3TNUB

Heterocomplex of coil 2b domains of human intermediate filament proteins, keratin 5 (krt5) and keratin 14 (krt14)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
95
structure length
95
Chain Sequence
TKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for heteromeric assembly and perinuclear organization of keratin filaments.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytosolic protein
molecule keywords Keratin, type I cytoskeletal 14
total genus 46
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3tnuB00
1GK4A 5AVTB 1MV8A 2KP8A 1MFZA 5AW2B 5AW3B 1HUCA 4KHXA 1GZLA 1OWAA 3A2AA 3M0DA 3VMZA 2R5DA 3KQGA 3P7KA 5CMZA 4HYTB 3TYYA 3VMYA 1T2KD 5AVQB 2Q7CA 2R5BA 3O8ZA 1JUNA 5APUA 3T97A 2N9BA 1HBWA 2WTYA 1X8YA 2JJLA 3MD0A 4GKGA 1GTWA 1A02F 3V5BA 3HE4A 1FOSF 5AW6B 5AVXB 3B8EB 3LIEA 5AW4B 4AUWA 4I6MC 3V4QA 2W27A 1A02J 1SLQA 5APWA 3VTPC 1J2JB 3TK1A 2XU6A 3HE4B 2WWWA 3MGNA 1KQLA 3M91A 5AVRB 1G2CB 2XV5A 2Z5IA 2WPSA 1H88A 2Z5HA 5AVWB 5AVZB 2IPPA 2C9NY 2C9LY 1CZQA 3A7OA 5APYA 4GT1A 2H7HA 2P7JA 2YO2A 2P2UA 2R32A 3KDPB 2P67A 4M3LA 1CSBA 3P32A 2ZFCA 3L37A 3HE5B 3UIAA 3V4WA 1HWTC 1FAVA 1DH3A 1IO4A 3L35A 1S9KD 3M9BA 3OAKA 3VMXA 4I2LC 4RESB 4AYCA 3SWFA 3HE5A 1JNMA 1H89A 4JYCA 3TNUB 1MUUA 3P8MC 3NTNA 1GK6A 4C7NA 1CI6B 1H8AA 1S9KE 3TNUA 4C7NB 5APVA 1CI6A 1FOSE 2W6AA 3M0AA 2QM7A 3A3YB 2XZRA 3HTKA 3A5TA 2QM8A 5AW5B 5AW1B 2BASA 3L36A 5AW8B 5AVUB 3VYIA 3I5CA 2WPQA 5AW9B 5AW7B 2VRSA 5APQA 5AVYB 3LIDA 3M06A 4XE5B 5APSA 4LC1A 5APXA 1T2KC 1NWQA 2Q3IA 3M9HA 1HJBA 4DZOA 4C46A 1YYCA 2YNYA 2WT7A 3NMDA 3NXSA 1GU4A 2E42A 3IR9A 1GU5A 2ZXEB 4EOTA 4JYBA 4AQRD 4B86A 2E43A 5APTA 2WT7B 1NAFA 5AVVB 5AVSB 3VN0A 2R3CA 2Q5UA 2WPRA 5AW0B 1SP4A 1GD2E 2YO3A 3NFQA 1OXZA
chains in the Genus database with same CATH superfamily
1RF1C 1SQPD 2L91A 2Y9YA 5AW2B 2HG5D 5KJ7C 1M1JB 1YQ3C 2XNXA 3L70D 1OWAA 2KI7B 2IZ0A 1AQTA 4GOFA 2KXPB 2R5DA 4H44B 4JQ0D 3KQGA 3MZWB 3RL0C 1SFCC 2E75C 2KUBA 2LXCB 2WVRA 3L71E 3P7KA 4PD4D 2FFDB 2XKMA 2QEXP 2YXRB 3BATA 3KYQA 1UIXA 1VF5C 2FYNC 2E74B 5AVQB 1YJWP 1S72P 4H0LC 1RE3A 1WRGA 1FBMA 1KYOE 2Y0CA 2K1AA 1ZV8A 2R5BA 5TISH 3R4YA 4GDOA 3RL0B 5CCHD 2WSEH 3II6A 1KQSO 1S2EA 3I56P 1HBWA 3GW6A 3B5ND 2I1JA 4D6TE 2WSFJ 2WZ7A 4ASWA 1X8YA 1GTWA 1A02F 1NU1G 1Q7YQ 4AUWA 1SLQA 1QL1A 4BRYB 1J2JB 4RO0A 2JKVA 1FJKA 1GL2D 1FS0E 3CCSP 2WWWA 2NPSA 1SFCA 2P10A 2QJYB 4DT0A 2A45G 4PJ0E 2CPSA 1KQLA 3CCJP 1PZQA 1FZGA 2ZT9B 1RH5B 2GUVA 3WUUA 3B5NA 4EIJA 1SQPG 2A45H 3V6IA 2Y9ZA 3H1KJ 2P58A 5AVWB 4Y28J 5AVZB 1Q81Q 2IYOA 1RF0A 3JSVC 1SQPK 1EDIA 3CX5E 4IFFA 2QJYC 5KLVE 2C9NY 3CC2P 3O6QA 3PP5A 3A7OA 4R4MA 3EFFK 1DEBA 1SQBD 5APYA 1L4AA 2H7HA 1BSHA 2R3SA 4D6TG 1FDMA 2E76B 2P67A 2ZXXA 3B4SA 5GTHH 1LTJC 2FYUE 2RMZA 2HFED 1BGYJ 1LP1A 2HODA 1SQXE 2ZYAA 2B87B 2ZFCA 1NTKK 2K9YA 3L37A 5KAIE 3MP7B 3UIAA 5KKZB 3CMEP 4O9BA 3FXDA 2POHA 5C39A 2IFNA 2E75B 5AW3B 3CPWO 2M5AB 1GDTA 1IO4A 3L71G 1PFIA 3OAKA 1BDDA 2ZYGA 5KJ7A 3CMAP 1ZR4A 3D71A 1JCDA 1HGVA 2B89A 1VF5B 2OQQA 1LWUA 1MUUA 1NO4A 3HUSB 4C7NA 1KILD 3L73G 1HVVA 2G8YA 1S9KE 3R2PA 1LWUB 3PTZA 2FXOA 3CCLP 1JY2N 2JDIH 4I7ZB 5APVA 2AXTE 2W6AA 2IDBA 1KFMA 3L4FA 4HH2A 3A3YB 3CCUP 1VQ4P 2XZRA 1NU1E 2YMKA 1S4XA 2P1JA 2QM8A 3L74D 4H13B 5M1BA 1DD3A 1IC2A 5AW1B 4IL6E 2NPSB 3TDKA 1NVOA 2V4HA 3VYIA 1N73A 1T3UA 3I5CA 2WSEJ 4ZKPA 5KTBA 3OW2O 5AW9B 5AW7B 1SVFA 3HTKB 3D6YA 2IBZD 4U3FG 1NKZB 3AE9C 3LIDA 1HTLC 1MZ9A 2KZIA 2ZT9C 3PLNA 4HJGH 5CCGA 1FZCB 1VQNP 1SFCD 1URQB 4WWIA 1EC5A 2FYUJ 2OYIC 2NPSC 5TISE 2WSFH 3BVHA 1YYCA 1EZVI 3N7NA 1XTGB 3NXSA 1FZCA 2E42A 2A06D 1GU5A 2KLVA 2JWAA 4ZNCA 2ZXEB 1MKMA 3ABVC 4UB6E 4K35A 3S1KA 2E43A 4YXDC 3Q5RA 1VQOP 1NJIQ 3QWOC 1LP1B 2HODB 4TT3H 3VN0A 2R3CA 3H1KD 2E76C 1SS1A 2FYUD 1SQVJ 3P8CD 3A0BH 1OZHA 1FZAA 1OXZA 1SQXG 3FWNA 5AVTB 2DW3A 2KSEA 3S9OA 1UIIA 2JO1A 2KP8A 3FX0A 4WY4D 3L73D 1J1DB 3M0DA 3FXEA 1AVOA 4U3FE 4W7ZA 1FZBA 3VMZA 4GOEA 1L0LJ 2OARA 2OYIA 2UWJE 2WSCJ 3E7KA 3HUSC 1VDFA 2O01N 4GIFA 4MN4C 3TYYA 3M0DC 1JTHB 1JM0A 4IFMA 3RK2B 1ZW0A 1AFOA 5H2FE 2Q9IA 1T2KD 1R5LA 1H0TB 2M8RA 2Q7CA 1S5LE 2HLOA 1E79H 1KC8Q 1PGJA 3WUVA 1LWUC 1X22A 1Q2NA 3Q2YA 1OVRA 3AE7C 3D6ZA 1K73Q 