1NTZG

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 17
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1ntzG00
1L0NG 3L71G 4PD4H 1SQPG 4U3FG 3H1KG 1NTMG 1SQVG 1L0LG 3L70G 2A06G 1SQQG 5KLVG 1KB9H 1BGYG 1BE3G 3H1IG 3CXHH 3L75G 1P84H 3CX5H 4D6TG 1SQBG 3L74G 3L72G 3CWBG 1BCCG 1PPJG 3H1HG 3H1JG 1SQXG 3BCCG 1KYOH 3H1LG 3TGUG 3L73G 1NTZG 1NU1G 1EZVG 1NTKG 2BCCG 2FYUG 2IBZG 1PP9G
chains in the Genus database with same CATH superfamily
2XZRA 2IFNA 1NTME 2QIWA 3V5BA 1JY3P 2FYUK 4OWFA 2P10A 4BRYB 2Z4EA 1LTTC 1MFZA 2WSSH 4K3AA 1HJBA 3EFFK 2QRXA 1KQGB 2AEMA 2B9BA 3KDPB 1VQ9P 2KZIA 4NPFX 3JCUE 4Y28J 1K73Q 1Q81Q 1BE3G 4TT3H 5TISH 3O8ZA 3Q5PA 4LGDE 1M90Q 2B88A 4KJMA 5CCHD 3A7OA 4WY4B 3TGUD 2Q3EA 1M1JA 3L72E 1NJIQ 3L74D 1A02F 1JY2N 1AQTA 3V2PA 2PAJA 1RF1B 3CXHI 5AVTB 2KK7A 4RO0A 1LTGC 2HPCA 3JSVC 5CCGC 3L36A 3CC7P 4H13B 1DEBA 2M5AB 1S5LE 2KB7P 2W27A 1PGQA 5KAIE 3WUTA 1GL2C 3M9BA 1FOSE 2O3JA 1MFTA 2QJYC 3H1LE 1L4AC 1Y8AA 1PP9G 3CX5D 1TU3F 1BSNA 2HG5D 4O9BA 2WMMA 3S1KA 3C1LA 2Z5HA 3M9HA 3N4XA 4RJTA 5CCHC 3TF5A 1VQNP 2G3AA 1NTZD 4IFDK 3M0AA 2OTLP 2D2CC 1RF0A 1YQ4C 2E75C 3R4YA 3A3YB 1DIPA 2P58A 4U3FD 2NZ2A 1LNQA 2M8RA 3H1IJ 1VDFA 3MUDC 5AW1B 2NPSA 1WRGA 1AJYA 3AE9C 1GK6A 5APUA 2PP6A 3VMYA 1N73C 1K9MQ 3SWFA 1PIXA 2LKMA 2Q1KA 2WPRA 2QG4A 3L73D 3MUDA 3OJAB 4WB4A 5E79H 5KLVE 4R4LA 2ZT9B 1S5LH 2IZ1A 2ZYDA 1BDDA 1VPCA 5CCHA 1SFCA 1NOHA 2WQYC 4ASWA 2FFDB 1IC2A 3TGUG 1S4XA 4L76A 4I7ZC 1Y9BA 3NFQA 5AVUB 1RHZB 2OTJP 1JTHA 3H1JJ 4MN4C 3VYIA 2A06E 3G6EP 2FFDA 1BSHA 1SQQK 2J58A 1JY2O 1LTJB 2YKOA 4NPEA 1KQFB 2R3SA 3IFMA 2GUVA 5KLVD 3GHGB 1YHQP 1H89A 2CPSA 1G2CA 2WSFH 1VF5B 1SQQG 2ZXXA 3AE3C 3IAOA 4JYCA 1URQC 4OGQD 1NTKK 5APYA 5KLVG 1HTLC 3H1HD 1MKMA 1BCCE 1T3JA 3VN0A 4Y99B 1M56D 3GHGA 4NPDA 1YQ3C 1SQBD 2BEZF 4OH8B 3RL0D 1VQ8P 3FXDA 2H88C 4LC1A 1ZV8A 2HODB 3B71A 2QJPC 5C39A 3R2PA 1L4AD 3L37A 3AE2C 3PJSK 2K3RA 1JO5A 2BCCJ 1ZR2A 2C9LY 1SQQD 3AEFC 3H1LG 3CCEP 3MGNA 1WMKA 1OIPA 2D2CD 1URQD 2QVAA 4GOEA 4HKZH 4YTPC 2Q6QA 3HE4A 3H1LJ 2W6AA 1FZAA 2P67A 1QX8A 2BCCG 4R4MA 1L0ND 2VRSA 1VQKP 1FZFA 1JMMA 2ZYAA 5KJ7D 1M57D 1GD2E 5BVZA 3BVHA 2WT7B 1YJNP 2YKQA 5APTA 1KD1Q 4PD4E 4H44B 2YXQB 3KQGA 2A06G 3V2NA 5BU8B 2ZFCA 1ZP0C 3HUSC 3B5NB 3U59A 1AA0A 5CBOA 5AW3B 1FAVA 2IFMA 2W8ZA 3AEDC 3LIDA 2WT7A 1GTWA 1EZVD 1LTIC 2AXTE 2R5BA 4EYYQ 1SFCD 3H32B 3S9OA 2ITAA 1JTHB 1S1CX 1LTAC 3PTZA 4C7NA 1FBMA 1H0TB 2OARA 1PPJG 5APWA 1DX7A 5B5EE 1G1JA 3B4SA 3QH9A 5AW9B 1S9KE 1OW8A 1PPJD 4GT1A 1NAYA 1S5LX 1LT1A 3VOPA 2XU6A 3L72D 1CSBA 1N7SA 2Y0CA 3M91A 3A0HE 3BCCJ 3RL0g 1SQXJ 1GMJA 2OGUA 3FWLA 3L75D 4L74A 4WWIA 4DCKA 2WZ7A 3CCSP 1YITP 2A45G 3A2AA 1BCCJ 1D7MA 2P1JA 1SFCC 3C8VA 1BGYD 2FYNB 2HYNA 4H13D 1J1DB 1N86A 4HYTB 2K37A 4C46A 2E42A 2E43A 4D6TJ 2KLVA 3F89A 4RKUJ 1PP9E 1KB9H 2HFED 1SS1A 3P8CD 