3TNUB

Heterocomplex of coil 2b domains of human intermediate filament proteins, keratin 5 (krt5) and keratin 14 (krt14)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
95
structure length
95
Chain Sequence
TKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cytosolic protein
molecule keywords Keratin, type I cytoskeletal 14
publication title Structural basis for heteromeric assembly and perinuclear organization of keratin filaments.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3tnuB00
3SWFA 1KQLA 5APTA 1SLQA 1MV8A 4AQRD 3P7KA 1GTWA 1SP4A 3VMYA 1GK6A 1T2KC 2WT7A 3VYIA 3A7OA 3M06A 4B86A 1JNMA 3P8MC 4M3LA 5AVTB 1A02F 5AW2B 1H8AA 5AW3B 1S9KD 4GT1A 4KHXA 3KDPB 3V4QA 2XV5A 3V4WA 1GU4A 3HE4A 3NTNA 5AVWB 3IR9A 3L36A 1GU5A 4LC1A 2H7HA 2Q3IA 5APWA 1NWQA 3VMXA 2WPSA 2IPPA 2Z5HA 4I2LC 3A5TA 1H88A 2Q7CA 2ZFCA 2WT7B 1J2JB 5AW8B 1FOSF 1OWAA 5AW6B 3M0DA 2R5BA 5AVSB 1HBWA 2QM7A 5AVQB 5APVA 5AVUB 2C9LY 2XU6A 1HJBA 2W27A 3TNUB 2P7JA 2N9BA 3L35A 3M9BA 5APYA 2JJLA 2E43A 1X8YA 1MFZA 3HE4B 1FOSE 3UIAA 3MGNA 3M0AA 1GD2E 1JUNA 3I5CA 2W6AA 2P67A 5APSA 3TNUA 3L37A 5CMZA 5AW7B 2VRSA 2C9NY 3HE5B 4GKGA 4JYCA 1IO4A 1G2CB 4XE5B 2R3CA 3TK1A 2WTYA 3KQGA 2WPQA 5AW1B 3VMZA 4C46A 2QM8A 2WWWA 2P2UA 1H89A 3P32A 3HE5A 1GK4A 2Z5IA 5APXA 2E42A 2XZRA 5AVXB 5AW9B 1A02J 3NFQA 3V5BA 1NAFA 3A3YB 4C7NA 3A2AA 5AVRB 2YO2A 3O8ZA 5AVVB 5APUA 4RESB 3LIEA 4JYBA 3B8EB 5AW0B 1T2KD 2KP8A 3M91A 3NXSA 4AUWA 1YYCA 1DH3A 3MD0A 2Q5UA 3VTPC 1MUUA 5APQA 4C7NB 3OAKA 3T97A 1CI6A 3LIDA 5AW4B 4I6MC 4EOTA 1OXZA 4AYCA 1FAVA 1HUCA 2WPRA 3HTKA 2BASA 3TYYA 5AW5B 2R5DA 1CSBA 3M9HA 4DZOA 1HWTC 3NMDA 2YNYA 3VN0A 1GZLA 5AVYB 2ZXEB 1CZQA 4HYTB 2R32A 1CI6B 5AVZB 1S9KE 2YO3A
chains in the Genus database with same CATH superfamily
4GDOA 1E79H 1M56D 1IFJA 3PLNA 4B86A 1AJYA 1T8ZA 5CJ4A 4LLHA 2B87B 4LC1A 1AVOA 3GHGC 1SVFA 1G1JA 2WT7B 1J2JB 2FFDA 4H13C 1G2CA 1YIJP 5GTHE 2NPSB 5KLVE 1YJWP 3G3ZA 3TNUB 2K3RA 2K9YA 1KFNA 3BCCE 1SQXJ 1U57A 2R3CA 3H1KE 4Y99B 3CWBD 5EFWB 4DT0A 1GK4A 2QRXA 3Q5RA 3H1HJ 1R5LA 2M8RA 2PP6A 4L75A 1FDOA 1NKNA 4WY4A 1E5WA 4JQ0D 2I1KA 2YO2A 4D6TD 1NHLA 1N7LA 2B9BA 3TGUG 3L4FA 4EDFA 2OQQA 1FBMA 4WY4D 1SQXE 3L73G 1R5SA 1HUCA 3H6PA 1HH0A 2IYOA 1GZLA 1K05A 3BASA 2M5AB 1VL2A 2BCCD 2I8DA 5KLIC 2HPCA 2KNCA 2KZJA 2YKPA 2FXMA 3IN6A 4U3FJ 1FS0E 1EDIA 1FU1A 1NO4A 1KILB 2Q3IA 3CI9A 2IPPA 3EWKA 2E5TA 1RE4A 3JCUH 2FXOA 3CLQA 4EYYQ 1OIPA 2D2CD 2P7JA 4PD4E 5KAIH 3MGNA 1FZFA 2OTJP 1EDKA 4L76A 2W6JH 3CCVP 3V2PA 1LNQA 4GODA 2QJKB 4W80A 3K5BA 3HUSA 1PP9J 4U3FE 2Z5IA 2O3JA 2R3SA 4LGDE 2KS1A 1G1IA 2LR2A 1S5LE 3GHGA 2Q9IA 1BDDA 4JBZA 2IZ1A 2NPSC 2A45G 1SQQG 1EQ7A 3G6EP 1GDTA 4L74A 3BATA 3L72G 1NTZG 1HWTC 4DZOA 1D7MA 3NMDA 4H13D 3CCSP 3II6A 4Y99C 1J1DB 3VP8A 2Q6QA 1LT9A 1QL1A 3T97B 1IFPA 2QE7H 3FWNA 5APTA 2IBZE 3A0HE 1OVRA 1KILE 5GTHH 3CC2P 2O01J 4EIJA 3M06A 1KYOE 3L71E 1KZUB 1NTMG 1LP1B 5AW2B 1NTKG 2XV5A 3RGUA 1LTSC 4I2LC 4IFDK 3L74G 3LW5J 1QEXA 2C0XA 4ZKPA 1QVGO 3UIAA 2LXBA 3I5CA 1DX7A 2P67A 3RK2B 3R2PA 3L70J 3D71A 1R8EA 4JYCA 5KLVD 1PGPA 2Z4EA 4HH2A 1YJ9P 2HLOA 2FKWB 3PJSK 2HODA 1BE3D 3B5NA 2Y0CA 2A45I 2I1JA 4WVZA 3BCCD 3MZWB 2A06G 1KILC 2H88C 1RH5B 3H1KD 1S3JA 1X22A 1NU1D 3AE4C 5GTIE 3CCMP 1K04A 2L91A 1KB9I 3AEEC 1SQPE 2WVRA 4OGQB 4C7NB 1BGYJ 3OAKA 4W7ZA 3LIDA 1OXZA 3PTZA 4O9BA 3IFMA 3CMAP 2M0BA 3M9HA 1PPJD 2QJKC 2ZXEB 3H1IJ 2YIUB 4DCKA 4UB6E 3VMYA 4WB4A 2WT7A 1FDIA 2NPSA 4PJ0E 3L70G 1RQUA 4PD4H 2YMKA 3NTNA 1QLED 5APWA 1MFTA 1H88A 3BVHA 1ZXGA 1NKZB 2NPSD 2C9LY 1TU3F 1J1DC 3IAOA 1URQA 1L0LG 3R4YA 1GL2B 3H1IE 1YQ3C 3L37A 1S5LH 5KAFH 4IL6X 1SQQK 1KB9D 4ASVA 3S4RA 1XTGB 2Q3EA 2PRRA 3AE2C 2W90A 3JSVC 4H0LB 1N73B 1WT6A 2FBWC 2Y9YA 2MKVA 1RF1B 5K5GB 3SFEC 4BRYB 1DH3A 3D6YA 2FYUJ 2K88A 3ITKA 3RK2C 3CPWO 3A0HH 3Q3DA 1UIXA 1PFIA 1XTCC 1L0NE 3O6QA 1QX8A 2YNYA 1KYOH 1NTKK 1FE6A 2G3AA 2O1KA 4XA4A 3RBXA 1BSHA 1T3UA 1JTHB 4ZKUA 1ZW0A 2P1JA 1AA0A 2KK7A 1SP4A 3CCEP 3VYIA 3P8MC 3GG2A 1A02F 5L8RJ 1OVUA 3CWBG 3VOPA 4OGQC 1NH4A 2IBZD 1NOHA 1VQLP 1KILD 4NPDA 3W67A 1Q82Q 2O01H 3L71D 1PV3A 4D6TG 1LTBC 2W27A 2W8ZA 2E75B 1KN7A 1KMIZ 5APYA 2JJLA 1P84I 4N78D 1Y8AA 1L4AA 2YIUC 1OW8A 