4H0LB

Cytochrome b6f complex crystal structure from mastigocladus laminosus with n-side inhibitor nqno
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
b'MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4h0lB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h0lB01
1ZRTE 1Q90D 2WPVB 4H13B 2WSCJ 2E75B 1JB0J 4OGQB 2FYNC 2QJPC 4H44B 2WSEJ 2QJYC 1VF5B 4PV1B 4IL6X 3C8VA 2E74B 2ZT9B 5KLIC 2K9YA 2D2CB 2YIUC 5KKZC 3LW5J 2E76B 4Y28J 4RKUJ 2QSIA 4KT0J 1S5LX 2WSFJ 4H0LB 5L8RJ 4I7ZB 2QIWA 2O01J 2QJKC
chains in the Genus database with same CATH superfamily
2OTLP 2Y0EA 1SQPE 3RK3E 4FPPA 2G8YA 1SRYA 3N27A 4J80A 1RM1C 5LGNA 1AQ5A 1XNQB 3JAWA 3L36A 2GUZA 1ZUQA 2ZT9D 1J2JB 2JR8A 1WT6A 1S72P 4CH6A 1LTAC 3KXDA 1H89A 4JI5O 1TGOA 3CXHD 2A0LA 2F43G 1NTKE 5KLVJ 5B1AB 4JI6B 2UU9O 2WPVB 5APVA 2YEVA 4GX0A 3HKEA 5LOVA 1WB8A 1NAYA 2ZKOA 1N73A 4QE7A 2BOBC 3FYEB 4J11A 4KHPB 3L75D 5K1PA 4NR1A 4H44C 3L75J 4TQDA 2AW9A 2DYSC 2HJFC 3ML0A 3M9BA 2YI9A 1OX3A 3L73E 4I0XB 1NTME 1W5CE 1OMIA 3JSNA 5IYBO 4ZOLA 2IZ1A 3A5TA 3F5HA 4GOFA 2KZJA 3CWBH 5KLIB 4NXMO 2JEEA 1NTKH 4TT3G 3I5DA 2WLIA 3K0GA 3OEHG 1Q81Q 3TF5A 2E75D 1F23A 2IBZI 1MV8A 1SQPD 3L71J 3MHHC 4GKKO 3RK3D 4ZKIA 1OCRB 1SQPJ 1LTSC 5BVZA 2WPSA 3T97A 2MK3A 4DR7O 1O9GA 3DGEA 1LWUB 3H1JE 5KX5B 1YJWP 2HG5C 2PY5A 2FYUE 3WB1A 3BASA 2QIWA 3ASNB 2ZVOB 3S3WA 3L73H 4UFZA 1WMKA 1NTMH 4W80A 3L74G 1ZLLA 3ZIAG 4UCRA 1MOFA 3HD7B 1NTKD 4J9ZB 3H1KG 5JQGA 3JCUZ 3A2AA 1GN3A 2JKVA 2Y69B 4GOEA 1JY2N 2WPRA 3AK3A 2V7QH 1NGMB 3JCUH 2QKSA 2HHHO 2AEMA 3RVZA 2H89C 2WVRA 3I55V 2RNBA 1VF6A 4E4EA 3B40A 1M7LA 2JGDB 3T4ZA 3B71A 3UQ8A 3OTOO 4LF6O 3FGAD 3CI9A 2QWPB 3B8EB 5JVDB 1EZVH 3L73D 1NTMD 1LR1A 1AP6A 5IJ0A 1NVPD 4O4JB 1FJPA 2JS5A 1SFCC 4UVBA 4JYYA 3H1LH 3OGIB 4MVOA 1IFNA 4UB8Z 2WLMA 2POHA 4YHHB 5KMGA 3CPWU 5H2FE 4DUYO 1ZR4A 1AJYA 1QR8A 4UB8H 2XNDH 3CCJV 2OYIB 1OCOC 3MHVA 2F1MA 2DW4A 1KC8Q 4JI4O 1L8DA 1ZL8A 2UUCO 3CB2A 1S5LZ 2Q6QA 1TUBB 1KP3A 3ZEDA 4BW9A 4C7NB 2E76C 1S3JA 2B88A 1S5LH 3BRCA 4PA9A 3H1JD 2E5TA 3H1JJ 1Q86Q 2GM4A 5BMVA 5CA1B 2W0XA 2Y4TA 1NTZJ 2FYUJ 4N21A 4HNAA 1MABG 3HKBA 3ZN0A 2ZNIA 1R3JC 4JF3A 3C3TA 1E79H 1YIJV 1VQ5P 2Y4UA 2KI7B 3ZRVA 1RP3B 2UUBB 4RKUJ 1V55B 1T2KD 1Y76A 5H2FH 5L3GA 4YJ3A 3IC9A 2KNCB 2B1GA 4CH3A 1R3IC 1K05A 3L70G 3VP9A 3OA7A 1FZBA 4BIOA 5CA0B 3G71P 4JAUA 2F4VO 3JD4A 2QJPC 2Y48A 4LF5B 1YXBA 3D36A 3LDCA 3QG5A 1L0LE 4DR1B 4EEQA 5A9GA 4ZHQB 5AVTB 2KSDA 3V6IA 4O4IB 3C9IA 1NU1E 3LW5H 5BU5A 3H32B 4GT1A 4X1IA 1YYCA 5KAFE 3E8FA 2WAMA 5JH7A 4MTOA 2YUAA 1M1JC 1JA8A 3QO5A 1VQNV 2HLOA 1MFTA 1Z5WA 4WBAA 1WJZA 3M06A 4YXWG 4JZGA 2EILC 1Y9BA 2PZSA 3PP5A 4H44D 1Q6UA 4I1LA 1VQPP 1JCCA 5IWAO 1TVKA 1BQ0A 1L0LH 1WP8A 3P8CE 4JGSA 3BVOA 5AVWB 1Y8AA 2FXOA 4QE9A 1NH2B 3FWNA 3AEGC 2JVDA 2M3BA 1RH5B 2WA3A 3B4SA 1EZJA 3ZBHA 2IYPA 2YC0A 4MVMA 4LFCO 1RPOA 4EFBA 2GV9A 3K06A 2IJKA 2AXTE 2QTSA 2IBZE 2WSEJ 4XBFA 1AI7A 4U3JA 1BSMA 1Z2GA 5IJ9B 4QJFB 1Y67A 2WT7A 4MVZA 3CXCU 5LXTB 1S77D 3CCMV 1GD2E 3O6QB 2ZFCA 4FVMA 4JZ2A 2K9PA 1L0LD 4EB6A 2HG5D 2A7WA 4JYAB 3JSVC 4LF7B 1OZ0A 2D2CC 1NU1D 3RYCA 3AK1A 1NU1J 2BSKB 2CUGA 1FZFA 4CC5A 3EVKA 4DR5O 4Z2WA 4XFJA 3TCUA 2BCCG 4OWFA 1G1IA 1RF1C 2P5OA 2WPQA 1XUQA 3KZIZ 1CW5A 4GKKB 2LP7A 2YXRB 3HKCB 2FBWC 3SJCC 2F66C 5KA5A 1S72V 3EFGA 4Y99B 3E35A 2WSFH 3P7KA 4JTCB 4R7CA 4BRYB 2EZPA 2JWAA 3G4SV 1XMOB 3VP8A 4RESB 2QJKC 3P8CD 3AK2A 2DYRB 3OMNB 3AE5C 5KHHA 2KOGA 2WSSH 2ZM6B 1SFCD 3SWFA 1FXKB 3HKDB 2XAGA 4GX5A 5LGUA 3L72G 5TJHA 2XDJA 1MG1A 3V5BA 1N7SC 4O9BA 1DD4A 3AG2B 2HFEC 3SWKA 3WUTA 5FPRA 1J1EB 3H1HJ 2G38A 4I4TA 4NTXA 2X7RB 1QBZA 4B3MO 1FAVA 2A45G 1SZTA 1MKMA 5AW3B 4GODA 1SQVE 1GL2C 4DR3O 4UCVA 2Q1KA 3W7UA 4LF4O 1OVVA 1K33A 1QQCA 1AR1B 3GHGB 1NR1A 5GTIE 3CC4P 4AUWA 3ABVC 1URFA 4AYCA 4MVQA 5JJEB 4FLXA 1YSCA 1IJDB 4D6TE 2N9BA 3FKSG 4DUYB 2LXCB 1K4CC 5GTHZ 2Z0AA 2Y9ZA 1IBLO 1HGVA 3T2MA 4CH5A 5BXZA 1IURA 4TT3H 2AEFA 2CK3H 3FWLA 2JIZG 4RAIA 1PGPA 4FM1A 4N6JA 1DIPA 1YJWV 2UUCB 2QWQB 2P2UA 3MGNA 5ITZA 1H2GA 2CTRA 3LDEA 2Q73A 2K9JA 5DJUB 1URQB 3K9AA 4GUNA 3USSA 1LJ2A 4WBNA 2OIGA 5IYZB 4HYOA 2FTKA 1SA0A 2X6AA 1YITP 1WAZA 2EIMB 4RJTA 1JY3N 1UFIA 1AVOA 1K34A 3QF7A 2CAZC 3RVYA 4XDJA 1UIXA 3L74H 3WB2A 3W67A 2OTJP 4DO2A 3BRVB 3JYCA 2ZE8A 4RO2A 2PTMA 3H1KH 5FL7G 4NPEA 2V4HA 1KUQA 2Q3EA 1FYJA 4H0LB 3L37A 2KG7A 3E22A 3VN0A 3UO3A 2CDYA 4U7NA 2O3JA 1Q8IA 2RKLA 1KYOI 1N36B 4QMAA 4JPZB 1K73Q 4JI1B 5E79Z 1QVGO 3ZMVA 3JD0A 3RK2C 1SQVJ 1IK7A 2A06H 2HEPA 4DR2O 3P30A 2ITDC 2Q7EA 1U96A 1SFCA 2ZYDA 5E79H 1NJIQ 3AG1B 2EIJC 4IT5A 5LA6A 5J2UA 1N2DC 4OVNF 2NPSD 4FLZA 1XNRO 2KB7P 4D6TD 4X62O 3ZHTA 3RYFA 2Y0CA 4D6TJ 2WZ7A 1T3UA 3CWBG 4L75A 1NTKG 4DRXA 1PPJH 2JJ1G 3GLMA 2AXCA 5B1BB 4DV0O 4OH8B 3OUFA 1EXJA 1Q90D 4HKZH 4IHJB 5L3DA 2HVJC 1R3KC 5CHXA 1KD1W 3P3PA 1LT9B 1I7FA 4GCZA 2KK7A 4IGGA 1YHQV 3THOA 2E74B 2XZRA 3P8MC 5IWAB 2R32A 2H3OA 1VQ5V 4BAYA 4HBNA 3H1IH 4GDOA 2Q0OC 1BSNA 4JI8O 3CX5I 3OD4A 2R5BA 3GVMA 1OFCX 2D2CD 3L73G 2BOCC 1NTMG 4ASWA 4UUJC 3JALB 4BWAA 5B5EE 2FYNB 2UUAO 5IT9N 1FDMA 1AJPA 1NKNA 3TXQA 4EYYQ 4X9QA 2WPDG 1U57A 2P1JA 3IR9A 1ROPA 3CCQP 1JFFB 3ZDMA 2IFMA 1AJNA 3T4DA 1P84F 1N8RW 4I9QA 3CMEP 2Q9LA 3MHSC 5KHIA 3B2EE 1GU4A 3C3SA 3E1RA 1IXBA 3U10A 1RF0C 3JARA 3A0HZ 4IL6Z 3GWOA 3M0DA 3SPIA 3H1ID 3NMDA 1NBMG 3VBBA 3OFNG 2N74A 3A0HH 2W6JH 4IL6H 1EZVG 1VPCA 4PA3A 4I7ZB 4ZI7A 2C0WA 1VIBA 3VTPC 2ZNJA 2QWNB 1SQXH 4I9WA 5H6RA 1G1XB 3GG2A 3HE5A 3TGUE 2XNDG 3N2KA 3CJHA 1M1JA 1MNGA 1I08A 2HFED 1VQPV 4DR4O 2YNYA 1RY3A 4X1KA 1R5LA 1G8MA 2QWRB 2O1JA 2N1TB 1D5NA 1HW7A 4WB4A 3IFMA 2ITCC 4I50A 3X2QC 1H8EG 4IIJA 1GL2D 1FPOA 4GZRB 3KG2A 5EBMC 1LT1A 1GM7A 4FZ0A 1PD3A 2ZCEA 3OT7A 2NPSA 1NO4A 2KSEA 4HZ3A 1X8YA 3HTKA 4FFBA 5AW5B 1VQ8V 1LP1B 4LFBO 2WWWA 4MVRA 2K1EA 3QWOC 3R4YA 2QR4A 4O2BB 3U59A 2KKWA 4PV1B 1Y74B 4J42A 3ABLC 1LTIC 5KLIC 4LGDE 2V4DA 5FNVA 3V2NA 3HR0A 3RK3C 3PH0A 2CTQA 1IDSA 4JI2B 1NWQA 1W2EA 2R5DA 4DR3B 1G1JA 1SQXK 3AE3C 1DH3A 3D36C 5C8YB 4C7RA 1ZP0C 3F89A 3B09A 3OW2U 1O9HA 1JMMA 1G2CA 2ZE6A 3RL0g 1OXZA 5LMUO 5LP6A 2BEQD 1X59A 1IBLB 1HWTC 1BZKA 1RF1A 3CCEV 1SQBE 4R8CA 4LH6A 1GTOA 1GAXA 3TGUD 4XDKA 1E1QG 3TGUJ 4DOJA 3RWRD 2RJZA 2E5YA 3CRCA 2HODA 1U7JA 1BS3A 2IFNA 2ETNA 2GSMB 1FU1A 1XREA 1EC5A 3JAWB 3GW6A 2WSCH 5B1OA 2SPZA 2R9IA 1KYOE 4B3TO 3FX7A 2O1KA 2QA4V 3RL0C 1VP7A 2Q69A 4B7EA 3RK2D 4BXLA 2XHBA 4X64O 3S1KA 2ZXWC 4BWNA 1L0LG 1EDLA 2ZAEB 2VRZA 3TYYA 1QLEC 1VQ6P 4JI0B 4OGQC 2JRIA 1D2DA 5KLVE 1L1FA 2Q7HA 2DJVA 4X65O 1S0VA 2W6IG 5LOVB 1H0TA 3L72H 2YIAA 4PDMA 1LUWA 3K03A 3QTCA 1HR0B 3HUSB 1N73B 4J7ZA 4DV3O 2Q5UA 1SQBH 2UXDB 2RDCA 4JV5B 4YPCA 1IFJA 4IFDK 1N7LA 5K5GB 5TISE 3T1YB 1T6AA 1IX9A 4O4LA 3A0BE 1K4DC 4K0KB 1SVFA 2P22C 