4HJGH 3N7NA 3AE5C 3FXEA 3H1JE 1OVRA 1S3JA 3L74E 2E5TA 3AE7C 4WY4D 3H1IG 3HTKB 3RK2C 4ZKUA 4EDFA 3Q2YA 1W2BO 3HE4B 1N73A 3ITKA 1BGYE 3V6IA 3Q5RA 1SQVJ 1NTMJ 3L74G 4GODA 4HB1A 1OMIA 3C9IA 4H0LB 3CWBG 1RF0C 3TSIA 3EFGA 3GG2A 3P7KA 3H1HG 3OW2O 2ZJSE 2QM7A 4PV1C 1FJKA 2KNCA 2NPSB 2RN0A 3B8EB 3H1KJ 1IFNA 2FFDC 1KILA 4RESB 1P84E 5KLIB 3UIAA 2HR3A 3FX0A 1SQPK 2IYPA 1USDA 3OAKA 3A5TA 1Q7YQ 3H1KG 4JQ0D 1NKZB 1NVOA 2KS1A 2P2UA 3U1CA 2XV5A 3HRNA 2QJKC 1SQPG 3FGAD 1RF1C 1M1JB 1IFJA 1KB9E 1NAFA 1SQQE 3L74J 1NTMG 2MJZA 4L73A 1L0LD 4UB6H 1ZR4A 3BATA 4OVNF 5B66H 3TNUA 3AE6C 1Q90D 2E5YA 4U7JA 3USSA 1HF9A 3G9RA 3MIWA 4PV1D 4W80A 2V7QJ 3I5CA 1USEA 1NTKD 1FDMA 3CX5H 5AW8B 1HH0A 4XA4A 1L2PA 2FBWC 1WT6A 2K88A 3GLMA 3IR9A 2OTKE 1IK7A 1LWUA 3TYYA 3W67A 1PZQA 2Q5UA 1U7JA 2N1TA 3L71J 5AVZB 3RK2D 4EI2A 2O01N 5KKZC 2OYHA 2K9YA 1SQXG 3CPWO 3CCUP 1HVVA 3H6PA 1L0LE 1NTZJ 1G1IA 1QLED 2N9BA 1LJ2A 3CX5I 2OYHC 1NU1G 3GW6A 5GTIH 3QWOC 3HTKA 1JNMA 1N73B 1XTCC 5AW5B 3H1ID 4W7YA 4YXWH 3G4SP 3HD7B 2FYUE 3SWYA 2QEXP 1NH4A 2IDBA 3RK3D 4U3FG 5TJHA 1H8AA 2ZT9C 2R5DA 2RH0A 1OZHA 2YO3A 1FZBA 1R5LA 4H44C 2QM8A 2J5UA 5APQA 1NKNA 1KFMA 3HUSB 1T2KD 3PH0A 1CI6B 3H32A 2O01J 2E74C 5AW6B 2WSEJ 1PFIA 1KYOE 3PP5A 3LW5J 4IFMA 1VQMP 3CC4P 1P84H 3BRVB 4LLHA 3L70J 3HUSA 4PD4D 1OXZA 4GKGA 2M0BA 3TDKA 3KZIE 1VQPP 1LT9B 1VQ5P 1OVVA 3H1JD 5CJ0A 1KC8Q 1YBKA 1LTJA 1FU1A 1KILC 1MUUA 2M3EA 3O6QA 3IF4A 3MD0A 1R5SA 1P84I 1IZNB 4I6MC 1RH5B 4PJ0H 2IBZI 1PGJA 4N6JA 2L91A 2PGDA 5H2FE 3D70A 2WSFJ 3H1HJ 2LXCB 2ZYGA 1E5WA 2FY8A 1BE3E 2GUSA 2WVRA 3CWBJ 2WSEH 1DEEG 3G3ZA 1SLQA 2FYNC 1KB9I 2I1JA 2QE7H 3B5ND 1EXIA 1SQBJ 2A06D 1SQVG 1X22A 1R8EA 5AW2B 1PV3A 1RE4C 4IL6E 3KHUA 1EDLA 1HUCA 3EWKA 2KLUA 2FXPA 5BU5A 1ZRTD 3CXHH 1Q2NA 1SQPE 2DW3A 1SQQJ 3KZIH 3SFDC 5EFWB 4KHXA 1VQ4P 2KNCB 1HJ0A 1U7MA 2O1JA 2YXRB 2E76C 3H1LD 3G71P 2JEEA 2JDIH 1VF5C 3WMM0 2FYUJ 2WTYA 1URQB 2HODA 3BCCG 4XE5B 5GTHH 3B5NC 1JUNA 2KS1B 2H89C 3CWBE 4U3FE 5CHXA 3D6ZA 1BDCA 2FYUG 4I2LC 2C9NY 3CC2P 4JBZA 5AVYB 4L75A 3P32A 3H1IE 1NU1D 3D6YA 5KJ7A 2JR8A 1L0LG 2E75B 5DJUB 2YNYA 5AVQB 2YMYA 2L5GB 4EOTA 1FDOA 5AW0B 1GU4A 1K8AQ 1X0TA 2E76D 1LP1B 3LIEA 3M0DA 1ZOYC 2AXCA 5AW7B 1L0LK 2CPBA 4D6TE 2A45H 1FJPA 3HD7D 1KYOI 1QGKB 3AEBC 1T8ZA 3L70E 1FC2C 2BEQD 4OGQB 1PGOA 4B86A 4IOIH 1IO4A 1FS0E 2KSJA 4M3LA 2W90A 3SSUA 5E79E 3TGUJ 5KKZB 1NWQA 3LW5H 2WWWA 5AVSB 3WU2E 1KN7A 1JCDA 2JJLA 1EZVE 1LGHB 3KPEA 3RL0C 2N1TC 1XTGB 3AE1C 3L35A 3RK2B 4D6TD 1EDKA 1J1EB 3TK1A 3H25A 1FZCB 1CW5A 1ZN5A 4HH2A 2M5AA 3H1KE 3HD7C 3CCLP 1JOCA 2AEFA 2HLOA 2M3BA 3L4FA 4KT0J 1FZEA 3U1AA 4A7PA 3GHGC 1Y47A 1PL5A 2W6BA 1OWAA 3L70G 3M9QA 4IL6X 4PD4I 4PV1B 4UB8E 1URQA 2W83C 1NTKE 2H8PD 4QMAA 2OYIC 1HBWA 2E74B 3AEGC 2KI7B 1EDIA 2LXBA 3E7KA 4TLFA 4W7ZA 2OYIA 1KMIZ 2N1TD 3VMAA 2W6JH 2RMZA 4U3FJ 5KAIH 