2WPVB

Crystal structure of s. cerevisiae get4-get5 complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
48
structure length
48
Chain Sequence
GPEHEFVSKFLTLATLTEPKLPKSYTKPLKDVTNLGVPLPTLKYKYKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Get4-Get5 Complex and its Interactions with Sgt2, Get3, and Ydj1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords UPF0363 PROTEIN YOR164C
total genus 7
structure length 48
sequence length 48
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2009-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2wpvB01
4OGQB 1Q90D 2FYNC 3C8VA 2QIWA 4PV1B 4H0LB 5KKZC 3LW5J 2WPVB 2K9YA 4KT0J 1ZRTE 1JB0J 2QJKC 5KLIC 1S5LX 2D2CB 2QJYC 4H44B 2WSFJ 2QJPC 2ZT9B 2E75B 2WSCJ 2YIUC 4RKUJ 4I7ZB 1VF5B 2E76B 2WSEJ 4H13B 5L8RJ 4IL6X 2O01J 4Y28J 2QSIA 2E74B
chains in the Genus database with same CATH superfamily
1CI6A 1SQPJ 3M0DA 1MFTA 1FU1A 1EXIA 1L0LD 3JC22 1BE3D 5BU8B 1RF0C 1S5LH 3RK2D 1KZUB 3VOPA 3MUDC 1VQLP 1YJNP 1BDCA 4C7NA 1CSBA 2XNXA 3CXHH 3OA7A 2K9YA 4PV1C 2H43A 1NTKG 1PP9J 2OGUA 2YMYA 3KDPB 4HH2A 1XTGB 2NPSB 1E79H 1RE4C 1L0NG 2GA1A 4LLHA 1SQBK 1P84H 3RL0g 1QL2A 3WUUA 2J58A 4L73A 2HFED 2K9JA 3L36A 3L74D 2E74D 2Y0CA 1VDFA 2FXPA 1IFPA 1JY3N 1SQXG 2FYUD 2PRRA 3BCCD 1YJ9P 4DZOA 1KN7A 3HE5A 2E76C 1NTKJ 4UB6H 4Z1MH 2WSSH 3O6QA 2YMKA 4IFFA 1H0TB 2P7JA 4I7ZB 1SQQE 3L71J 2O01N 2C0WA 4H13B 2IBZI 5CBOA 3PJSK 1RF1C 3CLQA 3O8ZA 3GG2A 4XFJA 1IFNA 2W83C 2Y0DA 1KFNA 3RBXA 1HJBA 4EOTA 4A7PA 1QVFO 1OXZA 3GMAA 3FXDA 1NTKD 1BDDA 1FZEA 1S2EA 2RH0A 3H1LD 4PD4D 1RF0A 3TK1A 3U1CA 3CC7P 3H1HD 3KZIH 1M7LA 2IZ0A 1GZLA 1DEBA 3CWBD 3GW6A 4YXDC 1SQBE 3NXSA 5KJ7D 3I55P 3G4SP 4LC1A 5AVWB 3TSIA 3RK3B 3SWFA 5AVRB 4D6TJ 4H44C 5KLVE 2MJZA 5AVYB 5B66E 2A06D 2AEFA 1HGVA 1KQGB 3HUSC 1L4AC 3HUSB 3NMDA 3KHUA 4N3YB 3K5BA 2E75B 3A2AA 4RKUJ 3OW2O 1NTZD 1VQOP 1A02J 1U7MA 1N73A 3L74E 2GUSA 5AW4B 2OYOA 3H1KG 1EDKA 1KYOE 1S3JA 1KORA 1KMIZ 3P7KA 1NAYA 4NPDA 3GLMA 4Y28J 4QMAA 2ZFCA 3L73E 2FYNC 2M0BA 2O1JA 4WVZA 1SVFA 1X9VA 1SQVD 1GW4A 2PGDA 3ITKA 4Y99C 4BWNA 5E79E 4C46A 1SQXJ 2RMZA 1OVVA 3ABVC 3L72G 3BVHA 5CMZA 1BCCD 3V2QA 2SPZA 3WU2H 2FBWC 3AE8C 1Z56A 2OTJP 2V7QH 2WTYA 3CX5I 3EQ2A 1MUUA 3EWKA 3L75D 3TGUG 4XE5B 1D7MA 2IDBA 2IFMA 1PP9G 3CX5H 5TISH 2E5YA 2ZXXA 5APUA 1YI2P 1HUCA 3HTKB 1ZXGA 3N4XA 3VMZA 1ZR4A 1BCCG 2C0XA 1Y8AA 1L4AB 3GHGB 3H6PA 5AVXB 1Q2NA 2WT7B 2OYIC 2OYIB 3Q1MA 3HE4A 3VP9A 1NHLA 2QSIA 1QVGO 4DJGA 2LR2A 1X79B 1FDOA 1MZ9A 1OW6A 2P67A 3WUTA 1EZVE 4DOJA 1AA0A 4OH8B 2FYUK 1KB9D 4HYTB 4JQ0D 4PJ0H 2Q3EA 2XZRA 5GTHH 4GIFA 5KLIC 4UB8H 1YIJP 5AVVB 2NPSA 3RK3C 3VMXA 1NU1E 3CXHE 3TNUA 4EYYQ 1L0ND 2V4HA 4RESB 3VMAA 2KNCA 2WSFJ 2W27A 1GW3A 3A0BE 3P8MC 1NWQA 1S1CX 3AEBC 1JTHA 2BEQD 3B5ND 3H1HG 2WSCJ 3CCUP 3FWLA 4CPGA 1N73C 3GF7A 1IK9A 2HPCB 2E76B 3CWBG 1LTJC 3A0HH 5KTBA 1YQ3C 2L5GB 1NAFA 2E42A 2BCCE 2XKMA 1JTHB 1L0NJ 4H13C 3V2NA 3MUDA 5APQA 2WSFH 2E43A 1OMIA 1LT9B 2Q6QA 3I56P 2UWJE 2Y9YA 2ZAEB 1PV3A 3IF4A 1QX8A 2Q3IA 3TNUB 4N78D 3USSA 1FJKA 1ZRTE 2QM7A 1RF1A 3JSVC 1AVYA 1SFCD 1GL2B 1SS1A 1RHZB 2N1TC 1GK6A 1SQXK 1T6AA 2D2CC 2QJYC 4C7RA 1EZVD 