1EFRG 2AGAA 2RMZA 1LTGC 1GL2A 3CC4V 3IFXA 2ZJSE 5LYJB 3P32A 4CS3A 1EN4A 2GTAA 4JAVA 4MW3A 4ZOLB 3ABKB 4H13C 3BCCE 4DZOA 4DW0A 2KLVA 1P7GA 3CX5F 1K92A 2IW5A 2WLIB 3E86A 1QVFO 1CI6A 1XOUA 2KZIA 3MAQA 4TSFG 5KLVH 1AI6A 4YIOA 1PP9J 1SQBD 5DN6G 5AVSB 1SLQA 4P2ZA 3CC2P 3AE2C 3L71E 2UXXA 3F7YC 4AQYO 2GUVA 2W90A 2VQEO 1M1KQ 3D70A 1BE3J 3A8TA 1PV0A 4MTFA 5J2TA 1XDCA 1M5IA 1KYOD 3L75H 1F4MA 4DV7O 4J10A 5LHGA 1KU9A 3B8MA 2OTJV 3JAKA 5CN0A 1M56C 3AE8C 4I2LC 2K88A 1Q7YW 2WSSG 4E2LA 4AILC 3ETDA 5JQGB 5KLVD 2O01H 3EFFK 3ABMC 1X0TA 4YY3B 4UXNA 1DK1A 3AE6C 2P67A 3LSSA 2QTOA 1HNZO 1KQGB 3H6PA 4BIUA 1TUEB 4K3AA 3JC22 1T5EA 3MUDC 2GBOA 4F6RA 4P9OA 4CS4A 3L71H 1Z56A 1GK6A 1SQPH 3CS5A 1HH0A 5IJ0B 2VQFO 1YTZI 1K8AQ 2UXCO 1HJBA 4B3SO 2N05A 2KYVA 2FYZA 5D5QA 3T1HB 1H88A 1P4RA 2X6CA 2H94A 1FE6A 1M9NA 4LC1A 4WFEA 5KMGB 3BCCJ 5L8RJ 1EXIA 4JI3O 3N2GB 3IF4A 1YJ9P 5GONA 3SWYA 4B3RB 3LNNA 2AZ2A 2Q0AA 2PRRA 1ZL8B 5LHHA 2CK3G 3QH9A 1AVYA 2JP3A 5KJ7C 3AG3B 4I55A 4DR4B 1JM0A 1GZLA 3L71D 5KHJA 1RE4A 2AEJA 4FMTA 2F93B 4HNAB 1YBKA 3HKBB 1GW3A 3PHLA 1S5JA 3WB0A 1NTZE 2LW7A 2UXBO 4XA4A 4I5SA 2WLJA 3CCQV 2H8PC 3ZMSA 5CA3A 1FC2C 2YMYA 2E75B 2YIBD 1Y76B 5E1AC 3CMEV 5EC1C 1WA8A 4YJ3B 1SQPK 1BCCJ 1H2NA 4PD4I 2EJRA 2NNUA 1KTMA 4LNUA 1IZ3A 3AEDC 4IL6X 4QPJA 4LF8O 2UXNA 2P4VA 4FM0A 1KILC 4NXNB 1ZN5A 3Q4HA 1NQTA 1HF9A 1TU3F 2Z5HA 3M7MX 5CJ0A 1RF0A 1MZFA 4YXDC 1ZW0A 3G6EV 1Q6IA 3K9SA 2E42A 2WITA 4DW1A 1GTWA 2XAFA 1NTKK 3RL0D 4PJ0E 1YF2A 5JCOA 2PI4A 3H1JH 1Q86W 3WFVA 2A06G 4WF9V 1KP2A 3O9OA 2FYUH 4WCEV 1KFMA 5IDJA 4CBCA 4W4LA 1QLED 2E5LB 1VF5B 2OCCB 4OGQD 1GW4A 1PGQA 2DQ3A 1N32O 1AFOA 3S9OA 2ADQB 2EIKB 2LFSA 5JH7B 1D7MA 4O4HA 1BGYJ 2M5AA 1N34B 2B89A 1PPJG 2FKWB 1VQKP 3ZX6A 2QEXV 2YMKA 3DSQA 3MIWA 1NI8A 1R8EA 4K8XA 5EBWC 2H43A 2YO3A 2FMLA 4W7ZA 1QHTA 1NTMK 5BR8B 2QJYB 1TVKB 5APTA 4B3TB 5LBQA 2M6YA 3W68A 1OCCC 1FZEA 4P9PA 3JSLA 4X64B 2KUBA 1NTZD 3V4QA 2HVKC 1HDJA 3H1IG 2FYUD 4H13D 4TQFA 4P30A 3OMIB 3E8HA 1XMQO 3SFEC 5AW7B 5H2FZ 2V7QJ 4U3JB 4DV3B 3K0DA 1N33O 2WT7B 1H2SB 1IO4A 2PGGA 4Q20A 2BTQB 4GKJO 1AV1A 1JTHA 1VQOP 2RMKB 1OCZC 5H9CA 3W7WA 3IN6A 3B5NC 1F7YA 1QU7A 5KX5A 3UT5A 3RYCB 3L35A 1Y47A 4GKGA 3H1LJ 5IY5B 4LF9B 3RBXA 4L8JA 4G28B 2W6JG 3M0DC 4TLFA 4R4LA 2YIBA 1S4XA 1M56D 4EIJA 2HP8A 2R9RB 4B08A 3TNUA 3WG7C 4LFAB 2QGNA 1M57C 1ZAUA 1SKVA 5FLXN 4MTXA 1SQXG 3AG4C 1KILE 3RT3C 2YKPA 4LP8A 1OVUA 2ZXXA 3WU2E 1HTLC 2YS8A 4AQYB 1RM1B 4U3FE 2MW2B 1JB0J 1VQLV 2WSEH 3VOPA 5HFMA 1QVGU 1JQ0A 3E8GA 4UVCA 1L0NE 3CRRA 2ZIMA 3BA9A 5EC2C 4DV7B 5KA6A 1VQ6V 1N0NA 3Q5RA 1KQSU 4D7SA 1ZOYC 4DV5O 1B6QA 4K8ZA 4FLTA 5B3SC 3R2PA 1KB9I 4FLYA 3CEIA 4OX9O 5JVDA 1LTJC 1NKZB 2KS1A 5AVXB 4JI5B 2JS3A 4BW5A 2Z4EA 2KB1A 2OYOA 2NPSC 1NU1H 5H5NA 1S9KE 4KFMA 1VEWA 2YKOA 2UU9B 4PDVA 2XKMA 3FYIB 2EZOA 4PA6A 1HNZB 2P7TC 1VDFA 2K1AA 5KAFZ 4DV2O 3OR6C 2UWJE 1FZCC 2P90A 2OYIA 3ZHVA 4H44B 3ZCCA 2I8DA 3H1HE 4Z1MH 4O2AB 2DYSB 5KJ7D 3WU2H 3SPHA 3AEAC 5KAFH 1FZGA 3K59A 1SQQE 3DXRA 1WNSA 2YIUC 2M3EA 1ZX3A 3TXSA 1TAEA 1NOHA 5L3CA 2B9BA 4UB6E 5CCGC 2LO1A 1QR9A 3G80A 1NKDA 1BDDA 2DE0X 4TV8A 4ZNCA 3ZHRA 4X20B 5B1NA 2H8PD 3ZS8C 3CC2V 5BZBA 3LIEA 2OTLV 3FXDA 1KMIZ 1R6NA 4NXMB 2FYNC 1RSOB 1IBKO 5LP6C 5KHKA 4PD4F 1OVRA 5ITZB 2CTWA 1P84I 4B7KA 1KILD 2AXTZ 4J7KA 1J1DC 3STLC 2EINC 3GF7A 4WBNB 1L0LK 4JQ0D 1SA0B 2F23A 4U3FD 3H1HH 1IFIA 2PFXA 5CA0A 3S4RA 1T3JA 2AXTH 4NTYA 4U3FJ 2IBZH 4DR7B 1NU1K 1L0ND 2CH7B 1H38A 1L0NJ 1Y66A 4FFKA 1YTFB 3OGCC 2DW3A 4ZIBA 3N7NA 2H88C 2P10A 2IYOA 3ASOC 3K5LA 1HNXO 1PL0A 2PF4E 1GK9A 5EFWB 5M1BA 1NR7A 2GDSA 2P06A 1G4YB 2HPCB 3H32A 1H2MA 3OJAB 1GM8A 1V54C 3QNEA 3APOA 3M91A 1S9KD 1JJOA 4PA4A 2KG7B 3E22B 5AVUB 4BR6A 3RYHA 2WTYA 1SQBG 3MUDA 1MMMA 3ABUA 3H1HD 2M8RA 1H2KA 3K5OA 2HHHB 4K35A 1BMFG 3CYOA 1MZ9A 2IBZD 2QSIA 1D5AA 5APSA 5IE9A 4LCUC 3I56P 1PZQA 3CCSP 1SQQD 4LBEC 2OYQA 1AI5A 1SQQJ 3OTOB 4LF6B 1FDIA 1SFCB 1PGJA 3MZWB 5J2UB 4IOIH 5A2QN 1YJ9V 5LMNO 5CBOA 1EBOA 2R72A 1WLEA 4MS2A 4TUYA 2LW1A 1LGHB 3U1AA 5EBLC 4KJMA 1OCOB 2HJDA 4DRXB 1KV4A 4NKGB 3DC5A 2K9YA 3LUTB 5EK0A 3TETA 5KLVG 1US6A 3CPWO 4DV1O 4MW8A 5CBFA 2OYHC 4FM2A 5KJ7A 4WFAV 2E76B 4RO0A 1FXHA 1GK4A 5DJTB 4ZBMA 4EOTA 2Z5IA 4NPDA 1VQ9P 3QVNA 4JI4B 1M8OB 4DV4O 1M90Q 4TWKA 5IJ9A 4JBZA 4JI7O 3SJBC 1XBLA 3PJSK 1NHLA 1L4AC 1URQD 4IYIA 3B5ND 3L75G 3F5WC 4L73A 1XL4A 1SQVH 3IGAC 5GTIZ 2O57A 1NJIW 1HNWO 5AVZB 1BT8A 3SYPA 5GTIH 1S5HC 4WVZA 1KILA 1M57D 4D6TH 1U97A 4KT0J 1N33B 1NZ6A 2QJPB 2O01N 2R70A 4WY4C 1X79B 3ZMZA 1QL2A 2RQ6A 5IYCO 2W0FC 3JARB 1IFMA 5D5PA 3OR7C 5JJJB 1SZXA 4IFFA 2ZR2A 1KKCA 3KCXA 2F4VB 3L71G 1SQPG 2WLLA 3VYIA 3KYQA 2PYLA 1IFDA 4ZI7B 1SQGA 3GF3A 2XOKG 1SQVD 1XTGB 4UV8A 1GKFA 4PI0A 1HWYA 1PNKA 2XASA 1K9MW 2IDBA 2LXBA 1EQ7A 1KB9F 3ETGA 3V4WA 1V9PA 5IYDO 3LW5J 2FB5A 3HE5B 3OAKA 4WWIA 1IZNB 1M1JB 1S5LX 2Q8VA 4FIPC 2QWOB 3WMM0 4RUFA 5LHIA 2E43A 1K5QA 3HRNA 4L74A 4X1KB 2A45I 1HBWA 5AW2B 1HP8A 3D71A 2EILB 3D6ZA 2FFDB 2M7WA 1SERA 1AVMA 4IIJB 2W6BA 1VQ4P 3G6BA 3V2RA 4DR6O 4DUZO 1YI2P 4DV6O 1RE4C 1KFNA 1BHBA 4DV5B 2AHYA 5CCGD 3HTKB 4FFBB 3L74J 5KKZC 3B8NA 5CMZA 3CXHI 3ZRWB 2E74D 1HVVA 3VQXA 5CCHC 1USDA 3H1KJ 5APQA 5AG2A 1TA8A 3K79A 2V1DA 4EKWA 3DTUB 3HB3B 5FNVB 2RH0A 4DV2B 4XDLA 3K5BA 1P84E 4R6ZA 3G71V 2C2AA 4LFCB 1JY2P 2J59M 3Q5PA 2XAHA 3IJ4A 3N4XA 1AR5A 2Q6AA 3UO2A 4A5UB 1Q6HA 3C1LA 4M3LA 3LNMB 1URQA 1Y4MA 3W7SA 2D2CB 2B87A 1JMKC 2JK5C 3B5NA 5IYZA 1XNQO 3CLQA 3A7OA 1PL5A 4BIZA 2P7JA 1XHZA 1X9VA 2EJ7A 5K1XA 4MSWC 2L35A 3H1JG 1IFPA 1NTZG 1GO3F 3SR2C 2KLUA 2FYUG 5JCOC 1RF1B 1EDJA 2E3CA 5B5EZ 4F6EA 1MSDA 3FB6C 4JI6O 3M0AA 4DR5B 1WN7A 5B5EH 1N86A 3IAOA 3SYCA 2HODB 2QM4A 2Q3IA 1MFZA 4GX1A 1KD1Q 5B1AC 4Z1VA 1VF7A 3V2PA 2IH3C 3CD6P 4OXSA 2IH1C 2XT9A 3UKMA 2IU3A 3D6YA 4KHPO 3IC7A 4A7PA 4DK1A 2QJKB 1XILA 5C93A 3I55P 1PKXA 1LTJA 1JUNA 1ZMEC 5EYPA 1QLNA 1HNXB 4DJGA 3BA8A 2OGUA 1BSHA 1H0TB 2L6LA 1JY3O 4FK5C 3U1CA 1N7SB 1JX9A 3M99B 2XTAA 1N8RQ 1CPYA 1DEEG 3KPEA 5KAIE 1IBMO 3I5CA 3RYIB 1FZCA 2IJIA 2KXPB 3L70J 4IYHA 2R3CA 2YXLA 3SPGA 1P84D 1QCEA 4O4LB 2XU6A 1IC2A 3KHUA 1QX8A 1Q43A 5JJNB 3CCJP 1GL2B 3HE4A 1WB7A 1DTOA 3TGUH 1FJGO 4Y28J 4B3MB 3TDKA 1NH4A 1GN6A 4YIPA 1S76D 2X0LA 1FD9A 3FXEA 1LNQA 5CCGA 1YQ4C 1OCRC 1GH6A 3A3YB 5EZYA 5CB4A 1PL4A 5L3BA 5LMNB 4LF4B 1KORA 1L4AD 1AP5A 1LWUC 1CI6B 3H9VA 2OTKE 2BCCE 2QSAA 2Q4PA 2WLNA 3U0ZA 1BDCA 5AVVB 3ASNC 4JYCA 1LUVA 1WRGA 2MJZA 4DV1B 1Q82W 2YXQB 4ASUG 5JWPA 1PP9E 3AE7C 1JOCA 4H37A 3HD7C 1GDTA 4WFGA 2Y9YA 5B66E 4WY4D 2Q5ZA 4DV4B 3KQGA 1B06A 1H2LA 1WPXA 2Y69C 4CS2A 3ICXA 4YJ2A 1BE3E 2QM7A 1EZVI 2WMMA 3JAKB 1GMJA 2GUZB 3CC7P 1KBHA 4DCKA 1NVOA 2I1JA 4MN4C 4TV9A 1B3QA 3FB7C 3FFQA 4D7TA 4YHHO 2AHZA 2YEVB 1R73A 1NU1G 2VS0A 