4H0LB

Cytochrome b6f complex crystal structure from mastigocladus laminosus with n-side inhibitor nqno
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4h0lB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h0lB01
2FYNC 1JB0J 2YIUC 5L8RJ 4H44B 2O01J 4PV1B 3LW5J 4I7ZB 2WPVB 5KKZC 2QJPC 2QJYC 1S5LX 2K9YA 1Q90D 2E75B 5KLIC 2ZT9B 4IL6X 2E76B 1ZRTE 2D2CB 2E74B 2WSCJ 2QIWA 2WSEJ 4RKUJ 2QSIA 3C8VA 4H0LB 2WSFJ 4Y28J 4OGQB 4H13B 2QJKC 1VF5B 4KT0J
chains in the Genus database with same CATH superfamily
4KHPB 2UXNA 3C90A 4XBFA 4LF7B 3RK3C 4H13D 3NTNA 3M99B 4C46A 2DQ0A 1SQQE 3ASOB 4JI4O 3EVKA 2Q6AA 5LHGA 1ZL8A 3HKEB 4CC5A 3OUSA 1UJWB 5FPRA 4IFDK 1QNMA 2FY8A 1GZLA 1BS3A 2OYIB 1ZLLA 4OVNF 1Q86Q 4CZZA 1JFFB 2R32A 3AEFC 2GUZA 3L9DA 5H9CA 4YXWH 3MTUE 1M1JA 3GB7C 1RP3B 1FZFA 3P30A 1Q6UA 4DV3O 3EXAA 2K1AA 1KBHA 3RBXA 2KG7A 2UUBB 4DCKA 1YI2P 1K5QA 1M4UA 1YCIA 1DGSA 4AILC 1US6A 3ZMVA 4TQFA 5GTHH 3A0HZ 1I5XA 5KAFE 5IJ0A 2M0BA 5EYPA 4PA9A 1URFA 1U97A 2R5DA 3G4SV 2K9JA 5CBNA 3JAWA 2WSCJ 1T2KC 1PNMA 2WSEJ 3L72J 1NJIW 3HD7C 3NR7A 3UO2A 1IBMO 4UVCA 4FFBA 2E5LB 1LUVA 5A9GA 3K9AA 3EWKA 2CTPA 4DV4B 1WB8A 2I1KA 1HH0A 5CJ4A 3K5OA 3MD0A 4DR7O 3RL0g 1XHZA 2WT7B 4CS3A 3QO5A 1A02J 3IN6A 3ICXA 1ROPA 1HDJA 3A0HE 4JI1O 2CPSA 1QLNA 3V2PA 3EQ2A 1JMBA 1X79B 1N2DC 2R3SA 2BCCH 4BAYA 2BASA 3H1HD 1KTMA 3L35A 1E5WA 3O8ZA 1R3JC 1AI7A 1LR1A 4DV6O 2ZR3A 1HTLC 5AVWB 1EZJA 3I56P 1N8RQ 4U7NA 3TK1A 4X9QA 2Y4UA 2R9AA 5B66Z 2PY5A 1ZTEA 4PJ0E 4B3TB 1RF0A 4TSFG 4UB8H 2Q7HA 1SQXG 2L6LA 1L0LE 2BTQB 1VQ7P 5FPOA 3SYQA 2BTOA 1QLEC 3TXSA 1Z5VA 5CBOA 1PP9E 2ZM6B 3HPLC 1DX7A 2WPDG 1R3LC 4JV5B 3RK3B 4BIUA 1H2LA 4MTGA 1MABG 5KHHA 5JH7B 5LA6B 1FZGA 2B5UA 1AJNA 4DW1A 2JP3A 2XAHA 4FLUA 1D2DA 1ZRTD 4DR2B 4GLXA 4DT0A 1OZHA 1NTMG 1IO4A 2Y48A 2OYOA 1M57C 3HE5B 1XEQA 4KHPO 2DW4A 1AVMA 4LF5O 3L4FA 3CWBJ 1MG1A 2L5GB 3KQGA 4X1KA 4H0LB 4ASVA 3H1IH 2V4DA 3GWOA 4JI4B 1B6QA 3E2EA 2ZXXA 1L0NG 2ZIMA 4XE5B 4YY3O 2VQEO 1VQ8V 1UPGA 2YNYA 3OE7G 1PKXA 2W6JG 4WF9V 1JTHA 2QWRB 3ZS8C 3STLC 1SQXK 4FFBB 4DV3B 1NAYA 4Z1MH 1OCRC 1RSOB 1PP9D 2EIKC 5IDJA 4I50B 1W2BU 3K08A 1JMMA 2WLLB 1W5CE 1EN5A 2OYHB 2XZRA 1U57A 4N3YB 5H5NA 4YXDC 2Z5HA 5DJUB 5IYZA 2H3OA 2O01J 5TJHA 1XMQB 2UXBB 1EBOA 4N6JA 1NU1E 1K34A 5KMGA 2J58A 1G4YB 3CMEV 1K4CC 1L2PA 4ZI7A 1USDA 5J2UB 3JARB 3JSNA 2G8YA 3B5NA 3LIEA 1K9MW 1YDXA 1KYOI 2WA4A 3FB8C 3VOPA 5CA1B 3C3SA 3D70A 4J7JA 1L0LG 3LDDA 4FLTA 2E42A 1Q7YW 3RW0A 3ZMTA 5EIBC 2R70A 5C8YA 3SPGA 2BTQA 2OYQA 3H1HE 2OCCB 3LW5J 3UT5B 3S3WA 3H1KJ 4I5SA 2K9YA 3SFEC 4MSWC 2Q68A 4JGSA 4ZOLB 1B06A 4JI5B 1S5LE 3L75E 1LJ2A 3H1KG 4EOTA 1FAFA 3K9SA 2QSIA 3CCLP 3C8VA 2WSFH 2WZ7A 4IT5A 1ZSPA 3HR0A 1F7YA 2YXHA 1T3UA 4DR6B 2ZFCA 3II6A 5LHHA 3BA9A 3G71V 4RQEA 1GW4A 3HD7A 1LT1A 2OQQA 4WFHA 3JD2A 3CC7P 3VP9A 2QM7A 2HPCA 2RNBA 3OTFA 1IK9A 2H7HA 2FYZA 1XNRB 3OR7C 2IFNA 4JV5O 5EBWC 1JY2P 3MZWB 2UWJE 1JO5A 4RQFA 5TISZ 2XOKG 4DR4O 2Z5IA 2HPCB 3KKYA 2KS1B 5B5EZ 1KB9D 4L75A 1TGOA 1KKCA 2BCCD 3H1JJ 4LFBO 1N33O 4RUFA 1SQVE 2ZM6O 1GL2C 5KLIB 1JY3P 4N21A 1FPOA 3L70H 1SQPD 4I50A 3N2GA 5APUA 1HNZB 4CBCA 1EM1A 1N4CA 3F5HA 3RK3E 4JI3B 4X1IA 4MVMA 2KSJA 1DLBA 3G80A 2QJYC 4NPEA 3D6ZA 4LP8A 2KS1A 4WY4B 2HR3A 1THZA 1O9HA 2ZKOA 1Y67A 3NMDA 1N73B 5IJ9A 4GKKB 4IL6H 4NKGB 5JJEB 3D3IA 2QEXV 1SESA 2XNDG 2YDEA 3SJAC 1FJGB 1VQ6V 1PIXA 1J1DB 3W67A 3AK1A 5J2TB 1SC5B 5JQGA 3CCQV 4L8JA 5L8RJ 1NWQA 1TVKB 5GTHZ 1N7SD 4JYAO 1FE6A 5CBHA 1JFFA 4J41A 5CBGA 4QGPA 4R7CA 5CB4B 4YY3B 2VQEB 4PD4D 5KTBA 4K8XA 1KQLA 3JCUE 2FXMA 4L74A 5L3DA 4R8CA 1KP3A 1BE3E 4KJMA 1MZFA 4UB8E 3CS5A 4WFBV 5JQGB 1RPOA 1MMMA 2R9IA 4EIJA 2JK5C 2M6YA 3A8TA 1DH3A 5KUMA 3B8NA 3G67A 3A7OA 1FJKA 2ITAA 2Y69C 1TUBB 2ZYAA 1LUWA 3AG2B 5KLVE 2K9JB 2KI7B 1P84F 4CPGA 3J81N 3L72G 4JBZA 3KYQA 4X1KB 2E76D 5DM6V 3FGAD 1QVGO 1ZV8A 4PA3A 1Y4MA 1KYOE 1OW6A 2F95B 1H38A 1XMQO 2UXBO 1KYOH 3CMEP 3GVMA 2YXRB 1VQPV 1VQ5V 4L87A 3LIDA 2XASA 4JQ0D 1NQTA 2WSFJ 1EZVE 1H88A 2F43G 4I55A 1L8DA 4GX0A 1SQVG 3M06A 4K35A 4UCOA 1BZKA 5DECA 2E5TA 2GM4A 2L91A 3AG7A 4FFKA 2Q67A 3FX7A 4FLYA 5CBFA 1SFCA 1AI5A 1SQBG 2V7QJ 1ZWIC 3CCVV 4A5UB 3SPCA 2O1JA 4Z1MG 5B1BB 5LYJA 5A2QN 4I4TB 3VQXA 2GDSA 3BA8A 1SQBJ 1LP1A 2OCCC 2CK3G 1XI1A 3W68A 5JJNB 3TNUB 1KB9H 1JCDA 3P7KA 2MK3A 1EDJA 5KJ7A 3GWKC 4IL6E 4R4LA 4F6RA 1NTKG 2R72A 2FXOA 2OTLV 3H1LG 2IZ1A 2FYUJ 1VQ8P 1DTOA 5LYJB 1L0LK 1N86A 2DWDC 3JATA 3OT7A 5HFLA 3FWNA 3RVYA 1LP1B 1G1JA 4JAVA 1NVPB 1PPJE 3DXRA 5KHKA 3VP8A 3GMAA 3EFGA 5AW4B 5LP6B 4NYKA 2WSCH 3ZMUA 1RE3C 2ZNJA 2OTJP 5LGUA 2BEQD 3IC7A 3H1JG 5TISE 1SZXA 1OFCX 1PFIA 2UUAO 3E7KA 1KYOF 2EIMB 3T1YO 4GOEA 4BIOA 4TQDA 2ZXWC 1K73W 1H0TB 3FAVA 1LT9B 2ZJSE 1BSNA 4D6TG 5C39A 1NTKE 4JI6B 1VQNP 1AFOA 4DXWA 1FJPA 3L75J 3QWOC 3HRNA 3RYIA 1AJPA 5LMNO 4D6TJ 4PJ0Z 5B66E 5EBMC 3O6QB 2H94A 2Q9IA 4O2BB 3GHGC 2RMKB 1F51A 2PYJA 1SA0B 2XNXA 1Q8IA 3R65A 1MFTA 4Q6GA 2C0XA 4XDKA 1XDCA 5E79E 1PPJH 2A9HA 3VOUA 3HE4B 1BE3D 1BGYG 1PL5A 3CCMV 3TJTA 1DEBA 4PV1B 3SPHA 4DK1A 5AW5B 2EULA 3G6BA 2YXLA 1GM9A 1K73Q 2K9PA 3K5BA 1WAZA 3CCVP 3OTOO 1GK4A 2MW2B 5IYZB 4FLXA 2RDCA 3ZN1A 3CJHA 4J80A 2GUZB 3TETA 3AE4C 4XDLA 1JY2O 4TWKA 2LR2A 3U1AA 4HAMA 3H1JE 4C7NA 3RK2B 2HFEC 3OUFA 2E74C 2YICA 2A06E 4WB4A 3UIAA 1NGMB 1FS0G 5IYCO 3SR2C 3L71E 3WUTA 1SLQA 4UFZA 2ZR2A 3H25A 1QX8A 5APQA 1DF4A 2YIAA 1KILE 1SQGA 3MP7B 1L0LH 5IT9N 4LF4O 1NH2B 4MTXA 4IYHA 3N2KA 5AVQB 2OCHA 2IYOA 2WPQA 1KQGB 4J9ZB 3CYOA 4UVBA 1N34O 4DR5B 4MTFA 3RWRD 5AW7B 2BOCC 4LH7A 3CPWU 2N1TB 5CMZA 3DSQA 5CCHC 3OA7A 5LGNA 4WY4A 4TOIA 4FMTA 2Q73A 1T6AA 3M91A 3ZRSA 2EX3A 4DV5B 1RE4C 1NZ6A 2ZAEB 3L37A 2QA4P 2YMYA 5KKZB 2PZSA 3ZIAG 1F23A 3HUSC 3VQYA 4DV1B 1IBKB 3H32A 1DK1A 3OEEG 3CWBE 1KP2A 3ZRXA 1WN7A 1Q6HA 1JVMA 3AG1B 1JY3O 3ABLC 1SQVH 1RQUA 1K3EA 3CCRV 1SFCC 2CTRA 2AEFA 1FZCB 5CCHA 1NVOA 2Q7CA 4BW5A 2VQFO 1FOSE 2EZOA 1GK9A 3FXEA 3L73D 4LCUC 3D6YA 5KKZC 4QNHB 2DMXA 1NTKH 3CX5F 2OYIA 2AXTH 1BE3J 4LF8B 4KHXA 4FZ1A 1HR0O 3L74D 1FFTB 2FXPA 5APTA 4JI6O 3HKBB 2ZQMA 4W80A 1IDSA 2LGWA 2UXXA 2IBZD 3AE8C 1JEKA 3UM7A 4OGQC 2XHBA 1NU1D 1VL2A 1G1IA 4PJ0H 2LO1A 4MVSA 5KX5A 2DE0X 1FOSF 3T1YB 2V4HA 4AHCA 3TNUA 3CRCA 2QE7H 3A2AA 2IW5A 1HUCA 3NFQA 3WMM0 4G27B 4O4HA 1ZXGA 5D5QA 4JYYA 2HYNA 1E79G 3RFRA 4IL6X 4RO0A 1GMJA 2Z5UA 5KAIH 3LSSA 1EZVG 5LMNB 2M5AB 2QVAA 2Y0PA 5AVXB 1SQXH 4JI0B 1GN2A 2IH1C 1P84I 2WLIA 1GW3A 1YEWA 4TUYB 1GM8A 2ZCEA 3CP1A 3CRAA 1PD3A 3BHPA 5FNVB 4WFFA 2ZNIA 1RY3A 3JSVC 3ZDMA 2L35A 3RL0B 2QGNA 1CI6A 1M5IA 2NLJC 3LUTB 3U0ZA 2WSSG 3ZRVA 5B1AB 4YJ2B 1I94B 2KK7A 1PM9A 4O4IA 2LKMA 1P84H 4H13B 4W7YA 4WVZA 3ETQA 1NJIQ 1COWG 1LTBC 2NPSD 3H1LE 3SSUA 3OMAB 1KKDA 2EZPA 1ZR2A 1A02F 4P9OA 1PPJD 3R66A 2PI5A 