1NTZG

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 17
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1ntzG00
4D6TG 3H1IG 3L73G 3H1LG 4U3FG 1PP9G 1BE3G 1KB9H 2FYUG 1SQBG 1KYOH 3H1JG 3L74G 3H1HG 1EZVG 1NTMG 1SQQG 3L71G 3BCCG 3L72G 3L75G 1SQPG 1BGYG 1P84H 1BCCG 5KLVG 1NTZG 1SQXG 3L70G 1L0NG 4PD4H 3CXHH 1L0LG 2IBZG 3H1KG 3CWBG 1NU1G 1SQVG 2A06G 3CX5H 2BCCG 3TGUG 1NTKG 1PPJG
chains in the Genus database with same CATH superfamily
4OVNF 1S5LX 1T2KC 2A06D 1OIPA 5CJ4A 1LTJC 3S4RA 1NGMB 4EOTA 2KP8A 1SQQJ 1QL2A 1S5LE 2I1KA 2QJYB 5M1BA 2A45I 3L73G 1IFMA 3L4FA 2XV5A 3L71G 2Q5UA 3BCCG 3QH9A 5KLVJ 1VL2A 1YJWP 2FFDB 1FOSF 1XTGB 1KQFB 1NKNA 2YMYA 5APTA 1XTCC 3JSVC 3L71E 4GOFA 4WWIA 1RY3A 1A02J 2PGDA 1FDIA 1M57D 4B86A 2M8RA 4JQ0D 5GTIH 2ZVNB 1N73B 1T3JA 1M7LA 1ZN5A 1Y8AA 4U3FE 1LTGC 1T6AA 2JJLA 4BRYB 1JY3P 1S1CX 2HR3A 3O6QB 5E79H 1IJDB 4C7RA 2QA4P 3G9RA 1ZXGA 3CCUP 1SQXE 3SWFA 1ZOYC 5KJ7D 3M9BA 1OVRA 1KQLA 1UIIA 5C39A 2RN0A 1JY2N 2IFNA 2R44A 1SQQD 3ZDMA 3WU2H 1OMIA 5KKZC 2R5BA 3VP9A 3L70D 2Y0EA 1Y9BA 2DW3A 1FZEA 1PP9G 1Q7YQ 3M91A 5KLVD 1VF5C 4BXLA 1URQA 1R8EA 3A0BE 5CCGA 4U7JA 2B87A 1HUCA 3TYYA 3Q3DA 3E1RA 4RO0A 2IPPA 1ZV8A 2IBZE 3AEGC 2ZYDA 4R4MA 4I7ZB 2JWAA 1L0LJ 3HE4B 2YO3A 2J5UA 1UIXA 2O01H 3AE5C 4H44D 4Z1MH 3L37A 1KILB 5AW2B 3D70A 3JCUH 2N1TA 3TGUJ 1KYOE 5AW1B 1BSHA 1JY3N 1SQVK 1KQSO 2K1AA 2GUSA 2FYUJ 1WMKA 3H1HJ 3H25A 3HE5B 3CX5E 2QM8A 1YYCA 2HYNA 2D2CD 2WTYA 4WY4D 3CCQP 1SQVD 3IF4A 2K37A 3Q1MA 2ZT9C 1GU5A 5CHXA 2KOGA 2QG4A 2N9YB 1RQVA 2OQQA 5CCHC 1MKMA 1W2BO 4H13C 2JO1A 1KV4A 4AUWA 1BGYJ 1PPJG 1SQBK 3EWKA 3L74G 1L0LD 4NPEA 2Q7CA 1FDMA 1PPJE 1E5WA 3B5NC 3CWBG 4JBZA 1CI6A 2ZYAA 1ZW0A 2IDBA 3L74E 2NRGA 2R3CA 1NJIQ 2WPVB 3RL0C 1PIXA 2LXBA 1D7MA 4QMAA 3TGUD 3CWBE 4IL6H 1X22A 3P32A 1RF1B 1G2CA 1S9KD 3H1HD 4IFMA 1FE6A 4DOJA 4M3LA 1L0NJ 1T8ZA 5APSA 2AEJA 2OTKE 3AE8C 2YIUC 4PV1C 1DEEG 1JTHA 1NKZB 3L73J 5KTBA 1H0TB 4H44B 3SFDC 1BGYD 4OGQB 3L71J 3BCCJ 1J1EC 1RQUA 2WZ7A 3HTKB 2ZT9B 1RHZB 2IBZI 1EXIA 3R4YA 3A0HH 1HGZA 3GHGA 3FX0A 1SQPG 1NTZG 4H13B 2K9JB 3AE6C 1NH4A 2BEQD 1U7MA 4PJ0H 2P58A 1EDKA 3D6YA 1SQPE 5KJ7A 1IFJA 2KYVA 1NTZE 3KXDA 1N7SB 3BVHA 3B5NB 1NTMG 1KYOI 1ZLLA 1JB0J 2WWWA 1GZLA 5KAFE 1K8AQ 3AEAC 1L4AC 3CX5I 5BU8B 2KXPB 3L35A 1K73Q 1ZMEC 3MP7B 2NZ2A 4Y99B 2KS1A 1J1DC 1SFCC 3E1IA 1KB9H 3KZIE 2XNXA 1GMJA 1PP9J 3L71D 5APUA 1A02F 3MGNA 2O3JA 3T97B 1N7LA 1SQXK 3HD7C 2W83C 4U3FD 1J1EB 1R5LA 1SP4A 3CLQA 4DT0A 5AW7B 3AEEC 3TNUA 1IC2A 2RKLA 1NAYA 5GTHE 1LT9C 1SQXD 2V4HA 2ZVOB 1IO4A 1EQ7A 4JPZB 2NPSD 1GL2B 4KT0J 4H0LC 1EDIA 3VMAA 4WY4A 3RK2D 3H1LG 3Q5SA 5AW0B 1ZRTE 3RK3D 1PL5A 1T3UA 3IFMA 5CCGD 3W67A 1USDA 3S1KA 3RGUA 1JCDA 2E76D 2IBZD 2YMKA 4BWNA 1HBWA 2WT7A 1QVFO 4I1LA 2YNYA 4DCKA 3NFQA 3L74J 1IK9A 1AV1A 3FWLA 1GK6A 5APVA 3GLMA 5AVZB 4ZNCA 