4H0LB

Cytochrome b6f complex crystal structure from mastigocladus laminosus with n-side inhibitor nqno
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4h0lB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h0lB01
1ZRTE 2QIWA 2WSFJ 4IL6X 2ZT9B 2QJKC 4H44B 4KT0J 4PV1B 4Y28J 2WSCJ 2WSEJ 4H13B 1JB0J 2D2CB 2WPVB 4I7ZB 1Q90D 2YIUC 2QJPC 2E75B 2O01J 5KLIC 2K9YA 5L8RJ 2E74B 4H0LB 4OGQB 5KKZC 1S5LX 2QSIA 2QJYC 1VF5B 4RKUJ 3LW5J 2FYNC 2E76B 3C8VA
chains in the Genus database with same CATH superfamily
2DQ0A 1SQVJ 1YQ4C 1HTLC 3K06A 3QTCA 1NTZD 1VQNV 1SQVE 2UXNA 2K9PA 1M57D 3D71A 1KECA 1XOUA 3JCUE 4FM0A 4DR6B 3IF4A 4A7PA 2WPVB 2XUMA 3BPZA 1OCRC 3ETQA 3PRJA 4LWSA 3LDEA 3RVZA 3B8NA 4O4LA 4RO2A 3AE5C 2E43A 3HE5A 1HUCA 4I9QA 4A5UB 1ZX3A 1KB9D 3E86A 2RCVA 3CCUP 4MVQA 4NR1A 2A3QA 1AI7A 3M06A 3WB2A 4I2LC 3WMM0 2KB1A 2OCCC 1X9VA 4K3AA 4JYYA 2QA4V 3T1HO 4B3MB 4PV1D 1SQGA 3T4ZA 3WFVA 5LMUO 5LP6B 4IL6Z 3RYHA 4EFEA 1NU1J 1QEXA 1QLNA 3MP7B 3IJ4A 5KHKA 4U3FD 3FFQA 3AG1C 4TQFA 1SQQK 1K73W 5CHXA 1YEWA 2Y4UA 4KP4A 1JTHA 3HB3B 2V7QG 2WA3A 5IJ9A 3L75G 2WPSA 3SWKA 3C3TA 3FXDA 4H13D 3BRCA 4Y99B 3HKDB 1U7MA 3F5HA 2N9BA 1VQ9P 4PD4D 1KD1W 4FFBB 4GX5A 5EZYA 2A06H 2YXLA 4UUJC 1FS0E 4ZBMA 2J58A 3V4WA 3DC6A 2PY5A 2N1TD 3HUSC 3LDDA 3ITKA 1LP1A 2HHHB 2M5AA 4KHPB 3FKSG 4RWUA 1Q6IA 1HNWB 3HD7D 2YMYA 1AJPA 3CS5A 3OM3B 3H1JJ 5KLVH 1QNMA 1HBWA 5JVDA 1BHAA 5C39A 1HF9A 1HR0O 3FX0A 2H8PD 5FL7G 1EDLA 2IM9A 5C93A 5LXTA 1WMKA 2L35A 2B88A 2FYNC 2Q6QA 2ZIOA 2EIJC 1O9HA 4BAYA 5B5EH 1XREA 1XNRO 2EILC 4JTAB 3CC2P 1ZL8A 1DD3A 3K9AA 4H0LD 5KJ7A 2HJFC 2YMKA 4IFDK 1NH2D 5CJ4A 2OIEA 3L35A 3L74E 3KZIZ 1NTZJ 1Q43A 2HJDA 4B3TB 3SFDC 5LA6A 4F6RA 