4H0LB

Cytochrome b6f complex crystal structure from mastigocladus laminosus with n-side inhibitor nqno
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4h0lB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h0lB01
2WSEJ 4OGQB 4IL6X 2WSCJ 1JB0J 1VF5B 2QJYC 2QIWA 4H44B 5KLIC 4KT0J 1ZRTE 5L8RJ 4I7ZB 2D2CB 3C8VA 2QSIA 5KKZC 2FYNC 2QJPC 2E76B 3LW5J 2O01J 2E75B 1Q90D 4Y28J 2YIUC 2K9YA 1S5LX 2ZT9B 2QJKC 2WPVB 4H13B 2WSFJ 2E74B 4RKUJ 4PV1B 4H0LB
chains in the Genus database with same CATH superfamily
4DUZO 1SS1A 2ODMA 1QLNA 3K0GA 3L35A 2B1GA 3B09A 4ZNCA 1S9KD 1YHQP 3B71A 2QG4A 1YJWP 5CBHA 2Q9LA 1BE3E 1TVKB 4U7OA 2Q4PA 3D71A 2YI9A 5KA5A 1KC8W 4GX5A 3B2EE 1NTKH 3RGBA 3B5NB 4DV2B 1AP5A 1NTZK 3IC9A 1RF1A 5JJNB 1M56D 4MTGA 3BASA 4DV6O 5GONB 3FWNA 1BT8A 3RFRA 3BATA 1GN4A 5EBWC 1XDCA 4JF3A 4B3SO 3B5NC 3G80A 1NU1H 4X1IA 1QX8A 2Q6QA 2UUBB 4O4HA 1S2EA 2QSIA 5CA1A 3L4FA 4ZKPA 1IBLB 1R3IC 2DN9A 1M7LA 4KUMA 4DV6B 1AP6A 4A5UB 2E74D 1NAYA 3TXQA 1L2PA 1PL4A 1KB9F 4J42A 5AW0B 4R4LA 2VWKA 4IL6H 5B66E 2WSEJ 4OGQB 4G28B 1YTZI 1YJ9P 1SQQK 1H8HG 4OXSA 3B77A 4UUJC 1KTMA 2ZXWC 1L0LE 3OUFA 4Z1MG 2E76D 3L72H 1RF1B 3N4XA 1PNKA 3L70H 2GUVA 1KQSO 4UCSA 1GMJA 1LNQA 1N0NA 4OGQC 1GN3A 4LC1A 4LNUA 4RWUA 5LGTA 1WN7A 2W0FC 2UXBO 5AVQB 5BXZA 4X1IB 1P84E 5LL6Y 4O4HB 4X65O 3ZHVA 5CA1B 1EZVG 1VIBA 1BGYG 3GWOA 4JI4B 1JO5A 3CHXA 1KECA 1S72P 2ZKOA 5AW8B 2WTYA 1YJNP 3HRNA 5B66H 3ZEDA 3AE9C 1CP9A 1YITP 2C9LY 3ASOB 1R3LC 4UV8A 1NI8A 1WMKA 2FYUK 4PHZA 4GKKO 3BRCA 2YMKA 1YIJV 3ZMZA 4YJ3B 1M93A 4DXWA 4P9OA 1K3EA 1NOHA 5KLVJ 3ZMTA 4JI7O 1QNMA 3DSQA 4PA3A 3CCJV 3LSUA 1G2CA 1R5SA 4LF5O 3T1HB 1M57B 2P10A 3ASOC 3CCQP 3ZJZA 3HE4B 4WFBV 2IBZH 3L73E 2QE7G 3MUDA 2WMMA 3EHBB 5IJ0A 3J7AU 3O65A 4PDMA 3FXDA 4LNUB 1OW6A 4DCKA 4HZ3A 1NH4A 1QVFO 2B87A 2W83C 1M57C 2ZE8A 3FB6C 3JYCA 5H6QA 2CK3G 1H38A 1FXHA 4LF6B 1H0TA 3TGUE 2W6AA 2Q6AA 3H01A 1ROPA 5KLVD 2OYHA 1A32A 2JS5A 4WCEV 2N1TB 3VQXA 1VQMP 4NVPA 2NPSA 3LDEA 3R66A 4WBNA 3SYPA 4YY3B 2CPSA 1AJPA 1YCIA 5EC2C 2ZT9C 1G2CB 2K88A 3AEBC 3MTUE 2PYLA 2YXRB 1KFMA 1B6QA 1UPGA 3WB2A 1QEXA 2MKVA 1E5WA 4HH2A 4DR5O 2IH1C 1Q90D 5IJ0B 1MKMA 4I4TA 4RJTA 4DW0A 3OW2O 3H1ID 3K5NA 4B86A 2QJPB 4O2BA 2YSUB 4JI8B 2QEXV 4ASUG 1I0HA 1L4AD 2B87B 2OCHA 1YEWA 1I7FA 1I5YA 1LT9C 1SFCA 1H0TB 1LT1A 2FMLA 1L0NH 3MUDC 1MFTA 2H94A 1LTTC 1ZP0C 1N8RQ 5AW1B 3X2QB 4MT8A 1NR1A 3TDKA 3VYIA 3N2KA 5APXA 3ABTA 4WFEA 1XOUA 2NPSB 1KBHA 4JQ0D 4WBNB 4QJFB 4RQEA 5H9CA 4UCRA 3I56V 3V2QA 1VQLV 3H1JD 1ZMEC 2DYRB 4OPAA 3AE2C 3A0BH 1TGOA 1O9HA 1T8ZA 1MNGA 3OFNG 4DV5B 2EX3A 5AVUB 3BAAA 3X2QC 2OYHC 1US6A 2R32A 4IT5A 4D6TE 2NPSC 1PIXA 2HPCA 1Q82Q 3E8FA 4I4TB 2VQFB 3RYFA 1TAEA 1IBKB 5APVA 3VQYA 1JMKC 1YYCA 3E7KA 2Q0AA 1G6UA 3CC4P 4O2BB 3H32A 5BVZA 1FKAO 3LW5H 1OCCB 4TSFG 4DR1O 2A45I 4FVMA 1SFCB 1OHHG 3CRRA 3UCSC 1SQVJ 2XNXA 4PI0A 3L70G 5AW6B 4DUYB 1NHLA 4JI0B 1KYOE 1QLED 1V55B 3N2KB 2A45G 4BW9A 3PN1A 3T97A 4I9WA 1AQTA 3K5OA 1N36O 2K1EA 1OCCC 4QMAA 5KUMA 1EC5A 3DGEA 2CTRA 5L3EA 1SFCC 3RK3E 5KMGB 2A0LA 3SPJA 2HFED 3CWBJ 2LW7A 5GTHH 1V55C 3KZIH 5K1XA 1PV3A 2FXPA 1Q6IA 2JGUA 5B66Z 2LGWA 3WFVA 1FC2C 2A06D 3RYFB 2OTJV 1SQQH 3AG4B 4DT0A 2BOCC 3K59A 2R5DA 3H32B 4X9QA 1SQVD 1XTGB 4W7YA 3OAAG 2EIMB 1P84I 2XHBA 3T1YO 4H44B 5K1PA 4J7KA 2ETNA 4ZHQB 4FM1A 1P7GA 3TNUB 5KTBA 3N27A 4LCUC 1S5LE 1N73C 3AE4C 3AG4C 5E1AC 4ZOLA 5FNVA 3MP7B 2LP7A 1R6TA 4MW8A 5L3GA 5LHGA 3CWBD 3ZRVA 4H44C 4DR4O 1BSHA 1GW4A 4U7JA 4FLTA 3Q2YA 1FZEA 2ZM6B 4XDKA 1DH3A 1NVPB 1K9MW 1J95A 3TJTA 4DK1A 1HDJA 1QVGU 5JCOA 2FYUH 4X8AA 1KD1W 3UQ8A 1XMQO 3M9HA 3C3SA 1BSNA 2O01N 2IYOA 3MHVA 1NTMH 3CLQA 4H13C 2CPBA 4L76A 1I94O 2AXTH 1K97A 3BHPA 1K7DA 1KN7A 2H88C 1U97A 1RF0A 2ZVOB 2VRZA 5M1BA 3JD2A 4X20A 1IFPA 2BTQA 2LKMA 1H2LA 1H2SB 5ITZA 3JATA 1JCHA 5BZBA 3CC7V 4HBNA 5FNVB 4ABMA 3LIEA 3TGUG 3CXHH 1HR0O 2PGGA 4LF4O 4KJMA 2HODB 3JAMN 4HJGH 3QVNA 2ZJSE 5IWAO 4JI2O 1Q8IA 1GTOA 1K34A 1FFXA 2OQQA 5AVRB 4GX0A 2OYOA 2Y4TA 3C1LA 4HKZH 3V2PA 3A5TA 5JJEB 1BE3D 2H89C 2N9BA 3LDDA 1SQBE 5D5PA 4NXNB 3C90A 2E74B 5LMNB 3JD4A 1RPOA 1THZA 2W6JH 1OCZB 3RGUA 4GLXA 3AEIA 4GZRB 5JQGB 3K79A 1K33A 1KKDA 2Q0OC 3C3TA 5JCOC 4N6JA 2UU9O 2IZ1A 5CCGD 1L0LJ 3JSNA 4JTDB 3JALA 2ARHA 2E76B 2M3EA 1MSWD 2E74C 3WU2H 4DV7B 2BTQB 2V7QJ 3K9AA 1M8OB 3ZMUA 5ITZB 1OCZC 3JATB 1FYJA 1JY2P 4UB8H 2AEJA 3VTPC 3D36A 3L74H 1RF0C 1YJ9V 1EM1A 1GN6A 1ZW0A 4JV5B 2A9HA 3O6QA 2X0LA 1FFXB 3E22B 3AE8C 1FXKA 1X9VA 2NNUA 5B3SC 2FKXA 1PP9D 4W4KA 1S1CX 3H1LE 2Y48A 1OVRA 1SQGA 3IFXA 1IXBA 1HNZO 4UB6E 1KB9I 1XNRO 2R3CA 3SFDC 2X6BA 3SWKA 1Q7YQ 4X64O 4Z2WA 4KHPO 1FDIA 1L0LD 2W90A 5TISH 1J1DB 1SRYA 5EIBC 5GTIH 1AI7A 4KP4A 3J81N 2V1DA 1HWYA 3ZBHA 2YS8A 3H1HD 1SQVK 2C0XA 3EVKA 2ZE5A 3JALB 1S72V 4LFBO 4LF8B 1I08A 3HKCA 3L73J 2YKOA 2Z4EA 1PV0A 5KHHA 2VQEO 2Y0CA 3QNEA 1LJ2A 1XNQB 1L4AA 4OX9B 3FYEB 4DYLA 1KQSU 4ZKIA 3WUUA 3M0DC 2QWOB 3B8EB 3O6QB 2ZR2A 1S76D 3TGUJ 1FXKB 3CCEP 2ZE7A 2O3JA 2OYIA 2K9PA 2K1AA 4UVBA 4DV3O 3D36C 1PGOA 2QKSA 1N7SD 2KS1A 2CTWA 1CW5A 3DC6A 4RAIA 2WA3A 4IYIA 1FXKC 1K73Q 3L73D 2B89A 1LTAC 1VQ4P 2FB5A 3D6YA 4Q6GA 2ZT9D 2RH0A 3HKCB 2R9RB 1NTMG 1WJZA 4LR3A 4DV3B 3VMAA 3A2AA 1D7MA 3W7SA 1VQMV 3L36A 5IJ9A 1PFIA 2RJZA 5DJUB 4E4EA 3TGUD 1I5XA 4TUYA 1L4AB 3N2GA 2UUAB 2WSCH 3L75H 2XKMA 2DYSB 4FM2A 5BR8O 3I5DA 2OT5A 3JSVC 1PGQA 1S5LZ 2EINB 4GUNA 5JJJB 5E79H 5KKZC 2EIKB 4FZ1A 1QVFU 3UIAA 1JOYA 3BCCE 1X4TA 2OYIB 4EYYQ 1ZLLA 3HE5B 3I55P 3OE7G 3BFRA 2OYQA 4GKJB 1K4DC 2DYSC 1BL8A 2KS1B 3OTFA 2BEZF 2NR5A 1DEEG 2KSDA 1KILA 1VQ9P 5TJHA 4MW3A 1WB7A 2OYIC 1QBZA 1Q86Q 1VQNV 2UUCB 1SQPK 2G3AA 4N78D 5LOVA 4W80A 4D6TJ 2RKLA 4UFZA 4I7ZB 2H8PC 4DR7O 2I1JA 4CBCA 4O4JA 3AEFC 3Q5PA 2E5YA 3II6A 3H1IH 5IJ9B 1BGYE 1HBWA 2E75D 1ZXGA 4YTPC 5CJ0A 3BCCH 1PGJA 1LGHB 4TUYB 1YBKA 1YI2P 3N2GB 1AA0A 2KKWA 2LXCB 3ZRSA 1R3KC 2CH7A 4NPDA 1JEKA 2JWDA 3UM7A 2JJLA 3JCZA 4ASWA 2EJ7A 1IVSA 1QLEB 3AG3B 4O4LA 2AEFA 1HNWO 1N33B 1DEBA 1MV8A 2IPPA 4AYCA 3VQWA 3G6EP 1S3JA 2E5LO 4K3AA 1SQBG 3L74G 3AE3C 3L75D 4WVZA 1N7LA 3H6PA 3H1JH 1MUUA 2LXBA 4NPFX 1R8EA 4NTYA 4D6TD 3ABKC 4L8JA 1L0LK 1VMGA 1JUNA 3UT5A 4GKGA 4BW5A 2A7WA 1P84F 3ABVC 2Q8VA 1KB9D 2PP6A 3HD7C 3F7VC 3CRMA 5LOVB 1Y76A 2Q1KA 1R6KA 3GB7C 1Q81W 1PM9A 5HFMA 2NN4A 1G1IA 5KA6A 4O4JB 1HJBA 2GV9A 1QGKB 3CCSV 4B3RO 2JEXA 1KILC 2HFEC 3U10A 5H5NA 5JVDA 3AE1C 3M06A 1PZQA 1CSBA 1XHZA 4U3FD 1ENVA 2B9ZA 4KXRA 4CS4A 5GTIZ 2WZ7A 3IAOA 3PJSK 3VOPA 3WB0A 1PPJE 2XUMA 2QA4V 1Y6XA 1XMOO 2ZE6A 4Y28J 3ICXA 3CMAV 1A02J 3ETQA 5KHJA 5B5EH 5B1AB 5KAFH 3OR6C 2C2AA 4RUEA 1XBLA 1V9PA 2IJHA 2QM4A 3SPGA 1E79G 3H1LG 1NYHA 5LMUO 2QWQB 3VMYA 3NTNA 4IFDK 4QPJA 3DC5A 2KSJA 4UB6Z 4JI1O 1AR5A 2K9JA 3HUSA 3RVYA 