2WPVB

Crystal structure of s. cerevisiae get4-get5 complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
48
structure length
48
Chain Sequence
b'GPEHEFVSKFLTLATLTEPKLPKSYTKPLKDVTNLGVPLPTLKYKYKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0363 PROTEIN YOR164C
publication title Crystal Structure of Get4-Get5 Complex and its Interactions with Sgt2, Get3, and Ydj1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 7
structure length 48
sequence length 48
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2009-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2wpvB01
4KT0J 2O01J 3LW5J 1JB0J 2QSIA 4I7ZB 3C8VA 4RKUJ 5L8RJ 2E76B 4OGQB 1Q90D 2WSCJ 2YIUC 4PV1B 2E75B 2ZT9B 2D2CB 2QJYC 2FYNC 2WSEJ 5KLIC 2K9YA 4H0LB 1ZRTE 1S5LX 4H44B 2QJPC 1VF5B 2WSFJ 5KKZC 2QIWA 2QJKC 4Y28J 4IL6X 2E74B 4H13B 2WPVB
chains in the Genus database with same CATH superfamily
4R4MA 1HGVA 1LNQA 4MN4C 3M0DA 2E76B 1AVOA 1Y47A 1DD3A 2J59M 1OIPA 1SQXG 3E7KA 2Z5HA 3B5NC 3H1LD 3LIDA 2C0XA 1P84E 2P67A 3CXHH 3CCRP 1Y9BA 1EDKA 4D6TE 2O1JA 1LP1A 2D2CD 2O01H 3CC7P 2J5UA 2QJPC 3L71D 1LTGC 2XNXA 2IBZE 3PLNA 3CMAP 3HUSB 3FWNA 3RK2B 3S1KA 2N1TB 1OXZA 2IDBA 4L74A 2Q9IA 4PJ0H 4N78D 3EQ2A 3CXHD 1Q81Q 1WMKA 1M7LA 1LTSC 5M1BA 3H1IG 2IZ0A 4LGDE 1JB0J 1YQ3C 1HH0A 1NU1E 4WY4A 4GIFA 5AVRB 5AW0B 3IFMA 5AVWB 2D2CC 4EI2A 1S9KD 3RGUA 1P84H 1RF0A 1JTHA 1RE3A 1SQQD 2AXCA 3AEAC 4OGQB 5AW6B 3V4WA 1KZUB 4B86A 1J1DC 3WMM0 5DJUB 1NTZE 1YBKA 3HTKA 3ABVC 1EXJA 2ZT9D 3I55P 3I5CA 4WB4A 2KK7A 1PGJA 2JEEA 1SQVJ 1FOSE 4Y99C 3VOPA 5GTHE 2A45G 2M3BA 3GF7A 3K5BA 4U3FG 4PD4I 3CCMP 1P84D 4YXDC 3L75G 2HFED 3EFFK 3SFDC 3H32B 1LTJA 4D6TD 1DX7A 4AUWA 3C8VA 3BRTB 3OA7A 1QVFO 1YYCA 1DEEG 2IBZD 2YMKA 1N8RQ 2ZT9C 3TYYA 2QM7A 3AE9C 1VPCA 3FWLA 2OYHB 1ZP0C 4K3AA 3CCSP 4DCKA 1LWUC 2ZVNB 1SQXJ 4LLHA 3V2NA 5TJHA 1NU1D 1G2CB 2ZVOB 3MUDA 2VRSA 1NKZB 5GTHH 2KSJA 2O3JA 1PP9E 1FZGA 3M0DC 4PD4E 3I56P 2YIUC 1DEBA 3C9IA 3PH0A 3TF5A 1FS0E 2ZAEB 5AW7B 2NZ2A 1LT9A 3RK3B 1YJNP 3CCJP 1KMIZ 5CMZA 3SFEC 2OYIC 4I7ZB 4OVNF 2WT7A 1HBWA 2QJYB 1PPJG 3H1IJ 2UWJE 2WSEJ 5KLIC 2XDJA 5AW4B 1BGYJ 1N7SB 1KFMA 3L72G 2Q5UA 3WUVA 2A45I 5KJ7D 1IZNB 1VQ8P 1DD4A 1NJIQ 1T2KD 3SSUA 2V7QJ 2C9LY 3N7NA 3AE6C 1L0NG 3W67A 2HODB 1L4AB 4HYTB 1EDJA 1FC2C 5CBNA 1N86A 1KORA 2QM8A 4GT1A 2ZJSE 4DZOA 1FZBA 4PD4H 1FDOA 4EOTA 2WZ7A 3H1JG 3CX5I 3GHGA 1NWQA 4WY4C 1LTTC 1RF1C 1GMJA 1E5WA 4PV1D 2N9BA 3H1KG 5KJ7C 4U3FJ 1IFMA 4H0LD 3U1CA 1T2KC 3L75J 1URQA 2YNYA 1M1JB 1NH4A 1SQQK 3AE8C 4GOEA 4PD4D 4OH8B 2MJZA 4U3FE 1CW5A 2FYUK 4JPZB 4QMAA 3L75E 3EWKA 3HD7D 2B88A 2WSEH 3FGAD 1RQUA 4PV1C 1AQTA 1AJYA 2Z5IA 1N73A 1VDFA 2KZJA 2WPSA 3CCQP 4H0LC 1LTJC 3M91A 2V7QH 1VQ7P 3HD7B 3B71A 3CX5E 4H44D 1YJWP 2IZ1A 1K73Q 2B87B 1USDA 3Q5SA 3RBZA 1TU3F 2PRRA 1KB9I 1XTCC 1KYOI 1S5LE 1D7MA 1GD2E 5APVA 2FXPA 4ZNCA 2FXMA 3H1HE 1A02J 1JY3O 4ASWA 3L36A 2A45H 4JYBA 2FBWC 1FOSF 4JYCA 2KLUA 2YMYA 3MUDC 2XKMA 1JY3P 4C7NB 2NPSA 4H44C 3HE4B 1RE4C 3L72J 1MZ9A 4HJGH 4UB6E 1QEXA 1H8AA 1AQ5A 2FFDB 1IFIA 5AVYB 2E75D 3MTUE 3IR9A 3CX5H 1L0NJ 2JWDA 1FJKA 1CI6B 1GZLA 2Q3IA 5AVSB 1M8OB 4M3LA 2QVAA 1IC2A 