1M9NA 4YJ2A 4FLVA 2XTAA 2ITCC 4GZRB 2B1GA 3FB6C 3TF5A 1Q86W 4TT3H 4DR5O 1N36B 3SGIA 2D3OW 2Q69A 1KC8W 2QIWA 1KB9E 3BFRA 1PZQA 4DR1O 2B87A 2EIMC 1G8MA 4HZ3A 5CN0A 3D36C 1SQVJ 4DV5O 1URQB 3L70E 4ZIBA 2XAFA 3RGBA 1OCCC 1R73A 3MIWA 1I5YA 5APYA 1WRGA 1DD4A 3AG2C 3K5LA 1IZNB 2IU3A 2GHYA 3G3ZA 2N1TC 3GF7A 1P84D 3M0AA 1KQSU 4GT1A 1Q7YQ 2YKPA 3I5CA 3B5ND 1IFPA 3L70D 1NTKJ 2RCVA 1RQVA 2IBZH 3FYEB 4B3SO 1S3JA 4I0XA 1MFZA 3CX5H 4IFMA 4RWUA 3I55V 4CH3A 2BSKB 1JJOA 3AG3B 2WSSH 5KX5B 2ZVNB 2HJFC 3CXHE 1OVVA 4JI2O 1G1XB 1K92A 2P7JA 4LH6A 1NTZD 2HG5C 4R50A 4U3FH 2FBWC 2K88A 2P4VA 4DR3B 3AE3C 2NPSA 2G3AA 2UXCB 2AXTZ 3PP5A 3CXHD 4DV2B 4FLZA 5L3GA 1FD9A 4GX5A 2E76B 3H9VA 5J2UA 4UB6Z 1M93A 2VWKA 1WP7A 2WITA 1KC8Q 5ITZA 1NBMG 3RBZA 1EXIA 3R2PA 2RN0A 3ASNC 3E83A 1SP4A 2QJ1A 3L75G 2KOGA 2QE7G 1S0VA 1GL2D 1HR0B 3BRVB 3B09A 1IFIA 1FS0E 1BCCD 5CB4A 1NTZK 3O6QA 2PUSA 2RN9A 1FBMA 2WTYA 5KHIA 2QJPC 1TAEA 2JDIG 3A0BH 3QH9A 3GF3A 1G2CB 3OGIB 1QQCA 4B7EA 5KAFZ 3K58A 2PAJA 1FAVA 2XAGA 1L0ND 1QLED 3TGUH 1EXJA 2P7TC 1DD3A 1TUEB 1R3IC 2ZE6A 2CPBA 3SPIA 3AEDC 1K8AQ 3PJSK 4UCVA 3CEIA 2EJRA 1SRYA 1JPXA 1LTJA 4J11A 5JH7A 3JCUZ 1PNKA 1PP9G 3L71J 2LW1A 2VRSA 5BY1A 2WPVB 3V2QA 3ETEA 1S76D 1R6TA 2ZXWB 2PYLA 3L74E 1J1EB 3SJQC 3OMNB 5KLVK 2F4VO 4O2AA 4LF9O 1ZRTE 1MZ9A 2P5OA 1VQMP 1URQA 1Y9BA 1FDIA 4F6EA 1P49A 1YTFB 5LMUB 1W59A 2BCCE 3ZHSA 2FYUE 3ZHRA 1L1FA 3PH0A 1R6NA 3MGNA 1SQBD 1QGKB 5CCGD 5JWPA 3BABA 3DTUB 3D3QA 2M8RA 3K0DA 4PI0A 1J1EC 2OIEA 3TSIA 3SYCA 3ZHQA 1V55C 3VBBA 1RSOA 2FYUK 1Y6XA 1LNQA 2QWPB 3E35A 3HE5A 2KSEA 1P4RA 1E1RG 1EDIA 2X7RB 1EZVI 1K04A 2RH0A 4YJ3B 1VF7A 1AR5A 2W0FC 2OTKE 2R44A 1IXMA 1JX9A 1YJ9P 4KFMA 2HVKC 1T5EA 3KPEA 1TA8A 1WA8B 3BCCG 1MSDA 2CDYA 1AVOA 4JF7A 3CMAP 3U11A 1VQ7V 2AHZA 3JAKA 1SQVK 1D5NA 1LTIC 4ASUG 1WNSA 4QE7A 4DR3O 1PGQA 4ASWA 1XNRO 1D5AA 2FYUG 5F2VO 3ABLB 3JARA 3AEBC 2A06H 3V6IA 1AROP 1HNXO 5L3CA 2B89A 3AEEC 1VMGA 1JOYA 1YBKA 2N1TA 3AK3A 3L71H 1OIPA 3TYYA 3P8MC 2CGNA 5EIBD 1CZQA 1VQLP 1W2BO 5GTIH 1SQPK 1URQD 4NPDA 1KB9F 2G38A 4O4JB 4QE9A 3DXRB 1EN6A 1VQMV 5LBQA 1ZUQA 4ZHQA 2M3EA 1FZBA 1PP9H 1OCZB 2SPZA 4W4LA 4C7UA 2DYRB 1HNZO 3CC2V 1RE4A 4I6MC 1M90Q 4JI8O 3RK2D 3LNMB 4WCEV 1WB7A 2K37A 4U3FD 2ADPA 2YEVA 1V55B 4AUWA 2JR8A 4U3FJ 3JC22 1VF6C 1S4XA 1NR7A 4IYIA 4D7SA 5CMUA 2Q3IA 5L3EA 4K8ZA 1JY3N 2YMKA 2LQTA 4JF3A 2JGUA 3B77A 3SDLA 3Q5PA 1XREA 4BWAA 4NXMO 4CH6A 3RYIB 5IY5B 4JYAB 3PRJA 2ZDIC 5FL7G 5LXTA 3KZIH 4I9WA 3HKBA 2KXPB 2JS3A 4TV9A 3K04A 3T2MA 2OYHA 3T97A 1YJNV 2Y0CA 3CSXA 1SF9A 3LDCA 3RL0D 3FFQA 4FM1A 4UXNA 4GDOA 1YI2V 1WPXA 3HKDA 1YTZT 5BXZA 1FC2C 4AQYB 1AP5A 4UCUA 1NU1K 1F4MA 1Q5OA 3SJBC 1NKDA 4CC6A 1L0NH 3FYIB 1L4AD 4MS2A 3WFVA 2QJKB 1BE3H 4OWFA 4HH2A 5IE9A 2H8PC 1WMKA 2Y0EA 1RHZB 2YO2A 4LF9B 2HVJC 2DN9A 1S77D 1J5EB 1SQBK 3TGUD 1VF5C 3MHVA 3RK3D 2KB1A 2E5LO 1H0TA 4K0KB 4H13C 3SYAA 2H43A 2NZ2A 4WY4D 4ZKUA 4WBAA 2QJPB 3E8HA 1JCCA 3LDEA 4FLWA 1IURA 2Q7EA 1CP9A 4LGDE 2HLOA 1H8EG 3AG1C 1LT9C 3CX5E 3M9HA 1AI6A 3ZBHA 1YIJV 1BQZA 3ASNB 1KILC 4YTPC 1Y8AA 4X1IB 2W8ZA 3LSUA 1SQVD 5EFWB 3SWKA 3HUSB 1KORA 3VQWA 4BXLA 3FKSG 1FZCA 2LW7A 1M7LA 4DJGA 4YHHO 2POHA 3JYCA 3S1KA 2YXQB 1VQ4V 3CRQA 3KXDA 1H8HG 4CS4A 1L4AB 2D2CC 5AVZB 2A3QA 2QKAA 3FAVB 1Q6IA 3SYOA 5CHXA 4BR6A 3IFXA 2IM9A 3ABKB 2E75B 1Z2GA 4DUYO 1YHQV 1SQPJ 1ZN5A 1ZW0A 5AVUB 4L73A 4FJCC 1H2NA 2NNUA 2GTAA 3BRTB 3ZN0A 2NRGA 4C7NB 1L4AA 4OGQB 1EDKA 3BATA 4XDJA 2J5UA 3H1LJ 1Y74B 3RT3C 3MAQA 4HYTB 1AQ5A 2WPSA 3J7AU 3LSQA 5DEDA 4X62B 2N04A 2JWDA 5TISH 2DYRC 1YITP 2IX7C 4FPPA 3IC9A 5B5EH 3S9OA 1HNWB 1SQXD 2KP8A 3BEHA 4N78D 2QM4A 2I8DA 5IWAB 2ZYGA 2Q0AA 2UUAB 2Z3YA 2F66C 4PDVA 2P6JA 2PGDA 3KG2A 2FKWB 4JTCB 1YJ9V 4YJ3A 3RVZA 3H1IE 5APVA 2YIDA 1QR9A 1JTHB 4UB8Z 1X4TA 1N73A 3JD1A 3L71G 3M9QA 1GN3A 1GTOA 1NH2D 4WFGA 2ZE5A 1BSMA 4AQRD 3IF4A 2FB5A 1NTMD 2A79B 1YZBA 2BE3A 2QDOA 1G2CA 4N23A 5HFMA 5J2TA 1OCRB 4NXNO 1RF1B 2Y0DA 1FXKB 4LFAB 3VTPC 2IZ0A 1XTCC 1WPBA 4FZ0A 3EHBB 3HTKB 4OPHA 5IYBO 1M1KQ 3KZIZ 3MDSA 3K57A 2O57A 2RMZA 3ABMB 1KMIZ 3OR6C 1L0NJ 1R8EA 1T2KD 3UKMA 1JCHA 4NPFX 4LF7O 4NXMB 4AQYO 1FXKA 1YTFD 4X20B 4H0LC 2FKXA 4GODA 1BGYJ 2BEZF 1MOFA 1SQQK 2IPPA 1PPJG 1VQNV 2UXDO 2W0XA 3OFNG 4GUNA 4P9PA 2PP6A 2QRXA 4O2AB 1TUBA 1NAFA 2VS0A 3CC2P 4PDMA 3C3TA 4GX1A 3CCSV 1SQQH 5M1BA 1WA8A 1XBLA 1N32B 2Q5ZA 3H1ID 2XUMA 1S5LX 4PHZA 4H44D 4QMAA 1N8RW 1RM1C 1SVFA 3JATB 2WWWA 5LOVB 3P3NA 2YEVB 4Q20A 3UT5A 4CH5A 1L0NK 1JNMA 1J1DC 1HVVA 4PD4H 3F7VC 4J7KA 1AR1B 2DQ3A 3N4XA 4ZOLA 1KQSO 1E79H 4LF4B 1Y66A 2QTOA 2NPSC 4JI7O 2YIUC 3IAYA 2WLHA 4MTOA 4KUMA 3HE4A 1N73C 3BPZA 4FIPC 2ZT9C 3MHHC 5LXTB 4ZHQB 4I7ZC 3WG7C 4YHHB 4JPRA 4NVPA 4ZKIA 3AE7C 2IJHA 2PI4A 3ITKA 3UQ8A 5KHGA 4JI5O 2AHYA 5K5GB 3H1LH 5B1BC 1BQ0A 1VF5B 2ZD9A 3QO8A 4GKJO 5B3SC 4O2BA 1BHAA 3APQA 2Z4EA 5GONA 3HKCB 3HB3B 4GX2A 2O1KA 3CC7V 2N9BA 3CCSP 1NH4A 2V7QH 3F5TA 3OM3B 1M57D 1SQPG 3A2FA 1GO3F 3AE5C 1ZR4A 3ETDA 1SQBH 2KB7P 5APXA 5CA0B 1FZCC 1OX3A 3QF7A 5KJ7C 1SFCB 2JKVA 1SQBE 4RKUJ 3O65A 1HNWO 5KMGB 4N78E 4TV8A 4PD4F 1BMFG 2YO3A 3L75D 1NYHA 4Y28J 4BWNA 1S9KE 2E43A 2MKVA 3K3WA 4U3JB 1NI8A 4KT0J 3ABUA 1OW7A 5AW0B 4NTWA 5IJ9B 5JVDB 1UIIA 4W7ZA 3FD9A 4WFEA 2W6JH 3IAOA 4JYCA 2Q0OC 4LF8O 4LFBB 3H1HJ 4TUYA 1N33B 4UCTA 2C0WA 4IOIH 1RH5B 3HUSA 5BVZA 3X2QC 1Q90D 1EDLA 1TVKA 1LTGC 1H2MA 2DOSA 3H1HG 4JI3O 1PGOA 3QNEA 3AEAC 3CCUV 4PI2A 3STZC 1PGJA 1FYJA 3OMIB 1VQ6P 4NB5A 1SQQD 1VDFA 1KILA 2R5BA 5KLVG 1Q82Q 2EILC 3W7TA 1M1JC 3BCCE 1H8AA 2CUGA 4LNUB 5IYDO 2E75C 4UCSA 2JEEA 1FJGO 4I9QA 2X6AA 1QBZA 1OJHA 5LOVA 3JCUH 3SYPA 5KA6A 3B8EB 1S5HC 4KXRA 3L75H 1S5LH 1UFIA 1GTWA 3P3PA 4JI0O 2YXYA 1VQKP 3W7UA 3AEGC 2A06G 2E74B 2PGGA 3JALA 3FWLA 1VQKV 2VRZA 1BDCA 1Q82W 4X65O 5AW6B 2P2UA 1AV1A 2KSDA 2ITDC 2N74A 2KLUA 2EBOA 4ABMA 1RE3A 4IL6Z 3A3YB 1J95A 1Y47A 2GV9A 1I7FA 1M56B 1EQ7A 2PRRA 3AE1C 4DV0B 2JJLA 3A0RA 1QCEA 2AZ0A 2KKWA 1OCOC 3CX5I 3CCRP 3WU2Z 2DJVA 1N32O 4PD4I 5GW7A 3FB5C 1MUUA 1Z5WA 4AYCA 1RF1A 1Y76B 3GLMA 1Y74A 2YKOA 4KP4A 3B8MA 4JPZB 1PGPA 2LP7A 1QVGU 1JMKC 2XU6A 4E2LA 3SWFA 2YSUB 1OVRA 1OWAA 3L72D 5BZBA 2WLJA 4PA6A 4IIJB 1VARA 1YXBA 5GTIE 5K1PA 1NVPD 1GH6A 4LR3A 1OHHG 3T1HB 1W2EA 1YYCA 2CK3H 4JI7B 5AW3B 3AEIA 1AILA 3ML0A 3JCZA 4I7ZB 3IFMA 1L0LJ 3S4RA 3JAWB 5B1NA 1VQOV 3QG5A 5H2FH 1WP8A 3QO7A 5CA3A 2P67A 3MUDA 4OH8B 1JA8A 1X59A 3V2NA 3D71A 4RAIA 1CPYA 4B3RB 1K5SA 2KUBA 4BRYA 3N2GB 5JCOA 1PV3A 3T1CA 3HKEA 1RPRA 5B5EE 2K3RA 1K05A 3W7SA 3SFDC 2ZE8A 3MHSC 1S9KD 1PL0A 1FZEA 1CXZB 4LF6B 4WFAV 4GKJB 5APSA 2QKCA 1M1JB 5GTIZ 5AW8B 4NR1A 5KUKA 1R1BA 2BOBC 1S2EA 4JI2B 5FLXN 2LFSA 3ETGA 4DR6O 1QL1A 5J9PC 1NTZJ 1KD1W 3L72H 2OIGA 1B04A 3T4ZA 2M7WA 1LTTC 1P7BA 2X0LA 3H1LD 