4X66O 1H38A 3GF3A 2RN0A 3TDKA 1NTMD 3JARA 3HKBA 4XDJA 1SQPD 3M9QA 4X1IA 3ZRXA 2Q7GA 5APUA 5B1NA 3OTOB 1FFXA 1IXMA 4WY4B 4D6TD 2UXXA 3OAAG 3AE6C 3MD0A 1NU1H 2IBZG 1XUQA 3MAQA 4RAIA 3JSNA 1OW7A 1WP7A 4DUYO 4JI8B 4CPGA 4UB8E 2AXTZ 2NN4A 5IT9N 2Q7EA 3RT3C 2JS3A 3ASNB 5IJ9B 4JZGA 2AXCA 3N2GB 3WUUA 4GX1A 3X2QB 3CX5D 4GIFA 4ZMDA 2LKMA 3N2KA 1GM7A 2W8ZA 4DV7B 5APVA 1CP9A 2P2UA 1NTKG 2GUVA 1TVKA 4F6EA 4LF5O 1E79H 4IT5A 5KX5B 2E5LO 2OCHA 1H8EG 1N32O 4R7CA 2KSJA 3HE4B 4U3FJ 3OFNG 1HGZA 3H1KH 4MTXA 2RQ6A 1BZKA 3NR7A 4U3FE 1E5WA 1PM9A 1X79B 3L72H 1GTOA 2BCCD 4AQRD 4BIZA 1NZ6A 1CI6A 4HB1A 3VN0A 1GRJA 4BWAA 3MZWB 4FPPA 3MGNA 4OPHA 2A06D 4D7SA 3D3QA 1ZV8A 2HG5D 1L8DA 4ASUG 1XMQB 2OIGA 3GHGB 4HJGH 3HKEB 3CPWO 2E5TA 1KU9A 1OCCB 3RYIB 2WLHA 2AHZA 1Y74B 1NJIQ 3RK3E 3JALB 3KPEA 1BGYH 2O01J 1XMQO 2WTYA 4B7KA 1MUUA 2QG4A 5KLVG 4C7NB 3BA8A 3V2PA 3CWBD 4NPEA 4LCUC 1IZ3A 1XTGB 3H1KG 4ABMA 3JAWB 5KHIA 3H1LE 1Q7YQ 5B1BC 3LW5H 1HH0A 1BCCD 4DCKA 2ZDIA 2FKWB 1ZTEA 2Q8VA 3CCRV 3H01A 3HR0A 2VRSA 1KQGB 5CCGD 1AA0A 4EIJA 2E74D 3L71E 1MZFA 2I8DA 3ML0A 4EOTA 2JRIA 3H1HH 4DR4O 2HPCA 4HYTB 4YHHB 1TU3F 1S3JA 3ZHVA 1TAEA 1H0TA 3AECC 1EN5A 2KXPB 1TVKB 4TUYA 4H0LC 5CA1B 3Q5PA 2QR4A 3O6QB 1P84I 4I1LA 4B3RB 2PYLA 3UT5B 1A02F 4QPKA 1EN6A 1YJNV 4LF9B 4ZHQA 2KNCB 1FFTB 2ZYAA 2YC0A 2ZD9A 3F7YC 3AE7C 3H1HG 1AVMA 3K59A 2Q1KA 3CCJV 3DTUB 3G71V 1QVGU 1KFMA 3AG1B 1FC2C 2VWJA 3KXDA 3P7KA 3CX5E 2GUSA 3E22B 2JO1A 5K1XA 3WUVA 4YXDC 2X7RB 3GHGA 2O1KA 1K8AQ 4JYAB 4UCVA 1SQFA 4PA7A 2KB7P 3RBZA 1LWUC 4NPFX 1OCZB 4QIWF 2PI5A 2IU3A 2ZXXA 5AVVB 4I6MC 1PD3A 4JI8O 1Y6XA 5EC2C 1R73A 1KQSU 4JI3B 3KG2A 4YJ3A 4JYAO 5IY5B 4JF3A 5E1AC 1O9GA 3OJAB 3VMZA 1R3KC 