3TNUB

Heterocomplex of coil 2b domains of human intermediate filament proteins, keratin 5 (krt5) and keratin 14 (krt14)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
95
structure length
95
Chain Sequence
TKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Keratin, type I cytoskeletal 14
publication title Structural basis for heteromeric assembly and perinuclear organization of keratin filaments.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytosolic protein
total genus 46
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3tnuB00
5AVXB 2QM7A 1T2KC 4I6MC 5AW8B 2R32A 5AW5B 3SWFA 2WWWA 3V5BA 4KHXA 5AW9B 3MD0A 4AQRD 5AW7B 1NWQA 1DH3A 2R5BA 1CI6A 1MFZA 5AW4B 1G2CB 2WPRA 1IO4A 1HBWA 3MGNA 3V4QA 2YO2A 3P8MC 1NAFA 3HE4A 1YYCA 4DZOA 3TYYA 1HJBA 5APXA 5AVQB 1S9KE 2E42A 4C46A 2XV5A 4B86A 2WPSA 1GU4A 3M0AA 2JJLA 1GD2E 1GZLA 1OXZA 1MUUA 1JNMA 3TNUB 2E43A 5CMZA 5AVZB 1X8YA 4XE5B 2XU6A 3HE5B 2H7HA 2XZRA 3L35A 5AW6B 1HUCA 5AVUB 3VMXA 3M0DA 1A02J 1J2JB 3NFQA 4LC1A 2W6AA 3M06A 1H8AA 2Q5UA 1SLQA 2IPPA 4JYBA 3L37A 5APTA 3A5TA 4C7NB 5AW2B 1CSBA 4HYTB 2P67A 3KQGA 2VRSA 2WT7B 4RESB 2YNYA 1MV8A 5APSA 3HE4B 5APUA 2R3CA 3LIEA 2P7JA 2R5DA 3OAKA 2N9BA 1FOSE 2KP8A 1KQLA 4EOTA 2YO3A 2WPQA 2C9NY 1JUNA 1HWTC 5AVTB 2WTYA 5APWA 2ZFCA 4AUWA 3L36A 5APVA 4AYCA 1GTWA 3A2AA 3TNUA 3UIAA 3HTKA 3NXSA 1H89A 1FOSF 5APQA 5AW3B 4JYCA 3M9BA 3HE5A 5AVWB 1CI6B 2C9LY 1GK6A 5AW1B 1CZQA 3VTPC 5AVSB 3VMYA 3VN0A 1FAVA 1OWAA 2P2UA 3LIDA 5AW0B 3VMZA 1A02F 2W27A 1GU5A 4C7NA 3P7KA 3P32A 1GK4A 5APYA 1H88A 4M3LA 2Q3IA 4GT1A 5AVYB 2WT7A 3A3YB 3I5CA 2Z5HA 3T97A 2BASA 2ZXEB 5AVVB 3B8EB 5AVRB 3TK1A 3O8ZA 2QM8A 3NTNA 3IR9A 4I2LC 3VYIA 3M9HA 4GKGA 1T2KD 1SP4A 3M91A 3NMDA 1S9KD 3A7OA 3V4WA 3KDPB 2Q7CA 2Z5IA
chains in the Genus database with same CATH superfamily
3TSIA 2ZJSE 2BEQD 2LXBA 5CCHA 1Y8AA 1K04A 1G1IA 1ZLLA 3Q5RA 1JY2P 3P8MC 1SQVJ 2B87A 1OW6A 2QRXA 4U3FD 3H1LE 2Y9YA 2KUBA 2K37A 4OGQB 5CCGA 1NH4A 2XU6A 3L35A 2OTLP 2IZ0A 2AXTH 4PV1B 1AVYA 2OYIC 3M06A 3H32B 1T3JA 2KS1A 4C7NB 4WY4D 4DOJA 2VRSA 1BDDA 3TGUG 2E76C 4BRYA 2KK7A 1IJDB 1YIJP 1JUNA 3H1HG 2WSCH 3H1KG 1RQVA 1EZVI 3F89A 3B5ND 1JTHB 1S4XA 2C9LY 5AW1B 1YBKA 3VMAA 2HFED 3Q2YA 2GUSA 2P2UA 1EC5A 3P32A 3A3YB 4D6TJ 1Q82Q 1LT1A 1KYOE 3RBXA 1G1JA 2H89C 3RK3D 4TLFA 1BDCA 3JSVC 1PPJG 3KZIH 1DIPA 4EIJA 3L71E 2P58A 3AEDC 3AE5C 4PD4E 2WPRA 3CI9A 1M56D 3H1JJ 1S9KE 2BEZF 2PRRA 1SQPK 2XV5A 2ZYAA 3BCCG 1NU1E 1YTZT 1L0NJ 3V2NA 1AFOA 2RH0A 2WMMA 1EXJA 4KT0J 5KLVE 3N4XA 1IC2A 2QJKC 3VMXA 3M0DA 1KQFB 1PGOA 2PP6A 1Y9BA 3CWBG 2KSJA 2BCCE 3HE4B 1KYOI 2R3CA 1H0TB 1HJ0A 1QL2A 2KXPB 2N9BA 1NTZD 2E74D 3BRVB 2C9NY 3D70A 1KTMA 3L75E 2WSFH 1T6AA 1JMMA 4LLHA 3RGUA 1W2EA 1OVUA 5APQA 1VQ4P 4PD4I 5DJTB 1FAVA 5M1BA 1JY3O 3A0BH 2PFXA 1ZR2A 4BXLA 3O6QB 2R3SA 4H0LB 4UB6H 3IR9A 3EWKA 2WZ7A 3MHVA 3KDPB 3E1RA 5AW8B 2NPSC 1SQQD 1VQKP 2ZXXA 3L72D 2WVRA 2KOGA 2WSSH 1HJBA 4H13B 1FZEA 1AVOA 2NRGA 2FYUK 3SFEC 3Q1MA 2RN0A 4C46A 1AQ5A 3TNUB 3HD7C 2MKVA 3BRTB 1QX8A 1URQB 1VDFA 5AVZB 3C9IA 1ZV8A 2GM4A 4IFFA 2HPCA 2O01N 3L73J 1SQBD 1VL2A 1LWUC 1SQPE 5APTA 4MN4C 2OYHC 4DT0A 3G4SP 1FOSE 3CD6P 1N73A 1RF0A 1P84E 1IFJA 1EZVD 1HWTC 5E79E 1VQ5P 2OYIA 1SFCB 3L71G 1FZGA 2ZFCA 3SFDC 1VPCA 2Q9IA 2XNDH 1ZP0C 1FOSF 5AW3B 1G2CA 1NU1G 3SWKA 3V2RA 3LIDA 2FYNC 3H1LD 2Y0EA 1L4AB 5TISH 4DJGA 5CBNA 2KB7P 3I5CA 5KLVG 1RE4A 5H2FE 2W83C 3VOPA 1KB9I 4WVZA 2JP3A 1W5CE 2Q7CA 2BCCG 1U7MA 4K3AA 3II6A 1L2PA 1AA0A 3L75G 1HBWA 3V4QA 1GL2C 1YYCA 1P84I 3D71A 4U3FJ 3HD7D 1DEBA 2IBZG 1IZNB 1GZLA 1OXZA 1KILD 1RQUA 1YTZI 3GW6A 3IFMA 1X8YA 1R5SA 4NPFX 4RJTA 1S5LX 5AVUB 2JO1A 2RKLA 4L74A 5CCGC 1KYOD 1NTKD 1K05A 2AEFA 5APSA 4GIFA 1JEKA 1BGYD 2YKQA 3L71D 3L70E 4EI2A 2P10A 2AXTE 1IFNA 5B66H 5KJ7D 3L74D 2QIWA 1VQ7P 4N78E 1NU1D 2KI7B 1QLED 1J1EC 4C7RA 3W68A 4N3YB 2IYPA 1LT9A 3HRNA 1N7SB 2H43A 3AECC 4I2LC 2OTKE 1BCCE 1SQPG 1Q7YQ 2Y0CA 2H88C 1M1KQ 3CCUP 3IAOA 2R32A 4OVNF 4I7ZC 1T3UA 2W90A 2A45I 4HB1A 1D7MA 1VF5B 1DH3A 1FZBA 5CCHD 2JKVA 1FU1A 3FXDA 5AVQB 4CPGA 1SQVK 3AEAC 2NPSA 1FDMA 1L0LD 2M8RA 3HUSB 3KZIE 3CCMP 1VQLP 1OVRA 5CCGD 3U59A 1IFDA 4JYBA 4LGDE 4PJ0H 1X9VA 1AV1A 1T8ZA 