2QRXA 1VQMP 3HKEB 2HYNA 3STZC 4J9YB 3CCSV 3AG7A 2ILMA 3SPJA 3SSUA 4EFEA 3L4FA 4Z1MG 2OYIC 3CCUP 3RK2B 5B66H 3AECC 1EDKA 1AR4A 1XQ8A 2J5UA 4HAMA 2ZINA 1FAFA 3M9QA 1VQNP 1FJKA 1M1KW 3OEEG 2IX7C 1FFXA 4UCSA 2EIJB 5L3FA 3CXHE 1KYOH 1QL1A 2L91A 1RE3C 4DR2B 3J81N 3CXHF 4MTGA 3CX5E 4JAAA 2BCCD 5CCHD 2BCCJ 1XNRB 2X6BA 2UUBO 4X62B 1RFYA 1VQ9V 4MVSA 3W7XA 5APXA 3AE9C 4I55B 4O2BA 2OYHA 4IFMA 2QVAA 1THZA 5DECA 4DV0B 1PP9D 5AW4B 2IU0A 2A9HA 2XV5A 1SQFA 4U7JA 1V55C 3T97B 1A32A 1BL8A 5TISZ 1YITV 2C9NY 3H1HG 3A0BZ 4LF5O 4DR6B 4DUZB 5DM6V 3MTUE 4DV6B 5APYA 3ETEA 3T1CA 1BE3D 2IBZG 5AW0B 5TISH 1L4AA 2JDIH 4DR1O 1OV9A 4QPKA 3A0BH 3GB7C 1A02F 2PUSA 4YTPC 3UIAA 2BEZF 2QDOA 1WA8B 3ZRXA 4JI8B 1FBMA 2ATKC 2IZ0A 3L72J 1SQBK 4LNUB 3JASA 2IM9A 3BCCH 2UUAB 1S2EA 3CP1A 4PDRA 3ABTA 3CX5H 3NTNA 1BCCE 3Q4HB 3H25A 2Q67A 1FOSF 3SDLA 4R50A 4HB1A 5KHGA 4WY4A 3FAVA 2JGUA 1OW6A 5AVRB 1AILA 3R66A 1Q81W 2JJLA 3O8ZA 4AI8A 2FL4A 2ODMA 2ZT9B 1FS0E 2WA4A 3BATA 3ZN1A 1FZAA 3PN1A 2XAQA 3F7VC 3JATA 2BASA 2N04A 4X1YA 1F4NA 5KLVK 2DWEC 3CWBE 4LWSA 3G4SP 3BCCD 3CX5D 2A79B 2NN4A 4O4HB 4AHCA 2M5AB 2QJ1A 2RN9A 1JOYA 2ARHA 2Y0IA 1BGYE 1BCCH 1KZUB 2P6JA 3ZJZA 4HYTB 1W0JG 3HUSA 1VQ4V 4GIFA 1YI2V 1B04A 1YJNP 5CBHA 3X2QB 4JTDB 3K3WA 4RQFA 2VRSA 2DN9A 1W59A 2K37A 1JY3P 5BMVB 2VWJA 1A02J 5LYJA 2Q68A 3AE4C 4JYAO 1Q7YQ 4LF7O 1COWG 5CCHA 4QNHB 2JWDA 2O01J 4X88A 1SQVG 3ABLB 3QO7A 1LTTC 1CEZA 4LFBB 1DEBA 2YDEA 1IBMB 1BCCD 1VQ7P 3A0RA 2WLKA 1JTHB 3JD3A 3JCUE 3RK3B 4D6TG 1BGYH 3VQWA 3HD7D 1E5WA 2KP8A 2CTPA 1QNMA 1FJGB 1R6KA 1I94O 2R3SA 3ETQA 1JR9A 4KP4A 1KC8W 3UT5B 5HFLA 1EZVE 2KIKA 2CGOA 1S1CX 3FX0A 1XMOO 4AQRD 1AJQA 2ADPA 3H1LE 4Y99C 3H01A 3TNUB 3OW2O 3CWBD 2ZM6O 1NTZH 4N78E 3CWBJ 4UB8E 4ZMDA 3KCYA 4X1IB 1NTKJ 5LMUB 4HH2A 2CE4A 2JEXA 2DYRC 3M8AA 1Q5OA 2YICA 3CD6V 3AEEC 3C8VA 1PIXA 2NRGA 1BGYD 1VF5D 1FXKC 2MKVA 3E1IA 4Q6GA 2IJJA 1S5LE 2N9YB 3RL0B 4NPFX 3TK1A 3K5MA 3EWKA 1J5EO 3FB8C 3SGIA 3AG2C 2ZXWB 4X66O 1J1EC 1NVPB 2KS1B 1QLEB 1AQTA 4OGQB 4PI2A 2FXMA 3L73J 3NFQA 3SYAA 1NTMJ 4PJ0Z 1R5SA 3GWKC 4KHXA 1RPRA 4I0XA 4PJ0H 2LFRA 3N2GA 3GHGC 3LSUA 4X65B 1JCHA 4OPHA 3CMAP 2BTOA 2Z3YA 1KN7A 1HUCA 4I6MC 2GA1A 3NXSA 4QIWF 1QEXA 1ZV8A 4ZKUA 3DXRB 1DF5A 1VL2A 1NTZK 2FYUK 4H13B 3E2EA 4TV8B 3UM7A 1EZVD 4EB6B 3NR7A 1RHZB 1ZLZA 3K57A 1URQC 1X22A 1W2BO 1AB3A 1YHQP 1LWUA 3H1LD 2OCHA 1XTCC 1MA1A 3CCRP 5AW8B 2EIMC 1I0HA 1L2PA 1ZXGA 3II6A 2DWDC 1P49A 4N78D 3AE1C 4GYCB 3ZRSA 3PRJA 5AW1B 1SP4A 2D3OW 3HD7A 4PHZA 3VMZA 3VMYA 4JYBA 1WPBA 1Q3EA 3D3QA 4RWUA 4J7JA 2FKXA 1ZTEA 1OHHG 4ZKPA 3CC7V 5AW9B 1KECA 2Y0PA 2VQEB 4H0LC 2ZYGA 1N36O 4PELA 2PP6A 1M56B 2LGWA 4UCOA 4JI1O 2AZ0A 2ZE7A 2JGDA 4OPAA 3ABMB 4U7OA 1UJWB 1VQMV 4G2KA 3BRTB 4DXWA 2ZD9A 3CCVP 2EULA 1EN6A 3A2FA 4O4JA 3RYHB 3AG1C 3CCUV 1RQUA 1ZRTE 1CP9A 1NH2D 3VQVA 1ZSPA 4I4TB 1VARA 3WU2Z 2NR5A 2I1KA 2CGNA 4FJCC 5B1BC 4GX2A 2W83C 3TGUG 1Q2NA 2ZIOA 2FXPA 3W7TA 2FFDC 4U3FH 1TUBA 4C7NA 3ZMTA 1VMGA 1JY2O 4TUYB 1L0NH 1YVWA 2VQFB 3BABA 2KQXA 3F5TA 2UXCB 4B3SB 3E89A 1LT9C 3WUUA 1RE3A 2ZDIC 2A3QA 3K5NA 2E74C 2B5UA 1DX7A 5CA1A 3GMAA 4NTWA 4JI3B 1I5YA 2HLDG 3E7KA 4F4LA 2GTSA 3APQA 3RGBA 1VQ8P 4PD4E 4R4MA 3SYQA 1PV3A 3KZIE 3J7AU 2K9JB 1NS1A 4CPGA 2KNCA 2P58A 2BTQA 5C39A 3EQ2A 5BY1A 1SS3A 5L3EA 3RBZA 2QE7H 1L0LJ 4KUMA 3BHPA 4UB6Z 1T8ZA 1SQQH 1PFIA 3CCLP 3TSIA 2YIDA 1YTFD 2UXBB 4UB6H 3VQYA 4ZHQA 1XI1A 1KILB 4O4IA 1K7DA 2EBOA 4I7ZC 2YXHA 4LF8B 3CRAA 1OWAA 3FB5C 1L0NK 1ZRTD 1M93A 4PD4H 2Y0DA 2PAJA 1I94B 1OIPA 1PP9G 3KZIH 3CCEP 1HGZA 2PYJA 1KQFB 2WLLB 2DQ0A 1OW7A 5LGTA 2RN0A 2Q7CA 4C46A 1M90W 4FLUA 3AEBC 4NB5A 1BE3G 2LGQA 1K97A 1GMGA 2N1TC 1CXZB 1LTBC 2XAJA 3UCSC 1N4CA 2QA4P 5LA6B 1U7MA 2J58A 3K58A 3RYFB 1FKAO 2LJ2A 5GTHE 1YJNV 2R44A 3ZHUA 1N32B 5KUKA 4MVUA 1DF4A 3V2QA 4PD4D 4H33A 4W4KA 1SQQK 3HPLC 1K5SA 1JNMA 1OCCB 4WFBV 4PV1C 3BPZA 2DMXA 1J5EB 4O2AA 4JI2O 2E76D 2WSFJ 4X66B 5EIBC 1SETA 4NVPA 4NYKA 2F95B 1DD3A 4MT8A 5LXTA 2JDIG 1JEKA 1CZQA 3L74E 3G67A 2ZQMA 1K73W 1VQ7V 1SF9A 3CE2A 3O6QA 4X20A 3H1KE 1FDOA 1AROP 4CC6A 1XMQB 3BCCG 1EN5A 2K3RA 3LIDA 2BSKA 5GTHH 3CRMA 1RSOA 5KUMA 3G3ZA 1E1RG 3BFRA 1OCZB 4GKJB 1K04A 2B87B 4LH7A 3B5NB 5APWA 2GHYA 1R6TA 1Z5VA 1XEQA 3HKCA 2B1IA 4H0LD 2A06E 2ZR3A 3D3IA 3ZHSA 5E79E 5FPOA 4JF7A 2CH7A 4DYLA 1WP7A 1BHAA 1JJ2U 3WG7B 3JAMN 4BRYA 1M57B 1R3LC 4UCTA 4JI0O 1KB9E 3CL3D 2LKMA 3AG4B 4UV9A 3ZHQA 1PPJE 3G9RA 3J80N 2GUSA 3WUVA 2OT5A 1VQKV 1IVSA 1OJHA 1HR0O 2IPPA 2HPCA 4KXRA 1FXKA 3HKDA 3CJHB 3N2KB 2YXYA 1BCCG 1NYHA 1NAFA 1NT2B 2UXDO 3AEFC 4JV5O 1FXVA 1OW8A 2M0BA 3T1YO 4N23A 3HUSC 2OIEA 2BE3A 1N73C 1SQVK 4K0KO 4CH4A 3Q5SA 2Q9IA 5B3SB 3H1IE 4I50B 1LTJB 4LR3A 5EYPB 4W7YA 1FS0G 4WFHA 2P4KA 2FY8A 2NPSB 1KQSO 3L74D 2QKCA 3O65A 3Q2YA 1SESA 4OX9B 3CMAV 3Q1MA 1QVFU 3H1KD 1FZCB 3ABKC 4FLVA 1KB9H 3GHGA 1DLBA 5CBGA 1ORQC 1W0KG 3AEIA 1PGOA 2WLHA 4UCUA 3L70E 3EXAA 5AW6B 3HE4B 3ZMUA 2YKQA 1VQOV 5AVYB 1BGYG 4XE5B 2YIUB 1XHXA 3FD9A 2ITAA 2VWKA 3LDDA 1YQ3C 2NZ2A 3P3NA 2RCVA 4PA7A 1YZBA 5EZYB 2CPSA 3A0HE 5CB4B 2KSJA 4IL6E 3CCRV 3C90A 2A06D 1K9MQ 2NLJC 1P7BA 1G2CB 3PLNA 3CHXA 1ZWIC 5LP6B 3OUSA 3RFRA 1KB9D 1Y6XA 1SQXE 5KTBA 1PPJD 1DGSA 1J1DB 3RGUA 5H6QA 2EINB 4YY3O 2CPBA 3BVHA 1IBKB 2IJHA 2LQTA 5CJ4A 3L9DA 1MUUA 5LL6Y 3ITKA 3L70H 2V7QG 3S3XA 1ZR2A 4YJ2B 4RUEA 4TOIA 1P84H 4FZ1A 2PI5A 1SC5B 2Z5UA 3U11A 2ZYAA 3BAAA 3ASOB 1VF6C 2XUMA 1USEA 3RW0A 3H1IJ 3CCVV 1AA0A 2W6AA 4B86A 4JPRA 2ZT9C 2H7HA 4UVAA 3G6EP 3OAAG 4RQEA 3CSXA 3T1HO 4TV9B 1M4UA 3MDSA 2N1TD 5APUA 1V54B 4FLWA 1BQZA 1FFTB 3H1LG 1IK9A 2QKAA 4ASVA 3D8CA 1RQVA 4B3RO 2YO2A 2XNXA 4GLXA 1I5XA 2JEUA 3SFDC 1J95A 5J9PC 2YSUB 1N7SD 5DEDA 3L70D 2HKOA 1EDIA 2OQQA 3JCZA 2C9LY 4PV1D 3BEHA 3OMAB 1FFXB 1R1BA 4IHJA 2QEXP 4YXWH 2FFDA 3AG3C 5EIBD 4G27B 2WQYC 1H8HG 3KDPB 1LT9A 3PTZA 1ENVA 3QO8A 1N0JA 2ZDIA 1JVMA 4ABMA 1XL6A 2QG4A 4EI2A 2JJ2G 3TJTA 3SYOA 4LLHA 1PNMA 3ZRWA 3OE7G 1E79G 5F2VO 1GU5A 1QGKB 3MD0A 3K08A 1SQXD 3VMAA 3VMXA 2OYHB 1KQLA 1SQXJ 5KAIZ 3JALA 3M9HA 3OM3B 2E75C 4NXNO 2B9ZA 3DC6A 4C7UA 1YIJP 4EDFA 3SJQC 5KAIH 1JCDA 1JFFA 2W8ZA 3VOUA 5BU8B 1L4AB 3CCLV 5J2TB 1MZEA 2R9AA 3KKYA 2G3AA 4JI7B 1GRJA 2HR3A 1PM9A 1MSWD 1UPGA 3EHBB 1GN4A 1GM9A 3LSQA 3JASB 3SJAC 1JMBA 1KKDA 3L72E 3MP7B 2L5GB 4HJGH 2E5LO 1AI4A 1HNWB 3JD2A 1UIIA 4WY4B 2BCCH 1GN2A 2ZE5A 4N3YB 3FAVB 2PGDA 3BY6A 1N34O 4KL1A 3SPCA 1VF5C 2OCCC 1K3EA 2ZXEB 3E83A 3I56V 4F6RB 3JD1A 2EIKC 1PNLA 5B66Z 2LR2A 2OARA 1PP9H 3RN4A 5AVQB 2EX3A 5BR8O 2C0XA 3Q3DA 3JATB 1SS1A 4X1YB 3OTFA 1X4TA 1VQLP 1KYOF 4U3FG 1CSBA 4LWSB 2N1TA 4WFFA 1BE3H 2YI8A 3K04A 2QJYC 1L0NG 4X8AA 4DT0A 3IAYA 4J41A 4X89A 1Q82Q 5CBNA 5GONB 2JO1A 2Q7GA 1YTZT 1N7SA 2DOSA 4JTAB 1IXMA 2QM8A 1LP1A 4ICGA 4PDLA 3RYIA 4CZZA 2W27A 1Y74A 5GW7A 1F51A 4L76A 2OWOA 4L87A 1HJ0A 2WSCJ 2A45H 3L75E 1H8AA 3R65A 1G6UA 5KKZB 1YCIA 1W2BU 3CRQA 1OZHA 1EM1A 4DK0A 1YEWA 2QE7G 5CMUA 2ZVNB 4LF9O 1SQQG 3CCMP 3B77A 5C8YA 1K8AW 1JPXA 3L72D 5IY5C 4LFAO 3CXHH 4QGPA 1JO5A 1YDXA 4JASA 1T2KC 1FOSE 3E8BA 1SQBJ