1IFJA 2H88C 2R44A 3L71G 3H1JJ 4H44B 1G1IA 2C9LY 2FXMA 1HGZA 2FYUG 2W90A 3BCCG 1KB9E 3AE2C 3CI9A 1FDIA 2AEJA 5M1BA 3RGUA 5GTIH 1JY3O 1ZN5A 2ZT9B 2N9YB 3H32A 1EDJA 1JUNA 3FGAD 4KHXA 1W5CE 3CCLP 1NO4A 2B87B 2K88A 4U3FJ 5CHXA 5L8RJ 5CCHC 2POHA 4JYBA 1ZOYC 1L0LG 2O01J 2VRSA 4UB6E 5AVSB 1NU1K 3Q3DA 3SWYA 3TYYA 1N7SD 2Y9ZA 1BE3G 2QIWA 1HBWA 3JCUE 2NRGA 2FXOA 4U3FD 1LP1B 2W6BA 2KP8A 5B5EH 3CCSP 3MD0A 4B86A 1KILE 5KAIE 2IYOA 1SQVG 1T3UA 1BGYJ 2QJKC 1SQPG 1X22A 1GL2A 2ZXEB 3U1AA 1SLQA 4IFMA 2WZ7A 3M9BA 3CCMP 2QG4A 1DD4A 1LNQA 3FX0A 2M3EA 1BGYD 3H25A 3H1JE 1VL2A 2N9BA 3RK2B 2GM4A 5APXA 2P10A 1R8EA 3V4QA 1N7SB 1M90Q 1VQ7P 1S72P 1FZCC 1LT1A 4I7ZC 3IAOA 4MN4C 1K05A 1RH5B 2IZ1A 2QE7H 3AEFC 1LTAC 3AE1C 3C1LA 3RK3D 1ZV8A 4R4MA 1BSNA 5APYA 4ZKUA 2KB7P 3E1IA 2PAJA 5AW9B 2AEMA 4ZNCA 1JMMA 2I1KA 1FBMA 3H1IE 4K3AA 1NKNA 4EDFA 3IR9A 2FFDA 1L0NE 4YPCA 2A06G 2M5AB 4K35A 4OGQC 5KKZC 1ZR2A 2BCCD 4BXLA 1R5SA 2J5UA 1NH4A 4H0LC 1AJYA 3SFEC 2XDJA 3LIDA 3R2PA 2R5DA 3CCQP 1X0TA 3L75J 2YXRB 3B4SA 4N78E 1PIXA 3F89A 1AVOA 1GMJA 3L70G 3S9OA 1X8YA 2QA4P 3M91A 1JY2N 1S9KE 2OQQA 1IO4A 1FDMA 1GU5A 3WU2E 1M1JA 4TT3H 2Z5IA 1KQLA 1VQ4P 4WB4A 5AW1B 1JNMA 3KZIE 1URQD 2MKVA 2I1JA 3AECC 4PD4H 3UIAA 1N73B 1HWTC 1RE3A 3E7KA 3R4YA 3PRJA 1LTJB 1YBKA 2V7QJ 1VF5C 1ZP0C 2DW3A 3HD7C 4IL6X 1AQ5A 5H2FE 1KILD 1J1DB 1PGOA 2CPSA 2K37A 4GT1A 1NTME 2KI7B 2W6AA 1H88A 3CWBJ 1TU3F 4I2LC 3SWKA 2WPRA 3Q5RA 2KS1B 2RN0A 3AE9C 1VQ5P 1NTZE 3H1HJ 5APSA 1HJ0A 3A5TA 1J1EB 3MZWB 5KLVD 1OZHA 2ZYAA 5C39A 1WT6A 2IPPA 1JB0J 3L37A 1P84I 1OX3A 2E75D 2HODB 2N1TB 3OAKA 1SQBJ 1U7JA 5KAFH 2KSJA 2QRXA 1L0LJ 1Q7YQ 5EFWB 1P84D 2K9JB 3TF5A 2WPQA 3MIWA 1KV4A 4M3LA 2YNYA 2CK3H 3IFMA 3RK2C 3WUVA 3CD6P 4ZMDA 1LJ2A 3AE5C 1LTJA 3H1KE 1PZQA 2KIKA 2W6JH 2YIUB 1MFZA 1T8ZA 2AXTE 3H1LE 2HR3A 1IK7A 1PGQA 2FYUJ 2HODA 2N1TA 2Y0EA 3H1LJ 3T97A 1A02F 3H1JD 4BRYA 3QWOC 2OYHB 3O6QB 1OVRA 1KQFB 1FAVA 1FZBA 1BGYG 1LWUB 4GODA 3MTUE 3L72E 1BCCJ 3L72J 3CX5E 5TISE 3SFDC 2WSCH 4JPZB 1LTTC 3A3YB 3G9RA 3TGUE 1URQA 3T97B 2LKMA 4IFDK 3C9IA 1RQUA 3PTZA 1S5LX 4Y99B 2JWDA 3V6IA 1NTMD 5KLIB 5B5EE 1KQSO 1DD3A 2W8ZA 3L70D 2ZVNB 4RJTA 1CW5A 1R5LA 3F5HA 4U3FG 3AEEC 1NKZB 3MP7B 2Q7CA 1NJIQ 5AW0B 3M9QA 4LGDE 1SQBG 2B9BA 2KZJA 2KS1A 2R3CA 2QJPC 1GU4A 1DX7A 5CCHA 2IBZG 2KYVA 5H2FH 1G2CA 1OWAA 2E5TA 3LW5H 1URQB 3VN0A 1KYOI 1VF5B 1NU1D 2BEZF 3HD7B 4GOFA 5BVZA 5GTHE 3VYIA 3CC4P 3BRTB 2ZVOB 4OWFA 2QM8A 2IYPA 4IL6H 3FWNA 4D6TG 1H8AA 2PFXA 1T3JA 2H8PD 2M3BA 1PGJA 2I8DA 3A0BH 3L71D 1FZAA 1LT9C 1YYCA 5K5GB 2OARA 3L75E 1PFIA 2HLOA 1WRGA 3LW5J 3G3ZA 1CI6B 2E76D 4WY4A 2Z5HA 1N2DC 1PPJE 4OGQD 1LTBC 1GTWA 4DT0A 3G6EP 1SQQJ 1FZCA 3D70A 2O01H 1JM0A 1KD1Q 4BRYB 2JDIH 4N6JA 3EFGA 1MV8A 1KFMA 2WQYC 1OIPA 1PGPA 3RL0B 3RL0C 3SSUA 2A45H 1G1JA 1IC2A 1SQQG 5AW2B 1NTKK 1ZRTD 2B88A 2ZT9C 1HF9A 2NPSD 1K73Q 5APWA 1GL2D 2A45G 4L76A 1L2PA 3N7NA 4AUWA 2ZYGA 2XV5A 5DJTB 1SFCC 3B71A 1NOHA 2L91A 4HJGH 1LTGC 1IFDA 3V5BA 5CCGD 3BCCJ 1DH3A 1HVVA 3V2PA 3HUSA 1YHQP 2FYNB 1EZVI 4I1LA 2Q5UA 5TJHA 4R4LA 2P1JA 5AW7B 1KB9H 1AFOA 2KOGA 4GDOA 2NZ2A 2G8YA 2NPSC 5KLVG 3PH0A 1Q81Q 1RE3C 1JOCA 4PJ0E 2FYUE 3WMM0 