2WPVB

Crystal structure of s. cerevisiae get4-get5 complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
48
structure length
48
Chain Sequence
GPEHEFVSKFLTLATLTEPKLPKSYTKPLKDVTNLGVPLPTLKYKYKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0363 PROTEIN YOR164C
publication title Crystal Structure of Get4-Get5 Complex and its Interactions with Sgt2, Get3, and Ydj1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 7
structure length 48
sequence length 48
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2009-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2wpvB01
4H13B 1S5LX 4RKUJ 2D2CB 2K9YA 2QJYC 4I7ZB 4Y28J 1ZRTE 5L8RJ 1JB0J 4IL6X 5KKZC 4H44B 1Q90D 3LW5J 2E74B 3C8VA 2WPVB 4OGQB 2WSCJ 2QJPC 2E75B 2QJKC 2FYNC 2WSEJ 2WSFJ 5KLIC 2QIWA 4H0LB 2QSIA 2E76B 1VF5B 4KT0J 2ZT9B 4PV1B 2YIUC 2O01J
chains in the Genus database with same CATH superfamily
1L4AD 5GTIH 1CI6B 2KLVA 1SQQE 5KAFH 3D71A 2E74B 3M9HA 2KP8A 3L75J 5AW6B 2OYIB 5DJUB 2WT7B 3L71D 1PGPA 2P2UA 2Y0EA 3AE3C 2JDIH 5CCHA 5KLIB 1LT9B 1NTZG 2BCCJ 3L71G 1JY3P 1NTKD 2AXTE 1RF0A 5E79H 3LW5J 1IZNB 3U1AA 3G6EP 4IL6H 5KJ7A 5C39A 2NPSA 2FXOA 2YKQA 4WY4A 1JY3N 1NYHA 4N78E 5GTHH 3SWFA 4DZOA 4DJGA 2E74C 1QL1A 1ZW0A 1OIPA 2OYIC 4H44B 1GU4A 4YXWH 4XA4A 2Q1KA 2W27A 5KLIC 1H88A 1LT9C 3BATA 3L73J 5KLVE 1FDIA 3RK3E 1PP9D 4I2LC 3H32A 2GUSA 3WU2H 2QM7A 2QJYB 1HBWA 1L0NE 1PP9G 1PGQA 1SQPE 5AVXB 1FC2C 3AE6C 5CMZA 1H89A 2C0XA 2W6AA 4H44C 1EZVI 4UB8E 3VP8A 1GL2A 3CWBE 2AXTH 1LGHB 1SQQK 1SQBD 1N86A 2R44A 1RE3A 4YTPC 1ZLLA 1UIXA 3T97B 3L36A 3HUSB 2QJYC 5KTBA 3CD6P 3V2RA 1RE4A 3TSIA 2IBZI 2E75B 1YTZT 4L75A 4U3FD 1NU1G 3IAOA 1K73Q 2KZIA 1HGZA 5EFWB 3CC7P 2W6BA 4R4MA 5CBNA 2D2CD 1GD2E 3AEFC 2I8DA 4DCKA 1OZHA 1P84E 3S9OA 1NKZB 5CCGC 2POHA 3V5BA 3GF3A 4GDOA 3CCSP 5KLVK 2BEQD 4RKUJ 2P58A 1AV1A 2E75C 1USEA 3CPWO 3PLNA 4UB8H 1Y9BA 4IOIH 1SQPJ 2Z4EA 3H1ID 1URQD 3M91A 3PP5A 3BASA 4PD4H 1L0NK 1P84I 2WPSA 3TNUB 1FOSF 1S72P 2Q3EA 2KS1B 1QEXA 2PRRA 4JF7A 3CWBJ 2KSJA 1OMIA 3L75G 3L37A 1VQ6P 1WT6A 3SFDC 1QVFO 2OYHA 3HUSA 2RH0A 2J58A 2BCCG 2HYNA 3H1KE 1SFCB 2FBWC 1YJ9P 1KYOE 4OVNF 1NTMD 1HUCA 4L73A 2XNDH 4TLFA 3L74D 3CMEP 1PGOA 1HWTC 3OAKA 1T2KC 1IK9A 1L4AA 5AVUB 3B5ND 3L74G 1D7MA 1PGJA 2M3BA 2IPPA 4KJMA 2KI7B 3FGAD 1IFJA 2M0BA 1NTZE 1IFMA 3L71E 3L73G 2KZJA 1SFCC 1KFMA 2M5AA 1RF1B 5B66E 1FU1A 4H13D 2BEZF 2ZXEB 3U1CA 1KORA 2RKLA 2IYOA 3A3YB 1FDOA 4I1LA 3ITKA 4HYTB 1R5SA 3TYYA 1GW3A 3SFEC 4O9BA 3H1HG 2A45I 3JSVC 3L70D 3QH9A 3TGUD 4Z1MH 3GW6A 3CCRP 2OARA 2LXCB 2WMMA 1ZRTD 3L70G 1KYOH 4ZKUA 3W68A 3AE1C 3BCCJ 1DH3A 1RF1C 1WRGA 1LTTC 1BSNA 3H1KJ 3E1RA 1PP9E 2JWDA 1L2PA 2DW3A 3H1LD 3KXDA 1PIXA 1LWUA 1JY2P 1URQB 1S3JA 3M0DA 4DT0A 1JY2N 1JTHA 2Y0CA 5B66H 1VQOP 5TJHA 3B8EB 1NTZJ 3L71J 1LTBC 1NTZK 2IZ0A 3CX5E 4NPEA 3VMAA 1VPCA 5CHXA 1EZVD 3WUVA 5AW1B 5AVYB 2FYZA 1NU1E 4ASVA 3A5TA 2IDBA 2E74D 3KHUA 1URQC 3RL0B 1FS0E 1G1IA 2YKOA 2KNCB 3AE4C 1SQXD 1LTAC 2LKMA 4YXDC 2IYPA 4ZNCA 3HE4A 2R3SA 3EFGA 2XKMA 2IBZD 3AECC 1KB9I 1NWQA 3GLMA 3MUDA 2KSEA 3RBXA 2R5DA 3H6PA 4D6TD 2E76D 1VQ9P 2YXQB 1L0LG 1J2JB 1VF5B 2QEXP 1RH5B 1PP9J 