chains in the Genus database with same CATH topology
1GMJA 4H13B 2E75B 1JB0J 3Q5PA 3RK3E 3Q5SA 2G8YA 4I7ZC 1KTMA 2WSEJ 3AEDC 4IL6X 1UIXA 4H13C 3Q5RA 2E75C 2K9YA 1ZOYC 2D2CB 1AJYA 3Q2YA 1HF9A 1TU3F 3AE1C 2ZT9D 1KQFB 1PL5A 3Q1MA 2E76B 1OW7A 3AE4C 4YXDC 2D2CC 4H0LB 3AEBC 2G3AA 2O01J 2E76C 3AECC 2WPVB 2J5UA 3AE2C 4XFJA 3IAOA 4H44B 1YQ3C 4H0LC 2NZ2A 4Z1MH 3D70A 3R4YA 3AEAC 1VF5B 4PV1B 4OGQD 1IK7A 5KLIC 3D6YA 3S9OA 2YIUC 2FBWC 4H44C 3AE8C 4RKUJ 2YMKA 1VF5C 4PV1C 4KT0J 1R8EA 3AE9C 2E76D 2WSFJ 1OMIA 1S1CX 1ZMEC 1K05A 3GLMA 2QJKC 1EXJA 3Q3DA 1DD3A 1RQUA 1ZRTE 3AE3C 1Q90D 4U7JA 1ZP0C 3AE6C 3AE5C 3T97B 1KMIZ 2FYNC 2QJPC 1KQGB 3RL0g 3O6QA 2QJYC 4H13D 2E75D 3GF3A 2BEQD 2FXPA 3C8VA 3GF7A 2E74B 1FDOA 3AEEC 1PIXA 3SFEC 2IDBA 1DD4A 4YTPC 1VF5D 2BEZF 4GDOA 2JO1A 3LW5J 2MKVA 2V7QJ 4Y28J 2ZT9C 2D2CD 1S5LX 2E74C 3GMAA 1MKMA 3EWKA 5L8RJ 2H88C 1YQ4C 3H25A 1K04A 2P10A 2QIWA 1EXIA 1U57A 3D71A 1KORA 3D6ZA 1WMKA 2WSCJ 1HJ0A 4H0LD 5M1BA 4R4MA 4OGQB 1RQVA 1PV3A 1OW6A 3IN6A 3SFDC 3ABVC 2JP3A 1Y9BA 2ZT9B 4H44D 2OQQA 4OGQC 4R4LA 5KKZC 3AE7C 4TT3H 4PV1D 2E74D 3G9RA 2QSIA 1NGMB 1DIPA 2H89C 2WQYC 1NYHA 4I7ZB 3AEGC 3B71A 3AEFC 1KILE 1FDIA 1VL2A 1OW8A 3FGAD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZRT E;  1Q90 D;  2WPV B;  4H13 B;  2WSC J;  2E75 B;  1JB0 J;  4OGQ B;  2FYN C;  2QJP C;  4H44 B;  2WSE J;  2QJY C;  1VF5 B;  4PV1 B;  4IL6 X;  3C8V A;  2E74 B;  2ZT9 B;  5KLI C;  2K9Y A;  2D2C B;  2YIU C;  5KKZ C;  3LW5 J;  2E76 B;  4Y28 J;  4RKU J;  2QSI A;  4KT0 J;  1S5L X;  2WSF J;  4H0L B;  5L8R J;  4I7Z B;  2QIW A;  2O01 J;  2QJK C; 
#chains in the Genus database with same CATH topology
 2OTL P;  2Y0E A;  1SQP E;  3RK3 E;  4FPP A;  2G8Y A;  1SRY A;  3N27 A;  4J80 A;  1RM1 C;  5LGN A;  1AQ5 A;  1XNQ B;  3JAW A;  3L36 A;  2GUZ A;  1ZUQ A;  2ZT9 D;  1J2J B;  2JR8 A;  1WT6 A;  1S72 P;  4CH6 A;  1LTA C;  3KXD A;  1H89 A;  4JI5 O;  1TGO A;  3CXH D;  2A0L A;  2F43 G;  1NTK E;  5KLV J;  5B1A B;  4JI6 B;  2UU9 O;  2WPV B;  5APV A;  2YEV A;  4GX0 A;  3HKE A;  5LOV A;  1WB8 A;  1NAY A;  2ZKO A;  1N73 A;  4QE7 A;  2BOB C;  3FYE B;  4J11 A;  4KHP B;  3L75 D;  5K1P A;  4NR1 A;  4H44 C;  3L75 J;  4TQD A;  2AW9 A;  2DYS C;  2HJF C;  3ML0 A;  3M9B A;  2YI9 A;  1OX3 A;  3L73 E;  4I0X B;  1NTM E;  1W5C E;  1OMI A;  3JSN A;  5IYB O;  4ZOL A;  2IZ1 A;  3A5T A;  3F5H A;  4GOF A;  2KZJ A;  3CWB H;  5KLI B;  4NXM O;  2JEE A;  1NTK H;  4TT3 G;  3I5D A;  2WLI A;  3K0G A;  3OEH G;  1Q81 Q;  3TF5 A;  2E75 D;  1F23 A;  2IBZ I;  1MV8 A;  1SQP D;  3L71 J;  3MHH C;  4GKK O;  3RK3 D;  4ZKI A;  1OCR B;  1SQP J;  1LTS C;  5BVZ A;  2WPS A;  3T97 A;  2MK3 A;  4DR7 O;  1O9G A;  3DGE A;  1LWU B;  3H1J E;  5KX5 B;  1YJW P;  2HG5 C;  2PY5 A;  2FYU E;  3WB1 A;  3BAS A;  2QIW A;  3ASN B;  2ZVO B;  3S3W A;  3L73 H;  4UFZ A;  1WMK A;  1NTM H;  4W80 A;  3L74 G;  1ZLL A;  3ZIA G;  4UCR A;  1MOF A;  3HD7 B;  1NTK D;  4J9Z B;  3H1K G;  5JQG A;  3JCU Z;  3A2A A;  1GN3 A;  2JKV A;  2Y69 B;  4GOE A;  1JY2 N;  2WPR A;  3AK3 A;  2V7Q H;  1NGM B;  3JCU H;  2QKS A;  2HHH O;  2AEM A;  3RVZ A;  2H89 C;  2WVR A;  3I55 V;  2RNB A;  1VF6 A;  4E4E A;  3B40 A;  1M7L A;  2JGD B;  3T4Z A;  3B71 A;  3UQ8 A;  3OTO O;  4LF6 O;  3FGA D;  3CI9 A;  2QWP B;  3B8E B;  5JVD B;  1EZV H;  3L73 D;  1NTM D;  1LR1 A;  1AP6 A;  5IJ0 A;  1NVP D;  4O4J B;  1FJP A;  2JS5 A;  1SFC C;  4UVB A;  4JYY A;  3H1L H;  3OGI B;  4MVO A;  1IFN A;  4UB8 Z;  2WLM A;  2POH A;  4YHH B;  5KMG A;  3CPW U;  5H2F E;  4DUY O;  1ZR4 A;  1AJY A;  1QR8 A;  4UB8 H;  2XND H;  3CCJ V;  2OYI B;  1OCO C;  3MHV A;  2F1M A;  2DW4 A;  1KC8 Q;  4JI4 O;  1L8D A;  1ZL8 A;  2UUC O;  3CB2 A;  1S5L Z;  2Q6Q A;  1TUB B;  1KP3 A;  3ZED A;  4BW9 A;  4C7N B;  2E76 C;  1S3J A;  2B88 A;  1S5L H;  3BRC A;  4PA9 A;  3H1J D;  2E5T A;  3H1J J;  1Q86 Q;  2GM4 A;  5BMV A;  5CA1 B;  2W0X A;  2Y4T A;  1NTZ J;  2FYU J;  4N21 A;  4HNA A;  1MAB G;  3HKB A;  3ZN0 A;  2ZNI A;  1R3J C;  4JF3 A;  3C3T A;  1E79 H;  1YIJ V;  1VQ5 P;  2Y4U A;  2KI7 B;  3ZRV A;  1RP3 B;  2UUB B;  4RKU J;  1V55 B;  1T2K D;  1Y76 A;  5H2F H;  5L3G A;  4YJ3 A;  3IC9 A;  2KNC B;  2B1G A;  4CH3 A;  1R3I C;  1K05 A;  3L70 G;  3VP9 A;  3OA7 A;  1FZB A;  4BIO A;  5CA0 B;  3G71 P;  4JAU A;  2F4V O;  3JD4 A;  2QJP C;  2Y48 A;  4LF5 B;  1YXB A;  3D36 A;  3LDC A;  3QG5 A;  1L0L E;  4DR1 B;  4EEQ A;  5A9G A;  4ZHQ B;  5AVT B;  2KSD A;  3V6I A;  4O4I B;  3C9I A;  1NU1 E;  3LW5 H;  5BU5 A;  3H32 B;  4GT1 A;  4X1I A;  1YYC A;  5KAF E;  3E8F A;  2WAM A;  5JH7 A;  4MTO A;  2YUA A;  1M1J C;  1JA8 A;  3QO5 A;  1VQN V;  2HLO A;  1MFT A;  1Z5W A;  4WBA A;  1WJZ A;  3M06 A;  4YXW G;  4JZG A;  2EIL C;  1Y9B A;  2PZS A;  3PP5 A;  4H44 D;  1Q6U A;  4I1L A;  1VQP P;  1JCC A;  5IWA O;  1TVK A;  1BQ0 A;  1L0L H;  1WP8 A;  3P8C E;  4JGS A;  3BVO A;  5AVW B;  1Y8A A;  2FXO A;  4QE9 A;  1NH2 B;  3FWN A;  3AEG C;  2JVD A;  2M3B A;  1RH5 B;  2WA3 A;  3B4S A;  1EZJ A;  3ZBH A;  2IYP A;  2YC0 A;  4MVM A;  4LFC O;  1RPO A;  4EFB A;  2GV9 A;  3K06 A;  2IJK A;  2AXT E;  2QTS A;  2IBZ E;  2WSE J;  4XBF A;  1AI7 A;  4U3J A;  1BSM A;  1Z2G A;  5IJ9 B;  4QJF B;  1Y67 A;  2WT7 A;  4MVZ A;  3CXC U;  5LXT B;  1S77 D;  3CCM V;  1GD2 E;  3O6Q B;  2ZFC A;  4FVM A;  4JZ2 A;  2K9P A;  1L0L D;  4EB6 A;  2HG5 D;  2A7W A;  4JYA B;  3JSV C;  4LF7 B;  1OZ0 A;  2D2C C;  1NU1 D;  3RYC A;  3AK1 A;  1NU1 J;  2BSK B;  2CUG A;  1FZF A;  4CC5 A;  3EVK A;  4DR5 O;  4Z2W A;  4XFJ A;  3TCU A;  2BCC G;  4OWF A;  1G1I A;  1RF1 C;  2P5O A;  2WPQ A;  1XUQ A;  3KZI Z;  1CW5 A;  4GKK B;  2LP7 A;  2YXR B;  3HKC B;  2FBW C;  3SJC C;  2F66 C;  5KA5 A;  1S72 V;  3EFG A;  4Y99 B;  3E35 A;  2WSF H;  3P7K A;  4JTC B;  4R7C A;  4BRY B;  2EZP A;  2JWA A;  3G4S V;  1XMO B;  3VP8 A;  4RES B;  2QJK C;  3P8C D;  3AK2 A;  2DYR B;  3OMN B;  3AE5 C;  5KHH A;  2KOG A;  2WSS H;  2ZM6 B;  1SFC D;  3SWF A;  1FXK B;  3HKD B;  2XAG A;  4GX5 A;  5LGU A;  3L72 G;  5TJH A;  2XDJ A;  1MG1 A;  3V5B A;  1N7S C;  4O9B A;  1DD4 A;  3AG2 B;  2HFE C;  3SWK A;  3WUT A;  5FPR A;  1J1E B;  3H1H J;  2G38 A;  4I4T A;  4NTX A;  2X7R B;  1QBZ A;  4B3M O;  1FAV A;  2A45 G;  1SZT A;  1MKM A;  5AW3 B;  4GOD A;  1SQV E;  1GL2 C;  4DR3 O;  4UCV A;  2Q1K A;  3W7U A;  4LF4 O;  1OVV A;  1K33 A;  1QQC A;  1AR1 B;  3GHG B;  1NR1 A;  5GTI E;  3CC4 