2IFNA 1LTAC 5BVZA 3N7NA 2FY8A 1X79B 3KQGA 5AVXB 2WITA 1A02J 3L75D 2IZ0A 1FJKA 4RESB 1YTZI 1OW7A 2HYNA 1BCCE 2B89A 3AE6C 3MD0A 1GL2C 2WSCJ 1VQ6P 4UB6H 3T97A 3AEAC 3C1LA 1EDLA 2DW3A 3AE7C 2AEMA 1SQPD 3VN0A 5KLIB 4PJ0H 1N7SC 4H0LC 1N73C 4JF7A 3VMAA 1LP1A 1RQVA 3V2QA 2JO1A 1VDFA 2AXTE 3WUUA 1M7LA 2KSEA 1LT1A 1JY2N 3H1LE 1RF1C 3KZIE 1USDA 1L0LK 4M3LA 4GT1A 3AEDC 1J1EB 2JP3A 2Z5HA 5DJTB 3TGUJ 1FOSF 5CCHC 2IYPA 3CMEP 2AEJA 2V4HA 3M9BA 3JC22 1YTZT 3L73J 3ZDMA 4HKZH 3H1JD 3RK2D 1Q7YQ 1KC8Q 1HVVA 2WSFH 2K37A 3AE1C 1JM0A 2WWWA 4JPZB 1FDMA 3RBZA 3CXHE 1EZVE 2J5UA 4DOJA 1VQ9P 1SQVD 1LTIC 1OFCX 3A3YB 3HD7B 4C7NA 1NJIQ 1YI2P 5APUA 3TGUE 2JWDA 4JYBA 4GIFA 1QVFO 2E75C 1JY3N 4OGQD 1PGQA 4KJMA 1ZN5A 2XNDH 2WPVB 3V2NA 4YXDC 3Q5SA 2GM4A 2KOGA 1IK9A 2BEQD 2SPZA 1L0ND 3P7KA 1ZRTE 2C0WA 2QVAA 1GK6A 2UWJE 3EFFK 5KLVG 2AXCA 1BE3G 3KDPB 1LWUB 1GL2A 3H1HE 4A7PA 1QL2A 2FYUK 5CBOA 1S72P 1LGHB 3OA7A 1SQQJ 1OWAA 1NU1G 2R5BA 3E1RA 3RL0C 2E43A 2XDJA 1GL2D 2GUVA 1KQFB 4IFMA 5CMZA 5KJ7C 3L72J 2H8PD 2VRSA 1NTZJ 3HE5B 1JB0J 2KSJA 3AE5C 1IFDA 3CX5E 4C46A 1JY2P 1RF1A 2ITAA 4YXWH 5E79E 1N7SD 1PPJG 4H0LD 2XZRA 1J1EC 1OZHA 1NAFA 2WQYC 1SS1A 3HRNA 1YHQP 1SQQE 1M90Q 2CPSA 1KQGB 1NTMJ 2OYOA 1NTKJ 1RE3C 5CCHA 3CCUP 3S1KA 3FWLA 1JTHA 2AXTH 3L74J 1FZGA 2WPRA 1BCCD 3KZIH 5CCHD 5KAFE 3CC4P 1PGJA 2WSCH 1IFNA 3GMAA 3HD7C 1ZOYC 3SWFA 5H2FE 2XNXA 3MIWA 2PFXA 1T2KC 3E1IA 4TLFA 1SQBD 1NTKE 3A7OA 1GU4A 3IR9A 1PP9E 3L74E 1NWQA 4YPCA 2WPSA 3H1LD 4KT0J 2OYIB 2E74C 3L35A 2GUSA 2E75D 3CXHH 2POHA 3PH0A 2RN0A 2KZIA 2C9NY 1WMKA 1USEA 1GW3A 1CW5A 2QM8A 1RF0C 3OJAB 5APXA 3AEGC 1LWUC 1H0TB 1BDCA 2JKVA 1QGKB 3NXSA 1EZVD 4N6JA 3G71P 3H32B 3RL0g 2N9YB 2Q1KA 2IBZG 1NAYA 3CCRP 3M0DC 5KJ7A 1FAVA 4AYCA 2E5YA 1VQPP 2ZVOB 4IOIH 1FZCB 1CSBA 1L0LJ 3GF7A 5M1BA 1JMBA 3RL0D 1CZQA 1M1JB 2V7QJ 2R32A 1S9KE 4PD4I 4C7RA 5KJ7D 1NU1K 1PZQA 3L70E 3MP7B 5DJUB 3RK3E 3EQ2A 1RE3A 1Z56A 5AW3B 3F5HA 1FZEA 4BWNA 2OTLP 2H7HA 3L75G 1SQXD 1DIPA 2B87A 3CX5H 4ZMDA 1L0LE 2ZT9B 5AVSB 4IFFA 5AVUB 5E79H 2XU6A 1HJBA 2LXCB 3CCQP 2JWAA 3H1HD 5B66H 3TNUA 2JDIH 1BGYE 2Y9ZA 2QSIA 5AW1B 3VMZA 1SQPG 5AW9B 3HD7D 3CX5D 3CD6P 1GW4A 2IBZI 2OYIC 1T2KD 3FXDA 3CWBJ 3Q2YA 2KXPB 1KYOI 2Q5UA 4PD4D 1N7SB 3D70A 1M57D 5H2FH 1VQ7P 4D6TJ 4UB8H 4I6MC 4EOTA 1ZV8A 1YITP 2YKQA 1NTZK 2QA4P 1RF0A 2E74D 1MZ9A 4U3FD 2FYNB 1KFMA 1JY2O 5CCGC 3U59A 3S9OA 3H1JG 2ZYGA 1Q81Q 2M5AA 3C8VA 1JNMA 1H8AA 1NTMK 4I1LA 4KHXA 2BCCJ 5AVWB 1SQVG 4D6TE 2M3BA 4BXLA 2ZYAA 5AW8B 2RH0A 1FZCC 3M0DA 1KILA 4ASWA 2QM7A 1W5CE 1M1JC 1PP9D 2GA1A 1LTTC 2FYUE 1ZLLA 2AEFA 1IO4A 3HUSB 2KS1B 2KB7P 3P32A 1KYOD 4HB1A 4PV1B 3A2AA 2L5GB 3KHUA 3PP5A 1L0NG 2ZT9C 3M91A 2CK3H 4K35A 3LW5H 3SSUA 2P58A 1RY3A 4HJGH 2IX7C 1IFMA 1LT9B 5AW5B 2BCCG 2QJPB 3U1CA 4HYTB 1S5LX 2O1JA 1VQKP 1VQ5P 2LKMA 3CCJP 3KXDA 1AV1A 2V7QH 1S9KD 1VQNP 3RL0B 3L36A 3L70D 1P84H 3FX0A 2WZ7A 1YQ4C 4H44B 4Y28J 1MFZA 3HE4B 1SFCB 2FYNC 1JMMA 5TISH 3M0AA 5CBNA 1JUNA 2W6AA 3CCLP 1AQTA 1PGOA 1H0TA 2HODB 3TDKA 3AEFC 1VQOP 1VQ8P 1RE4C 2ZVNB 3H32A 1BGYD 3V5BA 2K9JB 2MJZA 5CCGD 5KLVJ 2XKMA 1JO5A 2K1AA 3D6ZA 2KP8A 2E76B 1FZCA 4OH8B 1BE3J 1SQBG 1U7JA 1AFOA 3BCCJ 3VTPC 1M1JA 1MUUA 1FZBA 1IZNB 3H1ID 3H1KJ 3GF3A 4NPFX 1NU1J 3HUSC 2WMMA 3H1LG 2NZ2A 1N2DC 4DJGA 1FJPA 2HFED 1UIIA 3QH9A 4PV1C 1SQVK 1YBKA 1OVVA 3L73E 4AQRD 4IL6E 5KKZB 2PAJA 3F89A 1DD3A 1BE3E 2KIKA 3M9QA 2E74B 1IJDB 4RKUJ 1NU1E 4GOEA 1URQB 2N1TB 1LT9C 3FGAD 3MUDC 5APVA 2HR3A 2ZT9D 4Z1MH 5BU5A 2QJPC 2OYHB 1EZVG 4L73A 1FOSE 3TSIA 4CPGA 1GD2E 2YKOA 5APSA 4R4MA 1K8AQ 1L0NK 5CJ0A 2ZYDA 3BCCG 1JCDA 1IFIA 2WTYA 1PPJE 1RHZB 3C9IA 3H1KG 3B71A 2FYUD 5B5EE 1ZR4A 5KTBA 1N7SA 1ZR2A 1N73A 1Q90D 1L2PA 1Q2NA 1GMJA 4H44C 1KD1Q 1SFCC 3PHLA 1HTLC 3O6QB 1EDJA 4BRYA 3G4SP 3B5NC 5B66E 1T3JA 2WSSH 1SQXG 1JEKA 2R5DA 2YMYA 3KPEA 2NRGA 3AE3C 3H1HG 1CI6B 5AVZB 3FXEA 1SLQA 3ABVC 1KB9E 1FZAA 3L72E 1NTZE 3Q1MA 2E76C 5AVTB 3G9RA 2M3EA 3V4QA 3SFDC 4K3AA 3V4WA 1KORA 3CXHI 3VMXA 1EZVI 2IDBA 3B4SA 5AW6B 2KI7B 1L4AB 4UB8E 2H43A 2N9BA 1LTJB 1NTME 1MKMA 2Y0EA 5AW7B 3WUTA 4GKGA 1HJ0A 1ZP0C 4XE5B 3L71J 1JY3P 1M1KQ 5KKZC 1SQBK 2OGUA 3RK3B 1X0TA 2PGDA 3AECC 3U1AA 2E42A 4PV1D 3NFQA 4U3FG 2W83C 