3TNUB

Heterocomplex of coil 2b domains of human intermediate filament proteins, keratin 5 (krt5) and keratin 14 (krt14)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
95
structure length
95
Chain Sequence
b'TKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Keratin, type I cytoskeletal 14
publication title Structural basis for heteromeric assembly and perinuclear organization of keratin filaments.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytosolic protein
total genus 46
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3tnuB00
1HJBA 1FOSF 3HE4A 3L35A 5APUA 3M9BA 2Q3IA 1OXZA 5APVA 2QM7A 4GT1A 1GZLA 2WPQA 4EOTA 1G2CB 2WT7A 3B8EB 1J2JB 1GD2E 2ZFCA 5AW4B 5AW3B 2R3CA 2WPRA 2C9NY 4RESB 5AVXB 1H89A 1MV8A 5APSA 4AQRD 2P7JA 2XU6A 4XE5B 5APQA 1CI6A 5APXA 3M0DA 1NWQA 2WTYA 1MUUA 3M06A 5AW5B 1MFZA 3KDPB 4KHXA 1FOSE 5CMZA 5AVWB 3P32A 5AVYB 3VN0A 2WPSA 1T2KD 1JUNA 2R5DA 1S9KD 3HE5B 4C7NA 3TNUA 3M91A 4AYCA 3V4QA 5AVZB 3KQGA 2QM8A 2P67A 2N9BA 4DZOA 3O8ZA 3NXSA 3VMXA 2C9LY 1T2KC 4I2LC 1HUCA 4I6MC 4B86A 3HE4B 1SP4A 2P2UA 3A3YB 3M0AA 3P8MC 5AW2B 1A02F 3V5BA 1HBWA 5AW6B 2JJLA 3VMZA 2XZRA 5AW8B 3TK1A 4GKGA 3UIAA 2WT7B 2Z5HA 3VTPC 2BASA 3M9HA 3A5TA 1SLQA 3IR9A 1H88A 2XV5A 5AVRB 1CZQA 3I5CA 1GU5A 1GK6A 5AVQB 1HWTC 1GU4A 2Q7CA 2YO2A 2W6AA 3LIDA 1H8AA 1CI6B 1X8YA 4C46A 2R32A 3SWFA 1FAVA 3L37A 1YYCA 2ZXEB 3LIEA 2KP8A 3VMYA 1IO4A 5AVSB 3NMDA 1CSBA 2W27A 3L36A 2Z5IA 3T97A 1GTWA 1NAFA 5APTA 3A7OA 3NTNA 3TYYA 4LC1A 3P7KA 3MD0A 5AW0B 2IPPA 2YO3A 5AVVB 4C7NB 4HYTB 3TNUB 5AVUB 2YNYA 5APWA 3OAKA 3A2AA 5AW7B 3VYIA 3HE5A 1DH3A 2E43A 3HTKA 5AVTB 1S9KE 1A02J 1OWAA 2VRSA 2Q5UA 5APYA 4JYBA 4AUWA 2R5BA 1KQLA 2WWWA 4M3LA 2E42A 4JYCA 3V4WA 3NFQA 5AW9B 1GK4A 2H7HA 3MGNA 5AW1B 1JNMA
chains in the Genus database with same CATH superfamily
4W7ZA 1HJBA 3HE4A 5APUA 1OIPA 1Q7YQ 2Y9YA 1GW4A 2QJPB 1MV8A 2A06G 4WY4D 3FWNA 1SVFA 2W6JH 4KHXA 3WU2H 1JY3N 2CPSA 4R4LA 1KQFB 1KYOH 3QWOC 3E7KA 3CC4P 4DZOA 1LT1A 1BCCE 3B5NB 3AEDC 3PLNA 2NPSB 2RKLA 2KZJA 3A5TA 4H44C 1DD3A 4L76A 1N7SA 2ZYGA 2FBWC 2L91A 1M57D 3II6A 1YYCA 2Y9ZA 1OW7A 1NAFA 2BCCG 1IK7A 3SWKA 3TNUB 3CX5I 1JTHA 2YNYA 1JY3O 1W5CE 3IAOA 3L72G 1NTKD 4KT0J 2OYOA 1W2BO 3HE5A 1Y9BA 1L0ND 5AVTB 4DCKA 4Y99C 1M90Q 2QJKB 3MHVA 4H13B 2PGDA 1NTMK 3AE2C 3RK3E 1LTAC 2WPQA 1WT6A 2J58A 2HODB 5KLVK 1L0LK 4H44D 3EWKA 3L71E 3HD7A 3JC22 3CWBE 3P32A 1OX3A 4R4MA 1S9KD 2A45H 5AVZB 3OJAB 1FS0E 5BU8B 2P67A 1VQ5P 2B87B 1KTMA 3M9QA 4I6MC 2HLOA 2M3EA 3P8MC 2O01J 4BRYB 3B5NC 1SQBK 1SLQA 2XV5A 5AVRB 1LP1A 4N3YB 1KV4A 3H1KE 1SQQE 2P58A 4EI2A 4IFMA 1NTZE 1IFNA 3AE6C 2N1TB 3L73D 1LT9A 3MD0A 1HH0A 1YQ3C 3L72J 1PIXA 2QE7H 1X79B 1E79H 3H1LG 1G1IA 1SQXK 1NKNA 5BVZA 2LR2A 3I56P 1D7MA 1KB9D 1ZOYC 3GG2A 3D6YA 1AV1A 1FZFA 1GL2C 5E79E 2QJKC 1HGZA 2K88A 2IYPA 3G3ZA 4EOTA 1IFDA 3CXHE 4H13C 3B5ND 3Q1MA 2ZFCA 2OYHB 2KSJA 2Z4EA 2P7JA 1Y8AA 2PFXA 1CI6A 3M0DA 1K05A 2GM4A 3RBXA 2FXOA 1FZBA 1X22A 2WPSA 3LW5J 2KZIA 4GODA 4L74A 4DOJA 1VL2A 3O6QB 2P10A 2FYUE 1VPCA 3AE1C 1U7MA 3T97B 1PGQA 5GTHH 2ZVOB 1LJ2A 2H89C 1R5SA 2K9JA 1N2DC 3TDKA 2KS1B 2IFMA 3L70G 3BATA 5KAIE 2KB7P 3RGUA 1VQ7P 3I5CA 1L4AA 1SQVK 1PP9G 1GL2D 3P8CD 4GDOA 2W6AA 3LIDA 2B9BA 1TU3F 1M56D 5AVSB 4H13D 5APTA 1KYOI 3WMM0 2K9YA 4XA4A 4OWFA 1OMIA 2N1TC 2D2CD 5CCHC 4LLHA 1AA0A 2NZ2A 3WUUA 3Q3DA 1JEKA 2IFNA 3SSUA 2QRXA 2VRSA 2A06E 4UB8E 3RL0D 4JYBA 1YJNP 2M5AB 4JYCA 1GK4A 3AEGC 1KMIZ 1EDIA 2Y0DA 1QVFO 1BDCA 2IBZG 2C9NY 3RK2C 3EFFK 1E5WA 1RF1B 1NH4A 1N7LA 1PGOA 3M06A 5B66E 5AW5B 1YITP 3K5BA 2OYHC 3H1HG 1FOSE 1NKZB 3CCRP 1SQPK 2JWAA 3L4FA 1Q86Q 1FBMA 4AYCA 1P84I 3WU2E 1S1CX 4QMAA 4TT3H 2K1AA 2N1TD 2N9BA 1IJDB 3NXSA 2ZYDA 3BVHA 4U7JA 2BCCE 1HBWA 1UIXA 3L70J 2YXRB 1RF0C 1NTMG 5KJ7C 5BU5A 2KLUA 2JWDA 3IR9A 3WUTA 3L72E 1GU4A 2A45I 4ZKUA 3RK2D 1EZVE 3CWBG 3L74G 5H2FE 3F5HA 1EXIA 4GIFA 3V2NA 4HB1A 2JEEA 2E74B 2Q5UA 3TGUG 1DD4A 3L75E 3RL0g 1AFOA 2WSEJ 3B8EB 5KJ7D 2SPZA 1SQQG 1NTZG 2GUVA 2WTYA 4L73A 1WRGA 1FZCB 3FWLA 5L8RJ 1GL2A 5CMZA 2Y0CA 3CI9A 2R5DA 1SQXG 4N78E 1DIPA 1PFIA 4D6TG 1NOHA 2QM8A 3B71A 2W8ZA 1LGHB 1SFCC 3V5BA 1LTJA 2AEMA 3D71A 3H1LE 1QVGO 2AEFA 3CCJP 1RQVA 2H43A 