1N7SA 1L4AC 3SSUA 1ZN5A 5BU8B 1DX7A 1PPJE 2FY8A 1FDOA 2N9BA 3AE8C 3F5HA 4H13C 4U3FD 5B5EH 3GLMA 2V7QH 1SQVD 1NOHA 2AEFA 3HD7A 1DD4A 2MKVA 1LNQA 3HE4A 1N7SB 4GKGA 4PV1B 2IBZE 3LIEA 1BE3D 2Q1KA 1URQA 2M0BA 2W6JH 3V4QA 1LTBC 5APWA 1A02J 3L72J 2B88A 1G2CA 2RKLA 2XU6A 3AEEC 3PH0A 2A06G 4CPGA 5CCHC 1LTAC 1L0NE 5KLIC 1GW3A 1IFJA 1ZP0C 4UB8H 3SFEC 3C9IA 4EDFA 1L4AD 3RL0D 1RF1B 3LW5H 4GODA 5CCGC 1NTZJ 2Z5IA 3L75J 4XA4A 3W68A 2I1KA 2D2CB 1YITP 1K9MQ 4WB4A 2E5YA 2GM4A 2Z5HA 4OGQB 2HR3A 1ZRTE 4WY4A 2OYHA 1BE3E 3H1JJ 2BEZF 2C9LY 1IZNB 1SQVG 3BRVB 3H1HG 1U7JA 4IL6H 1HH0A 1FJPA 1GW4A 1VQ7P 2XNDH 1YJNP 1PPJG 3CXHI 3PJSK 2QE7H 1EQ7A 2K88A 1KV4A 2QIWA 1KD1Q 1CSBA 2AXCA 3P32A 1FE6A 1JY3P 1NGMB 3HE5B 1JOCA 3V4WA 1IFIA 4NPDA 3AEFC 5GTHE 1FAVA 3VMAA 3U1CA 1L0NG 3M9BA 1N86A 3HE5A 1SQXD 1RE3C 1H89A 3AEGC 5B66H 2BEQD 1GMJA 3P8MC 3G4SP 2Z4EA 3NTNA 2XDJA 1EDKA 1NTZG 1N2DC 4DZOA 1H8AA 2OYIB 4K3AA 1QLED 3CCMP 3GHGC 1W2BO 1MFTA 2PGDA 1S3JA 1RE4C 2N1TD 4LLHA 3CD6P 2QG4A 4Z1MH 3FWLA 1YQ4C 4L74A 1CI6A 1PP9E 1FOSE 3BRTB 3CC7P 1RE4A 2QM7A 3VP8A 3TF5A 3AEDC 1W2EA 3A5TA 2QRXA 1JMBA 1L0NJ 1BGYE 1KILA 1M56D 3F89A 3IAOA 2BASA 1OVVA 3HD7D 3RK3B 1NTMK 5B5EE 3G71P 3CWBE 2WPQA 1VF5D 3L75E 2VRSA 5EFWB 1P84E 1KILB 2V7QJ 3B5NC 4L76A 2BCCJ 1N8RQ 1JO5A 1U57A 1G1IA 1BE3J 1M57D 2IX7C 3RBZA 1YJ9P 4LC1A 4H0LB 2E5TA 4DJGA 2Q3IA 1HJBA 5KKZC 2ITAA 2YIUB 3EQ2A 1M7LA 2C0XA 2ZAEB 1S5LX 1FU1A 5H2FH 1KB9H 1NTZE 1VQ6P 2Q3EA 1YTZI 1JCCA 1YBKA 2M3BA 3CWBD 4JYBA 4N6JA 1VQPP 3L75D 2OGUA 1FDIA 1X79B 4N78E 1LTIC 1HJ0A 3CXHH 3RGUA 3LW5J 1KORA 1KYOH 5KLVK 1VQMP 1SP4A 1U7MA 1SQXJ 1HGZA 1M1JA 1ZMEC 4WBAA 3O6QB 2IBZG 1OFCX 2QJPC 2FFDA 1BDCA 2ZYDA 1IK7A 1MV8A 2H88C 3CWBJ 3SWYA 3H1LJ 5BU5A 2HPCB 3L72D 2AEMA 4KHXA 2RH0A 1ZR2A 2LKMA 3A0HH 5TJHA 5CJ4A 3TGUD 2B87A 3OA7A 4NPEA 4HYTB 1RHZB 2JWDA 3CX5D 3JCUH 4L73A 2KSJA 3CCQP 1S1CX 4DCKA 3L73E 4H44D 2W90A 4PD4I 2OTJP 1JMMA 1QVGO 3MUDA 1T8ZA 2IYPA 2YKQA 1QX8A 1NTKG 3O8ZA 3G6EP 1VQ5P 1SQQK 1JUNA 1M1KQ 2H43A 1S5LH 3MUDC 2CK3H 2E74D 4EI2A 1XTCC 3CX5I 3RBXA 3WMM0 2JJLA 3MD0A 3CCRP 4DOJA 4ZMDA 2RN0A 5AVXB 3WUTA 5AW4B 1NU1K 2J5UA 2O1JA 3B71A 3L75G 2W27A 2YMYA 3AECC 1KILC 4IFDK 3B5NB 1USDA 3H1LD 3TK1A 1LT9C 1ZXGA 3TSIA 4C7RA 4WVZA 3M91A 5KAIH 1LT9A 2QA4P 1KFNA 2XV5A 4Y99B 4OWFA 1NHLA 1OX3A 2JEEA 3C1LA 3KZIE 3H1IE 1H88A 1TU3F 4I7ZC 4UB8E 1QEXA 4PD4E 1EXJA 1FZFA 1N7SD 3ZDMA 2C0WA 2FYNB 3V2NA 1CZQA 3C8VA 1PP9G 2G3AA 2Y0DA 1NTKE 1FZEA 1SQBK 2GA1A 2QSIA 2WSCH 3GG2A 4GT1A 2YO2A 2R44A 1Q90D 4U7JA 4HB1A 2P2UA 3WU2H 5KLVJ 1IJDB 3EFGA 1BGYG 3MIWA 2HPCA 1LT1A 2QJPB 5KAFE 4YXWH 1T6AA 3USSA 5GTIE 3H1LG 2W6BA 1DEEG 1IFNA 3CWBG 3L72E 1L4AB 1SQBJ 3GF3A 3H1ID 4D6TD 1JEKA 1KQGB 1JY3O 1E5WA 2B9BA 2OYOA 4TLFA 1L0LG 1OW8A 2FXPA 2E76D 5K5GB 1DH3A 1AA0A 1KB9I 3L35A 1IFDA 1KB9E 4PV1C 3VMXA 1Y9BA 4I2LC 3H25A 2O01J 1SQXK 4JYCA 1SQQG 2HYNA 2KS1B 2KOGA 1BSNA 3H1KE 3P8CE 3G3ZA 4H13D 4IL6X 4QMAA 3L73J 1NTME 2NPSD 3BCCE 2ZVNB 1GL2A 4C7NB 3CXHD 4W7YA 2KS1A 4HKZH 4LGDE 1PIXA 1PGOA 1VQ9P 2FKWB 3D70A 1N73C 3FGAD 3PRJA 2K3RA 4BRYA 4OH8B 3HTKA 1LTJA 4H44C 5KLVD 4JPZB 3Q5SA 2KB7P 1VQKP 1SFCB 3L36A 5AW8B 2FFDC 1H0TA 3H1LE 1BCCE 3AE1C 1KN7A 2BCCE 3L74G 1LT9B 3VP9A 1D7MA 1LTJB 4W80A 1HF9A 2KNCB 2FBWC 5E79E 1L0LE 3AE4C 1BGYD 4U3FJ 2KIKA 1NTMJ 3BCCJ 4D6TJ 1LGHB 1JY2P 4Y99C 5APXA 2SPZA 1NWQA 1AVYA 1P84H 3K5BA 3M9QA 3M9HA 1NAYA 2IFMA 2YNYA 3AE6C 1P84D 2I8DA 3NMDA 4YPCA 4C46A 2PRRA 2AXTH 2NRGA 1GU4A 4ASVA 1EZVD 1JY3N 3RK3D 1URQD 3H1KG 2WT7A 1SQVE 4EOTA 3Q1MA 4AQRD 1NTMG 3BCCG 2WT7B 1NAFA 3KHUA 4KJMA 2JR8A 2LXBA 1N7SC 3Q3DA 1SQQD 1FC2C 1QL2A 1L0LD 2O1KA 2Q5UA 1AV1A 1NKNA 4WY4B 1LTGC 1NTZD 5AW0B 1GD2E 5KJ7D 2YO3A 2QJKB 2H8PD 3JC22 3NFQA 4NPFX 1YHQP 2OTLP 2L5GB 2WMMA 2M5AA 1VQ8P 1GK4A 3MTUE 2ZJSE 4L75A 2YKPA 3H1JD 1MFZA 4YTPC 2KLUA 2BCCG 2KYVA 2PFXA 3HUSA 1HUCA 3L74E 1KZUB 1GZLA 1ZOYC 1QGKB 2A45I 3A2AA 3KZIH 3L71J 4A7PA 3RK3C 5CCHA 1NU1J 2PP6A 2D2CC 2YKOA 3SWKA 5CMZA 1CW5A 1ZRTD 2QJKC 1K04A 1KYOI 1OW7A 1SQQE 2GUSA 2Q6QA 1EZVG 3H1HJ 3VMYA 4XFJA 1FZCC 4RKUJ 1GL2B 3H6PA 3VOPA 1NTMD 1L2PA 1PL5A 2K37A 2WITA 3AEBC 2NZ2A 1SQQJ 3BCCD 2N1TA 4JBZA 3WU2E 3CL3D 3TGUE 2ZT9D 3A0BE 1AQ5A 5CCGD 