1SQQK 3L35A 4WBAA 3AE3C 4AYCA 3HE4B 5CCHD 1M56D 3D71A 3H1KJ 1ZW0A 2N1TD 3E1RA 1Q82Q 3AEDC 1M1JC 2WT7A 1NTKE 2OYIA 2ITAA 1EDIA 3L73J 3CCRP 3GF3A 3PP5A 1YTZT 1SQVK 2P2UA 3EFFK 2R32A 3JCUH 2A45I 1L0LE 2KSEA 3L74G 1GK4A 1JCDA 2YXQB 3NTNA 3W67A 3G71P 1FZCB 3S4RA 3CX5D 3L73G 2RKLA 5KAIH 1SQPD 1SQXE 1M1KQ 2B89A 2K1AA 2XNDH 4PD4I 5AW5B 1DIPA 2E74B 1SFCB 3H1HE 3HTKA 2E74C 1K04A 1L0NK 1LT9A 4OGQB 3C8VA 3CWBE 1LWUA 3D6ZA 4I6MC 1PP9D 2PP6A 4OVNF 3B5NC 3L4FA 2BCCG 3CMEP 4ASWA 3BRVB 1FC2C 5KJ7C 2HPCA 3U59A 5CCGA 2IFNA 3IN6A 3PHLA 3KPEA 1NVOA 3V2RA 4H13D 4WY4B 2FFDC 1QLED 1EQ7A 4WWIA 1T2KD 1VQ9P 2ZT9D 2O3JA 1LTSC 1UIIA 3VP8A 3VTPC 2BCCJ 3M06A 3D6YA 1OFCX 5AVUB 3KQGA 3RBZA 1SQVJ 2JJLA 1URQC 1IZNB 2LXBA 3MHVA 4IL6E 1EC5A 3L71E 1NTZK 1SFCA 2KZIA 4L75A 3ZDMA 2QJPB 1YJWP 2C9NY 1VQKP 2IX7C 3P32A 1YQ4C 1EZVG 3L74J 3LIEA 2D2CD 3CCEP 4YTPC 5APTA 3GHGC 3H32B 1ZMEC 1RF1B 1JMBA 3H1IJ 1NTZJ 4WY4D 2K3RA 5CJ4A 1KILA 1KC8Q 3AE6C 3RK3E 3CC2P 3M0DC 1GL2C 1KB9I 1NU1G 5AW6B 1KYOD 1YTZI 4DCKA 1OW7A 1JY3P 4AQRD 2R3SA 1L4AA 2JO1A 2WPSA 3H1ID 3Q5PA 4HKZH 1S9KD 4H0LD 2D2CB 2QJYB 2KLVA 1GDTA 1QEXA 1KILB 1JCCA 1SQPE 3RL0D 3II6A 4KJMA 1N86A 1RQVA 4NPEA 4WY4C 3Q5SA 2FFDB 2WWWA 1HTLC 1K8AQ 1M8OB 3B8EB 1FZGA 2Z4EA 2YIUC 2Q1KA 4ASVA 1NTMG 1KTMA 1PP9E 1HH0A 2GUVA 3PLNA 1Q86Q 3BATA 4IOIH 5KAFE 1NGMB 2OTKE 1E5WA 1RE4A 1UIXA 2M5AA 2KUBA 4U7JA 1VF5D 1U57A 1BCCE 3HD7D 3H1KD 3VMYA 2KNCB 1SQXD 5CBNA 1WMKA 5KLVK 1NYHA 1S5LE 3CXHD 3FXEA 4NPFX 2H7HA 1P84E 5B66H 2WVRA 4KT0J 4ZKPA 1CZQA 1YITP 1J1EC 3CXHI 4D6TD 2WITA 1LP1A 4YXWH 1AQTA 1OVUA 3NFQA 1N8RQ 4JF7A 1IFMA 5CJ0A 5GTIE 1N7SC 3OJAB 4W7ZA 3A7OA 4EIJA 1M1JB 5AW3B 2OYHA 2OTLP 2IBZD 1FE6A 2JKVA 1AV1A 1USEA 4JBZA 4RO0A 5APVA 3CMAP 1L0LK 2IBZE 5E79H 3L70E 1J2JB 1BE3E 3L72D 4W80A 3S1KA 1BSHA 3V4WA 2AXCA 3HRNA 3P8CE 3M9HA 3TDKA 2WMMA 1VQPP 2CPBA 1N7SA 2M8RA 1FZFA 1FOSE 2KXPB 3CCJP 2OYHC 1FJPA 1NTMJ 3B5NB 1PL5A 1FOSF 2JWAA 1DEEG 4H0LB 1SQQD 1Y47A 4JYCA 2XU6A 2WPVB 1JY2P 4W7YA 2H89C 2YO2A 5KKZB 2B87A 3A0HE 2FY8A 1VQMP 1NTZG 1NTMK 4L74A 1IFIA 1SP4A 2YO3A 3MGNA 5DJUB 5AVQB 1W2EA 3B5NA 2FYZA 1N7LA 1PPJD 1FS0E 2KLUA 3AEGC 1T2KC 4XA4A 1Y9BA 1K9MQ 1XTCC 1JY2O 2QVAA 1NU1J 3M0AA 4GOEA 2JEEA 1KYOH 1ZLLA 4D6TE 3BASA 4TLFA 5KJ7A 2E75C 5KLVJ 4O9BA 5AVZB 2AXTH 5CCGC 2WSEJ 3H1IG 3BCCE 3W68A 1VQNP 2YKOA 2JP3A 2O1KA 4UB8E 1LWUC 2A06E 2HG5D 2YKPA 2ZYDA 3L75G 3TGUD 3CPWO 1OW8A 1LTIC 1USDA 1PPJG 3I5CA 3KYQA 1J1DC 2HYNA 3H1LG 4H44D 1MKMA 1Q90D 2R5BA 1EDLA 4PV1B 1SQBD 4EI2A 2LXCB 2G3AA 2QJKB 1M57D 2J59M 3Q2YA 1QGKB 3AEAC 3HD7A 4HB1A 3P8CD 2WSEH 3CL3D 1H89A 1BGYE 1BE3J 3AE7C 2JR8A 5AVTB 5AW8B 3CCVP 5BU5A 3AE4C 2Q9IA 1QL1A 3L73D 1LGHB 1IJDB 1JEKA 2KK7A 2FKWB 3QH9A 1KILC 1SQVE 1VPCA 2ZJSE 2QEXP 1EXJA 1GD2E 3HE5B 1VQ8P 1RY3A 3KXDA 1SQPK 2P58A 4PV1D 1VQ6P 1W2BO 1JO5A 1L4AD 4U3FE 2YKQA 4GKGA 3GHGA 4PD4E 3TGUJ 3H1JG 1S4XA 4C7NB 1G2CB 1H0TA 3L70J 2BASA
chains in the Genus database with same CATH topology