2JEEA 3K5BA 3RL0C 3L4FA 4H13B 2WQYC 1VQLP 4EDFA 3H1JG 2P7JA 2WZ7A 2FYUD 3HE5A 1NOHA 3L75E 3UIAA 1ZN5A 1BGYD 3AEEC 3TDKA 2WSFH 3IR9A 1YIJP 3HTKB 3AEDC 1YYCA 1VDFA 4C46A 4RJTA 2W83C 2BCCE 4GIFA 5AVWB 1LP1A 1VF5C 4H0LD 3V2NA 2WSFJ 3CXHI 1K8AQ 1DD4A 1Q81Q 4H13C 1M1JB 1NU1J 4MN4C 3EFFK 1NU1K 3RK2C 2NZ2A 1G2CA 2JJLA 2LR2A 2HFED 3B5NA 1KQGB 4BRYA 3ABVC 5CCGD 1GW4A 3QWOC 2KIKA 3L73E 1T3UA 1JM0A 4HB1A 3BCCG 2ZVNB 1U57A 4GOEA 2KYVA 1X8YA 2I1KA 1M1JC 3VMZA 2ZJSE 2AEFA 2QSIA 2WTYA 1S9KE 3MIWA 1K05A 3KDPB 3H1HE 1BE3D 1S5LX 2JKVA 5BU5A 3H1IJ 3M9BA 2Z5HA 3WU2E 1QX8A 2V4HA 1YI2P 5AW7B 3CCQP 1N8RQ 2HPCB 4C7NB 3HTKA 5APUA 3IFMA 4LC1A 1PPJD 3L70E 1Q82Q 3LW5H 1HGVA 1N73C 2K3RA 3VMYA 1FZGA 1SQVD 1PPJG 1M1KQ 3G4SP 3GHGB 1SVFA 4IFMA 3M06A 2IX7C 1NTKG 3CCJP 1RY3A 2E76B 3L72D 1EC5A 3OJAB 1T2KD 1VQ5P 3HD7D 1FJKA 3L74J 1NH4A 2C0WA 2O01H 3GG2A 2ZXXA 4XE5B 4AUWA 4QMAA 1SFCD 2O01J 1RQVA 3CL3D 1JY3O 1FBMA 2Y9YA 3GHGC 1JUNA 2E76C 1ZXGA 2YKPA 1BCCD 1ZOYC 4H0LB 1Y47A 3I56P 3H1HJ 1CI6A 2WSCH 1KC8Q 1A02J 2IFMA 2HPCA 1WMKA 1AVYA 2OYIA 1T6AA 1LNQA 2J59M 2M3EA 2WT7A 2B9BA 2B88A 2WSCJ 2H88C 1LT9A 3AE9C 3L70J 2K1AA 4PD4E 3TGUJ 3CC2P 2K88A 3NFQA 4W80A 3P8CE 1SQBG 5BU8B 3RL0g 3V4WA 1JEKA 1L0LE 5AVTB 3D70A 4H0LC 1OVVA 1MZ9A 3RGUA 4IFDK 1YTZI 3NTNA 3CMAP 4JPZB 4L74A 1E5WA 2YMYA 3H1JE 3CCMP 5M1BA 1EDKA 1H0TB 1KB9D 1KZUB 1KD1Q 4U3FG 4ZKPA 1N2DC 1G1JA 3I5CA 1YBKA 4I7ZB 2AEMA 4EYYQ 2AXCA 3JCUE 3V2PA 3N4XA 4W7ZA 3M0AA 3EQ2A 4PV1D 1DX7A 2WPQA 1J1EB 2OQQA 3KPEA 2PGDA 1ZR4A 2E43A 1KILD 5AW4B 4U7JA 3MTUE 2L91A 2RMZA 3PJSK 1SP4A 4I7ZC 3ZDMA 1SQPK 3H1IG 1KQFB 3CXHD 1GK4A 4Y28J 2XZRA 3HD7B 1M56D 1CZQA 4HJGH 4B86A 5CCGA 2HG5D 1J1EC 3T97A 3GF7A 1AJYA 4Y99B 2A06D 3BCCE 2QJPB 4AYCA 1S4XA 1L0LJ 3OA7A 1JCDA 3B71A 1R5LA 2KOGA 2O3JA 1L0LK 3RL0D 2KUBA 1Q90D 2PAJA 1SLQA 1H0TA 1LT1A 4OGQB 1NJIQ 1Y8AA 3H1JJ 5APVA 3JCUH 1EDIA 2SPZA 1QVGO 4KHXA 3P8MC 1OVRA 1OXZA 1NTMG 5AW5B 3RBZA 3HD7C 3AEGC 5K5GB 1VQ4P 1NAFA 1USDA 1S5LH 3O6QB 1LTJB 4Y99C 2QJPC 4OH8B 1PPJE 1KYOI 3IN6A 1VF5D 3MGNA 1Z56A 2K9JB 1NGMB 1GZLA 1Q86Q 1NTKE 3V6IA 4OGQC 2J5UA 3RK2D 1FE6A 3TNUA 1IC2A 2XU6A 2KS1A 3VMXA 1FZCB 4N6JA 1X22A 3A2AA 4I6MC 2OGUA 1GU5A 3MHVA 1LTJC 1Q2NA 1Q7YQ 2KXPB 3PRJA 3E1IA 2HODB 1SQQD 3TGUG 2LXBA 1SFCA 4HH2A 3WUTA 1KN7A 1YHQP 4PV1B 3KQGA 2YIUB 4IL6X 2ZAEB 3G9RA 1FZCC 3CC4P 5AVSB 1NHLA 2IFNA 3H1LG 3R4YA 1KILB 5KJ7D 5H2FE 1BE3J 1K04A 4WY4D 4N78D 2Q7CA 2PP6A 5B5EH 2QM8A 1W2EA 1JB0J 1M7LA 2R5BA 2QE7H 5APQA 3CCEP 1SQBE 1FZBA 1KFNA 3A7OA 1RF1A 2YO3A 4PV1C 1FAVA 1HVVA 2IZ1A 1SQVJ 4BWNA 1MFTA 1NTKJ 2YXRB 5AW9B 4LGDE 5KLVD 2YIUC 3S1KA 2ZYAA 3Q5RA 1EZVG 1NTKK 3RK3D 1VQ8P 1KILC 1JY2O 1GTWA 2JP3A 4U3FE 1AA0A 5KKZB 1L0ND 2Q9IA 2ZT9D 1MKMA 2I1JA 5AVQB 3CX5I 3PTZA 1SQXG 1ZMEC 4HKZH 3CWBD 1X79B 2IBZG 2PFXA 1HTLC 1PZQA 1OWAA 3H25A 5H2FH 1ZP0C 4D6TG 1OFCX 3KYQA 3C9IA 1IK7A 1BCCJ 1KILA 3IF4A 1URQA 5KKZC 5AW2B 1AQTA 3H1IE 3RK2B 5AVRB 5CBOA 2CPBA 2FYUG 1OW6A 2N1TB 3MD0A 1M57D 5TISE 1FOSE 1SQBJ 1BGYG 3TF5A 1P84D 1SQBK 1R8EA 2W8ZA 2OYOA 2WSSH 1GK6A 2Y9ZA 2KNCA 1VQ7P 4U3FJ 1NTME 2WITA 2WPVB 1MFZA 3L74E 1YQ4C 3GMAA 1IFDA 2ITAA 5BVZA 2N1TC 2R32A 