1ZLLA 3H1JG 1LT9C 5AW4B 2KSEA 3CD6P 1AV1A 3ABVC 2H7HA 1ZRTE 2GA1A 4H44D 2FXMA 3T97A 1L0NE 3BCCE 1VQOP 1NTZG 3AEEC 1IFMA 5TISE 3W68A 5APXA 2Q7CA 3L71G 5KLVK 3Q1MA 3OA7A 4UB8H 3ZDMA 5L8RJ 1S72P 2PRRA 3PRJA 4DZOA 2XNDH 2IZ0A 2NPSC 1LWUB 1NU1E 4Z1MH 1FDIA 4AQRD 3CCMP 1YIJP 3Q3DA 1KQLA 1SQBE 1PPJE 2G8YA 1EC5A 1SQXE 5M1BA 3RGUA 3WU2H 3D71A 1DD3A 2OYHB 1SQVE 1AVOA 1IJDB 2IYOA 1VQLP 1QEXA 2R3CA 1L4AA 4WBAA 1SQPJ 3E1RA 1L0NJ 1BE3D 2AEJA 3S4RA 1PP9J 1GW3A 1OW6A 2Y9YA 3JC22 1JMBA 2UWJE 4JPZB 1FOSF 1GDTA 2Y0DA 1PGPA 2KIKA 5B5EH 1JM0A 1W5CE 1KZUB 5CCGA 3CMEP 3RK3B 1EZVG 3CL3D 4BRYA 4WY4C 1N8RQ 2RKLA 1CI6A 1NHLA 1Q86Q 1KORA 3B5NA 2IBZD 2YO2A 2BCCD 2V7QH 3GF3A 3Q5SA 3MZWB 3HE5A 3V4WA 1EQ7A 2A45I 2B89A 2XDJA 2K9JB 3V4QA 1KILB 1DH3A 2JWDA 4BXLA 1EXJA 1GL2B 3V2RA 3HE5B 1J2JB 1M1KQ 3AEAC 2YIUB 4D6TG 3RBXA 1NTMK 2B87B 1NTZK 2KP8A 4OGQC 1AFOA 1RE4A 3KYQA 1BCCG 1U57A 4XFJA 1N7SC 5KAFE 5AVRB 2QSIA 1BCCD 1Z56A 3CWBD 1KTMA 3MP7B 4JYBA 1YYCA 1HGZA 3GF7A 1LTBC 2P7JA 2JKVA 2NPSD 3CX5E 1NYHA 5K5GB 1YTZT 4JF7A 1NTKG 1A02J 2QA4P 2IBZG 4CPGA 1FZGA 5AVVB 2WITA 4PD4H 2ZVOB 1CZQA 1MZ9A 4YXDC 3RL0B 2E76B 3E1IA 3L72J 3CCQP 3VP9A 4EIJA 2Y9ZA 1NTMD 1ZW0A 2OYOA 1RY3A 1SQXD 1N7SD 3L75J 1N7LA 2WPVB 4ASVA 5GTIE 2AXTH 3CI9A 3VP8A 1YJ9P 3AE4C 2OYIB 2POHA 4GDOA 1QVFO 1BGYJ 3H1KD 2J59M 2QJYB 3CXHD 3KXDA 4ZNCA 2H43A 1IK9A 2JO1A 2ZAEB 2IPPA 1Q82Q 5CBNA 2Q9IA 1GK4A 1JY3N 1JEKA 4I1LA 1KQSO 4AYCA 2O01H 1M8OB 1IFPA 2XNXA 3NMDA 4GIFA 1RQUA 3I55P 3A0HH 1SVFA 1KYOH 3CMAP 2ZT9D 1SQVD 1YJWP 3L73G 3A0BH 3L73J 1SQBK 2IBZE 1DD4A 1OFCX 3H1HE 2CK3H 2KYVA 1OX3A 1W2EA 3IN6A 1JB0J 2XKMA 3TGUE 2B87A 2WPSA 1SFCB 1LT9A 2FXOA 1J1DC 3V2QA 2YMKA 3BRTB 3T97B 4K35A 1X8YA 1LWUC 1KB9D 1RQVA 1KYOD 1VL2A 3O6QB 2R44A 4PJ0E 3VMXA 5KAFH 1IFDA 3WUVA 5H2FH 1S9KD 2YKPA 1L0NK 2KXPB 2HPCB 2C0XA 5CJ4A 2N1TB 3CCRP 5CMZA 3L75G 5KLVJ 1J1EC 5APVA 1FZCC 1HGVA 1L0LJ 1NTZE 1SQVK 3M0DC 5APSA 3L72G 5AVWB 3TNUB 1QVGO 4BWNA 3P8MC 2V4HA 1ZXGA 1T2KC 2FYZA 1NU1K 2SPZA 4H13C 1NTKJ 1RF1A 3HD7A 2KZJA 1FE6A 4ZKPA 4IFFA 4Y99C 3RBZA 1L4AB 3PHLA 3L71D 3SWKA 1UIIA 2KOGA 4UB6E 3GMAA 2BASA 2I8DA 2MKVA 1MV8A 1M1JC 3VMZA 1FZCA 2D2CB 1SP4A 1T3UA 2I1KA 2WSCJ 2NRGA 2OQQA 3RK3E 5GTHE 2LR2A 1GU5A 1NGMB 4AUWA 1LTSC 1EDJA 3BASA 3I56P 1VF5D 4IL6H 2JP3A 4N78D 3A0BE 2YIUC 3NXSA 3SFEC 1SQBG 3CXHE 1NO4A 4ZMDA 1YI2P 1S2EA 2K9JA 1H88A 4GOFA 1K04A 4C7RA 5KJ7C 2BCCE 5B66E 3JCUH 1N7SB 1GL2A 1KFNA 5DJTB 1LP1A 1UIXA 2KUBA 2Z5IA 2E75D 1OVUA 1QL1A 2ZVNB 1EZVI 3L70D 3L71E 4I7ZB 3AECC 3MTUE 3FWNA 4WY4A 3PLNA 4DOJA 2IX7C 3CCJP 1KV4A 4C7NB 1RE3C 1HWTC 1H0TA 2Q3IA 3K5BA 1L0NG 1GZLA 2E74D 4N78E 3L75E 1LTJC 3MHVA 4H0LC 1X9VA 5KTBA 3M06A 3CCVP 2WPQA 2K1AA 2PFXA 3BCCD 1IFIA 1X79B 1BGYG 5CCGD 1SQPD 2FKWB 1KILD 2WSCH 3VTPC 1BE3J 5KLIC 1G2CB 1PP9D 2Y0EA 1SQXK 1N2DC 1GL2D 1QL2A 2FYUD 2N9YB 3P8CE 4N3YB 3RK3C 3WUUA 1JY2P 1E79H 1T6AA 2C0WA 3F5HA 1M7LA 3CLQA 1AVYA 2ZXEB 1ZMEC 1GW4A 2QJPB 2QJKB 1RE3A 1YTZI 4DT0A 2GM4A 3L73E 4DJGA 1VQ6P 3EQ2A 3AE8C 1K05A 3II6A 4WVZA 2O1KA 5AVXB 3NTNA 1OW7A 1NU1J 4H0LD 1VQ7P 2JWAA 1AQ5A 4YPCA 2R32A 1JCCA 1KILE 1JY3O 1P84D
