3TNUB

Heterocomplex of coil 2b domains of human intermediate filament proteins, keratin 5 (krt5) and keratin 14 (krt14)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
95
structure length
95
Chain Sequence
TKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Keratin, type I cytoskeletal 14
publication title Structural basis for heteromeric assembly and perinuclear organization of keratin filaments.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytosolic protein
total genus 46
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3tnuB00
3HE4A 5AW2B 2ZFCA 2IPPA 5APXA 1DH3A 2P7JA 1T2KC 3VMZA 1CZQA 5AVVB 3M0AA 3MGNA 3A7OA 3TYYA 3P32A 1MUUA 4LC1A 3IR9A 2E43A 5AVYB 1FOSF 2C9LY 2WPRA 3M9BA 3L36A 3NFQA 1GK6A 2Z5IA 3UIAA 5AW0B 2C9NY 4AUWA 1MV8A 2KP8A 4RESB 3VMXA 1MFZA 1A02F 5AVRB 5APQA 3P8MC 5AW9B 3SWFA 2E42A 5AVTB 5AVQB 3NTNA 3TNUB 3TNUA 3VTPC 3M0DA 4JYCA 1H8AA 1J2JB 2WPSA 2R3CA 1GTWA 2JJLA 3M9HA 2WWWA 3M06A 5AVZB 1FOSE 4M3LA 1JUNA 5AVSB 5AVUB 1GZLA 1S9KE 4I6MC 3NMDA 3HTKA 2WTYA 2W6AA 1GU5A 2WT7B 5AW7B 2WT7A 2YO2A 3NXSA 4XE5B 5APWA 1NWQA 3LIEA 1NAFA 3MD0A 2YO3A 2R32A 4JYBA 4KHXA 1G2CB 2BASA 5APTA 5AW4B 3V4WA 1HWTC 2N9BA 1H88A 1GU4A 1SLQA 4HYTB 2Q7CA 2WPQA 1GK4A 1KQLA 3KQGA 2Q5UA 5AVXB 2R5BA 3B8EB 3V5BA 1CSBA 2QM8A 1IO4A 2Z5HA 3P7KA 3VYIA 5AW3B 1HBWA 1A02J 4AYCA 5CMZA 1GD2E 2W27A 3VN0A 5AW8B 3I5CA 1CI6B 1CI6A 2P67A 3KDPB 2Q3IA 3L37A 5AW5B 1SP4A 5APSA 3V4QA 5AW1B 3VMYA 4I2LC 4EOTA 2R5DA 5AW6B 3TK1A 4C7NB 3O8ZA 4C7NA 3A5TA 1JNMA 3T97A 1OWAA 2QM7A 1S9KD 2H7HA 4GT1A 5APUA 2ZXEB 2P2UA 1HUCA 4DZOA 5APYA 1FAVA 3A2AA 4B86A 1HJBA 3LIDA 1YYCA 1H89A 3M91A 3OAKA 2VRSA 1X8YA 2XZRA 1T2KD 3HE5B 5APVA 3HE5A 3L35A 4GKGA 3A3YB 4C46A 2XU6A 2XV5A 4AQRD 5AVWB 2YNYA 3HE4B 1OXZA
chains in the Genus database with same CATH superfamily
2ZVNB 1ZOYC 3P8CE 3QWOC 1DD3A 1AJYA 3VMAA 3GG2A 1MUUA 3G9RA 1KILB 5CCGA 2Y9YA 1G1IA 3B5ND 3RL0D 2M5AB 2FYZA 4H13C 2A45I 1R8EA 5DJUB 3TNUB 1JM0A 1N73A 2R3CA 1NTMG 2HFED 2O01H 5AVUB 1NKZB 3VP8A 3GLMA 2QJKB 3GHGC 3L70D 3L73G 1KILD 2K1AA 4YXDC 5CCHD 3BASA 2E75B 3OW2O 2BCCE 3H1HE 1SQXG 1SQPG 1FDMA 3CXHI 3C1LA 2YIUC 3V2RA 1MFTA 5AW5B 2Y0CA 5APSA 2K9YA 5AW1B 4CPGA 5AW6B 1KMIZ 4H13B 3L72J 4GT1A 2OQQA 1SQBK 2OYOA 2E75D 3KYQA 3D71A 4EI2A 3B5NA 1HUCA 3OA7A 3A2AA 1WT6A 1OW8A 3L75J 1YYCA 1H89A 1VQ8P 1VQ5P 1PIXA 1MZ9A 3L35A 3GHGB 1ZV8A 4OVNF 5TJHA 4H13D 1VQKP 2FYUK 1VQ4P 3U1AA 3TYYA 1SQVK 1KILA 3TSIA 3AE6C 5CCHA 2Z5IA 4W7ZA 2M5AA 2YIUB 1MFZA 5KTBA 3TNUA 1JCDA 1ZR2A 1UIIA 1LTSC 1S9KE 3HTKB 2WT7B 3CLQA 2W83C 3MUDC 2JWAA 2IDBA 2R32A 1WRGA 3AEFC 3L70J 4ZMDA 4OWFA 2R5BA 5AW3B 3AE8C 1VQNP 1OVUA 2LKMA 1LTIC 3L75E 1AFOA 3E1IA 1HF9A 2R5DA 3TGUD 2HYNA 5APUA 3IF4A 1AV1A 4IFMA 1Q82Q 2I8DA 1KYOD 2P2UA 4DZOA 3RK3C 1FC2C 4WB4A 1PV3A 2IBZI 2H88C 2WQYC 2P10A 2B9BA 3GHGA 5BU5A 2XU6A 1LP1B 5EFWB 3D6YA 2IPPA 1DH3A 2E5TA 1SFCC 1SQVD 2KNCB 1KQGB 3H1JE 2C9LY 4R4MA 5KLIB 3L36A 2C9NY 1EZVI 4GOFA 4YTPC 2MJZA 4BRYB 3CC7P 3U59A 2QRXA 1FOSE 2GA1A 2H89C 3I55P 1NTZK 1NOHA 2XNDH 3Q1MA 3HTKA 1E79H 2W8ZA 4IL6X 2WT7A 4K3AA 1S2EA 3AECC 1FBMA 3RK3B 3AE5C 1YTZT 2WSCJ 3H1LG 3CCMP 1SQQE 1LWUC 2AEMA 1S1CX 3BCCG 4D6TG 2FXMA 2WPVB 3CXHE 3U1CA 1SFCB 5M1BA 1D7MA 1VL2A 3A5TA 1FZGA 2IX7C 2QM7A 3RK3D 3HUSC 4O9BA 2ZXEB 5CBNA 3LW5J 3FGAD 3TGUJ 1BE3G 2XZRA 1SFCD 3MUDA 2QVAA 3V2QA 3PP5A 5AVVB 1LP1A 1LWUB 2KNCA 4LC1A 2OTLP 1PP9E 4L75A 1YTZI 1J1EC 2A45H 3C9IA 3BATA 4BRYA 1NTMD 5AVZB 2WMMA 4BWNA 3HUSB 3CMAP 3A0HH 4XE5B 2KLUA 3L73D 1DIPA 3V4WA 2Q6QA 2QA4P 3P8CD 3PRJA 4N78E 1SQXD 1AQ5A 1PP9G 1PZQA 3CXHH 1GD2E 1JY3P 1VQLP 1SFCA 4Y28J 3B71A 2E74C 2FXOA 2I1JA 1RF1C 1M7LA 4YPCA 4DJGA 2O01J 3CCJP 1N2DC 2VRSA 2BCCD 3MIWA 3H1HD 1DD4A 4GIFA 2IBZE 3AE4C 4RKUJ 4Y99B 2DW3A 1LWUA 3IAOA 1QVGO 1ZRTE 1YJNP 1N7SB 1NTKE 1KN7A 1IK7A 1EZVE 1IC2A 1X9VA 2E74B 4GOEA 1EQ7A 1K9MQ 3M06A 1Q2NA 2L5GB 1RF1B 3V2NA 3HUSA 3G3ZA 1NTMJ 2JP3A 3ABVC 1ZMEC 5APTA 1EDIA 1N7SD 4PD4I 3L73J 4RJTA 2K37A 2B88A 1VPCA 1P84I 2P58A 2E74D 3CC2P 2Z5HA 3VYIA 1PL5A 1NTKG 1OVVA 3H1IE 4PD4D 1NO4A 1SQXJ 2WSFH 1NU1E 1IFPA 2O1KA 4EOTA 2YXRB 2AXCA 3O8ZA 1S9KD 1BGYG 3FWLA 3L74G 3RK2B 2KZIA 1VF5C 4GKGA 1M57D 