2FYNB 3M06A 3SWKA 1NOHA 3CCJP 2JP3A 1HUCA 2WPSA 5DJUB 2N1TB 3CCSP 2Y9ZA 1NH4A 5CJ4A 1S2EA 1KC8Q 2BCCG 2BASA 2KB7P 2IFNA 2JJLA 3KXDA 1MKMA 3M9QA 2L91A 2Q9IA 3E1IA 1L0NE 3HTKB 2FKWB 4Y28J 1KQSO 2YXRB 1SQVK 1LWUC 1NTZJ 2E76D 2MKVA 1KD1Q 1DD4A 2Q3IA 1S9KD 1FDIA 2BEZF 2N1TA 3RK2D 2WPRA 2YXQB 1L0LK 1N2DC 3IR9A 1NTZE 2IBZG 2KS1B 4D6TJ 5APSA 2XKMA 2HLOA 1NTKD 2XNDH 5CCHD 3CCVP 1NWQA 2LXBA 1H88A 2LKMA 3HTKA 4PD4D 1SQPG 2WSEJ 1BDCA 4D6TE 2K1AA 1EDLA 1ZR2A 1KILC 2JWDA 3RBZA 5AVYB 2R32A 1SQBK 1PPJG 4DJGA 3KZIE 4A7PA 1PGJA 1SFCB 2H8PD 1KYOD 4EDFA 1RE4A 1SQVJ 3BCCJ 1R5SA 1SQXD 1P84H 2Q7CA 1KFNA 2O01N 3UIAA 1FJKA 2R3CA 4GIFA 2KI7B 4NPFX 2WT7B 5AVXB 2O3JA 3H1JD 1NU1G 1L4AB 1LT1A 5L8RJ 4H0LC 1SQVE 1KFMA 1NTMG 5AW7B 3EQ2A 2QJKC 1LTAC 3BVHA 3HRNA 4RKUJ 1LTIC 1PP9G 4I1LA 5GTIE 5KLVK 2PAJA 1IFPA 2E5YA 2H88C 1NAYA 1YQ4C 1NJIQ 4YXWH 1SFCA 2ZT9C 1N7SB 1L0ND 3AEGC 3HUSC 3LIDA 2E74B 3RK3D 4W7YA 1LGHB 3P32A 1G1JA 3NMDA 2WT7A 2QM8A 4JBZA 5AW9B 3H1IG 1BE3J 3KQGA 3IN6A 1GDTA 3D70A 4C7RA 3Q3DA 2E75D 3AE9C 3L74D 4YTPC 2V7QH 2NPSC 2FYUK 3L37A 3O6QA 1KB9E 4EI2A 3MIWA 1VQMP 5B5EE 2O01J 1KQFB 2QRXA 2A06E 1GU5A 1LTJB 2KSEA 5APVA 1YJWP 2YKPA 3M0AA 2J58A 1SQQJ 1LWUA 4U3FG 1KILB 2E43A 1FZGA 2E42A 1E5WA 1LTSC 2AEFA 3H1KE 5KLVJ 5GTHE 1IK7A 3VMXA 1M1JC 2KIKA 2K9YA 1KZUB 1NVOA 3AEEC 1SQQE 4EOTA 1BCCG 1J1EB 3CCUP 4KHXA 1GK6A 3SWFA 3G71P 1BDDA 2E76C 3L71J 5CMZA 1GW4A 2QEXP 2C0XA 2HPCB 3L75G 5AVSB 2OYIC 2AEJA 3CXHH 3L72G 2ZYGA 4IOIH 4L76A 3F5HA 2Q3EA 4H0LB 3F89A 3PP5A 3H25A 2CPSA 4U7JA 3L71E 4BRYB 1SVFA 2WSCH 1KILA 2ZJSE 1T2KD 2FYUJ 1A02J 1LTTC 5CCHC 3M9HA 3MD0A 2K9JB 4WY4B 1OIPA 2WPQA 4H44D 1W2BO 1VQOP 5BU5A 1CI6B 1KYOH 2RMZA 2H7HA 3CXHI 3L73J 4K35A 1FE6A 1IFJA 2KOGA 2LR2A 4CPGA 4BRYA 2IBZI 1N8RQ 3AEDC 3BATA 3KYQA 3L73E 4ZKPA 4H13B 3M0DC 2KLVA 3HE5B 1KB9D 3FWLA 2CPBA 4UB8H 3N7NA 4I7ZC 2YIUC 3C8VA 1ZLLA 5AW1B 3WU2E 3CCEP 2JDIH 3PJSK 1OZHA 1OVRA 3LIEA 1M90Q 1LTBC 2A06D 3VTPC 1IC2A 2Y0DA 2VRSA 3L70G 4C46A 2O1KA 3CPWO 4JYBA 5CCGC 1URQD 3OW2O 2N9YB 5KAIE 3H1KD 5AVRB 1U7JA 2RN0A 3CD6P 1PGOA 4AQRD 3L70D 1IJDB 1SQQD 3RK3C 4L74A 1LTGC 3TF5A 2HFED 3RL0D 4N6JA 2WITA 1YTZT 3HE5A 2PP6A 5APTA 1S4XA 4OGQD 1OXZA 4WVZA 1GL2D 2E75C 4O9BA 1HF9A 1IK9A 2IX7C 3HE4B 3A5TA 3L71D 2BCCJ 2AEMA 1M1JA 2W6AA 1BGYE 1H0TB 2XU6A 3VP9A 3H1LG 3CWBE 2OARA 4PJ0H 2R3SA 3CI9A 2BCCE 4TT3H 2W6BA 5KAFE 4EIJA 3JCUE 4PV1D 1HH0A 3CMEP 1NU1K 3V4WA 3PH0A 3W67A 1NTMK 3FGAD 1EXJA 5H2FH 2FFDB 4C7NB 3HE4A 3H1HG 3P8CE 1VF5D 1EDIA 3PTZA 5AVTB 1H0TA 1GZLA 1JY2O 1NAFA 2YIUB 1SQPJ 1FAVA 2HR3A 2IBZE 5K5GB 1KQLA 1ZRTE 2WSFH 1T2KC 