3HD7A 3WMM0 2JWAA 1NTZJ 1X79B 4OGQC 1HH0A 2O1KA 5KLIB 3AEFC 2IYOA 3JCUH 1LWUA 4PV1C 2WTYA 5BU8B 1GTWA 2OYHA 3A2AA 3HTKA 2UWJE 2IZ1A 1K8AQ 1YJ9P 3VMYA 4L76A 2ZAEB 2KS1B 1QVFO 4O9BA 1TU3F 1KZUB 1E5WA 1GK4A 1YQ3C 1QEXA 1KB9D 3F5HA 2HYNA 4WB4A 5AVVB 4YXDC 4BRYB 2M5AA 2QM8A 3H1IE 1RF1A 2OARA 3M9HA 3MP7B 1SQXJ 3USSA 3M91A 3AE9C 3V4WA 1SQQJ 4BWNA 1T2KC 3L72J 4HJGH 4H44C 4Y99B 3MD0A 3A0BE 2KYVA 1OZHA 5AW7B 1NWQA 1WRGA 5BVZA 1MFZA 3P8CE 2E75B 3L70G 1KD1Q 3RK2B 1QGKB 4UB6E 3AE2C 1BE3E 1VQ6P 2GUVA 1L0NK 4OWFA 4DCKA 1BSHA 1GL2A 3HE5B 1SQBJ 3CX5D 4ASVA 5KLVK 3GHGB 3ABVC 3NFQA 1H8AA 2Q5UA 5EFWB 1SQVE 3A0HH 1OVVA 2FYZA 1MV8A 1BCCG 1KORA 3T97B 3LIEA 1U7JA 4L75A 2WPQA 2G8YA 1S2EA 1USEA 5APWA 3BATA 1N73C 1RF0C 4AYCA 2YKOA 1FZCA 2A06E 3CXHD 2K3RA 1CI6B 3E1IA 1LGHB 2PGDA 1LTGC 2Q6QA 1OWAA 1FJPA 3CCQP 1S5LH 1JM0A 2AEMA 2FXPA 2FFDB 2KLUA 1SVFA 2BASA 5AVRB 2FYUD 2B89A 1T2KD 1RE4C 1VQ8P 4H44D 2KZIA 2G3AA 3BASA 4WY4B 5TISE 3RL0g 4D6TE 1IO4A 4DZOA 3TYYA 1MKMA 2E42A 4YTPC 5KAIH 2CPSA 3V2QA 1GU4A 3VP9A 1EQ7A 2KLVA 3ZDMA 1PP9D 3MUDC 4N78D 3B5NB 2CPBA 4IL6H 1JO5A 4H13C 1GDTA 1NTKJ 3AEBC 3H1JE 4NPEA 3G3ZA 3PH0A 4JBZA 3H1IG 2C0XA 1SQXG 1L0NE 1URQC 1NHLA 2C0WA 5APUA 1BGYJ 3RL0C 4KJMA 1KFNA 1KQLA 1ZMEC 1R5LA 3BVHA 3RK3B 3PTZA 1WT6A 1LTSC 4ZKUA 2Y0DA 2YIUB 3L74J 1YITP 2E76D 2D2CC 1BE3G 4HKZH 3TGUD 5AW0B 1SFCC 3U1AA 3H32A 4C7NA 1ZOYC 3H1HD 3WUTA 2YXRB 1HVVA 3H1KD 2KSEA 1EDKA 1AJYA 4GKGA 2LXCB 2IBZE 1SQVG 3PJSK 1LT9C 1L4AC 1JCCA 2FBWC 2E5TA 3CPWO 4XA4A 1JTHA 3GF7A 1G2CB 1FDIA 2YO2A 2E74B 1PGPA 1L0LJ 2A06G 1LTJB 2QE7H 4ZNCA 1IK9A 3CCRP 1PPJD 2ZYDA 1OIPA 4XE5B 2J59M 2ZT9C 1LTIC 2QG4A 2L91A 1S3JA 1M57D 1NTMJ 2O1JA 1CSBA 2Q1KA 1Q81Q 3RL0D 4RO0A 3BCCD 2WT7B 3CCEP 3CMAP 3SSUA 1ZRTE 4JPZB 2XDJA 1BSNA 2KP8A 4U7JA 3QH9A 2IBZI 1VQ9P 3L36A 4D6TG 3L73E 2D2CD 2PAJA 2KNCB 3PP5A 4PJ0E 4JYCA 1VQOP 2N1TC 3CWBD 3EFFK 3VTPC 1PFIA 2QJYB 5APYA 3JCUE 4UB8H 3V6IA 1DX7A 1H0TA 1EXIA 3O8ZA 1NVOA 3MTUE 3H1JG 3AE7C 3S1KA 2Z5IA 1JY3N 5AVXB 1L0NG 2W6JH 1RF1C 1U57A 1LP1B 1EDIA 1OMIA 1JY2O 2NPSD 1WMKA 3O6QA 2ZT9D 1VQNP 3FWLA 2OGUA 1JCDA 1XTGB 3I56P 4WBAA 1KYOH 1A02J 4LC1A 3L37A 3A5TA 3MUDA 4U3FE 4A7PA 3G71P 3KQGA 4JF7A 1QVGO 3KYQA 4RESB 1NTZK 4Y28J 1PZQA 1LTTC 1NKNA 2IX7C 2N1TD 2YKPA 1N86A 3TNUA 1URQA 3GF3A 3A0HE 3IN6A 1FZCC 4IOIH 5KLIC 3EFGA 1ZN5A 1NGMB 3HD7B 1NYHA 1OX3A 2Q3IA 1KILB 2FYUJ 1GMJA 1LJ2A 4PD4D 1SS1A 1W2BO 1NJIQ 1RY3A 1SFCA 1S9KD 2N9YB 3GG2A 2OYOA 2Y9ZA 1SQXK 1M1JB 2Q3EA 1SQQK 3OW2O 2POHA 3SWYA 2V4HA 4KHXA 1Q86Q 1S5LE 5KLVD 4IL6X 2K9JA 3B4SA 3RK3E 1JY2N 3V2PA 1Z56A 1L4AA 3Q5SA 3L73G 2HODB 1PP9J 3FGAD 3KPEA 2K9YA 2B9BA 4Y99C 2M5AB 2BCCD 3FXEA 2M0BA 2FYNB 2QA4P 2H7HA 2XZRA 3RK2C 1GL2D 1HUCA 3L75D 2ZVNB 1J2JB 1SQBK 1YI2P 1J1DB 1EDLA 2P67A 4K35A 2V7QJ 2IBZD 1FC2C 5B5EH 1OW8A 1KC8Q 3GHGC 2ZYGA 3AE4C 4IL6E 5APVA 1N8RQ 2XKMA 2IDBA 1X0TA 1EDJA 3M9BA 3CLQA 4OH8B 3TGUJ 2J58A 5CBOA 1NTZE 4ZMDA 1PIXA 3H1HJ 1KB9H 2B87B 4EYYQ 4ZKPA 2FXMA 2HLOA 3H1KJ 5AVYB 3KXDA 2ZXEB 2N1TA 3B8EB 1NOHA 5KKZB 5TJHA 4R4MA 3PHLA 1ZXGA 4U3FG 1ZRTD 4HH2A 2K88A 1Q2NA 4AQRD 4N6JA 3L73D 3H6PA 1SQPD 1SQXE 4WY4C 1SQQE 1IFMA 1UIIA 1KN7A 3L72E 5C39A 3CX5H 3I55P 1UIXA 1P84D 3OJAB 1R8EA 2B88A 3WU2H 1NTKK 3BCCJ 4NPDA 3B5NC 3G6EP 2R5DA 3OAKA 1NO4A 2O3JA 1RE3C 1YQ4C 1SQBE 4YXWH 3CXHH 2M3EA 2WSEH 2YMYA 3CWBJ 4OGQD 1QL1A 5AVWB 1PGQA 3N7NA 3RK3C 1EZVE 4PV1D 2I1KA 3AEGC 2YIUC 2DW3A 2JDIH 1K73Q 2A45H 5L8RJ 2YMKA 1VQMP 1JMBA 3Q3DA 3H1LJ 2QM7A 4I6MC 1KQSO 3PRJA 1IFIA 4UB8E 4Z1MH 2WPSA 1ZW0A 1L0LK 2QJPB 1USDA 3CCJP 1GD2E 1NTZG 3IF4A 1KMIZ 3CC2P 3CCVP 2E74C 3CC7P 4H0LC 3L70D 2JWDA 2W6AA 1IK7A 1LTJC 1SLQA 1NTMK 1KILE 2V7QH 3QWOC 1Q90D 4EOTA 3H25A 4H44B 5CHXA 1NAYA 1NTKE 1LNQA 5KAFH 1JOCA 3HE5A 1KV4A 2QSIA 1FJKA 1FBMA 1BCCD 3GHGA 3VN0A 1BGYE 3L71J 1SQQG 2MJZA 4YPCA 3L72G 1CW5A 3T97A 4GDOA 2W6BA 1M8OB 1KFMA 1PV3A 3L74E 5GTIH 3ITKA 1NU1J 1PGJA 2HPCB 4TT3H 2QJYC 5AW5B 3SWFA 3V5BA 5AW9B 5KLVJ 1CI6A 4I1LA 2W8ZA 3AE8C 4IFMA 2FXOA 1SQBG 1N73B 5GTHH 3U1CA 2ITAA 5B66E 4B86A 2OYIB 2FKWB 2BCCJ 2FFDA 2JR8A 5CJ4A 1MUUA 2E43A 4H0LD 1M7LA 1EZVG 3L75J 2E76B 2RMZA 3VP8A 1JB0J 4WY4A 1L0LE 2P1JA 3RBZA 2ZVOB 2KZJA 3H1LG 4H13D 