2UXCO 2WLNA 1YF2A 1AR4A 3L73J 4DV2O 3M0DA 2HFED 1FFXB 3ABTA 1SQXJ 5KLVH 2YI8A 1ZOYC 2ETNA 4J7ZA 3KHUA 3JSLA 2XV5A 1ZL8B 4Z1VA 2ZE7A 2NN4A 4DW0A 1BE3G 1LTJB 4W4KA 1URQC 5C93A 3R4YA 1MZEA 2QWQB 4DR4B 4UUJC 4X66O 1JUNA 1DF5A 1FFXA 5LL6Y 4LLHA 4HB1A 4OPAA 4UB6H 3QTCA 4MVUA 1KQFB 3KCYA 1GAXA 2WVRA 3W7WA 2WMMA 3KDPB 5KAIZ 2LJ2A 3DC6A 2XNDH 4D6TD 3NXSA 4G28B 1V54C 1OMIA 2B87B 3JD3A 2ARHA 4F6RB 4F4LA 1LTJC 2F93B 4Y99B 1XL6A 4TV8B 2E76C 1GU5A 4EI2A 4RJTA 1SQPH 4I55B 1AQTA 3WB2A 3ZEDA 3JD0A 2IU0A 1CI6B 2J59M 1OV9A 1XMOO 3G6EP 3E89A 2IYPA 1GKFA 1HGZA 1KD1Q 1M56D 2Y4TA 5LGTA 2IDBA 1AA0A 2F4VB 3RL0C 4X65B 3AG3C 2V1DA 4H33A 3B4SA 2JEUA 2OT5A 2KNCB 1GMGA 4IHJB 2Y9ZA 2P58A 3X2QB 1NHLA 1JQ0A 2OARA 2D2CB 1L4AC 1ZMEC 4DV0O 1BHBA 1VIBA 4P2ZA 2Q7GA 2IBZE 1K33A 3JASB 1AI4A 1UIXA 5C8YB 2WLMA 2JGDB 3CXHI 1HF9A 1H2KA 3Q4HB 4G2KA 1N34B 2FYUH 5BR8B 1SS1A 5LP6A 2W6AA 3E1IA 3IGAC 1JY2N 1H2SB 4I2LC 3PN1A 3SWYA 2P90A 4AI8A 3LW5H 1XOUA 2E5YA 3DC5A 1L0NE 2Q5UA 1XHXA 4JZGA 2QA4V 4DV4O 3G71P 3T1HO 4FM2A 2JS5A 4OX9B 4PV1C 4CH4A 3G9RA 1KILD 2FMLA 1IFNA 3ZHVA 3I55P 2JJ1G 1CEZA 4LWSA 1KN7A 2UUCB 3L72E 1OZ0A 4O4LB 1VQ5P 2A45I 3Q1MA 1BGYH 4J10A 3A5TA 2OGUA 3S3XA 2VWJA 1IVSA 4DV1O 3L36A 1K97A 3L73H 4PELA 2E74D 4WWIA 4JI1B 4HNAA 4FK5C 5BMVB 1N7LA 3CJHB 1FDOA 2IFMA 2C9NY 1N7SC 5KHJA 5CCGC 3LNNA 1ZLZA 4UV9A 1NTKD 2FFDB 5IJ0B 1S72V 3ZMZA 1N0NA 4O4LA 3E1RA 2R9RB 3D8CA 2PTMA 3K06A 2KYVA 5K1XA 4D6TH 4LF6O 2LXBA 3CCEP 3D36A 1NOHA 1VQ9P 4EFEA 3WU2E 4QPKA 3B71A 3P8CD 3K5MA 2A45G 1I0HA 2WQYC 4B3TO 5AVRB 3BCCH 1XL4A 1KECA 3W7XA 2FYNC 3VMXA 1KU9A 3AG4B 3H1JH 4TV9B 3MUDC 4E4EA 1AVYA 2ZIOA 3E8GA 2M5AA 3L70J 1P7GA 3T4DA 2GUVA 2B88A 3RYFB 2DWEC 1RM1B 3CCQP 1N0JA 4RO2A 4LC1A 1D7MA 3C1LA 1YQ3C 3V4WA 1F4NA 1NTZH 3L74G 2EINC 1P84E 2RQ6A 3N7NA 3A0BZ 1H2GA 3CWBG 2W6BA 1SFCD 3PLNA 5KLVJ 3PTZA 2YIBD 4QPJA 1IJDB 1GU4A 3V2RA 5EZYA 2EJ7A 1X22A 3AECC 1OCZC 3K5NA 3Q3DA 3H1IG 2O3JA 2Q6QA 1XMOB 4DUZO 2B9BA 4LFCB 4HBNA 3VN0A 1MSWD 2Q1KA 4JASA 4PDRA 3RYCB 1TU3F 2FYNB 3ABMC 2NR5A 3THOA 3CL3D 1OCCB 2GTSA 4X89A 4P30A 2YS8A 3CI9A 1V54B 1H89A 2KZJA 2BCCJ 3H1JD 1X8YA 1YQ4C 3V4QA 1VQ9V 1VPCA 2YI9A 1KILB 2R3CA 3VMYA 1OXZA 3Q5SA 3CHXA 3OGCC 3WB0A 1JM0A 2ZXEB 3FX0A 3CCJV 4EKWA 2XKMA 5AVVB 3CCJP 3CCUP 3U59A 1KYOD 1Q81W 3E86A 2P06A 2P4KA 1KB9I 5AW2B 3OTOB 2IBZI 1NTKK 1ZX3A 4MT8A 1Y76A 4PDLA 3A0HH 3H6PA 2JRIA 1FXVA 1J5EO 3E8FA 1W0KG 3RN4A 1LTAC 4HJGH 2ODMA 4HNAB 4MW8A 3HD7D 2P10A 4BW9A 3TGUG 3SJCC 2QR4A 1BGYD 4O4HB 4UB6E 5E1AC 3RYHA 2O01N 3TCUA 1R3KC 3P8CE 3OD4A 4I0XB 4CS2A 1EFRG 2JDIH 3T97B 2Y0IA 3L73E 2WT7A 1IBLB 2IJKA 4DR1B 1XQ8A 2JJ2G 4I4TA 3IR9A 4XFJA 3H1KE 2AEJA 3FB7C 2ZT9D 1KV4A 3HTKA 2CH7B 1BT8A 2EINB 3CB2A 5BR8O 2KQXA 3H01A 1WLEA 4GKGA 2OYIC 2XAQA 3SPJA 1WT6A 5AVYB 2YIUB 3ABKC 5L3BA 2Q9LA 5EYPB 2WLLA 1KFMA 2NPSB 1YJWV 4X20A 4U7OA 3ZHUA 3CE2A 5LP6C 3JAMN 2B1IA 2P22C 4B3SB 4OX9O 3M8AA 2W6IG 4DRXB 4DUYB 1IC2A 3BCCJ 1K9MQ 2UUCO 3CD6V 2X6CA 1OW8A 5DJTB 4OGQD 1SQFA 4BIZA 1XNQB 1PNLA 1IFMA 1M1KW 2F23A 2WLKA 2N9YB 1IBKO 1I08A 4X62O 2JO1A 1JJ2U 1AP6A 3L73G 1RFYA 4ZI7B 3OEHG 4IGGA 4ZKPA 1A32A 4HYOA 4R6ZA 5EC2C 5BU5A 4QJFB 5H6RA 3BVOA 5KA5A 5CJ0A 4WBNB 5CA1A 1V9PA 1N7SA 1XTGB 2RJZA 1YSCA 2Q4PA 2O01H 1IFDA 1B3QA 3DGEA 1Q3EA 2QTSA 2KNCA 2Z0AA 5LHIA 4B7KA 1LWUB 3M9BA 4LBEC 1BDDA 3GHGB 1GN6A 1NS1A 2CAZC 1KFNA 2A06D 5GTHE 1OCOB 1FKAO 4WBNA 4PA4A 1RF1C 5B1OA 4D7TA 1BCCJ 3CC4V 1NTMJ 3L71D 2QM8A 4UCRA 1T3JA 3CC4P 2IJJA 2YIBA 3EFFK 2CGOA 3B40A 3JASA 4LFAO 1AJYA 2K1EA 1NT2B 4DUZB 1XILA 2JIZG 2JGDA 2ZYDA 4O4JA 1LWUA 5JJJB 3B5NB 1MA1A 3HD7B 3GHGA 3ZRWA 1VF6A 3HKCA 1BGYE 2ILMA 3VMZA 4TT3G 1EZVD 1JB0J 3CD6P 2KG7B 5E79Z 2E75D 4UV8A 1HJBA 4MVRA 5LA6A 4GKKO 2QWOB 1U7MA 2XT9A 1XUQA 1R5SA 3H1KH 5IY5C 1S5LZ 1ENVA 2ZDIA 1NU1H 1NTME 1KZUB 4FVMA 2UXDB 2YKQA 1YJWP 1JR9A 1VEWA 4MVZA 3E22B 4LFCO 2W90A 4DZOA 1LTSC 3N27A 2QWNB 4HKZH 4GIFA 1VP7A 3WUUA 4D6TE 2DW3A 4NTXA 1CSBA 4X8AA 3CRMA 4YXWG 4B3MB 2EILB 3APOA 1SKVA 1U96A 3ZX6A 2CH7A 1GDTA 1M8OB 4JYBA 4IIJA 1R5LA 4GYCB 4ZNCA 3KCXA 2P1JA 3CCMP 2KLVA 1SERA 2ADQB 1QEXA 1IX9A 4DK0A 1X0TA 1VQPP 4KL1A 4U3FE 2C2AA 2IH3C 3ASOC 3H1HH 1I94O 2N1TD 1HJ0A 1MNGA 2ATKC 5L3FA 1OVUA 5D5PA 3AG4C 4EEQA 1YITV 3Q4HA 3F7YC 1EZVH 3OAKA 3TGUJ 5EZYB 5CA0A 3CXCU 1Z56A 4H0LD 4J42A 1GD2E 4GCZA 3TXQA 4TLFA 4XA4A 1IXBA 4YIOA 2IJIA 1T8ZA 1ORQC 5JCOC 2I1JA 2HODA 1BSHA 2XAJA 4IHJA 4YIPA 1FU1A 3RYFA 1N36O 4LWSB 1SQPE 1IBLO 4H37A 1SZTA 1Q43A 1N7SB 2B9ZA 1DIPA 1PL4A 5H2FZ 3CLQA 3OAAG 2V7QG 4DV7O 1HP8A 1K4DC 2EIJB 5APWA 3ZMSA 2UU9B 5B3SB 1XNQO 2CTQA 4O9BA 4B08A 1YVWA 4K3AA 3E8BA 2FFDA 2HJDA 3AK2A 2Y69B 2QJKC 3GW6A 4BRYB 4MVQA 1PV0A 1YIJP 4H44B 2Q8VA 1LT9A 4JZ2A 4X1YA 1L0LD 1QHTA 3WG7B 4IFFA 4RESB 3L74H 4RUEA 1NTZG 1M57B 4YPCA 4FM0A 2Q3EA 1EN4A 4GOFA 3USSA 2ZT9B 2FYUD 3CRRA 1NTMH 1SA0A 2LGQA 3I56V 3FXDA 2XDJA 5H2FE 1AB3A 3PHLA 3K03A 1S5JA 1E1QG 1QL2A 3H1KD 3OW2U 1CW5A 1QVFO 5BMVA 4R4MA 1QLEB 3J80N 2A45H 2QG4A 1K7DA 3K59A 2Y9YA 2GUSA 1VQ4P 1FDMA 5KAFH 1R6KA 3L70G 4ZMDA 2WPRA 1Q2NA 2CE4A 4ICGA 1SQQJ 4EFBA 3Q2YA 1QVFU 1BCCG 2HEPA 1G6UA 2BSKA 2WA3A 3O9OA 5B66H 3OW2O 2GA1A 1NO4A 1NU1J 3HKDB 2QJYB 4DRXA 1SQQG 5EBLC 5KJ7D 3CWBH 1M90W 2LFRA 4QIWF 5KLVD 3AE9C 3H1IJ 4U3FG 5KAIE 2KIKA 5DN6G 4L76A 5BU8B 1S72P 1W0JG 5H6QA 5AVTB 2YUAA 3UCSC 4X88A 1KUQA 1VQOP 4MW3A 5AVSB 3I5DA 3P32A 3WB1A 3BY6A 5JVDA 3CCLV 2BCCG 4Y99C 2EIJC 3CCEV 1EC5A 3G6EV 2FL4A 2W83C 4EB6B 1S1CX 1BCCE 2HLDG 3TDKA 4X64B 2HHHB 1BCCH 3B5NC 1SS3A 1FXKC 4DO2A 1PP9J 2OYHC 2OTLP 3V5BA 3VMAA 2KZIA 1AJQA 4DOJA 1BL8A 3BAAA 2F1MA 1M56C 4MVOA 2W27A 5EK0A 2H88C 2ZVOB 1IZ3A 2MJZA 4C7RA 1JOCA 1MV8A 4B3MO 1ZP0C 2HG5D 1LWUC 4J9YB 3U1CA 2JWAA 1GN4A 5CCHD 3VYIA 3IJ4A 4U3JA 4DYLA 1VQLV 4K0KO 4B86A 4EDFA 1LGHB 3BVHA 2C9LY 1NTZE 2UUBO 5LMUO 3AE6C 3H32B 1HW7A 4O4IB 3F89A 3WU2H 1DEEG 4Z2WA 3CPWO 5B1AC 1SQXE 1FXHA 4DR7B 2HP8A 3F5WC 4OXSA 4X1YB 2JEXA 1YJNP 1U7JA 2HKOA 4PA7A 2AGAA 1YTZI 1RF0C 2PF4E 1K8AW 3OJAB 4EYYQ 2A0LA 1USEA 3RGUA 4U7JA 5GONB 1IBMB 4B3RO 2UU9O 3BASA 1Q81Q 2ZINA 2JVDA 2QEXP 5EC1C 1MKMA 2GBOA 2FTKA 4LNUA 5CCGA 2QKSA 2H89C 4PV1D 2WSEH 1YHQP 1GK6A 3KZIE 4ZBMA 2AEMA 3BCCD 3RYHB 2PFXA 3ZRWB 4DV6B 2AXCA 1QR8A 3RK2C 3CXHF 1GL2A 3M7MX 3GG2A 1HBWA 4DV7B 2N05A 4MN4C 3JALB 3ZCCA 1VF5D 2DYSC 4JTDB 3U10A 3C9IA 4WY4C 2WAMA 3M0DC 3B2EE 1NTMK 3QVNA 5AG2A 1SETA 3BRCA 3UO3A 1O9GA 5AW1B 3JD4A 3AE2C 1NR1A 2E3CA 4JAAA 2AW9A 2EIKB 2GSMB 3E22A 5ITZB 4H44C 3G4SP 3Q5RA 1GL2B 5KLIC 3N2KB 2AXTE 2FFDC 1HWTC 3CWBD 1HNXB 2LXCB 3CMAV 5IWAO 5AW9B 2VQFB 4JTAB 2AZ2A 2OWOA 1X9VA 1IK7A 2HODB 2M3BA 2A7WA 2X6BA 4EB6A 3K0GA 4X66B 2RKLA 2WLIB 3CX5D 5E79H 2OTJV 3K79A 4UVAA 2QSAA 4M3LA 2YC0A 1ZAUA 5FNVA 1NKNA 2D2CD 3JAKB 3ZHTA 3RYCA 1GRJA 3L74J 4LF5B 2IBZG 4NXNB 2CTWA 3ABVC 1IFJA 1NU1G 3ZJZA 3A0BE 4JI8B 4JAUA 1GM7A 4NTYA 4I1LA 4DR2O 4PD4E 1WJZA 1FZAA 1HGVA 2DYSB 1NKZB 2H8PD 3VQVA 3CXHH 3TGUE 3WUVA 1J2JB 1QU7A 1HWYA 4X64O 4A7PA 2HHHO