3TGUG 1FDOA 2A45I 1RQVA 3P8MC 3CX5I 2KZIA 2PRRA 1SQPE 4H44C 1X9VA 3G3ZA 2IZ0A 1NKNA 1QL1A 1OWAA 2FFDA 4C7NA 3RK3B 1M56D 3GF7A 4EYYQ 3FWNA 1YJ9P 1QGKB 3BASA 4WWIA 2Z5HA 2JEEA 1NU1J 1EZVG 1KB9H 1NTMJ 1VQ5P 1Q81Q 3D71A 3VMAA 1ZP0C 1EXIA 2POHA 1PP9J 5CBNA 2C9NY 3FXEA 5CCGA 1Y47A 3CC4P 1EZVD 1BGYD 1JY3O 2OYHB 1K04A 1PP9E 3CWBD 3BRTB 3I5CA 4YXDC 1NTKG 1AQTA 4GOFA 2KLUA 1GTWA 1URQC 3K5BA 1QL2A 4TLFA 2WMMA 5M1BA 3H1IJ 3HD7D 3U1AA 3MTUE 2OTLP 2ZYDA 2K37A 1OVUA 1GD2E 1W5CE 4Z1MH 2JO1A 1SP4A 3RL0C 3ZDMA 1HGZA 3H1IE 4OGQC 3VMZA 5E79H 2PGDA 3AE3C 3P8CD 4L73A 3A0BE 1GL2C 4GKGA 2OYHA 1DEBA 3AEFC 4YPCA 1J1DB 1JOCA 1SQXG 1TU3F 2QA4P 1VQNP 4U3FJ 2JKVA 1CW5A 1K8AQ 2D2CB 1KORA 1ZRTD 2Q1KA 3H1JG 2MJZA 1N86A 1S5LH 1H89A 1G1IA 4U3FE 2PFXA 1BCCJ 3P7KA 1JNMA 2YKOA 5KKZC 3B5ND 4PV1C 4DZOA 2AXTE 3IF4A 2IPPA 3GF3A 5TISH 3L72J 3BCCE 4LLHA 2QJPC 1L0LJ 4AYCA 4Y99C 1JY2P 4N78E 3SFEC 3MUDA 1FOSF 1L0NG 3ABVC 3O6QB 2ZFCA 3PRJA 3L36A 1VF5C 1JO5A 4IL6E 3L4FA 2I8DA 3WU2H 3C1LA 1L0LE 2Y9YA 3G4SP 1DD3A 3CC7P 4ZMDA 1AVOA 1LWUB 2YO2A 1P84I 3M9BA 4IL6X 3L74G 3H6PA 4ASWA 1K73Q 1SQBJ 1NTZG 2XV5A 2DW3A 1GK4A 2OTJP 1EQ7A 3WUTA 1X0TA 3KPEA 3CLQA 3OJAB 5KTBA 1NTZD 1SQBE 1KV4A 2K88A 2N1TD 4L75A 1BE3E 1PIXA 3TSIA 3O8ZA 1ZOYC 5AVVB 1X22A 1HBWA 4R4MA 1JY3P 1ZXGA 3AE5C 1T3UA 3WMM0 4D6TD 2OQQA 2WPVB 1HGVA 4IFMA 2H89C 1PV3A 3GLMA 1FZEA 3L35A 1ZW0A 5KJ7D 3NTNA 1T3JA 3FXDA 1R5LA 3D6ZA 1G2CB 2P58A 2FYZA 5KLVE 1JM0A 1Q2NA 2HG5D 4K3AA 5KKZB 4RJTA 1N73C 2LXCB 4JF7A 3RK2C 1KN7A 2R5BA 4PD4H 2M3EA 3HD7C 2QJKB 2V4HA 3JSVC 1NGMB 4HYTB 1X8YA 4GODA 1SQVD 3BCCD 3MZWB 2Q6QA 2ZAEB 1KILE 3E7KA 2XNXA 4N78D 4BWNA 1PGQA 2OYOA 2KK7A 2KSJA 1IFNA 3A0HH 1Z56A 3AE4C 2P10A 2P67A 2ZT9B 1MFZA 4NPEA 1G2CA 2FYUE 3HUSB 3H1LJ 2KUBA 2ZVOB 1ZR4A 4HB1A 1DX7A 2QJYC 3MP7B 1SFCD 1XTCC 2ZYAA 5AW2B 1QEXA 1L2PA 4PD4I 1IO4A 3AE7C 3LW5H 4UB6H 5B66H 2B89A 3WUUA 2NPSB 1P84E 1RF1C 1M8OB 4WBAA 2A06G 1L4AD 3B5NC 2WVRA 3H1HJ 3SFDC 5AW8B 3H1KG 1BE3D 3HUSA 1KYOI 1RH5B 1VQ6P 1VDFA 3V2NA 1SQQG 1M1JB 3TGUJ 3B71A 1NTKK 1N7SD 3NFQA 3CL3D 2W90A 2B88A 2E74D 3Q5SA 2E76B 2NPSA 2KZJA 3V2PA 4ZKUA 2V7QJ 3PLNA 2OYIB 1Q7YQ 1DIPA 3L71G 5KLVD 3VMYA 4XFJA 1YBKA 2CK3H 3RK2B 1NO4A 2FYNC 2R5DA 2WSSH 2QG4A 1E79H 1AQ5A 2IFMA 1XTGB 4KT0J 1SQXK 1PFIA 1FJPA 2N1TC 1HWTC 2N9BA 2WZ7A 4OVNF 1FZAA 1S72P 1ZMEC 1FZBA 1KILD 2SPZA 1T6AA 3MGNA 5AW5B 5DJTB 1YJNP 2HYNA 2WSEH 2OYIA 5CHXA 3KZIH 3CC2P 2W8ZA 3MHVA 2FYUD 2QIWA 3I56P 1Y8AA 1FC2C 2IYPA 2IYOA 1NTKJ 5KJ7C 3S4RA 2M0BA 1SS1A 3L73G 4IFFA 3TNUA 1M1KQ 1FU1A 3OAKA 2WSCJ 4ZNCA 2XZRA 5CCHA 5CJ0A 3CXHE 1L0NK 1HJ0A 