1NTKE 1Y76B 1OWAA 1FJKA 2BSKA 5AVVB 2XAHA 5B1AC 1M1KQ 4J80A 4JI5O 3K08A 1N4CA 3S1KA 2CUGA 5CA0A 5B1BB 3JCUH 3DXRA 2W6IG 3HKEA 5APYA 2KP8A 1SQXD 3GG2A 1PPJH 5EYPA 4H13D 4FFKA 4U3JB 2H43A 1XL4A 3HKDA 1MZ9A 5CCGA 3ZX6A 5LGNA 1AB3A 3CC2P 2OIGA 2ATKC 1R73A 1E1QG 4FLYA 2I8DA 4NXMB 1NU1E 2K37A 4X62B 1NS1A 1VQOV 3CCUP 1N8RW 3K3WA 4RUFA 4YIPA 5B1BC 1IBMO 4KT0J 2Q67A 4BRYB 2IJKA 2P7TC 2R3SA 4N23A 3L75G 4GCZA 5APTA 1DLBA 1QL2A 2M6YA 3ASNB 1IC2A 4FFBA 1XEQA 4DUZB 4IL6E 1EDIA 1SQBJ 2K9JB 3HUSB 1Z2GA 4CS3A 1P7BA 4MVQA 5E79Z 2YO3A 4RO0A 4CH4A 1ZWIC 3TYYA 4B3TO 3CL3D 1H89A 4X1KA 2DQ3A 2IFMA 4J11A 3DXRB 5KLIC 3L72E 3GMAA 3GWKC 3ASNC 5IYDO 1OFCX 3L70E 5EYPB 2XV5A 1VQ7P 1B06A 1JA8A 5DJTB 3HUSC 3M0AA 2JEEA 1RH5B 3P8CE 3MDSA 4TOIA 2ZXWB 2HJDA 2P5OA 1LTGC 1ZLZA 2JP3A 3C9IA 3F5TA 2BCCH 3SDLA 3Q1MA 1KP2A 4J7JA 4B3SB 1FE6A 2YO2A 3BCCG 5AW9B 2YMYA 1GRJA 4W4LA 1GK6A 5CCGC 4N3YB 3QH9A 5K5GB 4EB6A 1N32O 5J9PC 1NR7A 4FFBB 5AVWB 2E3CA 4G27B 4CZZA 3H1LJ 1NJIQ 5DN6G 2IH3C 1KYOF 1N7SA 1X8YA 4KL1A 1EZVI 4AILC 2R9IA 1ZX3A 4PD4H 1WA8A 3CD6V 1FU1A 2IBZE 4RESB 1ZSPA 4DV0O 4H0LD 2FFDA 1IZ3A 2HG5D 4DOJA 1AJNA 1AILA 1SQPH 3AK2A 3ZHTA 1JJ2U 1FJGO 5EIBD 1RHZB 1AV1A 4QPKA 4JYYA 4MTOA 1IURA 4PELA 2FTKA 1OIPA 3FD9A 1URQD 3F5HA 1LUWA 4IIJA 2XAQA 2P4VA 3ZIAG 1LUVA 1S77D 1UFIA 2AW9A 4K0KO 2Z0AA 2UXBB 3TK1A 1LWUA 2IW5A 4WY4A 1W2BO 2M5AA 3H1LD 4X65B 4EB6B 2IZ0A 3L37A 1HJ0A 1BZKA 5H2FH 1PP9H 3H9VA 1BCCH 2OWOA 1DF4A 1LT9A 1M90W 2JJ1G 4QGPA 1S5JA 2QDOA 1SS3A 3WUVA 4ZI7A 3HR0A 4GKKB 2PAJA 1ZR4A 1DTOA 1N7SB 4BAYA 1TUBA 1A02F 4UCVA 2GSMB 3SPHA 4WF9V 4JI7B 1WA8B 1HH0A 3QO5A 4MTFA 3RYIA 3T1CA 2FFDB 2B9BA 3FYIB 1FAVA 3AG2C 1SQXK 4LF5B 3G3ZA 4HAMA 2YXQB 2ZT9B 1CXZB 5FL7G 4G2KA 4FLZA 1G1JA 1JVMA 4JPZB 1T3JA 1N7SC 3SPCA 4CC5A 4MVSA 2QTOA 3D8CA 1VQ8V 1J2JB 4IIJB 3L71E 2E5TA 1SLQA 1XTCC 2FFDC 1L0NE 1PPJG 2WA4A 3JCUZ 3M9QA 1F51A 2M5AB 2WPSA 2PUSA 3ABLB 2QJYB 3SFEC 3BCCJ 4H37A 2FL4A 1LT9B 2Y69C 4YHHO 3A0BE 4J10A 4CS2A 1EQ7A 4M3LA 4ZI7B 4JYAO 2XT9A 1LWUC 4WY4C 2DQ0A 4I1LA 1TUBB 1NTKG 3EFFK 4AQRD 1H2MA 1TUEB 3RYIB 3ZRWA 3ABLC 4B3MO 2QJYC 3U1AA 3L71H 3SWYA 4EIJA 4F6EA 3G4SP 3H1KH 3CX5H 5KX5A 4DR5B 2OYHB 1F7YA 2PI5A 2QJ1A 2E75B 1BGYJ 1Y66A 1OXZA 5CHXA 2LGQA 1NU1G 2H8PD 2K9YA 1AQ5A 5CB4A 3CMEV 2Y0IA 4B3MB 2WSFH 1T5EA 1FXVA 3QWOC 2K3RA 2WLIA 3NFQA 3K5BA 2KXPB 1T2KD 1K4CC 2WSSH 1DX7A 2E75C 3JC22 3CPWO 1YZBA 2PI4A 4Q20A 4HNAA 1HW7A 1D2DA 1N73A 1MMMA 2ZYDA 5GTHE 3U1CA 3KZIE 4EKWA 2HKOA 1MOFA 1K8AW 3V6IA 1KC8Q 1NTZH 3E8HA 2Q7GA 4IL6Z 3ZRWB 1IO4A 1AFOA 3D3IA 4OWFA 1F4MA 3CCVP 4JF7A 1K05A 2XAGA 3TETA 4ZIBA 2IU3A 1SQQE 3L72G 1EZVD 1BGYD 1DIPA 2XTAA 2IDBA 3U59A 3HD7D 5KX5B 4PDVA 2RDCA 1CI6A 5APUA 3R65A 3G6EV 4EFBA 3RYHA 4CH5A 3FB8C 3T2MA 3PHLA 3MZWB 1SQPG 2RCVA 4DR1B 3W7UA 1KILD 1RQVA 5APSA 2WLIB 2BTOA 2O01J 2QWNB 1JR9A 5APQA 5BU5A 3JD1A 1OJHA 2OTLP 2DWEC 3J80N 4GYCB 3RK3B 1TA8A 3ABUA 4FJCC 3SYCA 2HPCB 4FLWA 1HNXO 3ABMB 1N73B 4GDOA 1N36B 2FYUE 5J2UA 5AVTB 4HB1A 3NR7A 1L8DA 1K73W 1G1XB 1JY3N 1NTME 2XDJA 2FKWB 3OMIB 1FS0E 1BCCG 4MVUA 2AXTE 2IBZG 5FPRA 1VQKV 1N34O 2ITAA 3RK3C 4EDFA 1NTKJ 1SA0A 3MIWA 4DW1A 3ABMC 1R1BA 2LQTA 4R8CA 1SP4A 5KLVK 1KZUB 1VEWA 3K06A 2AHZA 1NQTA 3T97B 4FLUA 4H13B 1MSDA 3RYHB 4WB4A 3T1YB 5AVXB 2YIDA 2ZR3A 1VQ6P 3BVOA 4WFFA 2AXCA 2P2UA 5B1NA 3CXHE 2MJZA 4KHXA 3G71V 2WLJA 2ZYAA 2KI7B 2NLJC 2SPZA 3KQGA 2AHYA 4JTAB 1NU1J 2PRRA 3CCLP 3PH0A 4NB5A 1W0KG 4IYHA 3SYQA 2XNDH 2Y0DA 1JPXA 4DR2O 4B08A 1RP3B 1HTLC 3CS5A 4C7NA 4DJGA 1KFNA 4DV1O 3P3NA 4LWSA 5L3CA 4JI3O 4F6RA 4IFFA 2R9AA 4E2LA 4FK5C 5J2UB 4DR4B 2N9YB 4LFCO 2OIEA 4H33A 2YXLA 2HEPA 3CCMP 2H3OA 4FMTA 4O4IA 4JYBA 4UCUA 4JI6O 1BQZA 3QTCA 2PZSA 1SA0B 1XMQB 5DM6V 3CCUV 1YHQV 4ZOLB 1YJWV 1I94B 3WU2E 1RM1B 3IFMA 1XI1A 3L72J 4X66O 3L70J 4AHCA 1WPBA 1NU1D 1RSOA 3L71G 3OGCC 4UB8E 3P30A 1L0NG 3A2FA 2GUZA 1JCDA 4LF7O 1LTSC 3L74E 1URQA 3W7WA 2P67A 4JYCA 1RM1C 3SSUA 4GX1A 3AE6C 1HR0B 3E1RA 1Y4MA 4LWSB 4LF4B 4F6RB 1MZEA 3CP1A 5IWAB 4JI2B 1LTJA 3G67A 3SJAC 3AE5C 3M0DA 2QKAA 3A0BZ 4O4IB 5IT9N 1FZBA 4X20B 3TCUA 1EDKA 5TISE 5GTIE 1ZUQA 5B3SB 3L72D 3CI9A 2QR4A 1JJOA 3GW6A 3L70D 1FZGA 5C39A 1TU3F 3OGIB 2P6JA 3A0HH 3FFQA 2JVDA 2EZOA 1NTZG 4H0LB 1F4NA 2GTAA 1VF7A 4DZOA 2F23A 1RSOB 1WB8A 5CA3A 5IYZA 2UU9B 1VPCA 1QCEA 1XILA 2Y4UA 2GUZB 1OVVA 1PNMA 2VS0A 3RT3C 1KORA 1URQB 3I5CA 1AJQA 1AROP 3RW0A 4XDLA 2KNCA 1JCCA 4H0LC 1GAXA 2UWJE 1PKXA 2HG5C 1G4YB 2QVAA 1NBMG 3ML0A 1WRGA 1MFZA 1BS3A 4TLFA 4RKUJ 4LF9O 3S4RA 1LTJB 4K8XA 3ETGA 1F23A 4AQYO 4I9QA 1U7JA 4W7ZA 3CJHA 1URQC 5EBLC 1VDFA 1EFRG 1YJNV 1GM7A 1H2GA 5GTHZ 1KYOI 1YITV 3KZIZ 3APOA 3JAWA 1HNZB 1ZRTE 1XNRB 3A8TA 1P84D 1SQQG 1WP7A 2KG7A 5EK0A 2ZIMA 1KMIZ 4X64B 4WWIA 2IFNA 1FOSF 4KHPB 1LTJC 1JQ0A 2GTSA 4X88A 2KB1A 3AECC 1VQPP 3CCJP 3ZMVA 2AZ0A 5CCHD 3RN4A 4AQYB 2G8YA 5IYZB 3LIDA 1R3JC 4LFBB 4JZGA 3CCQV 1IX9A 3L75E 2WSEH 3JARA 3FX7A 5CBOA 2VQEB 2KNCB 1IZNB 3L71J 3GF7A 1GTWA 3FGAD 2MW2B 2ZXXA 3OUSA 1L0NJ 2ZFCA 5E79E 1YVWA 1HF9A 3ZHRA 4BXLA 3HTKA 4L73A 2BOBC 2HVKC 2QSAA 1YTFB 3B4SA 2HHHO 2Q7CA 3P32A 2W27A 1Q6HA 2FYUG 3JASA 4YPCA 3BA8A 2ZNJA 3CJHB 4B7KA 1W2BU 4GOEA 3M7MX 3ZDMA 2XNDG 5AW3B 4MVRA 3T4DA 5KKZB 3WB1A 3JAWB 1FS0G 2GA1A 3T4ZA 2KG7B 3Q4HA 3STZC 2Q3EA 1H2KA 1K92A 4EEQA 2J5UA 1OCRB 2AXTZ 5F2VO 4WY4D 5AW5B 2WT7A 4MVOA 3O8ZA 3CXHI 3H1IE 5C8YA 1HVVA 1DGSA 3OMAB 5FPOA 2YNYA 3HD7A 1L0ND 1NTZJ 4HYTB 5KLVH 3LW5J 1WAZA 1DD3A 2EZPA 2P06A 2XAJA 5LHHA 3JARB 3RK2C 3AEGC 3K9SA 1S5LX 4NTWA 1OCRC 4PA7A 1N0JA 2WPVB 2ZINA 2X6CA 1XHXA 3K57A 1USDA 2R70A 2HJFC 1URFA 1J5EO 2QTSA 1U7MA 2IX7C 5BR8B 1OZHA 3HTKB 3V4WA 2ZXEB 5BMVA 3RYCA 2JO1A 1K9MQ 2HLOA 2HR3A 4Z1VA 4FPPA 3JASB 4RO2A 1W59A 2WLMA 2KIKA 3H1JE 1KD1Q 3W7XA 2B1IA 2W6JG 1ZAUA 4CH6A 4MSWC 1JMBA 1JOCA 2YXYA 5KJ7D 3Q4HB 2DWDC 3I56P 3RWRD 3SJQC 1BDDA 2EIJB 1PGPA 1DD4A 2OGUA 4AUWA 4R50A 3LSQA 3OW2U 4O9BA 1Q2NA 3SYAA 1T2KC 1WLEA 2WT7B 4I50A 2C9NY 2R5BA 1GW3A 5C8YB 1SQQJ 3ABKB 1UIIA 4BWAA 3CXCU 1JY3O 1QR9A 4OH8B 5AVYB 3HD7B 3WU2Z 1NAFA 4JZ2A 4JGSA 4QE9A 4DR7B 2F4VO 3F7YC 1GD2E 1BDCA 2Q5UA 2EIJC 3MD0A 1S5HC 2KUBA 3EFGA 2Z5UA 4UB8Z 3CC4V 4DR3O 2PGDA 3A3YB 5AW7B 1JTHA 1KILB 1QQCA 2ADQB 5BMVB 1VF5C 2CTPA 2E43A 3CCVV 3RYCB 3OTOO 5B5EE 2IYPA 2JDIH 4LP8A 3MHHC 5KAFE 1GL2D 1OCOB 2VWJA 3ZN0A 4TWKA 1HNWB 4Z1MH 1EXJA 2E5LB 1RE3A 4RQFA 2M7WA 2D3OW 4DR6O 2JWAA 2FYUJ 3D3QA 2D2CD 3CPWU 4R6ZA 2KSEA 4UCOA 1NTMJ 4JTCB 1KYOD 2FXOA 5TISZ 2AGAA 2YI8A 3BRTB 1OCOC 2CH7B 1FDOA 4GIFA 3CCRP 4I50B 3OAKA 1COWG 3BABA 3JCUE 4EOTA 3CE2A 4LBEC 2F1MA 5B1OA 5CBFA 2P4KA 3LUTB 4O4LB 4U7NA 3ZCCA 3RK3D 2DW4A 1FOSE 4B3RB 2NRGA 4F4LA 3ZS8C 2WPQA 2RQ6A 4P30A 5CJ4A 1JTHB 4MS2A 3RVZA 1NKNA 2M8RA 3VP8A 