1E79H 3F5HA 5AW5B 2CPSA 4EDFA 1YIJP 3IR9A 1KYOD 3NMDA 1U57A 3O8ZA 4ASWA 4EYYQ 3CWBJ 2QJYC 1S2EA 2QRXA 1FZFA 1EDLA 1QLED 5DJUB 2N1TD 3H1KG 2AEFA 3CX5D 1M1JB 4UB6H 2FYUE 3CCSP 1ZR2A 2KLVA 2FFDC 2IZ1A 3IAOA 3JC22 1Q86Q 3H1KE 3WMM0 3Q5RA 3MIWA 5BU5A 3GMAA 1M56D 2VRSA 2WPSA 1FZCA 1IFNA 2KZIA 4N6JA 3AE9C 1N73C 3B71A 5E79E 1MZ9A 2J59M 1PPJD 1FC2C 2Q3EA 2M3EA 4W7ZA 2Q6QA 5L8RJ 3WU2E 2C9NY 2W6AA 1SQPJ 2A45H 1NTZJ 3AE3C 3RK3B 3A7OA 4IFFA 3CWBD 3SWYA 4DZOA 2OYIB 1URQB 2Y9ZA 1IFDA 2G8YA 2RH0A 1L0NG 2B87B 1OWAA 1NTMJ 1Q81Q 3LW5J 4IOIH 3MUDA 1VDFA 1L0NE 4GOEA 3WUUA 2ZAEB 3AE4C 2YXRB 2K9YA 3V2RA 3VTPC 4MN4C 1PFIA 3L73E 3CC7P 2WSFH 1KQGB 4I7ZC 1M1JA 4XFJA 3U1AA 2OYHA 3BCCE 1QGKB 3MD0A 4LC1A 2N1TB 1YHQP 3JCUE 1RE4A 1KILC 4HKZH 2OTJP 4RKUJ 3Q5PA 1K9MQ 2QJKB 3CXHE 1SQPD 2Q9IA 1NTZD 2HODA 2BASA 1GTWA 2H43A 2JP3A 2NPSA 1DEBA 1SQQK 1LNQA 3GHGC 1J2JB 1RF0A 2AEMA 5KLVK 2Y0DA 2E43A 3H6PA 3CCRP 1VF5D 5AW6B 4A7PA 4ZMDA 2IYPA 2KK7A 4RESB 5KJ7C 2OYIA 2JEEA 2ZFCA 4HJGH 3H1LJ 1JNMA 3USSA 2QE7H 5APWA 2KB7P 1CI6B 1PP9E 3H32A 4IL6X 1HGVA 3CI9A 2WITA 1NVOA 1N86A 5APQA 3OAKA 2FXOA 4KJMA 5B5EH 1VQ6P 2QEXP 1G2CB 1NAFA 1Q90D 4IL6E 4PD4E 2AXTH 4R4LA 4EI2A 3Q2YA 1RF1C 4C7NA 3TDKA 1X9VA 1QEXA 1AQTA 1JTHB 1LWUA 4HYTB 1RE3C 4YXWH 2WSFJ 2GA1A 3RL0g 5AVWB 1ZRTD 2W27A 1R5SA 4H44C 3H1KJ 2R3SA 4OGQC 4RJTA 3GHGB 1GDTA 1AVYA 1P84H 2FYNB 2H88C 2WSCH 5CBNA 1L0LK 3EQ2A 3MHVA 2E75D 3PTZA 4GIFA 1VQ5P 2K88A 2ZXXA 2D2CC 5AVSB 3L72G 3U59A 3V6IA 1GD2E 1N7SC 3CXHI 4L76A 3N4XA 3V2NA 2HPCA 4GKGA 3R2PA 3CPWO 1PV3A 3RL0D 3L72E 2BCCG 4CPGA 2FYUK 2YO2A 1LTJA 2KS1B 3AECC 2R32A 1KB9E 1LTIC 3ABVC 2WSSH 4Y99C 3NXSA 2BCCE 2FYUD 3WUVA 1QX8A 4YXDC 1AJYA 3H1KD 3KQGA 4PV1D 3M0DC 1W5CE 1YITP 2HFED 2KLUA 2LXCB 4WB4A 3TNUB 2O01J 4JYCA 2N9BA 3GW6A 4NPDA 3M06A 2XZRA 1LGHB 1VQOP 1KYOH 5TJHA 1KILE 4PD4I 1EXJA 1GL2C 1HH0A 2FKWB 2D2CB 4WY4B 1JUNA 2O1KA 1L0NK 1X8YA 4UB8H 1GW4A 1LP1A 3I55P 2JKVA 3BATA 1L4AD 3GF3A 2P67A 2C0XA 2E74D 1FJKA 3KDPB 1LTTC 1Y47A 2GUVA 1L0ND 1NTME 1SFCD 3LIEA 2QJPB 1Q2NA 2M0BA 2B88A 2KUBA 1NTKJ 2WT7B 2JWDA 3L73D 3N7NA 1JEKA 1MV8A 2HLOA 3BCCD 3TK1A 1WRGA 2WSEH 2O01N 3L36A 3HD7D 1N2DC 3K5BA 1Q82Q 3MUDC 4GODA 3CXHD 4WBAA 4L73A 3VP8A 1HWTC 1MFTA 3TF5A 5H2FH 3H1IG 4N3YB 1M1JC 3V2QA 1H88A 1FS0E 3SFEC 3H1JG 2Y9YA 4H0LD 1NOHA 1IFPA 3I56P 5TISH 4K35A 2WQYC 2Q1KA 3A3YB 4TLFA 3H1IE 3G4SP 1FZCB 1DD4A 1FZGA 3H1JE 5B66E 4I6MC 1YJ9P 1BE3G 2Z5HA 3FWNA 2NPSC 2A45G 1PP9D 1KMIZ 3H1LE 1FAVA 1ZR4A 5AVYB 1BE3E 1SQVG 4N78E 2K3RA 3PLNA 5KAIH 2I1JA 4O9BA 1NU1J 3P8CE 3RK3C 4PD4D 3B4SA 2OYIC 1URQC 2PP6A 5CCGC 3L72J 1AQ5A 1BSNA 1CZQA 2E76C 3KZIH 1TU3F 3M9HA 1SQBG 1DD3A 2OTLP 1VQ4P 3OW2O 2BCCJ 2B89A 2OGUA 1SQBE 2KNCA 1AFOA 2ZJSE 4ZKUA 3AEFC 2OYHB 1FZBA 3CL3D 2PRRA 3PP5A 3C9IA 2ITAA 1FJPA 1EC5A 1SS1A 3SSUA 1M1KQ 2XU6A 2ZXEB 