chains in the Genus database with same CATH topology
2FYNC 3AEEC 2OQQA 2YIUC 4H13D 1OW8A 1ZP0C 4OGQD 1NGMB 2JP3A 2D2CC 3O6QA 1OMIA 2ZT9C 3H25A 3AE1C 1KILE 2QJPC 2V7QJ 2E76C 3GF3A 4I7ZC 1DIPA 2E75B 2JO1A 3AE6C 1YQ3C 3AEFC 3AE7C 1EXJA 1DD3A 4H0LB 3GLMA 1KQGB 3AEDC 4OGQB 2J5UA 4H13B 4R4LA 2QJKC 1VF5B 2IDBA 3AECC 3Q3DA 4H44B 4U7JA 3S9OA 3RK3E 4I7ZB 2WPVB 2YMKA 1MKMA 1TU3F 2QJYC 4TT3H 4Z1MH 3D6ZA 3AE5C 3GMAA 3Q5PA 2ZT9B 2H89C 1ZRTE 2D2CB 4PV1D 1ZMEC 2WSCJ 2QIWA 1Y9BA 1YQ4C 2WSEJ 1FDIA 4RKUJ 3D71A 1AJYA 1UIXA 4Y28J 3Q5SA 1NYHA 1U57A 2MKVA 1PV3A 2BEQD 4YXDC 3EWKA 1PIXA 1RQUA 4KT0J 4R4MA 1OW7A 1HF9A 1VF5D 1JB0J 5L8RJ 1K05A 2E75D 2O01J 3IAOA 4GDOA 3SFDC 3RL0g 1DD4A 3AE2C 3IN6A 3D6YA 5KKZC 3GF7A 3Q2YA 3Q5RA 1Q90D 4H44C 5KLIC 1KMIZ 1RQVA 4PV1C 1R8EA 3G9RA 3AEAC 3AE9C 1WMKA 2P10A 2G8YA 3Q1MA 1IK7A 4H0LC 2FXPA 1KTMA 1K04A 2BEZF 2E74D 3D70A 1VF5C 1ZOYC 1PL5A 3T97B 4H13C 3AE8C 1FDOA 2NZ2A 2E75C 4OGQC 2FBWC 4PV1B 2D2CD 3AE3C 1VL2A 4XFJA 2G3AA 2ZT9D 3LW5J 5M1BA 1S1CX 1HJ0A 2E76D 1S5LX 3ABVC 3FGAD 2K9YA 3SFEC 4H44D 3R4YA 1OW6A 4IL6X 2E76B 3AEGC 1GMJA 2E74B 4YTPC 2QSIA 3C8VA 2WSFJ 3AE4C 1KQFB 1KORA 3B71A 1EXIA 3AEBC 2WQYC 2H88C 4H0LD 2E74C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYN C;  1JB0 J;  2YIU C;  5L8R J;  4H44 B;  2O01 J;  4PV1 B;  3LW5 J;  4I7Z B;  2WPV B;  5KKZ C;  2QJP C;  2QJY C;  1S5L X;  2K9Y A;  1Q90 D;  2E75 B;  5KLI C;  2ZT9 B;  4IL6 X;  2E76 B;  1ZRT E;  2D2C B;  2E74 B;  2WSC J;  2QIW A;  2WSE J;  4RKU J;  2QSI A;  3C8V A;  4H0L B;  2WSF J;  4Y28 J;  4OGQ B;  4H13 B;  2QJK C;  1VF5 B;  4KT0 J; 
#chains in the Genus database with same CATH topology
 4KHP B;  2UXN A;  3C90 A;  4XBF A;  4LF7 B;  3RK3 C;  4H13 D;  3NTN A;  3M99 B;  4C46 A;  2DQ0 A;  1SQQ E;  3ASO B;  4JI4 O;  3EVK A;  2Q6A A;  5LHG A;  1ZL8 A;  3HKE B;  4CC5 A;  3OUS A;  1UJW B;  5FPR A;  4IFD K;  1QNM A;  2FY8 A;  1GZL A;  1BS3 A;  2OYI B;  1ZLL A;  4OVN F;  1Q86 Q;  4CZZ A;  1JFF B;  2R32 A;  3AEF C;  2GUZ A;  3L9D A;  5H9C A;  4YXW H;  3MTU E;  1M1J A;  3GB7 C;  1RP3 B;  1FZF A;  3P30 A;  1Q6U A;  4DV3 O;  3EXA A;  2K1A A;  1KBH A;  3RBX A;  2KG7 A;  2UUB B;  4DCK A;  1YI2 P;  1K5Q A;  1M4U A;  1YCI A;  1DGS A;  4AIL C;  1US6 A;  3ZMV A;  4TQF A;  5GTH H;  3A0H Z;  1I5X A;  5KAF E;  5IJ0 A;  2M0B A;  5EYP A;  4PA9 A;  1URF A;  1U97 A;  2R5D A;  3G4S V;  2K9J A;  5CBN A;  3JAW A;  2WSC J;  1T2K C;  1PNM A;  2WSE J;  3L72 J;  1NJI W;  3HD7 C;  3NR7 A;  3UO2 A;  1IBM O;  4UVC A;  4FFB A;  2E5L B;  1LUV A;  5A9G A;  3K9A A;  3EWK A;  2CTP A;  4DV4 B;  1WB8 A;  2I1K A;  1HH0 A;  5CJ4 A;  3K5O A;  3MD0 A;  4DR7 O;  3RL0 g;  1XHZ A;  2WT7 B;  4CS3 A;  3QO5 A;  1A02 J;  3IN6 A;  3ICX A;  1ROP A;  1HDJ A;  3A0H E;  4JI1 O;  2CPS A;  1QLN A;  3V2P A;  3EQ2 A;  1JMB A;  1X79 B;  1N2D C;  2R3S A;  2BCC H;  4BAY A;  2BAS A;  3H1H D;  1KTM A;  3L35 A;  1E5W A;  3O8Z A;  1R3J C;  1AI7 A;  1LR1 A;  4DV6 O;  2ZR3 A;  1HTL C;  5AVW B;  1EZJ A;  3I56 P;  1N8R Q;  4U7N A;  3TK1 A;  4X9Q A;  2Y4U A;  2R9A A;  5B66 Z;  2PY5 A;  1ZTE A;  4PJ0 E;  4B3T B;  1RF0 A;  4TSF G;  4UB8 H;  2Q7H A;  1SQX G;  2L6L A;  1L0L E;  2BTQ B;  1VQ7 P;  5FPO A;  3SYQ A;  2BTO A;  1QLE C;  3TXS A;  1Z5V A;  5CBO A;  1PP9 E;  2ZM6 B;  3HPL C;  1DX7 A;  2WPD G;  1R3L C;  4JV5 B;  3RK3 B;  4BIU A;  1H2L A;  4MTG A;  1MAB G;  5KHH A;  5JH7 B;  5LA6 B;  1FZG A;  2B5U A;  1AJN A;  4DW1 A;  2JP3 A;  2XAH A;  4FLU A;  1D2D A;  1ZRT D;  4DR2 B;  4GLX A;  4DT0 A;  1OZH A;  1NTM G;  1IO4 A;  2Y48 A;  2OYO A;  1M57 C;  3HE5 B;  1XEQ A;  4KHP O;  2DW4 A;  1AVM A;  4LF5 O;  3L4F A;  3CWB J;  1MG1 A;  2L5G B;  3KQG A;  4X1K A;  4H0L B;  4ASV A;  3H1I H;  2V4D A;  3GWO A;  4JI4 B;  1B6Q A;  3E2E A;  2ZXX A;  1L0N G;  2ZIM A;  4XE5 B;  4YY3 O;  2VQE O;  1VQ8 V;  1UPG A;  2YNY A;  3OE7 G;  1PKX A;  2W6J G;  4WF9 V;  1JTH A;  2QWR B;  3ZS8 C;  3STL C;  1SQX K;  4FFB B;  4DV3 B;  1NAY A;  4Z1M H;  1OCR C;  1RSO B;  1PP9 D;  2EIK C;  5IDJ A;  4I50 B;  1W2B U;  3K08 A;  1JMM A;  2WLL B;  1W5C E;  1EN5 A;  2OYH B;  2XZR A;  1U57 A;  4N3Y B;  5H5N A;  4YXD C;  2Z5H A;  5DJU B;  5IYZ A;  2H3O A;  2O01 J;  5TJH A;  1XMQ B;  2UXB B;  1EBO A;  4N6J A;  1NU1 E;  1K34 A;  5KMG A;  2J58 A;  1G4Y B;  3CME V;  1K4C C;  1L2P A;  4ZI7 A;  1USD A;  5J2U B;  3JAR B;  3JSN A;  2G8Y A;  3B5N A;  3LIE A;  1K9M W;  1YDX A;  1KYO I;  2WA4 A;  3FB8 C;  3VOP A;  5CA1 B;  3C3S A;  3D70 A;  4J7J A;  1L0L G;  3LDD A;  4FLT A;  2E42 A;  1Q7Y W;  3RW0 A;  3ZMT A;  5EIB C;  2R70 A;  5C8Y A;  3SPG A;  2BTQ A;  2OYQ A;  3H1H E;  2OCC B;  3LW5 J;  3UT5 B;  3S3W A;  3H1K J;  4I5S A;  2K9Y A;  3SFE C;  4MSW C;  2Q68 A;  4JGS A;  4ZOL B;  1B06 A;  4JI5 B;  1S5L E;  3L75 E;  1LJ2 A;  3H1K G;  4EOT A;  1FAF A;  3K9S A;  2QSI A;  3CCL P;  3C8V A;  2WSF H;  2WZ7 A;  4IT5 A;  1ZSP A;  3HR0 A;  1F7Y A;  2YXH A;  1T3U A;  4DR6 B;  2ZFC A;  3II6 A;  5LHH A;  3BA9 A;  3G71 V;  4RQE A;  1GW4 A;  3HD7 A;  1LT1 A;  2OQQ A;  4WFH A;  3JD2 A;  3CC7 P;  3VP9 A;  2QM7 A;  2HPC A;  2RNB A;  3OTF A;  1IK9 A;  2H7H A;  2FYZ A;  1XNR B;  3OR7 C;  2IFN A;  4JV5 O;  5EBW C;  1JY2 P;  3MZW B;  2UWJ E;  1JO5 A;  4RQF A;  5TIS Z;  2XOK G;  4DR4 O;  2Z5I A;  2HPC B;  3KKY A;  2KS1 B;  5B5E Z;  1KB9 D;  4L75 A;  1TGO A;  1KKC A;  2BCC D;  3H1J J;  4LFB O;  1N33 O;  4RUF A;  1SQV E;  2ZM6 O;  1GL2 C;  5KLI B;  1JY3 P;  4N21 A;  1FPO A;  3L70 H;  1SQP D;  4I50 A;  3N2G A;  5APU A;  1HNZ B;  4CBC A;  1EM1 A;  1N4C A;  3F5H A;  3RK3 E;  4JI3 B;  4X1I A;  4MVM A;  2KSJ A;  1DLB A;  3G80 A;  2QJY C;  4NPE A;  3D6Z A;  4LP8 A;  2KS1 A;  4WY4 B;  2HR3 A;  1THZ A;  1O9H A;  2ZKO A;  1Y67 A;  3NMD A;  1N73 B;  5IJ9 A;  4GKK B;  4IL6 H;  4NKG B;  5JJE B;  3D3I A;  2QEX V;  1SES A;  2XND G;  2YDE A;  3SJA C;  1FJG B;  1VQ6 V;  1PIX A;  1J1D B;  3W67 A;  3AK1 A;  5J2T B;  1SC5 B;  5JQG A;  3CCQ V;  4L8J A;  5L8R J;  1NWQ A;  1TVK B;  5GTH Z;  1N7S D;  4JYA O;  1FE6 A;  5CBH A;  1JFF A;  4J41 A;  5CBG A;  4QGP A;  4R7C A;  5CB4 B;  4YY3 B;  2VQE B;  4PD4 D;  5KTB A;  4K8X A;  1KQL A;  3JCU E;  2FXM A;  4L74 A;  5L3D A;  4R8C A;  1KP3 A;  1BE3 E;  4KJM A;  1MZF A;  4UB8 E;  3CS5 A;  4WFB V;  5JQG B;  1RPO A;  1MMM A;  2R9I A;  4EIJ A;  2JK5 C;  2M6Y A;  3A8T A;  1DH3 A;  5KUM A;  3B8N A;  3G67 A;  3A7O A;  1FJK A;  2ITA A;  2Y69 