5GTIH 5KAFH 1PGPA 3H1JE 1KQFB 5APUA 3T97A 1N73B 1LTSC 5CJ0A 3RK2D 1M8OB 5DJTB 3AE2C 3E1IA 4EYYQ 2WTYA 1Z56A 1L0NK 2OTKE 1GL2C 3IFMA 4IOIH 2KNCA 3V2PA 1JY2O 3V5BA 1SQBG 2BCCD 4OGQC 1X0TA 1LTTC 1OW6A 3B8EB 1BCCG 3L72G 5AW6B 1SQPJ 2IBZI 4I6MC 3VTPC 1RF1A 2W8ZA 1IFPA 4R4LA 3HE4B 1WMKA 3L74J 3MGNA 2WQYC 3AE5C 4PV1D 3CCVP 3E1RA 3SFDC 1Q82Q 5AVRB 1G1JA 1PGQA 3KPEA 3RL0g 1P84I 1G2CB 1W5CE 1WT6A 2OYHC 3BASA 1EZVE 3V2QA 3MHVA 3AE3C 2WPSA 1Y8AA 1PP9D 1R5SA 2E75D 3CCEP 2IPPA 1IK9A 3EWKA 4BXLA 3CC4P 5B66E 1QVFO 3TGUG 1VPCA 1IFMA 1AJYA 3H1JG 4WY4C 2D2CD 2P7JA 1SQVK 4PD4H 5CHXA 4OGQD 2R32A 3KDPB 5DJUB 3H1HD 2ZVOB 5CBNA 1N7LA 1URQC 2FXMA 2W83C 2WSSH 1K05A 1PPJD 4M3LA 1KTMA 1NTKD 3IF4A 1JTHA 1J1EC 3GMAA 1KILE 2K9JA 3H32B 3ITKA 3JCUE 1HWTC 1EDJA 4KT0J 2KZJA 2QVAA 2YIUC 5BVZA 1S9KD 2FYUK 1RY3A 2N1TB 4RESB 4AYCA 3SWFA 1JNMA 1T3JA 3TNUB 3CI9A 1L0ND 1OVUA 2AEJA 2JP3A 1GK6A 1VL2A 2Y0EA 1CI6B 2YXQB 3G9RA 3L71D 4N78D 4PJ0H 1NU1D 2PAJA 1PP9J 3L70G 1J1EB 2E74C 1YTZT 4BWNA 2CPBA 1KB9D 3PHLA 1M90Q 1RQUA 3HD7B 5L8RJ 2J58A 1RF0C 3TNUA 5CBOA 1KYOD 3W67A 3T97B 2N9YB 2N1TC 4N3YB 1FOSF 1JB0J 3M0AA 2MJZA 3GF7A 3S4RA 3OJAB 3U59A 1OIPA 1L0LK 1J1DC 1BCCJ 2KK7A 3CX5H 1K8AQ 3N4XA 1ZLLA 5AW5B 3I55P 1Q86Q 4RJTA 3Q5PA 2J59M 2WPVB 3HRNA 5AVUB 3H1IJ 3CXHE 4H0LD 1OMIA 3HD7C 1DIPA 4JF7A 3RK2C 1YI2P 1EDLA 1PV3A 1NYHA 5APQA 4ZKUA 2O01H 2IZ1A 3KXDA 5AVYB 2A06E 1YIJP 2OYHB 3QH9A 3M06A 4XE5B 5APSA 1BCCD 1RQVA 4OVNF 1T2KC 5E79H 2M3EA 3H1IG 4UB6H 1SQPE 1VQLP 2LR2A 2FYZA 3A0HE 3AEAC 3GHGA 3TGUJ 3IR9A 1R8EA 3V2RA 1NTKJ 1X9VA 2O3JA 3L70E 1USEA 1EXIA 1BE3G 4B86A 5KLVG 2H89C 3IN6A 5APTA 1M1JC 5AVVB 3GHGB 3H1HE 5AVSB 3U1AA 1NH4A 2WPRA 3CLQA 1LJ2A 1KMIZ 1NTZK 1SQBE 3L70J 5KLIB 2K9JB 3H32A 3RK3E 4I1LA 1Y47A 2FYUG
chains in the Genus database with same CATH topology
1RF1C 5AW2B 2HG5D 5KJ7C 1M1JB 2XNXA 1OWAA 3RL0C 2R5DA 3KQGA 1SFCC 3P7KA 2FFDB 2XKMA 3BATA 3KYQA 5AVQB 1RE3A 1WRGA 1FBMA 1ZV8A 2R5BA 3RL0B 5CCHD 2WSEH 3II6A 1HBWA 3B5ND 2I1JA 2WZ7A 1X8YA 1GTWA 1A02F 4AUWA 1SLQA 1QL1A 1J2JB 1FJKA 1GL2D 2WWWA 2NPSA 1SFCA 1FZGA 2A45G 2CPSA 1KQLA 2GUVA 3B5NA 2A45H 5AVWB 5AVZB 1RF0A 1SQPK 4IFFA 2C9NY 3PP5A 3A7OA 5APYA 1DEBA 2H7HA 1L4AA 1FDMA 2P67A 1LTJC 2HFED 2HODA 2ZFCA 1NTKK 3L37A 3UIAA 4O9BA 2POHA 2IFNA 1GDTA 1IO4A 1PFIA 3OAKA 5KJ7A 1ZR4A 1JCDA 1HGVA 3HUSB 1LWUA 1MUUA 1NO4A 4C7NA 1KILD 1HVVA 1S9KE 3R2PA 1LWUB 1JY2N 5APVA 4HH2A 2W6AA 1KFMA 3L4FA 3A3YB 2XZRA 2P1JA 2QM8A 1IC2A 5AW1B 2NPSB 1N73A 3VYIA 1T3UA 3I5CA 5KTBA 4ZKPA 5AW9B 5AW7B 1SVFA 3HTKB 1NKZB 3LIDA 1HTLC 1MZ9A 5CCGA 1FZCB 1SFCD 1URQB 2OYIC 2NPSC 3BVHA 2WSFH 1YYCA 3N7NA 1XTGB 3NXSA 1FZCA 2E42A 1GU5A 2KLVA 2ZXEB 2E43A 2HODB 3VN0A 2R3CA 3P8CD 1FZAA 1OXZA 5AVTB 2KP8A 4WY4D 1J1DB 3M0DA 4W7ZA 3VMZA 1FZBA 2OARA 2OYIA 3HUSC 1VDFA 4GIFA 3TYYA 3M0DC 1JTHB 4IFMA 3RK2B 1AFOA 2Q9IA 1T2KD 2M8RA 2Q7CA 2HLOA 1LWUC 1N7SA 1L4AC 1ZN5A 5BU8B 1DX7A 2N9BA 1NOHA 4GKGA 3HD7A 3HE4A 1N7SB 3LIEA 3V4QA 1URQA 1A02J 1LTBC 5APWA 1G2CA 2XU6A 5CCHC 1LTAC 1GW3A 1IFJA 3C9IA 1L4AD 3RL0D 1RF1B 3LW5H 5CCGC 2Z5IA 4XA4A 2I1KA 4WB4A 2GM4A 2Z5HA 4WY4A 2OYHA 2C9LY 3BRVB 1HH0A 1FJPA 1GW4A 1EQ7A 1CSBA 3P32A 1JY3P 3HE5B 1JOCA 3V4WA 1IFIA 1FAVA 3M9BA 1N86A 3HE5A 1RE3C 1H89A 2Z4EA 3P8MC 3NTNA 2XDJA 1H8AA 1N2DC 3GHGC 4LLHA 1RE4C 2N1TD 1CI6A 1FOSE 3BRTB 1RE4A 2QM7A 3VP8A 1W2EA 3A5TA 3RK3B 1KILA 2BASA 3HD7D 1NTMK 2WPQA 2VRSA 1KILB 3B5NC 1JO5A 1G1IA 2IX7C 4LC1A 2Q3IA 1HJBA 3EQ2A 1M7LA 2C0XA 1FU1A 1YTZI 1JCCA 2M3BA 4JYBA 4N6JA 1X79B 4N78E 1LTIC 5KLVK 1SP4A 1HGZA 1M1JA 4WBAA 2FFDA 1MV8A 3SWYA 5BU5A 2HPCB 4KHXA 1ZR2A 2LKMA 5CJ4A 3OA7A 4HYTB 2KSJA 1JMMA 3MUDA 1T8ZA 2YKQA 3O8ZA 1JUNA 1SQQK 2H43A 1XTCC 3WMM0 2JJLA 3MD0A 4DOJA 5AVXB 5AW4B 1NU1K 2O1JA 2W27A 2YMYA 1KILC 4IFDK 3B5NB 3TK1A 1LT9C 3TSIA 4C7RA 3M91A 1LT9A 1KFNA 2XV5A 4Y99B 1NHLA 2JEEA 1H88A 1FZFA 1N7SD 2C0WA 3V2NA 1CZQA 1FZEA 1SQBK 2WSCH 4GT1A 2YO2A 2P2UA 1IJDB 3EFGA 3MIWA 2HPCA 2W6BA 1IFNA 1L4AB 1JY3O 1E5WA 1DH3A 3L35A 1IFDA 3VMXA 4I2LC 1SQXK 4JYCA 2HYNA 2KOGA 3P8CE 3G3ZA 2NPSD 1GL2A 4C7NB 4W7YA 4LGDE 2FKWB 1N73C 4OH8B 3HTKA 1LTJA 2KB7P 1SFCB 3L36A 5AW8B 2FFDC 1LT9B 3VP9A 1LTJB 4W80A 1LGHB 1JY2P 