3H25A 2OARA 3EFGA 1URQC 1VF5B 2N1TC 3BRVB 1OX3A 2KYVA 3MUDA 2OYHC 1N8RQ 2QJYB 3L75J 1K9MQ 2A06E 2RMZA 2Y0DA 4IL6H 1HF9A 3W68A 2BASA 4OWFA 2QG4A 2HG5D 5AVYB 4MN4C 2W6BA 2CPBA 4N78E 3P8CE 3TF5A 2OTKE 3CXHD 3WUVA 1PP9G 4EI2A 4NPEA 1GTWA 3HTKB 3Q5PA 3TGUD 1SQPJ 2KUBA 5KLVK 1EXIA 2O01N 4OVNF 3CX5I 3L75E 3L71G 3L73D 3HE4A 3SWYA 1SFCA 2Q7CA 1T6AA 1HBWA 5AVQB 1M8OB 4RO0A 2YXQB 5B5EH 1X8YA 4H44D 1NGMB 1SFCD 1JCCA 1PL5A 2FFDB 2K9JA 1G2CB 2WSEJ 3B5ND 1ZRTD 4I7ZB 4ZNCA 5BU8B 3H1JJ 2RKLA 1SQXK 3N4XA 5AVVB 3LIEA 2A45H 1VPCA 3B8EB 3HD7A 1L4AC 4RJTA 1P84E 2E76D 1YYCA 3QWOC 1LTJC 1PIXA 3PRJA 2ZAEB 1SQVJ 4WY4B 4U7JA 1VQMP 2QEXP 1N86A 1KB9H 2FXPA 3AEBC 2IFMA 2QIWA 5TISE 1X9VA 3TYYA 2B88A 4WWIA 3RK3C 1EC5A 1DEBA 1AVYA 3H1JE 3A0BE 3WU2E 2WSFJ 1VF5C 1SQQD 1KQSO 1W2EA 2N1TA 3MTUE 1YJNP 2KLVA 1SQVE 2QJYC 1DD4A 2OYHA 3V6IA 1L0NJ 2HPCB 2KNCB 2G8YA 1BGYG 1S2EA 3L72D 1NTZD 1URQD 1LWUA 2N1TD 2D2CB 3GLMA 5TJHA 3CWBE 3GW6A 1KV4A 3H1IG 1HGZA 3TK1A 1OW6A 1VQ4P 1NTMD 2WPQA 3AE8C 1NTKD 2P2UA 1H89A 3HE5A 2H89C 4QMAA 2P10A 5AVRB 3L74D 4XFJA 3O8ZA 1KTMA 2YXRB 3V2RA 4W7YA 3CC7P 1LTGC 1S1CX 3KYQA 1CI6A 3GHGB 2JR8A 5AW4B 2FFDC 2BCCE 3I55P 4H13B 1Y9BA 3WMM0 4I7ZC 2A06D 1JY3O 2J59M 2YO3A 1KQLA 1MV8A 3BRTB 1U7MA 1BCCJ 1WRGA 3E7KA 1NYHA 1ZMEC 2FYZA 3P8CD 5C39A 2JEEA 1LTJA 1OMIA 4WY4C 1GU5A 2FYUG 5GTIH 3IF4A 3A5TA 1AQ5A 2ZFCA 2KLUA 1SQBJ 4TT3H 3SWKA 2ZXXA 1K73Q 1JOCA 1L4AD 2ZJSE 1W2BO 2OYIA 3OW2O 3CL3D 3H1LJ 4R4LA 4N3YB 1Y47A 1IC2A 1S4XA 1IK7A 3JCUE 3USSA 1LJ2A 1FC2C 3RK3D 3I56P 1Q86Q 1DEEG 3VP9A 1SQPK 1EXJA 1HGVA 5KAIE 5CHXA 1NVOA 2R44A 2BEZF 1BSNA 2WSEH 1VF5D 1SQBE 5AW0B 2D2CC 5CCGA 1L0LD 3B5NB 4AUWA 3MHVA 1BCCG 5APQA 3A0BH 3WU2H 4YTPC 3HTKA 4WBAA 1P84D 4GOFA 3AE9C 2J58A
chains in the Genus database with same CATH topology
1SLQA 4C7RA 5KJ7D 1IFJA 1NU1K 1SP4A 1FZAA 3VYIA 4B86A 3EQ2A 3P8MC 1RE3A 5AVTB 1Z56A 1A02F 1T8ZA 5AW3B 3VOPA 5CJ4A 3V4QA 1FZEA 1NH4A 4LLHA 3V4WA 1NOHA 4LC1A 3GHGC 2H7HA 1SVFA 1KILD 1G1JA 3VMXA 2WT7B 2O01H 1J2JB 2FFDA 5AW6B 1G2CA 2NPSB 5AVSB 4IFFA 5AVUB 1L4AB 1LTBC 2XU6A 3G3ZA 1HJBA 2W27A 3TNUB 2H43A 2N9BA 1LTJB 5APYA 2JJLA 4N78D 1L4AA 1KFNA 2IFNA 3TNUA 5AW7B 1LTAC 4GKGA 5BVZA 4XE5B 1JY3P 2R3CA 3N7NA 1SQBK 1X79B 3KQGA 5AW1B 3RK3B 3VMZA 4Y99B 3U1AA 1GK4A 2M8RA 2PP6A 2E42A 5AVXB 2WITA 5AW9B 1A02J 3NFQA 1NKNA 4WY4A 1E5WA 3HD7D 2I1KA 2OARA 2YO2A 1FJKA 1URQC 3EFGA 1NHLA 2N1TC 4RESB 1N7LA 3BRVB 1GW4A 2OYIC 1YTZI 2HYNA 1T2KD 2KYVA 3MUDA 3L4FA 2OYHC 3MD0A 1GL2C 2Q5UA 1N7SB 1FBMA 4WY4D 3T97A 4I6MC 4EOTA 1ZV8A 1HUCA 3H6PA 1HH0A 2BASA 3VN0A 1GZLA 2HG5D 1NTZK 2YKQA 5AVYB 1N7SC 1N73C 1RF0A 4JF7A 2W6BA 3BASA 2CPBA 4N78E 3P8CE 1MZ9A 1KFMA 1JY2O 3V2QA 1VDFA 5CCGC 3U59A 1GTWA 2HPCA 1M7LA 3HTKB 1JY2N 1RF1C 1JNMA 1L0LK 5KLVK 4M3LA 2YKPA 2FXMA 1H8AA 1NTMK 4GT1A 4I1LA 4KHXA 1J1EB 1FU1A 3HE4A 5AVWB 3SWYA 1SFCA 1NO4A 1KILB 2Q3IA 3CI9A 2IPPA 2Z5HA 2M3BA 2Q7CA 1RE4A 5AW8B 1FOSF 1FZCC 5CCHC 3CLQA 3M0DA 1KILA 1HBWA 2QM7A 5AVQB 2P7JA 3M9BA 1M1JC 1X8YA 1YTZT 3MGNA 1SFCD 1JCCA 1LTTC 1FZFA 3RK2D 1ZLLA 2FFDB 1IO4A 3HUSB 1G2CB 1HVVA 3B5ND 2WSFH 3V2PA 2WWWA 2KB7P 3P32A 4W80A 1FDMA 3HUSA 2Z5IA 4DOJA 4LGDE 1LTIC 5BU8B 3A3YB 3HD7B 1G1IA 4C7NA 3A2AA 2L5GB 1SQXK 3PP5A 3N4XA 3GHGA 2Q9IA 5AVVB 5APUA 3LIEA 2NPSC 4JYBA 3B8EB 1VPCA 2A45H 2A45G 4GIFA 3HD7A 1L4AC 1EQ7A 3M91A 1GDTA 1YYCA 1LTJC 3LW5H 1JY3N 4WY4B 1RY3A 1N86A 2IX7C 2IFMA 3BATA 1IFMA 1LT9B 1X9VA 3TYYA 5AW5B 1HWTC 1ZN5A 3RK3C 3NMDA 4DZOA 3II6A 4Y99C 3V2NA 1DEBA 1J1DB 3VP8A 1LT9A 3U1CA 4HYTB 1QL1A 2GM4A 2KOGA 1IK9A 5APTA 2O1JA 3P7KA 2C0WA 1GK6A 2LKMA 1W2EA 2N1TA 3MTUE 4EIJA 3M06A 1KZUB 2KLVA 5AW2B 1S9KD 3KDPB 2XV5A 2OYHA 1LWUB 3RL0B 1GL2A 3L36A 2HPCB 1LTSC 1QL2A 2FYUK 4I2LC 1LGHB 3OA7A 4IFDK 1URQD 1LWUA 1OWAA 2N1TD 2R5BA 2WZ7A 3RL0C 2C0XA 2E43A 4ZKPA 1MFZA 3HE4B 1SFCB 2XDJA 3UIAA 3M0AA 1JMMA 1GL2D 2GUVA 1JUNA 3I5CA 1DX7A 2W6AA 2P67A 3RK2B 3R2PA 4IFMA 5CMZA 5KJ7C 2H8PD 2VRSA 2HODB 3HE5B 2KSJA 4JYCA 2Z4EA 1HGZA 4HH2A 3TK1A 2HLOA 2FKWB 1IFDA 2WPQA 4C46A 1JY2P 1RF1A 2P2UA 1H89A 2HODA 3HE5A 1N7SD 3B5NA 2A45I 2I1JA 1RE4C 2XZRA 3H32A 1J1EC 1KILC 3V5BA 1NAFA 3HRNA 2MJZA 5AVRB 5CCGD 2XKMA 3O8ZA 1JO5A 2CPSA 