C;  1TUB B;  2ZYA A;  1LUW A;  3AG2 B;  5KLV E;  2K9J B;  2KI7 B;  1P84 F;  4CPG A;  3J81 N;  3L72 G;  4JBZ A;  3KYQ A;  4X1K B;  2E76 D;  5DM6 V;  3FGA D;  1QVG O;  1ZV8 A;  4PA3 A;  1Y4M A;  1KYO E;  1OW6 A;  2F95 B;  1H38 A;  1XMQ O;  2UXB O;  1KYO H;  3CME P;  3GVM A;  2YXR B;  1VQP V;  1VQ5 V;  4L87 A;  3LID A;  2XAS A;  4JQ0 D;  1NQT A;  2WSF J;  1EZV E;  1H88 A;  2F43 G;  4I55 A;  1L8D A;  4GX0 A;  1SQV G;  3M06 A;  4K35 A;  4UCO A;  1BZK A;  5DEC A;  2E5T A;  2GM4 A;  2L91 A;  3AG7 A;  4FFK A;  2Q67 A;  3FX7 A;  4FLY A;  5CBF A;  1SFC A;  1AI5 A;  1SQB G;  2V7Q J;  1ZWI C;  3CCV V;  4A5U B;  3SPC A;  2O1J A;  4Z1M G;  5B1B B;  5LYJ A;  5A2Q N;  4I4T B;  3VQX A;  2GDS A;  3BA8 A;  1SQB J;  1LP1 A;  2OCC C;  2CK3 G;  1XI1 A;  3W68 A;  5JJN B;  3TNU B;  1KB9 H;  1JCD A;  3P7K A;  2MK3 A;  1EDJ A;  5KJ7 A;  3GWK C;  4IL6 E;  4R4L A;  4F6R A;  1NTK G;  2R72 A;  2FXO A;  2OTL V;  3H1L G;  2IZ1 A;  2FYU J;  1VQ8 P;  1DTO A;  5LYJ B;  1L0L K;  1N86 A;  2DWD C;  3JAT A;  3OT7 A;  5HFL A;  3FWN A;  3RVY A;  1LP1 B;  1G1J A;  4JAV A;  1NVP B;  1PPJ E;  3DXR A;  5KHK A;  3VP8 A;  3GMA A;  3EFG A;  5AW4 B;  5LP6 B;  4NYK A;  2WSC H;  3ZMU A;  1RE3 C;  2ZNJ A;  2OTJ P;  5LGU A;  2BEQ D;  3IC7 A;  3H1J G;  5TIS E;  1SZX A;  1OFC X;  1PFI A;  2UUA O;  3E7K A;  1KYO F;  2EIM B;  3T1Y O;  4GOE A;  4BIO A;  4TQD A;  2ZXW C;  1K73 W;  1H0T B;  3FAV A;  1LT9 B;  2ZJS E;  1BSN A;  4D6T G;  5C39 A;  1NTK E;  4JI6 B;  1VQN P;  1AFO A;  4DXW A;  1FJP A;  3L75 J;  3QWO C;  3HRN A;  3RYI A;  1AJP A;  5LMN O;  4D6T J;  4PJ0 Z;  5B66 E;  5EBM C;  3O6Q B;  2H94 A;  2Q9I A;  4O2B B;  3GHG C;  2RMK B;  1F51 A;  2PYJ A;  1SA0 B;  2XNX A;  1Q8I A;  3R65 A;  1MFT A;  4Q6G A;  2C0X A;  4XDK A;  1XDC A;  5E79 E;  1PPJ H;  2A9H A;  3VOU A;  3HE4 B;  1BE3 D;  1BGY G;  1PL5 A;  3CCM V;  3TJT A;  1DEB A;  4PV1 B;  3SPH A;  4DK1 A;  5AW5 B;  2EUL A;  3G6B A;  2YXL A;  1GM9 A;  1K73 Q;  2K9P A;  3K5B A;  1WAZ A;  3CCV P;  3OTO O;  1GK4 A;  2MW2 B;  5IYZ B;  4FLX A;  2RDC A;  3ZN1 A;  3CJH A;  4J80 A;  2GUZ B;  3TET A;  3AE4 C;  4XDL A;  1JY2 O;  4TWK A;  2LR2 A;  3U1A A;  4HAM A;  3H1J E;  4C7N A;  3RK2 B;  2HFE C;  3OUF A;  2E74 C;  2YIC A;  2A06 E;  4WB4 A;  3UIA A;  1NGM B;  1FS0 G;  5IYC O;  3SR2 C;  3L71 E;  3WUT A;  1SLQ A;  4UFZ A;  2ZR2 A;  3H25 A;  1QX8 A;  5APQ A;  1DF4 A;  2YIA A;  1KIL E;  1SQG A;  3MP7 B;  1L0L H;  5IT9 N;  4LF4 O;  1NH2 B;  4MTX A;  4IYH A;  3N2K A;  5AVQ B;  2OCH A;  2IYO A;  2WPQ A;  1KQG B;  4J9Z B;  3CYO A;  4UVB A;  1N34 O;  4DR5 B;  4MTF A;  3RWR D;  5AW7 B;  2BOC C;  4LH7 A;  3CPW U;  2N1T B;  5CMZ A;  3DSQ A;  5CCH C;  3OA7 A;  5LGN A;  4WY4 A;  4TOI A;  4FMT A;  2Q73 A;  1T6A A;  3M91 A;  3ZRS A;  2EX3 A;  4DV5 B;  1RE4 C;  1NZ6 A;  2ZAE B;  3L37 A;  2QA4 P;  2YMY A;  5KKZ B;  2PZS A;  3ZIA G;  1F23 A;  3HUS C;  3VQY A;  4DV1 B;  1IBK B;  3H32 A;  1DK1 A;  3OEE G;  3CWB E;  1KP2 A;  3ZRX A;  1WN7 A;  1Q6H A;  1JVM A;  3AG1 B;  1JY3 O;  3ABL C;  1SQV H;  1RQU A;  1K3E A;  3CCR V;  1SFC C;  2CTR A;  2AEF A;  1FZC B;  5CCH A;  1NVO A;  2Q7C A;  4BW5 A;  2VQF O;  1FOS E;  2EZO A;  1GK9 A;  3FXE A;  3L73 D;  4LCU C;  3D6Y A;  5KKZ C;  4QNH B;  2DMX A;  1NTK H;  3CX5 F;  2OYI A;  2AXT H;  1BE3 J;  4LF8 B;  4KHX A;  4FZ1 A;  1HR0 O;  3L74 D;  1FFT B;  2FXP A;  5APT A;  4JI6 O;  3HKB B;  2ZQM A;  4W80 A;  1IDS A;  2LGW A;  2UXX A;  2IBZ D;  3AE8 C;  1JEK A;  3UM7 A;  4OGQ C;  2XHB A;  1NU1 D;  1VL2 A;  1G1I A;  4PJ0 H;  2LO1 A;  4MVS A;  5KX5 A;  2DE0 X;  1FOS F;  3T1Y B;  2V4H A;  4AHC A;  3TNU A;  3CRC A;  2QE7 H;  3A2A A;  2IW5 A;  1HUC A;  3NFQ A;  3WMM 0;  4G27 B;  4O4H A;  1ZXG A;  5D5Q A;  4JYY A;  2HYN A;  1E79 G;  3RFR A;  4IL6 X;  4RO0 A;  1GMJ A;  2Z5U A;  5KAI H;  3LSS A;  1EZV G;  5LMN B;  2M5A B;  2QVA A;  2Y0P A;  5AVX B;  1SQX H;  4JI0 B;  1GN2 A;  2IH1 C;  1P84 I;  2WLI A;  1GW3 A;  1YEW A;  4TUY B;  1GM8 A;  2ZCE A;  3CP1 A;  3CRA A;  1PD3 A;  3BHP A;  5FNV B;  4WFF A;  2ZNI A;  1RY3 A;  3JSV C;  3ZDM A;  2L35 A;  3RL0 B;  2QGN A;  1CI6 A;  1M5I A;  2NLJ C;  3LUT B;  3U0Z A;  2WSS G;  3ZRV A;  5B1A B;  4YJ2 B;  1I94 B;  2KK7 A;  1PM9 A;  4O4I A;  2LKM A;  1P84 H;  4H13 B;  4W7Y A;  4WVZ A;  3ETQ A;  1NJI Q;  1COW G;  1LTB C;  2NPS D;  3H1L E;  3SSU A;  3OMA B;  1KKD A;  2EZP A;  1ZR2 A;  1A02 F;  4P9O A;  1PPJ D;  3R66 A;  2PI5 A;  1M9N A;  4YJ2 A;  4FLV A;  2XTA A;  2ITC C;  4GZR B;  2B1G A;  3FB6 C;  3TF5 A;  1Q86 W;  4TT3 H;  4DR5 O;  1N36 B;  3SGI A;  2D3O W;  2Q69 A;  1KC8 W;  2QIW A;  1KB9 E;  3BFR A;  1PZQ A;  4DR1 O;  2B87 A;  2EIM C;  1G8M A;  4HZ3 A;  5CN0 A;  3D36 C;  1SQV J;  4DV5 O;  1URQ B;  3L70 E;  4ZIB A;  2XAF A;  3RGB A;  1OCC C;  1R73 A;  3MIW A;  1I5Y A;  5APY A;  1WRG A;  1DD4 A;  3AG2 C;  3K5L A;  1IZN B;  2IU3 A;  2GHY A;  3G3Z A;  2N1T C;  3GF7 A;  1P84 D;  3M0A A;  1KQS U;  4GT1 A;  1Q7Y Q;  2YKP A;  3I5C A;  3B5N D;  1IFP A;  3L70 D;  1NTK J;  2RCV A;  1RQV A;  2IBZ H;  3FYE B;  4B3S O;  1S3J A;  4I0X A;  1MFZ A;  3CX5 H;  4IFM A;  4RWU A;  3I55 V;  4CH3 A;  2BSK B;  1JJO A;  3AG3 B;  2WSS H;  5KX5 B;  2ZVN B;  2HJF C;  3CXH E;  1OVV A;  4JI2 O;  1G1X B;  1K92 A;  2P7J A;  4LH6 A;  1NTZ D;  2HG5 C;  4R50 A;  4U3F H;  2FBW C;  2K88 A;  2P4V A;  4DR3 B;  3AE3 C;  2NPS A;  2G3A A;  2UXC B;  2AXT Z;  3PP5 A;  3CXH D;  4DV2 B;  4FLZ A;  5L3G A;  1FD9 A;  4GX5 A;  2E76 B;  3H9V A;  5J2U A;  4UB6 Z;  1M93 A;  2VWK A;  1WP7 A;  2WIT A;  1KC8 Q;  5ITZ A;  1NBM G;  3RBZ A;  1EXI A;  3R2P A;  2RN0 A;  3ASN C;  3E83 A;  1SP4 A;  2QJ1 A;  3L75 G;  2KOG A;  2QE7 G;  1S0V A;  1GL2 D;  1HR0 B;  3BRV B;  3B09 A;  1IFI A;  1FS0 E;  1BCC D;  5CB4 A;  1NTZ K;  3O6Q A;  2PUS A;  2RN9 A;  1FBM A;  2WTY A;  5KHI A;  2QJP C;  1TAE A;  2JDI G;  3A0B H;  3QH9 A;  3GF3 A;  1G2C B;  3OGI B;  1QQC A;  4B7E A;  5KAF Z;  3K58 A;  2PAJ A;  1FAV A;  2XAG A;  1L0N D;  1QLE D;  3TGU H;  1EXJ A;  2P7T C;  1DD3 A;  1TUE B;  1R3I C;  2ZE6 A;  2CPB A;  3SPI A;  3AED C;  1K8A Q;  3PJS K;  4UCV A;  3CEI A;  2EJR A;  1SRY A;  1JPX A;  1LTJ A;  4J11 A;  5JH7 A;  3JCU Z;  1PNK A;  1PP9 G;  3L71 J;  2LW1 A;  2VRS A;  5BY1 A;  2WPV B;  3V2Q A;  3ETE A;  1S76 D;  1R6T A;  2ZXW B;  2PYL A;  3L74 E;  1J1E B;  3SJQ C;  3OMN B;  5KLV K;  2F4V O;  4O2A A;  4LF9 O;  1ZRT E;  1MZ9 A;  2P5O A;  1VQM P;  1URQ A;  1Y9B A;  1FDI A;  4F6E A;  1P49 A;  1YTF B;  5LMU B;  1W59 A;  2BCC E;  3ZHS A;  2FYU E;  3ZHR A;  1L1F A;  3PH0 A;  1R6N A;  3MGN A;  1SQB D;  1QGK B;  5CCG D;  5JWP A;  3BAB A;  3DTU B;  3D3Q A;  2M8R A;  