2P7JA 1P84D 3L73D 1UIXA 3SWYA 4I7ZB 5AW3B 1ZN5A 5GTIH 1QVGO 3CMAP 3R2PA 3RGUA 1JMMA 1FZCC 3A2AA 2J5UA 2OGUA 1X79B 2WQYC 4WY4D 3N4XA 2C9LY 2HODA 2W6JH 1DEEG 3VYIA 1NTZK 5AW0B 1Y9BA 1A02F 1U7MA 1FBMA 1KYOE 1JTHB 1RF1A 3AE8C 2BEQD 1M7LA 1VQ4P 3OA7A 3M0DA 1SFCC 2Q5UA 2H43A 1JB0J 1PPJE 3KHUA 1FS0E 2YO3A 1LNQA 2E75B 3U1CA 2M5AB 1BGYG 4H13D 1MV8A 1WRGA 1PL5A 2FY8A 5B5EH 1QX8A 1L4AC 3CWBG 1L0NJ 2Y0EA 5APXA 5BU8B 1RHZB 4B86A 1NU1E 4UB8E 5BVZA 1USEA 2R44A 1JUNA 1NTME 3NXSA 2J59M 3RL0g 1EDKA 3VOPA 5AW6B 1JTHA 5GTHH 3C9IA 2O01H 3V6IA 1BSNA 3RK3E 3TK1A 3L74J 2BCCD 1UIIA 1N7SC 1KB9I 2E74C 2M5AA 1K9MQ 3EWKA 4I6MC 1AJYA 3AEAC 4RESB 1YQ3C 3L74E 3TYYA 2QVAA 1S3JA 1OW7A 3CCQP 1Q90D 3VN0A 2KP8A 2KYVA 3CXHD 2IDBA 5AW4B 1IFMA 2KNCB 4IFDK 1YYCA 1M57D 4HKZH 2Z5IA 1FZCB 3FX0A 2IBZD 1RF0C 1LTJC 3U59A 3AE1C 3CCRP 2FXPA 4H44B 4JYCA 5KJ7A 2YMYA 4PJ0E 1SQPD 3Q5RA 2AXCA 2G3AA 2UWJE 3R4YA 1VQKP 3L75J 3CX5E 4RO0A 1J1EC 2KS1A 4HH2A 2YMKA 1LJ2A 5EFWB 4W7ZA 2KNCA 2NZ2A 1JEKA 2WWWA 1BCCE 1NHLA 4LGDE 2G8YA 1OFCX 1PPJD 1FZCA 4MN4C 5H2FE 4BXLA 3L75E 2WSFJ 1W2EA 2IZ1A 3L72E 2B9BA 1SQQK 2GUSA 3Q5PA 1NU1D 1SLQA 2JWAA 3GHGC 4DCKA 1NTMD 5CCGD 1HTLC 4WY4C 5APWA 1PZQA 1MZ9A 5KAIH 1URQB 3A3YB 1RY3A 5APYA 3QH9A 3B8EB 2ZXXA 1J2JB 1PP9D 3RBXA 1RE3C 3Q2YA 3D6YA 1HJBA 4I2LC 1L4AA 4QMAA 3RL0B 2I1KA 4D6TG 1PGPA 2Y0CA 2KXPB 4OGQB 1YHQP 1GL2B 3GG2A 3EFGA 3H1ID 1CSBA 1KMIZ 4M3LA 4H13C 1JCCA 3H1KJ 1USDA 3AEBC 1URQA 3L70J 2RH0A 4JPZB 3M91A 1N7SA 3ITKA 1T8ZA 1WMKA 2XDJA 3S9OA 3KDPB 1Q86Q 2A45G 5KAFH 2E5TA 2QE7H 3JCUH 2QSIA 1OW8A 3L70E 1SQVG 3BCCG 4AUWA 4PV1B 4U3FD 3TDKA 1VQLP 3QWOC 2QJPB 1NKZB 1GL2A 1YI2P 4Y99B 2ZVNB 1EZVI 2FXOA 3CX5D 1OVVA 3JC22 1EDJA 1L0LG 1BCCD 3PHLA 4XA4A 1VF5B 1K05A 1RF0A 3S1KA 5APQA 1LTJA 1KQGB
chains in the Genus database with same CATH topology
1BGYG 1BCCG 1P84H 3L71G 4PD4H 4U3FG 1SQXG 1PP9G 3CX5H 1L0NG 1NTKG 3H1LG 3CWBG 5KLVG 1PPJG 2FYUG 1SQPG 3L74G 3L75G 1KYOH 3H1KG 1SQBG 1NU1G 3L73G 3H1IG 3CXHH 3L72G 1NTZG 1EZVG 2IBZG 1BE3G 4D6TG 1NTMG 3L70G 3H1JG 1SQVG 1L0LG 3BCCG 1KB9H 2BCCG 2A06G 3H1HG 1SQQG 3TGUG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGY G;  1BCC G;  1P84 H;  3L71 G;  4PD4 H;  4U3F G;  1SQX G;  1PP9 G;  3CX5 H;  1L0N G;  1NTK G;  3H1L G;  3CWB G;  5KLV G;  1PPJ G;  2FYU G;  1SQP G;  3L74 G;  3L75 G;  1KYO H;  3H1K G;  1SQB G;  1NU1 G;  3L73 G;  3H1I G;  3CXH H;  3L72 G;  1NTZ G;  1EZV G;  2IBZ G;  1BE3 G;  4D6T G;  1NTM G;  3L70 G;  3H1J G;  1SQV G;  1L0L G;  3BCC G;  1KB9 H;  2BCC G;  2A06 G;  3H1H G;  1SQQ G;  3TGU G; 