1RE3C 2KP8A 5CCHA 4OH8B 1FZCA 3V2RA 4W7YA 1AFOA 3VTPC 1LTGC 1M1JA 1JTHA 1MUUA 4C7NB 1FZBA 3KYQA 3OAKA 4W7ZA 1CI6A 3GHGB 3LIDA 5AW4B 1FZGA 2FFDC 3HUSC 1OXZA 4O9BA 2WPRA 3IFMA 1N2DC 3M9HA 5CCHD 3WMM0 1FJPA 2ZXEB 2HFED 1JY3O 2WSCH 1SQVK 1IFNA 2J59M 2YO3A 3HD7C 3SWFA 1KQLA 1MV8A 3BRTB 4AQRD 2XNXA 3MIWA 3VMYA 4WB4A 1T2KC 3E1IA 2WT7A 2PAJA 1WRGA 3A7OA 2NPSA 2FYZA 3P8CD 2JEEA 1LTJA 3M9QA 4WY4C 1GU4A 3NTNA 1GU5A 1IJDB 3IR9A 5APWA 1NWQA 1H88A 2WPSA 3A5TA 3BVHA 1URQB 1AQ5A 2ZFCA 2N1TB 1LT9C 1NKZB 2OYIB 2NPSD 1JOCA 5APVA 2C9LY 1L4AD 3L35A 5BU5A 1J1DC 1URQA 2GUSA 2OYHB 2POHA 1GL2B 1FOSE 2OYIA 3TSIA 1GD2E 3CL3D 2YKOA 5APSA 3L37A 1L0NK 5CJ0A 4N3YB 2C9NY 1IC2A 1SQQK 1JCDA 1IFIA 1GW3A 1XTGB 2WTYA 1CW5A 2QM8A 1RF0C 3RK3D 3C9IA 1N73B 3OJAB 5APXA 3VP9A 1SQPK 1HGVA 1LWUC 1ZR4A 1WT6A 5KTBA 5CHXA 1N7SA 1ZR2A 2WSEH 1N73A 1RF1B 5AW0B 5CCGA 3NXSA 3B5NB 4AUWA 4N6JA 1DH3A 3H32B 1SFCC 1HTLC 5APQA 3RK2C 1PFIA 1XTCC 3B5NC 3M0DC 1FAVA 1T3JA 4AYCA 5KJ7A 3HTKA 4WBAA 1FZCB 2R5DA 1CSBA 2YNYA 1NTKK 2YMYA 2O1KA 4XA4A 3RL0D 3KPEA 1CZQA 1M1JB 1T3UA 1JTHB 4ZKUA 2R32A 1CI6B 5AVZB 2P1JA 2J58A 1S9KE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SWF A;  1KQL A;  5APT A;  1SLQ A;  1MV8 A;  4AQR D;  3P7K A;  1GTW A;  1SP4 A;  3VMY A;  1GK6 A;  1T2K C;  2WT7 A;  3VYI A;  3A7O A;  3M06 A;  4B86 A;  1JNM A;  3P8M C;  4M3L A;  5AVT B;  1A02 F;  5AW2 B;  1H8A A;  5AW3 B;  1S9K D;  4GT1 A;  4KHX A;  3KDP B;  3V4Q A;  2XV5 A;  3V4W A;  1GU4 A;  3HE4 A;  3NTN A;  5AVW B;  3IR9 A;  3L36 A;  1GU5 A;  4LC1 A;  2H7H A;  2Q3I A;  5APW A;  1NWQ A;  3VMX A;  2WPS A;  2IPP A;  2Z5H A;  4I2L C;  3A5T A;  1H88 A;  2Q7C A;  2ZFC A;  2WT7 B;  1J2J B;  5AW8 B;  1FOS F;  1OWA A;  5AW6 B;  3M0D A;  2R5B A;  5AVS B;  1HBW A;  2QM7 A;  5AVQ B;  5APV A;  5AVU B;  2C9L Y;  2XU6 A;  1HJB A;  2W27 A;  3TNU B;  2P7J A;  2N9B A;  3L35 A;  3M9B A;  5APY A;  2JJL A;  2E43 A;  1X8Y A;  1MFZ A;  3HE4 B;  1FOS E;  3UIA A;  3MGN A;  3M0A A;  1GD2 E;  1JUN A;  3I5C A;  2W6A A;  2P67 A;  5APS A;  3TNU A;  3L37 A;  5CMZ A;  5AW7 B;  2VRS A;  2C9N Y;  3HE5 B;  4GKG A;  4JYC A;  1IO4 A;  1G2C B;  4XE5 B;  2R3C A;  3TK1 A;  2WTY A;  3KQG A;  2WPQ A;  5AW1 B;  3VMZ A;  4C46 A;  2QM8 A;  2WWW A;  2P2U A;  1H89 A;  3P32 A;  3HE5 A;  1GK4 A;  2Z5I A;  5APX A;  2E42 A;  2XZR A;  5AVX B;  5AW9 B;  1A02 J;  3NFQ A;  3V5B A;  1NAF A;  3A3Y B;  4C7N A;  3A2A A;  5AVR B;  2YO2 A;  3O8Z A;  5AVV B;  5APU A;  4RES B;  3LIE A;  4JYB A;  3B8E B;  5AW0 B;  1T2K D;  2KP8 A;  3M91 A;  3NXS A;  4AUW A;  1YYC A;  1DH3 A;  3MD0 A;  2Q5U A;  3VTP C;  1MUU A;  5APQ A;  4C7N B;  3OAK A;  3T97 A;  1CI6 A;  3LID A;  5AW4 B;  4I6M C;  4EOT A;  1OXZ A;  4AYC A;  1FAV A;  1HUC A;  2WPR A;  3HTK A;  2BAS A;  3TYY A;  5AW5 B;  2R5D A;  1CSB A;  3M9H A;  4DZO A;  1HWT C;  3NMD A;  2YNY A;  3VN0 A;  1GZL A;  5AVY B;  2ZXE B;  1CZQ A;  4HYT B;  2R32 A;  1CI6 B;  5AVZ B;  1S9K E;  2YO3 A; 
#chains in the Genus database with same CATH topology
 4GDO A;  1E79 H;  1M56 D;  1IFJ A;  3PLN A;  4B86 A;  1AJY A;  1T8Z A;  5CJ4 A;  4LLH A;  2B87 B;  4LC1 A;  1AVO A;  3GHG C;  1SVF A;  1G1J A;  2WT7 B;  1J2J B;  2FFD A;  4H13 C;  1G2C A;  1YIJ P;  5GTH E;  2NPS B;  5KLV E;  1YJW P;  3G3Z A;  3TNU B;  2K3R A;  2K9Y A;  1KFN A;  3BCC E;  1SQX J;  1U57 A;  2R3C A;  3H1K E;  4Y99 B;  3CWB D;  5EFW B;  4DT0 A;  1GK4 A;  2QRX A;  3Q5R A;  3H1H J;  1R5L A;  2M8R A;  2PP6 A;  4L75 A;  1FDO A;  1NKN A;  4WY4 A;  1E5W A;  4JQ0 D;  2I1K A;  2YO2 A;  4D6T D;  1NHL A;  1N7L A;  2B9B A;  3TGU G;  3L4F A;  4EDF A;  2OQQ A;  1FBM A;  4WY4 D;  1SQX E;  3L73 G;  1R5S A;  1HUC A;  3H6P A;  1HH0 A;  2IYO A;  1GZL A;  1K05 A;  3BAS A;  2M5A B;  1VL2 A;  2BCC D;  2I8D A;  5KLI C;  2HPC A;  2KNC A;  2KZJ A;  2YKP A;  2FXM A;  3IN6 A;  4U3F J;  1FS0 E;  1EDI A;  1FU1 A;  1NO4 A;  1KIL B;  2Q3I A;  3CI9 A;  2IPP A;  3EWK A;  2E5T A;  1RE4 A;  3JCU H;  2FXO A;  3CLQ A;  4EYY Q;  1OIP A;  2D2C D;  2P7J A;  4PD4 E;  5KAI H;  3MGN A;  1FZF A;  2OTJ P;  1EDK A;  4L76 A;  2W6J H;  3CCV P;  3V2P A;  1LNQ A;  4GOD A;  2QJK B;  4W80 A;  3K5B