chains in the Genus database with same CATH topology
1L0NG 3L71G 4PD4H 1SQPG 4U3FG 3H1KG 1NTMG 1SQVG 1L0LG 3L70G 2A06G 1SQQG 5KLVG 1KB9H 1BGYG 1BE3G 3H1IG 3CXHH 3L75G 1P84H 3CX5H 4D6TG 1SQBG 3L74G 3L72G 3CWBG 1BCCG 1PPJG 3H1HG 3H1JG 1SQXG 3BCCG 1KYOH 3H1LG 3TGUG 3L73G 1NTZG 1NU1G 1EZVG 1NTKG 2BCCG 2FYUG 2IBZG 1PP9G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0N G;  3L71 G;  4PD4 H;  1SQP G;  4U3F G;  3H1K G;  1NTM G;  1SQV G;  1L0L G;  3L70 G;  2A06 G;  1SQQ G;  5KLV G;  1KB9 H;  1BGY G;  1BE3 G;  3H1I G;  3CXH H;  3L75 G;  1P84 H;  3CX5 H;  4D6T G;  1SQB G;  3L74 G;  3L72 G;  3CWB G;  1BCC G;  1PPJ G;  3H1H G;  3H1J G;  1SQX G;  3BCC G;  1KYO H;  3H1L G;  3TGU G;  3L73 G;  1NTZ G;  1NU1 G;  1EZV G;  1NTK G;  2BCC G;  2FYU G;  2IBZ G;  1PP9 G; 
#chains in the Genus database with same CATH topology
 2XZR A;  2IFN A;  1NTM E;  2QIW A;  3V5B A;  1JY3 P;  2FYU K;  4OWF A;  2P10 A;  4BRY B;  2Z4E A;  1LTT C;  1MFZ A;  2WSS H;  4K3A A;  1HJB A;  3EFF K;  2QRX A;  1KQG B;  2AEM A;  2B9B A;  3KDP B;  1VQ9 P;  2KZI A;  4NPF X;  3JCU E;  4Y28 J;  1K73 Q;  1Q81 Q;  1BE3 G;  4TT3 H;  5TIS H;  3O8Z A;  3Q5P A;  4LGD E;  1M90 Q;  2B88 A;  4KJM A;  5CCH D;  3A7O A;  4WY4 B;  3TGU D;  2Q3E A;  1M1J A;  3L72 E;  1NJI Q;  3L74 D;  1A02 F;  1JY2 N;  1AQT A;  3V2P A;  2PAJ A;  1RF1 B;  3CXH I;  5AVT B;  2KK7 A;  4RO0 A;  1LTG C;  2HPC A;  3JSV C;  5CCG C;  3L36 A;  3CC7 P;  4H13 B;  1DEB A;  2M5A B;  1S5L E;  2KB7 P;  2W27 A;  1PGQ A;  5KAI E;  3WUT A;  1GL2 C;  3M9B A;  1FOS E;  2O3J A;  1MFT A;  2QJY C;  3H1L E;  1L4A C;  1Y8A A;  1PP9 G;  3CX5 D;  1TU3 F;  1BSN A;  2HG5 D;  4O9B A;  2WMM A;  3S1K A;  3C1L A;  2Z5H A;  3M9H A;  3N4X A;  4RJT A;  5CCH C;  3TF5 A;  1VQN P;  2G3A A;  1NTZ D;  4IFD K;  3M0A A;  2OTL P;  2D2C C;  1RF0 A;  1YQ4 C;  2E75 C;  3R4Y A;  3A3Y B;  1DIP A;  2P58 A;  4U3F D;  2NZ2 A;  1LNQ A;  2M8R A;  3H1I J;  1VDF A;  3MUD C;  5AW1 B;  2NPS A;  1WRG A;  1AJY A;  3AE9 C;  1GK6 A;  5APU A;  2PP6 A;  3VMY A;  1N73 C;  1K9M Q;  3SWF A;  1PIX A;  2LKM A;  2Q1K A;  2WPR A;  2QG4 A;  3L73 D;  3MUD A;  3OJA B;  4WB4 A;  5E79 H;  5KLV E;  4R4L A;  2ZT9 B;  1S5L H;  2IZ1 A;  2ZYD A;  1BDD A;  1VPC A;  5CCH A;  1SFC A;  1NOH A;  2WQY C;  4ASW A;  2FFD B;  1IC2 A;  3TGU G;  1S4X A;  4L76 A;  4I7Z C;  1Y9B A;  3NFQ A;  5AVU B;  1RHZ B;  2OTJ P;  1JTH A;  3H1J J;  4MN4 C;  3VYI A;  2A06 E;  3G6E P;  2FFD A;  1BSH A;  1SQQ K;  2J58 A;  1JY2 O;  1LTJ B;  2YKO A;  4NPE