5GTIE 1H89A 2N1TC 1JMBA 3P7KA 3D71A 2M3BA 2HODB 2NPSB 2QJKC 1LTAC 2Z5IA 2L91A 3MTUE 3SWKA 4ASVA 1VQ7P 3L74D 3L72D 4YPCA 3U1CA 3RK2B 1HF9A 3MZWB 1OW7A 1T2KD 2FY8A 1VQ8P 3EFFK 1KB9D 2QSIA 2CK3H 3AE7C 5AVQB 2CPBA 1L4AA 4W80A 2E76B 3H32B 1SFCA 1HTLC 3OJAB 1VQMP 3AEBC 1KC8Q 3CCEP 4IFDK 5CMZA 1W2EA 2P1JA 1OW6A 3P8MC 3FGAD 3HUSA 4GDOA 5B5EE 2FYZA 1OVUA 5AVXB 2KSEA 3BRTB 2AXTE 2Y0CA 3CCJP 4C7NB 3L70J 3FXDA 2E5TA 3HD7A 2UWJE 1PGOA 1SQPK 4DJGA 1JY2O 1OW8A 1NTZK 1KILD 2FXPA 1LT9A 3NTNA 1LWUB 1VQ9P 3VYIA 4W7YA 3D6ZA 5CJ0A 2IYOA 1FOSE 5CBOA 1JMMA 2SPZA 1NTMK 1YJNP 4U3FG 2WVRA 1DIPA 1VQNP 1VQKP 1QVGO 2KZJA 4K3AA 1SQXG 2OARA 1VQLP 3H1IJ 2E42A 1P84E 5BVZA 1KTMA 2RMZA 4NPFX 3F89A 1NTMD 2M5AA 3H1JJ 1JCCA 2P10A 1JOCA 2FYNC 1X0TA 1VPCA 2Z4EA 1NTKG 2HG5D 4D6TG 1FU1A 1KZUB 3AE1C 3G3ZA 3GF7A 1NTKE 2W6JH 4D6TE 2HPCB 1BE3J 1PZQA 4XE5B 2ZYGA 3A2AA 1YQ4C 1LTJB 2H7HA 1JY3O 1SQVJ 1KORA 3RK3E 2B9BA 4KHXA 1JO5A 1IK7A 1DX7A 2IBZG 4OWFA 2MKVA 4TT3H 4XA4A 1S5LH 2L5GB 1OX3A 4HB1A 1NO4A 5EFWB 1EZVG 4L74A 3H1ID 3H1JD 2FFDA 4YTPC 4AQRD 1SQBJ 2W8ZA 1EZVE 2QVAA 4OGQD 1DH3A 1SLQA 1KFNA 3WUTA 3UIAA 2ZT9D 1NHLA 3OA7A 3A5TA 3A0HE 3H1LD 5AVTB 1GU4A 1BE3D 3CXHH 1N73A 5CCHD 4H13D 4N78D 1NU1G 4BRYA 2C0WA 5AVRB 4PJ0E 3O6QA 1HJBA 3M9QA 3P8CD 3PH0A 3AE2C 1PGPA 4WY4C 5KKZB 1NU1E 1N7SD 3VMXA 3L75G 1LP1B 3C8VA 1BCCG 3B5ND 4UB8E 1YQ3C 4LLHA 2XNDH 2W6BA 1VF5B 3L75E 5AW9B 3CMAP 1BCCE 2E75C 1AVOA 3A0BH 3BASA 1G1JA 2QJPC 1H8AA 1P84I 1QL1A 3CCMP 2WPRA 1SQBD 2IX7C 2A06G 3S9OA 3KPEA 3HRNA 1K04A 1M90Q 4JF7A 1PGJA 4LGDE 2W90A 2FXMA 1S3JA 1KN7A 2A06E 3IN6A 4PD4H 2QIWA 1ZP0C 1OZHA 1LTBC 2J58A 3HE4A 5AW4B 2YKPA 3ITKA 5H2FE 1HVVA 1KILA 1AA0A 1FDOA 2AXCA 3BRVB 2GM4A 2P7JA 2KI7B 1GL2D 5TISE 4HH2A 1GW3A 1X79B 3CX5H 1FBMA 3HE5A 4AYCA 1FZCC 3I5CA 1KD1Q 1LTSC 1YTZT 3V5BA 4U3FJ 1MUUA 2WSCJ 2E75B 1VQPP 3GG2A 1EZVI 3M0AA 1M8OB 4ZKPA 1SQXJ 3QWOC 5KAIE 5DJTB 3CC2P 1SQQG 3EFGA 5AW3B 3CC4P 4D6TJ 3L70G 3PJSK 1WT6A 2V7QH 3RL0B 3CMEP 3VMZA 1JM0A 2E74C 1SQQE 5KLVG 1USEA 3AEDC 3L70E 3RBZA 3CCVP 1PGQA 5KLVE 1RF1A 2H89C 4JYBA 1S72P 2YIUB 2IFMA 4PV1B 2KNCB 1CW5A 3HUSC 2PFXA 1IFIA 4UB6E 1MFZA 1OXZA 1SVFA 1FZAA 1RE3A 1KB9I 1P84D 2WPQA 2OYHC 1Z56A 5APYA 1OVVA 1H0TA 1NTKK 4C46A 2WMMA 5KLIC 1RE4C 2R5DA 5AW8B 3CD6P 3HTKA 3V2PA 1NYHA 2POHA 1NTKD 4D6TD 5CCHA 3E7KA 2K9JA 2P2UA 2H8PD 4EIJA 3VMYA 3C1LA 2BEZF 3VOPA 3TSIA 1HJ0A 1RF0C 1RH5B 2C9LY 3RK2C 1N7SA 3KHUA 1G1IA 3B5NA 1LJ2A 4OH8B 1L4AB 1SQVE 2XKMA 2E74B 1URQD 3V4QA 3PHLA 2OYOA 5KAFH 2IZ0A 1J1DB 1SFCB 4WVZA 1YI2P 3LW5H 3G71P 3L75J 1BCCJ 1L0LG 2FBWC 2I8DA 2LKMA 2YKQA 5K5GB 1S4XA 2KIKA 3W68A 3CCLP 4GT1A 2Q3IA 4I2LC 1BDCA 3HUSB 1L0LE 3RBXA 3M0DA 1EZVD 2V7QJ 2MJZA 2WSEJ 3TGUG 3HD7B 2PAJA 2JDIH 3T97A 2FYUG 1IZNB 2JR8A 3H1HG 3G6EP 1LT9B 1NWQA 3TGUE 5KLIB 1NU1K 2KSJA 2XDJA 3V4WA 5GTHH 1S9KE 1LWUC 3H1HE 1BDDA 4L75A 1N8RQ 1L2PA 1NU1D 3PRJA 4H0LB 2YKOA 1GL2A 2LR2A 1BGYG 3LIDA 2O1JA 1U7JA 1YTZI 5AVUB 5B66H 3B8EB 2M5AB 1KFMA 2YXQB 3L75D 1BCCD 1EDJA 1OFCX 1YBKA 1BGYE 2E5YA 4Y28J 2BCCD 1LT1A 3II6A 3FXEA 1CSBA 5APXA 3VN0A 1JY2P 1K05A 2QM7A 2G3AA 5AVVB 1GK4A 3KYQA