#chains in the Genus database with same CATH topology
 5E79 E;  3L75 D;  5KLI C;  1Q82 Q;  2NRG A;  3VP8 A;  3L72 D;  1S1C X;  1L0L D;  3GHG B;  3II6 A;  4LC1 A;  1BSH A;  2D2C D;  3Q1M A;  1ZV8 A;  3W68 A;  1QLE D;  3E1R A;  5AVZ B;  1RQU A;  1JMB A;  1S5L E;  3H1L E;  2HPC A;  1SQB G;  3V4Q A;  4DT0 A;  1OX3 A;  1MUU A;  1BE3 G;  2FBW C;  1QVF O;  1S5L X;  1MFT A;  1KTM A;  5TIS E;  1IFI A;  1IFD A;  5C39 A;  2WTY A;  1YIJ P;  1SQB D;  1LT9 C;  2O1J A;  3B4S A;  4WB4 A;  2FFD C;  4ASV A;  2M8R A;  4OH8 B;  2I1J A;  3GHG A;  1GMJ A;  3G6E P;  3T97 B;  5AVU B;  2K9J A;  2YKQ A;  4WY4 A;  2Z4E A;  3H1H E;  3CCM P;  1H8A A;  1JY2 N;  1CI6 A;  5AVW B;  1RE3 A;  5KLV G;  1YIT P;  3GMA A;  2YNY A;  2ITA A;  3TGU E;  1EC5 A;  1FDM A;  4W80 A;  3I55 P;  4HJG H;  1N73 B;  4NPD A;  2GA1 A;  2B87 B;  5APU A;  1OMI A;  3HD7 B;  2M3B A;  3GW6 A;  3TNU B;  3WUV A;  3V2Q A;  1VQP P;  3T97 A;  1FZF A;  1HVV A;  5AVQ B;  3H32 B;  1AVY A;  2W27 A;  2P2U A;  1BGY J;  1NYH A;  1SQP K;  3A0B H;  3AEC C;  1YTZ I;  4R4L A;  2FYU G;  3G9R A;  1VPC A;  3CWB J;  5KLI B;  3V2R A;  1VQ9 P;  1WT6 A;  1DH3 A;  1EZV E;  1GU4 A;  1N7L A;  4N3Y B;  3IFM A;  1CZQ A;  1VL2 A;  4KJM A;  2RKL A;  2QJY B;  2ZXE B;  3IAO A;  1LP1 B;  1N73 A;  2GM4 A;  2HOD B;  1JY3 N;  2B87 A;  2C0W A;  1S9K E;  3HD7 A;  2OYH C;  1AV1 A;  2A45 H;  4XE5 B;  1RF1 B;  3H32 A;  5CBO A;  3H1L D;  3CCL P;  3CX5 H;  2AXT H;  2P1J A;  3B5N B;  3BRV B;  2GUV A;  4H0L D;  1NTK E;  4GDO A;  1D7M A;  2OTK E;  4GOE A;  2K3R A;  1RE4 C;  3AE6 C;  2FXM A;  4PD4 E;  1FOS E;  1VQ7 P;  1LT9 B;  4JQ0 D;  2JR8 A;  2W83 C;  3A7O A;  1R8E A;  4IL6 H;  1OW6 A;  1GW3 A;  4OWF A;  1LP1 A;  1SQX J;  2L5G B;  1VQ8 P;  2ZT9 D;  3A0H E;  3EFF K;  3AE2 C;  3H1H D;  3MUD C;  3SSU A;  1J1D C;  3H1J J;  3LW5 J;  4DOJ A;  1SQX E;  1U57 A;  2D2C C;  2QM7 A;  4GT1 A;  3B5N A;  3V5B A;  1AFO A;  5TJH A;  1IZN B;  1AA0 A;  3USS A;  3TGU D;  3H1J E;  1LT9 A;  2NPS D;  1JCD A;  4UB6 E;  5B66 E;  2FYN B;  3M06 A;  3SWK A;  1NOH A;  3CCJ P;  2JP3 A;  1HUC A;  2WPS A;  5DJU B;  2N1T B;  3CCS P;  2Y9Z A;  1NH4 A;  5CJ4 A;  1S2E A;  1KC8 Q;  2BCC G;  2BAS A;  2KB7 P;  2IFN A;  2JJL A;  3KXD A;  1MKM A;  3M9Q A;  2L91 A;  2Q9I A;  3E1I A;  1L0N E;  3HTK B;  2FKW B;  4Y28 J;  1KQS O;  2YXR B;  1SQV K;  1LWU C;  1NTZ J;  2E76 D;  2MKV A;  1KD1 Q;  1DD4 A;  2Q3I A;  1S9K D;  1FDI A;  2BEZ F;  2N1T A;  3RK2 D;  2WPR A;  2YXQ B;  1L0L K;  1N2D C;  3IR9 A;  1NTZ E;  2IBZ G;  2KS1 B;  4D6T J;  5APS A;  2XKM A;  2HLO A;  1NTK D;  2XND H;  5CCH D;  3CCV P;  