1NTZG

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 17
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1ntzG00
1SQQG 3CWBG 2A06G 1PP9G 1P84H 1KB9H 3TGUG 2FYUG 1NTKG 3L71G 4D6TG 3L74G 3H1HG 3H1KG 3L70G 2IBZG 1NU1G 5KLVG 1NTMG 1KYOH 3L75G 4U3FG 3BCCG 1NTZG 1PPJG 1BGYG 3CXHH 1SQBG 3H1LG 3L73G 1EZVG 1L0LG 1SQPG 3H1IG 1BCCG 1SQXG 1L0NG 3CX5H 1BE3G 3H1JG 3L72G 1SQVG 2BCCG 4PD4H
chains in the Genus database with same CATH superfamily
1W2EA 4L74A 2RH0A 3FX0A 2KNCA 2M5AB 4JQ0D 1YTZI 2KZIA 5AVYB 5B5EH 2AEFA 4PV1D 4HKZH 5L8RJ 3CCUP 1KQGB 1HGVA 1LTBC 1NTMD 2KXPB 3BASA 3ITKA 2IBZG 4UB8H 3CXHH 1BCCD 2V4HA 2PGDA 1MFZA 4JF7A 3CPWO 2QG4A 2AXTH 5KTBA 1G1IA 4HYTB 2YO2A 2WQYC 2LXBA 4Y99B 4N6JA 3H1ID 2QJPC 1OIPA 2OTLP 3PTZA 2KLVA 2RKLA 1CW5A 3L72G 3CMAP 2WT7B 3CX5D 1NKNA 1SQQG 3V2RA 1H0TB 1ZW0A 3L74J 5AW1B 4I6MC 2B87A 2NPSB 3OA7A 1BSHA 1KTMA 5KAIE 2CK3H 1L0NK 2YKOA 2YNYA 3Q5SA 1K9MQ 4CPGA 2OYOA 2OARA 3HE4A 5KJ7D 2IBZE 1T3JA 1PPJG 2JDIH 1SQXJ 2C0XA 1GZLA 1LNQA 2A45G 1AQ5A 4LC1A 3P8CD 1HH0A 1EDJA 1A02F 1SFCB 3TGUG 3L71G 2L5GB 1HBWA 1M8OB 4BRYA 4K35A 1SQBD 2IDBA 1JY2N 1SQXK 4R4LA 1PGOA 2J59M 3II6A 3CCRP 1N2DC 2W6JH 2Y9ZA 1SQQE 3F89A 1ZLLA 1GL2D 4IFFA 2MKVA 4IL6H 3VMYA 3H25A 2E5YA 3MUDC 1FJPA 2YKQA 3AEEC 1EDLA 2I1KA 2M5AA 4GOFA 2XNXA 4IFMA 1K8AQ 2FBWC 5B66E 2XDJA 1KB9D 2NRGA 1JUNA 4M3LA 1PPJE 4Y99C 5BU8B 3MUDA 1DEBA 3M9HA 2CPBA 2N9BA 4LGDE 3N7NA 2C0WA 1KV4A 3F5HA 1IO4A 1LTSC 3L70D 1K04A 3L71E 1LTJC 2FXPA 1T8ZA 2IFMA 1KILE 1NTMG 1LP1B 5KKZC 3CMEP 1BCCG 2KLUA 2E74D 3T97B 2NPSC 1KN7A 1SQVJ 2WSCJ 3CWBD 3MHVA 3OAKA 2P67A 4NPDA 1QX8A 1FZBA 4U3FJ 1NTZJ 2WT7A 1H0TA 3KYQA 1R8EA 2CPSA 3H1IG 1N7LA 2LKMA 1IFPA 2GUVA 4ZMDA 3M0DC 5KAFE 1CSBA 2P2UA 1SQVK 2A06G 3VYIA 2KSEA 1PV3A 1BDCA 4O9BA 2IBZI 3IAOA 1SFCC 1RE4C 3H1LJ 3RK3B 2E43A 1U57A 1NTZK 1RE3C 3HRNA 2FKWB 2NZ2A 1A02J 3H6PA 1JEKA 3A5TA 3VMXA 3AE9C 2XU6A 4BXLA 1KC8Q 1Q81Q 1WT6A 1JO5A 1FOSF 3CLQA 2AXCA 2Q3EA 2XNDH 3L75E 4WY4B 1OW8A 1HVVA 1L0LJ 1SFCA 2H8PD 1N7SD 1FJKA 3VTPC 3GG2A 1RE3A 1BCCE 3WUUA 2FXMA 1Y47A 2J5UA 3S4RA 2HFED 4IFDK 3A0HE 4EOTA 2PFXA 1L4AC 1D7MA 4PD4E 4PJ0E 1HJBA 1S5LE 2Y0CA 1SQBG 2BASA 1L0LK 3H1IE 4R4MA 1YQ4C 1NOHA 2WPVB 1G1JA 4D6TJ 3CX5E 2Q5UA 1FS0E 1L2PA 5KLVK 1IZNB 1XTCC 2A45I 1L0ND 5H2FE 3CCLP 2FYZA 2MJZA 4XE5B 1QEXA 5TISE 1EQ7A 1M7LA 3S9OA 2V7QH 1YTZT 5CCGA 1P84D 1X9VA 2KUBA 2KOGA 2KK7A 3IF4A 2ZT9B 4OH8B 2P1JA 3AE8C 1AVYA 1LP1A 1FE6A 3P8CE 2I8DA 3T97A 3L70G 3MP7B 2R32A 1S2EA 1SQBE 3Q2YA 1Q2NA 3RK3C 1NH4A 3CWBG 3TNUB 3P7KA 1HTLC 2R3SA 1LTAC 2FYUK 3HD7B 5AW0B 1URQB 3MTUE 1LWUB 2H89C 3TK1A 5EFWB 2BCCJ 4WY4C 3JCUH 1GW3A 1SVFA 3CCMP 1NYHA 2P7JA 3H1JJ 2LR2A 3L36A 2FY8A 3VMAA 4WY4A 1S72P 3WU2H 1M1JC 3N4XA 3S1KA 2W6BA 2IYPA 1CI6B 2G8YA 3L70E 3L35A 3EQ2A 3VN0A 4H44D 3R2PA 3V2NA 3CX5I 3M06A 1VQLP 