4AQRD 2BCCJ 1PFIA 1SVFA 1J1DB 2NZ2A 1DEBA 3MZWB 3MGNA 1NTME 5KJ7C 1KORA 2QJKC 1AQTA 1Q90D 1FOSF 2WVRA 3RK2D 1N7SA 3RL0g 4AUWA 2QEXP 1ZXGA 1JMMA 5AVQB 3L4FA 1GTWA 4NPEA 2JJLA 1JB0J 3ZDMA 1RF1A 1ZR4A 2IYPA 3NMDA 4HH2A 1FZBA 1NWQA 1SQXE 1SQPE 1VF5B 2HODB 1FJKA 3BCCD 4D6TD 3VP9A 4IOIH 3H1JD 2GM4A 5BVZA 5K5GB 1CSBA 2RH0A 4WWIA 1RF0C 3AEBC 1BCCG 1FZEA 5AW8B 3I5CA 3CX5I 1OVRA 1X79B 3IN6A 3PTZA 3V4QA 1N8RQ 1BSHA 1EDJA 3R4YA 1IJDB 2OTJP 1L0NE 1PGPA 1NTZG 2NRGA 1VF5D 1JY2P 2H43A 1SQQD 1X0TA 2PFXA 4DCKA 5KJ7D 3CXHD 2RKLA 1M90Q 5H2FE 1KD1Q 3HE4B 3TK1A 1OXZA 5AW2B 2JKVA 1KB9H 2HLOA 3A7OA 3CWBG 3P32A 4KT0J 5KLVG 3RBZA 3WUTA 1L0NG 1FZAA 3SWFA 1H8AA 1L2PA 1EC5A 3FX0A 3H32B 3D6ZA 4EDFA 3NXSA 3BRTB 2LXCB 1VDFA 3JSVC 2YO3A 4JYBA 4KHXA 1NJIQ 2QSIA 2HODA 4PD4E 3H1LJ 1P84E 1PP9D 1W2EA 1G1JA 3BCCJ 4D6TJ 2N1TB 3H1JJ 4WVZA 2OYHB 4WY4C 5KJ7A 3H1KG 1LT1A 5KKZC 2GUVA 2WZ7A 1L0LG 4OH8B 5KLIC 1CW5A 1LGHB 2Y0EA 4QMAA 3CCQP 1ZN5A 1K04A 3GF7A 4N78D 5E79E 1BDCA 2N1TD 1X8YA 1X22A 1SQQJ 2ZYAA 2OGUA 5H2FH 1IZNB 4NPDA 2AXTH 5AVWB 2FBWC 1U7JA 3HE4A 2ZFCA 3V6IA 1RE4A 1FDOA 1R5LA 3IR9A 2HPCB 5CHXA 3M9BA 1NAYA 1PPJE 1RF0A 1YJ9P 1OFCX 1WMKA 1QL1A 3G6EP 3Q5RA 1GL2C 4WY4B 3SFEC 4JYCA 3F89A 5DJTB 1YBKA 3H1LE 5KKZB 3H32A 2C0WA 4L73A 4EIJA 2W6JH 2W6AA 3BCCE 1OZHA 4D6TE 2IBZD 2OARA 2YO2A 1M1KQ 3N4XA 3S4RA 1HWTC 1H88A 4PD4H 1SLQA 1PGQA 1P84H 1ZRTD 4RO0A 3EFFK 4WY4D 1NTMK 4IFFA 1NTKD 1EZVD 4LLHA 3CCUP 1IFIA 1USDA 1PPJG 1Y9BA 2N1TA 1PP9J 3L71G 3CX5E 3A0HE 2OYHA 1BE3E 3AEDC 3AE1C 3VOPA 2JDIH 5BU8B 4HJGH 1GL2B 3L74D 4C7RA 2JEEA 2IYOA 4U3FE 1FAVA 1SQXK 5E79H 1EXJA 3OAKA 3HE5B 5C39A 3CMEP 1VQMP 1GMJA 3A3YB 1VQ9P 1L4AC 3H1ID 4HKZH 2YNYA 3W67A 1NU1D 2KSEA 1GL2D 2QJYC 2HPCA 3PJSK 5AW0B 2WSFJ 5KAIE 3L70G 1AVOA 2XDJA 2E42A 4WY4A 3VTPC 3PLNA 1JY2N 2KLVA 4U3FG 1OMIA 2Q3EA 1QEXA 3SFDC 1QX8A 1JTHB 1KB9I 1KQSO 1M8OB 2Y9ZA 3RBXA 2OYIB 1NYHA 1NVOA 1KB9D 1S5LX 1KQLA 1RQVA 1FU1A 3C8VA 1JOCA 2G3AA 1HGVA 2KS1B 1L4AB 4U7JA 1H0TB 1CI6B 3CX5H 2Q3IA 1NTKJ 2QJYB 1JMBA 3M0DC 4HB1A 2R3SA 3S9OA 1QLED 2CPBA 4Y99C 3IFMA 2PRRA 3AE2C 1GL2A 1SQPD 3EFGA 2V7QJ 1BGYJ 5APYA 1N7SC 1S3JA 3L74J 1L4AD 2XNXA 2KZJA 3HE5A 1T3UA 2IZ0A 5GTIH 1Q86Q 3SSUA 4H44C 3CWBD 3II6A 5KLVD 3H1IJ 1NH4A 3NFQA 5KAIH 1NU1J 1L0ND 2FXPA 5B5EE 1IFJA 2ZVOB 1USEA 1J2JB 2D2CC 2KUBA 2W90A 3G4SP 2HG5D 1GZLA 2O01N 1JTHA 2JR8A 2FYUE 4I7ZC 2JO1A 1KV4A 2KOGA 1G2CB 2QJPB 2N9BA 3CI9A 2OYIA 3AEAC 4W80A 1SQBG 3M9QA 2RMZA 3CCSP 3RK2C 2KS1A 1L4AA 2KI7B 1BGYE 4MN4C 2NPSC 1H0TA 2A06G 1CI6A 4H44B 3W68A 3L74E 3H1KD 3F5HA 1BCCJ 1IFNA 1GW4A 2QIWA 4JQ0D 1URQC 5GTHE 1J1DC 2V4HA 1L0LD 2FYUG 1SQVG 2D2CB 3CCVP 3LIDA 1SQPJ 1VQOP 1P84D 2L91A 2XKMA 3K5BA 4H44D 1PGJA 4I7ZB 1NGMB 3TDKA 2ZYDA 4C46A 2FYNC 3CL3D 4L76A 5APXA 1T2KC 3S1KA 3M0AA 1YJWP 2D2CD 1GK6A 1YHQP 1SQQK 2NPSB 3CWBJ 1Q7YQ 1VQ7P 3VMXA 5KLVJ 5AVRB 5APQA 5B5EH 1RHZB 5KAFE 3NTNA 2YKPA 3M0DA 1L0NJ 1IK9A 4M3LA 1URQB 5AVSB 4DT0A 2KB7P 1KB9E 3AEGC 1GW3A 2ZT9B 3V2PA 1BCCE 1G2CA 4DOJA 3Q5SA 2NPSD 1DEEG 3I56P 2WPQA 4KJMA 3KQGA 3CC4P 3Q5PA 1PPJD 1LT9C 2FYNB 2V7QH 2WSEH 1NTZE 3VN0A 3GF3A 1URQD 3KDPB 3L37A 3WMM0 1SP4A 2ZYGA 4ZKPA 3H1LD 5GTHH 2ZT9D 3KXDA 3H1KJ 1T3JA 2WSSH 1RE4C 1VQPP 1E5WA 1L0LJ 2J59M 3MP7B 1T2KD 3CWBE 2HR3A 5KLVE 4H0LC 1S72P 3CX5D 1HH0A 3VMZA 1BE3D 1ZLLA 4R4LA 1LT9B 2WITA 1T8ZA 2NPSA 4RESB 2RN0A 3AE9C 5AW9B 5KAFH 4XFJA 5AVTB 3PH0A 4U3FD 3FXDA 2AXTE 2WWWA 3KHUA 1JUNA 1URQA 5CJ0A 2N1TC 1JY3N 2OTKE 1OW6A 2OYHC 4ZNCA 1RH5B 2AEFA 3CCRP 4TT3H 5L8RJ 3AEEC 2FFDC 4JPZB 4HYTB 2Q7CA 2M0BA 3H1KE 4N6JA 1W2BO 2MKVA 3P7KA 1M1JC 1A02J 4H0LB 2BEZF 1K73Q 4JF7A 3SWYA 2N9YB 1L0LE 2E5YA 3E1RA 1JO5A 2FY8A 4IFDK 3CPWO 2BCCG 3L71J 3H1HG 1UIXA 1HJ0A 1JNMA 2H7HA 2M3BA 2Q1KA 1T6AA 1NTKK 1N7LA 2M8RA 1FZCC 2UWJE 4H0LD 1LTBC 1RY3A 4XA4A 2PAJA 2PP6A 3A0BE 2FFDB 2KYVA 3GMAA 1XTCC 1M1JB 1LT9A 1R5SA 2IFMA 1JY3O 1BE3J 1MV8A 1LTTC 1VQ6P 2ZAEB 3L72E 1LTJC 1KTMA 4K35A 2LXBA 4PJ0E 4U3FJ 4UB6E 1NU1K 1YIJP 3LIEA 4BXLA 1KYOI 1NAFA 1FZCB 1FJPA 1SQBD 2J5UA 3L71E 3JC22 2ZJSE 1GK4A 3V5BA 1HBWA 5CMZA 2A06D 3WUVA 2W27A 3EQ2A 1YITP 3O6QB 1QVFO 1S4XA 3CD6P 3L72G 4C7NB 1OWAA 4IL6E 2QG4A 1YQ3C 3WUUA 2FYUD 1YI2P 4PV1C 1DX7A 