1NWQ A;  2LXB A;  1H88 A;  2LKM A;  3HTK A;  4PD4 D;  1SQP G;  2WSE J;  1BDC A;  4D6T E;  2K1A A;  1EDL A;  1ZR2 A;  1KIL C;  2JWD A;  3RBZ A;  5AVY B;  2R32 A;  1SQB K;  1PPJ G;  4DJG A;  3KZI E;  4A7P A;  1PGJ A;  1SFC B;  2H8P D;  1KYO D;  4EDF A;  1RE4 A;  1SQV J;  3BCC J;  1R5S A;  1SQX D;  1P84 H;  2Q7C A;  1KFN A;  2O01 N;  3UIA A;  1FJK A;  2R3C A;  4GIF A;  2KI7 B;  4NPF X;  2WT7 B;  5AVX B;  2O3J A;  3H1J D;  1NU1 G;  1L4A B;  1LT1 A;  5L8R J;  4H0L C;  1SQV E;  1KFM A;  1NTM G;  5AW7 B;  3EQ2 A;  2QJK C;  1LTA C;  3BVH A;  3HRN A;  4RKU J;  1LTI C;  1PP9 G;  4I1L A;  5GTI E;  5KLV K;  2PAJ A;  1IFP A;  2E5Y A;  2H88 C;  1NAY A;  1YQ4 C;  1NJI Q;  4YXW H;  1SFC A;  2ZT9 C;  1N7S B;  1L0N D;  3AEG C;  3HUS C;  3LID A;  2E74 B;  3RK3 D;  4W7Y A;  1LGH B;  3P32 A;  1G1J A;  3NMD A;  2WT7 A;  2QM8 A;  4JBZ A;  5AW9 B;  3H1I G;  1BE3 J;  3KQG A;  3IN6 A;  1GDT A;  3D70 A;  4C7R A;  3Q3D A;  2E75 D;  3AE9 C;  3L74 D;  4YTP C;  2V7Q H;  2NPS C;  2FYU K;  3L37 A;  3O6Q A;  1KB9 E;  4EI2 A;  3MIW A;  1VQM P;  5B5E E;  2O01 J;  1KQF B;  2QRX A;  2A06 E;  1GU5 A;  1LTJ B;  2KSE A;  5APV A;  1YJW P;  2YKP A;  3M0A A;  2J58 A;  1SQQ J;  1LWU A;  4U3F G;  1KIL B;  2E43 A;  1FZG A;  2E42 A;  1E5W A;  1LTS C;  2AEF A;  3H1K E;  5KLV J;  5GTH E;  1IK7 A;  3VMX A;  1M1J C;  2KIK A;  2K9Y A;  1KZU B;  1NVO A;  3AEE C;  1SQQ E;  4EOT A;  1BCC G;  1J1E B;  3CCU P;  4KHX A;  1GK6 A;  3SWF A;  3G71 P;  1BDD A;  2E76 C;  3L71 J;  5CMZ A;  1GW4 A;  2QEX P;  2C0X A;  2HPC B;  3L75 G;  5AVS B;  2OYI C;  2AEJ A;  3CXH H;  3L72 G;  2ZYG A;  4IOI H;  4L76 A;  3F5H A;  2Q3E A;  4H0L B;  3F89 A;  3PP5 A;  3H25 A;  2CPS A;  4U7J A;  3L71 E;  4BRY B;  1SVF A;  2WSC H;  1KIL A;  2ZJS E;  1T2K D;  2FYU J;  1A02 J;  1LTT C;  5CCH C;  3M9H A;  3MD0 A;  2K9J B;  4WY4 B;  1OIP A;  2WPQ A;  4H44 D;  1W2B O;  1VQO P;  5BU5 A;  1CI6 B;  1KYO H;  2RMZ A;  2H7H A;  3CXH I;  3L73 J;  4K35 A;  1FE6 A;  1IFJ A;  2KOG A;  2LR2 A;  4CPG A;  4BRY A;  2IBZ I;  1N8R Q;  3AED C;  3BAT A;  3KYQ A;  3L73 E;  4ZKP A;  4H13 B;  3M0D C;  2KLV A;  3HE5 B;  1KB9 D;  3FWL A;  2CPB A;  4UB8 H;  3N7N A;  4I7Z C;  2YIU C;  3C8V A;  1ZLL A;  5AW1 B;  3WU2 E;  3CCE P;  2JDI H;  3PJS K;  1OZH A;  1OVR A;  3LIE A;  1M90 Q;  1LTB C;  2A06 D;  3VTP C;  1IC2 A;  2Y0D A;  2VRS A;  3L70 G;  4C46 A;  2O1K A;  3CPW O;  4JYB A;  5CCG C;  1URQ D;  3OW2 O;  2N9Y B;  5KAI E;  3H1K D;  5AVR B;  1U7J A;  2RN0 A;  3CD6 P;  1PGO A;  4AQR D;  3L70 D;  1IJD B;  1SQQ D;  3RK3 C;  4L74 A;  1LTG C;  3TF5 