2KOGA 1TUBB 1L0LG 2HR3A 1KP2A 1K9MW 1VQ9V 3P30A 3CXHE 2L5GB 3F89A 4LF6O 1FBMA 3WG7B 3VBBA 3HKDA 1BCCG 2FXMA 3U1AA 5JCOA 1QCEA 3WU2H 3H1HJ 2ZCEA 1K8AW 3AEAC 2JEXA 1KYOD 3DGEA 3A0BE 4DR1O 2K88A 2P6JA 4M3LA 1USEA 3B5NA 4EB6B 3ZMSA 4U7OA 3R2PA 2LQTA 3BCCD 2OCCB 1UPGA 3ABTA 4UCSA 2DWDC 2W6JH 5IYCO 2YXRB 5KLVD 3EXAA 4UVCA 3ZCCA 4ASVA 2YI9A 4X62O 1OIPA 4O4IB 1KD1Q 3GG2A 1GN6A 1YCIA 2LFSA 1MMMA 4TUYB 1AQTA 2P22C 2ZAEB 2HFEC 4W7YA 1JMBA 4DUZO 5LOVB 2PAJA 2IJIA 3Q5SA 3HPLC 1KKCA 5LYJB 3UM7A 3G80A 3LSUA 1YVWA 2ZE6A 2C2AA 3U11A 4DV5B 3B09A 3CCMP 2OTJP 1URQA 1T2KC 1YITV 2OQQA 1SZTA 1AJQA 1ZLLA 3BA9A 1WPBA 3P32A 3T1HB 4K0KB 2IYPA 3WU2E 2E75D 3BABA 4BIUA 1QHTA 1JOCA 3W68A 4QGPA 5J2UA 2WPQA 5B3SB 3SPGA 2UUAO 2HEPA 5CA3A 3G6EV 2LXCB 3BAAA 5TISZ 2M3BA 2RH0A 4O2AB 1MV8A 3JSVC 3FX7A 3TXSA 1KB9I 3IR9A 1S1CX 1R3IC 1PNMA 4AI8A 1NTMK 3RFRA 3TSIA 4DYLA 4O4LB 3JD4A 1AJNA 2LO1A 3L71H 2R32A 1OVVA 4J9YB 4LF8B 1KILC 3C9IA 5EIBD 2NPSB 1AJYA 2F95B 2QM8A 3OGIB 2PP6A 1KB9E 4DV3O 3JC22 2XAQA 3RYHB 3VYIA 3L75J 1N8RQ 1EZVI 1N4CA 4IIJA 2ADQB 3AG3C 4ZKIA 4TV9B 4WWIA 2N1TB 1PGJA 1WP8A 2QIWA 1ZXGA 3ASOC 1VQ8P 1L1FA 5CN0A 1UJWB 2EJRA 3B40A 1AILA 4U7NA 2ZR2A 4BR6A 2WLMA 4Z2WA 3RK2C 2H3OA 3A0RA 4IYHA 2QKSA 3ZN0A 4GKJO 2IYOA 3SFEC 4O2BA 4LF4O 1LGHB 1V54C 3I56V 2AXTH 4MSWC 3E2EA 4PA4A 2FXPA 5APXA 1U57A 2FXOA 3D8CA 4D6TJ 3LSQA 2Q68A 2W6IG 2XAGA 3CRAA 1XL6A 1AVOA 5LOVA 3CX5I 1LTJC 1SQPE 1N7SD 4KHXA 1KBHA 4W80A 3HKEA 1P84F 1YJNP 2EIKB 3LUTB 2QA4P 2AZ0A 3A3YB 2V4HA 1X59A 4MVRA 1FXHA 5IY5C 3ABLC 4L74A 2W6JG 3ZN1A 1LTJB 3APOA 4JI2O 1ROPA 1RE4C 2KP8A 3THOA 2OTLP 4DJGA 2ETNA 4XFJA 4Q20A 4YJ2A 1IFDA 5APQA 3RL0g 5H2FH 1N73A 1YI2P 4N6JA 3QF7A 