1PL5A 1M1JA 3L71J 1NU1K 2LKMA 3I55P 3VMYA 2Y0EA 2W27A 3CWBJ 3H1JE 3A7OA 4PD4E 3H25A 5GTIH 2W83C 4YPCA 3GMAA 1BCCD 4BRYA 3V2PA 2FYUG 1X0TA 3RK3C 1KFMA 2GUSA 3AE7C 3Q5SA 3JCUE 5CBOA 3MP7B 2E74C 3SWFA 2Q6QA 1SFCD 1SQVG 2GA1A 2WT7A 1SQQJ 3MIWA 1URQD 5AW3B 2O1JA 4RESB 1NTZJ 3ITKA 2B88A 2E75C 2XU6A 1KB9H 1ZXGA 1MUUA 5CCGC 3OA7A 1FE6A 1MFZA 2FXPA 1SQXJ 3L70E 4D6TJ 1ZR2A 3CLQA 1FZCC 3E1RA 2WSFJ 2KLVA 1PP9E 1VF5B 3GHGA 4ZKPA 3FXEA 5TJHA 4HKZH 3RK3D 1FJPA 2E76B 5TISH 5GTHE 3W68A 2IZ1A 2BASA 1H88A 3L71D 3PTZA 2WSCH 2E74D 4OGQB 3GF3A 3CWBD 1H8AA 3CPWO 1X8YA 1KILB 2R32A 1IO4A 2ZXEB 1AQ5A 2AXTH 1CSBA 3T97A 1DEBA 1RF0A 5KJ7A 2POHA 1SQPG 2E75D 2OGUA 5AVUB 2Q9IA 3CCEP 3AECC 5CCGD 2FYUJ 3KZIH 1HTLC 3A2AA 3H32B 1ZP0C 1G1JA 2IBZE 1M1KQ 1A02J 3MUDC 1UIIA 3NFQA 3H1HE 4JBZA 5EFWB 3H1KD 1SQQD 1FOSF 4U3FE 3L35A 2QM7A 4GT1A 1NTZD 1Q81Q 1RE3C 1H0TA 4BXLA 3SFDC 2KNCB 3G71P 4JPZB 1EZVG 1P84H 5B5EH 1BGYE 1NTME 2RH0A 4C7NA 3HTKB 3QH9A 5KLVE 1IFPA 1L0LE 3V4QA 1GDTA 3RBZA 5K5GB 2KI7B 1GMJA 2WVRA 1T2KC 2FXMA 3Q5RA 1MFTA 1LTTC 1VF5C 1FU1A 2P2UA 3CXHD 3L74E 3N4XA 3V6IA 1RHZB 2QJPC 4GOEA 3L75G 1FDIA 2YO2A 1M8OB 1G2CA 1SFCA 1FZGA 4OGQC 3V2RA 3TGUE 2FFDB 2LXBA 1SS1A 1KILC 1URQA 2FYUD 3CX5E 1SQBE 5DJUB 1QX8A 2KYVA 2NPSC 1S5LH 4NPDA 1EDLA 2E43A 4K3AA 2A45G 4IL6H 1EC5A 5CHXA 2BCCJ 1S4XA 3U1CA 4AUWA 2FKWB 2XDJA 5AW9B 1RE4A 2OTJP 4PJ0E 2P1JA 1VF5D 3C1LA 1SQXE 4D6TE 4WY4A 1NU1G 2PP6A 1VQ6P 2LXCB 4JQ0D 1NWQA 3H1JG 1NTKK 3HUSB 2OARA 2ZT9B 1L0NK 3FGAD 4OGQD 2A06D 3IN6A 2O3JA 2NPSD 1JCCA 1PV3A 2KUBA 1PPJG 3HE4B 5KAFE 3L75J 1VQKP 1KB9I 1BDDA 2W6BA 2M3BA 1CZQA 5AVQB 1IFIA 1XTCC 3NTNA 1VQOP 5AVVB 1Z56A 2QIWA 4NPEA 3SFEC 1OVRA 3A0HE 1SQVE 2E5YA 2FFDC 2BCCD 5GTIE 3F89A 3VYIA 4YXDC 5CBNA 3L72D 3CCLP 1N7SB 2YKOA 1NU1J 3H1LJ 1GZLA 3S1KA 3WUVA 3BASA 2MKVA 3MUDA 1EZVD 1YJWP 2JKVA 3H1JJ 1KILE 4Y28J 1JTHB 3EQ2A 2K3RA 1N73B 1RE3A 3HE5B 3BRTB 2YXQB 3HUSC 4N6JA 2ZT9C 3O8ZA 1FDMA 1USEA 3AE8C 2ITAA 3CCVP 2HPCA 1EDKA 1BE3G 1SQPE 1T6AA 2O01N 2KIKA 3TK1A 2BEQD 2Z5HA 1CW5A 4U3FG 4ZNCA 3PH0A 5M1BA 2N9YB 3H1IG 3HD7B 5CCHD 2KP8A 2KXPB 2HR3A 1IFJA 1KYOE 3CL3D 1GTWA 4RO0A 3PP5A 3TYYA 1JOCA 4N78D 2IPPA 2AXTE 3C8VA 1EDJA 2V4HA 1OVVA 3BCCG 1BGYG 5CJ4A 2JO1A 1PP9J 4MN4C 3Q2YA 5KLVG 1VQPP 1L0LG 1OW6A 2R44A 2WZ7A 5APYA 3KXDA 2ZT9D 2HFED 2RN0A 3H1LD 1LNQA 1IFMA 3B5NA 3AEEC 2NPSA 1LP1B 3VP8A 2KSEA 3H1JD 1N7SC 1VQMP 1VQ8P 3R2PA 2WSSH 4PD4D 4TLFA 1NHLA 3CC7P 1H89A 1LT9B 3KYQA 1YBKA 2V7QJ 3SWYA 1FZAA 2J59M 5AVWB 3VN0A 1SQBG 2J5UA 1T3JA 1Y47A 3TNUA 1P84E 3VOPA 1EXJA 3D70A 1N73C 3BRVB 3PHLA 1JCDA 1JMMA 1ZN5A 1HVVA 3VMXA 4HJGH 1BSHA 4IFDK 3H1HJ 2I8DA 2PRRA 1RH5B 5AW6B 4U3FJ 4OVNF 2WSFH 1RF1C 2Q3EA 5KLIB 2AXCA 1CI6B 2QJYB 1FAVA 3L37A 2HODA 3L70D 3L36A 1NTKG 2I1KA 1YTZI 3HD7C 1BGYJ 1L0NG 1NTMJ 1PP9D 2R3SA 4EIJA 2QVAA 5APWA 5KLVJ 1L0LJ 1NU1E 4I1LA 1KQSO 3AE9C 1KC8Q 2K9JB 1JB0J 2B87A 4IL6E 3L74J 2JP3A 1OZHA 2ZYAA 1K8AQ 3KPEA 4A7PA 3MGNA 1YQ4C 1L4AB 3M9BA 1LTIC 5DJTB 1ZR4A 4JF7A 5APSA 1S72P 5APQA 4H44B 3TGUJ 1PPJE 1SQBJ 3B4SA 1LT9C 2N1TA 2KK7A 5CCHA 2IBZD 2L5GB 1R5LA 4O9BA 3H1HD 4DJGA 4U3FD 3G6EP 2OQQA 4UB6H 1A02F 1OW8A 3M0AA 3V2QA 2H88C 1MZ9A 1AQTA 1S2EA 3VP9A 3L73G 2WITA 4UB8H 1OVUA 1GU5A 1GK6A 1ZV8A 4NPFX 1KQGB 1BGYD 3NMDA 1NTMD 5KLIC 1DEEG 2XNDH 2OYHA 1USDA 4LC1A 5KLVD 1L0LD 3M0DC 1RQUA 3GLMA 2QJYC 3VMAA 4GOFA 3AEAC 1FJKA 1MKMA 1YHQP 5AW7B 1J1EB 5B66H 3O6QA 3L74D 1ZW0A 3PRJA 1PZQA 1KQLA 2O01H 3V4WA 2JR8A 3A0BH 3JSVC 5APVA 2KS1A 1YTZT 2YMYA 3AE5C 2WPVB 3TGUD 1L4AC 2WPRA 3CX5D 1SQBD 1LTGC 2FY8A 2IYOA 1KFNA 1BE3E 1S5LX 1SQVJ 3CCUP 3S4RA 4IL6X 1T3UA 3TSIA 1LWUB 3KQGA 3U59A 1VQLP 3H1IE 4BWNA 1ZRTE 4XFJA 4LGDE 5H2FH 1GW3A 2MJZA 3KHUA 4HH2A 1SQXD 3AE3C 4D6TD 2JJLA 1EQ7A 3BCCE 3L73J 2CPBA 2M5AA 3N7NA 2YMKA 1N73A 3MZWB 2OTKE 2FYNB 1N8RQ 1HWTC 2Q7CA 4EYYQ 1U7JA 1VQ9P 1GL2B 2Z5IA 2C0XA 1L4AD 3TF5A 3LW5H 1RF1A 3CMAP 3G9RA 3CD6P 1W2EA 2E76C 2D2CB 1N86A 1DH3A 1ZMEC 4WVZA 1HGVA 1LTJB 4RKUJ 2UWJE 1SQPJ 1VQNP 1J1EC 3FX0A 4C7RA 3C9IA 3RL0B 5AW1B 1JNMA 2Q3IA 1M1JB 2O1KA 3OW2O 1FC2C 3CXHI 1J2JB 2WSCJ 4XE5B 1QL1A 1SQVD 1QLED 1PGJA 5AVYB 1T2KD 3GW6A 4PD4H 1AVYA 1JY2P 1SQQK 2E76D 1NTKE 1LWUC 1HUCA 