5AVUB 1KB9E 3HUSA 4ZMDA 1KYOE 4U3FD 1S5LH 3VMYA 2BEQD 1EXIA 2WSCJ 2R5BA 3L75D 4TT3H 4N6JA 3H1JJ 2W83C 3UIAA 1LT1A 2Z4EA 2AEJA 5AVZB 1VQ4P 1QGKB 3VN0A 1AFOA 3H1KJ 3CX5D 3VMZA 2FYNB 2E75C 4HH2A 1HF9A 2W6AA 3H1JE 2ITAA 1Y8AA 1SQVK 3AE5C 3M9QA 4UB6H 1M56D 3T97B 2POHA 2PP6A 3L35A 3H1KE 1H0TB 3GHGC 3C1LA 3F5HA 3H1HD 1USEA 1YJ9P 1S3JA 2JJLA 2Q7CA 2ZYDA 1MFTA 3KDPB 1ZXGA 1KB9H 1KYOH 2WSFJ 1M57D 1HTLC 1URQC 3B5ND 2K9JB 4H13D 4EDFA 2FXOA 1E79H 4KHXA 3FX0A 3KYQA 3V2RA 3NMDA 2P1JA 3PTZA 2YKOA 1QL1A 5B66E 3B5NB 2WSCH 1OMIA 1SQXK 2KB7P 2GUVA 1BE3G 4L75A 4YPCA 5H2FE 2FYUE 1PPJD 2PAJA 5AVXB 3A5TA 2Y0EA 3B8EB 2H88C 1KB9D 2KOGA 1KYOD 2KIKA 1N73C 5AW8B 1J1EC 4IL6E 3CD6P 3D70A 2QJPB 2KLVA 2OYHA 2NPSD 4H13C 2HR3A 3CLQA 2LR2A 4JBZA 2RMZA 4IFFA 1NHLA 3S4RA 1ZN5A 3O6QB 3BCCJ 1FBMA 1G2CA 5AW9B 4IFMA 1SQBG 4ZKPA 3U59A 2G3AA 3GMAA 2YO2A 3H1JD 1HJ0A 1WT6A 3RL0D 3L73G 1BSNA 1LGHB 3V2QA 2IX7C 2BCCG 2K3RA 4YXWH 2D2CB 1KQFB 3VTPC 3H1KD 3QWOC 2WSFH 5B66H 2GM4A 1BCCG 1EZVG 2NPSC 1N2DC 5H2FH 4GKGA 2WWWA 1PV3A 1SS1A 1BGYG 2HPCA 1J1DB 2KS1A 4IL6H 2P58A 3JSVC 1MKMA 2WTYA 3II6A 1KQSO 4Y99B 3RL0C 2GA1A 3HE5B 3Q5PA 1EDLA 1IK7A 2HODA 4GDOA 3A0HE 2JDIH 3KQGA 1NOHA 2FYUD 2WSSH 2XV5A 2OTJP 1SFCA 1K05A 1Q2NA 1FU1A 4NPDA 3P8MC 3CC2P 3WUUA 1L0LG 3TNUB 2ZT9B 3GF3A 1A02F 4W80A 1YITP 1T6AA 1DH3A 1SQVE 3LW5J 1LWUB 3AE1C 3L74G 4BXLA 4L76A 3L4FA 4JQ0D 1BE3J 1NTMG 1U7JA 2K9YA 2KNCB 2W6JH 4ZKUA 1AVYA 1JY2O 2QIWA 2LKMA 1SQPG 1ZR2A 1R5LA 2M5AB 1GU4A 3A0HH 2RH0A 3R2PA 2YIUB 3CWBG 1EZVI 5CCHA 4W7ZA 1BE3E 1JY2P 1VQ5P 1GTWA 5KKZC 3CCVP 2KI7B 4KJMA 2OYIB 5E79E 2B87A 2OYOA 4RKUJ 2WITA 1SQBJ 2OTKE 5KTBA 1SQXE 3M0AA 3CC4P 1LP1B 2JR8A 5KLIB 3L73J 3MZWB 3O8ZA 2AEFA 1AA0A 2BCCJ 3MD0A 2RN0A 3AEBC 1HGZA 1MUUA 2E74D 1SQBE 2Y9ZA 1VQOP 1BCCJ 1L0NK 3MHVA 4WY4D 2OARA 5APWA 1Q82Q 4YTPC 1UIIA 4O9BA 1GK6A 3LW5H 4C7NA 1NYHA 1JOCA 1QVGO 4WY4B 3H6PA 2LXCB 1FZCA 1QL2A 1RF1B 4I2LC 1EZVE 1SQVD 2FFDA 3H1IE 3P32A 3F89A 5E79H 1BGYE 2NRGA 1CI6A 1JTHB 1Z56A 4DOJA 5APTA 1SFCD 3KPEA 2E74C 1BSHA 3SWKA 2DW3A 4I6MC 1L0LJ 1RF0C 1KILA 1RE3C 1BE3D 1LTBC 3AE2C 2IPPA 1R5SA 2JKVA 1YTZT 4PV1B 2IYOA 3BATA 1IJDB 2M3EA 1GL2A 4H0LB 1LTJB 2PFXA 1ZLLA 3L74J 1SQXD 2Q6QA 1JMMA 1L0LE 1NAFA 1SFCC 3GW6A 1PFIA 1HVVA 5AW3B 1NTMJ 3CPWO 3WUTA 1HJBA 1H0TA 1LJ2A 1JCDA 1SQPJ 1U7MA 1M90Q 2YO3A 1SQBD 1JUNA 2L5GB 1KILE 2CPBA 3L74E 3TK1A 1OZHA 3E1IA 3W68A 3CWBJ 2Y0DA 2K1AA 1SVFA 4ASVA 1FZEA 1RQVA 3NFQA 5APSA 1N7LA 1T3UA 1T8ZA 2P2UA 2W6BA 3SWYA 3MIWA 1BCCD 3AECC 1EZVD 1KTMA 4H44B 3H1ID 3CWBE 5AVVB 2QJKC 4HB1A 2OGUA 1BGYD 1M1KQ 3TSIA 1YTZI 3OW2O 3D6ZA 3L70G 1FDMA 1VQMP 1RHZB 1GK4A 2H8PD 4D6TG 3BCCG 2WT7B 4UB8E 3AE4C 3O6QA 4HKZH 2WPQA 1IK9A 2AXTE 1YI2P 1J2JB 5APXA 1ZMEC 1LT9C 2Y0CA 3TDKA 1OWAA 1PPJE 1JCCA 1YQ4C 5CHXA 5KLVG 3QH9A 3L72E 1Q90D 4A7PA 2ZFCA 1L0LD 5B5EE 2IYPA 4AYCA 1KQGB 2E75B 2N1TA 1CSBA 2YXRB 1PGPA 1R8EA 1NU1G 3CL3D 1L0NE 1AV1A 2KXPB 1KILD 1VF5D 1X22A 3IAOA 3L74D 3AEEC 4I1LA 3GHGB 1URQD 4JF7A 1FZCC 4W7YA 2KUBA 1GL2D 3A0BE 2XU6A 3GLMA 2E5YA 1NTZG 4UB8H 1YHQP 3CWBD 2AXTH 1JM0A 2O1KA 2LXBA 4GOFA 1KILC 1VF5C 5B5EH 1S72P 2CK3H 2K88A 2HLOA 2QE7H 1KQLA 