A;  2HFE D;  3RL0 D;  4N6J A;  2WIT A;  1YTZ T;  3HE5 A;  2PP6 A;  5APT A;  1S4X A;  4OGQ D;  1OXZ A;  4WVZ A;  1GL2 D;  2E75 C;  4O9B A;  1HF9 A;  1IK9 A;  2IX7 C;  3HE4 B;  3A5T A;  3L71 D;  2BCC J;  2AEM A;  1M1J A;  2W6A A;  1BGY E;  1H0T B;  2XU6 A;  3VP9 A;  3H1L G;  3CWB E;  2OAR A;  4PJ0 H;  2R3S A;  3CI9 A;  2BCC E;  4TT3 H;  2W6B A;  5KAF E;  4EIJ A;  3JCU E;  4PV1 D;  1HH0 A;  3CME P;  1NU1 K;  3V4W A;  3PH0 A;  3W67 A;  1NTM K;  3FGA D;  1EXJ A;  5H2F H;  2FFD B;  4C7N B;  3HE4 A;  3H1H G;  3P8C E;  1VF5 D;  1EDI A;  3PTZ A;  5AVT B;  1H0T A;  1GZL A;  1JY2 O;  1NAF A;  2YIU B;  1SQP J;  1FAV A;  2HR3 A;  2IBZ E;  5K5G B;  1KQL A;  1ZRT E;  2WSF H;  1T2K C;  3TGU G;  1FDO A;  2A45 I;  1RQV A;  3P8M C;  3CX5 I;  2KZI A;  2PRR A;  1SQP E;  4H44 C;  1X9V A;  3G3Z A;  2IZ0 A;  1NKN A;  1QL1 A;  1OWA A;  2FFD A;  4C7N A;  3RK3 B;  1M56 D;  3GF7 A;  4EYY Q;  3FWN A;  1YJ9 P;  1QGK B;  3BAS A;  4WWI A;  2Z5H A;  2JEE A;  1NU1 J;  1EZV G;  1KB9 H;  1NTM J;  1VQ5 P;  1Q81 Q;  3D71 A;  3VMA A;  1ZP0 C;  1EXI A;  2POH A;  1PP9 J;  5CBN A;  2C9N Y;  3FXE A;  5CCG A;  1Y47 A;  3CC4 P;  1EZV D;  1BGY D;  1JY3 O;  2OYH B;  1K04 A;  1PP9 E;  3CWB D;  3BRT B;  3I5C A;  4YXD C;  1NTK G;  1AQT A;  4GOF A;  2KLU A;  1GTW A;  1URQ C;  3K5B A;  1QL2 A;  4TLF A;  2WMM A;  5M1B A;  3H1I J;  3HD7 D;  3U1A A;  3MTU E;  2OTL P;  2ZYD A;  2K37 A;  1OVU A;  1GD2 E;  1W5C E;  4Z1M H;  2JO1 A;  1SP4 A;  3RL0 C;  3ZDM A;  1HGZ A;  3H1I E;  4OGQ C;  3VMZ A;  5E79 H;  2PGD A;  3AE3 C;  3P8C D;  4L73 A;  3A0B E;  1GL2 C;  4GKG A;  2OYH A;  1DEB A;  3AEF C;  4YPC A;  1J1D B;  1JOC A;  1SQX G;  1TU3 F;  2QA4 P;  1VQN P;  4U3F J;  2JKV A;  1CW5 A;  1K8A Q;  2D2C B;  1KOR A;  1ZRT D;  2Q1K A;  3H1J G;  2MJZ A;  1N86 A;  1S5L H;  1H89 A;  1G1I A;  4U3F E;  2PFX A;  1BCC J;  3P7K A;  1JNM A;  2YKO A;  5KKZ C;  3B5N D;  4PV1 C;  4DZO A;  2AXT E;  3IF4 A;  2IPP A;  3GF3 A;  5TIS H;  3L72 J;  3BCC E;  4LLH A;  2QJP C;  1L0L J;  4AYC A;  4Y99 C;  1JY2 P;  4N78 E;  3SFE C;  3MUD A;  1FOS F;  1L0N G;  3ABV C;  3O6Q B;  2ZFC A;  3PRJ A;  3L36 A;  1VF5 C;  1JO5 A;  4IL6 E;  3L4F A;  2I8D A;  3WU2 H;  3C1L A;  1L0L E;  2Y9Y A;  3G4S P;  1DD3 A;  3CC7 P;  4ZMD A;  1AVO A;  1LWU B;  2YO2 A;  1P84 I;  3M9B A;  4IL6 X;  3L74 G;  3H6P A;  4ASW A;  1K73 Q;  1SQB J;  1NTZ G;  2XV5 A;  2DW3 A;  1GK4 A;  2OTJ P;  1EQ7 A;  3WUT A;  1X0T A;  3KPE A;  3CLQ A;  3OJA B;  5KTB A;  1NTZ D;  1SQB E;  1KV4 A;  2K88 A;  2N1T D;  4L75 A;  1BE3 E;  1PIX A;  3TSI A;  3O8Z A;  1ZOY C;  