3L75G 1LTJB 3AE3C 1LTGC 4ASWA 4B86A 1ZW0A 3KZIE 3EWKA 4I1LA 5APVA 3A0BH 2M3EA 1KZUB 1M56D 1BGYD 3L70E 2FFDA 1KILE 4OGQC 3USSA 4ASVA 2YMYA 1GDTA 1BDDA 1SQPK 3D70A 5AVYB 4A7PA 1M1JA 1QL2A 2WPRA 1FDIA 2OYIC 1ZP0C 1OIPA 1PGOA 2R44A 3BVHA 4N3YB 1YQ4C 2IFNA 3H1JG 4PJ0H 5GTIE 4UB6H 4I6MC 2BEQD 4EYYQ 4PV1B 2A45G 2ZXXA 2B89A 1MKMA 5KLVK 2CPSA 2E76C 1FZCA 2BASA 2KSJA 3KPEA 2FKWB 3FWNA 1L0NK 2AEJA 2SPZA 1SQBJ 2QM8A 1IO4A 5TISE 3B4SA 3Q2YA 4OGQB 1OX3A 1S5LE 2B87B 1SQQG 2K9JB 3O6QA 2KK7A 5B66E 4L74A 4Z1MH 4PV1D 4I2LC 1JCCA 4IL6H 4C7NA 3T97B 2Q9IA 3R2PA 1HVVA 4WBAA 3E7KA 1LTJA 3FXEA 3HD7C 1EDKA 1BCCD 3KZIH 2FYUJ 4OGQD 1SQVJ 3M91A 4TLFA 1IFDA 2JWDA 2O3JA 4ZKUA 3HRNA 2H8PD 3MHVA 3BRVB 3SWKA 1NTZD 2E76B 3WU2E 2KIKA 3JCUE 1QGKB 3N7NA 2P7JA 1L0LK 3Q3DA 2WSEJ 2POHA 2QJPC 3UIAA 1RE3C 2YMKA 3OJAB 1HGZA 3P8MC 1KC8Q 1Y8AA 3M9HA 3H25A 2CK3H 1SQBE 2E76D 2Y0DA 3TGUE 4GODA 1JY2O 1GU5A 2K88A 5AW7B 3HD7B 1KYOE 3MD0A 1NHLA 2YKOA 1LJ2A 3MTUE 2A06E 2PGDA 1GU4A 1KFNA 2GUSA 1J1EB 3QH9A 2Q5UA 1FS0E 2K3RA 5AVXB 1XTGB 5CCGC 4UB8E 3H6PA 5TISH 3CCEP 4AYCA 1S5LH 1Y47A 1EDLA 5B66H 2B87A 2P67A 2K9JA 2Z4EA 3PHLA 1SQVE 1N73C 3HD7D 1KFMA 2ITAA 1TU3F 3T97A 3TGUG 2LR2A 1HJBA 2J58A 2WSCH 2I1KA 1IFMA 5CJ4A 3WU2H 5CBOA 3JCUH 1K8AQ 2KXPB 1FE6A 2YKQA 1CZQA 1NTZJ 2E43A 2ZT9C 1KQFB 1HTLC 2IBZG 3TF5A 1Q81Q 1U57A 2KP8A 1A02F 3CCLP 3RGUA 4W7YA 1N73B 2WPSA 3B5NC 3LW5H 3RL0C 1EXIA 3RK3E 1EZVG 2WTYA 3HD7A 5APWA 1KYOH 1RQUA 1SS1A 5CCGD 4GDOA 5AW4B 1OW7A 1LTAC 1AVYA 2IZ1A 2C0XA 4YXWH 1LNQA 3GW6A 3B8EB 3AE7C 4UB8H 1KILC 2G8YA 5CCHC 4LGDE 3L72D 4NPFX 3G71P 1N86A 3VMYA 1AA0A 1NKNA 1U7MA 1RE3A 2W6BA 2YXQB 3ITKA 3H1IG 3H1HJ 3L75D 1FZFA 4JBZA 1NU1G 2QE7H 3B5NB 3RL0B 1BSNA 2O1JA 3L71D 1JEKA 2E75C 1Z56A 2P1JA 1K05A 3L73E 2XV5A 1W5CE
chains in the Genus database with same CATH topology
1LWUA 3P8CE 1GL2D 1XTCC 1MUUA 1KILB 5CCGA 2HPCA 1M1JB 1G1IA 1LT9A 3B5ND 3RL0D 1N7SB 2FYZA 2IFMA 5AW0B 1IC2A 1JY3O 1MV8A 1LTTC 1X9VA 2A45I 2XDJA 2E42A 3TNUB 4WY4A 3VTPC 1JY2N 1LTJC 2KLVA 1N73A 1EQ7A 2R3CA 3M06A 2HFED 2L5GB 1RF1B 3V2NA 3HUSA 3G3ZA 2O01H 5AVUB 1NKZB 1JTHB 1NU1K 3VP8A 3LIEA 1NAFA 3GHGC 1KILD 1FZCB 5APTA 1FJPA 5CCHD 2OYIB 1N7SD 3BASA 1GK4A 1KQLA 1VPCA 1FU1A 3V5BA 1JOCA 1HGVA 2Z5HA 3VYIA 1HBWA 1L4AB 1FDMA 5CMZA 2W27A 3EQ2A 1CI6B 1NO4A 2Q3IA 3V2RA 5AW5B 2WSFH 2O1KA 5APSA 5AW1B 3M0DC 4EOTA 5AW6B 2CPBA 4Y99C 3O8ZA 4C7NB 3IFMA 1OWAA 1S9KD 4GT1A 1SQBK 1GL2A 3KYQA 1DX7A 3EFGA 1LTJB 3RK2B 1LTGC 3B5NA 1HUCA 3OA7A 5APYA 1N7SC 3A2AA 4B86A 1WT6A 1L4AD 1YYCA 1H89A 2XNXA 4I1LA 5APVA 3HE5A 1MZ9A 3L35A 3GHGB 1KZUB 4GKGA 1T3UA 4AQRD 1ZV8A 2FFDA 1PFIA 1SVFA 2YMYA 1J1DB 1DEBA 3II6A 1GDTA 2FYUK 3MGNA 5KJ7C 3U1AA 3TYYA 1SQPK 1SQVK 1KILA 5AVYB 1FOSF 1NH4A 3TSIA 1M1JA 1QL2A 2WPRA 3RK2D 5CCHA 3NFQA 2OYIC 1N7SA 2Z5IA 4W7ZA 4AUWA 1MFZA 5KTBA 1IFJA 1JMMA 5AVQB 3TNUA 3L4FA 3BVHA 1J2JB 4N3YB 1GTWA 2JJLA 1JCDA 2IFNA 1ZR2A 1LTSC 1RF1A 1ZR4A 2HG5D 1GZLA 1S9KE 4I6MC 3HTKB 3NMDA 4HH2A 1JTHA 2WT7B 2A45G 1FZBA 3CLQA 1NWQA 5KLVK 2CPSA 2KOGA 2R32A 1FZCA 1G2CB 2BASA 2KSJA 3KPEA 2HODB 2FKWB 2N9BA 3CI9A 1L0NK 2OYIA 4W80A 1FJKA 3M9QA 1WRGA 3VP9A 3RK2C 2GM4A 5BVZA 2R5BA 1CSBA 2QM8A 1IO4A 5AW3B 1L4AA 1RF0C 1FZEA 2NPSC 5AW8B 3I5CA 1CI6A 2LKMA 1LTIC 1AFOA 1X79B 3E1IA 3V4QA 1IFNA 4I2LC 2R5DA 1JCCA 1GW4A 4C7NA 1IJDB 2Q9IA 3R2PA 1URQC 2HYNA 1HVVA 5APUA 1J1DC 4WBAA 1JY2P 2H43A 4IFMA 1LTJA 3HD7C 2P2UA 4DZOA 3RK3C 3LIDA 4WB4A 3M91A 1IFDA 2XKMA 4ZKUA 3HRNA 2H8PD 5KJ7D 3GHGA 3BRVB 4C46A 5BU5A 2XU6A 3CL3D 3HE4B 3TK1A 1OXZA 5AW2B 2IPPA 3N7NA 5APXA 2P7JA 1T2KC 1DH3A 1SFCC 1L0LK 3M0AA 2HLOA 3A7OA 3P32A 2POHA 2C9LY 3L36A 1GK6A 3UIAA 2C9NY 1SQQK 2NPSB 1RE3C 3OJAB 3VMXA 1HGZA 5AVRB 5APQA 1FZAA 3P8MC 2MJZA 3SWFA 3NTNA 2YKPA 3M0DA 1H8AA 3U59A 1IK9A 3M9HA 1FOSE 3H32B 4M3LA 1URQB 1NTZK 5AVSB 1NOHA 1JY2O 2KB7P 3HTKA 1GU5A 5AW7B 1GW3A 2WT7A 3HD7B 3NXSA 1FBMA 3RK3B 3BRTB 3MD0A 1YTZT 1VDFA 1NHLA 2YKOA 2YO3A 4JYBA 3MTUE 4KHXA 3V2PA 1G2CA 2HODA 4DOJA 1GU4A 1KFNA 2GUSA 1J1EB 2NPSD 1LWUC 2WPQA 3KQGA 2Q5UA 5AVXB 1XTGB 2FXMA 5CCGC 1W2EA 3H6PA 1LT9C 1G1JA 4AYCA 2WSEH 3VN0A 3U1CA 1URQD 2N1TB 2P67A 1SFCB 3KDPB 3L37A 2Z4EA 3WMM0 1SP4A 2OYHB 