4BRYB 3JC22 3IF4A 1N73B 2G8YA 1J1EB 1JY2N 2E43A 1GL2C 2FKWB 3H32A 3VP9A 2FY8A 1PGQA 1K8AQ 4H13B 2WPVB 2ZYAA 3TGUG 1JNMA 2QSIA 1LWUA 4IFDK 2E76D 3A0BH 3L72D 2IFNA 2KNCA 4WVZA 2B89A 1IO4A 3L70J 1FAVA 1IFPA 1SQBK 3GG2A 5AW2B 3S9OA 1H89A 4KT0J 2A06G 2M5AA 1L0ND 2C9NY 3AE7C 2M8RA 5C39A 3HRNA 4D6TJ 1PP9G 3E1RA 5CBOA 1NTKG 2XNDH 1KN7A 5AW1B 2WQYC 3A3YB 3CMEP 2AEMA 1X9VA 3JCUE 3L70E 3V4QA 2NPSB 1VQ9P 2B9BA 3AEDC 2OYIA 1MFZA 3CCEP 1GW4A 2E76C 4R4LA 1NO4A 3V5BA 3RK2D 1Q86Q 2N1TD 5KLVJ 3BCCE 1OVUA 1PIXA 1W5CE 3P8CE 3RL0B 3M9HA 1NU1J 2YKPA 3VMAA 2R3SA 5KLVE 1OW7A 2GUSA 1H88A 1KC8Q 2QG4A 1N7SA 3R4YA 1SLQA 4WWIA 2RKLA 4AQRD 3NTNA 4RJTA 1S1CX 1L2PA 1QLED 3HUSC 1PGOA 1RF1A 3RK2C 4OGQD 2WMMA 2N1TC 1NTZJ 1U57A 1L4AA 3JCUH 3KZIE 1G1JA 1L0LK 4XA4A 3RK3E 5KJ7A 3OAKA 2MKVA 1WRGA 5KAIE 2C0WA 1S4XA 2KSEA 1S2EA 3KXDA 1OW6A 2I1JA 4RESB 1CZQA 1XTGB 3BVHA 5AVTB 4EYYQ 5K5GB 1NTMK 4WBAA 2JWAA 4NPFX 2R44A 2N9YB 1SQPK 3L70D 2H89C 1M1JA 4OGQC 2W90A 4L73A 1IFJA 3TGUJ 2FYZA 3VP8A 2CPSA 2R3CA 2QRXA 4NPEA 4TLFA 5KKZB 2Y9YA 3A2AA 2ZXEB 3BCCD 2P10A 3KZIH 3P8CD 1KFNA 3NXSA 5BU5A 4C46A 3TGUE 3G71P 1LTIC 1X8YA 3V2PA 2WVRA 3FXEA 5KAIH 1PP9J 3LIEA 3HD7A 1GDTA 1JY3N 2Q1KA 1NTKJ 3G9RA 5KLVD 2M0BA 3RBXA 3PRJA 1FDIA 1BDCA 1QX8A 3VMXA 5GTIE 2A06E 3H1HG 5APQA 1DIPA 1PL5A 2OYHC 3Q3DA 2YKQA 1NTKE 3RK3D 1RE4A 3N4XA 1JEKA 1JMBA 3MP7B 5BVZA 2R32A 3G4SP 2XZRA 3L73E 3CI9A 1N7SD 1NKNA 1NTZD 2JP3A 2BCCE 3ITKA 2E74B 3HE4A 1RH5B 1HUCA 2HPCB 2KS1B 5CJ0A 1VQPP 1BCCE 3V6IA 3AEFC 4XFJA 4C7RA 1EDIA 4U7JA 2J58A 1L4AD 1IFNA 3RK3C 1FJPA 2JO1A 4K35A 5GTIH 4I7ZC 3H1LG 1K04A 1FZAA 1VQKP 2L91A 1OFCX 2H7HA 2Q3EA 2QJYC 1X0TA 3HTKB 1K9MQ 3Q5RA 2P7JA 1W2BO 3U1AA 3FXDA 1N7SC 2R5DA 2QA4P 1Q7YQ 1NGMB 1SFCB 3TGUD 4Y28J 1VQLP 3AE3C 2ZXXA 2WPRA 3L71G 3BASA 5CCGA 4RO0A 1X79B 1YIJP 3IN6A 2ZYGA 1L4AC 1NAYA 3PP5A 2A06D 1OX3A 3VYIA 3T97A 1PP9D 2K37A 3H25A 1NTKD 2W27A 1G1IA 4LC1A 3P7KA 5AVQB 5CCHD 1S5LX 1OVVA 4IOIH 2W8ZA 2QJKB 2O01N 5KAFE 5CJ4A 3L73D 1SQQG 1NTME 2KZIA 1UIXA 5L8RJ 2K9JA 1M1JC 2BCCD 4BRYA 1EQ7A 1SQPE 2E5TA 3L37A 2FYUG 3Q1MA 1KD1Q 1GW3A 3B5NA 3H1HJ 5APUA 4XE5B 3RL0g 5TISE 5CCHC 2QEXP 3SWFA 1ZRTE 1LT9B 2HYNA 2IFMA 3HD7C 3CCUP 3AEGC 4N3YB 4DT0A 3D71A 3PHLA 5KLVK 3CCLP 1ZW0A 3A7OA 2I8DA 2IBZG 5KAFH 3WU2E 5AW5B 1NU1K 1ZV8A 4OWFA 1FZCB 1VQNP 4Z1MH 1FE6A 1GU5A 3CXHI 3H1LJ 3PJSK 3OJAB 1NVOA 3BRVB 3EFGA 3M9BA 1NTZK 5APYA 5TISH 1HWTC 2BEZF 1FZFA 5CCGD 2PGDA 2YXQB 2V4HA 1NTMD 1RY3A 2FFDC 3L71J 2OTLP 1MV8A 3H1LE 4BWNA 5EFWB 2KYVA 1KILB 1VF5B 2KP8A 1SQPD 2SPZA 5BU8B 1URQB 4EIJA 3HE5A 2I1KA 3WU2H 3G3ZA 2H43A 1VQ6P 3L71E 1GL2B 1ZOYC 3D6YA 4GODA 1SP4A 3B4SA 3M06A 3MGNA 2O01J 3ZDMA 1ZRTD 1IFDA 5CCGC 1P84I 1KV4A 1PZQA 2E42A 3KHUA 4N78E 1BDDA 3CXHE 3TNUA 2FYNC 1SQVG 1SQQJ 1OW8A 1EC5A 3G6EP 1W2EA 4CPGA 3Q2YA 2BASA 4IL6X 1OVRA 2IBZI 3USSA 2FYUJ 1S9KE 1ZR4A 1JO5A 5DJTB 2OQQA 1LTAC 1SQQE 1T3JA 1NTKK 4DJGA 4PJ0E 2HG5D 1VL2A
chains in the Genus database with same CATH topology