1X22A 3CWBE 2JWDA 3WUTA 2HG5D 1KILD 1S1CX 1GW4A 3FWNA 3WMM0 1OMIA 2Y0DA 1SQPD 2Z5IA 4GOEA 3GF7A 2ZT9C 1JCCA 1SQVD 5AVTB 3KPEA 3KZIE 3G4SP 1VQMP 1VQ6P 2ZVNB 1DD3A 2Q6QA 3D6YA 3H1KD 3V2QA 1KORA 1NTZD 3PP5A 3P8MC 2SPZA 1N8RQ 1HWTC 4EYYQ 1L0NG 1IC2A 3L4FA 1CZQA 1VQNP 2QIWA 3AECC 2YMKA 3PHLA 1LTIC 5AVWB 3CXHD 1K05A 3HD7C 3I55P 4H0LB 1URQC 3HE5B 2ZYGA 3MIWA 3L75D 3AE1C 1L0LD 3PRJA 3TNUA 2JR8A 2WMMA 2Z5HA 3FXEA 1M57D 3HD7A 1URQA 1LWUA 4H13B 5AVQB 4PD4D 3RGUA 1MKMA 2KSJA 1RQVA 2V7QJ 5KLVD 1QGKB 1KB9I 1G2CA 1KYOD 1LTGC 3NFQA 1FDOA 5BU5A 2E5TA 1L0NE 1S9KE 3Q5RA 1PP9J 5TJHA 3KHUA 4L73A 1EDKA 3V6IA 1TU3F 3L74E 1YIJP 1P84E 1BGYJ 3L73D 4RESB 1ZP0C 3RBXA 2D2CC 1J2JB 4DJGA 1CI6A 1S5LH 4OGQB 3SFEC 1VPCA 4AYCA 2WTYA 1KQSO 5E79H 4RKUJ 1JCDA 1IK7A 3BVHA 1SQXE 4C46A 4UB6E 1Q7YQ 2FYNB 2FYUD 3I56P 5C39A 4OWFA 1AA0A 2K9YA 3BCCJ 2PP6A 2YIUB 1IFDA 5APUA 1S3JA 5APTA 5CHXA 2QEXP 1SQPG 4YXWH 2QM7A 3AE2C 1SQVG 2W90A 4AUWA 3EFGA 1ZRTD 2B88A 1X79B 2W6AA 4H0LC 3Q3DA 4ZKUA 3H1KG 2FFDB 2IZ0A 5AW3B 3LIDA 1JB0J 3L72J 1GMJA 3M9QA 1SQQJ 4N78D 1OVUA 1OX3A 1KQLA 1YITP 3HE5A 4H13C 3NXSA 1T6AA 3TSIA 1FDMA 2NPSD 3O8ZA 1KD1Q 1AJYA 1SQQK 2E76B 3BRTB 5AVXB 3OJAB 3L75G 1NVOA 5GTIE 1L0LG 2N1TB 1DIPA 5M1BA 1SQPE 1X0TA 3BRVB 3P32A 1YI2P 1SQVE 3TGUJ 2ZYDA 5CJ4A 2O01H 1KB9H 4WBAA 3A0BE 3GHGB 3A7OA 1P84I 2HYNA 1JY2O 4OGQC 1GK4A 3H1KE 1SFCD 2OQQA 5KLVG 2BEZF 1EZVD 1T2KC 1NTZE 3E1IA 1YJWP 3RK2B 3TYYA 3GF3A 1FZCB 1OVVA 5CCHC 2WPSA 1M90Q 5AVVB 1N73B 3GLMA 2K1AA 3NMDA 2OYHB 5APVA 4BWNA 4TT3H 2P58A 2FYNC 5B5EE 3L73G 3JSVC 4GDOA 2IPPA 1BE3J 4UB8E 3G3ZA 3C1LA 2YIUC 3SWYA 1VQ7P 3CXHE 5AW4B 2ZXEB 2JJLA 5CCHA 1T3UA 1FBMA 5AW2B 2AXTE 1L4AD 3B8EB 5GTHH 1NU1J 3CCQP 1JNMA 3KXDA 2DW3A 1QVGO 1USEA 2FFDC 5AW9B 1L0LE 1EC5A 3B71A 4XFJA 1J1EB 4YXDC 5CCGD 2JEEA 2W83C 2FYUG 1NTMJ 3OW2O 3SFDC 1N86A 3M0AA 1NU1K 5KLVE 4AQRD 1BCCJ 2C9LY 1H89A 2M8RA 2Y0EA 2PAJA 1JY3O 1KYOE 4I2LC 2FFDA 1IJDB 5CCGC 2B89A 2WSFH 3AEFC 1RH5B 2E75B 4HB1A 1NTMK 2E76C 3H1IJ 1PIXA 1GTWA 4EIJA 3D71A 1PFIA 3L73E 1YYCA 3SWKA 1VF5B 1S9KD 1ZXGA 2GM4A 1PP9D 2N1TC 1RF0A 4EI2A 3RL0B 1JMBA 3L74D 1FAVA 2JKVA 1BGYD 1VDFA 1NGMB 2M0BA 1LT9A 1VQKP 4RJTA 3B5NB 1HF9A 5AVUB 3CC7P 1NWQA 4DT0A 3RK3D 3MZWB 4JYBA 2H88C 3RK2C 2N1TA 4Y28J 1FZCC 2FYUE 2QA4P 1N73C 1SQXD 4C7NB 1GU5A 3GHGA 2QJKB 1VQ4P 4IL6E 4WY4D 2HODB 1AQTA 1JTHB 1YHQP 1EDIA 3ABVC 1OW6A 1ZRTE 1FZCA 5KAIH 3BCCD 1FZGA 1SQBJ 1HGZA 1SP4A 2O1JA 1IFNA 1N73A 1EZVG 2OYHA 1S5LX 3CXHI 3M9BA 2R5BA 2BCCE 3U1CA 2KIKA 4N78E 2K3RA 2Z4EA 1NAYA 1J1EC 3M91A 1G2CB 2QJYB 1Z56A 2WVRA 1Q86Q 4DZOA 1SQBK 3L72D 3AE7C 2WSEJ 2R3CA 2WPQA 2QM8A 4PD4I 3U1AA 1JM0A 3GW6A 3A3YB 2O01J 2XKMA 1AFOA 1W5CE 2JO1A 3Q1MA 3VP9A 1KYOI 2E75C 2O01N 3AE5C 2ZT9D 4PV1B 1QL2A 5BVZA 2WSSH 1VF5C 1NTKJ 3L70J 3H1HJ 1FZFA 3RL0C 2ZFCA 3D70A 2Q9IA 4DCKA 