4H13C 1KQFB 1EXIA 1OMIA 3AE6C 3RK3E 1PV3A 1OW7A 2K9YA 4PV1C 3G9RA 1ZRTE 3T97B 1RQUA 2JO1A 1S5LX 3Q5PA 4H0LD 2D2CB 1DD3A 2D2CC 2QJYC 3RL0g 2H88C 3AEEC 4H44B 2E74D 2FXPA 5M1BA 3AE2C 3Q5SA 1RQVA 1FDIA 2QJPC 2E76C 4Z1MH 2ZT9B 3O6QA 2YMKA 2YIUC 3FGAD 4I7ZB 1VF5B 2BEZF 1KTMA 4H13B 5L8RJ 1ZOYC 2O01J 1NGMB 4U7JA 1UIXA 1VF5D 1U57A 4XFJA 3Q3DA 2QIWA 1WMKA 3GMAA 1NYHA 3LW5J 2E76D 1KILE 4KT0J 4OGQD 2QJKC 3D70A 4YXDC 4H44C 2WQYC 1DD4A 3H25A 1KQGB 1VL2A 2ZT9C 1HF9A 2P10A 1R8EA 2E75B 4RKUJ 4I7ZC 3IAOA 1K05A 3AEFC 3B71A 3AE1C 4R4MA 1KORA 1KMIZ 4Y28J 3GLMA 2FYNC 4R4LA 1PL5A 4H0LB 4GDOA 4OGQC 5KKZC 2NZ2A 2G8YA 2WPVB 2J5UA 2H89C 4H0LC 1AJYA 3SFEC 3ABVC 3AE3C 3D71A 2FBWC 3AE8C 3AEDC 1PIXA 3EWKA 1GMJA 2IDBA 3S9OA 3GF3A 3AEGC 2OQQA 3SFDC 1Y9BA 4TT3H 2E75C 2MKVA 3AECC 2WSEJ 2JP3A 3R4YA 3Q1MA 2V7QJ 4IL6X 1VF5C 1ZP0C 2QSIA 1OW8A 2E74B 1DIPA 4H44D 2E74C 1K04A 4OGQB 3D6ZA 1MKMA 1Q90D 1TU3F 3C8VA 1FDOA 1OW6A 4PV1B 3Q5RA 3AE9C 2G3AA 1HJ0A 3Q2YA 3AEAC 1JB0J 3AE7C 2E75D 5KLIC 3AE4C 3IN6A 4H13D 2WSFJ 2ZT9D 3D6YA 1EXJA 3AE5C 1S1CX 3AEBC 2BEQD 4PV1D 2WSCJ 3GF7A 1IK7A 2E76B 1YQ4C 1YQ3C 2D2CD 4YTPC 1ZMEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OGQ B;  1Q90 D;  2FYN C;  3C8V A;  2QIW A;  4PV1 B;  4H0L B;  5KKZ C;  3LW5 J;  2WPV B;  2K9Y A;  4KT0 J;  1ZRT E;  1JB0 J;  2QJK C;  5KLI C;  1S5L X;  2D2C B;  2QJY C;  4H44 B;  2WSF J;  2QJP C;  2ZT9 B;  2E75 B;  2WSC J;  2YIU C;  4RKU J;  4I7Z B;  1VF5 B;  2E76 B;  2WSE J;  4H13 B;  5L8R J;  4IL6 X;  2O01 J;  4Y28 J;  2QSI A;  2E74 B; 
#chains in the Genus database with same CATH topology
 1CI6 A;  1SQP J;  3M0D A;  1MFT A;  1FU1 A;  1EXI A;  1L0L D;  3JC2 2;  1BE3 D;  5BU8 B;  1RF0 C;  1S5L H;  3RK2 D;  1KZU B;  3VOP A;  3MUD C;  1VQL P;  1YJN P;  1BDC A;  4C7N A;  1CSB A;  2XNX A;  3CXH H;  3OA7 A;  2K9Y A;  4PV1 C;  2H43 A;  1NTK G;  1PP9 J;  2OGU A;  2YMY A;  3KDP B;  4HH2 A;  1XTG B;  2NPS B;  1E79 H;  1RE4 C;  1L0N G;  2GA1 A;  4LLH A;  1SQB K;  1P84 H;  3RL0 g;  1QL2 A;  3WUU A;  2J58 A;  4L73 A;  2HFE D;  2K9J A;  3L36 A;  3L74 D;  2E74 D;  2Y0C A;  1VDF A;  2FXP A;  1IFP A;  1JY3 N;  1SQX G;  2FYU D;  2PRR A;  3BCC D;  1YJ9 P;  4DZO A;  1KN7 A;  3HE5 A;  2E76 C;  1NTK J;  4UB6 H;  4Z1M H;  2WSS H;  3O6Q A;  2YMK A;  4IFF A;  1H0T B;  2P7J A;  4I7Z B;  1SQQ E;  3L71 J;  2O01 N;  2C0W A;  4H13 B;  2IBZ I;  5CBO A;  3PJS K;  1RF1 C;  3CLQ A;  3O8Z A;  3GG2 A;  4XFJ A;  1IFN A;  2W83 C;  2Y0D A;  1KFN A;  3RBX A;  1HJB A;  4EOT A;  4A7P A;  1QVF O;  1OXZ A;  3GMA A;  3FXD A;  1NTK D;  1BDD A;  1FZE A;  1S2E A;  2RH0 A;  3H1L D;  4PD4 D;  1RF0 A;  3TK1 A;  3U1C A;  3CC7 P;  3H1H D;  3KZI H;  1M7L A;  2IZ0 A;  1GZL A;  1DEB A;  3CWB D;  3GW6 A;  4YXD C;  1SQB E;  3NXS A;  5KJ7 D;  3I55 P;  3G4S P;  4LC1 A;  5AVW B;  3TSI A;  3RK3 B;  3SWF A;  5AVR B;  4D6T J;  4H44 C;  5KLV E;  2MJZ A;  5AVY B;  5B66 E;  2A06 D;  2AEF A;  1HGV A;  1KQG B;  3HUS C;  1L4A C;  3HUS B;  3NMD A;  3KHU A;  4N3Y B;  3K5B A;  2E75 B;  3A2A A;  4RKU J;  3OW2 O;  1NTZ D;  1VQO P;  1A02 J;  1U7M A;  1N73 A;  3L74 E;  2GUS A;  5AW4 B;  2OYO A;  3H1K G;  1EDK A;  1KYO E;  1S3J A;  1KOR A;  1KMI Z;  3P7K A;  1NAY A;  4NPD A;  3GLM A;  4Y28 J;  4QMA A;  2ZFC A;  3L73 E;  2FYN C;  2M0B A;  2O1J A;  4WVZ A;  