4H0LB 4B86A 1NTZK 1SP4A 1L0NE 1AVOA 2XZRA 2WT7B 4GKGA 3VTPC 2H8PD 2OYIB 1FDOA 1KILD 2QSIA 4WBAA 3D6ZA 2WQYC 5C39A 3JCUH 1RY3A 5CCGA 4WWIA 4Z1MH 2FYNC 1KZUB 2ZJSE 3Q5PA 4WB4A 1FZCA 3RK2B 3GHGB 3GF7A 2B89A 1JM0A 1K04A 3AE4C 1SQPD 2IX7C 1S9KE 4ASWA 1U57A 1DX7A 1NVOA 2D2CC 2E42A 3FXDA 3R4YA 2KOGA 1JY2N 1LTJC 1OXZA 1KYOD 2ZAEB 4RJTA 2Q1KA 3RL0C 3USSA 2FYUK 1M1JC 2PAJA 1NYHA 1S3JA 4K35A 1IK9A 3KDPB 1K73Q 2RMZA 1M7LA 1JUNA 3L73E 1JMBA 2K37A 4EDFA 2V7QH 2C9LY 4I2LC 3A3YB 1QEXA 4IFFA 1NO4A 1WMKA 3VMZA 4UB6E 1KB9E 1JY2O 3CCQP 2WSEH 4H0LC 1H0TB 2IDBA 2YKPA 2FYZA 2E5TA 4C46A 5KKZB 3EFGA 3LIEA 2OYIC 1BCCG 3L75D 1P84D 3PJSK 2YO3A 1EZVI 4C7NB 2YIUB 3AEFC 2OTLP 4PV1B 3OAKA 5TISE 1KD1Q 4W7YA 2HG5D 3GHGC 1OWAA 2I1JA 2WWWA 4M3LA 1YJ9P 1OFCX 2CK3H 3G4SP 1R8EA 1LTSC 1KN7A 1J1DB 1G2CB 1SFCB 1QL2A 2AEJA 1GD2E 1KORA 4H0LD 2DW3A 3HRNA 3A0BE 4KJMA 3KZIE 4AQRD 1URQB 1K9MQ 5APXA 1KILA 3P8CE 2JDIH 1NU1D 2G3AA 5CJ0A 4OH8B 2NRGA 3CCSP 4YXWH 1VDFA 3H32A 3CX5H 3E1IA 3L71G 1YIJP 4I7ZB 1IC2A 3RK3B 2ZVNB 4WY4B 5AW8B 4YTPC 4ZMDA 1LTBC 5B5EE 1PPJD 1BCCJ 1ZLLA 4CPGA 1LWUA 4PJ0H 2YKQA 1BE3J 1NGMB 5AW0B 4PD4I 5KKZC 1VQ4P 2KNCA 4W80A 2E75B 5KTBA 3ZDMA 1AJYA 2G8YA 1PGPA 3AEBC 3H1IJ 1L2PA 2YIUC 3HTKA 3H1KG 4PV1C 2ZXXA 3H6PA 1N7SD 4ASVA 1HJ0A 2R5BA 5E79H 3BCCJ 3CXHH 1IZNB 3IF4A 2IZ0A 5AW4B 2R3CA 2XNXA 5AVXB 2C0WA 2M8RA 5KAFH 1S5LE 1J1DC 1Q82Q 1X9VA 1NAYA 1HF9A 1URQC 2FFDA 3S9OA 1XTGB 3ABVC 3M91A 4L75A 2XKMA 3IFMA 3A0HH 4PV1D 2QEXP 5AW2B 5KAIH 1T8ZA 1RE4C 3UIAA 2M0BA 3M9HA 2HYNA 1JO5A 3HD7D 4I7ZC 3U1AA 1BE3D 4WY4C 2BEZF 2W90A 4IOIH 2QA4P 1YI2P 1JY3P 1QGKB 3P7KA 1NJIQ 1Q90D 1Q2NA 4HYTB 3CC2P 2QG4A 1FZEA 3H1ID 1ZRTD 3MTUE 3HUSA 4Y99B 3W67A 3H1KJ 4DT0A 2OYIA 2HPCB 2IBZI 3CMEP 1NTKJ 3BCCD 3CCMP 1BSNA 1L0NJ 2WMMA 2H7HA
chains in the Genus database with same CATH topology
4W7ZA 2YKOA 3HE4A 1HJBA 5APUA 2Q3IA 1M1JB 2O1KA 1AFOA 1GZLA 3BASA 3B8EB 5KJ7D 1J2JB 3MUDA 1GW4A 1MV8A 4XE5B 1QL1A 2GUVA 4WY4D 2WTYA 1JTHB 1WRGA 3EQ2A 1FZCB 1SVFA 1GL2A 4KHXA 1N73B 5CMZA 5AVYB 1T2KD 3CI9A 1RE3A 2R5DA 1JY3N 3HE5B 4C7RA 2CPSA 4N78E 3BRTB 1PFIA 3HUSC 1NOHA 4N6JA 2QM8A 4DZOA 1JY2P 3O8ZA 1FDMA 1LGHB 1SQQK 3B5NB 1LWUC 1HUCA 2HPCA 1SFCC 2NPSB 4B86A 1NTZK 1SP4A 3V5BA 1LTJA 2XZRA 3TK1A 4GKGA 2WT7B 2Z5HA 3VTPC 3A5TA 2H8PD 1CW5A 2OYIB 1N7SA 1KILD 4WBAA 2H43A 3II6A 1M1JA 3HD7B 1NU1K 5CCHD 2LKMA 1YYCA 3VMYA 2KP8A 1RY3A 2W27A 1IFJA 5CCGA 3CL3D 1GTWA 1NAFA 3A7OA 3PP5A 3TYYA 1JOCA 4N78D 1KZUB 2IPPA 3TNUB 4WB4A 1JTHA 1FZCA 3RK2B 2YNYA 5CJ4A 1JY3O 3GHGB 3V2PA 3HE5A 5AVTB 3RK3C 2IX7C 1S9KE 1KFMA 4Y99C 2WZ7A 5APYA 2GUSA 1DX7A 2HFED 2E42A 2KOGA 1IFMA 3B5NA 3SWFA 2NPSA 3VP8A 1JY2N 1SFCD 1LTJC 1OXZA 1NTMK 1LTAC 2WPQA 1WT6A 2J58A 2WT7A 1N7SC 2HODB 3MIWA 3R2PA 3RL0C 1URQD 5KLVK 5AW3B 1L0LK 1NHLA 2O1JA 2FYUK 4RESB 1LT9B 1H89A 3KYQA 1M1JC 2PAJA 2XU6A 3HD7A 3SWYA 1MUUA 5CCGC 1FZAA 3OA7A 2J59M 1IK9A 1MFZA 3KDPB 5AVWB 1M7LA 3P32A 3VN0A 1T3JA 1JUNA 1S9KD 1ZR2A 3CLQA 3TNUA 2A45H 1FZCC 3VOPA 1N73C 2KLVA 5AVZB 3OJAB 5BU8B 3BRVB 3GHGA 1JCDA 2P67A 1JMMA 1ZN5A 1HVVA 4ZKPA 3VMXA 2C9LY 3M9QA 4I2LC 4I6MC 4IFDK 2HLOA 3RK3D 3A3YB 1FJPA 3P8MC 5AW6B 4IFFA 1NO4A 3VMZA 2WSFH 1JY2O 3B5NC 2WSEH 2BASA 1SQBK 2YKPA 1RF1C 1SLQA 1H88A 2XV5A 2WSCH 5AVRB 2FYZA 4N3YB 1H8AA 1CI6B 1X8YA 4C46A 1KILB 2R32A 3EFGA 1FAVA 3L37A 3LIEA 2ZXEB 2OYIC 1IO4A 1AQ5A 2HODA 4IFMA 1CSBA 1IFNA 3L36A 2N1TB 3T97A 1DEBA 1RF0A 1LT9A 3MD0A 1HH0A 2I1KA 1YTZI 3HD7C 5KJ7A 2YO3A 2POHA 4C7NB 2Q9IA 5AVUB 4EIJA 5APWA 5CCGD 1X79B 3OAKA 1HTLC 3A2AA 1G1IA 3H32B 1SQXK 1NKNA 4W7YA 4I1LA 1G1JA 2HG5D 5BVZA 1A02J 3GHGC 1OWAA 2I1JA 2WWWA 4M3LA 3NFQA 3KPEA 3MGNA 1L4AB 1FZFA 1FOSF 1GL2C 3L35A 3M9BA 1LTIC 1HGZA 1LTSC 2QM7A 4GT1A 3G3ZA 1J1DB 4EOTA 1IFDA 1G2CB 1RE3C 1SFCB 1QL2A 1ZR4A 3B5ND 1GD2E 2ZFCA 3HRNA 2OYHB 2KSJA 4JF7A 2Z4EA 5APSA 4AQRD 1URQB 2P7JA 5APQA 1CI6A 5APXA 3M0DA 1KILA 2GM4A 3P8CE 1FZBA 1LT9C 2N1TA 2WPSA 5CCHA 5CJ0A 4OH8B 2L5GB 4C7NA 3HTKB 4DOJA 3V4QA 4O9BA 1GDTA 1VPCA 1VDFA 3H32A 3E1IA 1T2KC 2FXMA 1LTTC 1FU1A 1A02F 2P2UA 3M0AA 1N2DC 3V2QA 3N4XA 2IFMA 1IC2A 1MZ9A 3RK3B 4WY4B 5AW8B 3VP9A 3BATA 2KB7P 2WITA 1LTBC 3I5CA 1L4AA 1GU5A 1SQVK 1GK6A 1GL2D 