2P1JA 2N9YB 3VP9A 2Q5UA 2QA4P 2NPSB 4WY4B 1AFOA 1KTMA 2XDJA 2K9YA 4OWFA 1N73B 2OTKE 3FXEA 2FFDB 3H1KD 2WPRA 3F89A 5TISH 3U59A 1RF0C 3USSA 1FJPA 3RK3B 4EI2A 5KJ7C 3SSUA 1BE3G 2NPSC 4WY4C 3H32B 2FXMA 3TGUE 1VQPP 2ZT9B 2XV5A 3EWKA 1K9MQ 4A7PA 3Q2YA 3Q5SA 1ZRTE 3L35A 3FWLA 2FFDC 1M1JA 1NTZD 3D6YA 1SQVG 4XFJA 3A0HE 1GL2B 2QIWA 1OVUA 4W7YA 1VQNP 2UWJE 2A45G 1EXIA 1OW7A 3H1LE 3LIDA 3RK3C 1NTMJ 3CCLP 3L72G 1BDCA 2CK3H 1S2EA 2W90A 2N9BA 2ZYGA 3MP7B 2JR8A 4CPGA 1GDTA 1NTMK 2ZT9C 1DEEG 4NPFX 1AQ5A 1N73A 2ZVOB 1GMJA 2GA1A 5KAIE 2FFDA 4WWIA 1GL2C 1T8ZA 1XTCC 2FY8A 4OGQD 1EZVE 1KQSO 1HJBA 1LJ2A 3F5HA 4L76A 1U7MA 1RE3C 1BCCG 2G8YA 2VRSA 4C7NA 4ASWA 2H7HA 2YNYA 1RE4C 3AE2C 5AW8B 4M3LA 1SQXE 2XNXA 1QLED 3A0HH 1J1DB 1JCCA 2E5TA 2IBZE 1SQQJ 3GHGA 1ZR2A 3Q5PA 1FZAA 4D6TE 3FWNA 1FDMA 3CX5D 2GM4A 4PJ0E 2V7QH 3H1LJ 4N3YB 4YPCA 2AEJA 4PD4I 4K35A 2OYHB 4GODA 1NU1D 2KB7P 3BRVB 5KAIH 1XTGB 2FYUE 2H8PD 4JYBA 1QL2A 2V7QJ 2G3AA 1BDDA 2O01N 1J1DC 3N7NA 1BGYE 2QVAA 2E42A 3II6A 4AQRD 1LTSC 1KMIZ 1S5LE 4C7RA 4WB4A 3AEAC 1L4AB 5APYA 4LLHA 1X0TA 1OW8A 5KLVJ 4RESB 1YITP 2OYHC 1UIIA 3HUSC 3R2PA 2Q3IA 4R4LA 1RQUA 1N7SD 2M5AB 3O8ZA 1L0NJ 1SQXJ 5APXA 2KK7A 3Q3DA 2B87B 3BRTB 1SQXK 3NXSA 3L75D 4K3AA 4PJ0H 2JO1A 1L4AC 2A06G 4D6TJ 1EXJA 2BCCD 2JWAA 4JQ0D 3FXDA 2Z5IA 2L5GB 1EDLA 1PV3A 1BE3E 3BVHA 2C9LY 2FYUJ 3MZWB 4BXLA 3W67A 1U7JA 3C8VA 2FYUK 1BGYJ 1FZFA 1P84H 1JNMA 1DD3A 1NKNA 5B5EE 2CPSA 1LWUB 3VTPC 1NVOA 3WUUA 1SQVE 2W6JH 2RN0A 3L73D 1EDJA 4UB6E 4WVZA 1KQLA 2P67A 1JTHB 5DJTB 3L72E 1IJDB 1S9KD 2N1TD 3HD7A 1A02F 1NAYA 5APSA 3H1HD 2B87A 2E5YA 2YMKA 5AVZB 1LTGC 1LWUC 1H8AA 4GT1A 3A0BE 1DEBA 3AE8C 1IFPA 1LTIC 1FZEA 1SQQG 3AE7C 3OW2O 1YJNP 3M0DC 1HH0A 3PH0A 2D2CB 2ZFCA 5CCHD 2Y0DA 3HE4B 2FKWB 1BSHA 1BCCE 2QG4A 1HJ0A 2FXPA 2NPSD 2FYNB 3VN0A 3O6QA 3E7KA 1LTJA 3B4SA 2MKVA 1N7SB 2M8RA 3M9QA 2A45H 4UB6H 2K9JA 1IFNA 1VQMP 1OX3A 2C9NY 2D2CC 1IO4A 2HLOA 3HE5B 2P10A 4WBAA 3JC22 5CJ0A 4JYCA 1SQVK 1T3JA 1FZCA 5APTA 1S1CX 4ZMDA 5KLVG 3L72J 3TK1A 1X9VA 2Q6QA 2FYNC 1CSBA 3MUDC 1PL5A 1KB9E 3G71P 3A0BH 1SQPD 1LP1B 2O1KA 3KZIE 4GOFA 2WSEH 3Q1MA 3VOPA 1KV4A 3CI9A 2HODA 1N7SC 1RHZB 1N7LA 1L0NG 3CLQA 1VQKP 3V4QA 1SQPG 1MV8A 1M8OB 1JMBA 3PHLA 4NPDA 1GL2D 3S4RA 1IFIA 2WSEJ 3SWYA 4PD4D 2H89C 2BASA 1G2CB 1AVOA 3SWKA 5CJ4A 3CWBG 4TT3H 3B5NB 5AW0B 3P8CD 4BRYB 1L0LD 3C1LA 1KILE 1SS1A 1W5CE 1YJWP 1QGKB 4GKGA 4EIJA 3H1JD 1N7SA 1MUUA 4IFFA 2MJZA 1M90Q 3V2QA 1HF9A 3FX0A 2OTJP 3CXHE 4H44D 5L8RJ 2QRXA 2H43A 2NRGA 1DIPA 1JMMA 5AW3B 1PFIA 3VYIA 2HR3A 2A06E 3B5NC 3CX5H 3G3ZA 3CCVP 3HRNA 3D6ZA 1KB9H 5GTIE 3I55P 4EOTA 3KZIH 1EQ7A 5KAFE 1YQ3C 1JO5A 2OTLP 1NO4A 2O1JA 2K37A 2QJKB 4JBZA 3AEBC 3P32A 5E79E 2ZYDA 4IL6E 2YO2A 1TU3F 1W2BO 5GTHE 1E79H 3AE5C 3LIEA 3BCCD 5CCHC 2R3CA 1JOCA 5APWA 3CXHH 4RO0A 2B89A 1KYOD 2GUVA 2E75D 2QJKC 3H1KG 3P7KA 2N1TA 1VL2A 4DOJA 3CCUP 3WMM0 1CW5A 2KLUA 2WVRA 4KT0J 2WWWA 5AVVB 1ZV8A 3NMDA
chains in the Genus database with same CATH topology