4Y99C 5APXA 1NWQA 3M9HA 3M9QA 4C46A 2YNYA 2IFMA 4DZOA 2WT7A 3NMDA 1GU4A 1JY3N 3RK3D 1URQD 4EOTA 4AQRD 2WT7B 1NAFA 1N7SC 1QL2A 2O1KA 4WY4B 2Q5UA 1NKNA 1LTGC 5AW0B 1GD2E 5KJ7D 2YO3A 2H8PD 3NFQA 2L5GB 1GK4A 3MTUE 3U1CA 2YKPA 1MFZA 2KYVA 5AW3B 3HUSA 1HUCA 1KZUB 1GZLA 2A45I 3A2AA 3RK3C 5CCHA 2PP6A 1CW5A 2YKOA 5CMZA 2GUSA 3VMYA 1FZCC 1GL2B 3H6PA 3VOPA 2OYIB 2WITA 2N1TA 3CL3D 1AQ5A 5CCGD 5APUA 3T97A 1N73B 1LTSC 5CJ0A 3RK2D 3E1IA 2WTYA 1Z56A 1L0NK 3IFMA 1GL2C 3V2PA 1FOSF 4EIJA 3V5BA 1JY2O 5AW6B 1LTTC 3B8EB 4I6MC 3VTPC 1RF1A 3HE4B 3MGNA 5AVRB 1G1JA 3KPEA 1G2CB 2OYHC 1WT6A 3BASA 3V2QA 2WPSA 2IPPA 1IK9A 1VPCA 1IFMA 4WY4C 2P7JA 1SQVK 5CHXA 2R32A 3KDPB 1N7LA 1URQC 2FXMA 4M3LA 1JTHA 1J1EC 3H32B 1HWTC 5BVZA 1S9KD 2FYUK 1RY3A 2N1TB 4RESB 4AYCA 3SWFA 1JNMA 1T3JA 3TNUB 3CI9A 1GK6A 1CI6B 4N78D 2PAJA 1J1EB 1YTZT 2CPBA 3HD7B 3TNUA 2J58A 1RF0C 2N1TC 4N3YB 3M0AA 2MJZA 3OJAB 3U59A 1L0LK 1J1DC 3N4XA 1ZLLA 5AW5B 2J59M 3HRNA 5AVUB 3HD7C 4JF7A 3RK2C 4ZKUA 5APQA 2O01H 5AVYB 2OYHB 3M06A 4XE5B 5APSA 1T2KC 2FYZA 3GHGA 3IR9A 3V2RA 1X9VA 4B86A 5APTA 1M1JC 5AVVB 3GHGB 5AVSB 3U1AA 1NH4A 2WPRA 3CLQA 1NTZK 3H32A 4I1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GK4 A;  5AVT B;  1MV8 A;  2KP8 A;  1MFZ A;  5AW2 B;  5AW3 B;  1HUC A;  4KHX A;  1GZL A;  1OWA A;  3A2A A;  3M0D A;  3VMZ A;  2R5D A;  3KQG A;  3P7K A;  5CMZ A;  4HYT B;  3TYY A;  3VMY A;  1T2K D;  5AVQ B;  2Q7C A;  2R5B A;  3O8Z A;  1JUN A;  5APU A;  3T97 A;  2N9B A;  1HBW A;  2WTY A;  1X8Y A;  2JJL A;  3MD0 A;  4GKG A;  1GTW A;  1A02 F;  3V5B A;  3HE4 A;  1FOS F;  5AW6 B;  5AVX B;  3B8E B;  3LIE A;  5AW4 B;  4AUW A;  4I6M C;  3V4Q A;  2W27 A;  1A02 J;  1SLQ A;  5APW A;  3VTP C;  1J2J B;  3TK1 A;  2XU6 A;  3HE4 B;  2WWW A;  3MGN A;  1KQL A;  3M91 A;  5AVR B;  1G2C B;  2XV5 A;  2Z5I A;  2WPS A;  1H88 A;  2Z5H A;  5AVW B;  5AVZ B;  2IPP A;  2C9N Y;  2C9L Y;  1CZQ A;  3A7O A;  5APY A;  4GT1 A;  2H7H A;  2P7J A;  2YO2 A;  2P2U A;  2R32 A;  3KDP B;  2P67 A;  4M3L A;  1CSB A;  3P32 A;  2ZFC A;  3L37 A;  3HE5 B;  3UIA A;  3V4W A;  1HWT C;  1FAV A;  1DH3 A;  1IO4 A;  3L35 A;  1S9K D;  3M9B A;  3OAK A;  3VMX A;  4I2L C;  4RES B;  4AYC A;  3SWF A;  3HE5 A;  1JNM A;  1H89 A;  4JYC A;  3TNU B;  1MUU A;  3P8M C;  3NTN A;  1GK6 A;  4C7N A;  1CI6 B;  1H8A A;  1S9K E;  3TNU A;  4C7N B;  5APV A;  1CI6 A;  1FOS E;  2W6A A;  3M0A A;  2QM7 A;  3A3Y B;  2XZR A;  3HTK A;  3A5T A;  2QM8 A;  5AW5 B;  5AW1 B;  2BAS A;  3L36 A;  5AW8 B;  5AVU B;  3VYI A;  3I5C A;  2WPQ A;  5AW9 B;  5AW7 B;  2VRS A;  5APQ A;  5AVY B;  3LID A;  3M06 A;  4XE5 B;  5APS A;  4LC1 A;  5APX A;  1T2K C;  1NWQ A;  2Q3I A;  3M9H A;  1HJB A;  4DZO A;  4C46 A;  1YYC A;  2YNY A;  2WT7 A;  3NMD A;  3NXS A;  1GU4 A;  2E42 A;  3IR9 A;  1GU5 A;  2ZXE B;  4EOT A;  4JYB A;  4AQR D;  4B86 A;  2E43 A;  5APT A;  2WT7 B;  1NAF A;  5AVV B;  5AVS B;  3VN0 A;  2R3C A;  2Q5U A;  2WPR A;  5AW0 B;  1SP4 A;  1GD2 E;  2YO3 A;  3NFQ A;  1OXZ A; 
#chains in the Genus database with same CATH topology
 1RF1 C;  1SQP D;  2L91 A;  2Y9Y A;  5AW2 B;  2HG5 D;  5KJ7 C;  1M1J B;  1YQ3 C;  2XNX A;  3L70 D;  1OWA A;  2KI7 B;  2IZ0 A;  1AQT A;  4GOF A;  2KXP B;  2R5D A;  4H44 B;  4JQ0 D;  3KQG A;  3MZW B;  3RL0 C;  1SFC C;  2E75 C;  2KUB A;  2LXC B;  2WVR A;  3L71 E;  3P7K A;  4PD4 D;  2FFD B;  2XKM A;  2QEX P;  2YXR B;  3BAT A;  3KYQ A;  1UIX A;  1VF5 C;  2FYN C;  2E74 B;  5AVQ B;  1YJW P;  1S72 P;  4H0L C;  1RE3 A;  1WRG A;  1FBM A;  1KYO E;  2Y0C A;  2K1A A;  1ZV8 A;  2R5B A;  5TIS H;  3R4Y A;  4GDO A;  3RL0 B;  5CCH D;  2WSE H;  3II6 A;  1KQS O;  1S2E A;  3I56 P;  1HBW A;  3GW6 A;  3B5N D;  2I1J A;  4D6T E;  2WSF J;  2WZ7 A;  4ASW A;  1X8Y A;  1GTW A;  1A02 F;  1NU1 G;  1Q7Y Q;  4AUW A;  1SLQ A;  1QL1 A;  4BRY B;  1J2J B;  4RO0 A;  2JKV A;  1FJK A;  1GL2 D;  1FS0 E;  3CCS P;  2WWW A;  2NPS A;  1SFC A;  2P10 A;  2QJY B;  4DT0 A;  2A45 G;  4PJ0 E;  2CPS A;  1KQL A;  3CCJ P;  1PZQ A;  1FZG A;  2ZT9 B;  1RH5 B;  2GUV A;  3WUU A;  3B5N A;  4EIJ A;  1SQP G;  2A45 H;  3V6I A;  2Y9Z A;  3H1K J;  2P58 A;  5AVW B;  4Y28 J;  5AVZ B;  1Q81 Q;  2IYO A;  1RF0 