A;  3HUS A;  1PP9 J;  4U3F E;  2Z5I A;  2O3J A;  2R3S A;  4LGD E;  2KS1 A;  1G1I A;  2LR2 A;  1S5L E;  3GHG A;  2Q9I A;  1BDD A;  4JBZ A;  2IZ1 A;  2NPS C;  2A45 G;  1SQQ G;  1EQ7 A;  3G6E P;  1GDT A;  4L74 A;  3BAT A;  3L72 G;  1NTZ G;  1HWT C;  4DZO A;  1D7M A;  3NMD A;  4H13 D;  3CCS P;  3II6 A;  4Y99 C;  1J1D B;  3VP8 A;  2Q6Q A;  1LT9 A;  1QL1 A;  3T97 B;  1IFP A;  2QE7 H;  3FWN A;  5APT A;  2IBZ E;  3A0H E;  1OVR A;  1KIL E;  5GTH H;  3CC2 P;  2O01 J;  4EIJ A;  3M06 A;  1KYO E;  3L71 E;  1KZU B;  1NTM G;  1LP1 B;  5AW2 B;  1NTK G;  2XV5 A;  3RGU A;  1LTS C;  4I2L C;  4IFD K;  3L74 G;  3LW5 J;  1QEX A;  2C0X A;  4ZKP A;  1QVG O;  3UIA A;  2LXB A;  3I5C A;  1DX7 A;  2P67 A;  3RK2 B;  3R2P A;  3L70 J;  3D71 A;  1R8E A;  4JYC A;  5KLV D;  1PGP A;  2Z4E A;  4HH2 A;  1YJ9 P;  2HLO A;  2FKW B;  3PJS K;  2HOD A;  1BE3 D;  3B5N A;  2Y0C A;  2A45 I;  2I1J A;  4WVZ A;  3BCC D;  3MZW B;  2A06 G;  1KIL C;  2H88 C;  1RH5 B;  3H1K D;  1S3J A;  1X22 A;  1NU1 D;  3AE4 C;  5GTI E;  3CCM P;  1K04 A;  2L91 A;  1KB9 I;  3AEE C;  1SQP E;  2WVR A;  4OGQ B;  4C7N B;  1BGY J;  3OAK A;  4W7Z A;  3LID A;  1OXZ A;  3PTZ A;  4O9B A;  3IFM A;  3CMA P;  2M0B A;  3M9H A;  1PPJ D;  2QJK C;  2ZXE B;  3H1I J;  2YIU B;  4DCK A;  4UB6 E;  3VMY A;  4WB4 A;  2WT7 A;  1FDI A;  2NPS A;  4PJ0 E;  3L70 G;  1RQU A;  4PD4 H;  2YMK A;  3NTN A;  1QLE D;  5APW A;  1MFT A;  1H88 A;  3BVH A;  1ZXG A;  1NKZ B;  2NPS D;  2C9L Y;  1TU3 F;  1J1D C;  3IAO A;  1URQ A;  1L0L G;  3R4Y A;  1GL2 B;  3H1I E;  1YQ3 C;  3L37 A;  1S5L H;  5KAF H;  4IL6 X;  1SQQ K;  1KB9 D;  4ASV A;  3S4R A;  1XTG B;  2Q3E A;  2PRR A;  3AE2 C;  2W90 A;  3JSV C;  4H0L B;  1N73 B;  1WT6 A;  2FBW C;  2Y9Y A;  2MKV A;  1RF1 B;  5K5G B;  3SFE C;  4BRY B;  1DH3 A;  3D6Y A;  2FYU J;  2K88 A;  3ITK A;  3RK2 C;  3CPW O;  3A0H H;  3Q3D A;  1UIX A;  1PFI A;  1XTC C;  1L0N E;  3O6Q A;  1QX8 A;  2YNY A;  1KYO H;  1NTK K;  1FE6 A;  2G3A A;  2O1K A;  4XA4 A;  3RBX A;  1BSH A;  1T3U A;  1JTH B;  4ZKU A;  1ZW0 A;  2P1J A;  1AA0 A;  2KK7 A;  1SP4 A;  3CCE P;  3VYI A;  3P8M C;  3GG2 A;  1A02 F;  5L8R J;  1OVU A;  3CWB G;  3VOP A;  4OGQ C;  1NH4 A;  2IBZ D;  1NOH A;  1VQL P;  1KIL D;  4NPD A;  3W67 A;  1Q82 Q;  2O01 H;  3L71 D;  1PV3 A;  4D6T G;  1LTB C;  2W27 A;  2W8Z A;  2E75 B;  1KN7 A;  1KMI Z;  5APY A;  2JJL A;  1P84 I;  4N78 D;  1Y8A A;  1L4A A;  2YIU C;  1OW8 A;  2IFN A;  1LTA C;  5BVZ A;  3N7N A;  2FY8 A;  1X79 B;  3KQG A;  5AVX B;  2WIT A;  1A02 J;  3L75 D;  2IZ0 A;  1FJK A;  4RES B;  1YTZ I;  1OW7 A;  2HYN A;  1BCC E;  2B89 A;  3AE6 C;  3MD0 A;  1GL2 C;  2WSC J;  1VQ6 P;  4UB6 H;  3T97 A;  3AEA C;  3C1L A;  1EDL A;  2DW3 A;  3AE7 C;  2AEM A;  1SQP D;  3VN0 A;  5KLI B;  4PJ0 H;  1N7S C;  4H0L C;  1N73 C;  4JF7 A;  3VMA A;  1LP1 A;  1RQV A;  3V2Q A;  2JO1 A;  1VDF A;  2AXT E;  3WUU A;  1M7L A;  2KSE A;  1LT1 A;  1JY2 N;  3H1L E;  1RF1 C;  3KZI E;  1USD A;  1L0L K;  4M3L A;  4GT1 A;  3AED C;  1J1E B;  2JP3 A;  2Z5H A;  5DJT B;  3TGU J;  1FOS F;  5CCH C;  2IYP A;  3CME P;  2AEJ A;  2V4H A;  3M9B A;  3JC2 2;  1YTZ T;  3L73 J;  3ZDM A;  4HKZ H;  3H1J D;  3RK2 D;  1Q7Y Q;  1KC8 Q;  1HVV A;  2WSF H;  2K37 A;  3AE1 C;  1JM0 A;  2WWW A;  4JPZ B;  1FDM A;  3RBZ A;  3CXH E;  1EZV E;  2J5U A;  4DOJ A;  1VQ9 P;  1SQV D;  1LTI C;  1OFC X;  3A3Y B;  3HD7 B;  4C7N A;  1NJI Q;  1YI2 P;  5APU A;  3TGU E;  2JWD A;  4JYB A;  4GIF A;  1QVF O;  2E75 C;  1JY3 N;  4OGQ D;  1PGQ A;  4KJM A;  1ZN5 A;  2XND H;  2WPV B;  3V2N A;  4YXD C;  3Q5S A;  2GM4 A;  2KOG A;  1IK9 A;  2BEQ D;  2SPZ A;  1L0N D;  3P7K A;  1ZRT E;  2C0W A;  2QVA A;  1GK6 A;  2UWJ E;  3EFF K;  5KLV G;  2AXC A;  1BE3 G;  3KDP B;  1LWU B;  1GL2 A;  3H1H E;  4A7P A;  1QL2 A;  2FYU K;  5CBO A;  1S72 P;  1LGH B;  3OA7 A;  1SQQ J;  1OWA A;  1NU1 G;  2R5B A;  3E1R A;  3RL0 C;  2E43 A;  2XDJ A;  1GL2 D;  2GUV A;  1KQF B;  4IFM A;  5CMZ A;  5KJ7 C;  3L72 J;  2H8P D;  2VRS A;  1NTZ J;  3HE5 B;  1JB0 J;  2KSJ A;  3AE5 C;  1IFD A;  3CX5 E;  4C46 A;  1JY2 P;  1RF1 A;  2ITA A;  4YXW H;  5E79 E;  1N7S D;  1PPJ G;  4H0L D;  2XZR A;  1J1E C;  1OZH