4Z1MH 3AECC 4OGQC 4H44D 3Q5RA 5L8RJ 1OMIA 2MKVA 2J5UA 3D71A 2E74B 1U57A 3C8VA 2V7QJ 2E76C 2WPVB 2G3AA 3GLMA 2JP3A 3AE1C 1YQ4C 3SFDC 1DIPA 2E76D 4U7JA 1ZOYC 3GMAA 2ZT9C 4H0LB 1DD3A 2QSIA 1VF5B 2ZT9D 3AE3C 2D2CC 1K05A 1KMIZ 4I7ZC 4YTPC 1GMJA 1MKMA 3D6ZA 2P10A 2FBWC 1UIXA 3T97B 4H13B 1S5LX 1KQFB 1WMKA 2WQYC 1KTMA 2QJYC 2K9YA 4Y28J 1ZMEC 3AEAC 1YQ3C 1S1CX 3LW5J 4OGQD 1PIXA 2WSCJ 2E75B 2FYNC 1OW8A 2H88C 3AE9C 1NYHA 1PL5A 3IAOA 3GF7A 1AJYA 3AEEC 3H25A 1ZP0C 4R4LA 3AEBC 4PV1B 3Q1MA 1RQUA 4R4MA 2G8YA 3AEDC 3RL0g 2E74C 2D2CD 3AEFC 3B71A 2YMKA 1IK7A 3FGAD 4IL6X 5KKZC 4H44B 1Q90D 3D70A 4H0LC 3G9RA 3S9OA 4OGQB 1TU3F 1VF5C 3Q3DA 4H0LD 3AE2C 2WSEJ 2WSFJ 3R4YA 5KLIC 1DD4A 3AE8C 2E76B 3AE5C 2H89C 1K04A 4H13C 5M1BA 3GF3A 3AE7C 4GDOA 4TT3H 1OW6A 2JO1A 2ZT9B 1FDIA 2BEZF 4H13D 3AEGC 3EWKA 2BEQD 1KORA 3Q2YA 3Q5SA 4RKUJ 2D2CB 3RK3E 4I7ZB 1FDOA 1ZRTE 2E75C 1JB0J 2IDBA 2E74D 1EXJA 2NZ2A 2E75D 3Q5PA 1Y9BA 1KILE 2QJPC 2QJKC 3SFEC 3D6YA 4XFJA 1VL2A 2QIWA 3AE4C 3IN6A 4PV1C 1HJ0A 1VF5D 1KQGB 2FXPA 3AE6C 1EXIA 3ABVC 4PV1D 4YXDC 1OW7A 1R8EA 1PV3A 4KT0J 3O6QA 1NGMB 2YIUC 1HF9A 2O01J 1RQVA 4H44C 2OQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H13 B;  1S5L X;  4RKU J;  2D2C B;  2K9Y A;  2QJY C;  4I7Z B;  4Y28 J;  1ZRT E;  5L8R J;  1JB0 J;  4IL6 X;  5KKZ C;  4H44 B;  1Q90 D;  3LW5 J;  2E74 B;  3C8V A;  2WPV B;  4OGQ B;  2WSC J;  2QJP C;  2E75 B;  2QJK C;  2FYN C;  2WSE J;  2WSF J;  5KLI C;  2QIW A;  4H0L B;  2QSI A;  2E76 B;  1VF5 B;  4KT0 J;  2ZT9 B;  4PV1 B;  2YIU C;  2O01 J; 
#chains in the Genus database with same CATH topology
 1L4A D;  5GTI H;  1CI6 B;  2KLV A;  1SQQ E;  5KAF H;  3D71 A;  2E74 B;  3M9H A;  2KP8 A;  3L75 J;  5AW6 B;  2OYI B;  5DJU B;  2WT7 B;  3L71 D;  1PGP A;  2P2U A;  2Y0E A;  3AE3 C;  2JDI H;  5CCH A;  5KLI B;  1LT9 B;  1NTZ G;  2BCC J;  3L71 G;  1JY3 P;  1NTK D;  2AXT E;  1RF0 A;  5E79 H;  3LW5 J;  1IZN B;  3U1A A;  3G6E P;  4IL6 H;  5KJ7 A;  5C39 A;  2NPS A;  2FXO A;  2YKQ A;  4WY4 A;  1JY3 N;  1NYH A;  4N78 E;  5GTH H;  3SWF A;  4DZO A;  4DJG A;  2E74 C;  1QL1 A;  1ZW0 A;  1OIP A;  2OYI C;  4H44 B;  1GU4 A;  4YXW H;  4XA4 A;  2Q1K A;  2W27 A;  5KLI C;  1H88 A;  1LT9 C;  3BAT A;  3L73 J;  5KLV E;  1FDI A;  3RK3 E;  1PP9 D;  4I2L C;  3H32 A;  2GUS A;  3WU2 H;  2QM7 A;  2QJY B;  1HBW A;  1L0N E;  1PP9 G;  1PGQ A;  1SQP E;  5AVX B;  1FC2 C;  3AE6 C;  5CMZ A;  1H89 A;  2C0X A;  2W6A A;  4H44 C;  1EZV I;  4UB8 E;  3VP8 A;  1GL2 A;  3CWB E;  2AXT H;  1LGH B;  1SQQ K;  1SQB D;  1N86 A;  2R44 A;  1RE3 A;  4YTP C;  1ZLL A;  1UIX A;  3T97 B;  3L36 A;  3HUS B;  2QJY C;  5KTB A;  3CD6 P;  3V2R A;  1RE4 A;  3TSI A;  2IBZ I;  2E75 B;  1YTZ T;  4L75 A;  4U3F D;  1NU1 G;  3IAO A;  1K73 Q;  2KZI A;  1HGZ A;  5EFW B;  3CC7 P;  2W6B A;  4R4M A;  5CBN A;  2D2C D;  1GD2 E;  3AEF C;  2I8D A;  4DCK A;  1OZH A;  1P84 E;  3S9O A;  1NKZ B;  5CCG C;  2POH A;  3V5B A;  3GF3 A;  4GDO A;  3CCS P;  5KLV K;  2BEQ D;  4RKU J;  2P58 A;  1AV1 A;  2E75 C;  1USE A;  3CPW O;  3PLN A;  4UB8 H;  1Y9B A;  4IOI H;  1SQP J;  2Z4E A;  3H1I D;  1URQ D;  3M91 A;  3PP5 A;  3BAS A;  4PD4 H;  1L0N K;  1P84 I;  2WPS A;  3TNU B;  1FOS F;  1S72 P;  2Q3E A;  2KS1 B;  1QEX A;  2PRR A;  4JF7 A;  3CWB J;  2KSJ A;  1OMI A;  3L75 G;  3L37 