chains in the Genus database with same CATH topology
4D6TG 3H1IG 3L73G 3H1LG 4U3FG 1PP9G 1BE3G 1KB9H 2FYUG 1SQBG 1KYOH 3H1JG 3L74G 3H1HG 1EZVG 1NTMG 1SQQG 3L71G 3BCCG 3L72G 3L75G 1SQPG 1BGYG 1P84H 1BCCG 5KLVG 1NTZG 1SQXG 3L70G 1L0NG 4PD4H 3CXHH 1L0LG 2IBZG 3H1KG 3CWBG 1NU1G 1SQVG 2A06G 3CX5H 2BCCG 3TGUG 1NTKG 1PPJG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D6T G;  3H1I G;  3L73 G;  3H1L G;  4U3F G;  1PP9 G;  1BE3 G;  1KB9 H;  2FYU G;  1SQB G;  1KYO H;  3H1J G;  3L74 G;  3H1H G;  1EZV G;  1NTM G;  1SQQ G;  3L71 G;  3BCC G;  3L72 G;  3L75 G;  1SQP G;  1BGY G;  1P84 H;  1BCC G;  5KLV G;  1NTZ G;  1SQX G;  3L70 G;  1L0N G;  4PD4 H;  3CXH H;  1L0L G;  2IBZ G;  3H1K G;  3CWB G;  1NU1 G;  1SQV G;  2A06 G;  3CX5 H;  2BCC G;  3TGU G;  1NTK G;  1PPJ G; 
#chains in the Genus database with same CATH topology
 4OVN F;  1S5L X;  1T2K C;  2A06 D;  1OIP A;  5CJ4 A;  1LTJ C;  3S4R A;  1NGM B;  4EOT A;  2KP8 A;  1SQQ J;  1QL2 A;  1S5L E;  2I1K A;  2QJY B;  5M1B A;  2A45 I;  3L73 G;  1IFM A;  3L4F A;  2XV5 A;  3L71 G;  2Q5U A;  3BCC G;  3QH9 A;  5KLV J;  1VL2 A;  1YJW P;  2FFD B;  1FOS F;  1XTG B;  1KQF B;  1NKN A;  2YMY A;  5APT A;  1XTC C;  3JSV C;  3L71 E;  4GOF A;  4WWI A;  1RY3 A;  1A02 J;  2PGD A;  1FDI A;  1M57 D;  4B86 A;  2M8R A;  4JQ0 D;  5GTI H;  2ZVN B;  1N73 B;  1T3J A;  1M7L A;  1ZN5 A;  1Y8A A;  4U3F E;  1LTG C;  1T6A A;  2JJL A;  4BRY B;  1JY3 P;  1S1C X;  2HR3 A;  3O6Q B;  5E79 H;  1IJD B;  4C7R A;  2QA4 P;  3G9R A;  1ZXG A;  3CCU P;  1SQX E;  3SWF A;  1ZOY C;  5KJ7 D;  3M9B A;  1OVR A;  1KQL A;  1UII A;  5C39 A;  2RN0 A;  1JY2 N;  2IFN A;  2R44 A;  1SQQ D;  3ZDM A;  3WU2 H;  1OMI A;  5KKZ C;  2R5B A;  3VP9 A;  3L70 D;  2Y0E A;  1Y9B A;  2DW3 A;  1FZE A;  1PP9 G;  1Q7Y Q;  3M91 A;  5KLV D;  1VF5 C;  4BXL A;  1URQ A;  1R8E A;  3A0B E;  5CCG A;  4U7J A;  2B87 A;  1HUC A;  3TYY A;  3Q3D A;  3E1R A;  4RO0 A;  2IPP A;  1ZV8 A;  2IBZ E;  3AEG C;  2ZYD A;  4R4M A;  4I7Z B;  2JWA A;  1L0L J;  3HE4 B;  2YO3 A;  2J5U A;  1UIX A;  2O01 H;  3AE5 C;  4H44 D;  4Z1M H;  3L37 A;  1KIL B;  5AW2 B;  3D70 A;  3JCU H;  2N1T A;  3TGU J;  1KYO E;  5AW1 B;  1BSH A;  1JY3 N;  1SQV K;  1KQS O;  2K1A A;  2GUS A;  2FYU J;  1WMK A;  3H1H J;  3H25 A;  3HE5 B;  3CX5 E;  2QM8 A;  1YYC A;  2HYN A;  2D2C D;  2WTY A;  4WY4 D;  3CCQ P;  1SQV D;  3IF4 A;  2K37 A;  3Q1M A;  2ZT9 C;  1GU5 A;  5CHX A;  2KOG A;  2QG4 A;  2N9Y B;  1RQV A;  2OQQ A;  5CCH C;  1MKM A;  1W2B O;  4H13 C;  2JO1 A;  1KV4 