3WUUA 3AE1C 3LW5J 5AVTB 2GA1A 3UIAA 1NTME 3B5NA 2QEXP 1H89A 1URQD 2WPVB 3FWNA 3H1ID 1GK6A 2I1JA 1SQXD 3EQ2A 1RE3A 2I8DA 5B5EE 3FX0A 1AQTA 3S9OA 2Z4EA 4WWIA 2L5GB 3AEEC 1DD3A 1LTBC 3M9QA 3P8CD 3CCSP 3VYIA 1FDOA 1SP4A 1SFCD 1BE3D 1LTAC 3CC4P 2WWWA 1KILC 1FE6A 1KB9E 3RL0B 3D6ZA 1IFPA 2QJKB 3HE4A 1DD4A 4GOEA 1OW7A 1SQPJ 1NTKG 2HR3A 1K9MQ 1L4AD 1SQVD 1M1JC 3CMEP 4IFDK 1JNMA 2D2CB 4XFJA 5CMZA 1GW3A 1BGYG 2R44A 1RHZB 1N7SC 1PL5A 1ZR4A 2XNXA 3CL3D 2A06D 2K1AA 3L74G 2K9JB 3MZWB 5KJ7C 1PP9G 2O01J 1LT9B 1VF5C 3CX5E 1X22A 3R4YA 1LTJA 1J1DC 1HGVA 1KQGB 3TDKA 1HF9A 3WU2E 5K5GB 2AEJA 3HUSC 2YXQB 2J5UA 1VQPP 3VMZA 1A02F 3W67A 2FY8A 1YJNP 2NPSB 4M3LA 2WT7A 4RKUJ 4PD4H 4QMAA 4ASWA 2ZT9B 3CXHE 4D6TD 2WSEJ 5CCHC 3D6YA 1L0LG 3AE3C 3K5BA 3G9RA 2KIKA 2KNCA 1FZAA 2LR2A 2R5BA 1DEEG 5KKZC 5AW4B 1M90Q 2FYUE 3CX5I 3C8VA 5KTBA 1NTMG 3H1JD 1LWUB 1RH5B 1E79H 2N1TB 1FZFA 2OYHB 1L0ND 3HTKB 1N7SD 3L70J 2AXCA 1XTCC 1NKZB 2IFMA 2OQQA 4EDFA 2E5YA 2IPPA 2H8PD 5AW2B 4HYTB 1PP9E 2YNYA 1VF5D 1LP1A 3CXHI 1Y47A 2P7JA 2CK3H 1RF1B 3LW5H 4R4LA 2E75C 5BU5A 1HTLC 2WSCJ 4AUWA 4JQ0D 5DJUB 3NXSA 1BCCJ 5KAIE 4W7YA 3JC22 2W27A 1GU5A 3P7KA 4GOFA 1H88A 3TK1A 2HG5D 2NZ2A 5KAFE 1GL2B 4W7ZA 1HGZA 1S72P 1JY3P 3TGUE 3Q5PA 3AE6C 4W80A 3H1HE 3CCLP 1MZ9A 3H1KE 3KHUA 3MGNA 1NAFA 1MFTA 1S1CX 5APXA 1NTMD 3M0DC 3S4RA 5GTIE 3M0AA 2JJLA 1KILA 3GMAA 2QVAA 1FZCB 3WUVA 1P84H 3L4FA 2FFDC 5E79H 5AW6B 1FS0E 2JEEA 1M1JA 2IFNA 5GTHE 1OFCX 2QJPC 3R2PA 1PPJE 2E75D 2O01H 3RK2D 2YO3A 2WQYC 1N7SA 2HODA 3MIWA 2WITA 2WSFJ 1J1EB 5CJ0A 3OA7A 5H2FH 1YJWP 2FYUG 3H1IJ 5KJ7A 3BCCE 1YHQP 2A45G 1N2DC 1CZQA 5AVSB 3B71A 4GODA 3TF5A 3C1LA 4L73A 3PLNA 4I7ZB 4GT1A 2Z5HA 1N7LA 2SPZA 2M3BA 3E7KA 3HUSA 3GLMA 3NTNA 2OTJP 1BE3J 3CWBE 1GW4A 3NMDA 3A7OA 2LKMA 1NU1K
chains in the Genus database with same CATH topology
5AVXB 3TSIA 1RF1C 2R32A 5AW5B 3SWFA 3V5BA 5AW9B 1T3UA 2A45I 5CCHA 1DH3A 1CI6A 1FZBA 1G1IA 4I1LA 5CCHD 1ZLLA 4IFMA 1JY2P 3P8MC 1N73B 1FU1A 5AVQB 3U1CA 2OYIB 4B86A 1SQVK 2NPSA 2FKWB 1FDMA 2FFDA 1JY2O 2M8RA 2NPSD 5CJ4A 1MUUA 3HUSB 2E43A 1M7LA 5CCGA 1NH4A 2XU6A 1JCDA 5CCGD 3L35A 1XTGB 4WBAA 3U59A 1IFDA 1A02J 4LC1A 3VP8A 2OYIC 3M06A 3H32B 1T3JA 4JYBA 3L37A 4LGDE 4WY4A 4C7NB 3A5TA 3MUDA 1X9VA 4WY4D 1T8ZA 3HD7A 2P1JA 3KQGA 4DOJA 4JF7A 3WMM0 2VRSA 3KYQA 4RESB 1X79B 1HH0A 1NTZK 1IJDB 2O1KA 1JUNA 5AVTB 1LWUA 2WSCH 2WTYA 1LTTC 5BU8B 1NKNA 2IX7C 1GTWA 2N1TD 2OYHA 2YKPA 1N86A 3A2AA 3TNUA 3UIAA 1URQA 3B5NA 3HTKA 1H89A 1URQD 1JTHB 3B5ND 2C9LY 1GK6A 1FZCC 2I1JA 5AW1B 3VMYA 2HFED 3EQ2A 1RE3A 2GUSA 3EFGA 1ZN5A 2P2UA 3HD7B 4O9BA 1KZUB 2Z4EA 1E5WA 3P32A 1GK4A 2Q3IA 1KILB 3A3YB 2L5GB 2HYNA 4WB4A 5AVVB 1LTBC 3M9QA 3P8CD 2QM8A 1G1JA 1RF1A 2OARA 3M9HA 3VYIA 1RY3A 3RK3D 1SP4A 3M91A 1SFCA 1S9KD 1SFCD 3V4WA 1SQXK 1T2KC 1M1JB 1LTAC 4EIJA 1SQQK 2WWWA 2POHA 4Y99B 3SWYA 4KHXA 1KILC 3RL0B 3MD0A 2KYVA 5AW7B 1NWQA 1WRGA 5BVZA 1MFZA 3P8CE 2WPRA 3CI9A 3RK2B 3HE4A 1JY2N 1S9KE 3V2PA 1Z56A 1L4AA 1SQPK 2HODB 1L4AD 2XV5A 1YTZT 1M1JC 2GUVA 3KPEA 4IFDK 4Y99C 3V2NA 1JNMA 1AFOA 1L0NK 5CMZA 1GW3A 1GL2A 3HE5B 2H7HA 2XZRA 1IC2A 3N4XA 1GL2D 3RK2C 1HUCA 3VMXA 3M0DA 5KLVK 1N7SC 3GHGB 1J2JB 2PP6A 1SQBK 3NFQA 1H8AA 2Q5UA 1J1DB 1ZR4A 2XNXA 3CL3D 2P67A 2FYZA 1MV8A 2KSJA 5KJ7C 3HE4B 2R3CA 3LIEA 1QL2A 2N9BA 1LT9B 3BRVB 2WPQA 2C9NY 3GHGC 2WSFH 1LTJA 5APWA 3BATA 1N73C 1J1DC 1HGVA 1RF0C 1JMMA 2YKOA 5APVA 4AYCA 1FZCA 4LLHA 2XKMA 1W2EA 5APQA 3M9BA 3CLQA 1CI6B 3E1IA 4OH8B 3HUSC 1LGHB 1JY3N 2J58A 1LTGC 1FAVA 1OWAA 1FJPA 3VMZA 1A02F 1JY3O 4ZKPA 2FXMA 2HLOA 2NPSB 4M3LA 2FFDB 5AVYB 2WT7A 1ZR2A 1SVFA 2BASA 2ZXEB 2N1TA 3B8EB 5AVRB 1NOHA 5CCHC 3IR9A 1T2KD 1RE4C 2WZ7A 3KDPB 3BASA 5AW8B 2NPSC 4HH2A 4WY4B 4AQRD 1FZAA 4N6JA 2R5BA 2KOGA 5AW4B 1IO4A 4DZOA 1HJBA 3TYYA 1FZEA 2FYUK 5KTBA 2E42A 4C46A 2CPSA 3H6PA 3V2QA 1AQ5A 1GU4A 1LWUB 3VP9A 1EQ7A 2KLVA 2N1TB 4WY4C 1FZFA 2OYHB 1IFMA 3TNUB 3HD7C 4N78D 3BRTB 1URQB 2CPBA 3B5NB 3HTKB 1VDFA 5AVZB 3C9IA 1N7SD 1ZV8A 3OJAB 1JO5A 1XTCC 2GM4A 1NKZB 4IFFA 2IFMA 1GDTA 2HPCA 1LWUC 1NTKK 5APTA 2IPPA 2H8PD 3G3ZA 5AW2B 4HYTB 2OYHC 2C0XA 2YNYA 1URQC 1NHLA 3B5NC 2C0WA 5APUA 2P7JA 2R5DA 3OAKA 3RL0C 1FOSE 1N73A 1KFNA 1KQLA 1RF0A 