A;  1KQF B;  2R3S A;  3IFM A;  2GUV A;  5KLV D;  3GHG B;  1YHQ P;  1H89 A;  2CPS A;  1G2C A;  2WSF H;  1VF5 B;  1SQQ G;  2ZXX A;  3AE3 C;  3IAO A;  4JYC A;  1URQ C;  4OGQ D;  1NTK K;  5APY A;  5KLV G;  1HTL C;  3H1H D;  1MKM A;  1BCC E;  1T3J A;  3VN0 A;  4Y99 B;  1M56 D;  3GHG A;  4NPD A;  1YQ3 C;  1SQB D;  2BEZ F;  4OH8 B;  3RL0 D;  1VQ8 P;  3FXD A;  2H88 C;  4LC1 A;  1ZV8 A;  2HOD B;  3B71 A;  2QJP C;  5C39 A;  3R2P A;  1L4A D;  3L37 A;  3AE2 C;  3PJS K;  2K3R A;  1JO5 A;  2BCC J;  1ZR2 A;  2C9L Y;  1SQQ D;  3AEF C;  3H1L G;  3CCE P;  3MGN A;  1WMK A;  1OIP A;  2D2C D;  1URQ D;  2QVA A;  4GOE A;  4HKZ H;  4YTP C;  2Q6Q A;  3HE4 A;  3H1L J;  2W6A A;  1FZA A;  2P67 A;  1QX8 A;  2BCC G;  4R4M A;  1L0N D;  2VRS A;  1VQK P;  1FZF A;  1JMM A;  2ZYA A;  5KJ7 D;  1M57 D;  1GD2 E;  5BVZ A;  3BVH A;  2WT7 B;  1YJN P;  2YKQ A;  5APT A;  1KD1 Q;  4PD4 E;  4H44 B;  2YXQ B;  3KQG A;  2A06 G;  3V2N A;  5BU8 B;  2ZFC A;  1ZP0 C;  3HUS C;  3B5N B;  3U59 A;  1AA0 A;  5CBO A;  5AW3 B;  1FAV A;  2IFM A;  2W8Z A;  3AED C;  3LID A;  2WT7 A;  1GTW A;  1EZV D;  1LTI C;  2AXT E;  2R5B A;  4EYY Q;  1SFC D;  3H32 B;  3S9O A;  2ITA A;  1JTH B;  1S1C X;  1LTA C;  3PTZ A;  4C7N A;  1FBM A;  1H0T B;  2OAR A;  1PPJ G;  5APW A;  1DX7 A;  5B5E E;  1G1J A;  3B4S A;  3QH9 A;  5AW9 B;  1S9K E;  1OW8 A;  1PPJ D;  4GT1 A;  1NAY A;  1S5L X;  1LT1 A;  3VOP A;  2XU6 A;  3L72 D;  1CSB A;  1N7S A;  2Y0C A;  3M91 A;  3A0H E;  3BCC J;  3RL0 g;  1SQX J;  1GMJ A;  2OGU A;  3FWL A;  3L75 D;  4L74 A;  4WWI A;  4DCK A;  2WZ7 A;  3CCS P;  1YIT P;  2A45 G;  3A2A A;  1BCC J;  1D7M A;  2P1J A;  1SFC C;  3C8V A;  1BGY D;  2FYN B;  2HYN A;  4H13 D;  1J1D B;  1N86 A;  4HYT B;  2K37 A;  4C46 A;  2E42 A;  2E43 A;  4D6T J;  2KLV A;  3F89 A;  4RKU J;  1PP9 E;  1KB9 H;  2HFE D;  1SS1 A;  3P8C D;  4HJG H;  3N7N A;  3AE5 C;  3FXE A;  3H1J E;  1OVR A;  1S3J A;  3L74 E;  2E5T A;  3AE7 C;  4WY4 D;  3H1I G;  3HTK B;  3RK2 C;  4ZKU A;  4EDF A;  3Q2Y A;  1W2B O;  3HE4 B;  1N73 A;  3ITK A;  1BGY E;  3V6I A;  3Q5R A;  1SQV J;  1NTM J;  3L74 G;  4GOD A;  4HB1 A;  1OMI A;  3C9I A;  4H0L B;  3CWB G;  1RF0 C;  3TSI A;  3EFG A;  3GG2 A;  3P7K A;  3H1H G;  3OW2 O;  2ZJS E;  2QM7 A;  4PV1 C;  1FJK A;  2KNC A;  2NPS B;  2RN0 A;  3B8E B;  3H1K J;  1IFN A;  2FFD C;  1KIL A;  4RES B;  1P84 E;  5KLI B;  3UIA A;  2HR3 A;  3FX0 A;  1SQP K;  2IYP A;  1USD A;  3OAK A;  3A5T A;  1Q7Y Q;  3H1K G;  4JQ0 D;  1NKZ B;  1NVO A;  2KS1 A;  2P2U A;  3U1C A;  2XV5 A;  3HRN A;  2QJK C;  1SQP G;  3FGA D;  1RF1 C;  1M1J B;  1IFJ A;  1KB9 E;  1NAF A;  1SQQ E;  3L74 J;  1NTM G;  2MJZ A;  4L73 A;  1L0L D;  4UB6 H;  1ZR4 A;  3BAT A;  4OVN F;  5B66 H;  3TNU A;  3AE6 C;  1Q90 D;  2E5Y A;  4U7J A;  3USS A;  1HF9 A;  3G9R A;  3MIW A;  4PV1 