A;  1VQ6 P;  1WT6 A;  3SFD C;  1QVF O;  2OYH A;  3HUS A;  2RH0 A;  2J58 A;  2BCC G;  2HYN A;  3H1K E;  1SFC B;  2FBW C;  1YJ9 P;  1KYO E;  4OVN F;  1NTM D;  1HUC A;  4L73 A;  2XND H;  4TLF A;  3L74 D;  3CME P;  1PGO A;  1HWT C;  3OAK A;  1T2K C;  1IK9 A;  1L4A A;  5AVU B;  3B5N D;  3L74 G;  1D7M A;  1PGJ A;  2M3B A;  2IPP A;  4KJM A;  2KI7 B;  3FGA D;  1IFJ A;  2M0B A;  1NTZ E;  1IFM A;  3L71 E;  3L73 G;  2KZJ A;  1SFC C;  1KFM A;  2M5A A;  1RF1 B;  5B66 E;  1FU1 A;  4H13 D;  2BEZ F;  2ZXE B;  3U1C A;  1KOR A;  2RKL A;  2IYO A;  3A3Y B;  1FDO A;  4I1L A;  3ITK A;  4HYT B;  1R5S A;  3TYY A;  1GW3 A;  3SFE C;  4O9B A;  3H1H G;  2A45 I;  3JSV C;  3L70 D;  3QH9 A;  3TGU D;  4Z1M H;  3GW6 A;  3CCR P;  2OAR A;  2LXC B;  2WMM A;  1ZRT D;  3L70 G;  1KYO H;  4ZKU A;  3W68 A;  3AE1 C;  3BCC J;  1DH3 A;  1RF1 C;  1WRG A;  1LTT C;  1BSN A;  3H1K J;  3E1R A;  1PP9 E;  2JWD A;  1L2P A;  2DW3 A;  3H1L D;  3KXD A;  1PIX A;  1LWU A;  1JY2 P;  1URQ B;  1S3J A;  3M0D A;  4DT0 A;  1JY2 N;  1JTH A;  2Y0C A;  5B66 H;  1VQO P;  5TJH A;  3B8E B;  1NTZ J;  3L71 J;  1LTB C;  1NTZ K;  2IZ0 A;  3CX5 E;  4NPE A;  3VMA A;  1VPC A;  5CHX A;  1EZV D;  3WUV A;  5AW1 B;  5AVY B;  2FYZ A;  1NU1 E;  4ASV A;  3A5T A;  2IDB A;  2E74 D;  3KHU A;  1URQ C;  3RL0 B;  1FS0 E;  1G1I A;  2YKO A;  2KNC B;  3AE4 C;  1SQX D;  1LTA C;  2LKM A;  4YXD C;  2IYP A;  4ZNC A;  3HE4 A;  2R3S A;  3EFG A;  2XKM A;  2IBZ D;  3AEC C;  1KB9 I;  1NWQ A;  3GLM A;  3MUD A;  2KSE A;  3RBX A;  2R5D A;  3H6P A;  4D6T D;  2E76 D;  1VQ9 P;  2YXQ B;  1L0L G;  1J2J B;  1VF5 B;  2QEX P;  1RH5 B;  1PP9 J;  2JEE A;  3K5B A;  3RL0 C;  3L4F A;  4H13 B;  2WQY C;  1VQL P;  4EDF A;  3H1J G;  2P7J A;  2WZ7 A;  2FYU D;  3HE5 A;  1NOH A;  3L75 E;  3UIA A;  1ZN5 A;  1BGY D;  3AEE C;  3TDK A;  2WSF H;  3IR9 A;  1YIJ P;  3HTK B;  3AED C;  1YYC A;  1VDF A;  4C46 A;  4RJT A;  2W83 C;  2BCC E;  4GIF A;  5AVW B;  1LP1 A;  1VF5 C;  4H0L D;  3V2N A;  2WSF J;  3CXH I;  1K8A Q;  1DD4 A;  1Q81 Q;  4H13 C;  1M1J B;  1NU1 J;  4MN4 C;  3EFF K;  1NU1 K;  3RK2 C;  2NZ2 A;  1G2C A;  2JJL A;  2LR2 A;  2HFE D;  3B5N A;  1KQG B;  4BRY A;  3ABV C;  5CCG D;  1GW4 A;  3QWO C;  2KIK A;  3L73 E;  1T3U A;  1JM0 A;  4HB1 A;  3BCC G;  2ZVN B;  1U57 A;  4GOE A;  2KYV A;  1X8Y A;  2I1K A;  1M1J C;  3VMZ A;  2ZJS E;  2AEF A;  2QSI A;  2WTY A;  1S9K E;  3MIW A;  1K05 A;  3KDP B;  3H1H E;  1BE3 D;  1S5L X;  2JKV A;  5BU5 A;  3H1I J;  3M9B A;  2Z5H A;  3WU2 E;  1QX8 A;  2V4H A;  1YI2 P;  5AW7 B;  3CCQ P;  1N8R Q;  2HPC B;  4C7N B;  3HTK A;  5APU A;  3IFM A;  4LC1 A;  1PPJ D;  3L70 E;  1Q82 Q;  3LW5 H;  1HGV A;  1N73 C;  2K3R A;  3VMY A;  1FZG A;  1SQV D;  1PPJ G;  1M1K Q;  3G4S P;  3GHG B;  1SVF A;  4IFM A;  3M06 A;  2IX7 C;  1NTK G;  3CCJ P;  1RY3 A;  2E76 B;  3L72 D;  1EC5 A;  3OJA B;  1T2K D;  1VQ5 P;  3HD7 D;  1FJK A;  3L74 J;  1NH4 A;  2C0W A;  2O01 H;  3GG2 A;  2ZXX A;  4XE5 B;  4AUW A;  4QMA A;  1SFC D;  2O01 J;  1RQV A;  3CL3 D;  1JY3 O;  1FBM A;  2Y9Y A;  3GHG C;  1JUN A;  2E76 C;  1ZXG A;  2YKP A;  1BCC D;  1ZOY C;  4H0L B;  1Y47 A;  3I56 