3PN1A 4J11A 1PGOA 2IZ1A 4FMTA 2QKCA 1SQBJ 1NGMB 4NXMB 1VF5D 2CTWA 2HLOA 4XDKA 4OPAA 1EQ7A 1P7GA 4FLZA 1Q2NA 4WF9V 1FZCB 5JVDB 4FLUA 2Q3EA 4JGSA 3CRCA 1OFCX 2X0LA 4R6ZA 1W2BU 1EDKA 2D2CD 5BXZA 3ZMVA 2ZM6B 4JI1B 2ZR3A 3BHPA 1NTZK 2FFDC 4MT8A 1GAXA 4PI0A 3LIEA 1N33B 2XNDH 2R5BA 4H44D 5E79E 1D5AA 3CCEP 5HFMA 3CC4P 3F5TA 3CXHF 4HKZH 4YHHO 3H25A 3TJTA 4WFAV 5AVYB 3MTUE 2JJLA 4XBFA 1SQVG 1H0TB 3OE7G 1HP8A 2UXBO 4NKGB 5CA1A 2H8PC 4MVOA 1CSBA 4LFAB 1AI5A 2ZE8A 5EYPB 1VARA 1BE3G 1FU1A 3HTKA 1Q6HA 3CE2A 2KKWA 1IFJA 3E7KA 4W4KA 1PL0A 1YQ3C 3CPWU 3TGUH 4ZHQB 3HKBB 1H88A 5F2VO 1RPOA 4LH6A 5KKZB 4FJCC 3CLQA 1TA8A 1ZLZA 3KKYA 3UIAA 3L4FA 5J2TA 2ZE5A 3B8EB 4FM2A 1J5EO 1Q86W 2BTOA 1I94B 1CEZA 4JAVA 2FY8A 2UXDB 1VQKP 1VP7A 1PV3A 4X1YB 4GT1A 3AEBC 3CMEP 2JR8A 2HG5C 5KHGA 1XTCC 4CH5A 4I4TB 2ZXWC 5GW7A 2YO3A 3HD7B 3KZIE 5GTIH 5JCOC 2V7QJ 5TJHA 1PKXA 5AVQB 1KILD 1NTMG 3B8MA 1DK1A 2H88C 2P7JA 3QO8A 3RGUA 2P67A 1ZWIC 3RYIA 1I0HA 5BMVB 3B5NC 2B87B 1OWAA 2KIKA 4WFGA 2RDCA 1Q6UA 2QVAA 3IAOA 2LFRA 3ABMC 2HODB 1EM1A 4CH6A 3HE5B 3B5ND 3H1KJ 4JV5B 4RUFA 2LW7A 5LBQA 4KUMA 5IYZA 2IH3C 2P7TC 1PNKA 2LGWA 1PFIA 3T97A 2EIMB 1BSNA 4UV8A 3CCVP 3GMAA 1G1JA 2WAMA 3WUTA 1FAVA 5KA6A 3EQ2A 2WQYC 4OGQB 1RY3A 2W0FC 2IBZD 3R4YA 5KUKA 5CCHD 1DGSA 1H8HG 4GX2A 4X64B 3CCUV 1QVGO 3K58A 2WWWA 4JI4O 2WMMA 2P4VA 1HVVA 5IDJA 4MVUA 4DV4O 1L0NH 4GX0A 3QO5A 4HH2A 3CCSP 4PD4F 1BCCE 2WLNA 2DYRB 2WSEH 1FZBA 1CZQA 3VP9A 5KUMA 3ETEA 4DK1A 5BU5A 3CC7V 2LXBA 1MOFA 2UUBO 1BE3J 5CBOA 4J10A 1KQLA 5KHJA 1AR4A 1K92A 5FNVB 1HNXB 4LF7O 3TGUE 4YIOA 3AK2A 5H5NA 4HBNA 1HJ0A 3G4SP 4ZIBA 5J2TB 2ZNIA 3K5OA 3C1LA 1T5EA 2UUCB 1G2CB 2YIAA 4W4LA 4B3RO 1JY2N 4IL6E 1Q86Q 1M1KQ 