1SVF A;  1X9V A;  1SQV D;  1GW4 A;  2PGD A;  3ITK A;  4Y99 C;  4BWN A;  5E79 E;  4C46 A;  1SQX J;  2RMZ A;  1OVV A;  3ABV C;  3L72 G;  3BVH A;  5CMZ A;  1BCC D;  3V2Q A;  2SPZ A;  3WU2 H;  2FBW C;  3AE8 C;  1Z56 A;  2OTJ P;  2V7Q H;  2WTY A;  3CX5 I;  3EQ2 A;  1MUU A;  3EWK A;  3L75 D;  3TGU G;  4XE5 B;  1D7M A;  2IDB A;  2IFM A;  1PP9 G;  3CX5 H;  5TIS H;  2E5Y A;  2ZXX A;  5APU A;  1YI2 P;  1HUC A;  3HTK B;  1ZXG A;  3N4X A;  3VMZ A;  1ZR4 A;  1BCC G;  2C0X A;  1Y8A A;  1L4A B;  3GHG B;  3H6P A;  5AVX B;  1Q2N A;  2WT7 B;  2OYI C;  2OYI B;  3Q1M A;  3HE4 A;  3VP9 A;  1NHL A;  2QSI A;  1QVG O;  4DJG A;  2LR2 A;  1X79 B;  1FDO A;  1MZ9 A;  1OW6 A;  2P67 A;  3WUT A;  1EZV E;  4DOJ A;  1AA0 A;  4OH8 B;  2FYU K;  1KB9 D;  4HYT B;  4JQ0 D;  4PJ0 H;  2Q3E A;  2XZR A;  5GTH H;  4GIF A;  5KLI C;  4UB8 H;  1YIJ P;  5AVV B;  2NPS A;  3RK3 C;  3VMX A;  1NU1 E;  3CXH E;  3TNU A;  4EYY Q;  1L0N D;  2V4H A;  4RES B;  3VMA A;  2KNC A;  2WSF J;  2W27 A;  1GW3 A;  3A0B E;  3P8M C;  1NWQ A;  1S1C X;  3AEB C;  1JTH A;  2BEQ D;  3B5N D;  3H1H G;  2WSC J;  3CCU P;  3FWL A;  4CPG A;  1N73 C;  3GF7 A;  1IK9 A;  2HPC B;  2E76 B;  3CWB G;  1LTJ C;  3A0H H;  5KTB A;  1YQ3 C;  2L5G B;  1NAF A;  2E42 A;  2BCC E;  2XKM A;  1JTH B;  1L0N J;  4H13 C;  3V2N A;  3MUD A;  5APQ A;  2WSF H;  2E43 A;  1OMI A;  1LT9 B;  2Q6Q A;  3I56 P;  2UWJ E;  2Y9Y A;  2ZAE B;  1PV3 A;  3IF4 A;  1QX8 A;  2Q3I A;  3TNU B;  4N78 D;  3USS A;  1FJK A;  1ZRT E;  2QM7 A;  1RF1 A;  3JSV C;  1AVY A;  1SFC D;  1GL2 B;  1SS1 A;  1RHZ B;  2N1T C;  1GK6 A;  1SQX K;  1T6A A;  2D2C C;  2QJY C;  4C7R A;  1EZV D;  1IFJ A;  2H88 C;  2R44 A;  3L71 G;  3H1J J;  4H44 B;  1G1I A;  2C9L Y;  2FXM A;  1HGZ A;  2FYU G;  2W90 A;  3BCC G;  1KB9 E;  3AE2 C;  3CI9 A;  1FDI A;  2AEJ A;  5M1B A;  3RGU A;  5GTI H;  1JY3 O;  1ZN5 A;  2ZT9 B;  2N9Y B;  3H32 A;  1EDJ A;  1JUN A;  3FGA D;  4KHX A;  1W5C E;  3CCL P;  1NO4 A;  2B87 B;  2K88 A;  4U3F J;  5CHX A;  5L8R J;  5CCH C;  2POH A;  4JYB A;  1ZOY C;  1L0L G;  2O01 J;  2VRS A;  4UB6 E;  5AVS B;  1NU1 K;  3Q3D A;  3SWY A;  3TYY A;  1N7S D;  2Y9Z A;  1BE3 G;  2QIW A;  1HBW A;  3JCU E;  2NRG A;  2FXO A;  4U3F D;  1LP1 B;  2W6B A;  2KP8 A;  5B5E H;  3CCS P;  3MD0 A;  4B86 A;  1KIL E;  5KAI E;  2IYO A;  1SQV G;  1T3U A;  1BGY J;  2QJK C;  1SQP G;  1X22 A;  1GL2 A;  2ZXE B;  3U1A A;  1SLQ A;  4IFM A;  2WZ7 A;  3M9B A;  3CCM P;  2QG4 A;  1DD4 A;  1LNQ A;  3FX0 A;  2M3E A;  1BGY D;  3H25 A;  3H1J E;  1VL2 A;  2N9B A;  3RK2 B;  2GM4 A;  5APX A;  2P10 A;  1R8E A;  3V4Q A;  1N7S B;  1M90 Q;  1VQ7 P;  1S72 P;  1FZC C;  1LT1 A;  4I7Z C;  3IAO A;  4MN4 C;  1K05 A;  1RH5 B;  2IZ1 A;  2QE7 H;  3AEF C;  1LTA C;  3AE1 C;  3C1L A;  3RK3 D;  1ZV8 A;  4R4M A;  1BSN A;  5APY A;  4ZKU A;  2KB7 P;  3E1I A;  2PAJ A;  5AW9 B;  2AEM A;  4ZNC A;  1JMM A;  2I1K A;  1FBM A;  3H1I E;  4K3A A;  1NKN A;  4EDF A;  3IR9 A;  2FFD A;  1L0N E;  4YPC A;  2A06 G;  2M5A B;  4K35 A;  4OGQ C;  5KKZ C;  1ZR2 A;  2BCC D;  4BXL A;  1R5S A;  2J5U A;  1NH4 A;  4H0L C;  1AJY A;  3SFE C;  2XDJ A;  3LID A;  3R2P