5AVV B;  1X22 A;  1HBW A;  4R4M A;  1JY3 P;  1ZXG A;  3AE5 C;  1T3U A;  3WMM 0;  4D6T D;  2OQQ A;  2WPV B;  1HGV A;  4IFM A;  2H89 C;  1PV3 A;  3GLM A;  1FZE A;  3L35 A;  1ZW0 A;  5KJ7 D;  3NTN A;  1T3J A;  3FXD A;  1R5L A;  3D6Z A;  1G2C B;  2P58 A;  2FYZ A;  5KLV E;  1JM0 A;  1Q2N A;  2HG5 D;  4K3A A;  5KKZ B;  4RJT A;  1N73 C;  2LXC B;  4JF7 A;  3RK2 C;  1KN7 A;  2R5B A;  4PD4 H;  2M3E A;  3HD7 C;  2QJK B;  2V4H A;  3JSV C;  1NGM B;  4HYT B;  1X8Y A;  4GOD A;  1SQV D;  3BCC D;  3MZW B;  2Q6Q A;  2ZAE B;  1KIL E;  3E7K A;  2XNX A;  4N78 D;  4BWN A;  1PGQ A;  2OYO A;  2KK7 A;  2KSJ A;  1IFN A;  3A0H H;  1Z56 A;  3AE4 C;  2P10 A;  2P67 A;  2ZT9 B;  1MFZ A;  4NPE A;  1G2C A;  2FYU E;  3HUS B;  3H1L J;  2KUB A;  2ZVO B;  1ZR4 A;  4HB1 A;  1DX7 A;  2QJY C;  3MP7 B;  1SFC D;  1XTC C;  2ZYA A;  5AW2 B;  1QEX A;  1L2P A;  4PD4 I;  1IO4 A;  3AE7 C;  3LW5 H;  4UB6 H;  5B66 H;  2B89 A;  3WUU A;  2NPS B;  1P84 E;  1RF1 C;  1M8O B;  4WBA A;  2A06 G;  1L4A D;  3B5N C;  2WVR A;  3H1H J;  3SFD C;  5AW8 B;  3H1K G;  1BE3 D;  3HUS A;  1KYO I;  1RH5 B;  1VQ6 P;  1VDF A;  3V2N A;  1SQQ G;  1M1J B;  3TGU J;  3B71 A;  1NTK K;  1N7S D;  3NFQ A;  3CL3 D;  2W90 A;  2B88 A;  2E74 D;  3Q5S A;  2E76 B;  2NPS A;  2KZJ A;  3V2P A;  4ZKU A;  2V7Q J;  3PLN A;  2OYI B;  1Q7Y Q;  1DIP A;  3L71 G;  5KLV D;  3VMY A;  4XFJ A;  1YBK A;  2CK3 H;  3RK2 B;  1NO4 A;  2FYN C;  2R5D A;  2WSS H;  2QG4 A;  1E79 H;  1AQ5 A;  2IFM A;  1XTG B;  4KT0 J;  1SQX K;  1PFI A;  1FJP A;  2N1T C;  1HWT C;  2N9B A;  2WZ7 A;  4OVN F;  1FZA A;  1S72 P;  1ZME C;  1FZB A;  1KIL D;  2SPZ A;  1T6A A;  3MGN A;  5AW5 B;  5DJT B;  1YJN P;  2HYN A;  2WSE H;  2OYI A;  5CHX A;  3KZI H;  3CC2 P;  2W8Z A;  3MHV A;  2FYU D;  2QIW A;  3I56 P;  1Y8A A;  1FC2 C;  2IYP A;  2IYO A;  1NTK J;  5KJ7 C;  3S4R A;  2M0B A;  1SS1 A;  3L73 G;  4IFF A;  3TNU A;  1M1K Q;  1FU1 A;  3OAK A;  2WSC J;  4ZNC A;  2XZR A;  5CCH A;  5CJ0 A;  3CXH E;  1L0N K;  1HJ0 A;  2P7J A;  1P84 D;  3L73 D;  1UIX A;  3SWY A;  4I7Z B;  5AW3 B;  1ZN5 A;  5GTI H;  1QVG O;  3CMA P;  3R2P A;  3RGU A;  1JMM A;  1FZC C;  3A2A A;  2J5U A;  2OGU A;  1X79 B;  2WQY C;  4WY4 D;  3N4X A;  2C9L Y;  2HOD A;  2W6J H;  1DEE G;  3VYI A;  1NTZ K;  5AW0 B;  1Y9B A;  1A02 F;  1U7M A;  1FBM A;  1KYO E;  1JTH B;  1RF1 A;  3AE8 C;  2BEQ D;  1M7L A;  1VQ4 P;  3OA7 A;  3M0D A;  1SFC C;  2Q5U A;  2H43 A;  1JB0 J;  1PPJ E;  3KHU A;  1FS0 E;  2YO3 A;  1LNQ A;  2E75 B;  3U1C A;  2M5A B;  1BGY G;  4H13 D;  1MV8 A;  1WRG A;  1PL5 A;  2FY8 A;  5B5E H;  1QX8 A;  1L4A