4JBZA 1EZVE 3CWBJ 2XZRA 2YMYA 3FWLA 1Y9BA 5B66H 3B5NC 1OVRA 3H32B 3TGUD 2O3JA 2PRRA 2O1KA 2RMZA 1YQ3C 1NTKK 4U3FD 5APQA 2A45H 2AEJA 3HD7D 1URQD 4YTPC 1UIIA 1PP9G 2QJKC 3B5NA 5K5GB 2YKPA 5GTIH 1AVOA 2K37A 2HR3A 4NPEA 3L74G 2KP8A 3H1LD 1BGYG 1BE3D 1ZR4A 2G3AA 3KDPB 4B86A 4GT1A 2W8ZA 1Q82Q 1LWUC 3CD6P 4C7NA 3V4WA 3Q5PA 2HODA 1NU1D 4KHXA 2WSFJ 1JTHA 1KILA 3LW5J 2BEQD 1IFMA 2QJYC 5KAFH 1UIXA 1SQXG 2I1JA 1ZV8A 1BDDA 1S4XA 3RL0g 4GODA 3AEDC 3BCCG 2ZAEB 4NPFX 2D2CD 2B9BA 3JC22 2K9JB 3R4YA 2L91A 4GIFA 1MUUA 1GL2B 1FZEA 4D6TD 4PV1C 1PP9E 4EDFA 2Y9YA 3FXDA 4HH2A 1L0NJ 3AE4C 1BGYE 1OW7A 1J1DB 5CMZA 3A0HH 4KT0J 2A06D 1LTJB 2LXCB 4PD4H 4PJ0H 3RK3E 2E42A 1VQ8P 1DEEG 2ZJSE 5KKZB 4OVNF 1GD2E 1JY2P 1KYOH 5AW7B 1EZVI 4K3AA 2YXRB 5AVSB 4IOIH 3AE6C 3CX5H 2OYIB 4YPCA 1Q90D 5AVZB 3QWOC 4I7ZB 1NHLA 4H0LD 4DOJA 1RF1B 3G6EP 5H2FH 3JCUE 4A7PA 1OXZA 2E74B 3H32A 1K73Q 5APYA 5TISH 3BCCE 1IFJA 3CCVP 1E5WA 3V2PA 1HJ0A 1VL2A 5KLIB 3TDKA 1LTTC 3PLNA 1M56D 2N9YB 2GUSA 1FU1A 1H88A 2IZ1A 3WU2E 4H13D 5KJ7C 4U3FG 3W67A 3PJSK 3E1RA 1NTZG 2IYOA 3USSA 1YJ9P 4WWIA 2BCCD 3L72E 2KYVA 2FXOA 1QVFO 3G9RA 4MN4C 1ZN5A 2H7HA 4TLFA 5CJ0A 5KJ7A 1ZR2A 3H1LG 2WPRA 3AEGC 5APXA 2XV5A 3H1JD 3WUVA 1BE3G 1L4AB 1U7MA 1XTGB 3MD0A 1JY3P 1ZOYC 1R5SA 1YJNP 1LT9B 1GL2C 3SSUA 1N7SB 3MGNA 4OGQD 1SS1A 3LIEA 1NU1G 4WB4A 3IR9A 1T2KD 5APWA 3VP8A 3CI9A 2WSEH 3UIAA 2KS1B 5CCHD 1OFCX 1FC2C 1J1DC 1FDIA 1NTKD 3L71J 1VQ9P 3TGUE 3H1HD 3QH9A 1U7JA 2K9JA 2QRXA 1YBKA 2QE7H 1GL2A 1LT1A 1SQPJ 2QVAA 4U3FE 3W68A 1OWAA 3RBZA 1R5LA 2JWAA 4W7YA 3V5BA 1GDTA 1JY3N 2OYIC 3H1KJ 4JPZB 4D6TG 3K5BA 4I7ZC 1LTJA 1Y8AA 1RF1C 3GMAA 1MZ9A 1SQPK 3H1LE 1EXIA 2E74C 2NPSA 1BE3E 3I5CA 1NJIQ 3C9IA 1JMMA 5KLIC 4U7JA 2KB7P 2R5DA 2OYIA 3VOPA 2P10A 5AW8B 1NU1E 1PGJA 1BSNA 1MFTA 3KZIH 4Z1MH 1RF1A 4W80A 3M0DA 3O6QB 2WWWA 3IFMA 2YXQB 3L75J 5DJTB 1NTME 2E76D 1NAFA 1QLED 1RE4A 3HTKB 5CBOA 1KFMA 2M3BA 1RF0C 3A2AA 2N1TD 3CL3D 1PL5A 3NTNA 4D6TE 3LW5H 5KLVJ 2Q1KA 1KQFB 3EWKA 1PGPA 3VMZA 1LT9C 3FGAD 1N7SC 1M1JB 5E79E 4HJGH 1JOCA 1GU4A 2C9NY 4ZNCA 2BCCG 2A06E 3RK2D 1X8YA 3C8VA 2OTJP 1HUCA 1L4AA 3SWFA 1DH3A 3L73J 3GHGC 2ZXXA 3PH0A 1N7SA 3ZDMA 3H1JG 2JP3A 2ZYAA 1IFIA 2HPCB 3E7KA 5CBNA 4H44B 3HUSB 2KS1A 1DD4A 1OZHA 4JYCA 5AW6B 2Q7CA 1VQPP 3CC4P 3V4QA 4XA4A 4ASVA 2OYHC 1IK9A 3G71P 1NO4A 3BATA 2KNCB 1KILB 2M3EA 4GKGA 2FYUJ 5AW5B 3B4SA 1P84H 1NTKG 1PGQA 1ZMEC 3CCJP 2IBZD 1KMIZ 3H1HG 1LGHB 2RN0A 1E79H 5DJUB 2IX7C 1KFNA 3KQGA 1RHZB 4ZKPA 1FOSE 1RY3A 4I1LA 4QMAA 4KJMA 1H8AA 1FZAA 2ZVOB 4UB6H 3IN6A 2E75D 1VQOP 1SQQD 2WITA 3H1JE 2ITAA 5AVRB 4W7ZA 4N3YB 1VF5D 1KZUB 3CCEP 1QL1A 3RL0D 1KB9E 3O6QA 3CCSP 2YO3A 1SLQA 2WZ7A 2W27A 2B87B 1PZQA 2KZJA 3B5ND 3CC2P 1WRGA 4LLHA 3HTKA 1M1KQ 3TF5A 1NTKE 2QJPB 4L75A 1W2BO 3H1HE 1PPJD 3AEBC 4RO0A 2AEMA 2QSIA 2KI7B 3EFFK 4ASWA 2IFNA 2OGUA 3HE4B 2H43A 2J58A 4IL6X 3L71D 1M1JA 2GA1A 1WMKA 1DX7A 2D2CB 2HLOA 4H44C 1MV8A 2R44A 1GK6A 5GTHE 3HUSC 5APSA 3U59A 2OTKE 4BRYB 1EXJA 2K88A 2POHA 1VQ5P 1KILC 3AEAC 1AV1A 2UWJE 3L37A 2HPCA 2Q3IA 4L76A 2VRSA 3D6ZA 1USDA 2WSCH 4WVZA 1RQUA 3AE3C 1LJ2A 3HUSA 1NKZB 4C7RA 3A0BH