2QJKB 3UT5B 2YDEA 3UO2A 3CRCA 3IF4A 2ADPA 2WWWA 1SZXA 2KQXA 4MVMA 1EDLA 2FYUD 1XMOB 2R72A 1CPYA 3JD3A 1FDMA 1GN2A 2F43G 2A06H 1NTMD 1Z5WA 5JVDB 2QJKC 5LMUB 1SQVH 4P9PA 3Q3DA 5CMZA 3OR7C 3FAVA 4TQDA 4JI1B 2G38A 2CK3H 1FFTB 3VMXA 2KZIA 2ZAEB 3L9DA 5KHGA 4LLHA 1AI5A 1FD9A 1RE3C 4JAAA 3B8MA 2C0WA 2RN9A 4JI5B 2CDYA 1X22A 1X79B 1JFFA 4BIUA 3CXHD 4XE5B 2Q69A 3CWBH 4FIPC 3M99B 1M9NA 1GM8A 1QHTA 2FYZA 5KLIB 2BCCE 3RL0D 4DV2O 2DE0X 4I55A 3AG7A 3UO3A 3KCYA 3L74J 4MTXA 5LXTA 1IBMB 1Z5VA 2BSKB 2XU6A 4BIZA 3CC7P 3LDCA 1Q82W 2DJVA 3SYOA 3WG7B 5A9GA 2ILMA 1AR4A 5CA0B 3K5MA 4PA4A 2W6BA 3HKEB 1GZLA 3EWKA 2JEUA 1USEA 2BEQD 3HKDB 2WPRA 2UUBO 1RPRA 3S3XA 3EQ2A 4JAVA 3H25A 4I2LC 1NGMB 1M4UA 3FAVB 4PD4E 4WFHA 1IBLO 3OEEG 2Q68A 1SKVA 4L75A 1BMFG 1GK9A 3WG7C 4B3TB 3H1IG 4DK0A 1SQPE 4PJ0H 2ITDC 4K35A 4IOIH 1JFFB 3SWFA 3FB7C 1ZOYC 1SQBD 3L74D 5CCHA 1IFJA 1JNMA 5L8RJ 4I0XA 3P8MC 1SERA 5GW7A 1SZTA 4I55B 3AG1B 1BE3H 2JGDA 1FZAA 3A0RA 3CSXA 5LXTB 2V4DA 1KU9A 3GLMA 2YIBA 4IGGA 5H2FE 1J1EB 4YJ3A 1PP9E 3GVMA 4X1KB 4CC6A 1BCCE 3H1JG 2KZJA 1KQFB 4GT1A 3U11A 1JY2N 1AVMA 2JR8A 2KYVA 3HPLC 3THOA 1N32B 2PTMA 3AG1C 2JDIG 1L1FA 4OVNF 4JI4O 3ZHSA 3G6BA 3HE4A 1JMMA 1J1EC 4WFGA 2L91A 4I6MC 2XASA 3H1HE 2X6AA 3Q5SA 2P1JA 1Q5OA 2DW3A 2A45H 1AJYA 3WMM0 1R6NA 4DV0B 2F93B 3QF7A 1PL0A 2Q9IA 2E42A 2Q5ZA 1FJGB 4Y99B 4I0XB 1RF1C 4DRXA 3T1HO 3AG2B 2WVRA 2JGDB 2WSCJ 2PY5A 1CEZA 1X59A 3L75J 3E8GA 5L3BA 4AI8A 2N1TA 5HFLA 4J9YB 1CZQA 2A3QA 1Y67A 4UV9A 3K5LA 5CCHC 4K0KB 4C7UA 1L0LH 1NTMK 3P7KA 3BVHA 5B5EZ 4Y99C 5KAFZ 2MK3A 2V4HA 3H1HH 1VQPV 2V7QH 1ZRTD 2RNBA 4EI2A 3CCEV 4LF6O 3CXHF 1K5QA 1N86A 4XA4A 2XZRA 2M0BA 2YICA 2A06G 1Q81Q 3BRVB 3STLC 5KJ7A 1P84H 1JB0J 2Y69B 1NKZB 2GDSA 4IFMA 4UVCA 1IJDB 1EN5A 1SQVG 1NVOA 3CX5E 3OMNB 1LWUB 3H1KE 3UKMA 4YY3O 4WY4B 2ZNIA 3G9RA 2P22C 3MHSC 1M5IA 2GBOA 2LO1A 2BASA 1H8EG 4L87A 1NT2B 3QG5A 5J2TA 1YTFD 5IYBO 2UXCO 3H1IJ 4BR6A 1VQ4V 1YSCA 4DRXB 1GU4A 3HB3B 3V2RA 2YIAA 1T3UA 2H7HA 3M9BA 3R2PA 1OW8A 4PV1D 3CWBG 5LGUA 3E83A 3RK2D 3B8NA 1UJWB 1RFYA 4UCTA 5JH7A 4ICGA 1IFNA 4QE7A 4JI8O 1ORQC 2AZ2A 3L73H 1ZN5A 1NKDA 2UXCB 3JAKA 1GL2A 3VP9A 2DOSA 5IY5B 3E35A 2KB7P 3H1JJ 2UXNA 1Y74A 2N1TC 3E8BA 1NTZE 4YHHB 2OTKE 3I55V 2HLDG 4JYAB 3R4YA 4J41A 1IFDA 4N78E 3TGUH 2AEMA 3BCCD 1H8AA 1JX9A 3SPIA 2ZCEA 2UXXA 1SC5B 3M91A 5IY5C 5J2TB 1VQ9V 1SQBK 3W7TA 4DV5O 1IFIA 1VQNP 2HYNA 3KXDA 2QM7A 5AG2A 2Z3YA 4K8ZA 1K04A 2LW1A 5KJ7C 2BCCG 1YTZT 1ZL8A 4PDLA 4GODA 1AVYA 2POHA 2QJPC 2RN0A 1XL6A 1Q7YW 3HKBA 2VQFO 1IBKO 1OMIA 4PJ0Z 1WT6A 2Q7HA 4X1YA 5KUKA 2CTQA 3S3WA 5JH7B 1YI2V 4TT3H 1X0TA 5KMGA 2GUSA 3KYQA 1IXMA 2P58A 5C93A 3D6ZA 3JAKB 1BE3G 1GL2B 4PD4I 1GM9A 1P4RA 2Q7EA 1GK4A 3PP5A 4IL6X 1VF5D 1Y74B 4NYKA 1WNSA 4DUYO 4JI0O 1KB9E 3K0DA 2D2CB 2DYRC 2P7JA 2WLLA 2J59M 4BWNA 5CB4B 3KDPB 1GL2C 4DO2A 2LFRA 4YJ2A 3JD0A 5D5QA 5H6RA 4ZHQA 3TNUA 3CEIA 4XBFA 1B04A 2DMXA 3CRQA 4FLVA 2KLUA 4U3FE 1ZL8B 2D2CC 1B3QA 1GH6A 3FWLA 3W67A 2EBOA 3CCSP 4HNAB 2Q73A 4C7RA 3HKBB 3LNNA 2IBZI 4X1YB 2L35A 2HP8A 4D6TH 1NH2D 4ZMDA 3A7OA 2ZQMA 1PP9G 1ZTEA 1KB9H 3B40A 4KFMA 3CCRV 5H2FZ 2QA4P 3VMZA 2JJ2G 1GU5A 3CB2A 3CMAP 1DK1A 1CI6B 1VQ5P 1HNXB 1L0LG 1OW7A 3E89A 3S9OA 5L3DA 1ZR2A 1KKCA 3E86A 1EBOA 2BE3A 4TV8A 3E2EA 1PPJD 1YXBA 2V7QG 2WLLB 1S0VA 1IK9A 3H1HG 4U3FH 1KYOH 5CBNA 3M8AA 4YJ2B 2ZM6O 2O57A 3PTZA 1N34B 2L6LA 1AVOA 1SQXE 4WBAA 5EC1C 1FZFA 3RL0g 3D70A 2N05A 4NPEA 4J9ZB 3APQA 4IHJA 2EIMC 2HODA 2WQYC 4X89A 3V5BA 1S9KE 1MA1A 3RL0B 1NTKD 2BCCJ 3CC2V 1FJPA 4QNHB 3OJAB 1Q86W 1PD3A 2YIUB 1M90Q 4L74A 3LSSA 2QIWA 3Q5RA 2F95B 1VQOP 5CBGA 4DR2B 3SR2C 4DV1B 5KAIE 3C8VA 4JI3B 1BE3J 5AVZB 3RL0C 2CGNA 1SQXH 1XREA 3CX5I 5JQGA 1OZ0A 3L73G 4TV8B 4LFCB 1W0JG 4BIOA 1S5LH 2JK5C 4JPRA 2YIUC 1Q6UA 1BSMA 3AEEC 3A0HE 1JY2O 1FBMA 2QWPB 3H1KG 3MAQA 4D7SA 4JI6B 1M56B 1O9GA 1N2DC 2ITCC 3JSLA 2B88A 4NXNO 3EXAA 1SQPJ 5LMNO 4C7NB 2BCCD 1WP8A 3TXSA 3OD4A 2ZD9A 3P3PA 4CPGA 4X66B 4IHJB 3FB5C 2WITA 2KLVA 3KPEA 1VQ7V 1R5LA 1PL5A 3IN6A 2W0XA 3B5ND 1M56C 2YEVA 3E22A 4OPHA 5KAIH 2WSSG 3BEHA 4NKGB 4LF7B 4LH6A 1SESA 4DV7O 2I1KA 1H2NA 1BHBA 5AW2B 2HVJC 1PP9J 1BCCJ 3TF5A 3MGNA 4TT3G 5L3FA 4PD4D 3P8CD 4PA6A 3K04A 1YDXA 1XUQA 1W2EA 4TQFA 1Q3EA 3O9OA 1YQ3C 4JV5O 4PI2A 1SQPD 5IE9A 1UIXA 3QO7A 2Z5HA 3TSIA 1WPXA 3H1HJ 4ASVA 2P90A 1OV9A 3K58A 1SQFA 3AEDC 1OX3A 3NXSA 4MVZA 3CD6P 2A79B 5KHIA 2FYNB 5EFWB 1LTIC 1SQBH 2GM4A 4OGQD 1EN6A 3N7NA 3E1IA 2E76C 1GMGA 2YEVB 2WLKA 5KHKA 1T6AA 3BPZA 1HUCA 5CMUA 4JBZA 1BCCD 3GHGA 2IBZD 4LH7A 4LF8O 2RMKB 1M1KW 2EILB 1YIJP 1MG1A 1E1RG 2FYNC 3V4QA 4I5SA 2N74A 5LP6A 2PFXA 3NMDA 1KQGB 2XOKG 4D6TG 1XNQO 1K8AQ 4OX9O 1EDJA 4LF9B 2WLHA 3IAYA 2O1JA 4FZ0A 2LJ2A 2YKQA 3QO8A 2ZDIA 2J58A 3FX0A 2EILC 2QRXA 2OCCB 1Q43A 2L5GB 1OVUA 3VQVA 2JS3A 4WFAV 2YIBD 3RBZA 1YQ4C 1J1DC 3H1KJ 5KLVE 4U3FG 5CN0A 1ZV8A 4CH3A 5LHIA 3H1LH 1E79H 4UVAA 1W5CE 4GOFA 1VF6A 4UB6H 5BY1A 1FAFA 1XQ8A 5AW4B 4HYOA 2OCCC 3IJ4A 1NTKK 4C46A 1M57D 4FLXA 3FKSG 1IFMA 3GHGB 4TV9A 3VOUA 1H88A 2WSFJ 5LYJA 3HE5A 4YXWH 3BA9A 4PV1B 1LTBC 3CRAA 1VQ8P 3ZHUA 3RK2B 1Z56A 3ETEA 5LP6B 1KUQA 2YC0A 2W8ZA 2VRSA 1RY3A 1SETA 2HHHB 2UUAO 4ZKUA 3OM3B 1QL1A 1V54B 1JM0A 1NU1K 3ZN1A 3ZHQA 2Y9YA 3GHGC 3F5WC 3L71D 3KKYA 2YUAA 4PV1C 3RBXA 5APWA 3SJBC 1IK7A 3KCXA 1LP1A 3CX5D 3H1KD 3ITKA 4XFJA 1GKFA 2M3BA 5LP6C 4B7EA 2O1KA 2N1TD 1NWQA 1LR1A 2KOGA 1D5NA 1SQXG 3GF3A 4GKJO 1FZCA 2RMZA 2QEXP 1Y9BA 1V54C 4A7PA 2XAFA 2ZDIC 2PF4E 2ZVNB 1EN4A 2JKVA 2NZ2A 5DECA 3OA7A 4YXDC 1GO3F 4PD4F 1AI4A 3ZRXA 4TV9B 4D7TA 2UUCO 5EZYA 3G4SV 1HGZA 5LYJB 5A2QN 1NJIW 1HGVA 1SF9A 3SGIA 1AR1B 1U57A 3W68A 1RE4A 1L4AC 3CYOA 2QWRB 4EFEA 1VQLP 1M1JA 1J5EB 3FXEA 5BU8B 1VF6C 3CMEP 1NTZD 5IYCO 3IR9A 2EINC 3IGAC 2WAMA 2EIKC 5FLXN 1VP7A 4NR1A 4DV4O 1VF5B 4NTXA 2PYJA 2ZYGA 5KAIZ 1IDSA 1RQUA 1FPOA 1G8MA 2KK7A 3KHUA 1LP1B 1HP8A 4UXNA 2IJIA 1HWTC 3KG2A 1N33O 2FXMA 1KV4A 2ZIOA 1NO4A 2CGOA 2UXDO 1EZVE 2NPSD 1FZCB 4PDRA 3AK1A 3A0HZ 1AI6A 4P2ZA 1NZ6A 4YIOA 1BQ0A 3DTUB 1YF2A 1U96A 4DV4B 4I7ZC 2X7RB 3V2NA 1GDTA 2F4VB 5EZYB 4U3FJ 5DEDA 2JRIA 1KILE 3PRJA 3USSA 1FZCC 1QU7A 1SVFA 4J7ZA 3ZMSA 2UXDB 2Z5IA 2LFSA 4O2AA 1SQQD 3IC7A 4DR3B 2OARA 1NH2B 1M1JB 4MN4C 1PNLA 2QM8A 2Q3IA 1QR8A 3LNMB 1DF5A 3F89A 4XDJA 2A06E 3OTOB 5LBQA 3WUTA 2WPDG 2EJRA 4ZBMA 2IM9A 1QLEC 4QIWF 1EZVH 5LA6A 1BGYH 3AG3C 1SFCD 2LR2A 3VBBA 1SQVE 3AEAC 2OTLV 1RE4C 1KP3A 2EULA 4DR6B 3PLNA 1M1JC 2OTJP 2IJJA 1P49A 1JY3P 2Y9ZA 1S4XA 2FY8A 5JWPA 1BHAA 3VN0A 4R4MA 4U3JA 1QVGO 2FBWC 2GHYA 1MZFA 3OT7A 3CWBE 2YKPA 2IU0A 1VQKP 1SQXJ 2N04A 4PA9A 2B5UA 2CE4A 3U0ZA 1VL2A 4N21A 4R7CA 2QGNA 3SJCC 2QE7H 2Y0EA 1VQ5V 1VARA 1TVKA 4BRYA 4O2AB 2Y0PA 1Y47A 2WLNA 1MABG 3CX5F 1D5AA 3B5NA 3ETDA 4LFAO 5AVSB 1K5SA 1VQ6V 4JAUA 2JIZG 4H44D 3G71P 4FM0A 5LA6B 4YXWG 2R44A 4GX2A 4NXMO 5EBMC 3CCLV 4X62O 4JASA 5GONA 1L0NK 3AK3A 2F66C 1KQLA 1Y8AA 3OEHG 5IDJA 3BY6A 2O01H 4LGDE 4LFAB 1EZJA 4PJ0E 2QKCA 3AE7C 2CAZC 3K03A 2YXHA 3CCMV 1EXIA 1NVPD 5KLVG