4WY4C 4ZKPA 5KJ7A 1N73C 3HD7D 1KFMA 3A5TA 2GUVA 2IX7C 3T97A 2QM7A 1FZGA 3RK3D 3HUSC 4O9BA 2ZXEB 1T3JA 2WZ7A 1RE4C 4OH8B 1CW5A 1E5WA 1LGHB 1HJBA 2J59M 1ZN5A 2J58A 4N78D 2WSCH 2N1TD 1X8YA 2I1KA 2XZRA 1T2KD 1IFMA 1SFCD 5CJ4A 3MUDA 3V2QA 3PP5A 5AVWB 5AVVB 3HE4A 2ZFCA 1LWUB 1HH0A 3VMZA 2YKQA 1CZQA 1ZLLA 1RE4A 2E43A 4LC1A 1HTLC 3IR9A 2HPCB 1LT9B 2WITA 5CHXA 1T8ZA 3M9BA 1YTZI 1RF0A 2NPSA 2KP8A 4RESB 1J1EC 1QL1A 2A45H 1A02F 3C9IA 5AW9B 1GL2C 5AVTB 3BATA 4W7YA 4WY4B 1N73B 4JYCA 2WPSA 3B5NC 3LW5H 3RL0C 2WWWA 5AVZB 3H32A 2C0WA 1JUNA 3HUSB 1URQA 5CJ0A 2N1TC 4EIJA 1JY3N 2WTYA 2W6AA 2OYHC 2OARA 3HD7A 2YO2A 4XE5B 5APWA 3N4XA 5CCGD 3V4WA 5AW4B 2FFDC 1HWTC 1H88A 1SLQA 1LTAC 3P8CD 4HYTB 2Q7CA 2C0XA 4N78E 4N6JA 3B8EB 4WY4D 1NTMK 4IFFA 1KILC 1AQ5A 3P7KA 1M1JC 4LLHA 1A02J 5CCHC 1IFIA 4LGDE 1GD2E 1JY3P 4JF7A 3SWYA 2N1TA 1JO5A 1SFCA 2OYHA 4IFDK 1N86A 3VMYA 2I1JA 3VOPA 1JNMA 1RF1C 1M7LA 2H7HA 1NKNA 1RE3A 2M3BA 5BU8B 2W6BA 1GL2B 4C7RA 1FZFA 2JEEA 3B5NB 3RL0B 1FAVA 1SQXK 1NTKK 2O1JA 1N7LA 2M8RA 1FZCC 1N2DC 1LTBC 1RY3A 3OAKA 2VRSA 1Z56A 2P1JA 3MIWA 4XA4A 2PAJA 3HE5B 4GIFA 2PP6A 3A3YB 1L4AC 4Y99B 2XV5A 2FFDB 2KYVA 2YNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HE4 A;  5AW2 B;  2ZFC A;  2IPP A;  5APX A;  1DH3 A;  2P7J A;  1T2K C;  3VMZ A;  1CZQ A;  5AVV B;  3M0A A;  3MGN A;  3A7O A;  3TYY A;  3P32 A;  1MUU A;  4LC1 A;  3IR9 A;  2E43 A;  5AVY B;  1FOS F;  2C9L Y;  2WPR A;  3M9B A;  3L36 A;  3NFQ A;  1GK6 A;  2Z5I A;  3UIA A;  5AW0 B;  2C9N Y;  4AUW A;  1MV8 A;  2KP8 A;  4RES B;  3VMX A;  1MFZ A;  1A02 F;  5AVR B;  5APQ A;  3P8M C;  5AW9 B;  3SWF A;  2E42 A;  5AVT B;  5AVQ B;  3NTN A;  3TNU B;  3TNU A;  3VTP C;  3M0D A;  4JYC A;  1H8A A;  1J2J B;  2WPS A;  2R3C A;  1GTW A;  2JJL A;  3M9H A;  2WWW A;  3M06 A;  5AVZ B;  1FOS E;  4M3L A;  1JUN A;  5AVS B;  5AVU B;  1GZL A;  1S9K E;  4I6M C;  3NMD A;  3HTK A;  2WTY A;  2W6A A;  1GU5 A;  2WT7 B;  5AW7 B;  2WT7 A;  2YO2 A;  3NXS A;  4XE5 B;  5APW A;  1NWQ A;  3LIE A;  1NAF A;  3MD0 A;  2YO3 A;  2R32 A;  4JYB A;  4KHX A;  1G2C B;  2BAS A;  5APT A;  5AW4 B;  3V4W A;  1HWT C;  2N9B A;  1H88 A;  1GU4 A;  1SLQ A;  4HYT B;  2Q7C A;  2WPQ A;  1GK4 A;  1KQL A;  3KQG A;  2Q5U A;  5AVX B;  2R5B A;  3B8E B;  3V5B A;  1CSB A;  2QM8 A;  1IO4 A;  2Z5H A;  3P7K A;  3VYI A;  5AW3 B;  1HBW A;  1A02 J;  4AYC A;  5CMZ A;  1GD2 E;  2W27 A;  3VN0 A;  5AW8 B;  3I5C A;  1CI6 B;  1CI6 A;  2P67 A;  3KDP B;  2Q3I A;  3L37 A;  5AW5 B;  1SP4 A;  5APS A;  3V4Q A;  5AW1 B;  3VMY A;  4I2L C;  4EOT A;  2R5D A;  5AW6 B;  3TK1 A;  4C7N B;  3O8Z A;  4C7N A;  3A5T A;  1JNM A;  3T97 A;  1OWA A;  2QM7 A;  1S9K D;  2H7H A;  4GT1 A;  5APU A;  2ZXE B;  2P2U A;  1HUC A;  4DZO A;  5APY A;  1FAV A;  3A2A A;  4B86 A;  1HJB A;  3LID A;  1YYC A;  1H89 A;  3M91 A;  3OAK A;  2VRS A;  1X8Y A;  2XZR A;  1T2K D;  3HE5 B;  5APV A;  3HE5 A;  3L35 A;  4GKG A;  3A3Y B;  4C46 A;  2XU6 A;  2XV5 A;  4AQR D;  5AVW B;  2YNY A;  3HE4 B;  1OXZ A; 
#chains in the Genus database with same CATH topology
 2ZVN B;  1ZOY C;  3P8C E;  3QWO C;  1DD3 A;  1AJY A;  3VMA A;  3GG2 A;  1MUU A;  3G9R A;  1KIL B;  5CCG A;  2Y9Y A;  1G1I A;  3B5N D;  3RL0 D;  2M5A B;  2FYZ A;  4H13 C;  2A45 I;  1R8E A;  5DJU B;  3TNU B;  1JM0 A;  1N73 A;  2R3C A;  1NTM G;  2HFE D;  2O01 H;  5AVU B;  1NKZ B;  3VP8 A;  3GLM A;  2QJK B;  3GHG C;  3L70 D;  3L73 G;  1KIL D;  2K1A A;  4YXD C;  5CCH D;  3BAS A;  2E75 B;  3OW2 O;  2BCC E;  3H1H E;  1SQX G;  1SQP G;  1FDM A;  3CXH I;  3C1L A;  2YIU C;  3V2R A;  1MFT A;  5AW5 B;  2Y0C A;  5APS A;  2K9Y A;  5AW1 B;  4CPG A;  5AW6 B;  1KMI Z;  4H13 B;  3L72 J;  4GT1 A;  2OQQ A;  1SQB K;  2OYO A;  2E75 D;  3KYQ A;  3D71 A;  4EI2 A;  3B5N A;  1HUC A;  3OA7 A;  3A2A A;  1WT6 A;  1OW8 A;  3L75 J;  1YYC A;  1H89 A;  1VQ8 P;  1VQ5 P;  1PIX A;  1MZ9 A;  3L35 A;  3GHG B;  1ZV8 A;  4OVN F;  5TJH A;  4H13 D;  1VQK P;  2FYU K;  1VQ4 P;  3U1A A;  3TYY A;  1SQV K;  1KIL A;  3TSI A;  3AE6 C;  5CCH A;  2Z5I A;  4W7Z A;  2M5A A;  2YIU B;  1MFZ A;  5KTB A;  3TNU A;  1JCD A;  1ZR2 A;  1UII A;  1LTS C;  1S9K E;  3HTK B;  2WT7 B;  3CLQ A;  2W83 C;  