chains in the Genus database with same CATH topology
1SQQG 3CWBG 2A06G 1PP9G 1P84H 1KB9H 3TGUG 2FYUG 1NTKG 3L71G 4D6TG 3L74G 3H1HG 3H1KG 3L70G 2IBZG 1NU1G 5KLVG 1NTMG 1KYOH 3L75G 4U3FG 3BCCG 1NTZG 1PPJG 1BGYG 3CXHH 1SQBG 3H1LG 3L73G 1EZVG 1L0LG 1SQPG 3H1IG 1BCCG 1SQXG 1L0NG 3CX5H 1BE3G 3H1JG 3L72G 1SQVG 2BCCG 4PD4H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQQ G;  3CWB G;  2A06 G;  1PP9 G;  1P84 H;  1KB9 H;  3TGU G;  2FYU G;  1NTK G;  3L71 G;  4D6T G;  3L74 G;  3H1H G;  3H1K G;  3L70 G;  2IBZ G;  1NU1 G;  5KLV G;  1NTM G;  1KYO H;  3L75 G;  4U3F G;  3BCC G;  1NTZ G;  1PPJ G;  1BGY G;  3CXH H;  1SQB G;  3H1L G;  3L73 G;  1EZV G;  1L0L G;  1SQP G;  3H1I G;  1BCC G;  1SQX G;  1L0N G;  3CX5 H;  1BE3 G;  3H1J G;  3L72 G;  1SQV G;  2BCC G;  4PD4 H; 
#chains in the Genus database with same CATH topology
 1W2E A;  4L74 A;  2RH0 A;  3FX0 A;  2KNC A;  2M5A B;  4JQ0 D;  1YTZ I;  2KZI A;  5AVY B;  5B5E H;  2AEF A;  4PV1 D;  4HKZ H;  5L8R J;  3CCU P;  1KQG B;  1HGV A;  1LTB C;  1NTM D;  2KXP B;  3BAS A;  3ITK A;  2IBZ G;  4UB8 H;  3CXH H;  1BCC D;  2V4H A;  2PGD A;  1MFZ A;  4JF7 A;  3CPW O;  2QG4 A;  2AXT H;  5KTB A;  1G1I A;  4HYT B;  2YO2 A;  2WQY C;  2LXB A;  4Y99 B;  4N6J A;  3H1I D;  2QJP C;  1OIP A;  2OTL P;  3PTZ A;  2KLV A;  2RKL A;  1CW5 A;  3L72 G;  3CMA P;  2WT7 B;  3CX5 D;  1NKN A;  1SQQ G;  3V2R A;  1H0T B;  1ZW0 A;  3L74 J;  5AW1 B;  4I6M C;  2B87 A;  2NPS B;  3OA7 A;  1BSH A;  1KTM A;  5KAI E;  2CK3 H;  1L0N K;  2YKO A;  2YNY A;  3Q5S A;  1K9M Q;  4CPG A;  2OYO A;  2OAR A;  3HE4 A;  5KJ7 D;  2IBZ E;  1T3J A;  1PPJ G;  2JDI H;  1SQX J;  2C0X A;  1GZL A;  1LNQ A;  2A45 G;  1AQ5 A;  4LC1 A;  3P8C D;  1HH0 A;  1EDJ A;  1A02 F;  1SFC B;  3TGU G;  3L71 G;  2L5G B;  1HBW A;  1M8O B;  4BRY A;  4K35 A;  1SQB D;  2IDB A;  1JY2 N;  1SQX K;  4R4L A;  1PGO A;  2J59 M;  3II6 A;  3CCR P;  1N2D C;  2W6J H;  2Y9Z A;  1SQQ E;  3F89 A;  1ZLL A;  1GL2 D;  4IFF A;  2MKV A;  4IL6 H;  3VMY A;  3H25 A;  2E5Y A;  3MUD C;  1FJP A;  2YKQ A;  3AEE C;  1EDL A;  2I1K A;  2M5A A;  4GOF A;  2XNX A;  4IFM A;  1K8A Q;  2FBW C;  5B66 E;  2XDJ A;  1KB9 D;  2NRG A;  1JUN A;  4M3L A;  1PPJ E;  4Y99 C;  5BU8 B;  3MUD A;  1DEB A;  3M9H A;  2CPB A;  2N9B A;  4LGD E;  3N7N A;  2C0W A;  1KV4 A;  3F5H A;  1IO4 A;  1LTS C;  3L70 D;  1K04 A;  3L71 E;  1LTJ C;  2FXP A;  1T8Z A;  2IFM A;  1KIL E;  1NTM G;  1LP1 B;  5KKZ C;  3CME P;  1BCC G;  2KLU A;  2E74 D;  3T97 B;  2NPS C;  1KN7 A;  1SQV J;  2WSC