4YXWH 1M93A 5KHHA 3DSQA 5KAFH 5JQGA 1R5SA 1S5LE 5APYA 1IBLB 1MABG 1Z5VA 3AEEC 2F23A 1R5LA 4KHPO 1FE6A 2NR5A 1S0VA 1GDTA 2QKAA 2A45I 4WBNA 4GKGA 3OR6C 1J1DC 1KB9F 4IHJB 3SDLA 3AG4B 3ABVC 4NTYA 3M99B 4UVAA 1K97A 2FL4A 3BVHA 3USSA 3VQYA 3L74D 2D2CC 3D6ZA 3H6PA 2L6LA 4H0LB 2BCCJ 1XNQB 1D7MA 1K33A 2M3EA 1OJHA 1MKMA 1GKFA 5LHGA 3H1JE 1YIJV 1OVRA 1E79G 2ZVNB 3AE3C 3V5BA 5LA6B 4F6RB 5KAIH 1RFYA 1IURA 1NQTA 1JOYA 4GKKO 1GD2E 2ZNJA 1AR5A 3T97B 3CRMA 2QEXV 4ZOLB 3M7MX 4X66B 4UCOA 2K9JA 3N4XA 3AEIA 1US6A 3OR7C 1N8RW 2GA1A 3HUSA 3RK2D 3O8ZA 2YUAA 1U96A 2CK3H 3CSXA 4R8CA 3AK1A 4FZ0A 4JPRA 1NH2B 3GWOA 4B86A 3HKCA 3D36A 3IGAC 2OT5A 5CA0B 4E4EA 1NTZE 2UUAB 4U3JA 3EWKA 1OHHG 3P8CE 1SA0A 4JYBA 2PRRA 1IFPA 1NBMG 4JTCB 1L4AD 5KLVE 4LBEC 1BSHA 1EZJA 2EJ7A 2QJPC 3L75D 3KCXA 4XDLA 5KLVJ 3CMAV 4FZ1A 1RF1A 5EIBC 1JJ2U 2R44A 1G2CA 5KMGA 5EFWB 4JYCA 1K4DC 1YJWP 2FYUJ 3TNUA 3RK2B 2OYIA 4P9OA 1J5EB 1FXVA 4C7UA 4QE9A 4JI3O 2JGUA 1WT6A 3CCQP 3H9VA 4LWSB 1FZCA 5J2UB 4FLTA 2IU0A 4IHJA 5BY1A 2E74C 5GTHH 3MUDC 1BE3D 1VEWA 3ABKB 3G9RA 4MVSA 4QMAA 2DWEC 1KKDA 3CHXA 1KC8Q 3LDCA 3I55P 2W27A 3NXSA 2E74B 3CRRA 1S77D 1QL2A 3ASNC 2R5DA 3W7TA 3W7XA 1YIJP 2QTOA 4MW8A 3X2QC 1LT9B 1ZUQA 5CCHC 2A9HA 4DR7O 4MN4C 4LFCO 3CXHI 1RE3A 2HFED 4O2AA 1RE4A 2GBOA 3ZRWA 1ZR4A 1VQPV 3CEIA 1COWG 3CCMV 2OTJV 2A45G 3L74J 2V4DA 3TXQA 3L72E 1SFCC 3BEHA 1KYOF 2W0XA 3JCUH 3K9SA 1JUNA 1R8EA 4DW0A 4EKWA 1RF1C 3MHVA 3JD2A 3ZX6A 1VQ5P 4DV5O 3FB8C 3SJBC 2XZRA 4NXMO 1XI1A 5FPOA 3RGBA 4DR6O 2J5UA 1HNZO 1AVYA 4D6TG 2JK5C 3TGUG 1DX7A 5H6RA 2GHYA 1QR8A 4X1YA 2JIZG 1LJ2A 1SA0B 3FYIB 5CB4A 3K5LA 4G2KA 1FXKB 1Y67A 4DR3O 1CXZB 1EXJA 3FYEB 1I94O 4J9ZB 1I08A 5M1BA 2YO2A 4X65B 1JNMA 1GH6A 5KMGB 1XHZA 2NPSD 4YY3O 2QEXP 1M56C 1QLEC 1SQXJ 2GDSA 5LHHA 4DV6B 1JR9A 1NTKH 3AE9C 3Q5RA 3TETA 1NU1E 1D2DA 2GTSA 5AW6B 4OGQC 4L87A 3ZJZA 1ZP0C 1VQLP 4I7ZC 4DR1B 4DK0A 2BEQD 1I7FA 1NKNA 2Q0OC 1AR1B 2ZFCA 4FVMA 1S5LH 1VQNP 3KQGA 4YJ2B 3SJCC 4P9PA 3QO7A 1SQPJ 1L4AA 1RF0C 1JB0J 2OGUA 1PP9G 1GN3A 1ZOYC 4IL6H 4KJMA 2C9LY 1XNRB 4WBAA 1WLEA 2B1IA 1NJIW 2O57A 1R6NA 4TOIA 1DD4A 5GTIZ 3FXEA 1P84D 1SQQG 1GN4A 1R6KA 1HDJA 3KCYA 4DXWA 4X64O 3M0DA 2QE7H 1M1JC 3C8VA 3BFRA 3FAVA 5GONA 2BTQA 4CS2A 3BY6A 5AW4B 2PFXA 4LFAO 2QJKC 3FB7C 3IC7A 4GOFA 1NTZG 1V55C 1X8YA 1OXZA 3JCUZ 4J42A 3BCCE 1B04A 2UXDO 2AGAA 2X6CA 2ZJSE 3J7AU 5FNVA 2UWJE 4DV0O 1QBZA 5ITZA 1XMOB 1N0JA 2G38A 2OYHB 1RSOA 1QVFU 4GUNA 2DN9A 3T2MA 4JI2B 1URFA 3IAYA 2KG7A 1SP4A 4TQDA 2AZ2A 3BCCH 2UU9B 1SQQJ 2CPSA 3OEEG 4IL6X 3CJHA 2JWDA 3QNEA 1F4NA 2RJZA 4WFEA 5BU8B 1GO3F 3AG2C 3U59A 1WPXA 1PIXA 4ZKUA 2Q67A 4WY4C 5LYJA 3E8GA 4WVZA 4UB8Z 4J7JA 1KQSO 3L70J 4OWFA 2ZQMA 3VTPC 1IO4A 1URQB 1KORA 2QSIA 1YF2A 4O4JB 1QU7A 1Y76B 4TSFG 1NI8A 4AQYB 4CH4A 1PL5A 5E79H 2NRGA 3M9BA 1QQCA 2DMXA 3B4SA 4X20A 4KXRA 3K0DA 1OCOB 5B1AB 3PJSK 5LMNO 2Y69C 3VMAA 1SLQA 4I55A 1VMGA 1JJOA 2Q4PA 3AK3A 1PP9J 2BSKA 1LTSC 1YJ9P 2ZXWB 4I4TA 2QJKB 3K04A 3RVYA 1PP9E 1K9MQ 3SSUA 2D3OW 3MDSA 2P06A 1ZAUA 3FAVB 5GONB 3FGAD 5L3BA 4DUZB 4R4LA 2R9RB 1J1EB 1NTKK 1ZL8B 3S1KA 2QE7G 1K04A 3ZHRA 4DR2B 2D2CB 1DIPA 3QVNA 2V1DA 5BZBA 3H1KE 3OUSA 4TT3G 2QM4A 5ITZB 2K1EA 3AG4C 3ICXA 1BL8A 4NB5A 2MW2B 3J80N 4NXNB 4RESB 1JM0A 1GMGA 5IWAB 1BQ0A 2YXQB 1IJDB 1NWQA 1L0LE 3U10A 1URQC 5IYBO 4U3FG 2RKLA 4O4HA 3BRTB 3WG7C 1NYHA 2KZJA 3SYQA 4PA9A 3WB0A 4NXNO 2BOBC 2XNXA 4UB8H 5H2FE 2B9ZA 1SQQD 