3K0D A;  4PI0 A;  1J1E C;  2OIE A;  3TSI A;  3SYC A;  3ZHQ A;  1V55 C;  3VBB A;  1RSO A;  2FYU K;  1Y6X A;  1LNQ A;  2QWP B;  3E35 A;  3HE5 A;  2KSE A;  1P4R A;  1E1R G;  1EDI A;  2X7R B;  1EZV I;  1K04 A;  2RH0 A;  4YJ3 B;  1VF7 A;  1AR5 A;  2W0F C;  2OTK E;  2R44 A;  1IXM A;  1JX9 A;  1YJ9 P;  4KFM A;  2HVK C;  1T5E A;  3KPE A;  1TA8 A;  1WA8 B;  3BCC G;  1MSD A;  2CDY A;  1AVO A;  4JF7 A;  3CMA P;  3U11 A;  1VQ7 V;  2AHZ A;  3JAK A;  1SQV K;  1D5N A;  1LTI C;  4ASU G;  1WNS A;  4QE7 A;  4DR3 O;  1PGQ A;  4ASW A;  1XNR O;  1D5A A;  2FYU G;  5F2V O;  3ABL B;  3JAR A;  3AEB C;  2A06 H;  3V6I A;  1ARO P;  1HNX O;  5L3C A;  2B89 A;  3AEE C;  1VMG A;  1JOY A;  1YBK A;  2N1T A;  3AK3 A;  3L71 H;  1OIP A;  3TYY A;  3P8M C;  2CGN A;  5EIB D;  1CZQ A;  1VQL P;  1W2B O;  5GTI H;  1SQP K;  1URQ D;  4NPD A;  1KB9 F;  2G38 A;  4O4J B;  4QE9 A;  3DXR B;  1EN6 A;  1VQM V;  5LBQ A;  1ZUQ A;  4ZHQ A;  2M3E A;  1FZB A;  1PP9 H;  1OCZ B;  2SPZ A;  4W4L A;  4C7U A;  2DYR B;  1HNZ O;  3CC2 V;  1RE4 A;  4I6M C;  1M90 Q;  4JI8 O;  3RK2 D;  3LNM B;  4WCE V;  1WB7 A;  2K37 A;  4U3F D;  2ADP A;  2YEV A;  1V55 B;  4AUW A;  2JR8 A;  4U3F J;  3JC2 2;  1VF6 C;  1S4X A;  1NR7 A;  4IYI A;  4D7S A;  5CMU A;  2Q3I A;  5L3E A;  4K8Z A;  1JY3 N;  2YMK A;  2LQT A;  4JF3 A;  2JGU A;  3B77 A;  3SDL A;  3Q5P A;  1XRE A;  4BWA A;  4NXM O;  4CH6 A;  3RYI B;  5IY5 B;  4JYA B;  3PRJ A;  2ZDI C;  5FL7 G;  5LXT A;  3KZI H;  4I9W A;  3HKB A;  2KXP B;  2JS3 A;  4TV9 A;  3K04 A;  3T2M A;  2OYH A;  3T97 A;  1YJN V;  2Y0C A;  3CSX A;  1SF9 A;  3LDC A;  3RL0 D;  3FFQ A;  4FM1 A;  4UXN A;  4GDO A;  1YI2 V;  1WPX A;  3HKD A;  1YTZ T;  5BXZ A;  1FC2 C;  4AQY B;  1AP5 A;  4UCU A;  1NU1 K;  1F4M A;  1Q5O A;  3SJB C;  1NKD A;  4CC6 A;  1L0N H;  3FYI B;  1L4A D;  4MS2 A;  3WFV A;  2QJK B;  1BE3 H;  4OWF A;  4HH2 A;  5IE9 A;  2H8P C;  1WMK A;  2Y0E A;  1RHZ B;  2YO2 A;  4LF9 B;  2HVJ C;  2DN9 A;  1S77 D;  1J5E B;  1SQB K;  3TGU D;  1VF5 C;  3MHV A;  3RK3 D;  2KB1 A;  2E5L O;  1H0T A;  4K0K B;  4H13 C;  3SYA A;  2H43 A;  2NZ2 A;  4WY4 D;  4ZKU A;  4WBA A;  2QJP B;  3E8H A;  1JCC A;  3LDE A;  4FLW A;  1IUR A;  2Q7E A;  1CP9 A;  4LGD E;  2HLO A;  1H8E G;  3AG1 C;  1LT9 C;  3CX5 E;  3M9H A;  1AI6 A;  3ZBH A;  1YIJ V;  1BQZ A;  3ASN B;  1KIL C;  4YTP C;  1Y8A A;  4X1I B;  2W8Z A;  3LSU A;  1SQV D;  5EFW B;  3SWK A;  3HUS B;  1KOR A;  3VQW A;  4BXL A;  3FKS G;  1FZC A;  2LW7 A;  1M7L A;  4DJG A;  4YHH O;  2POH A;  3JYC A;  3S1K A;  2YXQ B;  1VQ4 V;  3CRQ A;  3KXD A;  1H8H G;  4CS4 A;  1L4A B;  2D2C C;  5AVZ B;  2A3Q A;  2QKA A;  3FAV B;  1Q6I A;  3SYO A;  5CHX A;  4BR6 A;  3IFX A;  2IM9 A;  3ABK B;  2E75 B;  1Z2G A;  4DUY O;  1YHQ V;  1SQP J;  1ZN5 A;  1ZW0 A;  5AVU B;  4L73 A;  4FJC C;  1H2N A;  2NNU A;  2GTA A;  3BRT B;  3ZN0 A;  2NRG A;  4C7N B;  1L4A A;  4OGQ B;  1EDK A;  3BAT A;  4XDJ A;  2J5U A;  3H1L J;  1Y74 B;  3RT3 C;  3MAQ A;  4HYT B;  1AQ5 A;  2WPS A;  3J7A U;  3LSQ A;  5DED A;  4X62 B;  2N04 A;  2JWD A;  5TIS H;  2DYR C;  1YIT P;  2IX7 C;  4FPP A;  3IC9 A;  5B5E H;  3S9O A;  1HNW B;  1SQX D;  2KP8 A;  3BEH A;  4N78 D;  2QM4 A;  2I8D A;  5IWA B;  2ZYG A;  2Q0A A;  2UUA B;  2Z3Y A;  2F66 C;  4PDV A;  2P6J A;  2PGD A;  3KG2 A;  2FKW B;  4JTC B;  1YJ9 V;  4YJ3 A;  3RVZ A;  3H1I E;  5APV A;  2YID A;  1QR9 A;  1JTH B;  4UB8 Z;  1X4T A;  1N73 A;  3JD1 A;  3L71 G;  3M9Q A;  1GN3 A;  1GTO A;  1NH2 D;  4WFG A;  2ZE5 A;  1BSM A;  4AQR D;  3IF4 A;  2FB5 A;  1NTM D;  2A79 B;  1YZB A;  2BE3 A;  2QDO A;  1G2C A;  4N23 A;  5HFM A;  5J2T A;  1OCR B;  4NXN O;  1RF1 B;  2Y0D A;  1FXK B;  4LFA B;  3VTP C;  2IZ0 A;  1XTC C;  1WPB A;  4FZ0 A;  3EHB B;  3HTK B;  4OPH A;  5IYB O;  1M1K Q;  3KZI Z;  3MDS A;  3K57 A;  2O57 A;  2RMZ A;  3ABM B;  1KMI Z;  3OR6 C;  1L0N J;  1R8E A;  1T2K D;  3UKM A;  1JCH A;  4NPF X;  4LF7 O;  4NXM B;  4AQY O;  1FXK A;  1YTF D;  4X20 B;  4H0L C;  2FKX A;  4GOD A;  1BGY J;  2BEZ F;  1MOF A;  1SQQ K;  2IPP A;  1PPJ G;  1VQN V;  2UXD O;  2W0X A;  3OFN G;  4GUN A;  4P9P A;  2PP6 A;  2QRX A;  4O2A B;  1TUB A;  1NAF A;  2VS0 A;  3CC2 P;  4PDM A;  3C3T A;  4GX1 A;  3CCS V;  1SQQ H;  5M1B A;  1WA8 A;  1XBL A;  1N32 B;  2Q5Z A;  3H1I D;  2XUM A;  1S5L X;  4PHZ A;  4H44 D;  4QMA A;  1N8R W;  1RM1 C;  1SVF A;  3JAT B;  2WWW A;  5LOV B;  3P3N A;  2YEV B;  4Q20 A;  3UT5 A;  4CH5 A;  1L0N K;  1JNM A;  1J1D C;  1HVV A;  4PD4 H;  3F7V C;  4J7K A;  1AR1 B;  2DQ3 A;  3N4X A;  4ZOL A;  1KQS O;  1E79 H;  4LF4 B;  1Y66 A;  2QTO A;  2NPS C;  4JI7 O;  2YIU C;  3IAY A;  2WLH A;  4MTO A;  4KUM A;  3HE4 A;  1N73 C;  3BPZ A;  4FIP C;  2ZT9 C;  3MHH C;  5LXT B;  4ZHQ B;  4I7Z C;  3WG7 C;  4YHH B;  4JPR A;  4NVP A;  4ZKI A;  3AE7 C;  2IJH A;  2PI4 A;  3ITK A;  3UQ8 A;  5KHG A;  4JI5 O;  2AHY A;  5K5G B;  3H1L H;  5B1B C;  1BQ0 A;  1VF5 B;  2ZD9 A;  3QO8 A;  4GKJ O;  5B3S C;  4O2B A;  1BHA A;  3APQ A;  2Z4E A;  5GON A;  3HKC B;  3HB3 B;  4GX2 A;  2O1K A;  3CC7 V;  2N9B A;  3CCS P;  1NH4 A;  2V7Q H;  3F5T A;  3OM3 B;  1M57 D;  1SQP G;  3A2F A;  1GO3 F;  3AE5 C;  1ZR4 A;  3ETD A;  1SQB H;  2KB7 P;  5APX A;  5CA0 B;  1FZC C;  1OX3 A;  3QF7 A;  5KJ7 C;  1SFC B;  2JKV A;  1SQB E;  4RKU J;  3O65 A;  1HNW O;  5KMG B;  4N78 E;  4TV8 A;  4PD4 F;  1BMF G;  2YO3 A;  3L75 D;  1NYH A;  4Y28 J;  4BWN A;  1S9K E;  2E43 A;  2MKV A;  3K3W A;  4U3J B;  1NI8 A;  4KT0 J;  3ABU A;  1OW7 A;  5AW0 B;  4NTW A;  5IJ9 B;  5JVD B;  1UII A;  4W7Z A;  3FD9 A;  4WFE A;  2W6J H;  3IAO A;  4JYC A;  2Q0O C;  4LF8 O;  4LFB B;  3H1H J;  4TUY A;  1N33 B;  4UCT A;  2C0W A;  4IOI H;  1RH5 B;  3HUS A;  5BVZ A;  3X2Q C;  1Q90 D;  1EDL A;  1TVK A;  1LTG C;  1H2M A;  2DOS A;  3H1H G;  4JI3 O;  1PGO A;  3QNE A;  3AEA C;  3CCU V;  4PI2 A;  3STZ C;  1PGJ A;  1FYJ A;  3OMI B;  1VQ6 P;  4NB5 A;  1SQQ D;  1VDF A;  1KIL A;  2R5B A;  5KLV G;  1Q82 Q;  2EIL C;  3W7T A;  1M1J C;  3BCC E;  1H8A A;  2CUG A;  4LNU B;  5IYD O;  2E75 C;  4UCS A;  2JEE A;  1FJG O;  4I9Q A;  2X6A A;  1QBZ A;  1OJH A;  5LOV A;  3JCU H;  3SYP A;  5KA6 A;  3B8E B;  1S5H C;  4KXR A;  3L75 H;  1S5L H;  1UFI A;  1GTW A;  3P3P A;  4JI0 O;  2YXY A;  1VQK P;  3W7U A;  3AEG C;  2A06 G;  2E74 B;  2PGG A;  3JAL A;  3FWL A;  1VQK V;  2VRZ A;  1BDC A;  1Q82 W;  4X65 O;  5AW6 B;  2P2U A;  1AV1 A;  2KSD A;  2ITD C;  2N74 A;  2KLU A;  2EBO A;  4ABM A;  1RE3 A;  4IL6 Z;  3A3Y B;  1J95 A;  1Y47 A;  2GV9 A;  1I7F A;  1M56 B;  1EQ7 A;  2PRR A;  3AE1 C;  4DV0 B;  2JJL A;  3A0R A;  1QCE A;  2AZ0 A;  2KKW A;  1OCO C;  3CX5 I;  3CCR P;  3WU2 Z;  2DJV A;  1N32 O;  4PD4 I;  