J;  3CWB D;  3MHV A;  3OAK A;  2P67 A;  4NPD A;  1QX8 A;  1FZB A;  4U3F J;  1NTZ J;  2WT7 A;  1H0T A;  3KYQ A;  1R8E A;  2CPS A;  3H1I G;  1N7L A;  2LKM A;  1IFP A;  2GUV A;  4ZMD A;  3M0D C;  5KAF E;  1CSB A;  2P2U A;  1SQV K;  2A06 G;  3VYI A;  2KSE A;  1PV3 A;  1BDC A;  4O9B A;  2IBZ I;  3IAO A;  1SFC C;  1RE4 C;  3H1L J;  3RK3 B;  2E43 A;  1U57 A;  1NTZ K;  1RE3 C;  3HRN A;  2FKW B;  2NZ2 A;  1A02 J;  3H6P A;  1JEK A;  3A5T A;  3VMX A;  3AE9 C;  2XU6 A;  4BXL A;  1KC8 Q;  1Q81 Q;  1WT6 A;  1JO5 A;  1FOS F;  3CLQ A;  2AXC A;  2Q3E A;  2XND H;  3L75 E;  4WY4 B;  1OW8 A;  1HVV A;  1L0L J;  1SFC A;  2H8P D;  1N7S D;  1FJK A;  3VTP C;  3GG2 A;  1RE3 A;  1BCC E;  3WUU A;  2FXM A;  1Y47 A;  2J5U A;  3S4R A;  2HFE D;  4IFD K;  3A0H E;  4EOT A;  2PFX A;  1L4A C;  1D7M A;  4PD4 E;  4PJ0 E;  1HJB A;  1S5L E;  2Y0C A;  1SQB G;  2BAS A;  1L0L K;  3H1I E;  4R4M A;  1YQ4 C;  1NOH A;  2WPV B;  1G1J A;  4D6T J;  3CX5 E;  2Q5U A;  1FS0 E;  1L2P A;  5KLV K;  1IZN B;  1XTC C;  2A45 I;  1L0N D;  5H2F E;  3CCL P;  2FYZ A;  2MJZ A;  4XE5 B;  1QEX A;  5TIS E;  1EQ7 A;  1M7L A;  3S9O A;  2V7Q H;  1YTZ T;  5CCG A;  1P84 D;  1X9V A;  2KUB A;  2KOG A;  2KK7 A;  3IF4 A;  2ZT9 B;  4OH8 B;  2P1J A;  3AE8 C;  1AVY A;  1LP1 A;  1FE6 A;  3P8C E;  2I8D A;  3T97 A;  3L70 G;  3MP7 B;  2R32 A;  1S2E A;  1SQB E;  3Q2Y A;  1Q2N A;  3RK3 C;  1NH4 A;  3CWB G;  3TNU B;  3P7K A;  1HTL C;  2R3S A;  1LTA C;  2FYU K;  3HD7 B;  5AW0 B;  1URQ B;  3MTU E;  1LWU B;  2H89 C;  3TK1 A;  5EFW B;  2BCC J;  4WY4 C;  3JCU H;  1GW3 A;  1SVF A;  3CCM P;  1NYH A;  2P7J A;  3H1J J;  2LR2 A;  3L36 A;  2FY8 A;  3VMA A;  4WY4 A;  1S72 P;  3WU2 H;  1M1J C;  3N4X A;  3S1K A;  2W6B A;  2IYP A;  1CI6 B;  2G8Y A;  3L70 E;  3L35 A;  3EQ2 A;  3VN0 A;  4H44 D;  3R2P A;  3V2N A;  3CX5 I;  3M06 A;  1VQL P;  1X22 A;  3CWB E;  2JWD A;  3WUT A;  2HG5 D;  1KIL D;  1S1C X;  1GW4 A;  3FWN A;  3WMM 0;  1OMI A;  2Y0D A;  1SQP D;  2Z5I A;  4GOE A;  3GF7 A;  2ZT9 C;  1JCC A;  1SQV D;  5AVT B;  3KPE A;  3KZI E;  3G4S P;  1VQM P;  1VQ6 P;  2ZVN B;  1DD3 A;  2Q6Q A;  3D6Y A;  3H1K D;  3V2Q A;  1KOR A;  1NTZ D;  3PP5 A;  3P8M C;  2SPZ A;  1N8R Q;  1HWT C;  4EYY Q;  1L0N G;  1IC2 A;  3L4F A;  1CZQ A;  1VQN P;  2QIW A;  3AEC C;  2YMK A;  3PHL A;  1LTI C;  5AVW B;  3CXH D;  1K05 A;  3HD7 C;  3I55 P;  4H0L B;  1URQ C;  3HE5 B;  2ZYG A;  3MIW A;  3L75 D;  3AE1 C;  1L0L D;  3PRJ A;  3TNU A;  2JR8 A;  2WMM A;  2Z5H A;  3FXE A;  1M57 D;  3HD7 A;  1URQ A;  1LWU A;  4H13 B;  5AVQ B;  4PD4 D;  3RGU A;  1MKM A;  2KSJ A;  1RQV A;  2V7Q J;  5KLV D;  1QGK B;  1KB9 I;  1G2C A;  1KYO D;  1LTG C;  3NFQ A;  1FDO A;  5BU5 A;  2E5T A;  1L0N E;  1S9K E;  3Q5R A;  1PP9 J;  5TJH A;  3KHU A;  4L73 A;  1EDK A;  3V6I A;  1TU3 F;  3L74 E;  1YIJ P;  1P84 E;  1BGY J;  3L73 D;  4RES B;  1ZP0 C;  3RBX A;  2D2C C;  1J2J B;  4DJG A;  1CI6 A;  1S5L H;  4OGQ B;  3SFE C;  1VPC A;  4AYC A;  2WTY A;  1KQS O;  5E79 H;  4RKU J;  1JCD A;  1IK7 A;  3BVH A;  1SQX E;  4C46 A;  4UB6 E;  1Q7Y Q;  2FYN B;  2FYU D;  3I56 P;  5C39 A;  4OWF A;  1AA0 A;  2K9Y A;  3BCC J;  2PP6 A;  2YIU B;  1IFD A;  5APU A;  1S3J A;  5APT A;  5CHX A;  2QEX P;  1SQP G;  4YXW H;  2QM7 A;  3AE2 C;  1SQV G;  2W90 A;  4AUW A;  3EFG A;  1ZRT D;  2B88 A;  1X79 B;  2W6A A;  4H0L C;  3Q3D A;  4ZKU A;  3H1K G;  2FFD B;  2IZ0 A;  5AW3 B;  3LID A;  1JB0 J;  3L72 J;  1GMJ A;  3M9Q A;  1SQQ J;  4N78 D;  1OVU A;  1OX3 A;  1KQL A;  1YIT P;  3HE5 A;  4H13 C;  3NXS A;  1T6A A;  3TSI A;  1FDM A;  2NPS D;  3O8Z A;  1KD1 Q;  1AJY A;  1SQQ K;  2E76 B;  3BRT B;  5AVX B;  3OJA B;  3L75 G;  1NVO A;  5GTI E;  1L0L G;  2N1T B;  1DIP A;  5M1B A;  1SQP E;  1X0T A;  3BRV B;  3P32 A;  1YI2 P;  1SQV E;  3TGU J;  2ZYD A;  5CJ4 A;  2O01 H;  1KB9 H;  4WBA A;  3A0B E;  3GHG B;  3A7O A;  1P84 I;  2HYN A;  1JY2 O;  4OGQ C;  1GK4 A;  3H1K E;  1SFC D;  2OQQ A;  5KLV G;  2BEZ F;  1EZV D;  1T2K C;  1NTZ E;  3E1I A;  1YJW P;  3RK2 B;  3TYY A;  3GF3 A;  1FZC B;  1OVV A;  5CCH C;  2WPS A;  1M90 Q;  5AVV B;  1N73 B;  3GLM A;  2K1A A;  3NMD A;  2OYH B;  5APV A;  4BWN A;  4TT3 H;  2P58 A;  2FYN C;  5B5E E;  3L73 G;  3JSV C;  4GDO A;  2IPP A;  1BE3 J;  4UB8 E;  3G3Z A;  3C1L A;  2YIU C;  3SWY A;  1VQ7 P;  3CXH E;  5AW4 B;  2ZXE B;  2JJL A;  5CCH A;  1T3U A;  1FBM A;  5AW2 B;  2AXT E;  1L4A D;  3B8E B;  5GTH H;  1NU1 J;  3CCQ P;  1JNM A;  3KXD A;  2DW3 A;  1QVG O;  1USE A;  2FFD C;  5AW9 B;  1L0L E;  1EC5 A;  3B71 A;  4XFJ A;  1J1E B;  4YXD C;  5CCG D;  2JEE A;  2W83 C;  2FYU G;  1NTM J;  3OW2 O;  3SFD C;  1N86 A;  3M0A A;  1NU1 K;  5KLV E;  4AQR D;  1BCC J;  2C9L Y;  1H89 A;  2M8R A;  2Y0E A;  2PAJ A;  1JY3 O;  1KYO E;  4I2L C;  2FFD A;  1IJD B;  5CCG C;  2B89 A;  2WSF H;  3AEF C;  1RH5 B;  2E75 B;  4HB1 A;  1NTM K;  2E76 C;  3H1I J;  1PIX A;  1GTW A;  4EIJ A;  3D71 A;  1PFI A;  3L73 E;  1YYC A;  3SWK A;  1VF5 B;  1S9K D;  1ZXG A;  2GM4 A;  1PP9 D;  2N1T C;  1RF0 A;  4EI2 A;  3RL0 B;  1JMB A;  3L74 D;  1FAV A;  2JKV A;  1BGY D;  1VDF A;  1NGM B;  2M0B A;  1LT9 A;  1VQK P;  4RJT A;  3B5N B;  1HF9 A;  5AVU B;  3CC7 P;  1NWQ A;  4DT0 A;  3RK3 D;  3MZW B;  4JYB A;  2H88 C;  3RK2 C;  2N1T A;  4Y28 J;  1FZC C;  2FYU E;  2QA4 P;  1N73 C;  1SQX D;  4C7N B;  1GU5 A;  3GHG A;  2QJK B;  1VQ4 P;  4IL6 E;  4WY4 D;  2HOD B;  1AQT A;  1JTH B;  1YHQ P;  1EDI A;  3ABV C;  1OW6 A;  1ZRT E;  1FZC A;  5KAI H;  3BCC D;  1FZG A;  1SQB J;  1HGZ A;  1SP4 A;  2O1J A;  1IFN A;  1N73 A;  1EZV G;  2OYH A;  1S5L X;  3CXH I;  3M9B A;  2R5B A;  2BCC E;  3U1C A;  2KIK A;  4N78 E;  2K3R A;  2Z4E