D;  4W80 A;  2V7Q J;  3I5C A;  1USE A;  1NTK D;  1FDM A;  3CX5 H;  5AW8 B;  1HH0 A;  4XA4 A;  1L2P A;  2FBW C;  1WT6 A;  2K88 A;  3GLM A;  3IR9 A;  2OTK E;  1IK7 A;  1LWU A;  3TYY A;  3W67 A;  1PZQ A;  2Q5U A;  1U7J A;  2N1T A;  3L71 J;  5AVZ B;  3RK2 D;  4EI2 A;  2O01 N;  5KKZ C;  2OYH A;  2K9Y A;  1SQX G;  3CPW O;  3CCU P;  1HVV A;  3H6P A;  1L0L E;  1NTZ J;  1G1I A;  1QLE D;  2N9B A;  1LJ2 A;  3CX5 I;  2OYH C;  1NU1 G;  3GW6 A;  5GTI H;  3QWO C;  3HTK A;  1JNM A;  1N73 B;  1XTC C;  5AW5 B;  3H1I D;  4W7Y A;  4YXW H;  3G4S P;  3HD7 B;  2FYU E;  3SWY A;  2QEX P;  1NH4 A;  2IDB A;  3RK3 D;  4U3F G;  5TJH A;  1H8A A;  2ZT9 C;  2R5D A;  2RH0 A;  1OZH A;  2YO3 A;  1FZB A;  1R5L A;  4H44 C;  2QM8 A;  2J5U A;  5APQ A;  1NKN A;  1KFM A;  3HUS B;  1T2K D;  3PH0 A;  1CI6 B;  3H32 A;  2O01 J;  2E74 C;  5AW6 B;  2WSE J;  1PFI A;  1KYO E;  3PP5 A;  3LW5 J;  4IFM A;  1VQM P;  3CC4 P;  1P84 H;  3BRV B;  4LLH A;  3L70 J;  3HUS A;  4PD4 D;  1OXZ A;  4GKG A;  2M0B A;  3TDK A;  3KZI E;  1VQP P;  1LT9 B;  1VQ5 P;  1OVV A;  3H1J D;  5CJ0 A;  1KC8 Q;  1YBK A;  1LTJ A;  1FU1 A;  1KIL C;  1MUU A;  2M3E A;  3O6Q A;  3IF4 A;  3MD0 A;  1R5S A;  1P84 I;  1IZN B;  4I6M C;  1RH5 B;  4PJ0 H;  2IBZ I;  1PGJ A;  4N6J A;  2L91 A;  2PGD A;  5H2F E;  3D70 A;  2WSF J;  3H1H J;  2LXC B;  2ZYG A;  1E5W A;  2FY8 A;  1BE3 E;  2GUS A;  2WVR A;  3CWB J;  2WSE H;  1DEE G;  3G3Z A;  1SLQ A;  2FYN C;  1KB9 I;  2I1J A;  2QE7 H;  3B5N D;  1EXI A;  1SQB J;  2A06 D;  1SQV G;  1X22 A;  1R8E A;  5AW2 B;  1PV3 A;  1RE4 C;  4IL6 E;  3KHU A;  1EDL A;  1HUC A;  3EWK A;  2KLU A;  2FXP A;  5BU5 A;  1ZRT D;  3CXH H;  1Q2N A;  1SQP E;  2DW3 A;  1SQQ J;  3KZI H;  3SFD C;  5EFW B;  4KHX A;  1VQ4 P;  2KNC B;  1HJ0 A;  1U7M A;  2O1J A;  2YXR B;  2E76 C;  3H1L D;  3G71 P;  2JEE A;  2JDI H;  1VF5 C;  3WMM 0;  2FYU J;  2WTY A;  1URQ B;  2HOD A;  3BCC G;  4XE5 B;  5GTH H;  3B5N C;  1JUN A;  2KS1 B;  2H89 C;  3CWB E;  4U3F E;  5CHX A;  3D6Z A;  1BDC A;  2FYU G;  4I2L C;  2C9N Y;  3CC2 P;  4JBZ A;  5AVY B;  4L75 A;  3P32 A;  3H1I E;  1NU1 D;  3D6Y A;  5KJ7 A;  2JR8 A;  1L0L G;  2E75 B;  5DJU B;  2YNY A;  5AVQ B;  2YMY A;  2L5G B;  4EOT A;  1FDO A;  5AW0 B;  1GU4 A;  1K8A Q;  1X0T A;  2E76 D;  1LP1 B;  3LIE A;  3M0D A;  1ZOY C;  2AXC A;  5AW7 B;  1L0L K;  2CPB A;  4D6T E;  2A45 H;  1FJP A;  3HD7 D;  1KYO I;  1QGK B;  3AEB C;  1T8Z A;  3L70 E;  1FC2 C;  2BEQ D;  4OGQ B;  1PGO A;  4B86 A;  4IOI H;  1IO4 A;  1FS0 E;  2KSJ A;  4M3L A;  2W90 A;  3SSU A;  5E79 E;  3TGU J;  5KKZ B;  1NWQ A;  3LW5 H;  2WWW A;  5AVS B;  3WU2 E;  1KN7 A;  1JCD A;  2JJL A;  1EZV E;  1LGH B;  3KPE A;  3RL0 C;  2N1T C;  1XTG B;  3AE1 C;  3L35 A;  3RK2 B;  4D6T D;  1EDK A;  1J1E B;  3TK1 A;  3H25 A;  1FZC B;  1CW5 A;  1ZN5 A;  4HH2 