3P8CD 2YO2A 2W6AA 3LIDA 1ZLLA 1ZV8A 1LWUA 1G2CA 1SFCA 5AVSB 3NMDA 2YKQA 1FZGA 5APTA 2OYHA 4LC1A 3V2RA 3WMM0 5AW0B 2FFDB 3M0DC 1KILC 1URQA 4XA4A 4W80A 2N1TC 5CCHC 4LLHA 5KTBA 1FJKA 2KYVA 2NPSC 5AW7B 2E43A 1J1EB 2IFNA 3HTKA 2A45G 2VRSA 5CHXA 3H6PA 1N7SD 3RL0D 4JYBA 3U1CA 2R5BA 1KQLA 2FKWB 2O01H 4AUWA 4JYCA 3V4WA 2XDJA 5AW9B 1GK4A 1RE4A 2P1JA 5APVA 1YTZT 2YMYA 4WY4A 2PP6A 1L4AC 5AW4B 2R3CA 2WPRA 2XNXA 2C9NY 5AVXB 3RK2C 2C0WA 2M8RA 1J1DC 1E5WA 1RF1B 1NH4A 1N7LA 1LTGC 1NWQA 3M06A 1X9VA 1KFNA 5AW5B 1NTKK 2OYHC 3HUSB 1FOSE 2OARA 1URQC 1L0NK 1NKZB 1SQPK 2FFDA 3L4FA 1FBMA 1T3UA 1XTGB 3M91A 3TSIA 4AYCA 1LWUB 3KQGA 3U59A 2N1TD 2N9BA 1IJDB 2NPSD 1JCCA 3NXSA 4LGDE 2XKMA 3BVHA 3IFMA 1GW3A 2MJZA 4HH2A 3HE4B 1HBWA 5AW2B 1T8ZA 2JJLA 1RF0C 1EQ7A 1RE4C 2CPBA 5KJ7C 5BU5A 3UIAA 3N7NA 3M9HA 1N73A 2HYNA 3IR9A 1JO5A 2W6BA 2M3BA 3HD7D 1CZQA 5AVQB 1HWTC 3U1AA 2Q7CA 1GU4A 4WY4C 2A45I 1GL2B 1JY3P 1IFIA 1XTCC 2Z5IA 2C0XA 4ZKUA 1L4AD 3NTNA 3P7KA 3LW5H 3RK2D 5AVVB 1Z56A 4HYTB 1RF1A 1FZEA 3MTUE 3HUSA 4Y99B 1W2EA 2FFDC 4GIFA 2OYIA 1N86A 3VYIA 1DH3A 2HPCB 3V2NA 2JEEA 1HGVA 2Q5UA 1LTJB 1J1EC 1N7SB 2H7HA 3C9IA 3RL0B 5AW1B 1JNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJB A;  1FOS F;  3HE4 A;  3L35 A;  5APU A;  3M9B A;  2Q3I A;  1OXZ A;  5APV A;  2QM7 A;  4GT1 A;  1GZL A;  2WPQ A;  4EOT A;  1G2C B;  2WT7 A;  3B8E B;  1J2J B;  1GD2 E;  2ZFC A;  5AW4 B;  5AW3 B;  2R3C A;  2WPR A;  2C9N Y;  4RES B;  5AVX B;  1H89 A;  1MV8 A;  5APS A;  4AQR D;  2P7J A;  2XU6 A;  4XE5 B;  5APQ A;  1CI6 A;  5APX A;  3M0D A;  1NWQ A;  2WTY A;  1MUU A;  3M06 A;  5AW5 B;  1MFZ A;  3KDP B;  4KHX A;  1FOS E;  5CMZ A;  5AVW B;  3P32 A;  5AVY B;  3VN0 A;  2WPS A;  1T2K D;  1JUN A;  2R5D A;  1S9K D;  3HE5 B;  4C7N A;  3TNU A;  3M91 A;  4AYC A;  3V4Q A;  5AVZ B;  3KQG A;  2QM8 A;  2P67 A;  2N9B A;  4DZO A;  3O8Z A;  3NXS A;  3VMX A;  2C9L Y;  1T2K C;  4I2L C;  1HUC A;  4I6M C;  4B86 A;  3HE4 B;  1SP4 A;  2P2U A;  3A3Y B;  3M0A A;  3P8M C;  5AW2 B;  1A02 F;  3V5B A;  1HBW A;  5AW6 B;  2JJL A;  3VMZ A;  2XZR A;  5AW8 B;  3TK1 A;  4GKG A;  3UIA A;  2WT7 B;  2Z5H A;  3VTP C;  2BAS A;  3M9H A;  3A5T A;  1SLQ A;  3IR9 A;  1H88 A;  2XV5 A;  5AVR B;  1CZQ A;  3I5C A;  1GU5 A;  1GK6 A;  5AVQ B;  1HWT C;  1GU4 A;  2Q7C A;  2YO2 A;  2W6A A;  3LID A;  1H8A A;  1CI6 B;  1X8Y A;  4C46 A;  2R32 A;  3SWF A;  1FAV A;  3L37 A;  1YYC A;  2ZXE B;  3LIE A;  2KP8 A;  3VMY A;  1IO4 A;  5AVS B;  3NMD A;  1CSB A;  2W27 A;  3L36 A;  2Z5I A;  3T97 A;  1GTW A;  1NAF A;  5APT A;  3A7O A;  3NTN A;  3TYY A;  4LC1 A;  3P7K A;  3MD0 A;  5AW0 B;  2IPP A;  2YO3 A;  5AVV B;  4C7N B;  4HYT B;  3TNU B;  5AVU B;  2YNY A;  5APW A;  3OAK A;  3A2A A;  5AW7 B;  3VYI A;  3HE5 A;  1DH3 A;  2E43 A;  3HTK A;  5AVT B;  1S9K E;  1A02 J;  1OWA A;  2VRS A;  2Q5U A;  5APY A;  4JYB A;  4AUW A;  2R5B A;  1KQL A;  2WWW A;  4M3L A;  2E42 A;  4JYC A;  3V4W A;  3NFQ A;  5AW9 B;  1GK4 A;  2H7H A;  3MGN A;  5AW1 B;  1JNM A; 
#chains in the Genus database with same CATH topology
 4W7Z A;  1HJB A;  3HE4 A;  5APU A;  1OIP A;  1Q7Y Q;  2Y9Y A;  1GW4 A;  2QJP B;  1MV8 A;  2A06 G;  4WY4 D;  3FWN A;  1SVF A;  2W6J H;  4KHX A;  3WU2 H;  1JY3 N;  2CPS A;  4R4L A;  1KQF B;  1KYO H;  3QWO C;  3E7K A;  3CC4 P;  4DZO A;  1LT1 A;  1BCC E;  3B5N B;  3AED C;  3PLN A;  2NPS B;  2RKL A;  2KZJ A;  3A5T A;  4H44 C;  1DD3 A;  4L76 A;  1N7S A;  2ZYG A;  2FBW C;  2L91 A;  1M57 D;  3II6 A;  1YYC A;  2Y9Z A;  1OW7 A;  1NAF A;  2BCC G;  1IK7 A;  3SWK A;  3TNU B;  3CX5 I;  1JTH A;  2YNY A;  1JY3 O;  1W5C E;  3IAO A;  3L72 G;  1NTK D;  4KT0 J;  2OYO A;  1W2B O;  3HE5 A;  1Y9B A;  1L0N D;  5AVT B;  4DCK A;  4Y99 C;  1M90 Q;  2QJK B;  3MHV A;  4H13 B;  2PGD A;  1NTM K;  3AE2 C;  3RK3 E;  1LTA C;  2WPQ A;  1WT6 A;  2J58 A;  2HOD B;  5KLV K;  1L0L K;  4H44 D;  3EWK A;  3L71 E;  3HD7 A;  3JC2 2;  3CWB E;  3P32 A;  1OX3 A;  4R4M A;  1S9K D;  2A45 H;  5AVZ B;  3OJA B;  1FS0 E;  5BU8 B;  2P67 A;  1VQ5 P;  2B87 B;  1KTM A;  3M9Q A;  4I6M C;  2HLO A;  2M3E A;  3P8M C;  2O01 J;  4BRY B;  3B5N C;  1SQB K;  1SLQ A;  2XV5 A;  5AVR B;  1LP1 A;  4N3Y