P;  3H1H J;  1CI6 A;  2WSC H;  1KC8 Q;  1A02 J;  2IFM A;  2HPC A;  1WMK A;  1AVY A;  2OYI A;  1T6A A;  1LNQ A;  2J59 M;  2M3E A;  2WT7 A;  2B9B A;  2B88 A;  2WSC J;  2H88 C;  1LT9 A;  3AE9 C;  3L70 J;  2K1A A;  4PD4 E;  3TGU J;  3CC2 P;  2K88 A;  3NFQ A;  4W80 A;  3P8C E;  1SQB G;  5BU8 B;  3RL0 g;  3V4W A;  1JEK A;  1L0L E;  5AVT B;  3D70 A;  4H0L C;  1OVV A;  1MZ9 A;  3RGU A;  4IFD K;  1YTZ I;  3NTN A;  3CMA P;  4JPZ B;  4L74 A;  1E5W A;  2YMY A;  3H1J E;  3CCM P;  5M1B A;  1EDK A;  1H0T B;  1KB9 D;  1KZU B;  1KD1 Q;  4U3F G;  4ZKP A;  1N2D C;  1G1J A;  3I5C A;  1YBK A;  4I7Z B;  2AEM A;  4EYY Q;  2AXC A;  3JCU E;  3V2P A;  3N4X A;  4W7Z A;  3M0A A;  3EQ2 A;  4PV1 D;  1DX7 A;  2WPQ A;  1J1E B;  2OQQ A;  3KPE A;  2PGD A;  1ZR4 A;  2E43 A;  1KIL D;  5AW4 B;  4U7J A;  3MTU E;  2L91 A;  2RMZ A;  3PJS K;  1SP4 A;  4I7Z C;  3ZDM A;  1SQP K;  3H1I G;  1KQF B;  3CXH D;  1GK4 A;  4Y28 J;  2XZR A;  3HD7 B;  1M56 D;  1CZQ A;  4HJG H;  4B86 A;  5CCG A;  2HG5 D;  1J1E C;  3T97 A;  3GF7 A;  1AJY A;  4Y99 B;  2A06 D;  3BCC E;  2QJP B;  4AYC A;  1S4X A;  1L0L J;  3OA7 A;  1JCD A;  3B71 A;  1R5L A;  2KOG A;  2O3J A;  1L0L K;  3RL0 D;  2KUB A;  1Q90 D;  2PAJ A;  1SLQ A;  1H0T A;  1LT1 A;  4OGQ B;  1NJI Q;  1Y8A A;  3H1J J;  5APV A;  3JCU H;  1EDI A;  2SPZ A;  1QVG O;  4KHX A;  3P8M C;  1OVR A;  1OXZ A;  1NTM G;  5AW5 B;  3RBZ A;  3HD7 C;  3AEG C;  5K5G B;  1VQ4 P;  1NAF A;  1USD A;  1S5L H;  3O6Q B;  1LTJ B;  4Y99 C;  2QJP C;  4OH8 B;  1PPJ E;  1KYO I;  3IN6 A;  1VF5 D;  3MGN A;  1Z56 A;  2K9J B;  1NGM B;  1GZL A;  1Q86 Q;  1NTK E;  3V6I A;  4OGQ C;  2J5U A;  3RK2 D;  1FE6 A;  3TNU A;  1IC2 A;  2XU6 A;  2KS1 A;  3VMX A;  1FZC B;  4N6J A;  1X22 A;  3A2A A;  4I6M C;  2OGU A;  1GU5 A;  3MHV A;  1LTJ C;  1Q2N A;  1Q7Y Q;  2KXP B;  3PRJ A;  3E1I A;  2HOD B;  1SQQ D;  3TGU G;  2LXB A;  1SFC A;  4HH2 A;  3WUT A;  1KN7 A;  1YHQ P;  4PV1 B;  3KQG A;  2YIU B;  4IL6 X;  2ZAE B;  3G9R A;  1FZC C;  3CC4 P;  5AVS B;  1NHL A;  2IFN A;  3H1L G;  3R4Y A;  1KIL B;  5KJ7 D;  5H2F E;  1BE3 J;  1K04 A;  4WY4 D;  4N78 D;  2Q7C A;  2PP6 A;  5B5E H;  2QM8 A;  1W2E A;  1JB0 J;  1M7L A;  2R5B A;  2QE7 H;  5APQ A;  3CCE P;  1SQB E;  1FZB A;  1KFN A;  3A7O A;  1RF1 A;  2YO3 A;  4PV1 C;  1FAV A;  1HVV A;  2IZ1 A;  1SQV J;  4BWN A;  1MFT A;  1NTK J;  2YXR B;  5AW9 B;  4LGD E;  5KLV D;  2YIU C;  3S1K A;  2ZYA A;  3Q5R A;  1EZV G;  1NTK K;  3RK3 D;  1VQ8 P;  1KIL C;  1JY2 O;  1GTW A;  2JP3 A;  4U3F E;  1AA0 A;  5KKZ B;  1L0N D;  2Q9I A;  2ZT9 D;  1MKM A;  2I1J A;  5AVQ B;  3CX5 I;  3PTZ A;  1SQX G;  1ZME C;  4HKZ H;  3CWB D;  1X79 B;  2IBZ G;  2PFX A;  1HTL C;  1PZQ A;  1OWA A;  3H25 A;  5H2F H;  1ZP0 C;  4D6T G;  1OFC X;  3KYQ A;  3C9I A;  1IK7 A;  1BCC J;  1KIL A;  3IF4 A;  1URQ A;  5KKZ C;  5AW2 B;  1AQT A;  3H1I E;  3RK2 B;  5AVR B;  5CBO A;  2CPB A;  2FYU G;  1OW6 A;  2N1T B;  3MD0 A;  1M57 D;  5TIS E;  1FOS E;  1SQB J;  1BGY G;  3TF5 A;  1P84 D;  1SQB K;  1R8E A;  2W8Z A;  2OYO A;  2WSS H;  1GK6 A;  2Y9Z A;  2KNC A;  1VQ7 P;  4U3F J;  1NTM E;  2WIT A;  2WPV B;  1MFZ A;  