A;  1NAF A;  2WQY C;  1SS1 A;  3HRN A;  1YHQ P;  1SQQ E;  1M90 Q;  2CPS A;  1KQG B;  1NTM J;  2OYO A;  1NTK J;  1RE3 C;  5CCH A;  3CCU P;  3S1K A;  3FWL A;  1JTH A;  2AXT H;  3L74 J;  1FZG A;  2WPR A;  1BCC D;  3KZI H;  5CCH D;  5KAF E;  3CC4 P;  1PGJ A;  2WSC H;  1IFN A;  3GMA A;  3HD7 C;  1ZOY C;  3SWF A;  5H2F E;  2XNX A;  3MIW A;  2PFX A;  1T2K C;  3E1I A;  4TLF A;  1SQB D;  1NTK E;  3A7O A;  1GU4 A;  3IR9 A;  1PP9 E;  3L74 E;  1NWQ A;  4YPC A;  2WPS A;  3H1L D;  4KT0 J;  2OYI B;  2E74 C;  3L35 A;  2GUS A;  2E75 D;  3CXH H;  2POH A;  3PH0 A;  2RN0 A;  2KZI A;  2C9N Y;  1WMK A;  1USE A;  1GW3 A;  1CW5 A;  2QM8 A;  1RF0 C;  3OJA B;  5APX A;  3AEG C;  1LWU C;  1H0T B;  1BDC A;  2JKV A;  1QGK B;  3NXS A;  1EZV D;  4N6J A;  3G71 P;  3H32 B;  3RL0 g;  2N9Y B;  2Q1K A;  2IBZ G;  1NAY A;  3CCR P;  3M0D C;  5KJ7 A;  1FAV A;  4AYC A;  2E5Y A;  1VQP P;  2ZVO B;  4IOI H;  1FZC B;  1CSB A;  1L0L J;  3GF7 A;  5M1B A;  1JMB A;  3RL0 D;  1CZQ A;  1M1J B;  2V7Q J;  2R32 A;  1S9K E;  4PD4 I;  4C7R A;  5KJ7 D;  1NU1 K;  1PZQ A;  3L70 E;  3MP7 B;  5DJU B;  3RK3 E;  3EQ2 A;  1RE3 A;  1Z56 A;  5AW3 B;  3F5H A;  1FZE A;  4BWN A;  2OTL P;  2H7H A;  3L75 G;  1SQX D;  1DIP A;  2B87 A;  3CX5 H;  4ZMD A;  1L0L E;  2ZT9 B;  5AVS B;  4IFF A;  5AVU B;  5E79 H;  2XU6 A;  1HJB A;  2LXC B;  3CCQ P;  2JWA A;  3H1H D;  5B66 H;  3TNU A;  2JDI H;  1BGY E;  2Y9Z A;  2QSI A;  5AW1 B;  3VMZ A;  1SQP G;  5AW9 B;  3HD7 D;  3CX5 D;  3CD6 P;  1GW4 A;  2IBZ I;  2OYI C;  1T2K D;  3FXD A;  3CWB J;  3Q2Y A;  2KXP B;  1KYO I;  2Q5U A;  4PD4 D;  1N7S B;  3D70 A;  1M57 D;  5H2F H;  1VQ7 P;  4D6T J;  4UB8 H;  4I6M C;  4EOT A;  1ZV8 A;  1YIT P;  2YKQ A;  1NTZ K;  2QA4 P;  1RF0 A;  2E74 D;  1MZ9 A;  4U3F D;  2FYN B;  1KFM A;  1JY2 O;  5CCG C;  3U59 A;  3S9O A;  3H1J G;  2ZYG A;  1Q81 Q;  2M5A A;  3C8V A;  1JNM A;  1H8A A;  1NTM K;  4I1L A;  4KHX A;  2BCC J;  5AVW B;  1SQV G;  4D6T E;  2M3B A;  4BXL A;  2ZYA A;  5AW8 B;  2RH0 A;  1FZC C;  3M0D A;  1KIL A;  4ASW A;  2QM7 A;  1W5C E;  1M1J C;  1PP9 D;  2GA1 A;  1LTT C;  2FYU E;  1ZLL A;  2AEF A;  1IO4 A;  3HUS B;  2KS1 B;  2KB7 P;  3P32 A;  1KYO D;  4HB1 A;  4PV1 B;  3A2A A;  2L5G B;  3KHU A;  3PP5 A;  1L0N G;  2ZT9 C;  3M91 A;  2CK3 H;  4K35 A;  3LW5 H;  3SSU A;  2P58 A;  1RY3 A;  4HJG H;  2IX7 C;  1IFM A;  1LT9 B;  5AW5 B;  2BCC G;  2QJP B;  3U1C A;  4HYT B;  1S5L X;  2O1J A;  1VQK P;  1VQ5 P;  2LKM A;  3CCJ P;  3KXD A;  1AV1 A;  2V7Q H;  1S9K D;  1VQN P;  3RL0 B;  3L36 A;  3L70 D;  1P84 H;  3FX0 A;  2WZ7 A;  1YQ4 C;  4H44 B;  4Y28 J;  1MFZ A;  3HE4 B;  1SFC B;  2FYN C;  1JMM A;  5TIS H;  3M0A A;  5CBN A;  1JUN A;  2W6A A;  3CCL P;  1AQT A;  1PGO A;  1H0T A;  2HOD B;  3TDK A;  3AEF C;  1VQO P;  1VQ8 P;  1RE4 C;  2ZVN B;  3H32 A;  1BGY D;  3V5B A;  2K9J B;  2MJZ A;  5CCG D;  5KLV J;  2XKM A;  1JO5 A;  2K1A A;  3D6Z A;  2KP8 A;  2E76 B;  1FZC A;  4OH8 B;  1BE3 J;  1SQB G;  1U7J A;  1AFO A;  3BCC J;  3VTP C;  1M1J A;  1MUU A;  1FZB A;  1IZN B;  3H1I D;  3H1K J;  3GF3 A;  4NPF X;  1NU1 J;  3HUS C;  2WMM A;  3H1L G;  2NZ2 A;  1N2D C;  4DJG A;  1FJP A;  2HFE D;  1UII A;  3QH9 A;  4PV1 C;  1SQV K;  1YBK A;  1OVV A;  3L73 E;  4AQR D;  4IL6 E;  5KKZ B;  2PAJ A;  3F89 A;  1DD3 A;  1BE3 E;  2KIK A;  3M9Q A;  2E74 B;  1IJD B;  4RKU J;  1NU1 E;  4GOE A;  1URQ B;  2N1T B;  1LT9 C;  3FGA D;  3MUD C;  5APV A;  2HR3 A;  2ZT9 D;  4Z1M H;  5BU5 A;  2QJP C;  2OYH B;  1EZV G;  4L73 A;  1FOS E;  3TSI A;  4CPG A;  1GD2 E;  2YKO A;  5APS A;  4R4M A;  1K8A Q;  1L0N K;  5CJ0 A;  2ZYD A;  3BCC G;  1JCD A;  1IFI A;  2WTY A;  1PPJ E;  1RHZ B;  3C9I A;  3H1K G;  3B71 A;  2FYU D;  5B5E E;  1ZR4 A;  5KTB A;  1N7S A;  1ZR2 A;  1N73 A;  1Q90 D;  1L2P A;  1Q2N A;  1GMJ A;  4H44 C;  1KD1 Q;  1SFC C;  3PHL A;  1HTL C;  3O6Q B;  1EDJ A;  4BRY A;  3G4S P;  3B5N C;  5B66 E;  1T3J A;  2WSS H;  1SQX G;  1JEK A;  2R5D A;  2YMY A;  3KPE A;  2NRG A;  3AE3 C;  3H1H G;  1CI6 B;  5AVZ B;  3FXE A;  1SLQ A;  3ABV C;  1KB9 E;  1FZA A;  3L72 E;  1NTZ E;  3Q1M A;  2E76 C;  5AVT B;  3G9R A;  2M3E A;  3V4Q A;  3SFD C;  4K3A A;  3V4W A;  1KOR