chains in the Genus database with same CATH topology
1EXJA 2E76C 1VF5B 3GF7A 1RQUA 1ZOYC 3FGAD 2E75C 3B71A 2D2CD 5L8RJ 1OW6A 1HF9A 3RK3E 5KKZC 1FDOA 2FYNC 3D71A 2E76B 2E74C 3RL0g 3D70A 1KQGB 1PV3A 2V7QJ 3GLMA 3R4YA 2WQYC 1K05A 2FXPA 4H13D 2BEZF 1HJ0A 4I7ZC 1KQFB 1DIPA 2IDBA 3AE6C 1KILE 2J5UA 3O6QA 2QIWA 3Q5RA 3AE8C 2G3AA 4H44B 1K04A 1YQ4C 4KT0J 2ZT9C 4I7ZB 1S1CX 3C8VA 2QSIA 3AEBC 3AEFC 3Q5PA 2QJPC 3AE5C 3Q5SA 1OMIA 2MKVA 2E75D 3LW5J 1RQVA 3AE4C 3SFDC 4YTPC 1DD3A 2O01J 3AEGC 4TT3H 1Q90D 1AJYA 2YIUC 1FDIA 1S5LX 2ZT9B 1MKMA 3AEEC 3AEAC 3D6ZA 2E74D 2QJKC 2WPVB 4H44C 2WSFJ 1TU3F 4U7JA 4PV1B 3Q3DA 3Q2YA 4R4LA 4H0LB 2WSEJ 4OGQB 1VF5D 4GDOA 4IL6X 2WSCJ 2JO1A 4R4MA 1KTMA 5KLIC 2FBWC 3GMAA 2D2CB 3AE3C 1ZP0C 2E76D 4H13C 1PL5A 1KORA 3IN6A 1R8EA 1GMJA 3SFEC 4PV1C 1VL2A 4H0LC 1IK7A 4OGQC 3ABVC 4XFJA 2H88C 3T97B 1ZMEC 1DD4A 3AE2C 2JP3A 4H13B 3GF3A 5M1BA 4RKUJ 2D2CC 3Q1MA 1Y9BA 1JB0J 2QJYC 4H44D 2NZ2A 3AE1C 3AE9C 1PIXA 1YQ3C 1ZRTE 1WMKA 3G9RA 1UIXA 4YXDC 2YMKA 3EWKA 3IAOA 1KMIZ 2BEQD 1U57A 3D6YA 2OQQA 2E75B 3H25A 1NGMB 2ZT9D 3AECC 1VF5C 3AEDC 4Y28J 2K9YA 2H89C 2G8YA 1OW7A 3AE7C 4PV1D 1OW8A 2P10A 3S9OA 2E74B 4H0LD 1EXIA 4OGQD 4Z1MH 1NYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSE J;  4OGQ B;  4IL6 X;  2WSC J;  1JB0 J;  1VF5 B;  2QJY C;  2QIW A;  4H44 B;  5KLI C;  4KT0 J;  1ZRT E;  5L8R J;  4I7Z B;  2D2C B;  3C8V A;  2QSI A;  5KKZ C;  2FYN C;  2QJP C;  2E76 B;  3LW5 J;  2O01 J;  2E75 B;  1Q90 D;  4Y28 J;  2YIU C;  2K9Y A;  1S5L X;  2ZT9 B;  2QJK C;  2WPV B;  4H13 B;  2WSF J;  2E74 B;  4RKU J;  4PV1 B;  4H0L B; 
#chains in the Genus database with same CATH topology
 4DUZ O;  1SS1 A;  2ODM A;  1QLN A;  3K0G A;  3L35 A;  2B1G A;  3B09 A;  4ZNC A;  1S9K D;  1YHQ P;  3B71 A;  2QG4 A;  1YJW P;  5CBH A;  2Q9L A;  1BE3 E;  1TVK B;  4U7O A;  2Q4P A;  3D71 A;  2YI9 A;  5KA5 A;  1KC8 W;  4GX5 A;  3B2E E;  1NTK H;  3RGB A;  3B5N B;  4DV2 B;  1AP5 A;  1NTZ K;  3IC9 A;  1RF1 A;  5JJN B;  1M56 D;  4MTG A;  3BAS A;  4DV6 O;  5GON B;  3FWN A;  1BT8 A;  3RFR A;  3BAT A;  1GN4 A;  5EBW C;  1XDC A;  4JF3 A;  4B3S O;  3B5N C;  3G80 A;  1NU1 H;  4X1I A;  1QX8 A;  2Q6Q A;  2UUB B;  4O4H A;  1S2E A;  2QSI A;  5CA1 A;  3L4F A;  4ZKP A;  1IBL B;  1R3I C;  2DN9 A;  1M7L A;  4KUM A;  4DV6 B;  1AP6 A;  4A5U B;  2E74 D;  1NAY A;  3TXQ A;  1L2P A;  1PL4 A;  1KB9 F;  4J42 A;  5AW0 B;  4R4L A;  2VWK A;  4IL6 H;  5B66 E;  2WSE J;  4OGQ B;  4G28 B;  1YTZ I;  1YJ9 P;  1SQQ K;  1H8H G;  4OXS A;  3B77 A;  4UUJ C;  1KTM A;  2ZXW C;  1L0L E;  3OUF A;  4Z1M G;  2E76 D;  3L72 H;  1RF1 B;  3N4X A;  1PNK A;  3L70 H;  2GUV A;  1KQS O;  4UCS A;  1GMJ A;  1LNQ A;  1N0N A;  4OGQ C;  1GN3 A;  4LC1 A;  4LNU A;  4RWU A;  5LGT A;  1WN7 A;  2W0F C;  2UXB O;  5AVQ B;  5BXZ A;  4X1I B;  1P84 E;  5LL6 Y;  4O4H B;  4X65 O;  3ZHV A;  5CA1 B;  1EZV G;  1VIB A;  1BGY G;  3GWO A;  4JI4 B;  1JO5 A;  3CHX A;  1KEC A;  1S72 P;  2ZKO A;  5AW8 B;  2WTY A;  1YJN P;  3HRN A;  5B66 H;  3ZED A;  3AE9 C;  1CP9 A;  1YIT P;  2C9L Y;  3ASO B;  1R3L C;  4UV8 A;  1NI8 A;  1WMK A;  2FYU K;  4PHZ A;  4GKK O;  3BRC A;  2YMK A;  1YIJ V;  3ZMZ A;  4YJ3 B;  1M93 A;  4DXW A;  4P9O A;  1K3E A;  1NOH A;  5KLV J;  3ZMT A;  4JI7 O;  1QNM A;  3DSQ A;  4PA3 A;  3CCJ V;  3LSU A;  1G2C A;  1R5S A;  4LF5 O;  3T1H B;  1M57 B;  2P10 A;  3ASO C;  3CCQ P;  3ZJZ A;  3HE4 B;  4WFB V;  2IBZ H;  3L73 E;  2QE7 G;  3MUD A;  2WMM A;  3EHB B;  5IJ0 A;  3J7A U;  3O65 A;  4PDM A;  3FXD A;  4LNU B;  1OW6 A;  4DCK A;  4HZ3 A;  1NH4 A;  1QVF O;  2B87 A;  2W83 C;  1M57 C;  2ZE8 A;  3FB6 C;  3JYC A;  5H6Q A;  2CK3 G;  1H38 A;  1FXH A;  4LF6 B;  1H0T A;  3TGU E;  2W6A A;  2Q6A A;  3H01 A;  1ROP A;  5KLV D;  2OYH A;  1A32 A;  2JS5 A;  4WCE V;  2N1T B;  3VQX A;  1VQM P;  4NVP A;  2NPS A;  3LDE A;  3R66 A;  4WBN A;  3SYP A;  4YY3 B;  2CPS A;  1AJP A;  1YCI A;  5EC2 C;  2ZT9 C;  1G2C B;  2K88 A;  3AEB C;  3MTU E;  2PYL A;  2YXR B;  1KFM A;  1B6Q A;  1UPG A;  3WB2 A;  1QEX A;  2MKV A;  1E5W A;  4HH2 A;  4DR5 O;  2IH1 C;  1Q90 D;  5IJ0 B;  1MKM A;  4I4T A;  4RJT A;  4DW0 A;  3OW2 O;  3H1I D;  3K5N A;  4B86 A;  2QJP B;  4O2B A;  2YSU B;  4JI8 B;  2QEX V;  4ASU G;  1I0H A;  1L4A D;  2B87 B;  2OCH A;  1YEW A;  1I7F A;  1I5Y A;  1LT9 C;  1SFC A;  1H0T B;  1LT1 A;  2FML A;  1L0N H;  3MUD C;  1MFT A;  2H94 A;  1LTT C;  1ZP0 C;  1N8R Q;  5AW1 B;  3X2Q B;  4MT8 A;  1NR1 A;  3TDK A;  3VYI A;  3N2K A;  5APX A;  3ABT A;  4WFE A;  1XOU A;  2NPS B;  1KBH A;  4JQ0 D;  4WBN B;  4QJF B;  4RQE A;  5H9C A;  4UCR A;  3I56 V;  3V2Q A;  1VQL V;  3H1J D;  1ZME C;  2DYR B;  4OPA A;  3AE2 C;  3A0B H;  1TGO A;  1O9H A;  1T8Z A;  1MNG A;  3OFN G;  4DV5 B;  2EX3 A;  5AVU B;  3BAA A;  3X2Q C;  2OYH C;  1US6 A;  2R32 A;  4IT5 A;  4D6T E;  2NPS C;  1PIX A;  2HPC A;  1Q82 Q;  3E8F A;  4I4T B;  2VQF B;  3RYF A;  1TAE A;  1IBK B;  5APV A;  3VQY A;  1JMK C;  1YYC A;  3E7K A;  2Q0A A;  1G6U A;  3CC4 P;  4O2B B;  3H32 A;  5BVZ A;  1FKA O;  3LW5 H;  1OCC B;  4TSF G;  4DR1 O;  2A45 I;  4FVM A;  1SFC B;  1OHH G;  3CRR A;  3UCS C;  1SQV J;  2XNX A;  4PI0 A;  3L70 G;  5AW6 B;  4DUY B;  1NHL A;  4JI0 B;  1KYO E;  1QLE D;  1V55 B;  3N2K B;  2A45 G;  4BW9 A;  3PN1 A;  3T97 A;  4I9W A;  1AQT A;  3K5O A;  1N36 O;  2K1E A;  1OCC C;  4QMA A;  5KUM A;  1EC5 A;  3DGE A;  2CTR A;  5L3E A;  1SFC C;  3RK3 E;  5KMG B;  2A0L A;  3SPJ A;  2HFE D;  3CWB J;  2LW7 A;  5GTH H;  1V55 C;  3KZI H;  5K1X A;  1PV3 A;  2FXP A;  1Q6I A;  2JGU A;  5B66 Z;  2LGW A;  3WFV A;  1FC2 C;  2A06 D;  3RYF B;  2OTJ V;  1SQQ H;  3AG4 B;  4DT0 A;  2BOC C;  3K59 A;  2R5D A;  3H32 B;  4X9Q A;  1SQV D;  1XTG B;  4W7Y A;  3OAA G;  2EIM B;  1P84 I;  2XHB A;  3T1Y O;  4H44 B;  5K1P A;  4J7K A;  2ETN A;  4ZHQ B;  4FM1 A;  1P7G A;  3TNU B;  5KTB A;  3N27 A;  4LCU C;  1S5L E;  1N73 C;  3AE4 C;  3AG4 C;  5E1A C;  4ZOL A;  5FNV A;  3MP7 B;  2LP7 A;  1R6T A;  4MW8 A;  5L3G A;  5LHG A;  3CWB D;  3ZRV A;  4H44 C;  4DR4 O;  1BSH A;  1GW4 A;  4U7J A;  4FLT A;  3Q2Y A;  1FZE A;  2ZM6 B;  4XDK A;  1DH3 A;  1NVP B;  1K9M W;  1J95 A;  3TJT A;  4DK1 A;  1HDJ A;  1QVG U;  5JCO A;  2FYU H;  4X8A A;  1KD1 W;  3UQ8 A;  1XMQ O;  3M9H A;  3C3S A;  1BSN A;  2O01 N;  2IYO A;  3MHV A;  1NTM H;  3CLQ A;  4H13 C;  2CPB A;  4L76 A;  1I94 O;  2AXT H;  1K97 A;  3BHP A;  1K7D A;  1KN7 A;  2H88 C;  1U97 