A;  2M5A A;  3H1K E;  3HD7 C;  3CCL P;  1JOC A;  2AEF A;  2HLO A;  2M3B A;  3L4F A;  4KT0 J;  1FZE A;  3U1A A;  4A7P A;  3GHG C;  1Y47 A;  1PL5 A;  2W6B A;  1OWA A;  3L70 G;  3M9Q A;  4IL6 X;  4PD4 I;  4PV1 B;  4UB8 E;  1URQ A;  2W83 C;  1NTK E;  2H8P D;  4QMA A;  2OYI C;  1HBW A;  2E74 B;  3AEG C;  2KI7 B;  1EDI A;  2LXB A;  3E7K A;  4TLF A;  4W7Z A;  2OYI A;  1KMI Z;  2N1T D;  3VMA A;  2W6J H;  2RMZ A;  4U3F J;  5KAI H;  1ZLL A;  3H1J G;  1LT9 C;  5AW4 B;  2KSE A;  3CD6 P;  1AV1 A;  3ABV C;  2H7H A;  1ZRT E;  2GA1 A;  4H44 D;  2FXM A;  3T97 A;  1L0N E;  3BCC E;  1VQO P;  1NTZ G;  3AEE C;  1IFM A;  5TIS E;  3W68 A;  5APX A;  2Q7C A;  3L71 G;  5KLV K;  3Q1M A;  3OA7 A;  4UB8 H;  3ZDM A;  5L8R J;  1S72 P;  2PRR A;  3PRJ A;  4DZO A;  2XND H;  2IZ0 A;  2NPS C;  1LWU B;  1NU1 E;  4Z1M H;  1FDI A;  4AQR D;  3CCM P;  1YIJ P;  3Q3D A;  1KQL A;  1SQB E;  1PPJ E;  2G8Y A;  1EC5 A;  1SQX E;  5M1B A;  3RGU A;  3WU2 H;  3D71 A;  1DD3 A;  2OYH B;  1SQV E;  1AVO A;  1IJD B;  2IYO A;  1VQL P;  1QEX A;  2R3C A;  1L4A A;  4WBA A;  1SQP J;  3E1R A;  1L0N J;  1BE3 D;  2AEJ A;  3S4R A;  1PP9 J;  1GW3 A;  1OW6 A;  2Y9Y A;  3JC2 2;  1JMB A;  2UWJ E;  4JPZ B;  1FOS F;  1GDT A;  2Y0D A;  1PGP A;  2KIK A;  5B5E H;  1JM0 A;  1W5C E;  1KZU B;  5CCG A;  3CME P;  3RK3 B;  1EZV G;  3CL3 D;  4BRY A;  4WY4 C;  1N8R Q;  2RKL A;  1CI6 A;  1NHL A;  1Q86 Q;  1KOR A;  3B5N A;  2IBZ D;  2YO2 A;  2BCC D;  2V7Q H;  3GF3 A;  3Q5S A;  3MZW B;  3HE5 A;  3V4W A;  1EQ7 A;  2A45 I;  2B89 A;  2XDJ A;  2K9J B;  3V4Q A;  1KIL B;  1DH3 A;  2JWD A;  4BXL A;  1EXJ A;  1GL2 B;  3V2R A;  3HE5 B;  1J2J B;  1M1K Q;  3AEA C;  2YIU B;  4D6T G;  3RBX A;  1NTM K;  2B87 B;  1NTZ K;  2KP8 A;  4OGQ C;  1AFO A;  1RE4 A;  3KYQ A;  1BCC G;  1U57 A;  4XFJ A;  1N7S C;  5KAF E;  5AVR B;  2QSI A;  1BCC D;  1Z56 A;  3CWB D;  1KTM A;  3MP7 B;  4JYB A;  1YYC A;  1HGZ A;  3GF7 A;  1LTB C;  2P7J A;  2JKV A;  2NPS D;  3CX5 E;  1NYH A;  5K5G B;  1YTZ T;  4JF7 A;  1NTK G;  1A02 J;  2QA4 P;  2IBZ G;  4CPG A;  1FZG A;  5AVV B;  2WIT A;  4PD4 H;  2ZVO B;  1CZQ A;  1MZ9 A;  4YXD C;  3RL0 B;  2E76 B;  3E1I A;  3L72 J;  3CCQ P;  3VP9 A;  4EIJ A;  2Y9Z A;  1NTM D;  1ZW0 A;  2OYO A;  1RY3 A;  1SQX D;  1N7S D;  3L75 J;  1N7L A;  2WPV B;  4ASV A;  5GTI E;  2AXT H;  3CI9 A;  3VP8 A;  1YJ9 P;  3AE4 C;  2OYI B;  2POH A;  4GDO A;  1QVF O;  1BGY J;  3H1K D;  2J59 M;  2QJY B;  3CXH D;  3KXD A;  4ZNC A;  2H43 A;  1IK9 A;  2JO1 A;  2ZAE B;  2IPP A;  1Q82 Q;  5CBN A;  2Q9I A;  1GK4 A;  1JY3 N;  1JEK A;  4I1L A;  1KQS O;  4AYC A;  2O01 H;  1M8O B;  1IFP A;  2XNX A;  3NMD A;  4GIF A;  1RQU A;  3I55 P;  3A0H H;  1SVF A;  1KYO H;  3CMA P;  2ZT9 D;  1SQV D;  1YJW P;  3L73 G;  3A0B H;  3L73 J;  1SQB K;  2IBZ E;  1DD4 A;  1OFC X;  3H1H E;  