A;  3JSV C;  1SQP K;  1EDI A;  3CX5 E;  4IFF A;  2QJY C;  5KLV E;  2C9N Y;  3CC2 P;  3O6Q A;  3PP5 A;  3A7O A;  4R4M A;  3EFF K;  1DEB A;  1SQB D;  5APY A;  1L4A A;  2H7H A;  1BSH A;  2R3S A;  4D6T G;  1FDM A;  2E76 B;  2P67 A;  2ZXX A;  3B4S A;  5GTH H;  1LTJ C;  2FYU E;  2RMZ A;  2HFE D;  1BGY J;  1LP1 A;  2HOD A;  1SQX E;  2ZYA A;  2B87 B;  2ZFC A;  1NTK K;  2K9Y A;  3L37 A;  5KAI E;  3MP7 B;  3UIA A;  5KKZ B;  3CME P;  4O9B A;  3FXD A;  2POH A;  5C39 A;  2IFN A;  2E75 B;  5AW3 B;  3CPW O;  2M5A B;  1GDT A;  1IO4 A;  3L71 G;  1PFI A;  3OAK A;  1BDD A;  2ZYG A;  5KJ7 A;  3CMA P;  1ZR4 A;  3D71 A;  1JCD A;  1HGV A;  2B89 A;  1VF5 B;  2OQQ A;  1LWU A;  1MUU A;  1NO4 A;  3HUS B;  4C7N A;  1KIL D;  3L73 G;  1HVV A;  2G8Y A;  1S9K E;  3R2P A;  1LWU B;  3PTZ A;  2FXO A;  3CCL P;  1JY2 N;  2JDI H;  4I7Z B;  5APV A;  2AXT E;  2W6A A;  2IDB A;  1KFM A;  3L4F A;  4HH2 A;  3A3Y B;  3CCU P;  1VQ4 P;  2XZR A;  1NU1 E;  2YMK A;  1S4X A;  2P1J A;  2QM8 A;  3L74 D;  4H13 B;  5M1B A;  1DD3 A;  1IC2 A;  5AW1 B;  4IL6 E;  2NPS B;  3TDK A;  1NVO A;  2V4H A;  3VYI A;  1N73 A;  1T3U A;  3I5C A;  2WSE J;  4ZKP A;  5KTB A;  3OW2 O;  5AW9 B;  5AW7 B;  1SVF A;  3HTK B;  3D6Y A;  2IBZ D;  4U3F G;  1NKZ B;  3AE9 C;  3LID A;  1HTL C;  1MZ9 A;  2KZI A;  2ZT9 C;  3PLN A;  4HJG H;  5CCG A;  1FZC B;  1VQN P;  1SFC D;  1URQ B;  4WWI A;  1EC5 A;  2FYU J;  2OYI C;  2NPS C;  5TIS E;  2WSF H;  3BVH A;  1YYC A;  1EZV I;  3N7N A;  1XTG B;  3NXS A;  1FZC A;  2E42 A;  2A06 D;  1GU5 A;  2KLV A;  2JWA A;  4ZNC A;  2ZXE B;  1MKM A;  3ABV C;  4UB6 E;  4K35 A;  3S1K A;  2E43 A;  4YXD C;  3Q5R A;  1VQO P;  1NJI Q;  3QWO C;  1LP1 B;  2HOD B;  4TT3 H;  3VN0 A;  2R3C A;  3H1K D;  2E76 C;  1SS1 A;  2FYU D;  1SQV J;  3P8C D;  3A0B H;  1OZH A;  1FZA A;  1OXZ A;  1SQX G;  3FWN A;  5AVT B;  2DW3 A;  2KSE A;  3S9O A;  1UII A;  2JO1 A;  2KP8 A;  3FX0 A;  4WY4 D;  3L73 D;  1J1D B;  3M0D A;  3FXE A;  1AVO A;  4U3F E;  4W7Z A;  1FZB A;  3VMZ A;  4GOE A;  1L0L J;  2OAR A;  2OYI A;  2UWJ E;  2WSC J;  3E7K A;  3HUS C;  1VDF A;  2O01 N;  4GIF A;  4MN4 C;  3TYY A;  3M0D C;  1JTH B;  1JM0 A;  4IFM A;  3RK2 B;  1ZW0 A;  1AFO A;  5H2F E;  2Q9I A;  1T2K D;  1R5L A;  1H0T B;  2M8R A;  2Q7C A;  1S5L E;  2HLO A;  1E79 H;  1KC8 Q;  1PGJ A;  3WUV A;  1LWU C;  1X22 A;  1Q2N A;  3Q2Y A;  1OVR A;  3AE7 C;  3D6Z A;  1K73 Q;  1N7S A;  1L4A C;  3SSU A;  1ZN5 A;  5BU8 B;  1DX7 A;  1PPJ E;  2FY8 A;  1FDO A;  2N9B A;  3AE8 C;  3F5H A;  4H13 C;  4U3F D;  5B5E H;  3GLM A;  2V7Q H;  1SQV D;  1NOH A;  2AEF A;  3HD7 A;  1DD4 A;  2MKV A;  1LNQ A;  3HE4 A;  1N7S B;  4GKG A;  4PV1 B;  2IBZ E;  3LIE A;  1BE3 D;  2Q1K A;  1URQ A;  2M0B A;  2W6J H;  3V4Q A;  1LTB C;  5APW A;  1A02 J;  3L72 J;  2B88 A;  1G2C A;  2RKL A;  2XU6 A;  3AEE C;  3PH0 A;  2A06 G;  4CPG A;  5CCH C;  1LTA C;  1L0N E;  5KLI C;  1GW3 A;  1IFJ A;  1ZP0 C;  4UB8 H;  3SFE C;  3C9I A;  4EDF A;  1L4A D;  3RL0 D;  1RF1 B;  3LW5 H;  4GOD A;  5CCG C;  1NTZ J;  2Z5I A;  3L75 J;  4XA4 A;  3W68 A;  2I1K A;  2D2C B;  1YIT P;  1K9M Q;  4WB4 A;  2E5Y A;  2GM4 A;  2Z5H A;  4OGQ B;  2HR3 A;  1ZRT E;  4WY4 A;  2OYH A;  1BE3 E;  3H1J J;  2BEZ F;  2C9L Y;  1IZN B;  1SQV G;  3BRV B;  3H1H G;  1U7J A;  4IL6 H;  1HH0 A;  1FJP A;  1GW4 A;  1VQ7 P;  2XND H;  1YJN P;  1PPJ G;  3CXH I;  3PJS K;  2QE7 H;  1EQ7 A;  2K88 A;  1KV4 A;  2QIW A;  1KD1 Q;  1CSB A;  2AXC A;  3P32 A;  1FE6 A;  1JY3 P;  1NGM B;  3HE5 B;  1JOC A;  3V4W A;  1IFI A;  4NPD A;  3AEF C;  5GTH E;  1FAV A;  3VMA A;  3U1C A;  1L0N G;  3M9B A;  1N86 A;  3HE5 A;  1SQX D;  1RE3 C;  1H89 A;  3AEG C;  5B66 H;  2BEQ D;  1GMJ A;  3P8M C;  3G4S P;  2Z4E A;  3NTN A;  2XDJ A;  1EDK A;  1NTZ G;  1N2D C;  4DZO A;  1H8A A;  2OYI B;  4K3A A;  1QLE D;  3CCM P;  3GHG C;  1W2B O;  1MFT A;  2PGD A;  1S3J A;  1RE4 C;  2N1T D;  4LLH A;  3CD6 P;  2QG4 A;  4Z1M H;  3FWL A;  1YQ4 C;  4L74 A;  1CI6 A;  1PP9 E;  1FOS E;  3BRT B;  3CC7 P;  1RE4 A;  2QM7 A;  3VP8 A;  3TF5 A;  3AED C;  1W2E A;  3A5T A;  2QRX A;  1JMB A;  1L0N J;  1BGY E;  1KIL A;  1M56 D;  3F89 A;  3IAO A;  2BAS A;  1OVV A;  3HD7 D;  