A;  4AUW A;  1BGY J;  1PPJ G;  1SQB K;  3EWK A;  3L74 G;  1L0L D;  4NPE A;  2Q7C A;  1FDM A;  1PPJ E;  1E5W A;  3B5N C;  3CWB G;  4JBZ A;  1CI6 A;  2ZYA A;  1ZW0 A;  2IDB A;  3L74 E;  2NRG A;  2R3C A;  1NJI Q;  2WPV B;  3RL0 C;  1PIX A;  2LXB A;  1D7M A;  4QMA A;  3TGU D;  3CWB E;  4IL6 H;  1X22 A;  3P32 A;  1RF1 B;  1G2C A;  1S9K D;  3H1H D;  4IFM A;  1FE6 A;  4DOJ A;  4M3L A;  1L0N J;  1T8Z A;  5APS A;  2AEJ A;  2OTK E;  3AE8 C;  2YIU C;  4PV1 C;  1DEE G;  1JTH A;  1NKZ B;  3L73 J;  5KTB A;  1H0T B;  4H44 B;  3SFD C;  1BGY D;  4OGQ B;  3L71 J;  3BCC J;  1J1E C;  1RQU A;  2WZ7 A;  3HTK B;  2ZT9 B;  1RHZ B;  2IBZ I;  1EXI A;  3R4Y A;  3A0H H;  1HGZ A;  3GHG A;  3FX0 A;  1SQP G;  1NTZ G;  4H13 B;  2K9J B;  3AE6 C;  1NH4 A;  2BEQ D;  1U7M A;  4PJ0 H;  2P58 A;  1EDK A;  3D6Y A;  1SQP E;  5KJ7 A;  1IFJ A;  2KYV A;  1NTZ E;  3KXD A;  1N7S B;  3BVH A;  3B5N B;  1NTM G;  1KYO I;  1ZLL A;  1JB0 J;  2WWW A;  1GZL A;  5KAF E;  1K8A Q;  3AEA C;  1L4A C;  3CX5 I;  5BU8 B;  2KXP B;  3L35 A;  1K73 Q;  1ZME C;  3MP7 B;  2NZ2 A;  4Y99 B;  2KS1 A;  1J1D C;  1SFC C;  3E1I A;  1KB9 H;  3KZI E;  2XNX A;  1GMJ A;  1PP9 J;  3L71 D;  5APU A;  1A02 F;  3MGN A;  2O3J A;  3T97 B;  1N7L A;  1SQX K;  3HD7 C;  2W83 C;  4U3F D;  1J1E B;  1R5L A;  1SP4 A;  3CLQ A;  4DT0 A;  5AW7 B;  3AEE C;  3TNU A;  1IC2 A;  2RKL A;  1NAY A;  5GTH E;  1LT9 C;  1SQX D;  2V4H A;  2ZVO B;  1IO4 A;  1EQ7 A;  4JPZ B;  2NPS D;  1GL2 B;  4KT0 J;  4H0L C;  1EDI A;  3VMA A;  4WY4 A;  3RK2 D;  3H1L G;  3Q5S A;  5AW0 B;  1ZRT E;  3RK3 D;  1PL5 A;  1T3U A;  3IFM A;  5CCG D;  3W67 A;  1USD A;  3S1K A;  3RGU A;  1JCD A;  2E76 D;  2IBZ D;  2YMK A;  4BWN A;  1HBW A;  2WT7 A;  1QVF O;  4I1L A;  2YNY A;  4DCK A;  3NFQ A;  3L74 J;  1IK9 A;  1AV1 A;  3FWL A;  1GK6 A;  5APV A;  3GLM A;  5AVZ B;  4ZNC A;  1E79 H;  3F5H A;  5AW5 B;  2CPS A;  4EDF A;  1YIJ P;  3IR9 A;  1KYO D;  3NMD A;  1U57 A;  3O8Z A;  4ASW A;  4EYY Q;  3CWB J;  2QJY C;  1S2E A;  2QRX A;  1FZF A;  1EDL A;  1QLE D;  5DJU B;  2N1T D;  3H1K G;  2AEF A;  3CX5 D;  1M1J B;  4UB6 H;  2FYU E;  3CCS P;  1ZR2 A;  2KLV A;  2FFD C;  2IZ1 A;  3IAO A;  3JC2 2;  1Q86 Q;  3H1K E;  3WMM 0;  3Q5R A;  3MIW A;  5BU5 A;  3GMA A;  1M56 D;  2VRS A;  2WPS A;  1FZC A;  1IFN A;  2KZI A;  4N6J A;  3AE9 C;  1N73 C;  3B71 A;  5E79 E;  1MZ9 A;  2J59 M;  1PPJ D;  1FC2 C;  2Q3E A;  2M3E A;  4W7Z A;  2Q6Q A;  5L8R J;  3WU2 E;  2C9N Y;  2W6A A;  1SQP J;  2A45 H;  1NTZ J;  3AE3 C;  3RK3 B;  3A7O A;  4IFF A;  3CWB D;  3SWY A;  4DZO A;  2OYI B;  1URQ B;  2Y9Z A;  1IFD A;  2G8Y A;  2RH0 A;  1L0N G;  2B87 B;  1OWA A;  1NTM J;  1Q81 Q;  3LW5 J;  4IOI H;  3MUD A;  1VDF A;  1L0N E;  4GOE A;  3WUU A;  2ZAE B;  3AE4 C;  2YXR B;  2K9Y A;  3V2R A;  3VTP C;  4MN4 C;  1PFI A;  3L73 