B;  1KV4 A;  3H1K E;  1SQQ E;  2P58 A;  4EI2 A;  4IFM A;  1NTZ E;  1IFN A;  3AE6 C;  2N1T B;  3L73 D;  1LT9 A;  3MD0 A;  1HH0 A;  1YQ3 C;  3L72 J;  1PIX A;  2QE7 H;  1X79 B;  1E79 H;  3H1L G;  1G1I A;  1SQX K;  1NKN A;  5BVZ A;  2LR2 A;  3I56 P;  1D7M A;  1KB9 D;  1ZOY C;  3GG2 A;  3D6Y A;  1AV1 A;  1FZF A;  1GL2 C;  5E79 E;  2QJK C;  1HGZ A;  2K88 A;  2IYP A;  3G3Z A;  4EOT A;  1IFD A;  3CXH E;  4H13 C;  3B5N D;  3Q1M A;  2ZFC A;  2OYH B;  2KSJ A;  2Z4E A;  2P7J A;  1Y8A A;  2PFX A;  1CI6 A;  3M0D A;  1K05 A;  2GM4 A;  3RBX A;  2FXO A;  1FZB A;  1X22 A;  2WPS A;  3LW5 J;  2KZI A;  4GOD A;  4L74 A;  4DOJ A;  1VL2 A;  3O6Q B;  2P10 A;  2FYU E;  1VPC A;  3AE1 C;  1U7M A;  3T97 B;  1PGQ A;  5GTH H;  2ZVO B;  1LJ2 A;  2H89 C;  1R5S A;  2K9J A;  1N2D C;  3TDK A;  2KS1 B;  2IFM A;  3L70 G;  3BAT A;  5KAI E;  2KB7 P;  3RGU A;  1VQ7 P;  3I5C A;  1L4A A;  1SQV K;  1PP9 G;  1GL2 D;  3P8C D;  4GDO A;  2W6A A;  3LID A;  2B9B A;  1TU3 F;  1M56 D;  5AVS B;  4H13 D;  5APT A;  1KYO I;  3WMM 0;  2K9Y A;  4XA4 A;  4OWF A;  1OMI A;  2N1T C;  2D2C D;  5CCH C;  4LLH A;  1AA0 A;  2NZ2 A;  3WUU A;  3Q3D A;  1JEK A;  2IFN A;  3SSU A;  2QRX A;  2VRS A;  2A06 E;  4UB8 E;  3RL0 D;  4JYB A;  1YJN P;  2M5A B;  4JYC A;  1GK4 A;  3AEG C;  1KMI Z;  1EDI A;  2Y0D A;  1QVF O;  1BDC A;  2IBZ G;  2C9N Y;  3RK2 C;  3EFF K;  1E5W A;  1RF1 B;  1NH4 A;  1N7L A;  1PGO A;  3M06 A;  5B66 E;  5AW5 B;  1YIT P;  3K5B A;  2OYH C;  3H1H G;  1FOS E;  1NKZ B;  3CCR P;  1SQP K;  2JWA A;  3L4F A;  1Q86 Q;  1FBM A;  4AYC A;  1P84 I;  3WU2 E;  1S1C X;  4QMA A;  4TT3 H;  2K1A A;  2N1T D;  2N9B A;  1IJD B;  3NXS A;  2ZYD A;  3BVH A;  4U7J A;  2BCC E;  1HBW A;  1UIX A;  3L70 J;  2YXR B;  1RF0 C;  1NTM G;  5KJ7 C;  5BU5 A;  2KLU A;  2JWD A;  3IR9 A;  3WUT A;  3L72 E;  1GU4 A;  2A45 I;  4ZKU A;  3RK2 D;  1EZV E;  3CWB G;  3L74 G;  5H2F E;  3F5H A;  1EXI A;  4GIF A;  3V2N A;  4HB1 A;  2JEE A;  2E74 B;  2Q5U A;  3TGU G;  1DD4 A;  3L75 E;  3RL0 g;  1AFO A;  2WSE J;  3B8E B;  5KJ7 D;  2SPZ A;  1SQQ G;  1NTZ G;  2GUV A;  2WTY A;  4L73 A;  1WRG A;  1FZC B;  3FWL A;  5L8R J;  1GL2 A;  5CMZ A;  2Y0C A;  3CI9 A;  2R5D A;  1SQX G;  4N78 E;  1DIP A;  1PFI A;  4D6T G;  1NOH A;  2QM8 A;  3B71 A;  2W8Z A;  1LGH B;  1SFC C;  3V5B A;  1LTJ A;  2AEM A;  3D71 A;  3H1L E;  1QVG O;  2AEF A;  3CCJ P;  1RQV A;  2H43 A;  1PL5 A;  1M1J A;  3L71 J;  1NU1 K;  2LKM A;  3I55 P;  3VMY A;  2Y0E A;  2W27 A;  3CWB J;  3H1J E;  3A7O A;  4PD4 E;  3H25 A;  5GTI H;  2W83 C;  4YPC A;  3GMA A;  1BCC D;  4BRY A;  3V2P A;  2FYU G;  1X0T A;  3RK3 C;  1KFM A;  2GUS A;  3AE7 C;  3Q5S A;  3JCU E;  5CBO A;  3MP7 B;  2E74 C;  3SWF A;  2Q6Q A;  1SFC D;  1SQV G;  2GA1 A;  2WT7 A;  1SQQ J;  3MIW A;  1URQ D;  5AW3 B;  2O1J A;  4RES B;  1NTZ J;  3ITK A;  2B88 A;  2E75 C;  2XU6 A;  1KB9 H;  1ZXG A;  1MUU A;  5CCG C;  3OA7 A;  1FE6 A;  1MFZ A;  2FXP A;  1SQX J;  3L70 E;  4D6T J;  1ZR2 A;  3CLQ A;  1FZC C;  3E1R A;  2WSF J;  2KLV A;  1PP9 E;  1VF5 B;  3GHG A;  4ZKP A;  3FXE A;  5TJH A;  4HKZ H;  3RK3 D;  1FJP A;  2E76 B;  5TIS H;  5GTH E;  3W68 A;  2IZ1 A;  2BAS A;  1H88 A;  3L71 D;  3PTZ A;  2WSC H;  2E74 D;  4OGQ B;  3GF3 A;  3CWB D;  1H8A A;  3CPW O;  1X8Y A;  1KIL B;  2R32 A;  1IO4 A;  2ZXE B;  1AQ5 A;  2AXT H;  1CSB A;  3T97 A;  1DEB A;  1RF0 A;  5KJ7 A;  2POH A;  1SQP G;  2E75 D;  2OGU A;  5AVU B;  2Q9I A;  3CCE P;  3AEC C;  5CCG D;  2FYU J;  3KZI H;  1HTL C;  3A2A A;  3H32 B;  1ZP0 C;  1G1J A;  2IBZ E;  1M1K Q;  1A02 J;  3MUD C;  1UII A;  3NFQ A;  3H1H E;  4JBZ A;  5EFW B;  3H1K D;  1SQQ D;  1FOS F;  4U3F E;  3L35 A;  2QM7 A;  4GT1 A;  1NTZ D;  1Q81 Q;  1RE3 C;  1H0T A;  4BXL A;  3SFD C;  2KNC B;  3G71 P;  4JPZ B;  1EZV G;  1P84 H;  5B5E H;  1BGY E;  1NTM E;  2RH0 A;  4C7N A;  3HTK B;  3QH9 A;  5KLV E;  1IFP A;  1L0L E;  3V4Q A;  1GDT A;  3RBZ A;  5K5G B;  2KI7 B;  1GMJ A;  2WVR A;  1T2K C;  2FXM A;  3Q5R A;  1MFT A;  1LTT C;  1VF5 C;  1FU1 A;  2P2U A;  3CXH D;  3L74 E;  3N4X A;  3V6I A;  1RHZ B;  2QJP C;  4GOE A;  3L75 G;  1FDI A;  2YO2 A;  1M8O B;  1G2C A;  1SFC A;  1FZG A;  4OGQ C;  3V2R A;  