3RK3 B;  1NTM K;  5B5E E;  3G71 P;  3CWB E;  2WPQ A;  1VF5 D;  3L75 E;  2VRS A;  5EFW B;  1P84 E;  1KIL B;  2V7Q J;  3B5N C;  4L76 A;  2BCC J;  1N8R Q;  1JO5 A;  1U57 A;  1G1I A;  1BE3 J;  1M57 D;  2IX7 C;  3RBZ A;  1YJ9 P;  4LC1 A;  4H0L B;  2E5T A;  4DJG A;  2Q3I A;  1HJB A;  5KKZ C;  2ITA A;  2YIU B;  3EQ2 A;  1M7L A;  2C0X A;  2ZAE B;  1S5L X;  1FU1 A;  5H2F H;  1KB9 H;  1NTZ E;  1VQ6 P;  2Q3E A;  1YTZ I;  1JCC A;  1YBK A;  2M3B A;  3CWB D;  4JYB A;  4N6J A;  1VQP P;  3L75 D;  2OGU A;  1FDI A;  1X79 B;  4N78 E;  1LTI C;  1HJ0 A;  3CXH H;  3RGU A;  3LW5 J;  1KOR A;  1KYO H;  5KLV K;  1VQM P;  1SP4 A;  1U7M A;  1SQX J;  1HGZ A;  1M1J A;  1ZME C;  4WBA A;  3O6Q B;  2IBZ G;  1OFC X;  2QJP C;  2FFD A;  1BDC A;  2ZYD A;  1IK7 A;  1MV8 A;  2H88 C;  3CWB J;  3SWY A;  3H1L J;  5BU5 A;  2HPC B;  3L72 D;  2AEM A;  4KHX A;  2RH0 A;  1ZR2 A;  2LKM A;  3A0H H;  5TJH A;  5CJ4 A;  3TGU D;  2B87 A;  3OA7 A;  4NPE A;  4HYT B;  1RHZ B;  2JWD A;  3CX5 D;  3JCU H;  4L73 A;  2KSJ A;  3CCQ P;  1S1C X;  4DCK A;  3L73 E;  4H44 D;  2W90 A;  4PD4 I;  2OTJ P;  1JMM A;  1QVG O;  3MUD A;  1T8Z A;  2IYP A;  2YKQ A;  1QX8 A;  1NTK G;  3O8Z A;  3G6E P;  1VQ5 P;  1SQQ K;  1JUN A;  1M1K Q;  2H43 A;  1S5L H;  3MUD C;  2CK3 H;  2E74 D;  4EI2 A;  1XTC C;  3CX5 I;  3RBX A;  3WMM 0;  2JJL A;  3MD0 A;  3CCR P;  4DOJ A;  4ZMD A;  2RN0 A;  5AVX B;  3WUT A;  5AW4 B;  1NU1 K;  2J5U A;  2O1J A;  3B71 A;  3L75 G;  2W27 A;  2YMY A;  3AEC C;  1KIL C;  4IFD K;  3B5N B;  1USD A;  3H1L D;  3TK1 A;  1LT9 C;  1ZXG A;  3TSI A;  4C7R A;  4WVZ A;  3M91 A;  5KAI H;  1LT9 A;  2QA4 P;  1KFN A;  2XV5 A;  4Y99 B;  4OWF A;  1NHL A;  1OX3 A;  2JEE A;  3C1L A;  3KZI E;  3H1I E;  1H88 A;  1TU3 F;  4I7Z C;  4UB8 E;  1QEX A;  4PD4 E;  1EXJ A;  1FZF A;  1N7S D;  3ZDM A;  2C0W A;  2FYN B;  3V2N A;  1CZQ A;  3C8V A;  1PP9 G;  2G3A A;  2Y0D A;  1NTK E;  1FZE A;  1SQB K;  2GA1 A;  2QSI A;  2WSC H;  3GG2 A;  4GT1 A;  2YO2 A;  2R44 A;  1Q90 D;  4U7J A;  4HB1 A;  2P2U A;  3WU2 H;  5KLV J;  1IJD B;  3EFG A;  1BGY G;  3MIW A;  2HPC A;  1LT1 A;  2QJP B;  5KAF E;  4YXW H;  1T6A A;  3USS A;  5GTI E;  3H1L G;  2W6B A;  1DEE G;  1IFN A;  3CWB G;  3L72 E;  1L4A B;  1SQB J;  3GF3 A;  3H1I D;  4D6T D;  1JEK A;  1KQG B;  1JY3 O;  1E5W A;  2B9B A;  2OYO A;  4TLF A;  1L0L G;  1OW8 A;  2FXP A;  2E76 D;  5K5G B;  1DH3 A;  1AA0 A;  1KB9 I;  3L35 A;  1IFD A;  1KB9 E;  4PV1 C;  3VMX A;  1Y9B A;  4I2L C;  3H25 A;  2O01 J;  1SQX K;  4JYC A;  1SQQ G;  2HYN A;  2KS1 B;  2KOG A;  1BSN A;  3H1K E;  3P8C E;  3G3Z A;  4H13 D;  4IL6 X;  4QMA A;  3L73 J;  1NTM E;  2NPS D;  3BCC E;  2ZVN B;  1GL2 A;  4C7N B;  3CXH D;  4W7Y A;  2KS1 A;  4HKZ H;  4LGD E;  1PIX A;  1PGO A;  1VQ9 P;  2FKW B;  3D70 A;  1N73 C;  3FGA D;  3PRJ A;  2K3R A;  4BRY A;  4OH8 B;  3HTK A;  1LTJ A;  4H44 C;  5KLV D;  4JPZ B;  3Q5S A;  2KB7 P;  1VQK P;  1SFC B;  3L36 A;  5AW8 B;  2FFD C;  1H0T A;  3H1L E;  1BCC E;  3AE1 C;  1KN7 A;  2BCC E;  3L74 G;  1LT9 B;  3VP9 A;  1D7M A;  1LTJ B;  4W80 A;  1HF9 A;  2KNC B;  2FBW C;  5E79 E;  1L0L E;  3AE4 C;  1BGY D;  4U3F J;  2KIK A;  1NTM J;  3BCC J;  4D6T J;  1LGH B;  1JY2 P;  4Y99 C;  5APX A;  2SPZ A;  1NWQ A;  1AVY A;  1P84 H;  3K5B A;  3M9Q A;  3M9H A;  1NAY A;  2IFM A;  2YNY A;  3AE6 C;  1P84 D;  2I8D A;  3NMD A;  4YPC A;  4C46 A;  2PRR A;  2AXT H;  2NRG A;  1GU4 A;  4ASV A;  1EZV D;  1JY3 N;  3RK3 D;  1URQ D;  3H1K G;  2WT7 A;  1SQV E;  4EOT A;  3Q1M A;  4AQR D;  1NTM G;  3BCC G;  2WT7 B;  1NAF A;  3KHU A;  4KJM A;  2JR8 A;  2LXB A;  1N7S C;  3Q3D A;  1SQQ D;  1FC2 C;  1QL2 A;  1L0L D;  2O1K A;  2Q5U A;  1AV1 A;  1NKN A;  4WY4 B;  1LTG C;  1NTZ D;  5AW0 B;  1GD2 E;  5KJ7 D;  2YO3 A;  2QJK B;  2H8P D;  3JC2 2;  3NFQ A;  4NPF X;  1YHQ P;  2OTL P;  2L5G B;  2WMM A;  2M5A A;  1VQ8 P;  1GK4 A;  3MTU E;  2ZJS E;  4L75 A;  2YKP A;  3H1J D;  1MFZ A;  4YTP C;  2KLU A;  2BCC G;  2KYV A;  2PFX A;  3HUS A;  1HUC A;  3L74 E;  1KZU B;  1GZL A;  1ZOY C;  1QGK B;  2A45 I;  3A2A A;  3KZI H;  3L71 J;  4A7P A;  3RK3 C;  5CCH A;  1NU1 J;  2PP6 A;  2D2C C;  2YKO A;  3SWK A;  5CMZ A;  1CW5 A;  