E;  3CC7 P;  2WSF H;  1KQG B;  4I7Z C;  1M1J A;  4XFJ A;  3U1A A;  2OYH A;  3BCC E;  1QGK B;  3MD0 A;  4LC1 A;  2N1T B;  1YHQ P;  3JCU E;  1RE4 A;  1KIL C;  4HKZ H;  2OTJ P;  4RKU J;  3Q5P A;  1K9M Q;  2QJK B;  3CXH E;  1SQP D;  2Q9I A;  1NTZ D;  2HOD A;  2BAS A;  1GTW A;  2H43 A;  2JP3 A;  2NPS A;  1DEB A;  1SQQ K;  1LNQ A;  3GHG C;  1J2J B;  1RF0 A;  2AEM A;  5KLV K;  2Y0D A;  2E43 A;  3H6P A;  3CCR P;  1VF5 D;  5AW6 B;  4A7P A;  4ZMD A;  2IYP A;  2KK7 A;  4RES B;  5KJ7 C;  2OYI A;  2JEE A;  2ZFC A;  4HJG H;  3H1L J;  1JNM A;  3USS A;  2QE7 H;  5APW A;  2KB7 P;  1CI6 B;  1PP9 E;  3H32 A;  4IL6 X;  1HGV A;  3CI9 A;  2WIT A;  1NVO A;  1N86 A;  5APQ A;  3OAK A;  2FXO A;  4KJM A;  5B5E H;  1VQ6 P;  2QEX P;  1G2C B;  1NAF A;  1Q90 D;  4IL6 E;  4PD4 E;  2AXT H;  4R4L A;  4EI2 A;  3Q2Y A;  1RF1 C;  4C7N A;  3TDK A;  1X9V A;  1QEX A;  1AQT A;  1JTH B;  1LWU A;  4HYT B;  1RE3 C;  4YXW H;  2WSF J;  2GA1 A;  3RL0 g;  5AVW B;  1ZRT D;  2W27 A;  1R5S A;  4H44 C;  3H1K J;  2R3S A;  4OGQ C;  4RJT A;  3GHG B;  1GDT A;  1AVY A;  1P84 H;  2FYN B;  2H88 C;  2WSC H;  5CBN A;  1L0L K;  3EQ2 A;  3MHV A;  2E75 D;  3PTZ A;  4GIF A;  1VQ5 P;  2K88 A;  2ZXX A;  2D2C C;  5AVS B;  3L72 G;  3U59 A;  3V6I A;  1GD2 E;  1N7S C;  3CXH I;  4L76 A;  3N4X A;  3V2N A;  2HPC A;  4GKG A;  3R2P A;  3CPW O;  1PV3 A;  3RL0 D;  3L72 E;  2BCC G;  4CPG A;  2FYU K;  2YO2 A;  1LTJ A;  2KS1 B;  3AEC C;  2R32 A;  1KB9 E;  1LTI C;  3ABV C;  2WSS H;  4Y99 C;  3NXS A;  2BCC E;  2FYU D;  3WUV A;  1QX8 A;  4YXD C;  1AJY A;  3H1K D;  3KQG A;  4PV1 D;  3M0D C;  1W5C E;  1YIT P;  2HFE D;  2KLU A;  2LXC B;  4WB4 A;  3TNU B;  2O01 J;  4JYC A;  2N9B A;  3GW6 A;  4NPD A;  3M06 A;  2XZR A;  1LGH B;  1VQO P;  1KYO H;  5TJH A;  1KIL E;  4PD4 I;  1EXJ A;  1GL2 C;  1HH0 A;  2FKW B;  2D2C B;  4WY4 B;  1JUN A;  2O1K A;  1L0N K;  1X8Y A;  4UB8 H;  1GW4 A;  1LP1 A;  3I55 P;  2JKV A;  3BAT A;  1L4A D;  3GF3 A;  2P67 A;  2C0X A;  2E74 D;  1FJK A;  3KDP B;  1LTT C;  1Y47 A;  2GUV A;  1L0N D;  1NTM E;  1SFC D;  3LIE A;  2QJP B;  1Q2N A;  2M0B A;  2B88 A;  2KUB A;  1NTK J;  2WT7 B;  2JWD A;  3L73 D;  3N7N A;  1JEK A;  1MV8 A;  2HLO A;  3BCC D;  3TK1 A;  1WRG A;  2WSE H;  2O01 N;  3L36 A;  3HD7 D;  1N2D C;  3K5B A;  1Q82 Q;  3MUD C;  4GOD A;  3CXH D;  4WBA A;  4L73 A;  3VP8 A;  1HWT C;  1MFT A;  3TF5 A;  5H2F H;  3H1I G;  4N3Y B;  1M1J C;  3V2Q A;  1H88 A;  1FS0 E;  3SFE C;  3H1J G;  2Y9Y A;  4H0L D;  1NOH A;  1IFP A;  3I56 P;  5TIS H;  4K35 A;  2WQY C;  2Q1K A;  3A3Y B;  4TLF A;  3H1I E;  3G4S P;  1FZC B;  1DD4 A;  1FZG A;  3H1J E;  5B66 E;  4I6M C;  1YJ9 P;  1BE3 G;  2Z5H A;  3FWN A;  2NPS C;  2A45 G;  1PP9 D;  1KMI Z;  3H1L E;  1FAV A;  1ZR4 A;  5AVY B;  1BE3 E;  1SQV G;  4N78 E;  2K3R A;  3PLN A;  5KAI