3TGU E;  2FFD B;  2LXB A;  1SS1 A;  1KIL C;  1URQ A;  2FYU D;  3CX5 E;  1SQB E;  5DJU B;  1QX8 A;  2KYV A;  2NPS C;  1S5L H;  4NPD A;  1EDL A;  2E43 A;  4K3A A;  2A45 G;  4IL6 H;  1EC5 A;  5CHX A;  2BCC J;  1S4X A;  3U1C A;  4AUW A;  2FKW B;  2XDJ A;  5AW9 B;  1RE4 A;  2OTJ P;  4PJ0 E;  2P1J A;  1VF5 D;  3C1L A;  1SQX E;  4D6T E;  4WY4 A;  1NU1 G;  2PP6 A;  1VQ6 P;  2LXC B;  4JQ0 D;  1NWQ A;  3H1J G;  1NTK K;  3HUS B;  2OAR A;  2ZT9 B;  1L0N K;  3FGA D;  4OGQ D;  2A06 D;  3IN6 A;  2O3J A;  2NPS D;  1JCC A;  1PV3 A;  2KUB A;  1PPJ G;  3HE4 B;  5KAF E;  3L75 J;  1VQK P;  1KB9 I;  1BDD A;  2W6B A;  2M3B A;  1CZQ A;  5AVQ B;  1IFI A;  1XTC C;  3NTN A;  1VQO P;  5AVV B;  1Z56 A;  2QIW A;  4NPE A;  3SFE C;  1OVR A;  3A0H E;  1SQV E;  2E5Y A;  2FFD C;  2BCC D;  5GTI E;  3F89 A;  3VYI A;  4YXD C;  5CBN A;  3L72 D;  3CCL P;  1N7S B;  2YKO A;  1NU1 J;  3H1L J;  1GZL A;  3S1K A;  3WUV A;  3BAS A;  2MKV A;  3MUD A;  1EZV D;  1YJW P;  2JKV A;  3H1J J;  1KIL E;  4Y28 J;  1JTH B;  3EQ2 A;  2K3R A;  1N73 B;  1RE3 A;  3HE5 B;  3BRT B;  2YXQ B;  3HUS C;  4N6J A;  2ZT9 C;  3O8Z A;  1FDM A;  1USE A;  3AE8 C;  2ITA A;  3CCV P;  2HPC A;  1EDK A;  1BE3 G;  1SQP E;  1T6A A;  2O01 N;  2KIK A;  3TK1 A;  2BEQ D;  2Z5H A;  1CW5 A;  4U3F G;  4ZNC A;  3PH0 A;  5M1B A;  2N9Y B;  3H1I G;  3HD7 B;  5CCH D;  2KP8 A;  2KXP B;  2HR3 A;  1IFJ A;  1KYO E;  3CL3 D;  1GTW A;  4RO0 A;  3PP5 A;  3TYY A;  1JOC A;  4N78 D;  2IPP A;  2AXT E;  3C8V A;  1EDJ A;  2V4H A;  1OVV A;  3BCC G;  1BGY G;  5CJ4 A;  2JO1 A;  1PP9 J;  4MN4 C;  3Q2Y A;  5KLV G;  1VQP P;  1L0L G;  1OW6 A;  2R44 A;  2WZ7 A;  5APY A;  3KXD A;  2ZT9 D;  2HFE D;  2RN0 A;  3H1L D;  1LNQ A;  1IFM A;  3B5N A;  3AEE C;  2NPS A;  1LP1 B;  3VP8 A;  2KSE A;  3H1J D;  1N7S C;  1VQM P;  1VQ8 P;  3R2P A;  2WSS H;  4PD4 D;  4TLF A;  1NHL A;  3CC7 P;  1H89 A;  1LT9 B;  3KYQ A;  1YBK A;  2V7Q J;  3SWY A;  1FZA A;  2J59 M;  5AVW B;  3VN0 A;  1SQB G;  2J5U A;  1T3J A;  1Y47 A;  3TNU A;  1P84 E;  3VOP A;  1EXJ A;  3D70 A;  1N73 C;  3BRV B;  3PHL A;  1JCD A;  1JMM A;  1ZN5 A;  1HVV A;  3VMX A;  4HJG H;  1BSH A;  4IFD K;  3H1H J;  2I8D A;  2PRR A;  1RH5 B;  5AW6 B;  4U3F J;  4OVN F;  2WSF H;  1RF1 C;  2Q3E A;  5KLI B;  2AXC A;  1CI6 B;  2QJY B;  1FAV A;  3L37 A;  2HOD A;  3L70 D;  3L36 A;  1NTK G;  2I1K A;  1YTZ I;  3HD7 C;  1BGY J;  1L0N G;  1NTM J;  1PP9 D;  2R3S A;  4EIJ A;  2QVA A;  5APW A;  5KLV J;  1L0L J;  1NU1 E;  4I1L A;  1KQS O;  3AE9 C;  1KC8 Q;  2K9J B;  1JB0 J;  2B87 A;  4IL6 E;  3L74 J;  2JP3 A;  1OZH A;  2ZYA A;  1K8A Q;  3KPE A;  4A7P A;  3MGN A;  1YQ4 C;  1L4A B;  3M9B A;  1LTI C;  5DJT B;  1ZR4 A;  4JF7 A;  5APS A;  1S72 P;  5APQ A;  4H44 B;  3TGU J;  1PPJ E;  1SQB J;  3B4S A;  1LT9 C;  2N1T A;  2KK7 A;  5CCH A;  2IBZ D;  2L5G B;  1R5L A;  4O9B A;  3H1H D;  4DJG A;  4U3F D;  3G6E P;  2OQQ A;  4UB6 H;  1A02 F;  1OW8 A;  3M0A A;  3V2Q A;  2H88 C;  1MZ9 A;  1AQT A;  1S2E A;  3VP9 A;  3L73 G;  2WIT A;  4UB8 H;  1OVU A;  1GU5 A;  1GK6 A;  1ZV8 A;  4NPF X;  1KQG B;  1BGY D;  3NMD A;  1NTM D;  5KLI C;  1DEE G;  2XND H;  2OYH A;  1USD A;  4LC1 A;  5KLV D;  1L0L D;  3M0D C;  1RQU A;  3GLM A;  2QJY C;  3VMA A;  4GOF A;  3AEA C;  1FJK A;  1MKM A;  1YHQ P;  5AW7 B;  1J1E B;  5B66 H;  3O6Q A;  3L74 D;  1ZW0 A;  3PRJ A;  1PZQ A;  1KQL A;  2O01 H;  3V4W A;  2JR8 A;  3A0B H;  3JSV C;  5APV A;  2KS1 A;  1YTZ T;  2YMY A;  3AE5 C;  2WPV B;  3TGU D;  1L4A C;  2WPR A;  3CX5 D;  1SQB D;  1LTG C;  2FY8 A;  2IYO A;  1KFN A;  1BE3 E;  1S5L X;  1SQV J;  3CCU P;  3S4R A;  4IL6 X;  1T3U A;  3TSI A;  1LWU B;  3KQG A;  3U59 A;  1VQL P;  3H1I E;  4BWN A;  1ZRT E;  4XFJ A;  4LGD E;  5H2F H;  1GW3 A;  2MJZ A;  3KHU A;  4HH2 A;  1SQX D;  3AE3 C;  4D6T D;  2JJL A;  1EQ7 A;  3BCC E;  3L73 J;  2CPB A;  2M5A A;  3N7N A;  2YMK A;  1N73 A;  3MZW B;  2OTK E;  2FYN B;  1N8R Q;  1HWT C;  2Q7C A;  4EYY Q;  1U7J A;  1VQ9 P;  1GL2 B;  2Z5I A;  2C0X A;  1L4A D;  3TF5 A;  3LW5 H;  1RF1 A;  3CMA P;  3G9R A;  3CD6 P;  1W2E A;  2E76 C;  2D2C B;  1N86 A;  1DH3 A;  1ZME C;  4WVZ A;  1HGV A;  1LTJ B;  4RKU J;  2UWJ E;  1SQP