A;  1RF0 A;  2ZVO B;  2VRZ A;  5M1B A;  3JD2 A;  4X20 A;  1IFP A;  2BTQ A;  2LKM A;  1H2L A;  1H2S B;  5ITZ A;  3JAT A;  1JCH A;  5BZB A;  3CC7 V;  4HBN A;  5FNV B;  4ABM A;  3LIE A;  3TGU G;  3CXH H;  1HR0 O;  2PGG A;  4LF4 O;  4KJM A;  2HOD B;  3JAM N;  4HJG H;  3QVN A;  2ZJS E;  5IWA O;  4JI2 O;  1Q8I A;  1GTO A;  1K34 A;  1FFX A;  2OQQ A;  5AVR B;  4GX0 A;  2OYO A;  2Y4T A;  3C1L A;  4HKZ H;  3V2P A;  3A5T A;  5JJE B;  1BE3 D;  2H89 C;  2N9B A;  3LDD A;  1SQB E;  5D5P A;  4NXN B;  3C90 A;  2E74 B;  5LMN B;  3JD4 A;  1RPO A;  1THZ A;  2W6J H;  1OCZ B;  3RGU A;  4GLX A;  3AEI A;  4GZR B;  5JQG B;  3K79 A;  1K33 A;  1KKD A;  2Q0O C;  3C3T A;  5JCO C;  4N6J A;  2UU9 O;  2IZ1 A;  5CCG D;  1L0L J;  3JSN A;  4JTD B;  3JAL A;  2ARH A;  2E76 B;  2M3E A;  1MSW D;  2E74 C;  3WU2 H;  4DV7 B;  2BTQ B;  2V7Q J;  3K9A A;  1M8O B;  3ZMU A;  5ITZ B;  1OCZ C;  3JAT B;  1FYJ A;  1JY2 P;  4UB8 H;  2AEJ A;  3VTP C;  3D36 A;  3L74 H;  1RF0 C;  1YJ9 V;  1EM1 A;  1GN6 A;  1ZW0 A;  4JV5 B;  2A9H A;  3O6Q A;  2X0L A;  1FFX B;  3E22 B;  3AE8 C;  1FXK A;  1X9V A;  2NNU A;  5B3S C;  2FKX A;  1PP9 D;  4W4K A;  1S1C X;  3H1L E;  2Y48 A;  1OVR A;  1SQG A;  3IFX A;  1IXB A;  1HNZ O;  4UB6 E;  1KB9 I;  1XNR O;  2R3C A;  3SFD C;  2X6B A;  3SWK A;  1Q7Y Q;  4X64 O;  4Z2W A;  4KHP O;  1FDI A;  1L0L D;  2W90 A;  5TIS H;  1J1D B;  1SRY A;  5EIB C;  5GTI H;  1AI7 A;  4KP4 A;  3J81 N;  2V1D A;  1HWY A;  3ZBH A;  2YS8 A;  3H1H D;  1SQV K;  2C0X A;  3EVK A;  2ZE5 A;  3JAL B;  1S72 V;  4LFB O;  4LF8 B;  1I08 A;  3HKC A;  3L73 J;  2YKO A;  2Z4E A;  1PV0 A;  5KHH A;  2VQE O;  2Y0C A;  3QNE A;  1LJ2 A;  1XNQ B;  1L4A A;  4OX9 B;  3FYE B;  4DYL A;  1KQS U;  4ZKI A;  3WUU A;  3M0D C;  2QWO B;  3B8E B;  3O6Q B;  2ZR2 A;  1S76 D;  3TGU J;  1FXK B;  3CCE P;  2ZE7 A;  2O3J A;  2OYI A;  2K9P A;  2K1A A;  4UVB A;  4DV3 O;  3D36 C;  1PGO A;  2QKS A;  1N7S D;  2KS1 A;  2CTW A;  1CW5 A;  3DC6 A;  4RAI A;  2WA3 A;  4IYI A;  1FXK C;  1K73 Q;  3L73 D;  2B89 A;  1LTA C;  1VQ4 P;  2FB5 A;  3D6Y A;  4Q6G A;  2ZT9 D;  2RH0 A;  3HKC B;  2R9R B;  1NTM G;  1WJZ A;  4LR3 A;  4DV3 B;  3VMA A;  3A2A A;  1D7M A;  3W7S A;  1VQM V;  3L36 A;  5IJ9 A;  1PFI A;  2RJZ A;  5DJU B;  4E4E A;  3TGU D;  1I5X A;  4TUY A;  1L4A B;  3N2G A;  2UUA B;  2WSC H;  3L75 H;  2XKM A;  2DYS B;  4FM2 A;  5BR8 O;  3I5D A;  2OT5 A;  3JSV C;  1PGQ A;  1S5L Z;  2EIN B;  4GUN A;  5JJJ B;  5E79 H;  5KKZ C;  2EIK B;  4FZ1 A;  1QVF U;  3UIA A;  1JOY A;  3BCC E;  1X4T A;  2OYI B;  4EYY Q;  1ZLL A;  3HE5 B;  3I55 P;  3OE7 G;  3BFR A;  2OYQ A;  4GKJ B;  1K4D C;  2DYS C;  1BL8 A;  2KS1 B;  3OTF A;  2BEZ F;  2NR5 A;  1DEE G;  2KSD A;  1KIL A;  1VQ9 P;  5TJH A;  4MW3 A;  1WB7 A;  2OYI C;  1QBZ A;  1Q86 Q;  1VQN V;  2UUC B;  1SQP K;  2G3A A;  4N78 D;  5LOV A;  4W80 A;  4D6T J;  2RKL A;  4UFZ A;  4I7Z B;  2H8P C;  4DR7 O;  2I1J A;  4CBC A;  4O4J A;  3AEF C;  3Q5P A;  2E5Y A;  3II6 A;  3H1I H;  5IJ9 B;  1BGY E;  1HBW A;  2E75 D;  1ZXG A;  4YTP C;  5CJ0 A;  3BCC H;  1PGJ A;  1LGH B;  4TUY B;  1YBK A;  1YI2 P;  3N2G B;  1AA0 A;  2KKW A;  2LXC B;  3ZRS A;  1R3K C;  2CH7 A;  4NPD A;  1JEK A;  2JWD A;  3UM7 A;  2JJL A;  3JCZ A;  4ASW A;  2EJ7 A;  1IVS A;  1QLE B;  3AG3 B;  4O4L A;  2AEF A;  1HNW O;  1N33 B;  1DEB A;  1MV8 A;  2IPP A;  4AYC A;  3VQW A;  3G6E P;  1S3J A;  2E5L O;  4K3A A;  1SQB G;  3L74 G;  3AE3 C;  3L75 D;  4WVZ A;  1N7L A;  3H6P A;  3H1J H;  1MUU A;  2LXB A;  4NPF X;  1R8E A;  4NTY A;  4D6T D;  3ABK C;  4L8J A;  1L0L K;  1VMG A;  1JUN A;  3UT5 A;  4GKG A;  4BW5 A;  2A7W A;  1P84 F;  3ABV C;  2Q8V A;  1KB9 D;  2PP6 A;  3HD7 C;  3F7V C;  3CRM A;  5LOV B;  1Y76 A;  2Q1K A;  1R6K A;  3GB7 C;  1Q81 W;  1PM9 A;  5HFM A;  2NN4 A;  1G1I A;  5KA6 A;  4O4J B;  1HJB A;  2GV9 A;  1QGK B;  3CCS V;  4B3R O;  2JEX A;  1KIL C;  2HFE C;  3U10 A;  5H5N A;  5JVD A;  3AE1 C;  3M06 A;  1PZQ A;  1CSB A;  1XHZ A;  4U3F D;  1ENV A;  2B9Z A;  4KXR A;  4CS4 A;  5GTI Z;  2WZ7 A;  3IAO A;  3PJS K;  3VOP A;  3WB0 A;  1PPJ E;  2XUM A;  2QA4 V;  1Y6X A;  1XMO O;  2ZE6 A;  4Y28 J;  3ICX A;  3CMA V;  1A02 J;  3ETQ A;  5KHJ A;  5B5E H;  5B1A B;  5KAF H;  3OR6 C;  2C2A A;  4RUE A;  1XBL A;  1V9P A;  2IJH A;  2QM4 A;  3SPG A;  1E79 G;  3H1L G;  1NYH A;  5LMU O;  2QWQ B;  3VMY A;  3NTN A;  4IFD K;  4QPJ A;  3DC5 A;  2KSJ A;  4UB6 Z;  4JI1 O;  1AR5 A;  2K9J A;  3HUS A;  3RVY A;  1NTK E;  1Y76 B;  1OWA A;  1FJK A;  2BSK A;  5AVV B;  2XAH A;  5B1A C;  1M1K Q;  4J80 A;  4JI5 O;  3K08 A;  1N4C A;  3S1K A;  2CUG A;  5CA0 A;  5B1B B;  3JCU H;  3DXR A;  2W6I G;  3HKE A;  5APY A;  2KP8 A;  1SQX D;  3GG2 A;  1PPJ H;  5EYP A;  4H13 D;  4FFK A;  4U3J B;  2H43 A;  1XL4 A;  3HKD A;  1MZ9 A;  5CCG A;  3ZX6 A;  5LGN A;  1AB3 A;  3CC2 P;  2OIG A;  2ATK C;  1R73 A;  1E1Q G;  4FLY A;  2I8D A;  4NXM B;  1NU1 E;  2K37 A;  4X62 B;  1NS1 A;  1VQO V;  3CCU P;  1N8R W;  3K3W A;  4RUF A;  4YIP A;  5B1B C;  1IBM O;  4KT0 J;  2Q67 A;  4BRY B;  2IJK A;  2P7T C;  2R3S A;  4N23 A;  3L75 G;  4GCZ A;  5APT A;  1DLB A;  1QL2 A;  2M6Y A;  3ASN B;  1IC2 A;  4FFB A;  1XEQ A;  4DUZ B;  4IL6 E;  1EDI A;  1SQB J;  2K9J B;  3HUS B;  1Z2G A;  4CS3 A;  1P7B A;  4MVQ A;  5E79 Z;  2YO3 A;  4RO0 A;  4CH4 A;  1ZWI C;  3TYY A;  4B3T O;  3CL3 D;  1H89 A;  4X1K A;  2DQ3 A;  2IFM A;  4J11 A;  3DXR B;  5KLI C;  3L72 E;  3GMA A;  3GWK C;  3ASN C;  5IYD O;  1OFC X;  3L70 E;  5EYP B;  2XV5 A;  1VQ7 P;  1B06 A;  1JA8 A;  5DJT B;  3HUS C;  3M0A A;  2JEE A;  1RH5 B;  3P8C E;  3MDS A;  4TOI A;  2ZXW B;  2HJD A;  2P5O A;  1LTG C;  1ZLZ A;  2JP3 A;  3C9I A;  3F5T A;  2BCC H;  3SDL A;  3Q1M A;  1KP2 A;  4J7J A;  4B3S B;  1FE6 A;  2YO2 A;  3BCC G;  5AW9 B;  2YMY A;  1GRJ A;  4W4L A;  1GK6 A;  5CCG C;  4N3Y B;  3QH9 A;  5K5G B;  4EB6 A;  1N32 O;  5J9P C;  1NR7 A;  4FFB B;  5AVW B;  2E3C A;  4G27 B;  4CZZ A;  3H1L J;  1NJI Q;  5DN6 G;  2IH3 C;  1KYO F;  1N7S A;  1X8Y A;  4KL1 A;  1EZV I;  4AIL C;  2R9I A;  1ZX3 A;  4PD4 H;  1WA8 A;  3CD6 V;  1FU1 A;  2IBZ E;  4RES B;  1ZSP A;  4DV0 O;  4H0L D;  2FFD A;  1IZ3 A;  2HG5 D;  4DOJ A;  1AJN A;  1AIL A;  1SQP H;  3AK2 A;  3ZHT A;  1JJ2 U;  1FJG O;  5EIB D;  1RHZ B;  1AV1 A;  4QPK A;  4JYY A;  4MTO A;  1IUR A;  4PEL A;  2FTK A;  1OIP A;  3FD9 A;  1URQ D;  3F5H A;  1LUW A;  4IIJ A;  2XAQ A;  2P4V A;  3ZIA G;  1LUV A;  1S77 D;  1UFI A;  2AW9 A;  4K0K O;  2Z0A A;  2UXB B;  3TK1 A;  1LWU A;  2IW5 A;  4WY4 A;  1W2B O;  2M5A A;  3H1L D;  4X65 B;  4EB6 B;  2IZ0 A;  3L37 A;  1HJ0 A;  1BZK A;  5H2F H;  1PP9 H;  3H9V A;  1BCC H;  2OWO A;  1DF4 A;  1LT9 A;  1M90 W;  