H;  2I1J A;  4O9B A;  1NU1 J;  3P8C E;  3RK3 C;  4PD4 D;  3B4S A;  2OYI C;  1URQ C;  2PP6 A;  5CCG C;  3L72 J;  1AQ5 A;  1BSN A;  1CZQ A;  2E76 C;  3KZI H;  1TU3 F;  3M9H A;  1SQB G;  1DD3 A;  2OTL P;  1VQ4 P;  3OW2 O;  2BCC J;  2B89 A;  2OGU A;  1SQB E;  2KNC A;  1AFO A;  2ZJS E;  4ZKU A;  3AEF C;  2OYH B;  1FZB A;  3CL3 D;  2PRR A;  3PP5 A;  3C9I A;  2ITA A;  1FJP A;  1EC5 A;  1SS1 A;  3SSU A;  1M1K Q;  2XU6 A;  2ZXE B;  5GTI E;  1H89 A;  2N1T C;  1JMB A;  3P7K A;  3D71 A;  2M3B A;  2HOD B;  2NPS B;  2QJK C;  1LTA C;  2Z5I A;  2L91 A;  3MTU E;  3SWK A;  4ASV A;  1VQ7 P;  3L74 D;  3L72 D;  4YPC A;  3U1C A;  3RK2 B;  1HF9 A;  3MZW B;  1OW7 A;  1T2K D;  2FY8 A;  1VQ8 P;  3EFF K;  1KB9 D;  2QSI A;  2CK3 H;  3AE7 C;  5AVQ B;  2CPB A;  1L4A A;  4W80 A;  2E76 B;  3H32 B;  1SFC A;  1HTL C;  3OJA B;  1VQM P;  3AEB C;  1KC8 Q;  3CCE P;  4IFD K;  5CMZ A;  1W2E A;  2P1J A;  1OW6 A;  3P8M C;  3FGA D;  3HUS A;  4GDO A;  5B5E E;  2FYZ A;  1OVU A;  5AVX B;  2KSE A;  3BRT B;  2AXT E;  2Y0C A;  3CCJ P;  4C7N B;  3L70 J;  3FXD A;  2E5T A;  3HD7 A;  2UWJ E;  1PGO A;  1SQP K;  4DJG A;  1JY2 O;  1OW8 A;  1NTZ K;  1KIL D;  2FXP A;  1LT9 A;  3NTN A;  1LWU B;  1VQ9 P;  3VYI A;  4W7Y A;  3D6Z A;  5CJ0 A;  2IYO A;  1FOS E;  5CBO A;  1JMM A;  2SPZ A;  1NTM K;  1YJN P;  4U3F G;  2WVR A;  1DIP A;  1VQN P;  1VQK P;  1QVG O;  2KZJ A;  4K3A A;  1SQX G;  2OAR A;  1VQL P;  3H1I J;  2E42 A;  1P84 E;  5BVZ A;  1KTM A;  2RMZ A;  4NPF X;  3F89 A;  1NTM D;  2M5A A;  3H1J J;  1JCC A;  2P10 A;  1JOC A;  2FYN C;  1X0T A;  1VPC A;  2Z4E A;  1NTK G;  2HG5 D;  4D6T G;  1FU1 A;  1KZU B;  3AE1 C;  3G3Z A;  3GF7 A;  1NTK E;  2W6J H;  4D6T E;  2HPC B;  1BE3 J;  1PZQ A;  4XE5 B;  2ZYG A;  3A2A A;  1YQ4 C;  1LTJ B;  2H7H A;  1JY3 O;  1SQV J;  1KOR A;  3RK3 E;  2B9B A;  4KHX A;  1JO5 A;  1IK7 A;  1DX7 A;  2IBZ G;  4OWF A;  2MKV A;  4TT3 H;  4XA4 A;  1S5L H;  2L5G B;  1OX3 A;  4HB1 A;  1NO4 A;  5EFW B;  1EZV G;  4L74 A;  3H1I D;  3H1J D;  2FFD A;  4YTP C;  4AQR D;  1SQB J;  2W8Z A;  1EZV E;  2QVA A;  4OGQ D;  1DH3 A;  1SLQ A;  1KFN A;  3WUT A;  3UIA A;  2ZT9 D;  1NHL A;  3OA7 A;  3A5T A;  3A0H E;  3H1L D;  5AVT B;  1GU4 A;  1BE3 D;  3CXH H;  1N73 A;  5CCH D;  4H13 D;  4N78 D;  1NU1 G;  4BRY A;  2C0W A;  5AVR B;  4PJ0 E;  3O6Q A;  1HJB A;  3M9Q A;  3P8C D;  3PH0 A;  3AE2 C;  1PGP A;  4WY4 C;  5KKZ B;  1NU1 E;  1N7S D;  3VMX A;  3L75 G;  1LP1 B;  3C8V A;  1BCC G;  3B5N D;  4UB8 E;  1YQ3 C;  4LLH A;  2XND H;  2W6B A;  1VF5 B;  3L75 E;  5AW9 B;  3CMA P;  1BCC E;  2E75 C;  1AVO A;  3A0B H;  3BAS A;  1G1J A;  2QJP C;  1H8A A;  1P84 I;  1QL1 A;  3CCM P;  2WPR A;  1SQB D;  2IX7 C;  2A06 G;  3S9O A;  3KPE A;  3HRN A;  1K04 A;  1M90 Q;  4JF7 A;  1PGJ A;  4LGD E;  2W90 A;  2FXM A;  1S3J A;  1KN7 