1NO4A 1IFJA 3BVHA 3RK3B 1RF1B 3LW5H 1HWTC 2OYIA 1RE3C 1SFCB 5BU5A 1WT6A 1HTLC 1FZGA 2ZFCA 4AUWA 1LTSC 1VPCA 4ZKUA 2WSEH 2YMYA 2Q9IA 3NXSA 1FOSF 5AW3B 1QL1A 5AVWB 4W7YA 3N7NA 1G2CA 3RK3C 3V2RA 3LIDA 5AW0B 1SFCC 3U1AA 3H32A 2W27A 1L4AB 1GU5A 4C7NA 3P7KA 2I1KA 1H88A 2KB7P 3I5CA 1RE4A 1HVVA 3TK1A 2HG5D 3VOPA 1GL2B 2A45H 1HGZA 4GKGA 4W7ZA 1JY3P 1LT9C 4W80A 2Q7CA 1L4AC 2QM7A 1JCCA 4I6MC 4XA4A 1JTHA 1MZ9A 1IFIA 3II6A 1G2CB 1HBWA 3MGNA 3V4QA 2YO2A 1NAFA 1GL2C 1YYCA 5APXA 3M0DC 3HD7D 1DEBA 2WPSA 3M0AA 1LTJB 2JJLA 1L0LK 1GD2E 1KILA 1GZLA 1OXZA 1IK9A 1KILD 1FZCB 1YTZI 3IFMA 3L4FA 1X8YA 2FFDC 4XE5B 5AW6B 2J59M 5AVUB 1LTIC 2JEEA 2O1JA 5CCGC 1M1JA 2W6AA 1LTJC 1SLQA 2IFNA 1CSBA 1NTMK 3R2PA 3RL0D 2WT7B 5APSA 4GIFA 2O01H 2XDJA 2KP8A 3RK2D 4EOTA 2YO3A 1N7SA 2YKQA 2HODA 3MIWA 2WITA 1J1EB 5CHXA 5CJ0A 3L36A 3OA7A 1IFNA 5KJ7A 1JOCA 2PAJA 5KJ7D 3PP5A 4JYCA 2N1TC 3HE5A 1FJKA 1FBMA 2A45G 1N2DC 1CZQA 4N78E 3VTPC 5AVSB 3GHGA 3VN0A 2MJZA 1PFIA 1J1EC 4C7RA 4N3YB 5APYA 4GT1A 1CW5A 1DX7A 2Z5HA 3T97A 1N7LA 2M3BA 2W6BA 3HUSA 1LT9A 3HRNA 1N7SB 3O8ZA 2H43A 3NTNA 1KFMA 4I2LC 3MTUE 1GW4A 3NMDA 3A7OA 2LKMA 2HPCB 2Z5IA 1NU1K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVX B;  2QM7 A;  1T2K C;  4I6M C;  5AW8 B;  2R32 A;  5AW5 B;  3SWF A;  2WWW A;  3V5B A;  4KHX A;  5AW9 B;  3MD0 A;  4AQR D;  5AW7 B;  1NWQ A;  1DH3 A;  2R5B A;  1CI6 A;  1MFZ A;  5AW4 B;  1G2C B;  2WPR A;  1IO4 A;  1HBW A;  3MGN A;  3V4Q A;  2YO2 A;  3P8M C;  1NAF A;  3HE4 A;  1YYC A;  4DZO A;  3TYY A;  1HJB A;  5APX A;  5AVQ B;  1S9K E;  2E42 A;  4C46 A;  2XV5 A;  4B86 A;  2WPS A;  1GU4 A;  3M0A A;  2JJL A;  1GD2 E;  1GZL A;  1OXZ A;  1MUU A;  1JNM A;  3TNU B;  2E43 A;  5CMZ A;  5AVZ B;  1X8Y A;  4XE5 B;  2XU6 A;  3HE5 B;  2H7H A;  2XZR A;  3L35 A;  5AW6 B;  1HUC A;  5AVU B;  3VMX A;  3M0D A;  1A02 J;  1J2J B;  3NFQ A;  4LC1 A;  2W6A A;  3M06 A;  1H8A A;  2Q5U A;  1SLQ A;  2IPP A;  4JYB A;  3L37 A;  5APT A;  3A5T A;  4C7N B;  5AW2 B;  1CSB A;  4HYT B;  2P67 A;  3KQG A;  2VRS A;  2WT7 B;  4RES B;  2YNY A;  1MV8 A;  5APS A;  3HE4 B;  5APU A;  2R3C A;  3LIE A;  2P7J A;  2R5D A;  3OAK A;  2N9B A;  1FOS E;  2KP8 A;  1KQL A;  4EOT A;  2YO3 A;  2WPQ A;  2C9N Y;  1JUN A;  1HWT C;  5AVT B;  2WTY A;  5APW A;  2ZFC A;  4AUW A;  3L36 A;  5APV A;  4AYC A;  1GTW A;  3A2A A;  3TNU A;  3UIA A;  3HTK A;  3NXS A;  1H89 A;  1FOS F;  5APQ A;  5AW3 B;  4JYC A;  3M9B A;  3HE5 A;  5AVW B;  1CI6 B;  2C9L Y;  1GK6 A;  5AW1 B;  1CZQ A;  3VTP C;  5AVS B;  3VMY A;  3VN0 A;  1FAV A;  1OWA A;  2P2U A;  3LID A;  5AW0 B;  3VMZ A;  1A02 F;  2W27 A;  1GU5 A;  4C7N A;  3P7K A;  3P32 A;  1GK4 A;  5APY A;  1H88 A;  4M3L A;  2Q3I A;  4GT1 A;  5AVY B;  2WT7 A;  3A3Y B;  3I5C A;  2Z5H A;  3T97 A;  2BAS A;  2ZXE B;  5AVV B;  3B8E B;  5AVR B;  3TK1 A;  3O8Z A;  2QM8 A;  3NTN A;  3IR9 A;  4I2L C;  3VYI A;  3M9H A;  4GKG A;  1T2K D;  1SP4 A;  3M91 A;  3NMD A;  1S9K D;  3A7O A;  3V4W A;  3KDP B;  2Q7C A;  2Z5I A; 
#chains in the Genus database with same CATH topology
 3TSI A;  2ZJS E;  2BEQ D;  2LXB A;  5CCH A;  1Y8A A;  1K04 A;  1G1I A;  1ZLL A;  3Q5R A;  1JY2 P;  3P8M C;  1SQV J;  2B87 A;  1OW6 A;  2QRX A;  4U3F D;  3H1L E;  2Y9Y A;  2KUB A;  2K37 A;  4OGQ B;  5CCG A;  1NH4 A;  2XU6 A;  3L35 A;  2OTL P;  2IZ0 A;  2AXT H;  4PV1 B;  1AVY A;  2OYI C;  3M06 A;  3H32 B;  1T3J A;  2KS1 A;  4C7N B;  4WY4 D;  4DOJ A;  2VRS A;  1BDD A;  3TGU G;  2E76 C;  4BRY A;  2KK7 A;  1IJD B;  1YIJ P;  1JUN A;  3H1H G;  2WSC H;  3H1K G;  1RQV A;  1EZV I;  3F89 A;  3B5N D;  1JTH B;  1S4X A;  2C9L Y;  5AW1 B;  1YBK A;  3VMA A;  2HFE D;  3Q2Y A;  2GUS A;  2P2U A;  1EC5 A;  3P32 A;  3A3Y B;  4D6T J;  1Q82 Q;  1LT1 A;  1KYO E;  3RBX A;  1G1J A;  2H89 C;  3RK3 D;  4TLF A;  1BDC A;  3JSV C;  1PPJ G;  3KZI H;  1DIP A;  4EIJ A;  3L71 E;  2P58 A;  3AED C;  3AE5 C;  4PD4 E;  2WPR A;  3CI9 A;  1M56 D;  3H1J J;  1S9K E;  2BEZ F;  2PRR A;  1SQP K;  2XV5 A;  2ZYA A;  3BCC G;  1NU1 E;  1YTZ T;  1L0N J;  3V2N A;  1AFO A;  2RH0 A;  2WMM A;  1EXJ A;  4KT0 J;  5KLV E;  3N4X A;  1IC2 A;  2QJK C;  3VMX A;  3M0D A;  1KQF B;  1PGO A;  2PP6 A;  