3MUD C;  2JWA A;  2IDB A;  2R32 A;  1WRG A;  3AEF C;  3L70 J;  4ZMD A;  4OWF A;  2R5B A;  5AW3 B;  3AE8 C;  1VQN P;  1OVU A;  2LKM A;  1LTI C;  3L75 E;  1AFO A;  3E1I A;  1HF9 A;  2R5D A;  3TGU D;  2HYN A;  5APU A;  3IF4 A;  1AV1 A;  4IFM A;  1Q82 Q;  2I8D A;  1KYO D;  2P2U A;  4DZO A;  3RK3 C;  1FC2 C;  4WB4 A;  1PV3 A;  2IBZ I;  2H88 C;  2WQY C;  2P10 A;  2B9B A;  3GHG A;  5BU5 A;  2XU6 A;  1LP1 B;  5EFW B;  3D6Y A;  2IPP A;  1DH3 A;  2E5T A;  1SFC C;  1SQV D;  2KNC B;  1KQG B;  3H1J E;  2C9L Y;  4R4M A;  5KLI B;  3L36 A;  2C9N Y;  1EZV I;  4GOF A;  4YTP C;  2MJZ A;  4BRY B;  3CC7 P;  3U59 A;  2QRX A;  1FOS E;  2GA1 A;  2H89 C;  3I55 P;  1NTZ K;  1NOH A;  2XND H;  3Q1M A;  3HTK A;  1E79 H;  2W8Z A;  4IL6 X;  2WT7 A;  4K3A A;  1S2E A;  3AEC C;  1FBM A;  3RK3 B;  3AE5 C;  1YTZ T;  2WSC J;  3H1L G;  3CCM P;  1SQQ E;  1LWU C;  2AEM A;  1S1C X;  3BCC G;  4D6T G;  2FXM A;  2WPV B;  3CXH E;  3U1C A;  1SFC B;  5M1B A;  1D7M A;  1VL2 A;  3A5T A;  1FZG A;  2IX7 C;  2QM7 A;  3RK3 D;  3HUS C;  4O9B A;  2ZXE B;  5CBN A;  3LW5 J;  3FGA D;  3TGU J;  1BE3 G;  2XZR A;  1SFC D;  3MUD A;  2QVA A;  3V2Q A;  3PP5 A;  5AVV B;  1LP1 A;  1LWU B;  2KNC A;  4LC1 A;  2OTL P;  1PP9 E;  4L75 A;  1YTZ I;  1J1E C;  2A45 H;  3C9I A;  3BAT A;  4BRY A;  1NTM D;  5AVZ B;  2WMM A;  4BWN A;  3HUS B;  3CMA P;  3A0H H;  4XE5 B;  2KLU A;  3L73 D;  1DIP A;  3V4W A;  2Q6Q A;  2QA4 P;  3P8C D;  3PRJ A;  4N78 E;  1SQX D;  1AQ5 A;  1PP9 G;  1PZQ A;  3CXH H;  1GD2 E;  1JY3 P;  1VQL P;  1SFC A;  4Y28 J;  3B71 A;  2E74 C;  2FXO A;  2I1J A;  1RF1 C;  1M7L A;  4YPC A;  4DJG A;  2O01 J;  3CCJ P;  1N2D C;  2VRS A;  2BCC D;  3MIW A;  3H1H D;  1DD4 A;  4GIF A;  2IBZ E;  3AE4 C;  4RKU J;  4Y99 B;  2DW3 A;  1LWU A;  3IAO A;  1QVG O;  1ZRT E;  1YJN P;  1N7S B;  1NTK E;  1KN7 A;  1IK7 A;  1EZV E;  1IC2 A;  1X9V A;  2E74 B;  4GOE A;  1EQ7 A;  1K9M Q;  3M06 A;  1Q2N A;  2L5G B;  1RF1 B;  3V2N A;  3HUS A;  3G3Z A;  1NTM J;  2JP3 A;  3ABV C;  1ZME C;  5APT A;  1EDI A;  1N7S D;  4PD4 I;  3L73 J;  4RJT A;  2K37 A;  2B88 A;  1VPC A;  1P84 I;  2P58 A;  2E74 D;  3CC2 P;  2Z5H A;  3VYI A;  1PL5 A;  1NTK G;  1OVV A;  3H1I E;  4PD4 D;  1NO4 A;  1SQX J;  2WSF H;  1NU1 E;  1IFP A;  2O1K A;  4EOT A;  2YXR B;  2AXC A;  3O8Z A;  1S9K D;  1BGY G;  3FWL A;  3L74 G;  3RK2 B;  2KZI A;  1VF5 C;  4GKG A;  1M57 D;  4AQR D;  2BCC J;  1PFI A;  1SVF A;  1J1D B;  2NZ2 A;  1DEB A;  3MZW B;  3MGN A;  1NTM E;  5KJ7 C;  1KOR A;  2QJK C;  1AQT A;  1Q90 D;  1FOS F;  2WVR A;  3RK2 D;  1N7S A;  3RL0 g;  4AUW A;  2QEX P;  1ZXG A;  1JMM A;  5AVQ B;  3L4F A;  1GTW A;  4NPE A;  2JJL A;  1JB0 J;  3ZDM A;  1RF1 A;  1ZR4 A;  2IYP A;  3NMD A;  4HH2 A;  1FZB A;  1NWQ A;  1SQX E;  1SQP E;  1VF5 B;  2HOD B;  1FJK A;  3BCC D;  4D6T D;  3VP9 A;  4IOI H;  3H1J D;  2GM4 A;  5BVZ A;  5K5G B;  1CSB A;  2RH0 A;  4WWI A;  1RF0 C;  3AEB C;  1BCC G;  1FZE A;  5AW8 B;  3I5C A;  3CX5 I;  1OVR A;  1X79 B;  3IN6 A;  3PTZ A;  3V4Q A;  1N8R Q;  1BSH A;  1EDJ A;  3R4Y A;  1IJD B;  2OTJ P;  1L0N E;  1PGP A;  1NTZ G;  2NRG A;  1VF5 D;  1JY2 P;  2H43 A;  1SQQ D;  1X0T A;  2PFX A;  4DCK A;  5KJ7 D;  3CXH D;  2RKL A;  1M90 Q;  5H2F E;  1KD1 Q;  3HE4 B;  3TK1 A;  1OXZ A;  5AW2 B;  2JKV A;  1KB9 H;  2HLO A;  3A7O A;  3CWB G;  3P32 A;  4KT0 J;  5KLV G;  3RBZ A;  3WUT A;  1L0N G;  1FZA A;  3SWF A;  1H8A A;  1L2P A;  1EC5 A;  3FX0 A;  3H32 B;  3D6Z A;  4EDF A;  3NXS A;  3BRT B;  2LXC B;  1VDF A;  3JSV C;  2YO3 A;  4JYB A;  4KHX A;  1NJI Q;  2QSI A;  2HOD A;  4PD4 E;  3H1L J;  1P84 E;  1PP9 D;  1W2E A;  1G1J A;  3BCC J;  4D6T J;  2N1T B;  3H1J J;  4WVZ A;  2OYH B;  4WY4 C;  5KJ7 A;  3H1K G;  1LT1 A;  5KKZ C;  2GUV A;  2WZ7 A;  1L0L G;  4OH8 B;  5KLI C;  1CW5 A;  1LGH B;  2Y0E A;  4QMA A;  3CCQ P;  1ZN5 A;  1K04 A;  3GF7 A;  4N78 D;  5E79 E;  1BDC A;  2N1T D;  1X8Y A;  1X22 A;  1SQQ J;  2ZYA A;  2OGU A;  5H2F H;  1IZN B;  4NPD A;  2AXT H;  5AVW B;  2FBW C;  1U7J A;  3HE4 A;  2ZFC A;  3V6I A;  1RE4 A;  1FDO A;  1R5L A;  3IR9 A;  2HPC B;  5CHX A;  3M9B A;  1NAY A;  1PPJ E;  1RF0 A;  1YJ9 P;  1OFC X;  1WMK A;  1QL1 A;  3G6E