A;  3CXH I;  3VMX A;  1EZV I;  2IDB A;  3B4S A;  5AW6 B;  2KI7 B;  1L4A B;  4UB8 E;  2H43 A;  2N9B A;  1LTJ B;  1NTM E;  1MKM A;  2Y0E A;  5AW7 B;  3WUT A;  4GKG A;  1HJ0 A;  1ZP0 C;  4XE5 B;  3L71 J;  1JY3 P;  1M1K Q;  5KKZ C;  1SQB K;  2OGU A;  3RK3 B;  1X0T A;  2PGD A;  3AEC C;  3U1A A;  2E42 A;  4PV1 D;  3NFQ A;  4U3F G;  2W83 C;  3H25 A;  2OAR A;  3EFG A;  1URQ C;  1VF5 B;  2N1T C;  3BRV B;  1OX3 A;  2KYV A;  3MUD A;  2OYH C;  1N8R Q;  2QJY B;  3L75 J;  1K9M Q;  2A06 E;  2RMZ A;  2Y0D A;  4IL6 H;  1HF9 A;  3W68 A;  2BAS A;  4OWF A;  2QG4 A;  2HG5 D;  5AVY B;  4MN4 C;  2W6B A;  2CPB A;  4N78 E;  3P8C E;  3TF5 A;  2OTK E;  3CXH D;  3WUV A;  1PP9 G;  4EI2 A;  4NPE A;  1GTW A;  3HTK B;  3Q5P A;  3TGU D;  1SQP J;  2KUB A;  5KLV K;  1EXI A;  2O01 N;  4OVN F;  3CX5 I;  3L75 E;  3L71 G;  3L73 D;  3HE4 A;  3SWY A;  1SFC A;  2Q7C A;  1T6A A;  1HBW A;  5AVQ B;  1M8O B;  4RO0 A;  2YXQ B;  5B5E H;  1X8Y A;  4H44 D;  1NGM B;  1SFC D;  1JCC A;  1PL5 A;  2FFD B;  2K9J A;  1G2C B;  2WSE J;  3B5N D;  1ZRT D;  4I7Z B;  4ZNC A;  5BU8 B;  3H1J J;  2RKL A;  1SQX K;  3N4X A;  5AVV B;  3LIE A;  2A45 H;  1VPC A;  3B8E B;  3HD7 A;  1L4A C;  4RJT A;  1P84 E;  2E76 D;  1YYC A;  3QWO C;  1LTJ C;  1PIX A;  3PRJ A;  2ZAE B;  1SQV J;  4WY4 B;  4U7J A;  1VQM P;  2QEX P;  1N86 A;  1KB9 H;  2FXP A;  3AEB C;  2IFM A;  2QIW A;  5TIS E;  1X9V A;  3TYY A;  2B88 A;  4WWI A;  3RK3 C;  1EC5 A;  1DEB A;  1AVY A;  3H1J E;  3A0B E;  3WU2 E;  2WSF J;  1VF5 C;  1SQQ D;  1KQS O;  1W2E A;  2N1T A;  3MTU E;  1YJN P;  2KLV A;  1SQV E;  2QJY C;  1DD4 A;  2OYH A;  3V6I A;  1L0N J;  2HPC B;  2KNC B;  2G8Y A;  1BGY G;  1S2E A;  3L72 D;  1NTZ D;  1URQ D;  1LWU A;  2N1T D;  2D2C B;  3GLM A;  5TJH A;  3CWB E;  3GW6 A;  1KV4 A;  3H1I G;  1HGZ A;  3TK1 A;  1OW6 A;  1VQ4 P;  1NTM D;  2WPQ A;  3AE8 C;  1NTK D;  2P2U A;  1H89 A;  3HE5 A;  2H89 C;  4QMA A;  2P10 A;  5AVR B;  3L74 D;  4XFJ A;  3O8Z A;  1KTM A;  2YXR B;  3V2R A;  4W7Y A;  3CC7 P;  1LTG C;  1S1C X;  3KYQ A;  1CI6 A;  3GHG B;  2JR8 A;  5AW4 B;  2FFD C;  2BCC E;  3I55 P;  4H13 B;  1Y9B A;  3WMM 0;  4I7Z C;  2A06 D;  1JY3 O;  2J59 M;  2YO3 A;  1KQL A;  1MV8 A;  3BRT B;  1U7M A;  1BCC J;  1WRG A;  3E7K A;  1NYH A;  1ZME C;  2FYZ A;  3P8C D;  5C39 A;  2JEE A;  1LTJ A;  1OMI A;  4WY4 C;  1GU5 A;  2FYU G;  5GTI H;  3IF4 A;  3A5T A;  1AQ5 A;  2ZFC A;  2KLU A;  1SQB J;  4TT3 H;  3SWK A;  2ZXX A;  1K73 Q;  1JOC A;  1L4A D;  2ZJS E;  1W2B O;  2OYI A;  3OW2 O;  3CL3 D;  3H1L J;  4R4L A;  4N3Y B;  1Y47 A;  1IC2 A;  1S4X A;  1IK7 A;  3JCU E;  3USS A;  1LJ2 A;  1FC2 C;  3RK3 D;  3I56 P;  1Q86 Q;  1DEE G;  3VP9 A;  1SQP K;  1EXJ A;  1HGV A;  5KAI E;  5CHX A;  1NVO A;  2R44 A;  2BEZ F;  1BSN A;  2WSE H;  1VF5 D;  1SQB E;  5AW0 B;  2D2C C;  5CCG A;  1L0L D;  3B5N B;  4AUW A;  3MHV A;  1BCC G;  5APQ A;  3A0B H;  3WU2 H;  4YTP C;  3HTK A;  4WBA A;  1P84 D;  4GOF A;  3AE9 C;  2J58 A; 
#chains in the Genus database with same CATH homology
 1SLQ A;  4C7R A;  5KJ7 D;  1IFJ A;  1NU1 K;  1SP4 A;  1FZA A;  3VYI A;  4B86 A;  3EQ2 A;  3P8M C;  1RE3 A;  5AVT B;  1Z56 A;  1A02 F;  1T8Z A;  5AW3 B;  3VOP A;  5CJ4 A;  3V4Q A;  1FZE A;  1NH4 A;  4LLH A;  3V4W A;  1NOH A;  4LC1 A;  3GHG C;  2H7H A;  1SVF A;  1KIL D;  1G1J A;  3VMX A;  2WT7 B;  2O01 H;  1J2J B;  2FFD A;  5AW6 B;  1G2C A;  2NPS B;  5AVS B;  4IFF A;  5AVU B;  1L4A B;  1LTB C;  2XU6 A;  3G3Z A;  1HJB A;  2W27 A;  3TNU B;  2H43 A;  2N9B A;  1LTJ B;  5APY A;  2JJL A;  4N78 D;  1L4A A;  1KFN A;  2IFN A;  3TNU A;  5AW7 B;  1LTA C;  4GKG A;  5BVZ A;  4XE5 B;  1JY3 P;  2R3C A;  3N7N A;  1SQB K;  1X79 B;  3KQG A;  5AW1 B;  3RK3 B;  3VMZ A;  4Y99 B;  3U1A A;  1GK4 A;  2M8R A;  2PP6 A;  2E42 A;  5AVX B;  2WIT A;  5AW9 B;  1A02 J;  3NFQ A;  1NKN A;  4WY4 A;  1E5W A;  3HD7 D;  2I1K A;  2OAR A;  2YO2 A;  1FJK A;  1URQ C;  3EFG A;  1NHL A;  2N1T C;  4RES B;  1N7L A;  3BRV B;  1GW4 A;  2OYI C;  1YTZ I;  2HYN A;  1T2K D;  2KYV A;  3MUD A;  3L4F A;  2OYH C;  3MD0 A;  1GL2 C;  2Q5U A;  1N7S B;  1FBM A;  4WY4 D;  3T97 A;  4I6M C;  4EOT A;  1ZV8 A;  1HUC A;  3H6P A;  