A;  1NAY A;  1J1E C;  3M91 A;  1G2C B;  2QJY B;  1Z56 A;  2WVR A;  1Q86 Q;  4DZO A;  1SQB K;  3L72 D;  3AE7 C;  2WSE J;  2R3C A;  2WPQ A;  2QM8 A;  4PD4 I;  3U1A A;  1JM0 A;  3GW6 A;  3A3Y B;  2O01 J;  2XKM A;  1AFO A;  1W5C E;  2JO1 A;  3Q1M A;  3VP9 A;  1KYO I;  2E75 C;  2O01 N;  3AE5 C;  2ZT9 D;  4PV1 B;  1QL2 A;  5BVZ A;  2WSS H;  1VF5 C;  1NTK J;  3L70 J;  3H1H J;  1FZF A;  3RL0 C;  2ZFC A;  3D70 A;  2Q9I A;  4DCK A;  4JBZ A;  1EZV E;  3CWB J;  2XZR A;  2YMY A;  3FWL A;  1Y9B A;  5B66 H;  3B5N C;  1OVR A;  3H32 B;  3TGU D;  2O3J A;  2PRR A;  2O1K A;  2RMZ A;  1YQ3 C;  1NTK K;  4U3F D;  5APQ A;  2A45 H;  2AEJ A;  3HD7 D;  1URQ D;  4YTP C;  1UII A;  1PP9 G;  2QJK C;  3B5N A;  5K5G B;  2YKP A;  5GTI H;  1AVO A;  2K37 A;  2HR3 A;  4NPE A;  3L74 G;  2KP8 A;  3H1L D;  1BGY G;  1BE3 D;  1ZR4 A;  2G3A A;  3KDP B;  4B86 A;  4GT1 A;  2W8Z A;  1Q82 Q;  1LWU C;  3CD6 P;  4C7N A;  3V4W A;  3Q5P A;  2HOD A;  1NU1 D;  4KHX A;  2WSF J;  1JTH A;  1KIL A;  3LW5 J;  2BEQ D;  1IFM A;  2QJY C;  5KAF H;  1UIX A;  1SQX G;  2I1J A;  1ZV8 A;  1BDD A;  1S4X A;  3RL0 g;  4GOD A;  3AED C;  3BCC G;  2ZAE B;  4NPF X;  2D2C D;  2B9B A;  3JC2 2;  2K9J B;  3R4Y A;  2L91 A;  4GIF A;  1MUU A;  1GL2 B;  1FZE A;  4D6T D;  4PV1 C;  1PP9 E;  4EDF A;  2Y9Y A;  3FXD A;  4HH2 A;  1L0N J;  3AE4 C;  1BGY E;  1OW7 A;  1J1D B;  5CMZ A;  3A0H H;  4KT0 J;  2A06 D;  1LTJ B;  2LXC B;  4PD4 H;  4PJ0 H;  3RK3 E;  2E42 A;  1VQ8 P;  1DEE G;  2ZJS E;  5KKZ B;  4OVN F;  1GD2 E;  1JY2 P;  1KYO H;  5AW7 B;  1EZV I;  4K3A A;  2YXR B;  5AVS B;  4IOI H;  3AE6 C;  3CX5 H;  2OYI B;  4YPC A;  1Q90 D;  5AVZ B;  3QWO C;  4I7Z B;  1NHL A;  4H0L D;  4DOJ A;  1RF1 B;  3G6E P;  5H2F H;  3JCU E;  4A7P A;  1OXZ A;  2E74 B;  3H32 A;  1K73 Q;  5APY A;  5TIS H;  3BCC E;  1IFJ A;  3CCV P;  1E5W A;  3V2P A;  1HJ0 A;  1VL2 A;  5KLI B;  3TDK A;  1LTT C;  3PLN A;  1M56 D;  2N9Y B;  2GUS A;  1FU1 A;  1H88 A;  2IZ1 A;  3WU2 E;  4H13 D;  5KJ7 C;  4U3F G;  3W67 A;  3PJS K;  3E1R A;  1NTZ G;  2IYO A;  3USS A;  1YJ9 P;  4WWI A;  2BCC D;  3L72 E;  2KYV A;  2FXO A;  1QVF O;  3G9R A;  4MN4 C;  1ZN5 A;  2H7H A;  4TLF A;  5CJ0 A;  5KJ7 A;  1ZR2 A;  3H1L G;  2WPR A;  3AEG C;  5APX A;  2XV5 A;  3H1J D;  3WUV A;  1BE3 G;  1L4A B;  1U7M A;  1XTG B;  3MD0 A;  1JY3 P;  1ZOY C;  1R5S A;  1YJN P;  1LT9 B;  1GL2 C;  3SSU A;  1N7S B;  3MGN A;  4OGQ D;  1SS1 A;  3LIE A;  1NU1 G;  4WB4 A;  3IR9 A;  1T2K D;  5APW A;  3VP8 A;  3CI9 A;  2WSE H;  3UIA A;  2KS1 B;  5CCH D;  1OFC X;  1FC2 C;  1J1D C;  1FDI A;  1NTK D;  3L71 J;  1VQ9 P;  3TGU E;  3H1H D;  3QH9 A;  1U7J A;  2K9J A;  2QRX A;  1YBK A;  2QE7 H;  1GL2 A;  1LT1 A;  1SQP J;  2QVA A;  4U3F E;  3W68 A;  1OWA A;  3RBZ A;  1R5L A;  2JWA A;  4W7Y A;  3V5B A;  1GDT A;  1JY3 N;  2OYI C;  