3L74 E;  1YQ4 C;  3GMA A;  1IFD A;  2ITA A;  5BVZ A;  2N1T C;  2R32 A;  2P1J A;  2N9Y B;  3VP9 A;  2Q5U A;  2QA4 P;  2NPS B;  4WY4 B;  1AFO A;  1KTM A;  2XDJ A;  2K9Y A;  4OWF A;  1N73 B;  2OTK E;  3FXE A;  2FFD B;  3H1K D;  2WPR A;  3F89 A;  5TIS H;  3U59 A;  1RF0 C;  3USS A;  1FJP A;  3RK3 B;  4EI2 A;  5KJ7 C;  3SSU A;  1BE3 G;  2NPS C;  4WY4 C;  3H32 B;  2FXM A;  3TGU E;  1VQP P;  2ZT9 B;  2XV5 A;  3EWK A;  1K9M Q;  4A7P A;  3Q2Y A;  3Q5S A;  1ZRT E;  3L35 A;  3FWL A;  2FFD C;  1M1J A;  1NTZ D;  3D6Y A;  1SQV G;  4XFJ A;  3A0H E;  1GL2 B;  2QIW A;  1OVU A;  4W7Y A;  1VQN P;  2UWJ E;  2A45 G;  1EXI A;  1OW7 A;  3H1L E;  3LID A;  3RK3 C;  1NTM J;  3CCL P;  3L72 G;  1BDC A;  2CK3 H;  1S2E A;  2W90 A;  2N9B A;  2ZYG A;  3MP7 B;  2JR8 A;  4CPG A;  1GDT A;  1NTM K;  2ZT9 C;  1DEE G;  4NPF X;  1AQ5 A;  1N73 A;  2ZVO B;  1GMJ A;  2GA1 A;  5KAI E;  2FFD A;  4WWI A;  1GL2 C;  1T8Z A;  1XTC C;  2FY8 A;  4OGQ D;  1EZV E;  1KQS O;  1HJB A;  1LJ2 A;  3F5H A;  4L76 A;  1U7M A;  1RE3 C;  1BCC G;  2G8Y A;  2VRS A;  4C7N A;  4ASW A;  2H7H A;  2YNY A;  1RE4 C;  3AE2 C;  5AW8 B;  4M3L A;  1SQX E;  2XNX A;  1QLE D;  3A0H H;  1J1D B;  1JCC A;  2E5T A;  2IBZ E;  1SQQ J;  3GHG A;  1ZR2 A;  3Q5P A;  1FZA A;  4D6T E;  3FWN A;  1FDM A;  3CX5 D;  2GM4 A;  4PJ0 E;  2V7Q H;  3H1L J;  4N3Y B;  4YPC A;  2AEJ A;  4PD4 I;  4K35 A;  2OYH B;  4GOD A;  1NU1 D;  2KB7 P;  3BRV B;  5KAI H;  1XTG B;  2FYU E;  2H8P D;  4JYB A;  1QL2 A;  2V7Q J;  2G3A A;  1BDD A;  2O01 N;  1J1D C;  3N7N A;  1BGY E;  2QVA A;  2E42 A;  3II6 A;  4AQR D;  1LTS C;  1KMI Z;  1S5L E;  4C7R A;  4WB4 A;  3AEA C;  1L4A B;  5APY A;  4LLH A;  1X0T A;  1OW8 A;  5KLV J;  4RES B;  1YIT P;  2OYH C;  1UII A;  3HUS C;  3R2P A;  2Q3I A;  4R4L A;  1RQU A;  1N7S D;  2M5A B;  3O8Z A;  1L0N J;  1SQX J;  5APX A;  2KK7 A;  3Q3D A;  2B87 B;  3BRT B;  1SQX K;  3NXS A;  3L75 D;  4K3A A;  4PJ0 H;  2JO1 A;  1L4A C;  2A06 G;  4D6T J;  1EXJ A;  2BCC D;  2JWA A;  4JQ0 D;  3FXD A;  2Z5I A;  2L5G B;  1EDL A;  1PV3 A;  1BE3 E;  3BVH A;  2C9L Y;  2FYU J;  3MZW B;  4BXL A;  3W67 A;  1U7J A;  3C8V A;  2FYU K;  1BGY J;  1FZF A;  1P84 H;  1JNM A;  1DD3 A;  1NKN A;  5B5E E;  2CPS A;  1LWU B;  3VTP C;  1NVO A;  3WUU A;  1SQV E;  2W6J H;  2RN0 A;  3L73 D;  1EDJ A;  4UB6 E;  4WVZ A;  1KQL A;  2P67 A;  1JTH B;  5DJT B;  3L72 E;  1IJD B;  1S9K D;  2N1T D;  3HD7 A;  1A02 F;  1NAY A;  5APS A;  3H1H D;  2B87 A;  2E5Y A;  2YMK A;  5AVZ B;  1LTG C;  1LWU C;  1H8A A;  4GT1 A;  3A0B E;  1DEB A;  3AE8 C;  1IFP A;  1LTI C;  1FZE A;  1SQQ G;  3AE7 C;  3OW2 O;  1YJN P;  3M0D C;  1HH0 A;  3PH0 A;  2D2C B;  2ZFC A;  5CCH D;  2Y0D A;  3HE4 B;  2FKW B;  1BSH A;  1BCC E;  2QG4 A;  1HJ0 A;  2FXP A;  2NPS D;  2FYN B;  3VN0 A;  3O6Q A;  3E7K A;  1LTJ A;  3B4S A;  2MKV A;  1N7S B;  2M8R A;  3M9Q A;  2A45 H;  4UB6 H;  2K9J A;  1IFN A;  1VQM P;  1OX3 A;  2C9N Y;  2D2C C;  1IO4 A;  2HLO A;  3HE5 B;  2P10 A;  4WBA A;  3JC2 2;  5CJ0 A;  4JYC A;  1SQV K;  1T3J A;  1FZC A;  5APT A;  1S1C X;  4ZMD A;  5KLV G;  3L72 J;  3TK1 A;  1X9V A;  2Q6Q A;  2FYN C;  1CSB A;  