4R4MA 2E74C 3AEAC 1UIXA 5L8RJ 2E76B 1PV3A 4H13D 4OGQB 2BEZF 2E76C 2H89C 4OGQC 3D6ZA 2YIUC 4R4LA 3AEFC 3AE8C 4XFJA 4U7JA 2E75D 3ABVC 1EXJA 2ZT9D 1MKMA 1DD3A 1PIXA 2NZ2A 3Q1MA 1VF5B 5KKZC 1VF5C 1KMIZ 3AE2C 1OMIA 3SFEC 3EWKA 3Q5PA 2JO1A 4I7ZB 2P10A 4RKUJ 4I7ZC 1K04A 1Y9BA 2BEQD 1EXIA 2WSCJ 1IK7A 4PV1B 3FGAD 1RQUA 3GF7A 4TT3H 4PV1C 4GDOA 2H88C 2QJYC 3AE4C 3O6QA 1AJYA 3RL0g 2WSEJ 5KLIC 4YXDC 2G8YA 1OW7A 3Q5RA 2D2CD 3SFDC 1ZOYC 4H0LB 3D6YA 3R4YA 4H0LC 1ZRTE 3D70A 1NGMB 2J5UA 2QJPC 3B71A 1K05A 1ZMEC 1DD4A 3G9RA 4Y28J 4H44D 4H13B 2WPVB 3AE3C 3AEGC 3C8VA 2O01J 1YQ4C 2V7QJ 3AEBC 4H13C 2QSIA 3Q5SA 1TU3F 2E74D 1S1CX 1Q90D 3AE6C 3D71A 1FDIA 2E76D 1KQGB 2E75B 4OGQD 3IN6A 2ZT9B 2E75C 2YMKA 1U57A 1HF9A 2FYNC 2ZT9C 3GF3A 2IDBA 1OW8A 1R8EA 3AE9C 3RK3E 1DIPA 1KILE 1KORA 1PL5A 2FXPA 4YTPC 2MKVA 3AE5C 2G3AA 1ZP0C 3GMAA 1WMKA 3Q3DA 1HJ0A 1NYHA 5M1BA 3Q2YA 4IL6X 3S9OA 3IAOA 1VF5D 1FDOA 4KT0J 3LW5J 3T97B 1JB0J 1YQ3C 1RQVA 3AE7C 3AEEC 3AE1C 3H25A 4Z1MH 1OW6A 1GMJA 2D2CB 1KQFB 2FBWC 2OQQA 4PV1D 2D2CC 2K9YA 2WQYC 3AECC 1KTMA 1S5LX 4H44B 2JP3A 4H0LD 3AEDC 4H44C 2WSFJ 3GLMA 2QIWA 2QJKC 2E74B 1VL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KT0 J;  2O01 J;  3LW5 J;  1JB0 J;  2QSI A;  4I7Z B;  3C8V A;  4RKU J;  5L8R J;  2E76 B;  4OGQ B;  1Q90 D;  2WSC J;  2YIU C;  4PV1 B;  2E75 B;  2ZT9 B;  2D2C B;  2QJY C;  2FYN C;  2WSE J;  5KLI C;  2K9Y A;  4H0L B;  1ZRT E;  1S5L X;  4H44 B;  2QJP C;  1VF5 B;  2WSF J;  5KKZ C;  2QIW A;  2QJK C;  4Y28 J;  4IL6 X;  2E74 B;  4H13 B;  2WPV B; 
#chains in the Genus database with same CATH topology
 4R4M A;  1HGV A;  1LNQ A;  4MN4 C;  3M0D A;  2E76 B;  1AVO A;  1Y47 A;  1DD3 A;  2J59 M;  1OIP A;  1SQX G;  3E7K A;  2Z5H A;  3B5N C;  3H1L D;  3LID A;  2C0X A;  1P84 E;  2P67 A;  3CXH H;  3CCR P;  1Y9B A;  1EDK A;  4D6T E;  2O1J A;  1LP1 A;  2D2C D;  2O01 H;  3CC7 P;  2J5U A;  2QJP C;  3L71 D;  1LTG C;  2XNX A;  2IBZ E;  3PLN A;  3CMA P;  3HUS B;  3FWN A;  3RK2 B;  3S1K A;  2N1T B;  1OXZ A;  2IDB A;  4L74 A;  2Q9I A;  4PJ0 H;  4N78 D;  3EQ2 A;  3CXH D;  1Q81 Q;  1WMK A;  1M7L A;  1LTS C;  5M1B A;  3H1I G;  2IZ0 A;  4LGD E;  1JB0 J;  1YQ3 C;  1HH0 A;  1NU1 E;  4WY4 A;  4GIF A;  5AVR B;  5AW0 B;  3IFM A;  5AVW B;  2D2C C;  4EI2 A;  1S9K D;  3RGU A;  1P84 H;  1RF0 A;  1JTH A;  1RE3 A;  1SQQ D;  2AXC A;  3AEA C;  4OGQ B;  5AW6 B;  3V4W A;  1KZU B;  4B86 A;  1J1D C;  3WMM 0;  5DJU B;  1NTZ E;  1YBK A;  3HTK A;  3ABV C;  1EXJ A;  2ZT9 D;  3I55 P;  3I5C A;  4WB4 A;  2KK7 A;  1PGJ A;  2JEE A;  1SQV J;  1FOS E;  4Y99 C;  3VOP A;  5GTH E;  2A45 G;  2M3B A;  3GF7 A;  3K5B A;  4U3F G;  4PD4 I;  3CCM P;  1P84 D;  4YXD C;  3L75 G;  2HFE D;  3EFF K;  3SFD C;  3H32 B;  1LTJ A;  4D6T D;  1DX7 A;  4AUW A;  3C8V A;  3BRT B;  3OA7 A;  1QVF O;  1YYC A;  1DEE G;  2IBZ D;  2YMK A;  1N8R Q;  2ZT9 C;  3TYY A;  2QM7 A;  3AE9 C;  1VPC A;  3FWL A;  2OYH B;  1ZP0 C;  4K3A A;  3CCS P;  4DCK A;  1LWU C;  2ZVN B;  1SQX J;  4LLH A;  3V2N A;  5TJH A;  1NU1 D;  1G2C B;  2ZVO B;  3MUD A;  2VRS A;  1NKZ B;  5GTH H;  2KSJ A;  2O3J A;  1PP9 E;  1FZG A;  3M0D C;  4PD4 E;  3I56 P;  2YIU C;  1DEB A;  3C9I A;  3PH0 A;  3TF5 A;  1FS0 E;  2ZAE B;  5AW7 B;  2NZ2 A;  1LT9 A;  3RK3 B;  1YJN P;  3CCJ P;  1KMI Z;  5CMZ A;  3SFE