P;  4AUW A;  3ABV C;  1URF A;  4AYC A;  4MVQ A;  5JJE B;  4FLX A;  1YSC A;  1IJD B;  4D6T E;  2N9B A;  3FKS G;  4DUY B;  2LXC B;  1K4C C;  5GTH Z;  2Z0A A;  2Y9Z A;  1IBL O;  1HGV A;  3T2M A;  4CH5 A;  5BXZ A;  1IUR A;  4TT3 H;  2AEF A;  2CK3 H;  3FWL A;  2JIZ G;  4RAI A;  1PGP A;  4FM1 A;  4N6J A;  1DIP A;  1YJW V;  2UUC B;  2QWQ B;  2P2U A;  3MGN A;  5ITZ A;  1H2G A;  2CTR A;  3LDE A;  2Q73 A;  2K9J A;  5DJU B;  1URQ B;  3K9A A;  4GUN A;  3USS A;  1LJ2 A;  4WBN A;  2OIG A;  5IYZ B;  4HYO A;  2FTK A;  1SA0 A;  2X6A A;  1YIT P;  1WAZ A;  2EIM B;  4RJT A;  1JY3 N;  1UFI A;  1AVO A;  1K34 A;  3QF7 A;  2CAZ C;  3RVY A;  4XDJ A;  1UIX A;  3L74 H;  3WB2 A;  3W67 A;  2OTJ P;  4DO2 A;  3BRV B;  3JYC A;  2ZE8 A;  4RO2 A;  2PTM A;  3H1K H;  5FL7 G;  4NPE A;  2V4H A;  1KUQ A;  2Q3E A;  1FYJ A;  4H0L B;  3L37 A;  2KG7 A;  3E22 A;  3VN0 A;  3UO3 A;  2CDY A;  4U7N A;  2O3J A;  1Q8I A;  2RKL A;  1KYO I;  1N36 B;  4QMA A;  4JPZ B;  1K73 Q;  4JI1 B;  5E79 Z;  1QVG O;  3ZMV A;  3JD0 A;  3RK2 C;  1SQV J;  1IK7 A;  2A06 H;  2HEP A;  4DR2 O;  3P30 A;  2ITD C;  2Q7E A;  1U96 A;  1SFC A;  2ZYD A;  5E79 H;  1NJI Q;  3AG1 B;  2EIJ C;  4IT5 A;  5LA6 A;  5J2U A;  1N2D C;  4OVN F;  2NPS D;  4FLZ A;  1XNR O;  2KB7 P;  4D6T D;  4X62 O;  3ZHT A;  3RYF A;  2Y0C A;  4D6T J;  2WZ7 A;  1T3U A;  3CWB G;  4L75 A;  1NTK G;  4DRX A;  1PPJ H;  2JJ1 G;  3GLM A;  2AXC A;  5B1B B;  4DV0 O;  4OH8 B;  3OUF A;  1EXJ A;  1Q90 D;  4HKZ H;  4IHJ B;  5L3D A;  2HVJ C;  1R3K C;  5CHX A;  1KD1 W;  3P3P A;  1LT9 B;  1I7F A;  4GCZ A;  2KK7 A;  4IGG A;  1YHQ V;  3THO A;  2E74 B;  2XZR A;  3P8M C;  5IWA B;  2R32 A;  2H3O A;  1VQ5 V;  4BAY A;  4HBN A;  3H1I H;  4GDO A;  2Q0O C;  1BSN A;  4JI8 O;  3CX5 I;  3OD4 A;  2R5B A;  3GVM A;  1OFC X;  2D2C D;  3L73 G;  2BOC C;  1NTM G;  4ASW A;  4UUJ C;  3JAL B;  4BWA A;  5B5E E;  2FYN B;  2UUA O;  5IT9 N;  1FDM A;  1AJP A;  1NKN A;  3TXQ A;  4EYY Q;  4X9Q A;  2WPD G;  1U57 A;  2P1J A;  3IR9 A;  1ROP A;  3CCQ P;  1JFF B;  3ZDM A;  2IFM A;  1AJN A;  3T4D A;  1P84 F;  1N8R W;  4I9Q A;  3CME P;  2Q9L A;  3MHS C;  5KHI A;  3B2E E;  1GU4 A;  3C3S A;  3E1R A;  1IXB A;  3U10 A;  1RF0 C;  3JAR A;  3A0H Z;  4IL6 Z;  3GWO A;  3M0D A;  3SPI A;  3H1I D;  3NMD A;  1NBM G;  3VBB A;  3OFN G;  2N74 A;  3A0H H;  2W6J H;  4IL6 H;  1EZV G;  1VPC A;  4PA3 A;  4I7Z B;  4ZI7 A;  2C0W A;  1VIB A;  3VTP C;  2ZNJ A;  2QWN B;  1SQX H;  4I9W A;  5H6R A;  1G1X B;  3GG2 A;  3HE5 A;  3TGU E;  2XND G;  3N2K A;  3CJH A;  1M1J A;  1MNG A;  1I08 A;  2HFE D;  1VQP V;  4DR4 O;  2YNY A;  1RY3 A;  4X1K A;  1R5L A;  1G8M A;  2QWR B;  2O1J A;  2N1T B;  1D5N A;  1HW7 A;  4WB4 A;  3IFM A;  2ITC C;  4I50 A;  3X2Q C;  1H8E G;  4IIJ A;  1GL2 D;  1FPO A;  4GZR B;  3KG2 A;  5EBM C;  1LT1 A;  1GM7 A;  4FZ0 A;  1PD3 A;  2ZCE A;  3OT7 A;  2NPS A;  1NO4 A;  2KSE A;  4HZ3 A;  1X8Y A;  3HTK A;  4FFB A;  5AW5 B;  1VQ8 V;  1LP1 B;  4LFB O;  2WWW A;  4MVR A;  2K1E A;  3QWO C;  3R4Y A;  2QR4 A;  4O2B B;  3U59 A;  2KKW A;  4PV1 B;  1Y74 B;  4J42 A;  3ABL C;  1LTI C;  5KLI C;  4LGD E;  2V4D A;  5FNV A;  3V2N A;  3HR0 A;  3RK3 C;  3PH0 A;  2CTQ A;  1IDS A;  4JI2 B;  1NWQ A;  1W2E A;  2R5D A;  4DR3 B;  1G1J A;  1SQX K;  3AE3 C;  1DH3 A;  3D36 C;  5C8Y B;  4C7R A;  1ZP0 C;  3F89 A;  3B09 A;  3OW2 U;  1O9H A;  1JMM A;  1G2C A;  2ZE6 A;  3RL0 g;  1OXZ A;  5LMU O;  5LP6 A;  2BEQ D;  1X59 A;  1IBL B;  1HWT C;  1BZK A;  1RF1 A;  3CCE V;  1SQB E;  4R8C A;  4LH6 A;  1GTO A;  1GAX A;  3TGU D;  4XDK A;  1E1Q G;  3TGU J;  4DOJ A;  3RWR D;  2RJZ A;  2E5Y A;  3CRC A;  2HOD A;  1U7J A;  1BS3 A;  2IFN A;  2ETN A;  2GSM B;  1FU1 A;  1XRE A;  1EC5 A;  3JAW B;  3GW6 A;  2WSC H;  5B1O A;  2SPZ A;  2R9I A;  1KYO E;  4B3T O;  3FX7 A;  2O1K A;  2QA4 V;  3RL0 C;  1VP7 A;  2Q69 A;  4B7E A;  3RK2 D;  4BXL A;  2XHB A;  4X64 O;  3S1K A;  2ZXW C;  4BWN A;  1L0L G;  1EDL A;  2ZAE B;  2VRZ A;  3TYY A;  1QLE C;  1VQ6 P;  4JI0 B;  4OGQ C;  2JRI A;  1D2D A;  5KLV E;  1L1F A;  2Q7H A;  2DJV A;  4X65 O;  1S0V A;  2W6I G;  5LOV B;  1H0T A;  3L72 H;  2YIA A;  4PDM A;  1LUW A;  3K03 A;  3QTC A;  1HR0 B;  3HUS B;  1N73 B;  4J7Z A;  4DV3 O;  2Q5U A;  1SQB H;  2UXD B;  2RDC A;  4JV5 B;  4YPC A;  1IFJ A;  4IFD K;  1N7L A;  5K5G B;  5TIS E;  3T1Y B;  1T6A A;  1IX9 A;  4O4L A;  3A0B E;  1K4D C;  4K0K B;  1SVF A;  2P22 C;  1EFR G;  2AGA A;  2RMZ A;  1LTG C;  1GL2 A;  3CC4 V;  3IFX A;  2ZJS E;  5LYJ B;  3P32 A;  4CS3 A;  1EN4 A;  2GTA A;  4JAV A;  4MW3 A;  4ZOL B;  3ABK B;  4H13 C;  3BCC E;  4DZO A;  4DW0 A;  2KLV A;  1P7G A;  3CX5 F;  1K92 A;  2IW5 A;  2WLI B;  3E86 A;  1QVF O;  1CI6 A;  1XOU A;  2KZI A;  3MAQ A;  4TSF G;  5KLV H;  1AI6 A;  4YIO A;  1PP9 J;  1SQB D;  5DN6 G;  5AVS B;  1SLQ A;  4P2Z A;  3CC2 P;  3AE2 C;  3L71 E;  2UXX A;  3F7Y C;  4AQY O;  2GUV A;  2W90 A;  2VQE O;  1M1K Q;  3D70 A;  1BE3 J;  3A8T A;  1PV0 A;  4MTF A;  5J2T A;  1XDC A;  1M5I A;  1KYO D;  3L75 H;  1F4M A;  4DV7 O;  4J10 A;  5LHG A;  1KU9 A;  3B8M A;  2OTJ V;  3JAK A;  5CN0 A;  1M56 C;  3AE8 C;  4I2L C;  2K88 A;  1Q7Y W;  2WSS G;  4E2L A;  4AIL C;  3ETD A;  5JQG B;  5KLV D;  2O01 H;  3EFF K;  3ABM C;  1X0T A;  4YY3 B;  4UXN A;  1DK1 A;  3AE6 C;  2P67 A;  3LSS A;  2QTO A;  1HNZ O;  1KQG B;  3H6P A;  4BIU A;  1TUE B;  4K3A A;  3JC2 2;  1T5E A;  3MUD C;  2GBO A;  4F6R A;  4P9O A;  4CS4 A;  3L71 H;  1Z56 A;  1GK6 A;  1SQP H;  3CS5 A;  1HH0 A;  5IJ0 B;  2VQF O;  1YTZ I;  1K8A Q;  2UXC O;  1HJB A;  4B3S O;  2N05 A;  2KYV A;  2FYZ A;  5D5Q A;  3T1H B;  1H88 A;  1P4R A;  2X6C A;  2H94 A;  1FE6 A;  1M9N A;  4LC1 A;  4WFE A;  5KMG B;  3BCC J;  5L8R J;  1EXI A;  4JI3 O;  3N2G B;  3IF4 A;  1YJ9 P;  5GON A;  3SWY A;  4B3R B;  3LNN A;  2AZ2 A;  2Q0A A;  2PRR A;  1ZL8 B;  5LHH A;  2CK3 G;  3QH9 A;  1AVY A;  2JP3 A;  5KJ7 C;  3AG3 B;  4I55 A;  4DR4 B;  1JM0 A;  1GZL A;  3L71 D;  5KHJ A;  1RE4 A;  2AEJ A;  4FMT A;  2F93 B;  4HNA B;  1YBK A;  3HKB B;  1GW3 A;  3PHL A;  1S5J A;  3WB0 A;  1NTZ E;  2LW7 A;  2UXB O;  4XA4 A;  4I5S A;  2WLJ A;  3CCQ V;  2H8P C;  3ZMS A;  5CA3 A;  1FC2 C;  2YMY A;  2E75 B;  2YIB D;  1Y76 B;  5E1A C;  3CME V;  5EC1 C;  1WA8 A;  4YJ3 B;  1SQP K;  1BCC J;  1H2N A;  4PD4 I;  2EJR A;  2NNU A;  1KTM A;  4LNU A;  1IZ3 A;  3AED C;  4IL6 X;  4QPJ A;  4LF8 O;  2UXN A;  2P4V A;  4FM0 A;  1KIL C;  4NXN B;  1ZN5 A;  3Q4H A;  1NQT A;  1HF9 A;  1TU3 F;  2Z5H A;  3M7M X;  5CJ0 A;  1RF0 A;  1MZF A;  4YXD C;  1ZW0 A;  3G6E V;  1Q6I A;  3K9S A;  2E42 A;  2WIT A;  4DW1 A;  1GTW A;  2XAF A;  1NTK K;  3RL0 D;  4PJ0 E;  1YF2 A;  5JCO A;  2PI4 A;  3H1J H;  1Q86 