1ZRT D;  2QJK C;  1K04 A;  1KYO I;  1OW7 A;  1SQQ E;  2GUS A;  2Q6Q A;  1EZV G;  3H1H J;  3VMY A;  4XFJ A;  1FZC C;  4RKU J;  1GL2 B;  3H6P A;  3VOP A;  1NTM D;  1L2P A;  1PL5 A;  2K37 A;  2WIT A;  3AEB C;  2NZ2 A;  1SQQ J;  3BCC D;  2N1T A;  4JBZ A;  3WU2 E;  3CL3 D;  3TGU E;  2ZT9 D;  3A0B E;  1AQ5 A;  5CCG D;  5GTI H;  5KAF H;  1PGP A;  3H1J E;  1KQF B;  5APU A;  3T97 A;  1N73 B;  1LTS C;  5CJ0 A;  3RK2 D;  1M8O B;  5DJT B;  3AE2 C;  3E1I A;  4EYY Q;  2WTY A;  1Z56 A;  1L0N K;  2OTK E;  1GL2 C;  3IFM A;  4IOI H;  2KNC A;  3V2P A;  1JY2 O;  3V5B A;  1SQB G;  2BCC D;  4OGQ C;  1X0T A;  1LTT C;  1OW6 A;  3B8E B;  1BCC G;  3L72 G;  5AW6 B;  1SQP J;  2IBZ I;  4I6M C;  3VTP C;  1RF1 A;  2W8Z A;  1IFP A;  4R4L A;  3HE4 B;  1WMK A;  3L74 J;  3MGN A;  2WQY C;  3AE5 C;  4PV1 D;  3CCV P;  3E1R A;  3SFD C;  1Q82 Q;  5AVR B;  1G1J A;  1PGQ A;  3KPE A;  3RL0 g;  1P84 I;  1G2C B;  1W5C E;  1WT6 A;  2OYH C;  3BAS A;  1EZV E;  3V2Q A;  3MHV A;  3AE3 C;  2WPS A;  1Y8A A;  1PP9 D;  1R5S A;  2E75 D;  3CCE P;  2IPP A;  1IK9 A;  3EWK A;  4BXL A;  3CC4 P;  5B66 E;  1QVF O;  3TGU G;  1VPC A;  1IFM A;  1AJY A;  3H1J G;  4WY4 C;  2D2C D;  2P7J A;  1SQV K;  4PD4 H;  5CHX A;  4OGQ D;  2R32 A;  3KDP B;  5DJU B;  3H1H D;  2ZVO B;  5CBN A;  1N7L A;  1URQ C;  2FXM A;  2W83 C;  2WSS H;  1K05 A;  1PPJ D;  4M3L A;  1KTM A;  1NTK D;  3IF4 A;  1JTH A;  1J1E C;  3GMA A;  1KIL E;  2K9J A;  3H32 B;  3ITK A;  3JCU E;  1HWT C;  1EDJ A;  4KT0 J;  2KZJ A;  2QVA A;  2YIU C;  5BVZ A;  1S9K D;  2FYU K;  1RY3 A;  2N1T B;  4RES B;  4AYC A;  3SWF A;  1JNM A;  1T3J A;  3TNU B;  3CI9 A;  1L0N D;  1OVU A;  2AEJ A;  2JP3 A;  1GK6 A;  1VL2 A;  2Y0E A;  1CI6 B;  2YXQ B;  3G9R A;  3L71 D;  4N78 D;  4PJ0 H;  1NU1 D;  2PAJ A;  1PP9 J;  3L70 G;  1J1E B;  2E74 C;  1YTZ T;  4BWN A;  2CPB A;  1KB9 D;  3PHL A;  1M90 Q;  1RQU A;  3HD7 B;  5L8R J;  2J58 A;  1RF0 C;  3TNU A;  5CBO A;  1KYO D;  3W67 A;  3T97 B;  2N9Y B;  2N1T C;  4N3Y B;  1FOS F;  1JB0 J;  3M0A A;  2MJZ A;  3GF7 A;  3S4R A;  3OJA B;  3U59 A;  1OIP A;  1L0L K;  1J1D C;  1BCC J;  2KK7 A;  3CX5 H;  1K8A Q;  3N4X A;  1ZLL A;  5AW5 B;  3I55 P;  1Q86 Q;  4RJT A;  3Q5P A;  2J59 M;  2WPV B;  3HRN A;  5AVU B;  3H1I J;  3CXH E;  4H0L D;  1OMI A;  3HD7 C;  1DIP A;  4JF7 A;  3RK2 C;  1YI2 P;  1EDL A;  1PV3 A;  1NYH A;  5APQ A;  4ZKU A;  2O01 H;  2IZ1 A;  3KXD A;  5AVY B;  2A06 E;  1YIJ P;  2OYH B;  3QH9 A;  3M06 A;  4XE5 B;  5APS A;  1BCC D;  1RQV A;  4OVN F;  1T2K C;  5E79 H;  2M3E A;  3H1I G;  4UB6 H;  1SQP E;  1VQL P;  2LR2 A;  2FYZ A;  3A0H E;  3AEA C;  3GHG A;  3TGU J;  3IR9 A;  1R8E A;  3V2R A;  1NTK J;  1X9V A;  2O3J A;  3L70 E;  1USE A;  1EXI A;  1BE3 G;  4B86 A;  5KLV G;  2H89 C;  3IN6 A;  5APT A;  1M1J C;  5AVV B;  3GHG B;  3H1H E;  5AVS B;  3U1A A;  1NH4 A;  2WPR A;  3CLQ A;  1LJ2 A;  1KMI Z;  1NTZ K;  1SQB E;  3L70 J;  5KLI B;  2K9J B;  3H32 A;  3RK3 E;  4I1L A;  1Y47 A;  2FYU G; 
#chains in the Genus database with same CATH homology
 1RF1 C;  5AW2 B;  2HG5 D;  5KJ7 C;  1M1J B;  2XNX A;  1OWA A;  3RL0 C;  2R5D A;  3KQG A;  1SFC C;  3P7K A;  2FFD B;  2XKM A;  3BAT A;  3KYQ A;  5AVQ B;  1RE3 A;  1WRG A;  1FBM A;  1ZV8 A;  2R5B A;  3RL0 B;  5CCH D;  2WSE H;  3II6 A;  1HBW A;  3B5N D;  2I1J A;  2WZ7 A;  1X8Y A;  1GTW A;  1A02 F;  4AUW A;  1SLQ A;  1QL1 A;  1J2J B;  1FJK A;  1GL2 D;  2WWW A;  2NPS A;  1SFC A;  1FZG A;  2A45 G;  2CPS A;  1KQL A;  2GUV A;  3B5N A;  2A45 H;  5AVW B;  5AVZ B;  1RF0 A;  1SQP K;  4IFF A;  2C9N Y;  3PP5 A;  3A7O A;  5APY A;  1DEB A;  2H7H A;  1L4A A;  1FDM A;  2P67 A;  1LTJ C;  2HFE D;  2HOD A;  2ZFC A;  1NTK K;  3L37 A;  3UIA A;  4O9B A;  2POH A;  2IFN A;  1GDT A;  1IO4 A;  1PFI A;  3OAK A;  5KJ7 A;  1ZR4 A;  1JCD A;  1HGV A;  3HUS B;  1LWU A;  1MUU A;  1NO4 A;  4C7N A;  1KIL D;  1HVV A;  1S9K E;  3R2P A;  1LWU B;  1JY2 N;  5APV A;  4HH2 A;  2W6A A;  1KFM A;  3L4F A;  3A3Y B;  2XZR A;  2P1J A;  2QM8 A;  1IC2 A;  5AW1 B;  2NPS B;  1N73 A;  3VYI A;  1T3U A;  3I5C A;  5KTB A;  4ZKP A;  5AW9 B;  5AW7 B;  1SVF A;  3HTK B;  1NKZ B;  3LID A;  1HTL C;  1MZ9 A;  5CCG A;  1FZC