A;  2A06 E;  3IN6 A;  4PD4 H;  2QIW A;  1ZP0 C;  1OZH A;  1LTB C;  2J58 A;  3HE4 A;  5AW4 B;  2YKP A;  3ITK A;  5H2F E;  1HVV A;  1KIL A;  1AA0 A;  1FDO A;  2AXC A;  3BRV B;  2GM4 A;  2P7J A;  2KI7 B;  1GL2 D;  5TIS E;  4HH2 A;  1GW3 A;  1X79 B;  3CX5 H;  1FBM A;  3HE5 A;  4AYC A;  1FZC C;  3I5C A;  1KD1 Q;  1LTS C;  1YTZ T;  3V5B A;  4U3F J;  1MUU A;  2WSC J;  2E75 B;  1VQP P;  3GG2 A;  1EZV I;  3M0A A;  1M8O B;  4ZKP A;  1SQX J;  3QWO C;  5KAI E;  5DJT B;  3CC2 P;  1SQQ G;  3EFG A;  5AW3 B;  3CC4 P;  4D6T J;  3L70 G;  3PJS K;  1WT6 A;  2V7Q H;  3RL0 B;  3CME P;  3VMZ A;  1JM0 A;  2E74 C;  1SQQ E;  5KLV G;  1USE A;  3AED C;  3L70 E;  3RBZ A;  3CCV P;  1PGQ A;  5KLV E;  1RF1 A;  2H89 C;  4JYB A;  1S72 P;  2YIU B;  2IFM A;  4PV1 B;  2KNC B;  1CW5 A;  3HUS C;  2PFX A;  1IFI A;  4UB6 E;  1MFZ A;  1OXZ A;  1SVF A;  1FZA A;  1RE3 A;  1KB9 I;  1P84 D;  2WPQ A;  2OYH C;  1Z56 A;  5APY A;  1OVV A;  1H0T A;  1NTK K;  4C46 A;  2WMM A;  5KLI C;  1RE4 C;  2R5D A;  5AW8 B;  3CD6 P;  3HTK A;  3V2P A;  1NYH A;  2POH A;  1NTK D;  4D6T D;  5CCH A;  3E7K A;  2K9J A;  2P2U A;  2H8P D;  4EIJ A;  3VMY A;  3C1L A;  2BEZ F;  3VOP A;  3TSI A;  1HJ0 A;  1RF0 C;  1RH5 B;  2C9L Y;  3RK2 C;  1N7S A;  3KHU A;  1G1I A;  3B5N A;  1LJ2 A;  4OH8 B;  1L4A B;  1SQV E;  2XKM A;  2E74 B;  1URQ D;  3V4Q A;  3PHL A;  2OYO A;  5KAF H;  2IZ0 A;  1J1D B;  1SFC B;  4WVZ A;  1YI2 P;  3LW5 H;  3G71 P;  3L75 J;  1BCC J;  1L0L G;  2FBW C;  2I8D A;  2LKM A;  2YKQ A;  5K5G B;  1S4X A;  2KIK A;  3W68 A;  3CCL P;  4GT1 A;  2Q3I A;  4I2L C;  1BDC A;  3HUS B;  1L0L E;  3RBX A;  3M0D A;  1EZV D;  2V7Q J;  2MJZ A;  2WSE J;  3TGU G;  3HD7 B;  2PAJ A;  2JDI H;  3T97 A;  2FYU G;  1IZN B;  2JR8 A;  3H1H G;  3G6E P;  1LT9 B;  1NWQ A;  3TGU E;  5KLI B;  1NU1 K;  2KSJ A;  2XDJ A;  3V4W A;  5GTH H;  1S9K E;  1LWU C;  3H1H E;  1BDD A;  4L75 A;  1N8R Q;  1L2P A;  1NU1 D;  3PRJ A;  4H0L B;  2YKO A;  1GL2 A;  2LR2 A;  1BGY G;  3LID A;  2O1J A;  1U7J A;  1YTZ I;  5AVU B;  5B66 H;  3B8E B;  2M5A B;  1KFM A;  2YXQ B;  3L75 D;  1BCC D;  1EDJ A;  1OFC X;  1YBK A;  1BGY E;  2E5Y A;  4Y28 J;  2BCC D;  1LT1 A;  3II6 A;  3FXE A;  1CSB A;  5APX A;  3VN0 A;  1JY2 P;  1K05 A;  2QM7 A;  2G3A A;  5AVV B;  1GK4 A;  3KYQ A; 
#chains in the Genus database with same CATH homology
 4D6T G;  3H1I G;  3L73 G;  3H1L G;  4U3F G;  1PP9 G;  1BE3 G;  1KB9 H;  2FYU G;  1SQB G;  1KYO H;  3H1J G;  3L74 G;  3H1H G;  1EZV G;  1NTM G;  1SQQ G;  3L71 G;  3BCC G;  3L72 G;  3L75 G;  1SQP G;  1BGY G;  1P84 H;  1BCC G;  5KLV G;  1NTZ G;  1SQX G;  3L70 G;  1L0N G;  4PD4 H;  3CXH H;  1L0L G;  2IBZ G;  3H1K G;  3CWB G;  1NU1 G;  1SQV G;  2A06 G;  3CX5 H;  2BCC G;  3TGU G;  1NTK G;  1PPJ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...