P;  3Q5R A;  1GL2 C;  4WY4 B;  3SFE C;  4JYC A;  3F89 A;  5DJT B;  1YBK A;  3H1L E;  5KKZ B;  3H32 A;  2C0W A;  4L73 A;  4EIJ A;  2W6J H;  2W6A A;  3BCC E;  1OZH A;  4D6T E;  2IBZ D;  2OAR A;  2YO2 A;  1M1K Q;  3N4X A;  3S4R A;  1HWT C;  1H88 A;  4PD4 H;  1SLQ A;  1PGQ A;  1P84 H;  1ZRT D;  4RO0 A;  3EFF K;  4WY4 D;  1NTM K;  4IFF A;  1NTK D;  1EZV D;  4LLH A;  3CCU P;  1IFI A;  1USD A;  1PPJ G;  1Y9B A;  2N1T A;  1PP9 J;  3L71 G;  3CX5 E;  3A0H E;  2OYH A;  1BE3 E;  3AED C;  3AE1 C;  3VOP A;  2JDI H;  5BU8 B;  4HJG H;  1GL2 B;  3L74 D;  4C7R A;  2JEE A;  2IYO A;  4U3F E;  1FAV A;  1SQX K;  5E79 H;  1EXJ A;  3OAK A;  3HE5 B;  5C39 A;  3CME P;  1VQM P;  1GMJ A;  3A3Y B;  1VQ9 P;  1L4A C;  3H1I D;  4HKZ H;  2YNY A;  3W67 A;  1NU1 D;  2KSE A;  1GL2 D;  2QJY C;  2HPC A;  3PJS K;  5AW0 B;  2WSF J;  5KAI E;  3L70 G;  1AVO A;  2XDJ A;  2E42 A;  4WY4 A;  3VTP C;  3PLN A;  1JY2 N;  2KLV A;  4U3F G;  1OMI A;  2Q3E A;  1QEX A;  3SFD C;  1QX8 A;  1JTH B;  1KB9 I;  1KQS O;  1M8O B;  2Y9Z A;  3RBX A;  2OYI B;  1NYH A;  1NVO A;  1KB9 D;  1S5L X;  1KQL A;  1RQV A;  1FU1 A;  3C8V A;  1JOC A;  2G3A A;  1HGV A;  2KS1 B;  1L4A B;  4U7J A;  1H0T B;  1CI6 B;  3CX5 H;  2Q3I A;  1NTK J;  2QJY B;  1JMB A;  3M0D C;  4HB1 A;  2R3S A;  3S9O A;  1QLE D;  2CPB A;  4Y99 C;  3IFM A;  2PRR A;  3AE2 C;  1GL2 A;  1SQP D;  3EFG A;  2V7Q J;  1BGY J;  5APY A;  1N7S C;  1S3J A;  3L74 J;  1L4A D;  2XNX A;  2KZJ A;  3HE5 A;  1T3U A;  2IZ0 A;  5GTI H;  1Q86 Q;  3SSU A;  4H44 C;  3CWB D;  3II6 A;  5KLV D;  3H1I J;  1NH4 A;  3NFQ A;  5KAI H;  1NU1 J;  1L0N D;  2FXP A;  5B5E E;  1IFJ A;  2ZVO B;  1USE A;  1J2J B;  2D2C C;  2KUB A;  2W90 A;  3G4S P;  2HG5 D;  1GZL A;  2O01 N;  1JTH A;  2JR8 A;  2FYU E;  4I7Z C;  2JO1 A;  1KV4 A;  2KOG A;  1G2C B;  2QJP B;  2N9B A;  3CI9 A;  2OYI A;  3AEA C;  4W80 A;  1SQB G;  3M9Q A;  2RMZ A;  3CCS P;  3RK2 C;  2KS1 A;  1L4A A;  2KI7 B;  1BGY E;  4MN4 C;  2NPS C;  1H0T A;  2A06 G;  1CI6 A;  4H44 B;  3W68 A;  3L74 E;  3H1K D;  3F5H A;  1BCC J;  1IFN A;  1GW4 A;  2QIW A;  4JQ0 D;  1URQ C;  5GTH E;  1J1D C;  2V4H A;  1L0L D;  2FYU G;  1SQV G;  2D2C B;  3CCV P;  3LID A;  1SQP J;  1VQO P;  1P84 D;  2L91 A;  2XKM A;  3K5B A;  4H44 D;  1PGJ A;  4I7Z B;  1NGM B;  3TDK A;  2ZYD A;  4C46 A;  2FYN C;  3CL3 D;  4L76 A;  5APX A;  1T2K C;  3S1K A;  3M0A A;  1YJW P;  2D2C D;  1GK6 A;  1YHQ P;  1SQQ K;  2NPS B;  3CWB J;  1Q7Y Q;  1VQ7 P;  3VMX A;  5KLV J;  5AVR B;  5APQ A;  5B5E H;  1RHZ B;  5KAF E;  3NTN A;  2YKP A;  3M0D A;  1L0N J;  1IK9 A;  4M3L A;  1URQ B;  5AVS B;  4DT0 A;  2KB7 P;  1KB9 E;  3AEG C;  1GW3 A;  2ZT9 B;  3V2P A;  1BCC E;  1G2C A;  4DOJ A;  3Q5S A;  2NPS D;  1DEE G;  3I56 P;  2WPQ A;  4KJM A;  3KQG A;  3CC4 P;  3Q5P A;  1PPJ D;  1LT9 C;  2FYN B;  2V7Q H;  2WSE H;  1NTZ E;  3VN0 A;  3GF3 A;  1URQ D;  3KDP B;  3L37 A;  3WMM 0;  1SP4 A;  2ZYG A;  4ZKP A;  3H1L D;  5GTH H;  2ZT9 D;  3KXD A;  3H1K J;  1T3J A;  2WSS H;  1RE4 C;  1VQP P;  1E5W A;  1L0L J;  2J59 M;  3MP7 B;  1T2K D;  3CWB E;  2HR3 A;  5KLV E;  4H0L C;  1S72 P;  3CX5 D;  1HH0 A;  3VMZ A;  1BE3 D;  1ZLL A;  4R4L A;  1LT9 B;  2WIT A;  1T8Z A;  2NPS A;  4RES B;  2RN0 A;  3AE9 C;  5AW9 B;  5KAF H;  4XFJ A;  5AVT B;  3PH0 A;  4U3F D;  3FXD A;  2AXT E;  2WWW A;  3KHU A;  1JUN A;  1URQ A;  5CJ0 A;  2N1T C;  1JY3 N;  2OTK E;  1OW6 A;  2OYH C;  4ZNC A;  1RH5 B;  2AEF A;  3CCR P;  4TT3 H;  5L8R J;  3AEE C;  2FFD C;  4JPZ B;  4HYT B;  2Q7C A;  2M0B A;  3H1K E;  4N6J A;  1W2B O;  2MKV A;  3P7K A;  1M1J C;  1A02 J;  4H0L B;  2BEZ F;  1K73 Q;  4JF7 A;  3SWY A;  2N9Y B;  1L0L E;  2E5Y A;  3E1R A;  1JO5 A;  2FY8 A;  4IFD K;  3CPW O;  2BCC G;  3L71 J;  3H1H G;  1UIX A;  1HJ0 A;  1JNM A;  2H7H A;  2M3B A;  2Q1K A;  1T6A A;  1NTK K;  1N7L A;  2M8R A;  1FZC C;  2UWJ E;  4H0L D;  1LTB C;  1RY3 A;  4XA4 A;  2PAJ A;  2PP6 A;  3A0B E;  2FFD B;  2KYV A;  3GMA A;  1XTC C;  1M1J B;  1LT9 A;  1R5S A;  2IFM A;  1JY3 O;  1BE3 J;  1MV8 A;  1LTT C;  1VQ6 P;  2ZAE B;  3L72 E;  1LTJ C;  1KTM A;  4K35 A;  2LXB A;  4PJ0 E;  4U3F J;  4UB6 E;  1NU1 K;  1YIJ P;  3LIE A;  4BXL