3L75E 5LGUA 2Y0EA 5B1BB 5JJJB 3SYAA 1LT9C 3IC9A 1FJPA 1S72P 3TF5A 2F43G 1HJBA 2DYRC 3H1LJ 4N78E 2XNDG 3SWFA 1EZVG 1NVOA 3QWOC 4UB6H 4AUWA 3AEGC 2B9BA 1EFRG 4BRYB 3E35A 2B5UA 3A2FA 4Q6GA 1PGQA 1VPCA 1OCRB 3LNMB 5BR8O 1AROP 2DW4A 4OX9O 1N73B 4RQEA 4H33A 1S76D 4EDFA 2XTAA 1HR0B 1F4MA 2F4VO 2YICA 3RL0C 3ZRWB 2XU6A 3ZMZA 1JEKA 1VQ4P 5GTHZ 2WLLB 3CCRP 5LHIA 4JI0O 1T6AA 3ABMB 1IDSA 3S3WA 2H94A 3G6EP 2EX3A 2K37A 3L75H 1LTGC 5KA5A 1FOSF 1IFNA 1RPRA 2M6YA 2XAJA 5A2QN 1LUVA 5FLXN 4IFFA 1XL4A 1ZRTD 2FFDB 4XA4A 3H1LG 4C7RA 4CC5A 3K57A 2JWAA 4RJTA 1NKZB 4JI0B 1VQ7P 1X22A 5TISE 2WT7B 1H2SB 2LP7A 2H89C 5AVXB 1VQ4V 3SPJA 1LTIC 3WU2Z 2VQEB 4CBCA 3C90A 5CA0A 2B89A 2N9YB 5CBNA 4R50A 3CL3D 3H1LH 4UB6E 1NOHA 3QH9A 3QG5A 2EZPA 3NTNA 2QJ1A 3OA7A 1LP1B 2M5AB 3S9OA 2GV9A 2N05A 3OGCC 2FBWC 1VQOP 2CDYA 1FPOA 2IBZI 2EINC 3H32A 1ZR2A 1PP9H 5L3EA 2HP8A 1KILA 1K4CC 3L73H 3ZEDA 1SC5B 3H1JH 3HRNA 1W2BO 2ZT9D 2E5LB 4GKKB 3M8AA 1HNZB 4GZRB 4JI6O 4MVZA 4DV7O 3R65A 1KUQA 3CWBJ 5K5GB 4LNUB 1VL2A 2CE4A 2E76D 2EZOA 1P49A 1SFCB 3JD3A 4IYIA 2GUZA 4GCZA 1FJKA 2WSCJ 2DOSA 1ZN5A 2H7HA 1SRYA 2P5OA 2EIJB 2EULA 1F23A 2YXHA 1SKVA 3D3IA 1LT1A 1NH4A 1W0KG 5CJ0A 1FZCC 3CCLV 4JI6B 1XMOO 3M9HA 3RBXA 4FLVA 1T2KD 5IYZB 3RW0A 3JARB 5AW5B 4H13C 2GTAA 3RK3B 2LW1A 2DW3A 1NTMH 2KG7B 1YYCA 2AXTE 1OZHA 4J7ZA 5AVRB 3SWYA 5J9PC 4JV5O 3B71A 1N34O 3ZDMA 3OW2U 1VQOV 3CJHB 1BGYD 1RF0A 3H1JG 5AW8B 1YTFD 1ORQC 2ZIMA 1L0NE 3N27A 2WLIA 4YTPC 5B5EE 2BASA 2Q3IA 1QX8A 3SPHA 2MK3A 2KYVA 1GK4A 1NKDA 1IBMB 3H1IE 4IGGA 2DYSB 4C46A 2EIKC 2ODMA 4TLFA 1GL2D 3L72J 3VOPA 2W90A 1H2GA 4O4JA 4AQYO 2NPSC 1ZSPA 1Y76A 2E42A 3RL0B 2OARA 3M0AA 3P8MC 4OGQD 2JJ2G 1UFIA 2UXCB 5JH7A 