2CK3 H;  2KYV A;  1OX3 A;  1W2E A;  3IN6 A;  1JB0 J;  2XKM A;  3TGU E;  2B87 A;  2WPS A;  1SFC B;  1LT9 A;  2FXO A;  1J1D C;  3V2Q A;  2YMK A;  3BRT B;  3T97 B;  4K35 A;  1X8Y A;  1LWU C;  1KB9 D;  1RQV A;  1KYO D;  1VL2 A;  3O6Q B;  2R44 A;  4PJ0 E;  3VMX A;  5KAF H;  1IFD A;  3WUV A;  5H2F H;  1S9K D;  2YKP A;  1L0N K;  2KXP B;  2HPC B;  2C0X A;  5CJ4 A;  2N1T B;  3CCR P;  5CMZ A;  3L75 G;  5KLV J;  1J1E C;  5APV A;  1FZC C;  1HGV A;  1L0L J;  1NTZ E;  1SQV K;  3M0D C;  5APS A;  3L72 G;  5AVW B;  3TNU B;  1QVG O;  4BWN A;  3P8M C;  2V4H A;  1ZXG A;  1T2K C;  2FYZ A;  1NU1 K;  2SPZ A;  4H13 C;  1NTK J;  1RF1 A;  3HD7 A;  2KZJ A;  1FE6 A;  4ZKP A;  4IFF A;  4Y99 C;  3RBZ A;  1L4A B;  3PHL A;  3L71 D;  3SWK A;  1UII A;  2KOG A;  4UB6 E;  3GMA A;  2BAS A;  2I8D A;  2MKV A;  1MV8 A;  1M1J C;  3VMZ A;  1FZC A;  2D2C B;  1SP4 A;  1T3U A;  2I1K A;  2WSC J;  2NRG A;  2OQQ A;  3RK3 E;  5GTH E;  2LR2 A;  1GU5 A;  1NGM B;  4AUW A;  1LTS C;  1EDJ A;  3BAS A;  3I56 P;  1VF5 D;  4IL6 H;  2JP3 A;  4N78 D;  3A0B E;  2YIU C;  3NXS A;  3SFE C;  1SQB G;  3CXH E;  1NO4 A;  4ZMD A;  1YI2 P;  1S2E A;  2K9J A;  1H88 A;  4GOF A;  1K04 A;  4C7R A;  5KJ7 C;  2BCC E;  5B66 E;  3JCU H;  1N7S B;  1GL2 A;  1KFN A;  5DJT B;  1LP1 A;  1UIX A;  2KUB A;  2Z5I A;  2E75 D;  1OVU A;  1QL1 A;  2ZVN B;  1EZV I;  3L70 D;  3L71 E;  4I7Z B;  3AEC C;  3MTU E;  3FWN A;  4WY4 A;  3PLN A;  4DOJ A;  2IX7 C;  3CCJ P;  1KV4 A;  4C7N B;  1RE3 C;  1HWT C;  1H0T A;  2Q3I A;  3K5B A;  1L0N G;  1GZL A;  2E74 D;  4N78 E;  3L75 E;  1LTJ C;  3MHV A;  4H0L C;  1X9V A;  5KTB A;  3M06 A;  3CCV P;  2WPQ A;  2K1A A;  2PFX A;  3BCC D;  1IFI A;  1X79 B;  1BGY G;  5CCG D;  1SQP D;  2FKW B;  1KIL D;  2WSC H;  3VTP C;  1BE3 J;  5KLI C;  1G2C B;  1PP9 D;  2Y0E A;  1SQX K;  1N2D C;  1GL2 D;  1QL2 A;  2FYU D;  2N9Y B;  3P8C E;  4N3Y B;  3RK3 C;  3WUU A;  1JY2 P;  1E79 H;  1T6A A;  2C0W A;  3F5H A;  1M7L A;  3CLQ A;  1AVY A;  2ZXE B;  1ZME C;  1GW4 A;  2QJP B;  2QJK B;  1RE3 A;  1YTZ I;  4DT0 A;  2GM4 A;  3L73 E;  4DJG A;  1VQ6 P;  3EQ2 A;  3AE8 C;  1K05 A;  3II6 A;  4WVZ A;  2O1K A;  5AVX B;  3NTN A;  1OW7 A;  1NU1 J;  4H0L D;  1VQ7 P;  2JWA A;  1AQ5 A;  4YPC A;  2R32 A;  1JCC A;  1KIL E;  1JY3 O;  1P84 D; 
#chains in the Genus database with same CATH homology
 1L0N G;  3L71 G;  4PD4 H;  1SQP G;  4U3F G;  3H1K G;  1NTM G;  1SQV G;  1L0L G;  3L70 G;  2A06 G;  1SQQ G;  5KLV G;  1KB9 H;  1BGY G;  1BE3 G;  3H1I G;  3CXH H;  3L75 G;  1P84 H;  3CX5 H;  4D6T G;  1SQB G;  3L74 G;  3L72 G;  3CWB G;  1BCC G;  1PPJ G;  3H1H G;  3H1J G;  1SQX G;  3BCC G;  1KYO H;  3H1L G;  3TGU G;  3L73 G;  1NTZ G;  1NU1 G;  1EZV G;  1NTK G;  2BCC G;  2FYU G;  2IBZ G;  1PP9 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...