C;  2OYI C;  4I7Z B;  4OVN F;  2WT7 A;  1HBW A;  2QJY B;  1PPJ G;  3H1I J;  2UWJ E;  2WSE J;  5KLI C;  2XDJ A;  5AW4 B;  1BGY J;  1N7S B;  1KFM A;  3L72 G;  2Q5U A;  3WUV A;  2A45 I;  5KJ7 D;  1IZN B;  1VQ8 P;  1DD4 A;  1NJI Q;  1T2K D;  3SSU A;  2V7Q J;  2C9L Y;  3N7N A;  3AE6 C;  1L0N G;  3W67 A;  2HOD B;  1L4A B;  4HYT B;  1EDJ A;  1FC2 C;  5CBN A;  1N86 A;  1KOR A;  2QM8 A;  4GT1 A;  2ZJS E;  4DZO A;  1FZB A;  4PD4 H;  1FDO A;  4EOT A;  2WZ7 A;  3H1J G;  3CX5 I;  3GHG A;  1NWQ A;  4WY4 C;  1LTT C;  1RF1 C;  1GMJ A;  1E5W A;  4PV1 D;  2N9B A;  3H1K G;  5KJ7 C;  4U3F J;  1IFM A;  4H0L D;  3U1C A;  1T2K C;  3L75 J;  1URQ A;  2YNY A;  1M1J B;  1NH4 A;  1SQQ K;  3AE8 C;  4GOE A;  4PD4 D;  4OH8 B;  2MJZ A;  4U3F E;  1CW5 A;  2FYU K;  4JPZ B;  4QMA A;  3L75 E;  3EWK A;  3HD7 D;  2B88 A;  2WSE H;  3FGA D;  1RQU A;  4PV1 C;  1AQT A;  1AJY A;  2Z5I A;  1N73 A;  1VDF A;  2KZJ A;  2WPS A;  3CCQ P;  4H0L C;  1LTJ C;  3M91 A;  2V7Q H;  1VQ7 P;  3HD7 B;  3B71 A;  3CX5 E;  4H44 D;  1YJW P;  2IZ1 A;  1K73 Q;  2B87 B;  1USD A;  3Q5S A;  3RBZ A;  1TU3 F;  2PRR A;  1KB9 I;  1XTC C;  1KYO I;  1S5L E;  1D7M A;  1GD2 E;  5APV A;  2FXP A;  4ZNC A;  2FXM A;  3H1H E;  1A02 J;  1JY3 O;  4ASW A;  3L36 A;  2A45 H;  4JYB A;  2FBW C;  1FOS F;  4JYC A;  2KLU A;  2YMY A;  3MUD C;  2XKM A;  1JY3 P;  4C7N B;  2NPS A;  4H44 C;  3HE4 B;  1RE4 C;  3L72 J;  1MZ9 A;  4HJG H;  4UB6 E;  1QEX A;  1H8A A;  1AQ5 A;  2FFD B;  1IFI A;  5AVY B;  2E75 D;  3MTU E;  3IR9 A;  3CX5 H;  1L0N J;  2JWD A;  1FJK A;  1CI6 B;  1GZL A;  2Q3I A;  5AVS B;  1M8O B;  4M3L A;  2QVA A;  1IC2 A;  5AVU B;  1KB9 E;  3HUS A;  4ZMD A;  1KYO E;  4U3F D;  1S5L H;  3VMY A;  2BEQ D;  1EXI A;  2WSC J;  2R5B A;  3L75 D;  4TT3 H;  4N6J A;  3H1J J;  2W83 C;  3UIA A;  1LT1 A;  2Z4E A;  2AEJ A;  5AVZ B;  1VQ4 P;  1QGK B;  3VN0 A;  1AFO A;  3H1K J;  3CX5 D;  3VMZ A;  2FYN B;  2E75 C;  4HH2 A;  1HF9 A;  2W6A A;  3H1J E;  2ITA A;  1Y8A A;  1SQV K;  3AE5 C;  3M9Q A;  4UB6 H;  1M56 D;  3T97 B;  2POH A;  2PP6 A;  3L35 A;  3H1K E;  1H0T B;  3GHG C;  3C1L A;  3F5H A;  3H1H D;  1USE A;  1YJ9 P;  1S3J A;  2JJL A;  2Q7C A;  2ZYD A;  1MFT A;  3KDP B;  1ZXG A;  1KB9 H;  1KYO H;  2WSF J;  1M57 D;  1HTL C;  1URQ C;  3B5N D;  2K9J B;  4H13 D;  4EDF A;  2FXO A;  1E79 H;  4KHX A;  3FX0 A;  3KYQ A;  3V2R A;  3NMD A;  2P1J A;  3PTZ A;  2YKO A;  1QL1 A;  5B66 E;  3B5N B;  2WSC H;  1OMI A;  1SQX K;  2KB7 P;  2GUV A;  1BE3 G;  4L75 A;  4YPC A;  5H2F E;  2FYU E;  1PPJ D;  2PAJ A;  5AVX B;  3A5T A;  2Y0E A;  3B8E B;  2H88 C;  1KB9 D;  2KOG A;  1KYO D;  2KIK A;  1N73 C;  5AW8 B;  1J1E C;  4IL6 E;  3CD6 P;  3D70 A;  2QJP B;  2KLV A;  2OYH A;  2NPS D;  4H13 C;  2HR3 A;  3CLQ A;  2LR2 A;  4JBZ A;  2RMZ A;  4IFF A;  1NHL A;  3S4R A;  1ZN5 A;  3O6Q B;  3BCC J;  1FBM A;  1G2C A;  5AW9 B;  4IFM A;  1SQB G;  4ZKP A;  3U59 A;  2G3A A;  3GMA A;  2YO2 A;  3H1J D;  1HJ0 A;  1WT6 A;  3RL0 D;  3L73 G;  1BSN A;  1LGH B;  3V2Q A;  2IX7 C;  2BCC G;  2K3R A;  4YXW H;  2D2C B;  1KQF B;  3VTP C;  3H1K D;  3QWO C;  2WSF H;  5B66 H;  2GM4 A;  1BCC G;  1EZV