C;  3CWB G;  1L0N J;  2Y0E A;  5APX A;  5BU8 B;  1RHZ B;  4B86 A;  1NU1 E;  4UB8 E;  5BVZ A;  1USE A;  2R44 A;  1JUN A;  1NTM E;  3NXS A;  2J59 M;  3RL0 g;  1EDK A;  3VOP A;  5AW6 B;  1JTH A;  5GTH H;  3C9I A;  2O01 H;  3V6I A;  1BSN A;  3RK3 E;  3TK1 A;  3L74 J;  2BCC D;  1UII A;  1N7S C;  1KB9 I;  2E74 C;  2M5A A;  1K9M Q;  3EWK A;  4I6M C;  1AJY A;  3AEA C;  4RES B;  1YQ3 C;  3L74 E;  3TYY A;  2QVA A;  1S3J A;  1OW7 A;  3CCQ P;  1Q90 D;  3VN0 A;  2KP8 A;  2KYV A;  3CXH D;  2IDB A;  5AW4 B;  1IFM A;  2KNC B;  4IFD K;  1YYC A;  1M57 D;  4HKZ H;  2Z5I A;  1FZC B;  3FX0 A;  2IBZ D;  1RF0 C;  1LTJ C;  3U59 A;  3AE1 C;  3CCR P;  2FXP A;  4H44 B;  4JYC A;  5KJ7 A;  2YMY A;  4PJ0 E;  1SQP D;  3Q5R A;  2AXC A;  2G3A A;  2UWJ E;  3R4Y A;  1VQK P;  3L75 J;  3CX5 E;  4RO0 A;  1J1E C;  2KS1 A;  4HH2 A;  2YMK A;  1LJ2 A;  5EFW B;  4W7Z A;  2KNC A;  2NZ2 A;  1JEK A;  2WWW A;  1BCC E;  1NHL A;  4LGD E;  2G8Y A;  1OFC X;  1PPJ D;  1FZC A;  4MN4 C;  5H2F E;  4BXL A;  3L75 E;  2WSF J;  1W2E A;  2IZ1 A;  3L72 E;  2B9B A;  1SQQ K;  2GUS A;  3Q5P A;  1NU1 D;  1SLQ A;  2JWA A;  3GHG C;  4DCK A;  1NTM D;  5CCG D;  1HTL C;  4WY4 C;  5APW A;  1PZQ A;  1MZ9 A;  5KAI H;  1URQ B;  3A3Y B;  1RY3 A;  5APY A;  3QH9 A;  3B8E B;  2ZXX A;  1J2J B;  1PP9 D;  3RBX A;  1RE3 C;  3Q2Y A;  3D6Y A;  1HJB A;  4I2L C;  1L4A A;  4QMA A;  3RL0 B;  2I1K A;  4D6T G;  1PGP A;  2Y0C A;  2KXP B;  4OGQ B;  1YHQ P;  1GL2 B;  3GG2 A;  3EFG A;  3H1I D;  1CSB A;  1KMI Z;  4M3L A;  4H13 C;  1JCC A;  3H1K J;  1USD A;  3AEB C;  1URQ A;  3L70 J;  2RH0 A;  4JPZ B;  3M91 A;  1N7S A;  3ITK A;  1T8Z A;  1WMK A;  2XDJ A;  3S9O A;  3KDP B;  1Q86 Q;  2A45 G;  5KAF H;  2E5T A;  2QE7 H;  3JCU H;  2QSI A;  1OW8 A;  3L70 E;  1SQV G;  3BCC G;  4AUW A;  4PV1 B;  4U3F D;  3TDK A;  1VQL P;  3QWO C;  2QJP B;  1NKZ B;  1GL2 A;  1YI2 P;  4Y99 B;  2ZVN B;  1EZV I;  2FXO A;  3CX5 D;  1OVV A;  3JC2 2;  1EDJ A;  1L0L G;  1BCC D;  3PHL A;  4XA4 A;  1VF5 B;  1K05 A;  1RF0 A;  3S1K A;  5APQ A;  1LTJ A;  1KQG B; 
#chains in the Genus database with same CATH homology
 1BGY G;  1BCC G;  1P84 H;  3L71 G;  4PD4 H;  4U3F G;  1SQX G;  1PP9 G;  3CX5 H;  1L0N G;  1NTK G;  3H1L G;  3CWB G;  5KLV G;  1PPJ G;  2FYU G;  1SQP G;  3L74 G;  3L75 G;  1KYO H;  3H1K G;  1SQB G;  1NU1 G;  3L73 G;  3H1I G;  3CXH H;  3L72 G;  1NTZ G;  1EZV G;  2IBZ G;  1BE3 G;  4D6T G;  1NTM G;  3L70 G;  3H1J G;  1SQV G;  1L0L G;  3BCC G;  1KB9 H;  2BCC G;  2A06 G;  3H1H G;  1SQQ G;  3TGU G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...