1Y9B A;  3CWB G;  2KSJ A;  2BCC E;  3HE4 B;  1KYO I;  2R3C A;  1H0T B;  1HJ0 A;  1QL2 A;  2KXP B;  2N9B A;  1NTZ D;  2E74 D;  3BRV B;  2C9N Y;  3D70 A;  1KTM A;  3L75 E;  2WSF H;  1T6A A;  1JMM A;  4LLH A;  3RGU A;  1W2E A;  1OVU A;  5APQ A;  1VQ4 P;  4PD4 I;  5DJT B;  1FAV A;  5M1B A;  1JY3 O;  3A0B H;  2PFX A;  1ZR2 A;  4BXL A;  3O6Q B;  2R3S A;  4H0L B;  4UB6 H;  3IR9 A;  3EWK A;  2WZ7 A;  3MHV A;  3KDP B;  3E1R A;  5AW8 B;  2NPS C;  1SQQ D;  1VQK P;  2ZXX A;  3L72 D;  2WVR A;  2KOG A;  2WSS H;  1HJB A;  4H13 B;  1FZE A;  1AVO A;  2NRG A;  2FYU K;  3SFE C;  3Q1M A;  2RN0 A;  4C46 A;  1AQ5 A;  3TNU B;  3HD7 C;  2MKV A;  3BRT B;  1QX8 A;  1URQ B;  1VDF A;  5AVZ B;  3C9I A;  1ZV8 A;  2GM4 A;  4IFF A;  2HPC A;  2O01 N;  3L73 J;  1SQB D;  1VL2 A;  1LWU C;  1SQP E;  5APT A;  4MN4 C;  2OYH C;  4DT0 A;  3G4S P;  1FOS E;  3CD6 P;  1N73 A;  1RF0 A;  1P84 E;  1IFJ A;  1EZV D;  1HWT C;  5E79 E;  1VQ5 P;  2OYI A;  1SFC B;  3L71 G;  1FZG A;  2ZFC A;  3SFD C;  1VPC A;  2Q9I A;  2XND H;  1ZP0 C;  1FOS F;  5AW3 B;  1G2C A;  1NU1 G;  3SWK A;  3V2R A;  3LID A;  2FYN C;  3H1L D;  2Y0E A;  1L4A B;  5TIS H;  4DJG A;  5CBN A;  2KB7 P;  3I5C A;  5KLV G;  1RE4 A;  5H2F E;  2W83 C;  3VOP A;  1KB9 I;  4WVZ A;  2JP3 A;  1W5C E;  2Q7C A;  2BCC G;  1U7M A;  4K3A A;  3II6 A;  1L2P A;  1AA0 A;  3L75 G;  1HBW A;  3V4Q A;  1GL2 C;  1YYC A;  1P84 I;  3D71 A;  4U3F J;  3HD7 D;  1DEB A;  2IBZ G;  1IZN B;  1GZL A;  1OXZ A;  1KIL D;  1RQU A;  1YTZ I;  3GW6 A;  3IFM A;  1X8Y A;  1R5S A;  4NPF X;  4RJT A;  1S5L X;  5AVU B;  2JO1 A;  2RKL A;  4L74 A;  5CCG C;  1KYO D;  1NTK D;  1K05 A;  2AEF A;  5APS A;  4GIF A;  1JEK A;  1BGY D;  2YKQ A;  3L71 D;  3L70 E;  4EI2 A;  2P10 A;  2AXT E;  1IFN A;  5B66 H;  5KJ7 D;  3L74 D;  2QIW A;  1VQ7 P;  4N78 E;  1NU1 D;  2KI7 B;  1QLE D;  1J1E C;  4C7R A;  3W68 A;  4N3Y B;  2IYP A;  1LT9 A;  3HRN A;  1N7S B;  2H43 A;  3AEC C;  4I2L C;  2OTK E;  1BCC E;  1SQP G;  1Q7Y Q;  2Y0C A;  2H88 C;  1M1K Q;  3CCU P;  3IAO A;  2R32 A;  4OVN F;  4I7Z C;  1T3U A;  2W90 A;  2A45 I;  4HB1 A;  1D7M A;  1VF5 B;  1DH3 A;  1FZB A;  5CCH D;  2JKV A;  1FU1 A;  3FXD A;  5AVQ B;  4CPG A;  1SQV K;  3AEA C;  2NPS A;  1FDM A;  1L0L D;  2M8R A;  3HUS B;  3KZI E;  3CCM P;  1VQL P;  1OVR A;  5CCG D;  3U59 A;  1IFD A;  4JYB A;  4LGD E;  4PJ0 H;  1X9V A;  1AV1 A;  1T8Z A;  3HD7 A;  3WMM 0;  2JWA A;  1NTZ J;  1X79 B;  4OGQ C;  1HH0 A;  2O1K A;  5KLI B;  3AEF C;  2IYO A;  3JCU H;  1LWU A;  4PV1 C;  2WTY A;  5BU8 B;  1GTW A;  2OYH A;  3A2A A;  3HTK A;  2UWJ E;  2IZ1 A;  1K8A Q;  1YJ9 P;  3VMY A;  4L76 A;  2ZAE B;  2KS1 B;  1QVF O;  4O9B A;  1TU3 F;  1KZU B;  1E5W A;  1GK4 A;  1YQ3 C;  1QEX A;  1KB9 D;  3F5H A;  2HYN A;  4WB4 A;  5AVV B;  4YXD C;  4BRY B;  2M5A A;  2QM8 A;  3H1I E;  1RF1 A;  2OAR A;  3M9H A;  3MP7 B;  1SQX J;  3USS A;  3M91 A;  3AE9 C;  3V4W A;  1SQQ J;  4BWN A;  1T2K C;  3L72 J;  4HJG H;  4H44 C;  4Y99 B;  3MD0 A;  3A0B E;  2KYV A;  1OZH A;  5AW7 B;  1NWQ A;  1WRG A;  5BVZ A;  1MFZ A;  3P8C E;  2E75 B;  3L70 G;  1KD1 Q;  3RK2 B;  1QGK B;  4UB6 E;  3AE2 C;  1BE3 E;  1VQ6 P;  2GUV A;  1L0N K;  4OWF A;  4DCK A;  1BSH A;  1GL2 A;  3HE5 B;  1SQB J;  3CX5 D;  4ASV A;  5KLV K;  3GHG B;  3ABV C;  3NFQ A;  1H8A A;  2Q5U A;  5EFW B;  1SQV E;  3A0H H;  1OVV A;  2FYZ A;  1MV8 A;  1BCC G;  1KOR A;  3T97 B;  3LIE A;  1U7J A;  4L75 A;  2WPQ A;  2G8Y A;  1S2E A;  1USE A;  5APW A;  3BAT A;  1N73 C;  1RF0 C;  4AYC A;  2YKO A;  1FZC A;  2A06 E;  3CXH D;  2K3R A;  1CI6 B;  3E1I A;  1LGH B;  2PGD A;  1LTG C;  2Q6Q A;  1OWA A;  1FJP A;  3CCQ P;  1S5L H;  1JM0 A;  2AEM A;  2FXP A;  2FFD B;  2KLU A;  1SVF A;  2BAS A;  5AVR B;  2FYU D;  2B89 A;  1T2K D;  1RE4 C;  1VQ8 P;  4H44 D;  2KZI A;  2G3A A;  3BAS A;  4WY4 B;  5TIS E;  3RL0 g;  4D6T E;  1IO4 A;  4DZO A;  3TYY A;  1MKM A;  2E42 A;  4YTP C;  5KAI H;  2CPS A;  3V2Q A;  1GU4 A;  3VP9 A;  1EQ7 A;  2KLV A;  3ZDM A;  1PP9 D;  3MUD C;  4N78 D;  3B5N B;  2CPB A;  4IL6 H;  1JO5 A;  4H13 C;  1GDT A;  1NTK J;  3AEB C;  3H1J E;  4NPE A;  3G3Z A;  3PH0 A;  4JBZ A;  3H1I G;  2C0X A;  1SQX G;  1L0N