W;  3WFV A;  2A06 G;  4WF9 V;  1KP2 A;  3O9O A;  2FYU H;  4WCE V;  1KFM A;  5IDJ A;  4CBC A;  4W4L A;  1QLE D;  2E5L B;  1VF5 B;  2OCC B;  4OGQ D;  1GW4 A;  1PGQ A;  2DQ3 A;  1N32 O;  1AFO A;  3S9O A;  2ADQ B;  2EIK B;  2LFS A;  5JH7 B;  1D7M A;  4O4H A;  1BGY J;  2M5A A;  1N34 B;  2B89 A;  1PPJ G;  2FKW B;  1VQK P;  3ZX6 A;  2QEX V;  2YMK A;  3DSQ A;  3MIW A;  1NI8 A;  1R8E A;  4K8X A;  5EBW C;  2H43 A;  2YO3 A;  2FML A;  4W7Z A;  1QHT A;  1NTM K;  5BR8 B;  2QJY B;  1TVK B;  5APT A;  4B3T B;  5LBQ A;  2M6Y A;  3W68 A;  1OCC C;  1FZE A;  4P9P A;  3JSL A;  4X64 B;  2KUB A;  1NTZ D;  3V4Q A;  2HVK C;  1HDJ A;  3H1I G;  2FYU D;  4H13 D;  4TQF A;  4P30 A;  3OMI B;  3E8H A;  1XMQ O;  3SFE C;  5AW7 B;  5H2F Z;  2V7Q J;  4U3J B;  4DV3 B;  3K0D A;  1N33 O;  2WT7 B;  1H2S B;  1IO4 A;  2PGG A;  4Q20 A;  2BTQ B;  4GKJ O;  1AV1 A;  1JTH A;  1VQO P;  2RMK B;  1OCZ C;  5H9C A;  3W7W A;  3IN6 A;  3B5N C;  1F7Y A;  1QU7 A;  5KX5 A;  3UT5 A;  3RYC B;  3L35 A;  1Y47 A;  4GKG A;  3H1L J;  5IY5 B;  4LF9 B;  3RBX A;  4L8J A;  4G28 B;  2W6J G;  3M0D C;  4TLF A;  4R4L A;  2YIB A;  1S4X A;  1M56 D;  4EIJ A;  2HP8 A;  2R9R B;  4B08 A;  3TNU A;  3WG7 C;  4LFA B;  2QGN A;  1M57 C;  1ZAU A;  1SKV A;  5FLX N;  4MTX A;  1SQX G;  3AG4 C;  1KIL E;  3RT3 C;  2YKP A;  4LP8 A;  1OVU A;  2ZXX A;  3WU2 E;  1HTL C;  2YS8 A;  4AQY B;  1RM1 B;  4U3F E;  2MW2 B;  1JB0 J;  1VQL V;  2WSE H;  3VOP A;  5HFM A;  1QVG U;  1JQ0 A;  3E8G A;  4UVC A;  1L0N E;  3CRR A;  2ZIM A;  3BA9 A;  5EC2 C;  4DV7 B;  5KA6 A;  1VQ6 V;  1N0N A;  3Q5R A;  1KQS U;  4D7S A;  1ZOY C;  4DV5 O;  1B6Q A;  4K8Z A;  4FLT A;  5B3S C;  3R2P A;  1KB9 I;  4FLY A;  3CEI A;  4OX9 O;  5JVD A;  1LTJ C;  1NKZ B;  2KS1 A;  5AVX B;  4JI5 B;  2JS3 A;  4BW5 A;  2Z4E A;  2KB1 A;  2OYO A;  2NPS C;  1NU1 H;  5H5N A;  1S9K E;  4KFM A;  1VEW A;  2YKO A;  2UU9 B;  4PDV A;  2XKM A;  3FYI B;  2EZO A;  4PA6 A;  1HNZ B;  2P7T C;  1VDF A;  2K1A A;  5KAF Z;  4DV2 O;  3OR6 C;  2UWJ E;  1FZC C;  2P90 A;  2OYI A;  3ZHV A;  4H44 B;  3ZCC A;  2I8D A;  3H1H E;  4Z1M H;  4O2A B;  2DYS B;  5KJ7 D;  3WU2 H;  3SPH A;  3AEA C;  5KAF H;  1FZG A;  3K59 A;  1SQQ E;  3DXR A;  1WNS A;  2YIU C;  2M3E A;  1ZX3 A;  3TXS A;  1TAE A;  1NOH A;  5L3C A;  2B9B A;  4UB6 E;  5CCG C;  2LO1 A;  1QR9 A;  3G80 A;  1NKD A;  1BDD A;  2DE0 X;  4TV8 A;  4ZNC A;  3ZHR A;  4X20 B;  5B1N A;  2H8P D;  3ZS8 C;  3CC2 V;  5BZB A;  3LIE A;  2OTL V;  3FXD A;  1KMI Z;  1R6N A;  4NXM B;  2FYN C;  1RSO B;  1IBK O;  5LP6 C;  5KHK A;  4PD4 F;  1OVR A;  5ITZ B;  2CTW A;  1P84 I;  4B7K A;  1KIL D;  2AXT Z;  4J7K A;  1J1D C;  3STL C;  2EIN C;  3GF7 A;  4WBN B;  1L0L K;  4JQ0 D;  1SA0 B;  2F23 A;  4U3F D;  3H1H H;  1IFI A;  2PFX A;  5CA0 A;  3S4R A;  1T3J A;  2AXT H;  4NTY A;  4U3F J;  2IBZ H;  4DR7 B;  1NU1 K;  1L0N D;  2CH7 B;  1H38 A;  1L0N J;  1Y66 A;  4FFK A;  1YTF B;  3OGC C;  2DW3 A;  4ZIB A;  3N7N A;  2H88 C;  2P10 A;  2IYO A;  3ASO C;  3K5L A;  1HNX O;  1PL0 A;  2PF4 E;  1GK9 A;  5EFW B;  5M1B A;  1NR7 A;  2GDS A;  2P06 A;  1G4Y B;  2HPC B;  3H32 A;  1H2M A;  3OJA B;  1GM8 A;  1V54 C;  3QNE A;  3APO A;  3M91 A;  1S9K D;  1JJO A;  4PA4 A;  2KG7 B;  3E22 B;  5AVU B;  4BR6 A;  3RYH A;  2WTY A;  1SQB G;  3MUD A;  1MMM A;  3ABU A;  3H1H D;  2M8R A;  1H2K A;  3K5O A;  2HHH B;  4K35 A;  1BMF G;  3CYO A;  1MZ9 A;  2IBZ D;  2QSI A;  1D5A A;  5APS A;  5IE9 A;  4LCU C;  3I56 P;  1PZQ A;  3CCS P;  1SQQ D;  4LBE C;  2OYQ A;  1AI5 A;  1SQQ J;  3OTO B;  4LF6 B;  1FDI A;  1SFC B;  1PGJ A;  3MZW B;  5J2U B;  4IOI H;  5A2Q N;  1YJ9 V;  5LMN O;  5CBO A;  1EBO A;  2R72 A;  1WLE A;  4MS2 A;  4TUY A;  2LW1 A;  1LGH B;  3U1A A;  5EBL C;  4KJM A;  1OCO B;  2HJD A;  4DRX B;  1KV4 A;  4NKG B;  3DC5 A;  2K9Y A;  3LUT B;  5EK0 A;  3TET A;  5KLV G;  1US6 A;  3CPW O;  4DV1 O;  4MW8 A;  5CBF A;  2OYH C;  4FM2 A;  5KJ7 A;  4WFA V;  2E76 B;  4RO0 A;  1FXH A;  1GK4 A;  5DJT B;  4ZBM A;  4EOT A;  2Z5I A;  4NPD A;  1VQ9 P;  3QVN A;  4JI4 B;  1M8O B;  4DV4 O;  1M90 Q;  4TWK A;  5IJ9 A;  4JBZ A;  4JI7 O;  3SJB C;  1XBL A;  3PJS K;  1NHL A;  1L4A C;  1URQ D;  4IYI A;  3B5N D;  3L75 G;  3F5W C;  4L73 A;  1XL4 A;  1SQV H;  3IGA C;  5GTI Z;  2O57 A;  1NJI W;  1HNW O;  5AVZ B;  1BT8 A;  3SYP A;  5GTI H;  1S5H C;  4WVZ A;  1KIL A;  1M57 D;  4D6T H;  1U97 A;  4KT0 J;  1N33 B;  1NZ6 A;  2QJP B;  2O01 N;  2R70 A;  4WY4 C;  1X79 B;  3ZMZ A;  1QL2 A;  2RQ6 A;  5IYC O;  2W0F C;  3JAR B;  1IFM A;  5D5P A;  3OR7 C;  5JJJ B;  1SZX A;  4IFF A;  2ZR2 A;  1KKC A;  3KCX A;  2F4V B;  3L71 G;  1SQP G;  2WLL A;  3VYI A;  3KYQ A;  2PYL A;  1IFD A;  4ZI7 B;  1SQG A;  3GF3 A;  2XOK G;  1SQV D;  1XTG B;  4UV8 A;  1GKF A;  4PI0 A;  1HWY A;  1PNK A;  2XAS A;  1K9M W;  2IDB A;  2LXB A;  1EQ7 A;  1KB9 F;  3ETG A;  3V4W A;  1V9P A;  5IYD O;  3LW5 J;  2FB5 A;  3HE5 B;  3OAK A;  4WWI A;  1IZN B;  1M1J B;  1S5L X;  2Q8V A;  4FIP C;  2QWO B;  3WMM 0;  4RUF A;  5LHI A;  2E43 A;  1K5Q A;  3HRN A;  4L74 A;  4X1K B;  2A45 I;  1HBW A;  5AW2 B;  1HP8 A;  3D71 A;  2EIL B;  3D6Z A;  2FFD B;  2M7W A;  1SER A;  1AVM A;  4IIJ B;  2W6B A;  1VQ4 P;  3G6B A;  3V2R A;  4DR6 O;  4DUZ O;  1YI2 P;  4DV6 O;  1RE4 C;  1KFN A;  1BHB A;  4DV5 B;  2AHY A;  5CCG D;  3HTK B;  4FFB B;  3L74 J;  5KKZ C;  3B8N A;  5CMZ A;  3CXH I;  3ZRW B;  2E74 D;  1HVV A;  3VQX A;  5CCH C;  1USD A;  3H1K J;  5APQ A;  5AG2 A;  1TA8 A;  3K79 A;  2V1D A;  4EKW A;  3DTU B;  3HB3 B;  5FNV B;  2RH0 A;  4DV2 B;  4XDL A;  3K5B A;  1P84 E;  4R6Z A;  3G71 V;  2C2A A;  4LFC B;  1JY2 P;  2J59 M;  3Q5P A;  2XAH A;  3IJ4 A;  3N4X A;  1AR5 A;  2Q6A A;  3UO2 A;  4A5U B;  1Q6H A;  3C1L A;  4M3L A;  3LNM B;  1URQ A;  1Y4M A;  3W7S A;  2D2C B;  2B87 A;  1JMK C;  2JK5 C;  3B5N A;  5IYZ A;  1XNQ O;  3CLQ A;  3A7O A;  1PL5 A;  4BIZ A;  2P7J A;  1XHZ A;  1X9V A;  2EJ7 A;  5K1X A;  4MSW C;  2L35 A;  3H1J G;  1IFP A;  1NTZ G;  1GO3 F;  3SR2 C;  2KLU A;  2FYU G;  5JCO C;  1RF1 B;  1EDJ A;  2E3C A;  5B5E Z;  4F6E A;  1MSD A;  3FB6 C;  4JI6 O;  3M0A A;  4DR5 B;  1WN7 A;  5B5E H;  1N86 A;  3IAO A;  3SYC A;  2HOD B;  2QM4 A;  2Q3I A;  1MFZ A;  4GX1 A;  1KD1 Q;  5B1A C;  4Z1V A;  1VF7 A;  3V2P A;  2IH3 C;  3CD6 P;  4OXS A;  2IH1 C;  2XT9 A;  3UKM A;  2IU3 A;  3D6Y A;  4KHP O;  3IC7 A;  4A7P A;  4DK1 A;  2QJK B;  1XIL A;  5C93 A;  3I55 P;  1PKX A;  1LTJ A;  1JUN A;  1ZME C;  5EYP A;  1QLN A;  1HNX B;  4DJG A;  3BA8 A;  2OGU A;  1BSH A;  1H0T B;  2L6L A;  1JY3 O;  4FK5 C;  3U1C A;  1N7S B;  1JX9 A;  3M99 B;  2XTA A;  1N8R Q;  1CPY A;  1DEE G;  3KPE A;  5KAI E;  1IBM O;  3I5C A;  3RYI B;  1FZC