A;  2R5D A;  3CCQ P;  1X0T A;  3L75 J;  2YXR B;  3B4S A;  4N78 E;  1PIX A;  3F89 A;  1AVO A;  1GMJ A;  3L70 G;  3S9O A;  1X8Y A;  2QA4 P;  3M91 A;  1JY2 N;  1S9K E;  2OQQ A;  1IO4 A;  1FDM A;  1GU5 A;  3WU2 E;  1M1J A;  4TT3 H;  2Z5I A;  1KQL A;  1VQ4 P;  4WB4 A;  5AW1 B;  1JNM A;  3KZI E;  1URQ D;  2MKV A;  2I1J A;  3AEC C;  4PD4 H;  3UIA A;  1N73 B;  1HWT C;  1RE3 A;  3E7K A;  3R4Y A;  3PRJ A;  1LTJ B;  1YBK A;  2V7Q J;  1VF5 C;  1ZP0 C;  2DW3 A;  3HD7 C;  4IL6 X;  1AQ5 A;  5H2F E;  1KIL D;  1J1D B;  1PGO A;  2CPS A;  2K37 A;  4GT1 A;  1NTM E;  2KI7 B;  2W6A A;  1H88 A;  3CWB J;  1TU3 F;  4I2L C;  3SWK A;  2WPR A;  3Q5R A;  2KS1 B;  2RN0 A;  3AE9 C;  1VQ5 P;  1NTZ E;  3H1H J;  5APS A;  1HJ0 A;  3A5T A;  1J1E B;  3MZW B;  5KLV D;  1OZH A;  2ZYA A;  5C39 A;  1WT6 A;  2IPP A;  1JB0 J;  3L37 A;  1P84 I;  1OX3 A;  2E75 D;  2HOD B;  2N1T B;  3OAK A;  1SQB J;  1U7J A;  5KAF H;  2KSJ A;  2QRX A;  1L0L J;  1Q7Y Q;  5EFW B;  1P84 D;  2K9J B;  3TF5 A;  2WPQ A;  3MIW A;  1KV4 A;  4M3L A;  2YNY A;  2CK3 H;  3IFM A;  3RK2 C;  3WUV A;  3CD6 P;  4ZMD A;  1LJ2 A;  3AE5 C;  1LTJ A;  3H1K E;  1PZQ A;  2KIK A;  2W6J H;  2YIU B;  1MFZ A;  1T8Z A;  2AXT E;  3H1L E;  2HR3 A;  1IK7 A;  1PGQ A;  2FYU J;  2HOD A;  2N1T A;  2Y0E A;  3H1L J;  3T97 A;  1A02 F;  3H1J D;  4BRY A;  3QWO C;  2OYH B;  3O6Q B;  1OVR A;  1KQF B;  1FAV A;  1FZB A;  1BGY G;  1LWU B;  4GOD A;  3MTU E;  3L72 E;  1BCC J;  3L72 J;  3CX5 E;  5TIS E;  3SFD C;  2WSC H;  4JPZ B;  1LTT C;  3A3Y B;  3G9R A;  3TGU E;  1URQ A;  3T97 B;  2LKM A;  4IFD K;  3C9I A;  1RQU A;  3PTZ A;  1S5L X;  4Y99 B;  2JWD A;  3V6I A;  1NTM D;  5KLI B;  5B5E E;  1KQS O;  1DD3 A;  2W8Z A;  3L70 D;  2ZVN B;  4RJT A;  1CW5 A;  1R5L A;  3F5H A;  4U3F G;  3AEE C;  1NKZ B;  3MP7 B;  2Q7C A;  1NJI Q;  5AW0 B;  3M9Q A;  4LGD E;  1SQB G;  2B9B A;  2KZJ A;  2KS1 A;  2R3C A;  2QJP C;  1GU4 A;  1DX7 A;  5CCH A;  2IBZ G;  2KYV A;  5H2F H;  1G2C A;  1OWA A;  2E5T A;  3LW5 H;  1URQ B;  3VN0 A;  1KYO I;  1VF5 B;  1NU1 D;  2BEZ F;  3HD7 B;  4GOF A;  5BVZ A;  5GTH E;  3VYI A;  3CC4 P;  3BRT B;  2ZVO B;  4OWF A;  2QM8 A;  2IYP A;  4IL6 H;  3FWN A;  4D6T G;  1H8A A;  2PFX A;  1T3J A;  2H8P D;  2M3B A;  1PGJ A;  2I8D A;  3A0B H;  3L71 D;  1FZA A;  1LT9 C;  1YYC A;  5K5G B;  2OAR A;  3L75 E;  1PFI A;  2HLO A;  1WRG A;  3LW5 J;  3G3Z A;  1CI6 B;  2E76 D;  4WY4 A;  2Z5H A;  1N2D C;  1PPJ E;  4OGQ D;  1LTB C;  1GTW A;  4DT0 A;  3G6E P;  1SQQ J;  1FZC A;  3D70 A;  2O01 H;  1JM0 A;  1KD1 Q;  4BRY B;  2JDI H;  4N6J A;  3EFG A;  1MV8 A;  1KFM A;  2WQY C;  1OIP A;  1PGP A;  3RL0 B;  3RL0 C;  3SSU A;  2A45 H;  1G1J A;  1IC2 A;  1SQQ G;  5AW2 B;  1NTK K;  1ZRT D;  2B88 A;  2ZT9 C;  1HF9 A;  2NPS D;  1K73 Q;  5APW A;  1GL2 D;  2A45 G;  4L76 A;  1L2P A;  3N7N A;  4AUW A;  2ZYG A;  2XV5 A;  5DJT B;  1SFC C;  3B71 A;  1NOH A;  2L91 A;  4HJG H;  1LTG C;  1IFD A;  3V5B A;  5CCG D;  3BCC J;  1DH3 A;  1HVV A;  3V2P A;  3HUS A;  1YHQ P;  2FYN B;  1EZV I;  4I1L A;  2Q5U A;  5TJH A;  4R4L A;  2P1J A;  5AW7 B;  1KB9 H;  1AFO A;  2KOG A;  4GDO A;  2NZ2 A;  