B;  1SFC D;  1URQ B;  2OYI C;  2NPS C;  3BVH A;  2WSF H;  1YYC A;  3N7N A;  1XTG B;  3NXS A;  1FZC A;  2E42 A;  1GU5 A;  2KLV A;  2ZXE B;  2E43 A;  2HOD B;  3VN0 A;  2R3C A;  3P8C D;  1FZA A;  1OXZ A;  5AVT B;  2KP8 A;  4WY4 D;  1J1D B;  3M0D A;  4W7Z A;  3VMZ A;  1FZB A;  2OAR A;  2OYI A;  3HUS C;  1VDF A;  4GIF A;  3TYY A;  3M0D C;  1JTH B;  4IFM A;  3RK2 B;  1AFO A;  2Q9I A;  1T2K D;  2M8R A;  2Q7C A;  2HLO A;  1LWU C;  1N7S A;  1L4A C;  1ZN5 A;  5BU8 B;  1DX7 A;  2N9B A;  1NOH A;  4GKG A;  3HD7 A;  3HE4 A;  1N7S B;  3LIE A;  3V4Q A;  1URQ A;  1A02 J;  1LTB C;  5APW A;  1G2C A;  2XU6 A;  5CCH C;  1LTA C;  1GW3 A;  1IFJ A;  3C9I A;  1L4A D;  3RL0 D;  1RF1 B;  3LW5 H;  5CCG C;  2Z5I A;  4XA4 A;  2I1K A;  4WB4 A;  2GM4 A;  2Z5H A;  4WY4 A;  2OYH A;  2C9L Y;  3BRV B;  1HH0 A;  1FJP A;  1GW4 A;  1EQ7 A;  1CSB A;  3P32 A;  1JY3 P;  3HE5 B;  1JOC A;  3V4W A;  1IFI A;  1FAV A;  3M9B A;  1N86 A;  3HE5 A;  1RE3 C;  1H89 A;  2Z4E A;  3P8M C;  3NTN A;  2XDJ A;  1H8A A;  1N2D C;  3GHG C;  4LLH A;  1RE4 C;  2N1T D;  1CI6 A;  1FOS E;  3BRT B;  1RE4 A;  2QM7 A;  3VP8 A;  1W2E A;  3A5T A;  3RK3 B;  1KIL A;  2BAS A;  3HD7 D;  1NTM K;  2WPQ A;  2VRS A;  1KIL B;  3B5N C;  1JO5 A;  1G1I A;  2IX7 C;  4LC1 A;  2Q3I A;  1HJB A;  3EQ2 A;  1M7L A;  2C0X A;  1FU1 A;  1YTZ I;  1JCC A;  2M3B A;  4JYB A;  4N6J A;  1X79 B;  4N78 E;  1LTI C;  5KLV K;  1SP4 A;  1HGZ A;  1M1J A;  4WBA A;  2FFD A;  1MV8 A;  3SWY A;  5BU5 A;  2HPC B;  4KHX A;  1ZR2 A;  2LKM A;  5CJ4 A;  3OA7 A;  4HYT B;  2KSJ A;  1JMM A;  3MUD A;  1T8Z A;  2YKQ A;  3O8Z A;  1JUN A;  1SQQ K;  2H43 A;  1XTC C;  3WMM 0;  2JJL A;  3MD0 A;  4DOJ A;  5AVX B;  5AW4 B;  1NU1 K;  2O1J A;  2W27 A;  2YMY A;  1KIL C;  4IFD K;  3B5N B;  3TK1 A;  1LT9 C;  3TSI A;  4C7R A;  3M91 A;  1LT9 A;  1KFN A;  2XV5 A;  4Y99 B;  1NHL A;  2JEE A;  1H88 A;  1FZF A;  1N7S D;  2C0W A;  3V2N A;  1CZQ A;  1FZE A;  1SQB K;  2WSC H;  4GT1 A;  2YO2 A;  2P2U A;  1IJD B;  3EFG A;  3MIW A;  2HPC A;  2W6B A;  1IFN A;  1L4A B;  1JY3 O;  1E5W A;  1DH3 A;  3L35 A;  1IFD A;  3VMX A;  4I2L C;  1SQX K;  4JYC A;  2HYN A;  2KOG A;  3P8C E;  3G3Z A;  2NPS D;  1GL2 A;  4C7N B;  4W7Y A;  4LGD E;  2FKW B;  1N73 C;  4OH8 B;  3HTK A;  1LTJ A;  2KB7 P;  1SFC B;  3L36 A;  5AW8 B;  2FFD C;  1LT9 B;  3VP9 A;  1LTJ B;  4W80 A;  1LGH B;  1JY2 P;  4Y99 C;  5APX A;  1NWQ A;  3M9H A;  3M9Q A;  4C46 A;  2YNY A;  2IFM A;  4DZO A;  2WT7 A;  3NMD A;  1GU4 A;  1JY3 N;  3RK3 D;  1URQ D;  4EOT A;  4AQR D;  2WT7 B;  1NAF A;  1N7S C;  1QL2 A;  2O1K A;  4WY4 B;  2Q5U A;  1NKN A;  1LTG C;  5AW0 B;  1GD2 E;  5KJ7 D;  2YO3 A;  2H8P D;  3NFQ A;  2L5G B;  1GK4 A;  3MTU E;  3U1C A;  2YKP A;  1MFZ A;  2KYV A;  5AW3 B;  3HUS A;  1HUC A;  1KZU B;  1GZL A;  2A45 I;  3A2A A;  3RK3 C;  5CCH A;  2PP6 A;  1CW5 A;  2YKO A;  5CMZ A;  2GUS A;  3VMY A;  1FZC C;  1GL2 B;  3H6P A;  3VOP A;  2OYI B;  2WIT A;  2N1T A;  3CL3 D;  1AQ5 A;  5CCG D;  5APU A;  3T97 A;  1N73 B;  1LTS C;  5CJ0 A;  3RK2 D;  3E1I A;  2WTY A;  1Z56 A;  1L0N K;  3IFM A;  1GL2 C;  3V2P A;  1FOS F;  4EIJ A;  3V5B A;  1JY2 O;  5AW6 B;  1LTT C;  3B8E B;  4I6M C;  3VTP C;  1RF1 A;  3HE4 B;  3MGN A;  5AVR B;  1G1J A;  3KPE A;  1G2C B;  2OYH C;  1WT6 A;  3BAS A;  3V2Q A;  2WPS A;  2IPP A;  1IK9 A;  1VPC A;  1IFM A;  4WY4 C;  2P7J A;  1SQV K;  5CHX A;  2R32 A;  3KDP B;  1N7L A;  1URQ C;  2FXM A;  4M3L A;  1JTH A;  1J1E C;  3H32 B;  1HWT C;  5BVZ A;  1S9K D;  2FYU K;  1RY3 A;  2N1T B;  4RES B;  4AYC A;  3SWF A;  1JNM A;  1T3J A;  3TNU B;  3CI9 A;  1GK6 A;  1CI6 B;  4N78 D;  2PAJ A;  1J1E B;  1YTZ T;  2CPB A;  3HD7 B;  3TNU A;  2J58 A;  1RF0 C;  2N1T C;  4N3Y B;  3M0A A;  2MJZ A;  3OJA B;  3U59 A;  1L0L K;  1J1D C;  3N4X A;  1ZLL A;  5AW5 B;  2J59 M;  3HRN A;  5AVU B;  3HD7 C;  4JF7 A;  3RK2 C;  4ZKU A;  5APQ A;  2O01 H;  5AVY B;  2OYH B;  3M06 A;  4XE5 B;  5APS A;  1T2K C;  2FYZ A;  3GHG A;  3IR9 A;  3V2R A;  1X9V A;  4B86 A;  5APT A;  1M1J C;  5AVV B;  3GHG B;  5AVS B;  3U1A A;  1NH4 A;  2WPR A;  3CLQ A;  1NTZ K;  3H32 A;  4I1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...