A;  2IJI A;  2KXP B;  3L70 J;  4IYH A;  2R3C A;  2YXL A;  3SPG A;  1P84 D;  1QCE A;  4O4L B;  2XU6 A;  1IC2 A;  3KHU A;  1QX8 A;  1Q43 A;  5JJN B;  3CCJ P;  1GL2 B;  3HE4 A;  1WB7 A;  1DTO A;  3TGU H;  1FJG O;  4Y28 J;  4B3M B;  3TDK A;  1NH4 A;  1GN6 A;  4YIP A;  1S76 D;  2X0L A;  1FD9 A;  3FXE A;  1LNQ A;  5CCG A;  1YQ4 C;  1OCR C;  1GH6 A;  3A3Y B;  5EZY A;  5CB4 A;  1PL4 A;  5L3B A;  5LMN B;  4LF4 B;  1KOR A;  1L4A D;  1AP5 A;  1LWU C;  1CI6 B;  3H9V A;  2OTK E;  2BCC E;  2QSA A;  2Q4P A;  2WLN A;  3U0Z A;  1BDC A;  5AVV B;  3ASN C;  4JYC A;  1LUV A;  1WRG A;  2MJZ A;  4DV1 B;  1Q82 W;  2YXQ B;  4ASU G;  5JWP A;  1PP9 E;  3AE7 C;  1JOC A;  4H37 A;  3HD7 C;  1GDT A;  4WFG A;  2Y9Y A;  5B66 E;  4WY4 D;  2Q5Z A;  4DV4 B;  3KQG A;  1B06 A;  1H2L A;  1WPX A;  2Y69 C;  4CS2 A;  3ICX A;  4YJ2 A;  1BE3 E;  2QM7 A;  1EZV I;  2WMM A;  3JAK B;  1GMJ A;  2GUZ B;  3CC7 P;  1KBH A;  4DCK A;  1NVO A;  2I1J A;  4MN4 C;  4TV9 A;  1B3Q A;  3FB7 C;  3FFQ A;  4D7T A;  4YHH O;  2AHZ A;  2YEV B;  1R73 A;  1NU1 G;  2VS0 A;  2QRX A;  1VQM P;  3HKE B;  2HYN A;  3STZ C;  4J9Y B;  3CCS V;  3AG7 A;  2ILM A;  3SPJ A;  3SSU A;  4EFE A;  3L4F A;  4Z1M G;  2OYI C;  3CCU P;  3RK2 B;  5B66 H;  3AEC C;  1EDK A;  1AR4 A;  1XQ8 A;  2J5U A;  4HAM A;  2ZIN A;  1FAF A;  3M9Q A;  1VQN P;  1FJK A;  1M1K W;  3OEE G;  2IX7 C;  1FFX A;  4UCS A;  2EIJ B;  5L3F A;  3CXH E;  1KYO H;  1QL1 A;  2L91 A;  1RE3 C;  4DR2 B;  3J81 N;  3CXH F;  4MTG A;  3CX5 E;  4JAA A;  2BCC D;  5CCH D;  2BCC J;  1XNR B;  2X6B A;  2UUB O;  4X62 B;  1RFY A;  1VQ9 V;  4MVS A;  3W7X A;  5APX A;  3AE9 C;  4I55 B;  4O2B A;  2OYH A;  4IFM A;  2QVA A;  1THZ A;  5DEC A;  4DV0 B;  1PP9 D;  5AW4 B;  2IU0 A;  2A9H A;  2XV5 A;  1SQF A;  4U7J A;  1V55 C;  3T97 B;  1A32 A;  1BL8 A;  5TIS Z;  1YIT V;  2C9N Y;  3H1H G;  3A0B Z;  4LF5 O;  4DR6 B;  4DUZ B;  5DM6 V;  3MTU E;  4DV6 B;  5APY A;  3ETE A;  3T1C A;  1BE3 D;  2IBZ G;  5AW0 B;  5TIS H;  1L4A A;  2JDI H;  4DR1 O;  1OV9 A;  4QPK A;  3A0B H;  3GB7 C;  1A02 F;  2PUS A;  4YTP C;  3UIA A;  2BEZ F;  2QDO A;  1WA8 B;  3ZRX A;  4JI8 B;  1FBM A;  2ATK C;  2IZ0 A;  3L72 J;  1SQB K;  4LNU B;  3JAS A;  2IM9 A;  3BCC H;  2UUA B;  1S2E A;  3CP1 A;  4PDR A;  3ABT A;  3CX5 H;  3NTN A;  1BCC E;  3Q4H B;  3H25 A;  2Q67 A;  1FOS F;  3SDL A;  4R50 A;  4HB1 A;  5KHG A;  4WY4 A;  3FAV A;  2JGU A;  1OW6 A;  5AVR B;  1AIL A;  3R66 A;  1Q81 W;  2JJL A;  3O8Z A;  4AI8 A;  2FL4 A;  2ODM A;  2ZT9 B;  1FS0 E;  2WA4 A;  3BAT A;  3ZN1 A;  1FZA A;  3PN1 A;  2XAQ A;  3F7V C;  3JAT A;  2BAS A;  2N04 A;  4X1Y A;  1F4N A;  5KLV K;  2DWE C;  3CWB E;  4LWS A;  3G4S P;  3BCC D;  3CX5 D;  2A79 B;  2NN4 A;  4O4H B;  4AHC A;  2M5A B;  2QJ1 A;  2RN9 A;  1JOY A;  2ARH A;  2Y0I A;  1BGY E;  1BCC H;  1KZU B;  2P6J A;  3ZJZ A;  4HYT B;  1W0J G;  3HUS A;  1VQ4 V;  4GIF A;  1YI2 V;  1B04 A;  1YJN P;  5CBH A;  3X2Q B;  4JTD B;  3K3W A;  4RQF A;  2VRS A;  2DN9 A;  1W59 A;  2K37 A;  1JY3 P;  5BMV B;  2VWJ A;  1A02 J;  5LYJ A;  2Q68 A;  3AE4 C;  4JYA O;  1Q7Y Q;  4LF7 O;  1COW G;  5CCH A;  4QNH B;  2JWD A;  2O01 J;  4X88 A;  1SQV G;  3ABL B;  3QO7 A;  1LTT C;  1CEZ A;  4LFB B;  1DEB A;  2YDE A;  1IBM B;  1BCC D;  1VQ7 P;  3A0R A;  2WLK A;  1JTH B;  3JD3 A;  3JCU E;  3RK3 B;  4D6T G;  1BGY H;  3VQW A;  3HD7 D;  1E5W A;  2KP8 A;  2CTP A;  1QNM A;  1FJG B;  1R6K A;  1I94 O;  2R3S A;  3ETQ A;  1JR9 A;  4KP4 A;  1KC8 W;  3UT5 B;  5HFL A;  1EZV E;  2KIK A;  2CGO A;  1S1C X;  3FX0 A;  1XMO O;  4AQR D;  1AJQ A;  2ADP A;  3H1L E;  4Y99 C;  3H01 A;  3TNU B;  3OW2 O;  3CWB D;  2ZM6 O;  1NTZ H;  4N78 E;  3CWB J;  4UB8 E;  4ZMD A;  3KCY A;  4X1I B;  1NTK J;  5LMU B;  4HH2 A;  2CE4 A;  2JEX A;  2DYR C;  3M8A A;  1Q5O A;  2YIC A;  3CD6 V;  3AEE C;  3C8V A;  1PIX A;  2NRG A;  1BGY D;  1VF5 D;  1FXK C;  2MKV A;  3E1I A;  4Q6G A;  2IJJ A;  1S5L E;  2N9Y B;  3RL0 B;  4NPF X;  3TK1 A;  3K5M A;  3EWK A;  1J5E O;  3FB8 C;  3SGI A;  3AG2 C;  2ZXW B;  4X66 O;  1J1E C;  1NVP B;  2KS1 B;  1QLE B;  1AQT A;  4OGQ B;  4PI2 A;  2FXM A;  3L73 J;  3NFQ A;  3SYA A;  1NTM J;  4PJ0 Z;  1R5S A;  3GWK C;  4KHX A;  1RPR A;  4I0X A;  4PJ0 H;  2LFR A;  3N2G A;  3GHG C;  3LSU A;  4X65 B;  1JCH A;  4OPH A;  3CMA P;  2BTO A;  2Z3Y A;  1KN7 A;  1HUC A;  4I6M C;  2GA1 A;  3NXS A;  4QIW F;  1QEX A;  1ZV8 A;  4ZKU A;  3DXR B;  1DF5 A;  1VL2 A;  1NTZ K;  2FYU K;  4H13 B;  3E2E A;  4TV8 B;  3UM7 A;  1EZV D;  4EB6 B;  3NR7 A;  1RHZ B;  1ZLZ A;  3K57 A;  1URQ C;  1X22 A;  1W2B O;  1AB3 A;  1YHQ P;  1LWU A;  3H1L D;  2OCH A;  1XTC C;  1MA1 A;  3CCR P;  5AW8 B;  2EIM C;  1I0H A;  1L2P A;  1ZXG A;  3II6 A;  2DWD C;  1P49 A;  4N78 D;  3AE1 C;  4GYC B;  3ZRS A;  3PRJ A;  5AW1 B;  1SP4 A;  2D3O W;  3HD7 A;  4PHZ A;  3VMZ A;  3VMY A;  4JYB A;  1WPB A;  1Q3E A;  3D3Q A;  4RWU A;  4J7J A;  2FKX A;  1ZTE A;  1OHH G;  4ZKP A;  3CC7 V;  5AW9 B;  1KEC A;  2Y0P A;  2VQE B;  4H0L C;  2ZYG A;  1N36 O;  4PEL A;  2PP6 A;  1M56 B;  2LGW A;  4UCO A;  4JI1 O;  2AZ0 A;  2ZE7 A;  2JGD A;  4OPA A;  3ABM B;  4U7O A;  1UJW B;  1VQM V;  4G2K A;  3BRT B;  4DXW A;  2ZD9 A;  3CCV P;  2EUL A;  1EN6 A;  3A2F A;  4O4J A;  3RYH B;  3AG1 C;  3CCU V;  1RQU A;  1ZRT E;  1CP9 A;  1NH2 D;  3VQV A;  1ZSP A;  4I4T B;  1VAR A;  3WU2 Z;  2NR5 A;  2I1K A;  2CGN A;  4FJC C;  5B1B C;  4GX2 A;  2W83 C;  3TGU G;  1Q2N A;  2ZIO A;  2FXP A;  3W7T A;  2FFD C;  4U3F H;  1TUB A;  4C7N A;  3ZMT A;  1VMG A;  1JY2 O;  4TUY B;  1L0N H;  1YVW A;  2VQF B;  3BAB A;  2KQX A;  3F5T A;  2UXC B;  4B3S B;  3E89 A;  1LT9 C;  3WUU A;  1RE3 A;  2ZDI C;  2A3Q A;  3K5N A;  2E74 C;  2B5U A;  1DX7 A;  5CA1 A;  3GMA A;  4NTW A;  4JI3 B;  1I5Y A;  2HLD G;  3E7K A;  4F4L A;  2GTS A;  3APQ A;  3RGB A;  1VQ8 P;  4PD4 E;  4R4M A;  3SYQ A;  1PV3 A;  3KZI E;  3J7A U;  2K9J B;  1NS1 A;  4CPG A;  2KNC A;  2P58 A;  2BTQ A;  5C39 A;  3EQ2 A;  5BY1 A;  1SS3 A;  5L3E A;  3RBZ A;  2QE7 H;  1L0L J;  4KUM A;  3BHP A;  4UB6 Z;  1T8Z A;  1SQQ H;  1PFI A;  3CCL P;  3TSI A;  2YID A;  1YTF D;  2UXB B;  4UB6 H;  3VQY A;  4ZHQ A;  1XI1 A;  1KIL B;  4O4I A;  1K7D A;  2EBO A;  4I7Z C;  2YXH A;  4LF8 B;  3CRA A;  1OWA A;  3FB5 C;  1L0N K;  1ZRT D;  1M93 A;  4PD4 H;  2Y0D A;  2PAJ A;  1I94 B;  1OIP A;  1PP9 G;  3KZI H;  3CCE P;  1HGZ A;  2PYJ A;  1KQF B;  2WLL B;  2DQ0 A;  1OW7 A;  5LGT A;  2RN0 A;  2Q7C A;  4C46 A;  1M90 W;  4FLU A;  3AEB C;  4NB5 A;  1BE3 G;  2LGQ A;  1K97 A;  1GMG A;  2N1T C;  1CXZ B;  1LTB C;  2XAJ A;  3UCS C;  1N4C A;  2QA4 P;  5LA6 B;  1U7M A;  2J58 A;  3K58 A;  3RYF B;  1FKA O;  2LJ2 A;  5GTH E;  1YJN V;  2R44 A;  