1HH0 A;  2BAS A;  3VN0 A;  1GZL A;  2HG5 D;  1NTZ K;  2YKQ A;  5AVY B;  1N7S C;  1N73 C;  1RF0 A;  4JF7 A;  2W6B A;  3BAS A;  2CPB A;  4N78 E;  3P8C E;  1MZ9 A;  1KFM A;  1JY2 O;  3V2Q A;  1VDF A;  5CCG C;  3U59 A;  1GTW A;  2HPC A;  1M7L A;  3HTK B;  1JY2 N;  1RF1 C;  1JNM A;  1L0L K;  5KLV K;  4M3L A;  2YKP A;  2FXM A;  1H8A A;  1NTM K;  4GT1 A;  4I1L A;  4KHX A;  1J1E B;  1FU1 A;  3HE4 A;  5AVW B;  3SWY A;  1SFC A;  1NO4 A;  1KIL B;  2Q3I A;  3CI9 A;  2IPP A;  2Z5H A;  2M3B A;  2Q7C A;  1RE4 A;  5AW8 B;  1FOS F;  1FZC C;  5CCH C;  3CLQ A;  3M0D A;  1KIL A;  1HBW A;  2QM7 A;  5AVQ B;  2P7J A;  3M9B A;  1M1J C;  1X8Y A;  1YTZ T;  3MGN A;  1SFC D;  1JCC A;  1LTT C;  1FZF A;  3RK2 D;  1ZLL A;  2FFD B;  1IO4 A;  3HUS B;  1G2C B;  1HVV A;  3B5N D;  2WSF H;  3V2P A;  2WWW A;  2KB7 P;  3P32 A;  4W80 A;  1FDM A;  3HUS A;  2Z5I A;  4DOJ A;  4LGD E;  1LTI C;  5BU8 B;  3A3Y B;  3HD7 B;  1G1I A;  4C7N A;  3A2A A;  2L5G B;  1SQX K;  3PP5 A;  3N4X A;  3GHG A;  2Q9I A;  5AVV B;  5APU A;  3LIE A;  2NPS C;  4JYB A;  3B8E B;  1VPC A;  2A45 H;  2A45 G;  4GIF A;  3HD7 A;  1L4A C;  1EQ7 A;  3M91 A;  1GDT A;  1YYC A;  1LTJ C;  3LW5 H;  1JY3 N;  4WY4 B;  1RY3 A;  1N86 A;  2IX7 C;  2IFM A;  3BAT A;  1IFM A;  1LT9 B;  1X9V A;  3TYY A;  5AW5 B;  1HWT C;  1ZN5 A;  3RK3 C;  3NMD A;  4DZO A;  3II6 A;  4Y99 C;  3V2N A;  1DEB A;  1J1D B;  3VP8 A;  1LT9 A;  3U1C A;  4HYT B;  1QL1 A;  2GM4 A;  2KOG A;  1IK9 A;  5APT A;  2O1J A;  3P7K A;  2C0W A;  1GK6 A;  2LKM A;  1W2E A;  2N1T A;  3MTU E;  4EIJ A;  3M06 A;  1KZU B;  2KLV A;  5AW2 B;  1S9K D;  3KDP B;  2XV5 A;  2OYH A;  1LWU B;  3RL0 B;  1GL2 A;  3L36 A;  2HPC B;  1LTS C;  1QL2 A;  2FYU K;  4I2L C;  1LGH B;  3OA7 A;  4IFD K;  1URQ D;  1LWU A;  1OWA A;  2N1T D;  2R5B A;  2WZ7 A;  3RL0 C;  2C0X A;  2E43 A;  4ZKP A;  1MFZ A;  3HE4 B;  1SFC B;  2XDJ A;  3UIA A;  3M0A A;  1JMM A;  1GL2 D;  2GUV A;  1JUN A;  3I5C A;  1DX7 A;  2W6A A;  2P67 A;  3RK2 B;  3R2P A;  4IFM A;  5CMZ A;  5KJ7 C;  2H8P D;  2VRS A;  2HOD B;  3HE5 B;  2KSJ A;  4JYC A;  2Z4E A;  1HGZ A;  4HH2 A;  3TK1 A;  2HLO A;  2FKW B;  1IFD A;  2WPQ A;  4C46 A;  1JY2 P;  1RF1 A;  2P2U A;  1H89 A;  2HOD A;  3HE5 A;  1N7S D;  3B5N A;  2A45 I;  2I1J A;  1RE4 C;  2XZR A;  3H32 A;  1J1E C;  1KIL C;  3V5B A;  1NAF A;  3HRN A;  2MJZ A;  5AVR B;  5CCG D;  2XKM A;  3O8Z A;  1JO5 A;  2CPS A;  1RE3 C;  2KP8 A;  5CCH A;  4OH8 B;  1FZC A;  3V2R A;  4W7Y A;  1AFO A;  3VTP C;  1LTG C;  1M1J A;  1JTH A;  1MUU A;  4C7N B;  1FZB A;  3KYQ A;  3OAK A;  4W7Z A;  1CI6 A;  3GHG B;  3LID A;  5AW4 B;  1FZG A;  2FFD C;  3HUS C;  1OXZ A;  4O9B A;  2WPR A;  3IFM A;  1N2D C;  3M9H A;  5CCH D;  3WMM 0;  1FJP A;  2ZXE B;  2HFE D;  1JY3 O;  2WSC H;  1SQV K;  1IFN A;  2J59 M;  2YO3 A;  3HD7 C;  3SWF A;  1KQL A;  1MV8 A;  3BRT B;  4AQR D;  2XNX A;  3MIW A;  3VMY A;  4WB4 A;  1T2K C;  3E1I A;  2WT7 A;  2PAJ A;  1WRG A;  3A7O A;  2NPS A;  2FYZ A;  3P8C D;  2JEE A;  1LTJ A;  3M9Q A;  4WY4 C;  1GU4 A;  3NTN A;  1GU5 A;  1IJD B;  3IR9 A;  5APW A;  1NWQ A;  1H88 A;  2WPS A;  3A5T A;  3BVH A;  1URQ B;  1AQ5 A;  2ZFC A;  2N1T B;  1LT9 C;  1NKZ B;  2OYI B;  2NPS D;  1JOC A;  5APV A;  2C9L Y;  1L4A D;  3L35 A;  5BU5 A;  1J1D C;  1URQ A;  2GUS A;  2OYH B;  2POH A;  1GL2 B;  1FOS E;  2OYI A;  3TSI A;  1GD2 E;  3CL3 D;  2YKO A;  5APS A;  3L37 A;  1L0N K;  5CJ0 A;  4N3Y B;  2C9N Y;  1IC2 A;  1SQQ K;  1JCD A;  1IFI A;  1GW3 A;  1XTG B;  2WTY A;  1CW5 A;  2QM8 A;  1RF0 C;  3RK3 D;  3C9I A;  1N73 B;  3OJA B;  5APX A;  3VP9 A;  1SQP K;  1HGV A;  1LWU C;  1ZR4 A;  1WT6 A;  5KTB A;  5CHX A;  1N7S A;  1ZR2 A;  2WSE H;  1N73 A;  1RF1 B;  5AW0 B;  5CCG A;  3NXS A;  3B5N B;  4AUW A;  4N6J A;  1DH3 A;  3H32 B;  1SFC C;  1HTL C;  5APQ A;  3RK2 C;  1PFI A;  1XTC C;  3B5N C;  3M0D C;  1FAV A;  1T3J A;  4AYC A;  5KJ7 A;  3HTK A;  4WBA A;  1FZC B;  2R5D A;  1CSB A;  2YNY A;  1NTK K;  2YMY A;  2O1K A;  4XA4 A;  3RL0 D;  3KPE A;  1CZQ A;  1M1J B;  1T3U A;  1JTH B;  4ZKU A;  2R32 A;  1CI6 B;  5AVZ B;  2P1J A;  2J58 A;  1S9K E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...