3MUD C;  1PL5 A;  1KB9 E;  3G71 P;  3A0B H;  1SQP D;  1LP1 B;  2O1K A;  3KZI E;  4GOF A;  2WSE H;  3Q1M A;  3VOP A;  1KV4 A;  3CI9 A;  2HOD A;  1N7S C;  1RHZ B;  1N7L A;  1L0N G;  3CLQ A;  1VQK P;  3V4Q A;  1SQP G;  1MV8 A;  1M8O B;  1JMB A;  3PHL A;  4NPD A;  1GL2 D;  3S4R A;  1IFI A;  2WSE J;  3SWY A;  4PD4 D;  2H89 C;  2BAS A;  1G2C B;  1AVO A;  3SWK A;  5CJ4 A;  3CWB G;  4TT3 H;  3B5N B;  5AW0 B;  3P8C D;  4BRY B;  1L0L D;  3C1L A;  1KIL E;  1SS1 A;  1W5C E;  1YJW P;  1QGK B;  4GKG A;  4EIJ A;  3H1J D;  1N7S A;  1MUU A;  4IFF A;  2MJZ A;  1M90 Q;  3V2Q A;  1HF9 A;  3FX0 A;  2OTJ P;  3CXH E;  4H44 D;  5L8R J;  2QRX A;  2H43 A;  2NRG A;  1DIP A;  1JMM A;  5AW3 B;  1PFI A;  3VYI A;  2HR3 A;  2A06 E;  3B5N C;  3CX5 H;  3G3Z A;  3CCV P;  3HRN A;  3D6Z A;  1KB9 H;  5GTI E;  3I55 P;  4EOT A;  3KZI H;  1EQ7 A;  5KAF E;  1YQ3 C;  1JO5 A;  2OTL P;  1NO4 A;  2O1J A;  2K37 A;  2QJK B;  4JBZ A;  3AEB C;  3P32 A;  5E79 E;  2ZYD A;  4IL6 E;  2YO2 A;  1TU3 F;  1W2B O;  5GTH E;  1E79 H;  3AE5 C;  3LIE A;  3BCC D;  5CCH C;  2R3C A;  1JOC A;  5APW A;  3CXH H;  4RO0 A;  2B89 A;  1KYO D;  2GUV A;  2E75 D;  2QJK C;  3H1K G;  3P7K A;  2N1T A;  1VL2 A;  4DOJ A;  3CCU P;  3WMM 0;  1CW5 A;  2KLU A;  2WVR A;  4KT0 J;  2WWW A;  5AVV B;  1ZV8 A;  3NMD A; 
#chains in the Genus database with same CATH homology
 4Z1M H;  3AEC C;  4OGQ C;  4H44 D;  3Q5R A;  5L8R J;  1OMI A;  2MKV A;  2J5U A;  3D71 A;  2E74 B;  1U57 A;  3C8V A;  2V7Q J;  2E76 C;  2WPV B;  2G3A A;  3GLM A;  2JP3 A;  3AE1 C;  1YQ4 C;  3SFD C;  1DIP A;  2E76 D;  4U7J A;  1ZOY C;  3GMA A;  2ZT9 C;  4H0L B;  1DD3 A;  2QSI A;  1VF5 B;  2ZT9 D;  3AE3 C;  2D2C C;  1K05 A;  1KMI Z;  4I7Z C;  4YTP C;  1GMJ A;  1MKM A;  3D6Z A;  2P10 A;  2FBW C;  1UIX A;  3T97 B;  4H13 B;  1S5L X;  1KQF B;  1WMK A;  2WQY C;  1KTM A;  2QJY C;  2K9Y A;  4Y28 J;  1ZME C;  3AEA C;  1YQ3 C;  1S1C X;  3LW5 J;  4OGQ D;  1PIX A;  2WSC J;  2E75 B;  2FYN C;  1OW8 A;  2H88 C;  3AE9 C;  1NYH A;  1PL5 A;  3IAO A;  3GF7 A;  1AJY A;  3AEE C;  3H25 A;  1ZP0 C;  4R4L A;  3AEB C;  4PV1 B;  3Q1M A;  1RQU A;  4R4M A;  2G8Y A;  3AED C;  3RL0 g;  2E74 C;  2D2C D;  3AEF C;  3B71 A;  2YMK A;  1IK7 A;  3FGA D;  4IL6 X;  5KKZ C;  4H44 B;  1Q90 D;  3D70 A;  4H0L C;  3G9R A;  3S9O A;  4OGQ B;  1TU3 F;  1VF5 C;  3Q3D A;  4H0L D;  3AE2 C;  2WSE J;  2WSF J;  3R4Y A;  5KLI C;  1DD4 A;  3AE8 C;  2E76 B;  3AE5 C;  2H89 C;  1K04 A;  4H13 C;  5M1B A;  3GF3 A;  3AE7 C;  4GDO A;  4TT3 H;  1OW6 A;  2JO1 A;  2ZT9 B;  1FDI A;  2BEZ F;  4H13 D;  3AEG C;  3EWK A;  2BEQ D;  1KOR A;  3Q2Y A;  3Q5S A;  4RKU J;  2D2C B;  3RK3 E;  4I7Z B;  1FDO A;  1ZRT E;  2E75 C;  1JB0 J;  2IDB A;  2E74 D;  1EXJ A;  2NZ2 A;  2E75 D;  3Q5P A;  1Y9B A;  1KIL E;  2QJP C;  2QJK C;  3SFE C;  3D6Y A;  4XFJ A;  1VL2 A;  2QIW A;  3AE4 C;  3IN6 A;  4PV1 C;  1HJ0 A;  1VF5 D;  1KQG B;  2FXP A;  3AE6 C;  1EXI A;  3ABV C;  4PV1 D;  4YXD C;  1OW7 A;  1R8E A;  1PV3 A;  4KT0 J;  3O6Q A;  1NGM B;  2YIU C;  1HF9 A;  2O01 J;  1RQV A;  4H44 C;  2OQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...