2JJ1 G;  4QGP A;  1S5J A;  2QDO A;  1SS3 A;  3WUV A;  4ZI7 A;  3HR0 A;  4GKK B;  2PAJ A;  1ZR4 A;  1DTO A;  1N7S B;  4BAY A;  1TUB A;  1A02 F;  4UCV A;  2GSM B;  3SPH A;  4WF9 V;  4JI7 B;  1WA8 B;  1HH0 A;  3QO5 A;  4MTF A;  3RYI A;  3T1C A;  2FFD B;  2B9B A;  3FYI B;  1FAV A;  3AG2 C;  1SQX K;  4LF5 B;  3G3Z A;  4HAM A;  2YXQ B;  2ZT9 B;  1CXZ B;  5FL7 G;  4G2K A;  4FLZ A;  1G1J A;  1JVM A;  4JPZ B;  1T3J A;  1N7S C;  3SPC A;  4CC5 A;  4MVS A;  2QTO A;  3D8C A;  1VQ8 V;  1J2J B;  4IIJ B;  3L71 E;  2E5T A;  1SLQ A;  1XTC C;  2FFD C;  1L0N E;  1PPJ G;  2WA4 A;  3JCU Z;  3M9Q A;  1F51 A;  2M5A B;  2WPS A;  2PUS A;  3ABL B;  2QJY B;  3SFE C;  3BCC J;  4H37 A;  2FL4 A;  1LT9 B;  2Y69 C;  4YHH O;  3A0B E;  4J10 A;  4CS2 A;  1EQ7 A;  4M3L A;  4ZI7 B;  4JYA O;  2XT9 A;  1LWU C;  4WY4 C;  2DQ0 A;  4I1L A;  1TUB B;  1NTK G;  3EFF K;  4AQR D;  1H2M A;  1TUE B;  3RYI B;  3ZRW A;  3ABL C;  4B3M O;  2QJY C;  3U1A A;  3L71 H;  3SWY A;  4EIJ A;  4F6E A;  3G4S P;  3H1K H;  3CX5 H;  5KX5 A;  4DR5 B;  2OYH B;  1F7Y A;  2PI5 A;  2QJ1 A;  2E75 B;  1BGY J;  1Y66 A;  1OXZ A;  5CHX A;  2LGQ A;  1NU1 G;  2H8P D;  2K9Y A;  1AQ5 A;  5CB4 A;  3CME V;  2Y0I A;  4B3M B;  2WSF H;  1T5E A;  1FXV A;  3QWO C;  2K3R A;  2WLI A;  3NFQ A;  3K5B A;  2KXP B;  1T2K D;  1K4C C;  2WSS H;  1DX7 A;  2E75 C;  3JC2 2;  3CPW O;  1YZB A;  2PI4 A;  4Q20 A;  4HNA A;  1HW7 A;  1D2D A;  1N73 A;  1MMM A;  2ZYD A;  5GTH E;  3U1C A;  3KZI E;  4EKW A;  2HKO A;  1MOF A;  1K8A W;  3V6I A;  1KC8 Q;  1NTZ H;  3E8H A;  2Q7G A;  4IL6 Z;  3ZRW B;  1IO4 A;  1AFO A;  3D3I A;  4OWF A;  1F4M A;  3CCV P;  4JF7 A;  1K05 A;  2XAG A;  3TET A;  4ZIB A;  2IU3 A;  1SQQ E;  3L72 G;  1EZV D;  1BGY D;  1DIP A;  2XTA A;  2IDB A;  3U59 A;  3HD7 D;  5KX5 B;  4PDV A;  2RDC A;  1CI6 A;  5APU A;  3R65 A;  3G6E V;  4EFB A;  3RYH A;  4CH5 A;  3FB8 C;  3T2M A;  3PHL A;  3MZW B;  1SQP G;  2RCV A;  4DR1 B;  3W7U A;  1KIL D;  1RQV A;  5APS A;  2WLI B;  2BTO A;  2O01 J;  2QWN B;  1JR9 A;  5APQ A;  5BU5 A;  3JD1 A;  1OJH A;  2OTL P;  2DWE C;  3J80 N;  4GYC B;  3RK3 B;  1TA8 A;  3ABU A;  4FJC C;  3SYC A;  2HPC B;  4FLW A;  1HNX O;  3ABM B;  1N73 B;  4GDO A;  1N36 B;  2FYU E;  5J2U A;  5AVT B;  4HB1 A;  3NR7 A;  1L8D A;  1K73 W;  1G1X B;  1JY3 N;  1NTM E;  2XDJ A;  2FKW B;  3OMI B;  1FS0 E;  1BCC G;  4MVU A;  2AXT E;  2IBZ G;  5FPR A;  1VQK V;  1N34 O;  2ITA A;  3RK3 C;  4EDF A;  1NTK J;  1SA0 A;  3MIW A;  4DW1 A;  3ABM C;  1R1B A;  2LQT A;  4R8C A;  1SP4 A;  5KLV K;  1KZU B;  1VEW A;  3K06 A;  2AHZ A;  1NQT A;  3T97 B;  4FLU A;  4H13 B;  1MSD A;  3RYH B;  4WB4 A;  3T1Y B;  5AVX B;  2YID A;  2ZR3 A;  1VQ6 P;  3BVO A;  4WFF A;  2AXC A;  2P2U A;  5B1N A;  3CXH E;  2MJZ A;  4KHX A;  3G71 V;  2WLJ A;  2ZYA A;  2KI7 B;  2NLJ C;  2SPZ A;  3KQG A;  2AHY A;  4JTA B;  1NU1 J;  2PRR A;  3CCL P;  3PH0 A;  4NB5 A;  1W0K G;  4IYH A;  3SYQ A;  2XND H;  2Y0D A;  1JPX A;  4DR2 O;  4B08 A;  1RP3 B;  1HTL C;  3CS5 A;  4C7N A;  4DJG A;  1KFN A;  4DV1 O;  3P3N A;  4LWS A;  5L3C A;  4JI3 O;  4F6R A;  4IFF A;  2R9A A;  4E2L A;  4FK5 C;  5J2U B;  4DR4 B;  2N9Y B;  4LFC O;  2OIE A;  4H33 A;  2YXL A;  2HEP A;  3CCM P;  2H3O A;  4FMT A;  4O4I A;  4JYB A;  4UCU A;  4JI6 O;  1BQZ A;  3QTC A;  2PZS A;  1SA0 B;  1XMQ B;  5DM6 V;  3CCU V;  1YHQ V;  4ZOL B;  1YJW V;  1I94 B;  3WU2 E;  1RM1 B;  3IFM A;  1XI1 A;  3L72 J;  4X66 O;  3L70 J;  4AHC A;  1WPB A;  1NU1 D;  1RSO A;  3L71 G;  3OGC C;  4UB8 E;  3P30 A;  1L0N G;  3A2F A;  2GUZ A;  1JCD A;  4LF7 O;  1LTS C;  3L74 E;  1URQ A;  3W7W A;  2P67 A;  4JYC A;  1RM1 C;  3SSU A;  4GX1 A;  3AE6 C;  1HR0 B;  3E1R A;  1Y4M A;  4LWS B;  4LF4 B;  4F6R B;  1MZE A;  3CP1 A;  5IWA B;  4JI2 B;  1LTJ A;  3G67 A;  3SJA C;  3AE5 C;  3M0D A;  2QKA A;  3A0B Z;  4O4I B;  5IT9 N;  1FZB A;  4X20 B;  3TCU A;  1EDK A;  5TIS E;  5GTI E;  1ZUQ A;  5B3S B;  3L72 D;  3CI9 A;  2QR4 A;  1JJO A;  3GW6 A;  3L70 D;  1FZG A;  5C39 A;  1TU3 F;  3OGI B;  2P6J A;  3A0H H;  3FFQ A;  2JVD A;  2EZO A;  1NTZ G;  4H0L B;  1F4N A;  2GTA A;  1VF7 A;  4DZO A;  2F23 A;  1RSO B;  1WB8 A;  5CA3 A;  5IYZ A;  2UU9 B;  1VPC A;  1QCE A;  1XIL A;  2Y4U A;  2GUZ B;  1OVV A;  1PNM A;  2VS0 A;  3RT3 C;  1KOR A;  1URQ B;  3I5C A;  1AJQ A;  1ARO P;  3RW0 A;  4XDL A;  2KNC A;  1JCC A;  4H0L C;  1GAX A;  2UWJ E;  1PKX A;  2HG5 C;  1G4Y B;  2QVA A;  1NBM G;  3ML0 A;  1WRG A;  1MFZ A;  1BS3 A;  4TLF A;  4RKU J;  4LF9 O;  3S4R A;  1LTJ B;  4K8X A;  3ETG A;  1F23 A;  4AQY O;  4I9Q A;  1U7J A;  4W7Z A;  3CJH A;  1URQ C;  5EBL C;  1VDF A;  1EFR G;  1YJN V;  1GM7 A;  1H2G A;  5GTH Z;  1KYO I;  1YIT V;  3KZI Z;  3APO A;  3JAW A;  1HNZ B;  1ZRT E;  1XNR B;  3A8T A;  1P84 D;  1SQQ G;  1WP7 A;  2KG7 A;  5EK0 A;  2ZIM A;  1KMI Z;  4X64 B;  4WWI A;  2IFN A;  1FOS F;  4KHP B;  1LTJ C;  1JQ0 A;  2GTS A;  4X88 A;  2KB1 A;  3AEC C;  1VQP P;  3CCJ P;  3ZMV A;  2AZ0 A;  5CCH D;  3RN4 A;  4AQY B;  2G8Y A;  5IYZ B;  3LID A;  1R3J C;  4LFB B;  4JZG A;  3CCQ V;  1IX9 A;  3L75 E;  2WSE H;  3JAR A;  3FX7 A;  5CBO A;  2VQE B;  2KNC B;  1IZN B;  3L71 J;  3GF7 A;  1GTW A;  3FGA D;  2MW2 B;  2ZXX A;  3OUS A;  1L0N J;  2ZFC A;  5E79 E;  1YVW A;  1HF9 A;  3ZHR A;  4BXL A;  3HTK A;  4L73 A;  2BOB C;  2HVK C;  2QSA A;  1YTF B;  3B4S A;  2HHH O;  2Q7C A;  3P32 A;  2W27 A;  1Q6H A;  2FYU G;  3JAS A;  4YPC A;  3BA8 A;  2ZNJ A;  3CJH B;  4B7K A;  1W2B U;  4GOE A;  3M7M X;  3ZDM A;  2XND G;  5AW3 B;  4MVR A;  3T4D A;  5KKZ B;  3WB1 A;  3JAW B;  1FS0 G;  2GA1 A;  3T4Z A;  2KG7 B;  3Q4H A;  3STZ C;  2Q3E A;  1H2K A;  1K92 A;  4EEQ A;  2J5U A;  1OCR B;  2AXT Z;  5F2V O;  4WY4 D;  5AW5 B;  2WT7 A;  4MVO A;  3O8Z A;  3CXH I;  3H1I E;  5C8Y A;  1HVV A;  1DGS A;  3OMA B;  5FPO A;  2YNY A;  3HD7 A;  1L0N D;  1NTZ J;  4HYT B;  5KLV H;  3LW5 J;  1WAZ A;  1DD3 A;  2EZP A;  2P06 A;  2XAJ A;  5LHH A;  3JAR B;  3RK2 C;  3AEG C;  3K9S A;  1S5L X;  4NTW A;  1OCR C;  4PA7 A;  1N0J A;  2WPV B;  2ZIN A;  2X6C A;  1XHX A;  3K57 A;  1USD A;  2R70 A;  2HJF C;  1URF A;  1J5E O;  2QTS A;  1U7M A;  2IX7 C;  5BR8 B;  1OZH A;  3HTK B;  3V4W A;  2ZXE B;  5BMV A;  3RYC A;  2JO1 A;  1K9M Q;  2HLO A;  2HR3 A;  4Z1V A;  4FPP A;  3JAS B;  4RO2 A;  1W59 A;  2WLM A;  2KIK A;  3H1J E;  1KD1 Q;  3W7X A;  2B1I A;  2W6J G;  1ZAU A;  4CH6 A;  4MSW C;  1JMB A;  1JOC A;  2YXY A;  5KJ7 D;  3Q4H B;  2DWD C;  3I56 P;  3RWR D;  3SJQ C;  1BDD A;  2EIJ B;  1PGP A;  1DD4 A;  2OGU A;  4AUW A;  4R50 A;  3LSQ A;  3OW2 U;  4O9B A;  1Q2N A;  3SYA A;  1T2K C;  1WLE A;  2WT7 B;  4I50 A;  2C9N Y;  2R5B A;  1GW3 A;  5C8Y B;  