5GW7 A;  3FB5 C;  1MUU A;  1Z5W A;  4AYC A;  1RF1 A;  1Y76 B;  3GLM A;  1Y74 A;  2YKO A;  4KP4 A;  3B8M A;  4JPZ B;  1PGP A;  2LP7 A;  1QVG U;  1JMK C;  2XU6 A;  4E2L A;  3SWF A;  2YSU B;  1OVR A;  1OWA A;  3L72 D;  5BZB A;  2WLJ A;  4PA6 A;  4IIJ B;  1VAR A;  1YXB A;  5GTI E;  5K1P A;  1NVP D;  1GH6 A;  4LR3 A;  1OHH G;  3T1H B;  1W2E A;  1YYC A;  2CK3 H;  4JI7 B;  5AW3 B;  3AEI A;  1AIL A;  3ML0 A;  3JCZ A;  4I7Z B;  3IFM A;  1L0L J;  3S4R A;  3JAW B;  5B1N A;  1VQO V;  3QG5 A;  5H2F H;  1WP8 A;  3QO7 A;  5CA3 A;  2P67 A;  3MUD A;  4OH8 B;  1JA8 A;  1X59 A;  3V2N A;  3D71 A;  4RAI A;  1CPY A;  4B3R B;  1K5S A;  2KUB A;  4BRY A;  3N2G B;  5JCO A;  1PV3 A;  3T1C A;  3HKE A;  1RPR A;  5B5E E;  2K3R A;  1K05 A;  3W7S A;  3SFD C;  2ZE8 A;  3MHS C;  1S9K D;  1PL0 A;  1FZE A;  1CXZ B;  4LF6 B;  4WFA V;  4GKJ B;  5APS A;  2QKC A;  1M1J B;  5GTI Z;  5AW8 B;  4NR1 A;  5KUK A;  1R1B A;  2BOB C;  1S2E A;  4JI2 B;  5FLX N;  2LFS A;  3ETG A;  4DR6 O;  1QL1 A;  5J9P C;  1NTZ J;  1KD1 W;  3L72 H;  2OIG A;  1B04 A;  3T4Z A;  2M7W A;  1LTT C;  1P7B A;  2X0L A;  3H1L D;  2UXC O;  2WLN A;  1YF2 A;  1AR4 A;  3L73 J;  4DV2 O;  3M0D A;  2HFE D;  1FFX B;  3ABT A;  1SQX J;  5KLV H;  2YI8 A;  1ZOY C;  2ETN A;  4J7Z A;  3KHU A;  3JSL A;  2XV5 A;  1ZL8 B;  4Z1V A;  2ZE7 A;  2NN4 A;  4DW0 A;  1BE3 G;  1LTJ B;  4W4K A;  1URQ C;  5C93 A;  3R4Y A;  1MZE A;  2QWQ B;  4DR4 B;  4UUJ C;  4X66 O;  1JUN A;  1DF5 A;  1FFX A;  5LL6 Y;  4LLH A;  4HB1 A;  4OPA A;  4UB6 H;  3QTC A;  4MVU A;  1KQF B;  3KCY A;  1GAX A;  2WVR A;  3W7W A;  2WMM A;  3KDP B;  5KAI Z;  2LJ2 A;  3DC6 A;  2XND H;  4D6T D;  3NXS A;  4G28 B;  1V54 C;  1OMI A;  2B87 B;  3JD3 A;  2ARH A;  4F6R B;  4F4L A;  1LTJ C;  2F93 B;  4Y99 B;  1XL6 A;  4TV8 B;  2E76 C;  1GU5 A;  4EI2 A;  4RJT A;  1SQP H;  4I55 B;  1AQT A;  3WB2 A;  3ZED A;  3JD0 A;  2IU0 A;  1CI6 B;  2J59 M;  1OV9 A;  1XMO O;  3G6E P;  3E89 A;  2IYP A;  1GKF A;  1HGZ A;  1KD1 Q;  1M56 D;  2Y4T A;  5LGT A;  2IDB A;  1AA0 A;  2F4V B;  3RL0 C;  4X65 B;  3AG3 C;  2V1D A;  4H33 A;  3B4S A;  2JEU A;  2OT5 A;  2KNC B;  1GMG A;  4IHJ B;  2Y9Z A;  2P58 A;  3X2Q B;  1NHL A;  1JQ0 A;  2OAR A;  2D2C B;  1L4A C;  1ZME C;  4DV0 O;  1BHB A;  1VIB A;  4P2Z A;  2Q7G A;  2IBZ E;  1K33 A;  3JAS B;  1AI4 A;  1UIX A;  5C8Y B;  2WLM A;  2JGD B;  3CXH I;  1HF9 A;  1H2K A;  3Q4H B;  4G2K A;  1N34 B;  2FYU H;  5BR8 B;  1SS1 A;  5LP6 A;  2W6A A;  3E1I A;  3IGA C;  1JY2 N;  1H2S B;  4I2L C;  3PN1 A;  3SWY A;  2P90 A;  4AI8 A;  3LW5 H;  1XOU A;  2E5Y A;  3DC5 A;  1L0N E;  2Q5U A;  1XHX A;  4JZG A;  2QA4 V;  4DV4 O;  3G71 P;  3T1H O;  4FM2 A;  2JS5 A;  4OX9 B;  4PV1 C;  4CH4 A;  3G9R A;  1KIL D;  2FML A;  1IFN A;  3ZHV A;  3I55 P;  2JJ1 G;  1CEZ A;  4LWS A;  1KN7 A;  2UUC B;  3L72 E;  1OZ0 A;  4O4L B;  1VQ5 P;  2A45 I;  3Q1M A;  1BGY H;  4J10 A;  3A5T A;  2OGU A;  3S3X A;  2VWJ A;  1IVS A;  4DV1 O;  3L36 A;  1K97 A;  3L73 H;  4PEL A;  2E74 D;  4WWI A;  4JI1 B;  4HNA A;  4FK5 C;  5BMV B;  1N7L A;  3CJH B;  1FDO A;  2IFM A;  2C9N Y;  1N7S C;  5KHJ A;  5CCG C;  3LNN A;  1ZLZ A;  4UV9 A;  1NTK D;  2FFD B;  5IJ0 B;  1S72 V;  3ZMZ A;  1N0N A;  4O4L A;  3E1R A;  2R9R B;  3D8C A;  2PTM A;  3K06 A;  2KYV A;  5K1X A;  4D6T H;  4LF6 O;  2LXB A;  3CCE P;  3D36 A;  1NOH A;  1VQ9 P;  4EFE A;  3WU2 E;  4QPK A;  3B71 A;  3P8C D;  3K5M A;  2A45 G;  1I0H A;  2WQY C;  4B3T O;  5AVR B;  3BCC H;  1XL4 A;  1KEC A;  3W7X A;  2FYN C;  3VMX A;  1KU9 A;  3AG4 B;  3H1J H;  4TV9 B;  3MUD C;  4E4E A;  1AVY A;  2ZIO A;  3E8G A;  2M5A A;  3L70 J;  1P7G A;  3T4D A;  2GUV A;  2B88 A;  3RYF B;  2DWE C;  1RM1 B;  3CCQ P;  1N0J A;  4RO2 A;  4LC1 A;  1D7M A;  3C1L A;  1YQ3 C;  3V4W A;  1F4N A;  1NTZ H;  3L74 G;  2EIN C;  1P84 E;  2RQ6 A;  3N7N A;  3A0B Z;  1H2G A;  3CWB G;  2W6B A;  1SFC D;  3PLN A;  5KLV J;  3PTZ A;  2YIB D;  4QPJ A;  1IJD B;  1GU4 A;  3V2R A;  5EZY A;  2EJ7 A;  1X22 A;  3AEC C;  1OCZ C;  3K5N A;  3Q3D A;  3H1I G;  2O3J A;  2Q6Q A;  1XMO B;  4DUZ O;  2B9B A;  4LFC B;  4HBN A;  3VN0 A;  1MSW D;  2Q1K A;  4JAS A;  4PDR A;  3RYC B;  1TU3 F;  2FYN B;  3ABM C;  2NR5 A;  3THO A;  3CL3 D;  1OCC B;  2GTS A;  4X89 A;  4P30 A;  2YS8 A;  3CI9 A;  1V54 B;  1H89 A;  2KZJ A;  2BCC J;  3H1J D;  1X8Y A;  1YQ4 C;  3V4Q A;  1VQ9 V;  1VPC A;  2YI9 A;  1KIL B;  2R3C A;  3VMY A;  1OXZ A;  3Q5S A;  3CHX A;  3OGC C;  3WB0 A;  1JM0 A;  2ZXE B;  3FX0 A;  3CCJ V;  4EKW A;  2XKM A;  5AVV B;  3CCJ P;  3CCU P;  3U59 A;  1KYO D;  1Q81 W;  3E86 A;  2P06 A;  2P4K A;  1KB9 I;  5AW2 B;  3OTO B;  2IBZ I;  1NTK K;  1ZX3 A;  4MT8 A;  1Y76 A;  4PDL A;  3A0H H;  3H6P A;  2JRI A;  1FXV A;  1J5E O;  3E8F A;  1W0K G;  3RN4 A;  1LTA C;  4HJG H;  2ODM A;  4HNA B;  4MW8 A;  3HD7 D;  2P10 A;  4BW9 A;  3TGU G;  3SJC C;  2QR4 A;  1BGY D;  4O4H B;  4UB6 E;  5E1A C;  3RYH A;  2O01 N;  3TCU A;  1R3K C;  3P8C E;  3OD4 A;  4I0X B;  4CS2 A;  1EFR G;  2JDI H;  3T97 B;  2Y0I A;  3L73 E;  2WT7 A;  1IBL B;  2IJK A;  4DR1 B;  1XQ8 A;  2JJ2 G;  4I4T A;  3IR9 A;  4XFJ A;  3H1K E;  2AEJ A;  3FB7 C;  2ZT9 D;  1KV4 A;  3HTK A;  2CH7 B;  1BT8 A;  2EIN B;  3CB2 A;  5BR8 O;  2KQX A;  3H01 A;  1WLE A;  4GKG A;  2OYI C;  2XAQ A;  3SPJ A;  1WT6 A;  5AVY B;  2YIU B;  3ABK C;  5L3B A;  2Q9L A;  5EYP B;  2WLL A;  1KFM A;  2NPS B;  1YJW V;  4X20 A;  4U7O A;  3ZHU A;  3CE2 A;  5LP6 C;  3JAM N;  2B1I A;  2P22 C;  4B3S B;  4OX9 O;  3M8A A;  2W6I G;  4DRX B;  4DUY B;  1IC2 A;  3BCC J;  1K9M Q;  2UUC O;  3CD6 V;  2X6C A;  1OW8 A;  5DJT B;  4OGQ D;  1SQF A;  4BIZ A;  1XNQ B;  1PNL A;  1IFM A;  1M1K W;  2F23 A;  2WLK A;  2N9Y B;  1IBK O;  1I08 A;  4X62 O;  2JO1 A;  1JJ2 U;  1AP6 A;  3L73 G;  1RFY A;  4ZI7 B;  3OEH G;  4IGG A;  4ZKP A;  1A32 A;  4HYO A;  4R6Z A;  5EC2 C;  5BU5 A;  4QJF B;  5H6R A;  3BVO A;  5KA5 A;  5CJ0 A;  4WBN B;  5CA1 A;  1V9P A;  1N7S A;  1XTG B;  2RJZ A;  1YSC A;  2Q4P A;  2O01 H;  1IFD A;  1B3Q A;  3DGE A;  1Q3E A;  2QTS A;  2KNC A;  2Z0A A;  5LHI A;  4B7K A;  1LWU B;  3M9B A;  4LBE C;  1BDD A;  3GHG B;  1GN6 A;  1NS1 A;  2CAZ C;  1KFN A;  2A06 D;  5GTH E;  1OCO B;  1FKA O;  4WBN A;  4PA4 A;  1RF1 C;  5B1O A;  4D7T A;  1BCC J;  3CC4 V;  1NTM J;  3L71 D;  2QM8 A;  4UCR A;  1T3J A;  3CC4 P;  2IJJ A;  2YIB A;  3EFF K;  2CGO A;  3B40 A;  3JAS A;  4LFA O;  1AJY A;  2K1E A;  1NT2 B;  4DUZ B;  1XIL A;  2JIZ G;  2JGD A;  2ZYD A;  4O4J A;  1LWU A;  5JJJ B;  3B5N B;  1MA1 A;  3HD7 B;  3GHG A;  3ZRW A;  1VF6 A;  3HKC A;  1BGY E;  2ILM A;  3VMZ A;  4TT3 G;  1EZV D;  1JB0 J;  3CD6 P;  2KG7 B;  5E79 Z;  2E75 D;  4UV8 A;  1HJB A;  4MVR