E;  1URQ C;  1NHL A;  2C0W A;  5APU A;  1BGY J;  3RL0 C;  4KJM A;  1KFN A;  1KQL A;  1ZME C;  1R5L A;  3BVH A;  3RK3 B;  3PTZ A;  1WT6 A;  1LTS C;  4ZKU A;  2Y0D A;  2YIU B;  3L74 J;  1YIT P;  2E76 D;  2D2C C;  1BE3 G;  4HKZ H;  3TGU D;  5AW0 B;  1SFC C;  3U1A A;  3H32 A;  4C7N A;  1ZOY C;  3H1H D;  3WUT A;  2YXR B;  1HVV A;  3H1K D;  2KSE A;  1EDK A;  1AJY A;  4GKG A;  2LXC B;  2IBZ E;  1SQV G;  3PJS K;  1LT9 C;  1L4A C;  1JCC A;  2FBW C;  2E5T A;  3CPW O;  4XA4 A;  1JTH A;  3GF7 A;  1G2C B;  1FDI A;  2YO2 A;  2E74 B;  1PGP A;  1L0L J;  2A06 G;  1LTJ B;  2QE7 H;  4ZNC A;  1IK9 A;  3CCR P;  1PPJ D;  2ZYD A;  1OIP A;  4XE5 B;  2J59 M;  2ZT9 C;  1LTI C;  2QG4 A;  2L91 A;  1S3J A;  1M57 D;  1NTM J;  2O1J A;  1CSB A;  2Q1K A;  1Q81 Q;  3RL0 D;  4RO0 A;  3BCC D;  2WT7 B;  3CCE P;  3CMA P;  3SSU A;  1ZRT E;  4JPZ B;  2XDJ A;  1BSN A;  2KP8 A;  4U7J A;  3QH9 A;  2IBZ I;  1VQ9 P;  3L36 A;  4D6T G;  3L73 E;  2D2C D;  2PAJ A;  2KNC B;  3PP5 A;  4PJ0 E;  4JYC A;  1VQO P;  2N1T C;  3CWB D;  3EFF K;  3VTP C;  1PFI A;  2QJY B;  5APY A;  3JCU E;  4UB8 H;  3V6I A;  1DX7 A;  1H0T A;  1EXI A;  3O8Z A;  1NVO A;  3MTU E;  3H1J G;  3AE7 C;  3S1K A;  2Z5I A;  1JY3 N;  5AVX B;  1L0N G;  2W6J H;  1RF1 C;  1U57 A;  1LP1 B;  1EDI A;  1OMI A;  1JY2 O;  2NPS D;  1WMK A;  3O6Q A;  2ZT9 D;  1VQN P;  3FWL A;  2OGU A;  1JCD A;  1XTG B;  3I56 P;  4WBA A;  1KYO H;  1A02 J;  4LC1 A;  3L37 A;  3A5T A;  3MUD A;  4U3F E;  4A7P A;  3G71 P;  3KQG A;  4JF7 A;  1QVG O;  3KYQ A;  4RES B;  1NTZ K;  4Y28 J;  1PZQ A;  1LTT C;  1NKN A;  2IX7 C;  2N1T D;  2YKP A;  1N86 A;  3TNU A;  1URQ A;  3GF3 A;  3A0H E;  3IN6 A;  1FZC C;  4IOI H;  5KLI C;  3EFG A;  1ZN5 A;  1NGM B;  3HD7 B;  1NYH A;  1OX3 A;  2Q3I A;  1KIL B;  2FYU J;  1GMJ A;  1LJ2 A;  4PD4 D;  1SS1 A;  1W2B O;  1NJI Q;  1RY3 A;  1SFC A;  1S9K D;  2N9Y B;  3GG2 A;  2OYO A;  2Y9Z A;  1SQX K;  1M1J B;  2Q3E A;  1SQQ K;  3OW2 O;  2POH A;  3SWY A;  2V4H A;  4KHX A;  1Q86 Q;  1S5L E;  5KLV D;  4IL6 X;  2K9J A;  3B4S A;  3RK3 E;  1JY2 N;  3V2P A;  1Z56 A;  1L4A A;  3Q5S A;  3L73 G;  2HOD B;  1PP9 J;  3FGA D;  3KPE A;  2K9Y A;  2B9B A;  4Y99 C;  2M5A B;  2BCC D;  3FXE A;  2M0B A;  2FYN B;  2QA4 P;  2H7H A;  2XZR A;  3RK2 C;  1GL2 D;  1HUC A;  3L75 D;  2ZVN B;  1J2J B;  1SQB K;  1YI2 P;  1J1D B;  1EDL A;  2P67 A;  4K35 A;  2V7Q J;  2IBZ D;  1FC2 C;  5B5E H;  1OW8 A;  1KC8 Q;  3GHG C;  2ZYG A;  3AE4 C;  4IL6 E;  5APV A;  1N8R Q;  2XKM A;  2IDB A;  1X0T A;  1EDJ A;  3M9B A;  3CLQ A;  4OH8 B;  3TGU J;  2J58 A;  5CBO A;  1NTZ E;  4ZMD A;  1PIX A;  3H1H J;  1KB9 H;  2B87 B;  4EYY Q;  4ZKP A;  2FXM A;  2HLO A;  3H1K J;  5AVY B;  3KXD A;  2ZXE B;  2N1T A;  3B8E B;  1NOH A;  5KKZ B;  5TJH A;  4R4M A;  3PHL A;  1ZXG A;  4U3F G;  1ZRT D;  4HH2 A;  2K88 A;  1Q2N A;  4AQR D;  4N6J A;  3L73 D;  3H6P A;  1SQP D;  1SQX E;  4WY4 C;  1SQQ E;  1IFM A;  1UII A;  1KN7 A;  3L72 E;  5C39 A;  3CX5 H;  3I55 P;  1UIX A;  1P84 D;  3OJA B;  1R8E A;  2B88 A;  3WU2 H;  1NTK K;  3BCC J;  4NPD A;  3B5N C;  3G6E P;  2R5D A;  3OAK A;  1NO4 A;  2O3J A;  1RE3 C;  1YQ4 C;  1SQB E;  4YXW H;  3CXH H;  2M3E A;  2WSE H;  2YMY A;  3CWB J;  4OGQ D;  1QL1 A;  5AVW B;  1PGQ A;  3N7N A;  3RK3 C;  1EZV E;  4PV1 D;  2I1K A;  3AEG C;  2YIU C;  2DW3 A;  2JDI H;  1K73 Q;  2A45 H;  5L8R J;  2YMK A;  1VQM P;  1JMB A;  3Q3D A;  3H1L J;  2QM7 A;  4I6M C;  1KQS O;  3PRJ A;  1IFI A;  4UB8 E;  4Z1M H;  2WPS A;  1ZW0 A;  1L0L K;  2QJP B;  1USD A;  3CCJ P;  1GD2 E;  1NTZ G;  3IF4 A;  1KMI Z;  3CC2 P;  3CCV P;  2E74 C;  3CC7 P;  4H0L C;  3L70 D;  2JWD A;  2W6A A;  1IK7 A;  1LTJ C;  1SLQ A;  1NTM K;  1KIL E;  2V7Q H;  3QWO C;  1Q90 D;  4EOT A;  3H25 A;  4H44 B;  5CHX A;  1NAY A;  1NTK E;  1LNQ A;  5KAF H;  1JOC A;  3HE5 A;  1KV4 A;  2QSI A;  1FJK A;  1FBM A;  1BCC D;  3GHG A;  3VN0 A;  1BGY E;  3L71 J;  1SQQ G;  2MJZ A;  4YPC A;  3L72 G;  1CW5 A;  3T97 A;  4GDO A;  2W6B A;  1M8O B;  1KFM A;  1PV3 A;  3L74 E;  5GTI H;  3ITK A;  1NU1 J;  1PGJ A;  2HPC B;  4TT3 H;  2QJY C;  5AW5 B;  3SWF A;  3V5B A;  5AW9 B;  5KLV J;  1CI6 A;  4I1L A;  2W8Z A;  3AE8 C;  