1SQQ J;  3ABK B;  1UII A;  4BWA A;  3CXC U;  1JY3 O;  1QR9 A;  4OH8 B;  5AVY B;  3HD7 B;  3WU2 Z;  1NAF A;  4JZ2 A;  4JGS A;  4QE9 A;  4DR7 B;  2F4V O;  3F7Y C;  1GD2 E;  1BDC A;  2Q5U A;  2EIJ C;  3MD0 A;  1S5H C;  2KUB A;  3EFG A;  2Z5U A;  4UB8 Z;  3CC4 V;  4DR3 O;  2PGD A;  3A3Y B;  5AW7 B;  1JTH A;  1KIL B;  1QQC A;  2ADQ B;  5BMV B;  1VF5 C;  2CTP A;  2E43 A;  3CCV V;  3RYC B;  3OTO O;  5B5E E;  2IYP A;  2JDI H;  4LP8 A;  3MHH C;  5KAF E;  1GL2 D;  1OCO B;  2VWJ A;  3ZN0 A;  4TWK A;  1HNW B;  4Z1M H;  1EXJ A;  2E5L B;  1RE3 A;  4RQF A;  2M7W A;  2D3O W;  4DR6 O;  2JWA A;  2FYU J;  3D3Q A;  2D2C D;  3CPW U;  4R6Z A;  2KSE A;  4UCO A;  1NTM J;  4JTC B;  1KYO D;  2FXO A;  5TIS Z;  2AGA A;  2YI8 A;  3BRT B;  1OCO C;  2CH7 B;  1FDO A;  4GIF A;  3CCR P;  4I50 B;  3OAK A;  1COW G;  3BAB A;  3JCU E;  4EOT A;  3CE2 A;  4LBE C;  2F1M A;  5B1O A;  5CBF A;  2P4K A;  3LUT B;  4O4L B;  4U7N A;  3ZCC A;  3RK3 D;  2DW4 A;  1FOS E;  4B3R B;  2NRG A;  4F4L A;  3ZS8 C;  2WPQ A;  2RQ6 A;  4P30 A;  5CJ4 A;  1JTH B;  4MS2 A;  3RVZ A;  1NKN A;  2M8R A;  3VP8 A;  2QJK B;  3UT5 B;  2YDE A;  3UO2 A;  3CRC A;  3IF4 A;  2ADP A;  2WWW A;  1SZX A;  2KQX A;  4MVM A;  1EDL A;  2FYU D;  1XMO B;  2R72 A;  1CPY A;  3JD3 A;  1FDM A;  1GN2 A;  2F43 G;  2A06 H;  1NTM D;  1Z5W A;  5JVD B;  2QJK C;  5LMU B;  1SQV H;  4P9P A;  3Q3D A;  5CMZ A;  3OR7 C;  3FAV A;  4TQD A;  4JI1 B;  2G38 A;  2CK3 H;  1FFT B;  3VMX A;  2KZI A;  2ZAE B;  3L9D A;  5KHG A;  4LLH A;  1AI5 A;  1FD9 A;  1RE3 C;  4JAA A;  3B8M A;  2C0W A;  2RN9 A;  4JI5 B;  2CDY A;  1X22 A;  1X79 B;  1JFF A;  4BIU A;  3CXH D;  4XE5 B;  2Q69 A;  3CWB H;  4FIP C;  3M99 B;  1M9N A;  1GM8 A;  1QHT A;  2FYZ A;  5KLI B;  2BCC E;  3RL0 D;  4DV2 O;  2DE0 X;  4I55 A;  3AG7 A;  3UO3 A;  3KCY A;  3L74 J;  4MTX A;  5LXT A;  1IBM B;  1Z5V A;  2BSK B;  2XU6 A;  4BIZ A;  3CC7 P;  3LDC A;  1Q82 W;  2DJV A;  3SYO A;  3WG7 B;  5A9G A;  2ILM A;  1AR4 A;  5CA0 B;  3K5M A;  4PA4 A;  2W6B A;  3HKE B;  1GZL A;  3EWK A;  2JEU A;  1USE A;  2BEQ D;  3HKD B;  2WPR A;  2UUB O;  1RPR A;  3S3X A;  3EQ2 A;  4JAV A;  3H25 A;  4I2L C;  1NGM B;  1M4U A;  3FAV B;  4PD4 E;  4WFH A;  1IBL O;  3OEE G;  2Q68 A;  1SKV A;  4L75 A;  1BMF G;  1GK9 A;  3WG7 C;  4B3T B;  3H1I G;  4DK0 A;  1SQP E;  4PJ0 H;  2ITD C;  4K35 A;  4IOI H;  1JFF B;  3SWF A;  3FB7 C;  1ZOY C;  1SQB D;  3L74 D;  5CCH A;  1IFJ A;  1JNM A;  5L8R J;  4I0X A;  3P8M C;  1SER A;  5GW7 A;  1SZT A;  4I55 B;  3AG1 B;  1BE3 H;  2JGD A;  1FZA A;  3A0R A;  3CSX A;  5LXT B;  2V4D A;  1KU9 A;  3GLM A;  2YIB A;  4IGG A;  5H2F E;  1J1E B;  4YJ3 A;  1PP9 E;  3GVM A;  4X1K B;  4CC6 A;  1BCC E;  3H1J G;  2KZJ A;  1KQF B;  4GT1 A;  3U11 A;  1JY2 N;  1AVM A;  2JR8 A;  2KYV A;  3HPL C;  3THO A;  1N32 B;  2PTM A;  3AG1 C;  2JDI G;  1L1F A;  4OVN F;  4JI4 O;  3ZHS A;  3G6B A;  3HE4 A;  1JMM A;  1J1E C;  4WFG A;  2L91 A;  4I6M C;  2XAS A;  3H1H E;  2X6A A;  3Q5S A;  2P1J A;  1Q5O A;  2DW3 A;  2A45 H;  1AJY A;  3WMM 0;  1R6N A;  4DV0 B;  2F93 B;  3QF7 A;  1PL0 A;  2Q9I A;  2E42 A;  2Q5Z A;  1FJG B;  4Y99 B;  4I0X B;  1RF1 C;  4DRX A;  3T1H O;  3AG2 B;  2WVR A;  2JGD B;  2WSC J;  2PY5 A;  1CEZ A;  1X59 A;  3L75 J;  3E8G A;  5L3B A;  4AI8 A;  2N1T A;  5HFL A;  4J9Y B;  1CZQ A;  2A3Q A;  1Y67 A;  4UV9 A;  3K5L A;  5CCH C;  4K0K B;  4C7U A;  1L0L H;  1NTM K;  3P7K A;  3BVH A;  5B5E Z;  4Y99 C;  5KAF Z;  2MK3 A;  2V4H A;  3H1H H;  1VQP V;  2V7Q H;  1ZRT D;  2RNB A;  4EI2 A;  3CCE V;  4LF6 O;  3CXH F;  1K5Q A;  1N86 A;  4XA4 A;  2XZR A;  2M0B A;  2YIC A;  2A06 G;  1Q81 Q;  3BRV B;  3STL C;  5KJ7 A;  1P84 H;  1JB0 J;  2Y69 B;  1NKZ B;  2GDS A;  4IFM A;  4UVC A;  1IJD B;  1EN5 A;  1SQV G;  1NVO A;  3CX5 E;  3OMN B;  1LWU B;  3H1K E;  3UKM A;  4YY3 O;  4WY4 B;  2ZNI A;  3G9R A;  2P22 C;  3MHS C;  1M5I A;  2GBO A;  2LO1 A;  2BAS A;  1H8E G;  4L87 A;  1NT2 B;  3QG5 A;  5J2T A;  1YTF D;  5IYB O;  2UXC O;  3H1I J;  4BR6 A;  1VQ4 V;  1YSC A;  4DRX B;  1GU4 A;  3HB3 B;  3V2R A;  2YIA A;  1T3U A;  2H7H A;  3M9B A;  3R2P A;  1OW8 A;  4PV1 D;  3CWB G;  5LGU A;  3E83 A;  3RK2 D;  3B8N A;  1UJW B;  1RFY A;  4UCT A;  5JH7 A;  4ICG A;  1IFN A;  4QE7 A;  4JI8 O;  1ORQ C;  2AZ2 A;  3L73 H;  1ZN5 A;  1NKD A;  2UXC B;  3JAK A;  1GL2 A;  3VP9 A;  2DOS A;  5IY5 B;  3E35 A;  2KB7 P;  3H1J J;  2UXN A;  1Y74 A;  2N1T C;  3E8B A;  1NTZ E;  4YHH B;  2OTK E;  3I55 V;  2HLD G;  4JYA B;  3R4Y A;  4J41 A;  1IFD A;  4N78 E;  3TGU H;  2AEM A;  3BCC D;  1H8A A;  1JX9 A;  3SPI A;  2ZCE A;  2UXX A;  1SC5 B;  3M91 A;  5IY5 C;  5J2T B;  1VQ9 V;  1SQB K;  3W7T A;  4DV5 O;  1IFI A;  1VQN P;  2HYN A;  3KXD A;  2QM7 A;  5AG2 A;  2Z3Y A;  4K8Z A;  1K04 A;  2LW1 A;  5KJ7 C;  2BCC G;  1YTZ T;  1ZL8 A;  4PDL A;  4GOD A;  1AVY A;  2POH A;  2QJP C;  2RN0 A;  1XL6 A;  1Q7Y W;  3HKB A;  2VQF O;  1IBK O;  1OMI A;  4PJ0 Z;  1WT6 A;  2Q7H A;  4X1Y A;  5KUK A;  2CTQ A;  3S3W A;  5JH7 B;  1YI2 V;  4TT3 H;  1X0T A;  5KMG A;  2GUS A;  3KYQ A;  1IXM A;  2P58 A;  5C93 A;  3D6Z A;  3JAK B;  1BE3 G;  1GL2 B;  4PD4 I;  1GM9 A;  1P4R A;  2Q7E A;  1GK4 A;  3PP5 A;  4IL6 X;  1VF5 D;  1Y74 B;  4NYK A;  1WNS A;  4DUY O;  4JI0 O;  1KB9 E;  3K0D A;  2D2C B;  2DYR C;  2P7J A;  2WLL A;  2J59 M;  4BWN A;  5CB4 B;  3KDP B;  1GL2 C;  4DO2 A;  2LFR A;  4YJ2 A;  3JD0 A;  5D5Q A;  5H6R A;  4ZHQ A;  3TNU A;  3CEI A;  4XBF A;  1B04 A;  2DMX A;  3CRQ A;  4FLV A;  2KLU A;  4U3F E;  1ZL8 B;  2D2C C;  1B3Q A;  1GH6 A;  3FWL A;  3W67 A;  2EBO A;  3CCS P;  4HNA B;  2Q73 A;  4C7R A;  3HKB B;  3LNN A;  2IBZ I;  4X1Y B;  2L35 A;  2HP8 A;  4D6T H;  1NH2 D;  4ZMD A;  3A7O A;  2ZQM A;  1PP9 G;  1ZTE A;  1KB9 H;  3B40 A;  4KFM A;  3CCR V;  5H2F Z;  2QA4 P;  3VMZ A;  2JJ2 G;  1GU5 A;  3CB2 A;  3CMA P;  1DK1 A;  1CI6 B;  1VQ5 P;  1HNX B;  1L0L G;  1OW7 A;  3E89 A;  3S9O A;  5L3D A;  1ZR2 A;  1KKC A;  3E86 A;  1EBO A;  2BE3 A;  4TV8 A;  3E2E A;  1PPJ D;  1YXB A;  2V7Q G;  2WLL B;  1S0V A;  1IK9 A;  3H1H G;  4U3F H;  1KYO H;  5CBN A;  3M8A A;  4YJ2 B;  2ZM6 O;  2O57 A;  3PTZ A;  1N34 B;  2L6L A;  1AVO A;  1SQX E;  4WBA A;  5EC1 C;  1FZF A;  3RL0 g;  3D70 A;  2N05 A;  4NPE A;  4J9Z B;  3APQ A;  4IHJ A;  2EIM C;  2HOD A;  2WQY C;  4X89 A;  3V5B A;  1S9K E;  1MA1 A;  3RL0 B;  1NTK D;  2BCC J;  3CC2 V;  1FJP A;  4QNH B;  3OJA B;  1Q86 W;  1PD3 A;  2YIU B;  1M90 Q;  4L74 A;  3LSS A;  2QIW A;  3Q5R A;  2F95 B;  1VQO P;  5CBG A;  4DR2 B;  3SR2 C;  4DV1 B;  5KAI E;  3C8V A;  4JI3 B;  1BE3 J;  5AVZ B;  3RL0 C;  2CGN A;  1SQX H;  1XRE A;  3CX5 I;  5JQG A;  1OZ0 A;  3L73 G;  4TV8 B;  4LFC