J;  1VQN P;  1J1E C;  3FX0 A;  4C7R A;  3C9I A;  3RL0 B;  5AW1 B;  1JNM A;  2Q3I A;  1M1J B;  2O1K A;  3OW2 O;  1FC2 C;  3CXH I;  1J2J B;  2WSC J;  4XE5 B;  1QL1 A;  1SQV D;  1QLE D;  1PGJ A;  5AVY B;  1T2K D;  3GW6 A;  4PD4 H;  1AVY A;  1JY2 P;  1SQQ K;  2E76 D;  1NTK E;  1LWU C;  1HUC A;  4H0L B;  4B86 A;  1NTZ K;  1SP4 A;  1L0N E;  1AVO A;  2XZR A;  2WT7 B;  4GKG A;  3VTP C;  2H8P D;  2OYI B;  1FDO A;  1KIL D;  2QSI A;  4WBA A;  3D6Z A;  2WQY C;  5C39 A;  3JCU H;  1RY3 A;  5CCG A;  4WWI A;  4Z1M H;  2FYN C;  1KZU B;  2ZJS E;  3Q5P A;  4WB4 A;  1FZC A;  3RK2 B;  3GHG B;  3GF7 A;  2B89 A;  1JM0 A;  1K04 A;  3AE4 C;  1SQP D;  2IX7 C;  1S9K E;  4ASW A;  1U57 A;  1DX7 A;  1NVO A;  2D2C C;  2E42 A;  3FXD A;  3R4Y A;  2KOG A;  1JY2 N;  1LTJ C;  1OXZ A;  1KYO D;  2ZAE B;  4RJT A;  2Q1K A;  3RL0 C;  3USS A;  2FYU K;  1M1J C;  2PAJ A;  1NYH A;  1S3J A;  4K35 A;  1IK9 A;  3KDP B;  1K73 Q;  2RMZ A;  1M7L A;  1JUN A;  3L73 E;  1JMB A;  2K37 A;  4EDF A;  2V7Q H;  2C9L Y;  4I2L C;  3A3Y B;  1QEX A;  4IFF A;  1NO4 A;  1WMK A;  3VMZ A;  4UB6 E;  1KB9 E;  1JY2 O;  3CCQ P;  2WSE H;  4H0L C;  1H0T B;  2IDB A;  2YKP A;  2FYZ A;  2E5T A;  4C46 A;  5KKZ B;  3EFG A;  3LIE A;  2OYI C;  1BCC G;  3L75 D;  1P84 D;  3PJS K;  2YO3 A;  1EZV I;  4C7N B;  2YIU B;  3AEF C;  2OTL P;  4PV1 B;  3OAK A;  5TIS E;  1KD1 Q;  4W7Y A;  2HG5 D;  3GHG C;  1OWA A;  2I1J A;  2WWW A;  4M3L A;  1YJ9 P;  1OFC X;  2CK3 H;  3G4S P;  1R8E A;  1LTS C;  1KN7 A;  1J1D B;  1G2C B;  1SFC B;  1QL2 A;  2AEJ A;  1GD2 E;  1KOR A;  4H0L D;  2DW3 A;  3HRN A;  3A0B E;  4KJM A;  3KZI E;  4AQR D;  1URQ B;  1K9M Q;  5APX A;  1KIL A;  3P8C E;  2JDI H;  1NU1 D;  2G3A A;  5CJ0 A;  4OH8 B;  2NRG A;  3CCS P;  4YXW H;  1VDF A;  3H32 A;  3CX5 H;  3E1I A;  3L71 G;  1YIJ P;  4I7Z B;  1IC2 A;  3RK3 B;  2ZVN B;  4WY4 B;  5AW8 B;  4YTP C;  4ZMD A;  1LTB C;  5B5E E;  1PPJ D;  1BCC J;  1ZLL A;  4CPG A;  1LWU A;  4PJ0 H;  2YKQ A;  1BE3 J;  1NGM B;  5AW0 B;  4PD4 I;  5KKZ C;  1VQ4 P;  2KNC A;  4W80 A;  2E75 B;  5KTB A;  3ZDM A;  1AJY A;  2G8Y A;  1PGP A;  3AEB C;  3H1I J;  1L2P A;  2YIU C;  3HTK A;  3H1K G;  4PV1 C;  2ZXX A;  3H6P A;  1N7S D;  4ASV A;  1HJ0 A;  2R5B A;  5E79 H;  3BCC J;  3CXH H;  1IZN B;  3IF4 A;  2IZ0 A;  5AW4 B;  2R3C A;  2XNX A;  5AVX B;  2C0W A;  2M8R A;  5KAF H;  1S5L E;  1J1D C;  1Q82 Q;  1X9V A;  1NAY A;  1HF9 A;  1URQ C;  2FFD A;  3S9O A;  1XTG B;  3ABV C;  3M91 A;  4L75 A;  2XKM A;  3IFM A;  3A0H H;  4PV1 D;  2QEX P;  5AW2 B;  5KAI H;  1T8Z A;  1RE4 C;  3UIA A;  2M0B A;  3M9H A;  2HYN A;  1JO5 A;  3HD7 D;  4I7Z C;  3U1A A;  1BE3 D;  4WY4 C;  2BEZ F;  2W90 A;  4IOI H;  2QA4 P;  1YI2 P;  1JY3 P;  1QGK B;  3P7K A;  1NJI Q;  1Q90 D;  1Q2N A;  4HYT B;  3CC2 P;  2QG4 A;  1FZE A;  3H1I D;  1ZRT D;  3MTU E;  3HUS A;  4Y99 B;  3W67 A;  3H1K J;  4DT0 A;  2OYI A;  2HPC B;  2IBZ I;  3CME P;  1NTK J;  3BCC D;  3CCM P;  1BSN A;  1L0N J;  2WMM A;  2H7H A; 
#chains in the Genus database with same CATH homology
 4W7Z A;  2YKO A;  3HE4 A;  1HJB A;  5APU A;  2Q3I A;  1M1J B;  2O1K A;  1AFO A;  1GZL A;  3BAS A;  3B8E B;  5KJ7 D;  1J2J B;  3MUD A;  1GW4 A;  1MV8 A;  4XE5 B;  1QL1 A;  2GUV A;  4WY4 D;  2WTY A;  1JTH B;  1WRG A;  3EQ2 A;  1FZC B;  1SVF A;  1GL2 A;  4KHX A;  1N73 B;  5CMZ A;  5AVY B;  1T2K D;  3CI9 A;  1RE3 A;  2R5D A;  1JY3 N;  3HE5 B;  4C7R A;  2CPS A;  4N78 E;  3BRT B;  1PFI A;  3HUS C;  1NOH A;  4N6J A;  2QM8 A;  4DZO A;  1JY2 P;  3O8Z A;  1FDM A;  1LGH B;  1SQQ K;  3B5N B;  1LWU C;  1HUC A;  2HPC A;  1SFC C;  2NPS B;  4B86 A;  1NTZ K;  1SP4 A;  3V5B A;  1LTJ A;  2XZR A;  3TK1 A;  4GKG A;  2WT7 B;  2Z5H A;  3VTP C;  3A5T A;  2H8P D;  1CW5 A;  2OYI B;  1N7S A;  1KIL D;  4WBA A;  2H43 A;  3II6 A;  1M1J A;  3HD7 B;  1NU1 K;  5CCH D;  2LKM A;  1YYC A;  3VMY A;  2KP8 A;  1RY3 A;  2W27 A;  1IFJ A;  5CCG A;  3CL3 D;  1GTW A;  1NAF A;  3A7O A;  3PP5 A;  3TYY A;  1JOC A;  4N78 D;  1KZU B;  2IPP A;  3TNU B;  4WB4 A;  1JTH A;  1FZC A;  3RK2 B;  2YNY A;  5CJ4 A;  1JY3 O;  3GHG B;  3V2P A;  3HE5 A;  5AVT B;  3RK3 C;  2IX7 C;  1S9K E;  1KFM A;  4Y99 C;  2WZ7 A;  