4IFM A;  2FXO A;  1SQB G;  1N73 B;  5GTH H;  3U1C A;  2ITA A;  5B66 E;  4B86 A;  2OYI B;  2FKW B;  2BCC J;  2FFD A;  2JR8 A;  5CJ4 A;  1MUU A;  2E43 A;  4H0L D;  1M7L A;  1EZV G;  3L75 J;  2E76 B;  2RMZ A;  3VP8 A;  1JB0 J;  4WY4 A;  1L0L E;  2P1J A;  3RBZ A;  2ZVO B;  2KZJ A;  3H1L G;  4H13 D;  3WUU A;  3AE1 C;  3LW5 J;  5AVT B;  2GA1 A;  3UIA A;  1NTM E;  3B5N A;  2QEX P;  1H89 A;  1URQ D;  2WPV B;  3FWN A;  3H1I D;  1GK6 A;  2I1J A;  1SQX D;  3EQ2 A;  1RE3 A;  2I8D A;  5B5E E;  3FX0 A;  1AQT A;  3S9O A;  2Z4E A;  4WWI A;  2L5G B;  3AEE C;  1DD3 A;  1LTB C;  3M9Q A;  3P8C D;  3CCS P;  3VYI A;  1FDO A;  1SP4 A;  1SFC D;  1BE3 D;  1LTA C;  3CC4 P;  2WWW A;  1KIL C;  1FE6 A;  1KB9 E;  3RL0 B;  3D6Z A;  1IFP A;  2QJK B;  3HE4 A;  1DD4 A;  4GOE A;  1OW7 A;  1SQP J;  1NTK G;  2HR3 A;  1K9M Q;  1L4A D;  1SQV D;  1M1J C;  3CME P;  4IFD K;  1JNM A;  2D2C B;  4XFJ A;  5CMZ A;  1GW3 A;  1BGY G;  2R44 A;  1RHZ B;  1N7S C;  1PL5 A;  1ZR4 A;  2XNX A;  3CL3 D;  2A06 D;  2K1A A;  3L74 G;  2K9J B;  3MZW B;  5KJ7 C;  1PP9 G;  2O01 J;  1LT9 B;  1VF5 C;  3CX5 E;  1X22 A;  3R4Y A;  1LTJ A;  1J1D C;  1HGV A;  1KQG B;  3TDK A;  1HF9 A;  3WU2 E;  5K5G B;  2AEJ A;  3HUS C;  2YXQ B;  2J5U A;  1VQP P;  3VMZ A;  1A02 F;  3W67 A;  2FY8 A;  1YJN P;  2NPS B;  4M3L A;  2WT7 A;  4RKU J;  4PD4 H;  4QMA A;  4ASW A;  2ZT9 B;  3CXH E;  4D6T D;  2WSE J;  5CCH C;  3D6Y A;  1L0L G;  3AE3 C;  3K5B A;  3G9R A;  2KIK A;  2KNC A;  1FZA A;  2LR2 A;  2R5B A;  1DEE G;  5KKZ C;  5AW4 B;  1M90 Q;  2FYU E;  3CX5 I;  3C8V A;  5KTB A;  1NTM G;  3H1J D;  1LWU B;  1RH5 B;  1E79 H;  2N1T B;  1FZF A;  2OYH B;  1L0N D;  3HTK B;  1N7S D;  3L70 J;  2AXC A;  1XTC C;  1NKZ B;  2IFM A;  2OQQ A;  4EDF A;  2E5Y A;  2IPP A;  2H8P D;  5AW2 B;  4HYT B;  1PP9 E;  2YNY A;  1VF5 D;  1LP1 A;  3CXH I;  1Y47 A;  2P7J A;  2CK3 H;  1RF1 B;  3LW5 H;  4R4L A;  2E75 C;  5BU5 A;  1HTL C;  2WSC J;  4AUW A;  4JQ0 D;  5DJU B;  3NXS A;  1BCC J;  5KAI E;  4W7Y A;  3JC2 2;  2W27 A;  1GU5 A;  3P7K A;  4GOF A;  1H88 A;  3TK1 A;  2HG5 D;  2NZ2 A;  5KAF E;  1GL2 B;  4W7Z A;  1HGZ A;  1S72 P;  1JY3 P;  3TGU E;  3Q5P A;  3AE6 C;  4W80 A;  3H1H E;  3CCL P;  1MZ9 A;  3H1K E;  3KHU A;  3MGN A;  1NAF A;  1MFT A;  1S1C X;  5APX A;  1NTM D;  3M0D C;  3S4R A;  5GTI E;  3M0A A;  2JJL A;  1KIL A;  3GMA A;  2QVA A;  1FZC B;  3WUV A;  1P84 H;  3L4F A;  2FFD C;  5E79 H;  5AW6 B;  1FS0 E;  2JEE A;  1M1J A;  2IFN A;  5GTH E;  1OFC X;  2QJP C;  3R2P A;  1PPJ E;  2E75 D;  2O01 H;  3RK2 D;  2YO3 A;  2WQY C;  1N7S A;  2HOD A;  3MIW A;  2WIT A;  2WSF J;  1J1E B;  5CJ0 A;  3OA7 A;  5H2F H;  1YJW P;  2FYU G;  3H1I J;  5KJ7 A;  3BCC E;  1YHQ P;  2A45 G;  1N2D C;  1CZQ A;  5AVS B;  3B71 A;  4GOD A;  3TF5 A;  3C1L A;  4L73 A;  3PLN A;  4I7Z B;  4GT1 A;  2Z5H A;  1N7L A;  2SPZ A;  2M3B A;  3E7K A;  3HUS A;  3GLM A;  3NTN A;  2OTJ P;  1BE3 J;  3CWB E;  1GW4 A;  3NMD A;  3A7O A;  2LKM A;  1NU1 K; 
#chains in the Genus database with same CATH homology
 5AVX B;  3TSI A;  1RF1 C;  2R32 A;  5AW5 B;  3SWF A;  3V5B A;  5AW9 B;  1T3U A;  2A45 I;  5CCH A;  1DH3 A;  1CI6 A;  1FZB A;  1G1I A;  4I1L A;  5CCH D;  1ZLL A;  4IFM A;  1JY2 P;  3P8M C;  1N73 B;  1FU1 A;  5AVQ B;  3U1C A;  2OYI B;  4B86 A;  1SQV K;  2NPS A;  2FKW B;  1FDM A;  2FFD A;  1JY2 O;  2M8R A;  2NPS D;  5CJ4 A;  1MUU A;  3HUS B;  2E43 A;  1M7L A;  5CCG A;  1NH4 A;  2XU6 A;  1JCD A;  5CCG D;  3L35 A;  1XTG B;  4WBA A;  3U59 A;  1IFD A;  1A02 J;  4LC1 A;  3VP8 A;  2OYI C;  3M06 A;  3H32 B;  1T3J A;  4JYB A;  3L37 A;  4LGD E;  4WY4 A;  4C7N B;  3A5T A;  3MUD A;  1X9V A;  4WY4 D;  1T8Z A;  3HD7 A;  2P1J A;  3KQG A;  4DOJ A;  4JF7 A;  3WMM 0;  2VRS A;  3KYQ A;  4RES B;  1X79 B;  1HH0 A;  1NTZ K;  1IJD B;  2O1K A;  1JUN A;  5AVT B;  1LWU A;  2WSC H;  2WTY A;  1LTT C;  5BU8 B;  1NKN A;  2IX7 C;  1GTW A;  2N1T D;  2OYH A;  2YKP A;  1N86 A;  3A2A A;  3TNU A;  3UIA A;  1URQ A;  3B5N A;  3HTK A;  1H89 A;  1URQ D;  1JTH B;  3B5N D;  2C9L Y;  1GK6 A;  1FZC C;  2I1J A;  5AW1 B;  3VMY A;  2HFE D;  3EQ2 A;  1RE3 A;  2GUS A;  3EFG A;  1ZN5 A;  2P2U A;  3HD7 B;  