G;  2NPS C;  1N2D C;  5H2F H;  4GKG A;  2WWW A;  1PV3 A;  1SS1 A;  1BGY G;  2HPC A;  1J1D B;  2KS1 A;  4IL6 H;  2P58 A;  3JSV C;  1MKM A;  2WTY A;  3II6 A;  1KQS O;  4Y99 B;  3RL0 C;  2GA1 A;  3HE5 B;  3Q5P A;  1EDL A;  1IK7 A;  2HOD A;  4GDO A;  3A0H E;  2JDI H;  3KQG A;  1NOH A;  2FYU D;  2WSS H;  2XV5 A;  2OTJ P;  1SFC A;  1K05 A;  1Q2N A;  1FU1 A;  4NPD A;  3P8M C;  3CC2 P;  3WUU A;  1L0L G;  3TNU B;  2ZT9 B;  3GF3 A;  1A02 F;  4W80 A;  1YIT P;  1T6A A;  1DH3 A;  1SQV E;  3LW5 J;  1LWU B;  3AE1 C;  3L74 G;  4BXL A;  4L76 A;  3L4F A;  4JQ0 D;  1BE3 J;  1NTM G;  1U7J A;  2K9Y A;  2KNC B;  2W6J H;  4ZKU A;  1AVY A;  1JY2 O;  2QIW A;  2LKM A;  1SQP G;  1ZR2 A;  1R5L A;  2M5A B;  1GU4 A;  3A0H H;  2RH0 A;  3R2P A;  2YIU B;  3CWB G;  1EZV I;  5CCH A;  4W7Z A;  1BE3 E;  1JY2 P;  1VQ5 P;  1GTW A;  5KKZ C;  3CCV P;  2KI7 B;  4KJM A;  2OYI B;  5E79 E;  2B87 A;  2OYO A;  4RKU J;  2WIT A;  1SQB J;  2OTK E;  5KTB A;  1SQX E;  3M0A A;  3CC4 P;  1LP1 B;  2JR8 A;  5KLI B;  3L73 J;  3MZW B;  3O8Z A;  2AEF A;  1AA0 A;  2BCC J;  3MD0 A;  2RN0 A;  3AEB C;  1HGZ A;  1MUU A;  2E74 D;  1SQB E;  2Y9Z A;  1VQO P;  1BCC J;  1L0N K;  3MHV A;  4WY4 D;  2OAR A;  5APW A;  1Q82 Q;  4YTP C;  1UII A;  4O9B A;  1GK6 A;  3LW5 H;  4C7N A;  1NYH A;  1JOC A;  1QVG O;  4WY4 B;  3H6P A;  2LXC B;  1FZC A;  1QL2 A;  1RF1 B;  4I2L C;  1EZV E;  1SQV D;  2FFD A;  3H1I E;  3P32 A;  3F89 A;  5E79 H;  1BGY E;  2NRG A;  1CI6 A;  1JTH B;  1Z56 A;  4DOJ A;  5APT A;  1SFC D;  3KPE A;  2E74 C;  1BSH A;  3SWK A;  2DW3 A;  4I6M C;  1L0L J;  1RF0 C;  1KIL A;  1RE3 C;  1BE3 D;  1LTB C;  3AE2 C;  2IPP A;  1R5S A;  2JKV A;  1YTZ T;  4PV1 B;  2IYO A;  3BAT A;  1IJD B;  2M3E A;  1GL2 A;  4H0L B;  1LTJ B;  2PFX A;  1ZLL A;  3L74 J;  1SQX D;  2Q6Q A;  1JMM A;  1L0L E;  1NAF A;  1SFC C;  3GW6 A;  1PFI A;  1HVV A;  5AW3 B;  1NTM J;  3CPW O;  3WUT A;  1HJB A;  1H0T A;  1LJ2 A;  1JCD A;  1SQP J;  1U7M A;  1M90 Q;  2YO3 A;  1SQB D;  1JUN A;  2L5G B;  1KIL E;  2CPB A;  3L74 E;  3TK1 A;  1OZH A;  3E1I A;  3W68 A;  3CWB J;  2Y0D A;  2K1A A;  1SVF A;  4ASV A;  1FZE A;  1RQV A;  3NFQ A;  5APS A;  1N7L A;  1T3U A;  1T8Z A;  2P2U A;  2W6B A;  3SWY A;  3MIW A;  1BCC D;  3AEC C;  1EZV D;  1KTM A;  4H44 B;  3H1I D;  3CWB E;  5AVV B;  2QJK C;  4HB1 A;  2OGU A;  1BGY D;  1M1K Q;  3TSI A;  1YTZ I;  3OW2 O;  3D6Z A;  3L70 G;  1FDM A;  1VQM P;  1RHZ B;  1GK4 A;  2H8P D;  4D6T G;  3BCC G;  2WT7 B;  4UB8 E;  3AE4 C;  3O6Q A;  4HKZ H;  2WPQ A;  1IK9 A;  2AXT E;  1YI2 P;  1J2J B;  5APX A;  1ZME C;  1LT9 C;  2Y0C A;  3TDK A;  1OWA A;  1PPJ E;  1JCC A;  1YQ4 C;  5CHX A;  5KLV G;  3QH9 A;  3L72 E;  1Q90 D;  4A7P A;  2ZFC A;  1L0L D;  5B5E E;  2IYP A;  4AYC A;  1KQG B;  2E75 B;  2N1T A;  1CSB A;  2YXR B;  1PGP A;  1R8E A;  1NU1 G;  3CL3 D;  1L0N E;  1AV1 A;  2KXP B;  1KIL D;  1VF5 D;  1X22 A;  3IAO A;  3L74 D;  3AEE C;  4I1L A;  3GHG B;  1URQ D;  4JF7 A;  1FZC C;  4W7Y A;  2KUB A;  1GL2 D;  3A0B E;  2XU6 A;  3GLM A;  2E5Y A;  1NTZ G;  4UB8 H;  1YHQ P;  3CWB D;  2AXT H;  1JM0 A;  2O1K A;  2LXB A;  4GOF A;  1KIL C;  