A;  1KYO I;  1NAF A;  1FZC B;  1FJP A;  1SQB D;  2J5U A;  3L71 E;  3JC2 2;  2ZJS E;  1GK4 A;  3V5B A;  1HBW A;  5CMZ A;  2A06 D;  3WUV A;  2W27 A;  3EQ2 A;  1YIT P;  3O6Q B;  1QVF O;  1S4X A;  3CD6 P;  3L72 G;  4C7N B;  1OWA A;  4IL6 E;  2QG4 A;  1YQ3 C;  3WUU A;  2FYU D;  1YI2 P;  4PV1 C;  1DX7 A;  3L75 G;  1LTJ B;  3AE3 C;  1LTG C;  4ASW A;  4B86 A;  1ZW0 A;  3KZI E;  3EWK A;  4I1L A;  5APV A;  3A0B H;  2M3E A;  1KZU B;  1M56 D;  1BGY D;  3L70 E;  2FFD A;  1KIL E;  4OGQ C;  3USS A;  4ASV A;  2YMY A;  1GDT A;  1BDD A;  1SQP K;  3D70 A;  5AVY B;  4A7P A;  1M1J A;  1QL2 A;  2WPR A;  1FDI A;  2OYI C;  1ZP0 C;  1OIP A;  1PGO A;  2R44 A;  3BVH A;  4N3Y B;  1YQ4 C;  2IFN A;  3H1J G;  4PJ0 H;  5GTI E;  4UB6 H;  4I6M C;  2BEQ D;  4EYY Q;  4PV1 B;  2A45 G;  2ZXX A;  2B89 A;  1MKM A;  5KLV K;  2CPS A;  2E76 C;  1FZC A;  2BAS A;  2KSJ A;  3KPE A;  2FKW B;  3FWN A;  1L0N K;  2AEJ A;  2SPZ A;  1SQB J;  2QM8 A;  1IO4 A;  5TIS E;  3B4S A;  3Q2Y A;  4OGQ B;  1OX3 A;  1S5L E;  2B87 B;  1SQQ G;  2K9J B;  3O6Q A;  2KK7 A;  5B66 E;  4L74 A;  4Z1M H;  4PV1 D;  4I2L C;  1JCC A;  4IL6 H;  4C7N A;  3T97 B;  2Q9I A;  3R2P A;  1HVV A;  4WBA A;  3E7K A;  1LTJ A;  3FXE A;  3HD7 C;  1EDK A;  1BCC D;  3KZI H;  2FYU J;  4OGQ D;  1SQV J;  3M91 A;  4TLF A;  1IFD A;  2JWD A;  2O3J A;  4ZKU A;  3HRN A;  2H8P D;  3MHV A;  3BRV B;  3SWK A;  1NTZ D;  2E76 B;  3WU2 E;  2KIK A;  3JCU E;  1QGK B;  3N7N A;  2P7J A;  1L0L K;  3Q3D A;  2WSE J;  2POH A;  2QJP C;  3UIA A;  1RE3 C;  2YMK A;  3OJA B;  1HGZ A;  3P8M C;  1KC8 Q;  1Y8A A;  3M9H A;  3H25 A;  2CK3 H;  1SQB E;  2E76 D;  2Y0D A;  3TGU E;  4GOD A;  1JY2 O;  1GU5 A;  2K88 A;  5AW7 B;  3HD7 B;  1KYO E;  3MD0 A;  1NHL A;  2YKO A;  1LJ2 A;  3MTU E;  2A06 E;  2PGD A;  1GU4 A;  1KFN A;  2GUS A;  1J1E B;  3QH9 A;  2Q5U A;  1FS0 E;  2K3R A;  5AVX B;  1XTG B;  5CCG C;  4UB8 E;  3H6P A;  5TIS H;  3CCE P;  4AYC A;  1S5L H;  1Y47 A;  1EDL A;  5B66 H;  2B87 A;  2P67 A;  2K9J A;  2Z4E A;  3PHL A;  1SQV E;  1N73 C;  3HD7 D;  1KFM A;  2ITA A;  1TU3 F;  3T97 A;  3TGU G;  2LR2 A;  1HJB A;  2J58 A;  2WSC H;  2I1K A;  1IFM A;  5CJ4 A;  3WU2 H;  5CBO A;  3JCU H;  1K8A Q;  2KXP B;  1FE6 A;  2YKQ A;  1CZQ A;  1NTZ J;  2E43 A;  2ZT9 C;  1KQF B;  1HTL C;  2IBZ G;  3TF5 A;  1Q81 Q;  1U57 A;  2KP8 A;  1A02 F;  3CCL P;  3RGU A;  4W7Y A;  1N73 B;  2WPS A;  3B5N C;  3LW5 H;  3RL0 C;  1EXI A;  3RK3 E;  1EZV G;  2WTY A;  3HD7 A;  5APW A;  1KYO H;  1RQU A;  1SS1 A;  5CCG D;  4GDO A;  5AW4 B;  1OW7 A;  1LTA C;  1AVY A;  2IZ1 A;  2C0X A;  4YXW H;  1LNQ A;  3GW6 A;  3B8E B;  3AE7 C;  4UB8 H;  1KIL C;  2G8Y A;  5CCH C;  4LGD E;  3L72 D;  4NPF X;  3G71 P;  1N86 A;  3VMY A;  1AA0 A;  1NKN A;  1U7M A;  1RE3 A;  2W6B A;  2YXQ B;  3ITK A;  3H1I G;  3H1H J;  3L75 D;  1FZF A;  4JBZ A;  1NU1 G;  2QE7 H;  3B5N B;  3RL0 B;  1BSN A;  2O1J A;  3L71 D;  1JEK A;  2E75 C;  1Z56 A;  2P1J A;  1K05 A;  3L73 E;  2XV5 A;  1W5C E; 
#chains in the Genus database with same CATH homology
 1LWU A;  3P8C E;  1GL2 D;  1XTC C;  1MUU A;  1KIL B;  5CCG A;  2HPC A;  1M1J B;  1G1I A;  1LT9 A;  3B5N D;  3RL0 D;  1N7S B;  2FYZ A;  2IFM A;  5AW0 B;  1IC2 A;  1JY3 O;  1MV8 A;  1LTT C;  1X9V A;  2A45 I;  2XDJ A;  2E42 A;  3TNU B;  4WY4 A;  3VTP C;  1JY2 N;  1LTJ C;  2KLV A;  1N73 A;  1EQ7 A;  2R3C A;  3M06 A;  2HFE D;  2L5G B;  1RF1 B;  3V2N A;  3HUS A;  3G3Z A;  2O01 H;  5AVU B;  1NKZ B;  1JTH B;  1NU1 K;  3VP8 A;  3LIE A;  1NAF A;  3GHG C;  1KIL D;  1FZC B;  5APT A;  1FJP A;  5CCH D;  2OYI B;  1N7S D;  3BAS A;  1GK4 A;  1KQL A;  1VPC A;  1FU1 A;  3V5B A;  1JOC A;  1HGV A;  2Z5H A;  3VYI A;  1HBW A;  1L4A B;  1FDM A;  5CMZ A;  2W27 A;  3EQ2 A;  1CI6 B;  1NO4 A;  2Q3I A;  3V2R A;  5AW5 B;  2WSF H;  2O1K A;  5APS A;  5AW1 B;  3M0D C;  4EOT A;  5AW6 B;  2CPB A;  4Y99 C;  3O8Z A;  4C7N B;  3IFM A;  1OWA A;  1S9K D;  4GT1 A;  1SQB K;  1GL2 A;  3KYQ A;  1DX7 A;  3EFG A;  1LTJ B;  3RK2 B;  1LTG C;  3B5N A;  1HUC A;  3OA7 A;  5APY A;  1N7S C;  3A2A A;  4B86 A;  1WT6 A;  1L4A D;  1YYC A;  1H89 A;  2XNX A;  4I1L A;  5APV A;  3HE5 A;  1MZ9 A;  3L35 A;  3GHG B;  