5APY A;  2GUS A;  1DX7 A;  2HFE D;  2E42 A;  2KOG A;  1IFM A;  3B5N A;  3SWF A;  2NPS A;  3VP8 A;  1JY2 N;  1SFC D;  1LTJ C;  1OXZ A;  1NTM K;  1LTA C;  2WPQ A;  1WT6 A;  2J58 A;  2WT7 A;  1N7S C;  2HOD B;  3MIW A;  3R2P A;  3RL0 C;  1URQ D;  5KLV K;  5AW3 B;  1L0L K;  1NHL A;  2O1J A;  2FYU K;  4RES B;  1LT9 B;  1H89 A;  3KYQ A;  1M1J C;  2PAJ A;  2XU6 A;  3HD7 A;  3SWY A;  1MUU A;  5CCG C;  1FZA A;  3OA7 A;  2J59 M;  1IK9 A;  1MFZ A;  3KDP B;  5AVW B;  1M7L A;  3P32 A;  3VN0 A;  1T3J A;  1JUN A;  1S9K D;  1ZR2 A;  3CLQ A;  3TNU A;  2A45 H;  1FZC C;  3VOP A;  1N73 C;  2KLV A;  5AVZ B;  3OJA B;  5BU8 B;  3BRV B;  3GHG A;  1JCD A;  2P67 A;  1JMM A;  1ZN5 A;  1HVV A;  4ZKP A;  3VMX A;  2C9L Y;  3M9Q A;  4I2L C;  4I6M C;  4IFD K;  2HLO A;  3RK3 D;  3A3Y B;  1FJP A;  3P8M C;  5AW6 B;  4IFF A;  1NO4 A;  3VMZ A;  2WSF H;  1JY2 O;  3B5N C;  2WSE H;  2BAS A;  1SQB K;  2YKP A;  1RF1 C;  1SLQ A;  1H88 A;  2XV5 A;  2WSC H;  5AVR B;  2FYZ A;  4N3Y B;  1H8A A;  1CI6 B;  1X8Y A;  4C46 A;  1KIL B;  2R32 A;  3EFG A;  1FAV A;  3L37 A;  3LIE A;  2ZXE B;  2OYI C;  1IO4 A;  1AQ5 A;  2HOD A;  4IFM A;  1CSB A;  1IFN A;  3L36 A;  2N1T B;  3T97 A;  1DEB A;  1RF0 A;  1LT9 A;  3MD0 A;  1HH0 A;  2I1K A;  1YTZ I;  3HD7 C;  5KJ7 A;  2YO3 A;  2POH A;  4C7N B;  2Q9I A;  5AVU B;  4EIJ A;  5APW A;  5CCG D;  1X79 B;  3OAK A;  1HTL C;  3A2A A;  1G1I A;  3H32 B;  1SQX K;  1NKN A;  4W7Y A;  4I1L A;  1G1J A;  2HG5 D;  5BVZ A;  1A02 J;  3GHG C;  1OWA A;  2I1J A;  2WWW A;  4M3L A;  3NFQ A;  3KPE A;  3MGN A;  1L4A B;  1FZF A;  1FOS F;  1GL2 C;  3L35 A;  3M9B A;  1LTI C;  1HGZ A;  1LTS C;  2QM7 A;  4GT1 A;  3G3Z A;  1J1D B;  4EOT A;  1IFD A;  1G2C B;  1RE3 C;  1SFC B;  1QL2 A;  1ZR4 A;  3B5N D;  1GD2 E;  2ZFC A;  3HRN A;  2OYH B;  2KSJ A;  4JF7 A;  2Z4E A;  5APS A;  4AQR D;  1URQ B;  2P7J A;  5APQ A;  1CI6 A;  5APX A;  3M0D A;  1KIL A;  2GM4 A;  3P8C E;  1FZB A;  1LT9 C;  2N1T A;  2WPS A;  5CCH A;  5CJ0 A;  4OH8 B;  2L5G B;  4C7N A;  3HTK B;  4DOJ A;  3V4Q A;  4O9B A;  1GDT A;  1VPC A;  1VDF A;  3H32 A;  3E1I A;  1T2K C;  2FXM A;  1LTT C;  1FU1 A;  1A02 F;  2P2U A;  3M0A A;  1N2D C;  3V2Q A;  3N4X A;  2IFM A;  1IC2 A;  1MZ9 A;  3RK3 B;  4WY4 B;  5AW8 B;  3VP9 A;  3BAT A;  2KB7 P;  2WIT A;  1LTB C;  3I5C A;  1L4A A;  1GU5 A;  1SQV K;  1GK6 A;  1GL2 D;  3P8C D;  2YO2 A;  2W6A A;  3LID A;  1ZLL A;  1ZV8 A;  1LWU A;  1G2C A;  1SFC A;  5AVS B;  3NMD A;  2YKQ A;  1FZG A;  5APT A;  2OYH A;  4LC1 A;  3V2R A;  3WMM 0;  5AW0 B;  2FFD B;  3M0D C;  1KIL C;  1URQ A;  4XA4 A;  4W80 A;  2N1T C;  5CCH C;  4LLH A;  5KTB A;  1FJK A;  2KYV A;  2NPS C;  5AW7 B;  2E43 A;  1J1E B;  2IFN A;  3HTK A;  2A45 G;  2VRS A;  5CHX A;  3H6P A;  1N7S D;  3RL0 D;  4JYB A;  3U1C A;  2R5B A;  1KQL A;  2FKW B;  2O01 H;  4AUW A;  4JYC A;  3V4W A;  2XDJ A;  5AW9 B;  1GK4 A;  1RE4 A;  2P1J A;  5APV A;  1YTZ T;  2YMY A;  4WY4 A;  2PP6 A;  1L4A C;  5AW4 B;  2R3C A;  2WPR A;  2XNX A;  2C9N Y;  5AVX B;  3RK2 C;  2C0W A;  2M8R A;  1J1D C;  1E5W A;  1RF1 B;  1NH4 A;  1N7L A;  1LTG C;  1NWQ A;  3M06 A;  1X9V A;  1KFN A;  5AW5 B;  1NTK K;  2OYH C;  3HUS B;  1FOS E;  2OAR A;  1URQ C;  1L0N K;  1NKZ B;  1SQP K;  2FFD A;  3L4F A;  1FBM A;  1T3U A;  1XTG B;  3M91 A;  3TSI A;  4AYC A;  1LWU B;  3KQG A;  3U59 A;  2N1T D;  2N9B A;  1IJD B;  2NPS D;  1JCC A;  3NXS A;  4LGD E;  2XKM A;  3BVH A;  3IFM A;  1GW3 A;  2MJZ A;  4HH2 A;  3HE4 B;  1HBW A;  5AW2 B;  1T8Z A;  2JJL A;  1RF0 C;  1EQ7 A;  1RE4 C;  2CPB A;  5KJ7 C;  5BU5 A;  3UIA A;  3N7N A;  3M9H A;  1N73 A;  2HYN A;  3IR9 A;  1JO5 A;  2W6B A;  2M3B A;  3HD7 D;  1CZQ A;  5AVQ B;  1HWT C;  3U1A A;  2Q7C A;  1GU4 A;  4WY4 C;  2A45 I;  1GL2 B;  1JY3 P;  1IFI A;  1XTC C;  2Z5I A;  2C0X A;  4ZKU A;  1L4A D;  3NTN A;  3P7K A;  3LW5 H;  3RK2 D;  5AVV B;  1Z56 A;  4HYT B;  1RF1 A;  1FZE A;  3MTU E;  3HUS A;  4Y99 B;  1W2E A;  2FFD C;  4GIF A;  2OYI A;  1N86 A;  3VYI A;  1DH3 A;  2HPC B;  3V2N A;  2JEE A;  1HGV A;  2Q5U A;  1LTJ B;  1J1E C;  1N7S B;  2H7H A;  3C9I A;  3RL0 B;  5AW1 B;  1JNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...