B;  1W0J G;  4BIO A;  1S5L H;  2JK5 C;  4JPR A;  2YIU C;  1Q6U A;  1BSM A;  3AEE C;  3A0H E;  1JY2 O;  1FBM A;  2QWP B;  3H1K G;  3MAQ A;  4D7S A;  4JI6 B;  1M56 B;  1O9G A;  1N2D C;  2ITC C;  3JSL A;  2B88 A;  4NXN O;  3EXA A;  1SQP J;  5LMN O;  4C7N B;  2BCC D;  1WP8 A;  3TXS A;  3OD4 A;  2ZD9 A;  3P3P A;  4CPG A;  4X66 B;  4IHJ B;  3FB5 C;  2WIT A;  2KLV A;  3KPE A;  1VQ7 V;  1R5L A;  1PL5 A;  3IN6 A;  2W0X A;  3B5N D;  1M56 C;  2YEV A;  3E22 A;  4OPH A;  5KAI H;  2WSS G;  3BEH A;  4NKG B;  4LF7 B;  4LH6 A;  1SES A;  4DV7 O;  2I1K A;  1H2N A;  1BHB A;  5AW2 B;  2HVJ C;  1PP9 J;  1BCC J;  3TF5 A;  3MGN A;  4TT3 G;  5L3F A;  4PD4 D;  3P8C D;  4PA6 A;  3K04 A;  1YDX A;  1XUQ A;  1W2E A;  4TQF A;  1Q3E A;  3O9O A;  1YQ3 C;  4JV5 O;  4PI2 A;  1SQP D;  5IE9 A;  1UIX A;  3QO7 A;  2Z5H A;  3TSI A;  1WPX A;  3H1H J;  4ASV A;  2P90 A;  1OV9 A;  3K58 A;  1SQF A;  3AED C;  1OX3 A;  3NXS A;  4MVZ A;  3CD6 P;  2A79 B;  5KHI A;  2FYN B;  5EFW B;  1LTI C;  1SQB H;  2GM4 A;  4OGQ D;  1EN6 A;  3N7N A;  3E1I A;  2E76 C;  1GMG A;  2YEV B;  2WLK A;  5KHK A;  1T6A A;  3BPZ A;  1HUC A;  5CMU A;  4JBZ A;  1BCC D;  3GHG A;  2IBZ D;  4LH7 A;  4LF8 O;  2RMK B;  1M1K W;  2EIL B;  1YIJ P;  1MG1 A;  1E1R G;  2FYN C;  3V4Q A;  4I5S A;  2N74 A;  5LP6 A;  2PFX A;  3NMD A;  1KQG B;  2XOK G;  4D6T G;  1XNQ O;  1K8A Q;  4OX9 O;  1EDJ A;  4LF9 B;  2WLH A;  3IAY A;  2O1J A;  4FZ0 A;  2LJ2 A;  2YKQ A;  3QO8 A;  2ZDI A;  2J58 A;  3FX0 A;  2EIL C;  2QRX A;  2OCC B;  1Q43 A;  2L5G B;  1OVU A;  3VQV A;  2JS3 A;  4WFA V;  2YIB D;  3RBZ A;  1YQ4 C;  1J1D C;  3H1K J;  5KLV E;  4U3F G;  5CN0 A;  1ZV8 A;  4CH3 A;  5LHI A;  3H1L H;  1E79 H;  4UVA A;  1W5C E;  4GOF A;  1VF6 A;  4UB6 H;  5BY1 A;  1FAF A;  1XQ8 A;  5AW4 B;  4HYO A;  2OCC C;  3IJ4 A;  1NTK K;  4C46 A;  1M57 D;  4FLX A;  3FKS G;  1IFM A;  3GHG B;  4TV9 A;  3VOU A;  1H88 A;  2WSF J;  5LYJ A;  3HE5 A;  4YXW H;  3BA9 A;  4PV1 B;  1LTB C;  3CRA A;  1VQ8 P;  3ZHU A;  3RK2 B;  1Z56 A;  3ETE A;  5LP6 B;  1KUQ A;  2YC0 A;  2W8Z A;  2VRS A;  1RY3 A;  1SET A;  2HHH B;  2UUA O;  4ZKU A;  3OM3 B;  1QL1 A;  1V54 B;  1JM0 A;  1NU1 K;  3ZN1 A;  3ZHQ A;  2Y9Y A;  3GHG C;  3F5W C;  3L71 D;  3KKY A;  2YUA A;  4PV1 C;  3RBX A;  5APW A;  3SJB C;  1IK7 A;  3KCX A;  1LP1 A;  3CX5 D;  3H1K D;  3ITK A;  4XFJ A;  1GKF A;  2M3B A;  5LP6 C;  4B7E A;  2O1K A;  2N1T D;  1NWQ A;  1LR1 A;  2KOG A;  1D5N A;  1SQX G;  3GF3 A;  4GKJ O;  1FZC A;  2RMZ A;  2QEX P;  1Y9B A;  1V54 C;  4A7P A;  2XAF A;  2ZDI C;  2PF4 E;  2ZVN B;  1EN4 A;  2JKV A;  2NZ2 A;  5DEC A;  3OA7 A;  4YXD C;  1GO3 F;  4PD4 F;  1AI4 A;  3ZRX A;  4TV9 B;  4D7T A;  2UUC O;  5EZY A;  3G4S V;  1HGZ A;  5LYJ B;  5A2Q N;  1NJI W;  1HGV A;  1SF9 A;  3SGI A;  1AR1 B;  1U57 A;  3W68 A;  1RE4 A;  1L4A C;  3CYO A;  2QWR B;  4EFE A;  1VQL P;  1M1J A;  1J5E B;  3FXE A;  5BU8 B;  1VF6 C;  3CME P;  1NTZ D;  5IYC O;  3IR9 A;  2EIN C;  3IGA C;  2WAM A;  2EIK C;  5FLX N;  1VP7 A;  4NR1 A;  4DV4 O;  1VF5 B;  4NTX A;  2PYJ A;  2ZYG A;  5KAI Z;  1IDS A;  1RQU A;  1FPO A;  1G8M A;  2KK7 A;  3KHU A;  1LP1 B;  1HP8 A;  4UXN A;  2IJI A;  1HWT C;  3KG2 A;  1N33 O;  2FXM A;  1KV4 A;  2ZIO A;  1NO4 A;  2CGO A;  2UXD O;  1EZV E;  2NPS D;  1FZC B;  4PDR A;  3AK1 A;  3A0H Z;  1AI6 A;  4P2Z A;  1NZ6 A;  4YIO A;  1BQ0 A;  3DTU B;  1YF2 A;  1U96 A;  4DV4 B;  4I7Z C;  2X7R B;  3V2N A;  1GDT A;  2F4V B;  5EZY B;  4U3F J;  5DED A;  2JRI A;  1KIL E;  3PRJ A;  3USS A;  1FZC C;  1QU7 A;  1SVF A;  4J7Z A;  3ZMS A;  2UXD B;  2Z5I A;  2LFS A;  4O2A A;  1SQQ D;  3IC7 A;  4DR3 B;  2OAR A;  1NH2 B;  1M1J B;  4MN4 C;  1PNL A;  2QM8 A;  2Q3I A;  1QR8 A;  3LNM B;  1DF5 A;  3F89 A;  4XDJ A;  2A06 E;  3OTO B;  5LBQ A;  3WUT A;  2WPD G;  2EJR A;  4ZBM A;  2IM9 A;  1QLE C;  4QIW F;  1EZV H;  5LA6 A;  1BGY H;  3AG3 C;  1SFC D;  2LR2 A;  3VBB A;  1SQV E;  3AEA C;  2OTL V;  1RE4 C;  1KP3 A;  2EUL A;  4DR6 B;  3PLN A;  1M1J C;  2OTJ P;  2IJJ A;  1P49 A;  1JY3 P;  2Y9Z A;  1S4X A;  2FY8 A;  5JWP A;  1BHA A;  3VN0 A;  4R4M A;  4U3J A;  1QVG O;  2FBW C;  2GHY A;  1MZF A;  3OT7 A;  3CWB E;  2YKP A;  2IU0 A;  1VQK P;  1SQX J;  2N04 A;  4PA9 A;  2B5U A;  2CE4 A;  3U0Z A;  1VL2 A;  4N21 A;  4R7C A;  2QGN A;  3SJC C;  2QE7 H;  2Y0E A;  1VQ5 V;  1VAR A;  1TVK A;  4BRY A;  4O2A B;  2Y0P A;  1Y47 A;  2WLN A;  1MAB G;  3CX5 F;  1D5A A;  3B5N A;  3ETD A;  4LFA O;  5AVS B;  1K5S A;  1VQ6 V;  4JAU A;  2JIZ G;  4H44 D;  3G71 P;  4FM0 A;  5LA6 B;  4YXW G;  2R44 A;  4GX2 A;  4NXM O;  5EBM C;  3CCL V;  4X62 O;  4JAS A;  5GON A;  1L0N K;  3AK3 A;  2F66 C;  1KQL A;  1Y8A A;  3OEH G;  5IDJ A;  3BY6 A;  2O01 H;  4LGD E;  4LFA B;  1EZJ A;  4PJ0 E;  2QKC A;  3AE7 C;  2CAZ C;  3K03 A;  2YXH A;  3CCM V;  1EXI A;  1NVP D;  5KLV G; 
#chains in the Genus database with same CATH homology
 1EXJ A;  2E76 C;  1VF5 B;  3GF7 A;  1RQU A;  1ZOY C;  3FGA D;  2E75 C;  3B71 A;  2D2C D;  5L8R J;  1OW6 A;  1HF9 A;  3RK3 E;  5KKZ C;  1FDO A;  2FYN C;  3D71 A;  2E76 B;  2E74 C;  3RL0 g;  3D70 A;  1KQG B;  1PV3 A;  2V7Q J;  3GLM A;  3R4Y A;  2WQY C;  1K05 A;  2FXP A;  4H13 D;  2BEZ F;  1HJ0 A;  4I7Z C;  1KQF B;  1DIP A;  2IDB A;  3AE6 C;  1KIL E;  2J5U A;  3O6Q A;  2QIW A;  3Q5R A;  3AE8 C;  2G3A A;  4H44 B;  1K04 A;  1YQ4 C;  4KT0 J;  2ZT9 C;  4I7Z B;  1S1C X;  3C8V A;  2QSI A;  3AEB C;  3AEF C;  3Q5P A;  2QJP C;  3AE5 C;  3Q5S A;  1OMI A;  2MKV A;  2E75 D;  3LW5 J;  1RQV A;  3AE4 C;  3SFD C;  4YTP C;  1DD3 A;  2O01 J;  3AEG C;  4TT3 H;  1Q90 D;  1AJY A;  2YIU C;  1FDI A;  1S5L X;  2ZT9 B;  1MKM A;  3AEE C;  3AEA C;  3D6Z A;  2E74 D;  2QJK C;  2WPV B;  4H44 C;  2WSF J;  1TU3 F;  4U7J A;  4PV1 B;  3Q3D A;  3Q2Y A;  4R4L A;  4H0L B;  2WSE J;  4OGQ B;  1VF5 D;  4GDO A;  4IL6 X;  2WSC J;  2JO1 A;  4R4M A;  1KTM A;  5KLI C;  2FBW C;  3GMA A;  2D2C B;  3AE3 C;  1ZP0 C;  2E76 D;  4H13 C;  1PL5 A;  1KOR A;  3IN6 A;  1R8E A;  1GMJ A;  3SFE C;  4PV1 C;  1VL2 A;  4H0L C;  1IK7 A;  4OGQ C;  3ABV C;  4XFJ A;  2H88 C;  3T97 B;  1ZME C;  1DD4 A;  3AE2 C;  2JP3 A;  4H13 B;  3GF3 A;  5M1B A;  4RKU J;  2D2C C;  3Q1M A;  1Y9B A;  1JB0 J;  2QJY C;  4H44 D;  2NZ2 A;  3AE1 C;  3AE9 C;  1PIX A;  1YQ3 C;  1ZRT E;  1WMK A;  3G9R A;  1UIX A;  4YXD C;  2YMK A;  3EWK A;  3IAO A;  1KMI Z;  2BEQ D;  1U57 A;  3D6Y A;  2OQQ A;  2E75 B;  3H25 A;  1NGM B;  2ZT9 D;  3AEC C;  1VF5 C;  3AED C;  4Y28 J;  2K9Y A;  2H89 C;  2G8Y A;  1OW7 A;  3AE7 C;  4PV1 D;  1OW8 A;  2P10 A;  3S9O A;  2E74 B;  4H0L D;  1EXI A;  4OGQ D;  4Z1M H;  1NYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...