3H1K J;  4JPZ B;  4D6T G;  3K5B A;  4I7Z C;  1LTJ A;  1Y8A A;  1RF1 C;  3GMA A;  1MZ9 A;  1SQP K;  3H1L E;  1EXI A;  2E74 C;  2NPS A;  1BE3 E;  3I5C A;  1NJI Q;  3C9I A;  1JMM A;  5KLI C;  4U7J A;  2KB7 P;  2R5D A;  2OYI A;  3VOP A;  2P10 A;  5AW8 B;  1NU1 E;  1PGJ A;  1BSN A;  1MFT A;  3KZI H;  4Z1M H;  1RF1 A;  4W80 A;  3M0D A;  3O6Q B;  2WWW A;  3IFM A;  2YXQ B;  3L75 J;  5DJT B;  1NTM E;  2E76 D;  1NAF A;  1QLE D;  1RE4 A;  3HTK B;  5CBO A;  1KFM A;  2M3B A;  1RF0 C;  3A2A A;  2N1T D;  3CL3 D;  1PL5 A;  3NTN A;  4D6T E;  3LW5 H;  5KLV J;  2Q1K A;  1KQF B;  3EWK A;  1PGP A;  3VMZ A;  1LT9 C;  3FGA D;  1N7S C;  1M1J B;  5E79 E;  4HJG H;  1JOC A;  1GU4 A;  2C9N Y;  4ZNC A;  2BCC G;  2A06 E;  3RK2 D;  1X8Y A;  3C8V A;  2OTJ P;  1HUC A;  1L4A A;  3SWF A;  1DH3 A;  3L73 J;  3GHG C;  2ZXX A;  3PH0 A;  1N7S A;  3ZDM A;  3H1J G;  2JP3 A;  2ZYA A;  1IFI A;  2HPC B;  3E7K A;  5CBN A;  4H44 B;  3HUS B;  2KS1 A;  1DD4 A;  1OZH A;  4JYC A;  5AW6 B;  2Q7C A;  1VQP P;  3CC4 P;  3V4Q A;  4XA4 A;  4ASV A;  2OYH C;  1IK9 A;  3G71 P;  1NO4 A;  3BAT A;  2KNC B;  1KIL B;  2M3E A;  4GKG A;  2FYU J;  5AW5 B;  3B4S A;  1P84 H;  1NTK G;  1PGQ A;  1ZME C;  3CCJ P;  2IBZ D;  1KMI Z;  3H1H G;  1LGH B;  2RN0 A;  1E79 H;  5DJU B;  2IX7 C;  1KFN A;  3KQG A;  1RHZ B;  4ZKP A;  1FOS E;  1RY3 A;  4I1L A;  4QMA A;  4KJM A;  1H8A A;  1FZA A;  2ZVO B;  4UB6 H;  3IN6 A;  2E75 D;  1VQO P;  1SQQ D;  2WIT A;  3H1J E;  2ITA A;  5AVR B;  4W7Z A;  4N3Y B;  1VF5 D;  1KZU B;  3CCE P;  1QL1 A;  3RL0 D;  1KB9 E;  3O6Q A;  3CCS P;  2YO3 A;  1SLQ A;  2WZ7 A;  2W27 A;  2B87 B;  1PZQ A;  2KZJ A;  3B5N D;  3CC2 P;  1WRG A;  4LLH A;  3HTK A;  1M1K Q;  3TF5 A;  1NTK E;  2QJP B;  4L75 A;  1W2B O;  3H1H E;  1PPJ D;  3AEB C;  4RO0 A;  2AEM A;  2QSI A;  2KI7 B;  3EFF K;  4ASW A;  2IFN A;  2OGU A;  3HE4 B;  2H43 A;  2J58 A;  4IL6 X;  3L71 D;  1M1J A;  2GA1 A;  1WMK A;  1DX7 A;  2D2C B;  2HLO A;  4H44 C;  1MV8 A;  2R44 A;  1GK6 A;  5GTH E;  3HUS C;  5APS A;  3U59 A;  2OTK E;  4BRY B;  1EXJ A;  2K88 A;  2POH A;  1VQ5 P;  1KIL C;  3AEA C;  1AV1 A;  2UWJ E;  3L37 A;  2HPC A;  2Q3I A;  4L76 A;  2VRS A;  3D6Z A;  1USD A;  2WSC H;  4WVZ A;  1RQU A;  3AE3 C;  1LJ2 A;  3HUS A;  1NKZ B;  4C7R A;  3A0B H; 
#chains in the Genus database with same CATH homology
 1SQQ G;  3CWB G;  2A06 G;  1PP9 G;  1P84 H;  1KB9 H;  3TGU G;  2FYU G;  1NTK G;  3L71 G;  4D6T G;  3L74 G;  3H1H G;  3H1K G;  3L70 G;  2IBZ G;  1NU1 G;  5KLV G;  1NTM G;  1KYO H;  3L75 G;  4U3F G;  3BCC G;  1NTZ G;  1PPJ G;  1BGY G;  3CXH H;  1SQB G;  3H1L G;  3L73 G;  1EZV G;  1L0L G;  1SQP G;  3H1I G;  1BCC G;  1SQX G;  1L0N G;  3CX5 H;  1BE3 G;  3H1J G;  3L72 G;  1SQV G;  2BCC G;  4PD4 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...