2G8Y A;  2NPS C;  5KLV G;  3PH0 A;  1Q81 Q;  1RE3 C;  1JOC A;  4PJ0 E;  2FYU E;  3WMM 0;  1SQQ K;  3L35 A;  4WBA A;  3AE3 C;  4AYC A;  3HE4 B;  5CCH D;  1M56 D;  3D71 A;  3H1K J;  1ZW0 A;  2N1T D;  3E1R A;  1Q82 Q;  3AED C;  1M1J C;  2WT7 A;  1NTK E;  2OYI A;  2ITA A;  1EDI A;  3L73 J;  3CCR P;  3GF3 A;  3PP5 A;  1YTZ T;  1SQV K;  2P2U A;  3EFF K;  2R32 A;  3JCU H;  2A45 I;  1L0L E;  2KSE A;  3L74 G;  1GK4 A;  1JCD A;  2YXQ B;  3NTN A;  3W67 A;  3G71 P;  1FZC B;  3S4R A;  3CX5 D;  3L73 G;  2RKL A;  5KAI H;  1SQP D;  1SQX E;  1M1K Q;  2B89 A;  2K1A A;  2XND H;  4PD4 I;  5AW5 B;  1DIP A;  2E74 B;  1SFC B;  3H1H E;  3HTK A;  2E74 C;  1K04 A;  1L0N K;  1LT9 A;  4OGQ B;  3C8V A;  3CWB E;  1LWU A;  3D6Z A;  4I6M C;  1PP9 D;  2PP6 A;  4OVN F;  3B5N C;  3L4F A;  2BCC G;  3CME P;  4ASW A;  3BRV B;  1FC2 C;  5KJ7 C;  2HPC A;  3U59 A;  5CCG A;  2IFN A;  3IN6 A;  3PHL A;  3KPE A;  1NVO A;  3V2R A;  4H13 D;  4WY4 B;  2FFD C;  1QLE D;  1EQ7 A;  4WWI A;  1T2K D;  1VQ9 P;  2ZT9 D;  2O3J A;  1LTS C;  1UII A;  3VP8 A;  3VTP C;  2BCC J;  3M06 A;  3D6Y A;  1OFC X;  5AVU B;  3KQG A;  3RBZ A;  1SQV J;  2JJL A;  1URQ C;  1IZN B;  2LXB A;  3MHV A;  4IL6 E;  1EC5 A;  3L71 E;  1NTZ K;  1SFC A;  2KZI A;  4L75 A;  3ZDM A;  2QJP B;  1YJW P;  2C9N Y;  1VQK P;  2IX7 C;  3P32 A;  1YQ4 C;  1EZV G;  3L74 J;  3LIE A;  2D2C D;  3CCE P;  4YTP C;  5APT A;  3GHG C;  3H32 B;  1ZME C;  1RF1 B;  1JMB A;  3H1I J;  1NTZ J;  4WY4 D;  2K3R A;  5CJ4 A;  1KIL A;  1KC8 Q;  3AE6 C;  3RK3 E;  3CC2 P;  3M0D C;  1GL2 C;  1KB9 I;  1NU1 G;  5AW6 B;  1KYO D;  1YTZ I;  4DCK A;  1OW7 A;  1JY3 P;  4AQR D;  2R3S A;  1L4A A;  2JO1 A;  2WPS A;  3H1I D;  3Q5P A;  4HKZ H;  1S9K D;  4H0L D;  2D2C B;  2QJY B;  2KLV A;  1GDT A;  1QEX A;  1KIL B;  1JCC A;  1SQP E;  3RL0 D;  3II6 A;  4KJM A;  1N86 A;  1RQV A;  4NPE A;  4WY4 C;  3Q5S A;  2FFD B;  2WWW A;  1HTL C;  1K8A Q;  1M8O B;  3B8E B;  1FZG A;  2Z4E A;  2YIU C;  2Q1K A;  4ASV A;  1NTM G;  1KTM A;  1PP9 E;  1HH0 A;  2GUV A;  3PLN A;  1Q86 Q;  3BAT A;  4IOI H;  5KAF E;  1NGM B;  2OTK E;  1E5W A;  1RE4 A;  1UIX A;  2M5A A;  2KUB A;  4U7J A;  1VF5 D;  1U57 A;  1BCC E;  3HD7 D;  3H1K D;  3VMY A;  2KNC B;  1SQX D;  5CBN A;  1WMK A;  5KLV K;  1NYH A;  1S5L E;  3CXH D;  3FXE A;  4NPF X;  2H7H A;  1P84 E;  5B66 H;  2WVR A;  4KT0 J;  4ZKP A;  1CZQ A;  1YIT P;  1J1E C;  3CXH I;  4D6T D;  2WIT A;  1LP1 A;  4YXW H;  1AQT A;  1OVU A;  3NFQ A;  1N8R Q;  4JF7 A;  1IFM A;  5CJ0 A;  5GTI E;  1N7S C;  3OJA B;  4W7Z A;  3A7O A;  4EIJ A;  1M1J B;  5AW3 B;  2OYH A;  2OTL P;  2IBZ D;  1FE6 A;  2JKV A;  1AV1 A;  1USE A;  4JBZ A;  4RO0 A;  5APV A;  3CMA P;  1L0L K;  2IBZ E;  5E79 H;  3L70 E;  1J2J B;  1BE3 E;  3L72 D;  4W80 A;  3S1K A;  1BSH A;  3V4W A;  2AXC A;  3HRN A;  3P8C E;  3M9H A;  3TDK A;  2WMM A;  1VQP P;  2CPB A;  1N7S A;  2M8R A;  1FZF A;  1FOS E;  2KXP B;  3CCJ P;  2OYH C;  1FJP A;  1NTM J;  3B5N B;  1PL5 A;  1FOS F;  2JWA A;  1DEE G;  4H0L B;  1SQQ D;  1Y47 A;  4JYC A;  2XU6 A;  2WPV B;  1JY2 P;  4W7Y A;  2H89 C;  2YO2 A;  5KKZ B;  2B87 A;  3A0H E;  2FY8 