A;  5LA6 A;  4GKK O;  2QWO B;  1U7M A;  2XT9 A;  1XUQ A;  1R5S A;  3H1K H;  5IY5 C;  1S5L Z;  1ENV A;  2ZDI A;  1NU1 H;  1NTM E;  1KZU B;  4FVM A;  2UXD B;  2YKQ A;  1YJW P;  1JR9 A;  1VEW A;  4MVZ A;  3E22 B;  4LFC O;  2W90 A;  4DZO A;  1LTS C;  3N27 A;  2QWN B;  4HKZ H;  4GIF A;  1VP7 A;  3WUU A;  4D6T E;  2DW3 A;  4NTX A;  1CSB A;  4X8A A;  3CRM A;  4YXW G;  4B3M B;  2EIL B;  3APO A;  1SKV A;  1U96 A;  3ZX6 A;  2CH7 A;  1GDT A;  1M8O B;  4JYB A;  4IIJ A;  1R5L A;  4GYC B;  4ZNC A;  3KCX A;  2P1J A;  3CCM P;  2KLV A;  1SER A;  2ADQ B;  1QEX A;  1IX9 A;  4DK0 A;  1X0T A;  1VQP P;  4KL1 A;  4U3F E;  2C2A A;  2IH3 C;  3ASO C;  3H1H H;  1I94 O;  2N1T D;  1HJ0 A;  1MNG A;  2ATK C;  5L3F A;  1OVU A;  5D5P A;  3AG4 C;  4EEQ A;  1YIT V;  3Q4H A;  3F7Y C;  1EZV H;  3OAK A;  3TGU J;  5EZY B;  5CA0 A;  3CXC U;  1Z56 A;  4H0L D;  4J42 A;  1GD2 E;  4GCZ A;  3TXQ A;  4TLF A;  4XA4 A;  1IXB A;  4YIO A;  2IJI A;  1T8Z A;  1ORQ C;  5JCO C;  2I1J A;  2HOD A;  1BSH A;  2XAJ A;  4IHJ A;  4YIP A;  1FU1 A;  3RYF A;  1N36 O;  4LWS B;  1SQP E;  1IBL O;  4H37 A;  1SZT A;  1Q43 A;  1N7S B;  2B9Z A;  1DIP A;  1PL4 A;  5H2F Z;  3CLQ A;  3OAA G;  2V7Q G;  4DV7 O;  1HP8 A;  1K4D C;  2EIJ B;  5APW A;  3ZMS A;  2UU9 B;  5B3S B;  1XNQ O;  2CTQ A;  4O9B A;  4B08 A;  1YVW A;  4K3A A;  3E8B A;  2FFD A;  2HJD A;  3AK2 A;  2Y69 B;  2QJK C;  3GW6 A;  4BRY B;  4MVQ A;  1PV0 A;  1YIJ P;  4H44 B;  2Q8V A;  1LT9 A;  4JZ2 A;  4X1Y A;  1L0L D;  1QHT A;  3WG7 B;  4IFF A;  4RES B;  3L74 H;  4RUE A;  1NTZ G;  1M57 B;  4YPC A;  4FM0 A;  2Q3E A;  1EN4 A;  4GOF A;  3USS A;  2ZT9 B;  2FYU D;  3CRR A;  1NTM H;  1SA0 A;  2LGQ A;  3I56 V;  3FXD A;  2XDJ A;  5H2F E;  1AB3 A;  3PHL A;  3K03 A;  1S5J A;  1E1Q G;  1QL2 A;  3H1K D;  3OW2 U;  1CW5 A;  1QVF O;  5BMV A;  4R4M A;  1QLE B;  3J80 N;  2A45 H;  2QG4 A;  1K7D A;  3K59 A;  2Y9Y A;  2GUS A;  1VQ4 P;  1FDM A;  5KAF H;  1R6K A;  3L70 G;  4ZMD A;  2WPR A;  1Q2N A;  2CE4 A;  4ICG A;  1SQQ J;  4EFB A;  3Q2Y A;  1QVF U;  1BCC G;  2HEP A;  1G6U A;  2BSK A;  2WA3 A;  3O9O A;  5B66 H;  3OW2 O;  2GA1 A;  1NO4 A;  1NU1 J;  3HKD B;  2QJY B;  4DRX A;  1SQQ G;  5EBL C;  5KJ7 D;  3CWB H;  1M90 W;  2LFR A;  4QIW F;  5KLV D;  3AE9 C;  3H1I J;  4U3F G;  5KAI E;  2KIK A;  5DN6 G;  4L76 A;  5BU8 B;  1S72 P;  1W0J G;  5H6Q A;  5AVT B;  2YUA A;  3UCS C;  4X88 A;  1KUQ A;  1VQO P;  4MW3 A;  5AVS B;  3I5D A;  3P32 A;  3WB1 A;  3BY6 A;  5JVD A;  3CCL V;  2BCC G;  4Y99 C;  2EIJ C;  3CCE V;  1EC5 A;  3G6E V;  2FL4 A;  2W83 C;  4EB6 B;  1S1C X;  1BCC E;  2HLD G;  3TDK A;  4X64 B;  2HHH B;  1BCC H;  3B5N C;  1SS3 A;  1FXK C;  4DO2 A;  1PP9 J;  2OYH C;  2OTL P;  3V5B A;  3VMA A;  2KZI A;  1AJQ A;  4DOJ A;  1BL8 A;  3BAA A;  2F1M A;  1M56 C;  4MVO A;  2W27 A;  5EK0 A;  2H88 C;  2ZVO B;  1IZ3 A;  2MJZ A;  4C7R A;  1JOC A;  1MV8 A;  4B3M O;  1ZP0 C;  2HG5 D;  1LWU C;  4J9Y B;  3U1C A;  2JWA A;  1GN4 A;  5CCH D;  3VYI A;  3IJ4 A;  4U3J A;  4DYL A;  1VQL V;  4K0K O;  4B86 A;  4EDF A;  1LGH B;  3BVH A;  2C9L Y;  1NTZ E;  2UUB O;  5LMU O;  3AE6 C;  3H32 B;  1HW7 A;  4O4I B;  3F89 A;  3WU2 H;  1DEE G;  4Z2W A;  3CPW O;  5B1A C;  1SQX E;  1FXH A;  4DR7 B;  2HP8 A;  3F5W C;  4OXS A;  4X1Y B;  2JEX A;  1YJN P;  1U7J A;  2HKO A;  4PA7 A;  2AGA A;  1YTZ I;  1RF0 C;  2PF4 E;  1K8A W;  3OJA B;  4EYY Q;  2A0L A;  1USE A;  3RGU A;  4U7J A;  5GON B;  1IBM B;  4B3R O;  2UU9 O;  3BAS A;  1Q81 Q;  2ZIN A;  2JVD A;  2QEX P;  5EC1 C;  1MKM A;  2GBO A;  2FTK A;  4LNU A;  5CCG A;  2QKS A;  2H89 C;  4PV1 D;  2WSE H;  1YHQ P;  1GK6 A;  3KZI E;  4ZBM A;  2AEM A;  3BCC D;  3RYH B;  2PFX A;  3ZRW B;  4DV6 B;  2AXC A;  1QR8 A;  3RK2 C;  3CXH F;  1GL2 A;  3M7M X;  3GG2 A;  1HBW A;  4DV7 B;  2N05 A;  4MN4 C;  3JAL B;  3ZCC A;  1VF5 D;  2DYS C;  4JTD B;  3U10 A;  3C9I A;  4WY4 C;  2WAM A;  3M0D C;  3B2E E;  1NTM K;  3QVN A;  5AG2 A;  1SET A;  3BRC A;  3UO3 A;  1O9G A;  5AW1 B;  3JD4 A;  3AE2 C;  1NR1 A;  2E3C A;  4JAA A;  2AW9 A;  2EIK B;  2GSM B;  3E22 A;  5ITZ B;  4H44 C;  3G4S P;  3Q5R A;  1GL2 B;  5KLI C;  3N2K B;  2AXT E;  2FFD C;  1HWT C;  3CWB D;  1HNX B;  2LXC B;  3CMA V;  5IWA O;  5AW9 B;  2VQF B;  4JTA B;  2AZ2 A;  2OWO A;  1X9V A;  1IK7 A;  2HOD B;  2M3B A;  2A7W A;  2X6B A;  4EB6 A;  3K0G A;  4X66 B;  2RKL A;  2WLI B;  3CX5 D;  5E79 H;  2OTJ V;  3K79 A;  4UVA A;  2QSA A;  4M3L A;  2YC0 A;  1ZAU A;  5FNV A;  1NKN A;  2D2C D;  3JAK B;  3ZHT A;  3RYC A;  1GRJ A;  3L74 J;  4LF5 B;  2IBZ G;  4NXN B;  2CTW A;  3ABV C;  1IFJ A;  1NU1 G;  3ZJZ A;  3A0B E;  4JI8 B;  4JAU A;  1GM7 A;  4NTY A;  4I1L A;  4DR2 O;  4PD4 E;  1WJZ A;  1FZA A;  1HGV A;  2DYS B;  1NKZ B;  2H8P D;  3VQV A;  3CXH H;  3TGU E;  3WUV A;  1J2J B;  1QU7 A;  1HWY A;  4X64 O;  4A7P A;  2HHH O; 
#chains in the Genus database with same CATH homology
 2FYN C;  3AEE C;  2OQQ A;  2YIU C;  4H13 D;  1OW8 A;  1ZP0 C;  4OGQ D;  1NGM B;  2JP3 A;  2D2C C;  3O6Q A;  1OMI A;  2ZT9 C;  3H25 A;  3AE1 C;  1KIL E;  2QJP C;  2V7Q J;  2E76 C;  3GF3 A;  4I7Z C;  1DIP A;  2E75 B;  2JO1 A;  3AE6 C;  1YQ3 C;  3AEF C;  3AE7 C;  1EXJ A;  1DD3 A;  4H0L B;  3GLM A;  1KQG B;  3AED C;  4OGQ B;  2J5U A;  4H13 B;  4R4L A;  2QJK C;  1VF5 B;  2IDB A;  3AEC C;  3Q3D A;  4H44 B;  4U7J A;  3S9O A;  3RK3 E;  4I7Z B;  2WPV B;  2YMK A;  1MKM A;  1TU3 F;  2QJY C;  4TT3 H;  4Z1M H;  3D6Z A;  3AE5 C;  3GMA A;  3Q5P A;  2ZT9 B;  2H89 C;  1ZRT E;  2D2C B;  4PV1 D;  1ZME C;  2WSC J;  2QIW A;  1Y9B A;  1YQ4 C;  2WSE J;  1FDI A;  4RKU J;  3D71 A;  1AJY A;  1UIX A;  4Y28 J;  3Q5S A;  1NYH A;  1U57 A;  2MKV A;  1PV3 A;  2BEQ D;  4YXD C;  3EWK A;  1PIX A;  1RQU A;  4KT0 J;  4R4M A;  1OW7 A;  1HF9 A;  1VF5 D;  1JB0 J;  5L8R J;  1K05 A;  2E75 D;  2O01 J;  3IAO A;  4GDO A;  3SFD C;  3RL0 g;  1DD4 A;  3AE2 C;  3IN6 A;  3D6Y A;  5KKZ C;  3GF7 A;  3Q2Y A;  3Q5R A;  1Q90 D;  4H44 C;  5KLI C;  1KMI Z;  1RQV A;  4PV1 C;  1R8E A;  3G9R A;  3AEA C;  3AE9 C;  1WMK A;  2P10 A;  2G8Y A;  3Q1M A;  1IK7 A;  4H0L C;  2FXP A;  1KTM A;  1K04 A;  2BEZ F;  2E74 D;  3D70 A;  1VF5 C;  1ZOY C;  1PL5 A;  3T97 B;  4H13 C;  3AE8 C;  1FDO A;  2NZ2 A;  2E75 C;  4OGQ C;  2FBW C;  4PV1 B;  2D2C D;  3AE3 C;  1VL2 A;  4XFJ A;  2G3A A;  2ZT9 D;  3LW5 J;  5M1B A;  1S1C X;  1HJ0 A;  2E76 D;  1S5L X;  3ABV C;  3FGA D;  2K9Y A;  3SFE C;  4H44 D;  3R4Y A;  1OW6 A;  4IL6 X;  2E76 B;  3AEG C;  1GMJ A;  2E74 B;  4YTP C;  2QSI A;  3C8V A;  2WSF J;  3AE4 C;  1KQF B;  1KOR A;  3B71 A;  1EXI A;  3AEB C;  2WQY C;  2H88 C;  4H0L D;  2E74 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...