4O9B A;  1KZU B;  2Z4E A;  1E5W A;  3P32 A;  1GK4 A;  2Q3I A;  1KIL B;  3A3Y B;  2L5G B;  2HYN A;  4WB4 A;  5AVV B;  1LTB C;  3M9Q A;  3P8C D;  2QM8 A;  1G1J A;  1RF1 A;  2OAR A;  3M9H A;  3VYI A;  1RY3 A;  3RK3 D;  1SP4 A;  3M91 A;  1SFC A;  1S9K D;  1SFC D;  3V4W A;  1SQX K;  1T2K C;  1M1J B;  1LTA C;  4EIJ A;  1SQQ K;  2WWW A;  2POH A;  4Y99 B;  3SWY A;  4KHX A;  1KIL C;  3RL0 B;  3MD0 A;  2KYV A;  5AW7 B;  1NWQ A;  1WRG A;  5BVZ A;  1MFZ A;  3P8C E;  2WPR A;  3CI9 A;  3RK2 B;  3HE4 A;  1JY2 N;  1S9K E;  3V2P A;  1Z56 A;  1L4A A;  1SQP K;  2HOD B;  1L4A D;  2XV5 A;  1YTZ T;  1M1J C;  2GUV A;  3KPE A;  4IFD K;  4Y99 C;  3V2N A;  1JNM A;  1AFO A;  1L0N K;  5CMZ A;  1GW3 A;  1GL2 A;  3HE5 B;  2H7H A;  2XZR A;  1IC2 A;  3N4X A;  1GL2 D;  3RK2 C;  1HUC A;  3VMX A;  3M0D A;  5KLV K;  1N7S C;  3GHG B;  1J2J B;  2PP6 A;  1SQB K;  3NFQ A;  1H8A A;  2Q5U A;  1J1D B;  1ZR4 A;  2XNX A;  3CL3 D;  2P67 A;  2FYZ A;  1MV8 A;  2KSJ A;  5KJ7 C;  3HE4 B;  2R3C A;  3LIE A;  1QL2 A;  2N9B A;  1LT9 B;  3BRV B;  2WPQ A;  2C9N Y;  3GHG C;  2WSF H;  1LTJ A;  5APW A;  3BAT A;  1N73 C;  1J1D C;  1HGV A;  1RF0 C;  1JMM A;  2YKO A;  5APV A;  4AYC A;  1FZC A;  4LLH A;  2XKM A;  1W2E A;  5APQ A;  3M9B A;  3CLQ A;  1CI6 B;  3E1I A;  4OH8 B;  3HUS C;  1LGH B;  1JY3 N;  2J58 A;  1LTG C;  1FAV A;  1OWA A;  1FJP A;  3VMZ A;  1A02 F;  1JY3 O;  4ZKP A;  2FXM A;  2HLO A;  2NPS B;  4M3L A;  2FFD B;  5AVY B;  2WT7 A;  1ZR2 A;  1SVF A;  2BAS A;  2ZXE B;  2N1T A;  3B8E B;  5AVR B;  1NOH A;  5CCH C;  3IR9 A;  1T2K D;  1RE4 C;  2WZ7 A;  3KDP B;  3BAS A;  5AW8 B;  2NPS C;  4HH2 A;  4WY4 B;  4AQR D;  1FZA A;  4N6J A;  2R5B A;  2KOG A;  5AW4 B;  1IO4 A;  4DZO A;  1HJB A;  3TYY A;  1FZE A;  2FYU K;  5KTB A;  2E42 A;  4C46 A;  2CPS A;  3H6P A;  3V2Q A;  1AQ5 A;  1GU4 A;  1LWU B;  3VP9 A;  1EQ7 A;  2KLV A;  2N1T B;  4WY4 C;  1FZF A;  2OYH B;  1IFM A;  3TNU B;  3HD7 C;  4N78 D;  3BRT B;  1URQ B;  2CPB A;  3B5N B;  3HTK B;  1VDF A;  5AVZ B;  3C9I A;  1N7S D;  1ZV8 A;  3OJA B;  1JO5 A;  1XTC C;  2GM4 A;  1NKZ B;  4IFF A;  2IFM A;  1GDT A;  2HPC A;  1LWU C;  1NTK K;  5APT A;  2IPP A;  2H8P D;  3G3Z A;  5AW2 B;  4HYT B;  2OYH C;  2C0X A;  2YNY A;  1URQ C;  1NHL A;  3B5N C;  2C0W A;  5APU A;  2P7J A;  2R5D A;  3OAK A;  3RL0 C;  1FOS E;  1N73 A;  1KFN A;  1KQL A;  1RF0 A;  1NO4 A;  1IFJ A;  3BVH A;  3RK3 B;  1RF1 B;  3LW5 H;  1HWT C;  2OYI A;  1RE3 C;  1SFC B;  5BU5 A;  1WT6 A;  1HTL C;  1FZG A;  2ZFC A;  4AUW A;  1LTS C;  1VPC A;  4ZKU A;  2WSE H;  2YMY A;  2Q9I A;  3NXS A;  1FOS F;  5AW3 B;  1QL1 A;  5AVW B;  4W7Y A;  3N7N A;  1G2C A;  3RK3 C;  3V2R A;  3LID A;  5AW0 B;  1SFC C;  3U1A A;  3H32 A;  2W27 A;  1L4A B;  1GU5 A;  4C7N A;  3P7K A;  2I1K A;  1H88 A;  2KB7 P;  3I5C A;  1RE4 A;  1HVV A;  3TK1 A;  2HG5 D;  3VOP A;  1GL2 B;  2A45 H;  1HGZ A;  4GKG A;  4W7Z A;  1JY3 P;  1LT9 C;  4W80 A;  2Q7C A;  1L4A C;  2QM7 A;  1JCC A;  4I6M C;  4XA4 A;  1JTH A;  1MZ9 A;  1IFI A;  3II6 A;  1G2C B;  1HBW A;  3MGN A;  3V4Q A;  2YO2 A;  1NAF A;  1GL2 C;  1YYC A;  5APX A;  3M0D C;  3HD7 D;  1DEB A;  2WPS A;  3M0A A;  1LTJ B;  2JJL A;  1L0L K;  1GD2 E;  1KIL A;  1GZL A;  1OXZ A;  1IK9 A;  1KIL D;  1FZC B;  1YTZ I;  3IFM A;  3L4F A;  1X8Y A;  2FFD C;  4XE5 B;  5AW6 B;  2J59 M;  5AVU B;  1LTI C;  2JEE A;  2O1J A;  5CCG C;  1M1J A;  2W6A A;  1LTJ C;  1SLQ A;  2IFN A;  1CSB A;  1NTM K;  3R2P A;  3RL0 D;  2WT7 B;  5APS A;  4GIF A;  2O01 H;  2XDJ A;  2KP8 A;  3RK2 D;  4EOT A;  2YO3 A;  1N7S A;  2YKQ A;  2HOD A;  3MIW A;  2WIT A;  1J1E B;  5CHX A;  5CJ0 A;  3L36 A;  3OA7 A;  1IFN A;  5KJ7 A;  1JOC A;  2PAJ A;  5KJ7 D;  3PP5 A;  4JYC A;  2N1T C;  3HE5 A;  1FJK A;  1FBM A;  2A45 G;  1N2D C;  1CZQ A;  4N78 E;  3VTP C;  5AVS B;  3GHG A;  3VN0 A;  2MJZ A;  1PFI A;  1J1E C;  4C7R A;  4N3Y B;  5APY A;  4GT1 A;  1CW5 A;  1DX7 A;  2Z5H A;  3T97 A;  1N7L A;  2M3B A;  2W6B A;  3HUS A;  1LT9 A;  3HRN A;  1N7S B;  3O8Z A;  2H43 A;  3NTN A;  1KFM A;  4I2L C;  3MTU E;  1GW4 A;  3NMD A;  3A7O A;  2LKM A;  2HPC B;  2Z5I A;  1NU1 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...