A;  1VQM P;  1NTZ G;  1NTM K;  4L74 A;  1IFI A;  1SP4 A;  2YO3 A;  3MGN A;  5DJU B;  5AVQ B;  1W2E A;  3B5N A;  2FYZ A;  1N7L A;  1PPJ D;  1FS0 E;  2KLU A;  3AEG C;  1T2K C;  4XA4 A;  1Y9B A;  1K9M Q;  1XTC C;  1JY2 O;  2QVA A;  1NU1 J;  3M0A A;  4GOE A;  2JEE A;  1KYO H;  1ZLL A;  4D6T E;  3BAS A;  4TLF A;  5KJ7 A;  2E75 C;  5KLV J;  4O9B A;  5AVZ B;  2AXT H;  5CCG C;  2WSE J;  3H1I G;  3BCC E;  3W68 A;  1VQN P;  2YKO A;  2JP3 A;  2O1K A;  4UB8 E;  1LWU C;  2A06 E;  2HG5 D;  2YKP A;  2ZYD A;  3L75 G;  3TGU D;  3CPW O;  1OW8 A;  1LTI C;  1USD A;  1PPJ G;  3I5C A;  3KYQ A;  1J1D C;  2HYN A;  3H1L G;  4H44 D;  1MKM A;  1Q90 D;  2R5B A;  1EDL A;  4PV1 B;  1SQB D;  4EI2 A;  2LXC B;  2G3A A;  2QJK B;  1M57 D;  2J59 M;  3Q2Y A;  1QGK B;  3AEA C;  3HD7 A;  4HB1 A;  3P8C D;  2WSE H;  3CL3 D;  1H89 A;  1BGY E;  1BE3 J;  3AE7 C;  2JR8 A;  5AVT B;  5AW8 B;  3CCV P;  5BU5 A;  3AE4 C;  2Q9I A;  1QL1 A;  3L73 D;  1LGH B;  1IJD B;  1JEK A;  2KK7 A;  2FKW B;  3QH9 A;  1KIL C;  1SQV E;  1VPC A;  2ZJS E;  2QEX P;  1EXJ A;  1GD2 E;  3HE5 B;  1VQ8 P;  1RY3 A;  3KXD A;  1SQP K;  2P58 A;  4PV1 D;  1VQ6 P;  1W2B O;  1JO5 A;  1L4A D;  4U3F E;  2YKQ A;  4GKG A;  3GHG A;  4PD4 E;  3TGU J;  3H1J G;  1S4X A;  4C7N B;  1G2C B;  1H0T A;  3L70 J;  2BAS A; 
#chains in the Genus database with same CATH homology
 4H13 C;  1KQF B;  1EXI A;  1OMI A;  3AE6 C;  3RK3 E;  1PV3 A;  1OW7 A;  2K9Y A;  4PV1 C;  3G9R A;  1ZRT E;  3T97 B;  1RQU A;  2JO1 A;  1S5L X;  3Q5P A;  4H0L D;  2D2C B;  1DD3 A;  2D2C C;  2QJY C;  3RL0 g;  2H88 C;  3AEE C;  4H44 B;  2E74 D;  2FXP A;  5M1B A;  3AE2 C;  3Q5S A;  1RQV A;  1FDI A;  2QJP C;  2E76 C;  4Z1M H;  2ZT9 B;  3O6Q A;  2YMK A;  2YIU C;  3FGA D;  4I7Z B;  1VF5 B;  2BEZ F;  1KTM A;  4H13 B;  5L8R J;  1ZOY C;  2O01 J;  1NGM B;  4U7J A;  1UIX A;  1VF5 D;  1U57 A;  4XFJ A;  3Q3D A;  2QIW A;  1WMK A;  3GMA A;  1NYH A;  3LW5 J;  2E76 D;  1KIL E;  4KT0 J;  4OGQ D;  2QJK C;  3D70 A;  4YXD C;  4H44 C;  2WQY C;  1DD4 A;  3H25 A;  1KQG B;  1VL2 A;  2ZT9 C;  1HF9 A;  2P10 A;  1R8E A;  2E75 B;  4RKU J;  4I7Z C;  3IAO A;  1K05 A;  3AEF C;  3B71 A;  3AE1 C;  4R4M A;  1KOR A;  1KMI Z;  4Y28 J;  3GLM A;  2FYN C;  4R4L A;  1PL5 A;  4H0L B;  4GDO A;  4OGQ C;  5KKZ C;  2NZ2 A;  2G8Y A;  2WPV B;  2J5U A;  2H89 C;  4H0L C;  1AJY A;  3SFE C;  3ABV C;  3AE3 C;  3D71 A;  2FBW C;  3AE8 C;  3AED C;  1PIX A;  3EWK A;  1GMJ A;  2IDB A;  3S9O A;  3GF3 A;  3AEG C;  2OQQ A;  3SFD C;  1Y9B A;  4TT3 H;  2E75 C;  2MKV A;  3AEC C;  2WSE J;  2JP3 A;  3R4Y A;  3Q1M A;  2V7Q J;  4IL6 X;  1VF5 C;  1ZP0 C;  2QSI A;  1OW8 A;  2E74 B;  1DIP A;  4H44 D;  2E74 C;  1K04 A;  4OGQ B;  3D6Z A;  1MKM A;  1Q90 D;  1TU3 F;  3C8V A;  1FDO A;  1OW6 A;  4PV1 B;  3Q5R A;  3AE9 C;  2G3A A;  1HJ0 A;  3Q2Y A;  3AEA C;  1JB0 J;  3AE7 C;  2E75 D;  5KLI C;  3AE4 C;  3IN6 A;  4H13 D;  2WSF J;  2ZT9 D;  3D6Y A;  1EXJ A;  3AE5 C;  1S1C X;  3AEB C;  2BEQ D;  4PV1 D;  2WSC J;  3GF7 A;  1IK7 A;  2E76 B;  1YQ4 C;  1YQ3 C;  2D2C D;  4YTP C;  1ZME C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...