1KZU B;  4GKG A;  1T3U A;  4AQR D;  1ZV8 A;  2FFD A;  1PFI A;  1SVF A;  2YMY A;  1J1D B;  1DEB A;  3II6 A;  1GDT A;  2FYU K;  3MGN A;  5KJ7 C;  3U1A A;  3TYY A;  1SQP K;  1SQV K;  1KIL A;  5AVY B;  1FOS F;  1NH4 A;  3TSI A;  1M1J A;  1QL2 A;  2WPR A;  3RK2 D;  5CCH A;  3NFQ A;  2OYI C;  1N7S A;  2Z5I A;  4W7Z A;  4AUW A;  1MFZ A;  5KTB A;  1IFJ A;  1JMM A;  5AVQ B;  3TNU A;  3L4F A;  3BVH A;  1J2J B;  4N3Y B;  1GTW A;  2JJL A;  1JCD A;  2IFN A;  1ZR2 A;  1LTS C;  1RF1 A;  1ZR4 A;  2HG5 D;  1GZL A;  1S9K E;  4I6M C;  3HTK B;  3NMD A;  4HH2 A;  1JTH A;  2WT7 B;  2A45 G;  1FZB A;  3CLQ A;  1NWQ A;  5KLV K;  2CPS A;  2KOG A;  2R32 A;  1FZC A;  1G2C B;  2BAS A;  2KSJ A;  3KPE A;  2HOD B;  2FKW B;  2N9B A;  3CI9 A;  1L0N K;  2OYI A;  4W80 A;  1FJK A;  3M9Q A;  1WRG A;  3VP9 A;  3RK2 C;  2GM4 A;  5BVZ A;  2R5B A;  1CSB A;  2QM8 A;  1IO4 A;  5AW3 B;  1L4A A;  1RF0 C;  1FZE A;  2NPS C;  5AW8 B;  3I5C A;  1CI6 A;  2LKM A;  1LTI C;  1AFO A;  1X79 B;  3E1I A;  3V4Q A;  1IFN A;  4I2L C;  2R5D A;  1JCC A;  1GW4 A;  4C7N A;  1IJD B;  2Q9I A;  3R2P A;  1URQ C;  2HYN A;  1HVV A;  5APU A;  1J1D C;  4WBA A;  1JY2 P;  2H43 A;  4IFM A;  1LTJ A;  3HD7 C;  2P2U A;  4DZO A;  3RK3 C;  3LID A;  4WB4 A;  3M91 A;  1IFD A;  2XKM A;  4ZKU A;  3HRN A;  2H8P D;  5KJ7 D;  3GHG A;  3BRV B;  4C46 A;  5BU5 A;  2XU6 A;  3CL3 D;  3HE4 B;  3TK1 A;  1OXZ A;  5AW2 B;  2IPP A;  3N7N A;  5APX A;  2P7J A;  1T2K C;  1DH3 A;  1SFC C;  1L0L K;  3M0A A;  2HLO A;  3A7O A;  3P32 A;  2POH A;  2C9L Y;  3L36 A;  1GK6 A;  3UIA A;  2C9N Y;  1SQQ K;  2NPS B;  1RE3 C;  3OJA B;  3VMX A;  1HGZ A;  5AVR B;  5APQ A;  1FZA A;  3P8M C;  2MJZ A;  3SWF A;  3NTN A;  2YKP A;  3M0D A;  1H8A A;  3U59 A;  1IK9 A;  3M9H A;  1FOS E;  3H32 B;  4M3L A;  1URQ B;  1NTZ K;  5AVS B;  1NOH A;  1JY2 O;  2KB7 P;  3HTK A;  1GU5 A;  5AW7 B;  1GW3 A;  2WT7 A;  3HD7 B;  3NXS A;  1FBM A;  3RK3 B;  3BRT B;  3MD0 A;  1YTZ T;  1VDF A;  1NHL A;  2YKO A;  2YO3 A;  4JYB A;  3MTU E;  4KHX A;  3V2P A;  1G2C A;  2HOD A;  4DOJ A;  1GU4 A;  1KFN A;  2GUS A;  1J1E B;  2NPS D;  1LWU C;  2WPQ A;  3KQG A;  2Q5U A;  5AVX B;  1XTG B;  2FXM A;  5CCG C;  1W2E A;  3H6P A;  1LT9 C;  1G1J A;  4AYC A;  2WSE H;  3VN0 A;  3U1C A;  1URQ D;  2N1T B;  2P67 A;  1SFC B;  3KDP B;  3L37 A;  2Z4E A;  3WMM 0;  1SP4 A;  2OYH B;  4WY4 C;  4ZKP A;  5KJ7 A;  1N73 C;  3HD7 D;  1KFM A;  3A5T A;  2GUV A;  2IX7 C;  3T97 A;  2QM7 A;  1FZG A;  3RK3 D;  3HUS C;  4O9B A;  2ZXE B;  1T3J A;  2WZ7 A;  1RE4 C;  4OH8 B;  1CW5 A;  1E5W A;  1LGH B;  1HJB A;  2J59 M;  1ZN5 A;  2J58 A;  4N78 D;  2WSC H;  2N1T D;  1X8Y A;  2I1K A;  2XZR A;  1T2K D;  1IFM A;  1SFC D;  5CJ4 A;  3MUD A;  3V2Q A;  3PP5 A;  5AVW B;  5AVV B;  3HE4 A;  2ZFC A;  1LWU B;  1HH0 A;  3VMZ A;  2YKQ A;  1CZQ A;  1ZLL A;  1RE4 A;  2E43 A;  4LC1 A;  1HTL C;  3IR9 A;  2HPC B;  1LT9 B;  2WIT A;  5CHX A;  1T8Z A;  3M9B A;  1YTZ I;  1RF0 A;  2NPS A;  2KP8 A;  4RES B;  1J1E C;  1QL1 A;  2A45 H;  1A02 F;  3C9I A;  5AW9 B;  1GL2 C;  5AVT B;  3BAT A;  4W7Y A;  4WY4 B;  1N73 B;  4JYC A;  2WPS A;  3B5N C;  3LW5 H;  3RL0 C;  2WWW A;  5AVZ B;  3H32 A;  2C0W A;  1JUN A;  3HUS B;  1URQ A;  5CJ0 A;  2N1T C;  4EIJ A;  1JY3 N;  2WTY A;  2W6A A;  2OYH C;  2OAR A;  3HD7 A;  2YO2 A;  4XE5 B;  5APW A;  3N4X A;  5CCG D;  3V4W A;  5AW4 B;  2FFD C;  1HWT C;  1H88 A;  1SLQ A;  1LTA C;  3P8C D;  4HYT B;  2Q7C A;  2C0X A;  4N78 E;  4N6J A;  3B8E B;  4WY4 D;  1NTM K;  4IFF A;  1KIL C;  1AQ5 A;  3P7K A;  1M1J C;  4LLH A;  1A02 J;  5CCH C;  1IFI A;  4LGD E;  1GD2 E;  1JY3 P;  4JF7 A;  3SWY A;  2N1T A;  1JO5 A;  1SFC A;  2OYH A;  4IFD K;  1N86 A;  3VMY A;  2I1J A;  3VOP A;  1JNM A;  1RF1 C;  1M7L A;  2H7H A;  1NKN A;  1RE3 A;  2M3B A;  5BU8 B;  2W6B A;  1GL2 B;  4C7R A;  1FZF A;  2JEE A;  3B5N B;  3RL0 B;  1FAV A;  1SQX K;  1NTK K;  2O1J A;  1N7L A;  2M8R A;  1FZC C;  1N2D C;  1LTB C;  1RY3 A;  3OAK A;  2VRS A;  1Z56 A;  2P1J A;  3MIW A;  4XA4 A;  2PAJ A;  3HE5 B;  4GIF A;  2PP6 A;  3A3Y B;  1L4A C;  4Y99 B;  2XV5 A;  2FFD B;  2KYV A;  2YNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...