3ZHU A;  1N32 B;  5KUK A;  4MVU A;  1DF4 A;  3V2Q A;  4PD4 D;  4H33 A;  4W4K A;  1SQQ K;  3HPL C;  1K5S A;  1JNM A;  1OCC B;  4WFB V;  4PV1 C;  3BPZ A;  2DMX A;  1J5E B;  4O2A A;  4JI2 O;  2E76 D;  2WSF J;  4X66 B;  5EIB C;  1SET A;  4NVP A;  4NYK A;  2F95 B;  1DD3 A;  4MT8 A;  5LXT A;  2JDI G;  1JEK A;  1CZQ A;  3L74 E;  3G67 A;  2ZQM A;  1K73 W;  1VQ7 V;  1SF9 A;  3CE2 A;  3O6Q A;  4X20 A;  3H1K E;  1FDO A;  1ARO P;  4CC6 A;  1XMQ B;  3BCC G;  1EN5 A;  2K3R A;  3LID A;  2BSK A;  5GTH H;  3CRM A;  1RSO A;  5KUM A;  3G3Z A;  1E1R G;  3BFR A;  1OCZ B;  4GKJ B;  1K04 A;  2B87 B;  4LH7 A;  3B5N B;  5APW A;  2GHY A;  1R6T A;  1Z5V A;  1XEQ A;  3HKC A;  2B1I A;  4H0L D;  2A06 E;  2ZR3 A;  3D3I A;  3ZHS A;  5E79 E;  5FPO A;  4JF7 A;  2CH7 A;  4DYL A;  1WP7 A;  1BHA A;  1JJ2 U;  3WG7 B;  3JAM N;  4BRY A;  1M57 B;  1R3L C;  4UCT A;  4JI0 O;  1KB9 E;  3CL3 D;  2LKM A;  3AG4 B;  4UV9 A;  3ZHQ A;  1PPJ E;  3G9R A;  3J80 N;  2GUS A;  3WUV A;  2OT5 A;  1VQK V;  1IVS A;  1OJH A;  1HR0 O;  2IPP A;  2HPC A;  4KXR A;  1FXK A;  3HKD A;  3CJH B;  3N2K B;  2YXY A;  1BCC G;  1NYH A;  1NAF A;  1NT2 B;  2UXD O;  3AEF C;  4JV5 O;  1FXV A;  1OW8 A;  2M0B A;  3T1Y O;  4N23 A;  3HUS C;  2OIE A;  2BE3 A;  1N73 C;  1SQV K;  4K0K O;  4CH4 A;  3Q5S A;  2Q9I A;  5B3S B;  3H1I E;  4I50 B;  1LTJ B;  4LR3 A;  5EYP B;  4W7Y A;  1FS0 G;  4WFH A;  2P4K A;  2FY8 A;  2NPS B;  1KQS O;  3L74 D;  2QKC A;  3O65 A;  3Q2Y A;  1SES A;  4OX9 B;  3CMA V;  3Q1M A;  1QVF U;  3H1K D;  1FZC B;  3ABK C;  4FLV A;  1KB9 H;  3GHG A;  1DLB A;  5CBG A;  1ORQ C;  1W0K G;  3AEI A;  1PGO A;  2WLH A;  4UCU A;  3L70 E;  3EXA A;  5AW6 B;  3HE4 B;  3ZMU A;  2YKQ A;  1VQO V;  5AVY B;  1BGY G;  4XE5 B;  2YIU B;  1XHX A;  3FD9 A;  2ITA A;  2VWK A;  3LDD A;  1YQ3 C;  2NZ2 A;  3P3N A;  2RCV A;  4PA7 A;  1YZB A;  5EZY B;  2CPS A;  3A0H E;  5CB4 B;  2KSJ A;  4IL6 E;  3CCR V;  3C90 A;  2A06 D;  1K9M Q;  2NLJ C;  1P7B A;  1G2C B;  3PLN A;  3CHX A;  1ZWI C;  5LP6 B;  3OUS A;  3RFR A;  1KB9 D;  1Y6X A;  1SQX E;  5KTB A;  1PPJ D;  1DGS A;  1J1D B;  3RGU A;  5H6Q A;  2EIN B;  4YY3 O;  2CPB A;  3BVH A;  1IBK B;  2IJH A;  2LQT A;  5CJ4 A;  3L9D A;  1MUU A;  5LL6 Y;  3ITK A;  3L70 H;  2V7Q G;  3S3X A;  1ZR2 A;  4YJ2 B;  4RUE A;  4TOI A;  1P84 H;  4FZ1 A;  2PI5 A;  1SC5 B;  2Z5U A;  3U11 A;  2ZYA A;  3BAA A;  3ASO B;  1VF6 C;  2XUM A;  1USE A;  3RW0 A;  3H1I J;  3CCV V;  1AA0 A;  2W6A A;  4B86 A;  4JPR A;  2ZT9 C;  2H7H A;  4UVA A;  3G6E P;  3OAA G;  4RQE A;  3CSX A;  3T1H O;  4TV9 B;  1M4U A;  3MDS A;  2N1T D;  5APU A;  1V54 B;  4FLW A;  1BQZ A;  1FFT B;  3H1L G;  1IK9 A;  2QKA A;  4ASV A;  3D8C A;  1RQV A;  4B3R O;  2YO2 A;  2XNX A;  4GLX A;  1I5X A;  2JEU A;  3SFD C;  1J95 A;  5J9P C;  2YSU B;  1N7S D;  5DED A;  3L70 D;  2HKO A;  1EDI A;  2OQQ A;  3JCZ A;  2C9L Y;  4PV1 D;  3BEH A;  3OMA B;  1FFX B;  1R1B A;  4IHJ A;  2QEX P;  4YXW H;  2FFD A;  3AG3 C;  5EIB D;  4G27 B;  2WQY C;  1H8H G;  3KDP B;  1LT9 A;  3PTZ A;  1ENV A;  3QO8 A;  1N0J A;  2ZDI A;  1JVM A;  4ABM A;  1XL6 A;  2QG4 A;  4EI2 A;  2JJ2 G;  3TJT A;  3SYO A;  4LLH A;  1PNM A;  3ZRW A;  3OE7 G;  1E79 G;  5F2V O;  1GU5 A;  1QGK B;  3MD0 A;  3K08 A;  1SQX D;  3VMA A;  3VMX A;  2OYH B;  1KQL A;  1SQX J;  5KAI Z;  3JAL A;  3M9H A;  3OM3 B;  2E75 C;  4NXN O;  2B9Z A;  3DC6 A;  4C7U A;  1YIJ P;  4EDF A;  3SJQ C;  5KAI H;  1JCD A;  1JFF A;  2W8Z A;  3VOU A;  5BU8 B;  1L4A B;  3CCL V;  5J2T B;  1MZE A;  2R9A A;  3KKY A;  2G3A A;  4JI7 B;  1GRJ A;  2HR3 A;  1PM9 A;  1MSW D;  1UPG A;  3EHB B;  1GN4 A;  1GM9 A;  3LSQ A;  3JAS B;  3SJA C;  1JMB A;  1KKD A;  3L72 E;  3MP7 B;  2L5G B;  4HJG H;  2E5L O;  1AI4 A;  1HNW B;  3JD2 A;  1UII A;  4WY4 B;  2BCC H;  1GN2 A;  2ZE5 A;  4N3Y B;  3FAV B;  2PGD A;  3BY6 A;  1N34 O;  4KL1 A;  3SPC A;  1VF5 C;  2OCC C;  1K3E A;  2ZXE B;  3E83 A;  3I56 V;  4F6R B;  3JD1 A;  2EIK C;  1PNL A;  5B66 Z;  2LR2 A;  2OAR A;  1PP9 H;  3RN4 A;  5AVQ B;  2EX3 A;  5BR8 O;  2C0X A;  3Q3D A;  3JAT B;  1SS1 A;  4X1Y B;  3OTF A;  1X4T A;  1VQL P;  1KYO F;  4U3F G;  1CSB A;  4LWS B;  2N1T A;  4WFF A;  1BE3 H;  2YI8 A;  3K04 A;  2QJY C;  1L0N G;  4X8A A;  4DT0 A;  3IAY A;  4J41 A;  4X89 A;  1Q82 Q;  5CBN A;  5GON B;  2JO1 A;  2Q7G A;  1YTZ T;  1N7S A;  2DOS A;  4JTA B;  1IXM A;  2QM8 A;  1LP1 A;  4ICG A;  4PDL A;  3RYI A;  4CZZ A;  2W27 A;  1Y74 A;  5GW7 A;  1F51 A;  4L76 A;  2OWO A;  4L87 A;  1HJ0 A;  2WSC J;  2A45 H;  3L75 E;  1H8A A;  3R65 A;  1G6U A;  5KKZ B;  1YCI A;  1W2B U;  3CRQ A;  1OZH A;  1EM1 A;  4DK0 A;  1YEW A;  2QE7 G;  5CMU A;  2ZVN B;  4LF9 O;  1SQQ G;  3CCM P;  3B77 A;  5C8Y A;  1K8A W;  1JPX A;  3L72 D;  5IY5 C;  4LFA O;  3CXH H;  4QGP A;  1JO5 A;  1YDX A;  4JAS A;  1T2K C;  1FOS E;  3E8B A;  1SQB J; 
#chains in the Genus database with same CATH homology
 1GMJ A;  4H13 B;  2E75 B;  1JB0 J;  3Q5P A;  3RK3 E;  3Q5S A;  2G8Y A;  4I7Z C;  1KTM A;  2WSE J;  3AED C;  4IL6 X;  1UIX A;  4H13 C;  3Q5R A;  2E75 C;  2K9Y A;  1ZOY C;  2D2C B;  1AJY A;  3Q2Y A;  1HF9 A;  1TU3 F;  3AE1 C;  2ZT9 D;  1KQF B;  1PL5 A;  3Q1M A;  2E76 B;  1OW7 A;  3AE4 C;  4YXD C;  2D2C C;  4H0L B;  3AEB C;  2G3A A;  2O01 J;  2E76 C;  3AEC C;  2WPV B;  2J5U A;  3AE2 C;  4XFJ A;  3IAO A;  4H44 B;  1YQ3 C;  4H0L C;  2NZ2 A;  4Z1M H;  3D70 A;  3R4Y A;  3AEA C;  1VF5 B;  4PV1 B;  4OGQ D;  1IK7 A;  5KLI C;  3D6Y A;  3S9O A;  2YIU C;  2FBW C;  4H44 C;  3AE8 C;  4RKU J;  2YMK A;  1VF5 C;  4PV1 C;  4KT0 J;  1R8E A;  3AE9 C;  2E76 D;  2WSF J;  1OMI A;  1S1C X;  1ZME C;  1K05 A;  3GLM A;  2QJK C;  1EXJ A;  3Q3D A;  1DD3 A;  1RQU A;  1ZRT E;  3AE3 C;  1Q90 D;  4U7J A;  1ZP0 C;  3AE6 C;  3AE5 C;  3T97 B;  1KMI Z;  2FYN C;  2QJP C;  1KQG B;  3RL0 g;  3O6Q A;  2QJY C;  4H13 D;  2E75 D;  3GF3 A;  2BEQ D;  2FXP A;  3C8V A;  3GF7 A;  2E74 B;  1FDO A;  3AEE C;  1PIX A;  3SFE C;  2IDB A;  1DD4 A;  4YTP C;  1VF5 D;  2BEZ F;  4GDO A;  2JO1 A;  3LW5 J;  2MKV A;  2V7Q J;  4Y28 J;  2ZT9 C;  2D2C D;  1S5L X;  2E74 C;  3GMA A;  1MKM A;  3EWK A;  5L8R J;  2H88 C;  1YQ4 C;  3H25 A;  1K04 A;  2P10 A;  2QIW A;  1EXI A;  1U57 A;  3D71 A;  1KOR A;  3D6Z A;  1WMK A;  2WSC J;  1HJ0 A;  4H0L D;  5M1B A;  4R4M A;  4OGQ B;  1RQV A;  1PV3 A;  1OW6 A;  3IN6 A;  3SFD C;  3ABV C;  2JP3 A;  1Y9B A;  2ZT9 B;  4H44 D;  2OQQ A;  4OGQ C;  4R4L A;  5KKZ C;  3AE7 C;  4TT3 H;  4PV1 D;  2E74 D;  3G9R A;  2QSI A;  1NGM B;  1DIP A;  2H89 C;  2WQY C;  1NYH A;  4I7Z B;  3AEG C;  3B71 A;  3AEF C;  1KIL E;  1FDI A;  1VL2 A;  1OW8 A;  3FGA D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...