1VF5 C;  5B5E H;  1S72 P;  2CK3 H;  2K88 A;  2HLO A;  2QE7 H;  1KQL A;  4BRY B;  3JC2 2;  3IF4 A;  1N73 B;  2G8Y A;  1J1E B;  1JY2 N;  2E43 A;  1GL2 C;  2FKW B;  3H32 A;  3VP9 A;  2FY8 A;  1PGQ A;  1K8A Q;  4H13 B;  2WPV B;  2ZYA A;  3TGU G;  1JNM A;  2QSI A;  1LWU A;  4IFD K;  2E76 D;  3A0B H;  3L72 D;  2IFN A;  2KNC A;  4WVZ A;  2B89 A;  1IO4 A;  3L70 J;  1FAV A;  1IFP A;  1SQB K;  3GG2 A;  5AW2 B;  3S9O A;  1H89 A;  4KT0 J;  2A06 G;  2M5A A;  1L0N D;  2C9N Y;  3AE7 C;  2M8R A;  5C39 A;  3HRN A;  4D6T J;  1PP9 G;  3E1R A;  5CBO A;  1NTK G;  2XND H;  1KN7 A;  5AW1 B;  2WQY C;  3A3Y B;  3CME P;  2AEM A;  1X9V A;  3JCU E;  3L70 E;  3V4Q A;  2NPS B;  1VQ9 P;  2B9B A;  3AED C;  2OYI A;  1MFZ A;  3CCE P;  1GW4 A;  2E76 C;  4R4L A;  1NO4 A;  3V5B A;  3RK2 D;  1Q86 Q;  2N1T D;  5KLV J;  3BCC E;  1OVU A;  1PIX A;  1W5C E;  3P8C E;  3RL0 B;  3M9H A;  1NU1 J;  2YKP A;  3VMA A;  2R3S A;  5KLV E;  1OW7 A;  2GUS A;  1H88 A;  1KC8 Q;  2QG4 A;  1N7S A;  3R4Y A;  1SLQ A;  4WWI A;  2RKL A;  4AQR D;  3NTN A;  4RJT A;  1S1C X;  1L2P A;  1QLE D;  3HUS C;  1PGO A;  1RF1 A;  3RK2 C;  4OGQ D;  2WMM A;  2N1T C;  1NTZ J;  1U57 A;  1L4A A;  3JCU H;  3KZI E;  1G1J A;  1L0L K;  4XA4 A;  3RK3 E;  5KJ7 A;  3OAK A;  2MKV A;  1WRG A;  5KAI E;  2C0W A;  1S4X A;  2KSE A;  1S2E A;  3KXD A;  1OW6 A;  2I1J A;  4RES B;  1CZQ A;  1XTG B;  3BVH A;  5AVT B;  4EYY Q;  5K5G B;  1NTM K;  4WBA A;  2JWA A;  4NPF X;  2R44 A;  2N9Y B;  1SQP K;  3L70 D;  2H89 C;  1M1J A;  4OGQ C;  2W90 A;  4L73 A;  1IFJ A;  3TGU J;  2FYZ A;  3VP8 A;  2CPS A;  2R3C A;  2QRX A;  4NPE A;  4TLF A;  5KKZ B;  2Y9Y A;  3A2A A;  2ZXE B;  3BCC D;  2P10 A;  3KZI H;  3P8C D;  1KFN A;  3NXS A;  5BU5 A;  4C46 A;  3TGU E;  3G71 P;  1LTI C;  1X8Y A;  3V2P A;  2WVR A;  3FXE A;  5KAI H;  1PP9 J;  3LIE A;  3HD7 A;  1GDT A;  1JY3 N;  2Q1K A;  1NTK J;  3G9R A;  5KLV D;  2M0B A;  3RBX A;  3PRJ A;  1FDI A;  1BDC A;  1QX8 A;  3VMX A;  5GTI E;  2A06 E;  3H1H G;  5APQ A;  1DIP A;  1PL5 A;  2OYH C;  3Q3D A;  2YKQ A;  1NTK E;  3RK3 D;  1RE4 A;  3N4X A;  1JEK A;  1JMB A;  3MP7 B;  5BVZ A;  2R32 A;  3G4S P;  2XZR A;  3L73 E;  3CI9 A;  1N7S D;  1NKN A;  1NTZ D;  2JP3 A;  2BCC E;  3ITK A;  2E74 B;  3HE4 A;  1RH5 B;  1HUC A;  2HPC B;  2KS1 B;  5CJ0 A;  1VQP P;  1BCC E;  3V6I A;  3AEF C;  4XFJ A;  4C7R A;  1EDI A;  4U7J A;  2J58 A;  1L4A D;  1IFN A;  3RK3 C;  1FJP A;  2JO1 A;  4K35 A;  5GTI H;  4I7Z C;  3H1L G;  1K04 A;  1FZA A;  1VQK P;  2L91 A;  1OFC X;  2H7H A;  2Q3E A;  2QJY C;  1X0T A;  3HTK B;  1K9M Q;  3Q5R A;  2P7J A;  1W2B O;  3U1A A;  3FXD A;  1N7S C;  2R5D A;  2QA4 P;  1Q7Y Q;  1NGM B;  1SFC B;  3TGU D;  4Y28 J;  1VQL P;  3AE3 C;  2ZXX A;  2WPR A;  3L71 G;  3BAS A;  5CCG A;  4RO0 A;  1X79 B;  1YIJ P;  3IN6 A;  2ZYG A;  1L4A C;  1NAY A;  3PP5 A;  2A06 D;  1OX3 A;  3VYI A;  3T97 A;  1PP9 D;  2K37 A;  3H25 A;  1NTK D;  2W27 A;  1G1I A;  4LC1 A;  3P7K A;  5AVQ B;  5CCH D;  1S5L X;  1OVV A;  4IOI H;  2W8Z A;  2QJK B;  2O01 N;  5KAF E;  5CJ4 A;  3L73 D;  1SQQ G;  1NTM E;  2KZI A;  1UIX A;  5L8R J;  2K9J A;  1M1J C;  2BCC D;  4BRY A;  1EQ7 A;  1SQP E;  2E5T A;  3L37 A;  2FYU G;  3Q1M A;  1KD1 Q;  1GW3 A;  3B5N A;  3H1H J;  5APU A;  4XE5 B;  3RL0 g;  5TIS E;  5CCH C;  2QEX P;  3SWF A;  1ZRT E;  1LT9 B;  2HYN A;  2IFM A;  3HD7 C;  3CCU P;  3AEG C;  4N3Y B;  4DT0 A;  3D71 A;  3PHL A;  5KLV K;  3CCL P;  1ZW0 A;  3A7O A;  2I8D A;  2IBZ G;  5KAF H;  3WU2 E;  5AW5 B;  1NU1 K;  1ZV8 A;  4OWF A;  1FZC B;  1VQN P;  4Z1M H;  1FE6 A;  1GU5 A;  3CXH I;  3H1L J;  3PJS K;  3OJA B;  1NVO A;  3BRV B;  3EFG A;  3M9B A;  1NTZ K;  5APY A;  5TIS H;  1HWT C;  2BEZ F;  1FZF A;  5CCG D;  2PGD A;  2YXQ B;  2V4H A;  1NTM D;  1RY3 A;  2FFD C;  3L71 J;  2OTL P;  1MV8 A;  3H1L E;  4BWN A;  5EFW B;  2KYV A;  1KIL B;  1VF5 B;  2KP8 A;  1SQP D;  2SPZ A;  5BU8 B;  1URQ B;  4EIJ A;  3HE5 A;  2I1K A;  3WU2 H;  3G3Z A;  2H43 A;  1VQ6 P;  3L71 E;  1GL2 B;  1ZOY C;  3D6Y A;  4GOD A;  1SP4 A;  3B4S A;  3M06 A;  3MGN A;  2O01 J;  3ZDM A;  1ZRT D;  1IFD A;  5CCG C;  1P84 I;  1KV4 A;  1PZQ A;  2E42 A;  3KHU A;  4N78 E;  1BDD A;  3CXH E;  3TNU A;  2FYN C;  1SQV G;  1SQQ J;  1OW8 A;  1EC5 A;  3G6E P;  1W2E A;  4CPG A;  3Q2Y A;  2BAS A;  4IL6 X;  1OVR A;  2IBZ I;  3USS A;  2FYU J;  1S9K E;  1ZR4 A;  1JO5 A;  5DJT B;  2OQQ A;  1LTA C;  1SQQ E;  1T3J A;  1NTK K;  4DJG A;  4PJ0 E;  2HG5 D;  1VL2 A; 
#chains in the Genus database with same CATH homology
 4R4M A;  2E74 C;  3AEA C;  1UIX A;  5L8R J;  2E76 B;  1PV3 A;  4H13 D;  4OGQ B;  2BEZ F;  2E76 C;  2H89 C;  4OGQ C;  3D6Z A;  2YIU C;  4R4L A;  3AEF C;  3AE8 C;  4XFJ A;  4U7J A;  2E75 D;  3ABV C;  1EXJ A;  2ZT9 D;  1MKM A;  1DD3 A;  1PIX A;  2NZ2 A;  3Q1M A;  1VF5 B;  5KKZ C;  1VF5 C;  1KMI Z;  3AE2 C;  1OMI A;  3SFE C;  3EWK A;  3Q5P A;  2JO1 A;  4I7Z B;  2P10 A;  4RKU J;  4I7Z C;  1K04 A;  1Y9B A;  2BEQ D;  1EXI A;  2WSC J;  1IK7 A;  4PV1 B;  3FGA D;  1RQU A;  3GF7 A;  4TT3 H;  4PV1 C;  4GDO A;  2H88 C;  2QJY C;  3AE4 C;  3O6Q A;  1AJY A;  3RL0 g;  2WSE J;  5KLI C;  4YXD C;  2G8Y A;  1OW7 A;  3Q5R A;  2D2C D;  3SFD C;  1ZOY C;  4H0L B;  3D6Y A;  3R4Y A;  4H0L C;  1ZRT E;  3D70 A;  1NGM B;  2J5U A;  2QJP C;  3B71 A;  1K05 A;  1ZME C;  1DD4 A;  3G9R A;  4Y28 J;  4H44 D;  4H13 B;  2WPV B;  3AE3 C;  3AEG C;  3C8V A;  2O01 J;  1YQ4 C;  2V7Q J;  3AEB C;  4H13 C;  2QSI A;  3Q5S A;  1TU3 F;  2E74 D;  1S1C X;  1Q90 D;  3AE6 C;  3D71 A;  1FDI A;  2E76 D;  1KQG B;  2E75 B;  4OGQ D;  3IN6 A;  2ZT9 B;  2E75 C;  2YMK A;  1U57 A;  1HF9 A;  2FYN C;  2ZT9 C;  3GF3 A;  2IDB A;  1OW8 A;  1R8E A;  3AE9 C;  3RK3 E;  1DIP A;  1KIL E;  1KOR A;  1PL5 A;  2FXP A;  4YTP C;  2MKV A;  3AE5 C;  2G3A A;  1ZP0 C;  3GMA A;  1WMK A;  3Q3D A;  1HJ0 A;  1NYH A;  5M1B A;  3Q2Y A;  4IL6 X;  3S9O A;  3IAO A;  1VF5 D;  1FDO A;  4KT0 J;  3LW5 J;  3T97 B;  1JB0 J;  1YQ3 C;  1RQV A;  3AE7 C;  3AEE C;  3AE1 C;  3H25 A;  4Z1M H;  1OW6 A;  1GMJ A;  2D2C B;  1KQF B;  2FBW C;  2OQQ A;  4PV1 D;  2D2C C;  2K9Y A;  2WQY C;  3AEC C;  1KTM A;  1S5L X;  4H44 B;  2JP3 A;  4H0L D;  3AED C;  4H44 C;  2WSF J;  3GLM A;  2QIW A;  2QJK C;  2E74 B;  1VL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...