1HNWO 1WJZA 4B3TO 1SQVK 2YNYA 3H1KD 4EYYQ 1JQ0A 1FYJA 3L74G 1CI6B 4AILC 3G6BA 4X9QA 1SQXK 2O01N 1FXKC 1SQBK 1NVPD 2XT9A 1L4AB 3VQXA 3A0HH 4H37A 4N23A 2CK3G 1GK6A 2YKOA 1IZNB 3K5NA 1OW8A 4JAUA 5CBGA 3BRVB 2Z3YA 3TGUJ 1IXBA 1FKAO 2JDIH 4DV2B 3FD9A 1N36B 1GK9A 1LR1A 2PYJA 2KLUA 4PJ0E 1WN7A 3ZRSA 4DV1B 3ZHSA 1AB3A 1FDMA 1NTZH 5APTA 1M1JB 3TYYA 5DM6V 4WFHA 1NTKJ 1FJGO 3O9OA 3L73G 5LMUB 3SPIA 3SYPA 1T8ZA 2QDOA 1X4TA 3ZMUA 4PI2A 4BXLA 4FFBA 5EZYB 3JAWA 4B08A 1N7SB 3NFQA 3Q3DA 1PPJD 4U3FH 1N34B 3U0ZA 1BDDA 2YKPA 2DE0X 5EBMC 2ITDC 1FJGB 3M0DC 4LFBO 3D70A 2XAHA 4FK5C 1T3UA 3DXRB 4X62B 4LF5B 3HKCB 1NTKD 2Z5UA 2YEVA 5C8YA 2Y0DA 1MG1A 5CMUA 1NU1G 3HD7C 4U3JB 1G1XB 3VQVA 2FYUD 2HPCB 1R3LC 3APQA 3K79A 4LF6B 3CC4V 3V6IA 5L3CA 4BRYA 4DV0B 4H44C 2R3CA 4DUYB 4DO2A 2PTMA 4E2LA 4K8XA 1IFMA 3TNUB 1BCCJ 3E83A 2OYHA 4BW9A 1BE3E 4MW3A 2QWOB 4YXWG 3CD6V 4NYKA 2K9YA 2WZ7A 3W7UA 1Q5OA 4KFMA 1XHXA 2KS1B 4N78D 5APWA 2RMZA 4DOJA 1RHZB 1GU5A 2Y9YA 3OMIB 2JP3A 1JA8A 3TK1A 1IFIA 3E22A 3L70E 2F1MA 1MFZA 1KV4A 4I55B 2QSAA 1BS3A 3O65A 2JGDB 5AVTB 4X1KA 3S4RA 5JWPA 2PGDA 3MHSC 1LT9A 1DEEG 1N86A 1WB8A 4DR2O 4RQFA 5B3SC 1CPYA 3J81N 3JASB 1G6UA 1OCZC 5KLIC 4X20B 4X65O 4HZ3A 1YBKA 1M7LA 4R4MA 1THZA 1OV9A 4QNHB 3Q4HA 4PA3A 1JVMA 2BCCE 3D36C 3L37A 2W6BA 1URQD 1DTOA 1V9PA 5FPRA 1YTZI 3G3ZA 4LF8O 1IK9A 2R72A 2XDJA 1E1RG 1GM9A 1YSCA 1U97A 2C0XA 3V2QA 2N04A 1Z56A 2KLVA 2O1JA 2WSFH 3LIDA 1KYOH 2XHBA 1K7DA 3PTZA 1SQPG 5E79Z 1SS1A 1VQ7V 2JEUA 1KQFB 1BDCA 1EC5A 2HYNA 1VQPP 2N1TC 3H32B 3L73D 4LF4B 3RWRD 2FKXA 4GLXA 3A0BZ 1SVFA 2IW5A 3SR2C 1UIIA 3SJAC 2ZXEB 3VOUA 2ADPA 2E3CA 5CB4B 4DR5B 1RP3B 4WBNB 1VDFA 3CXHD 1N0NA 2W83C 1MZEA 1YTFB 3BVOA 2SPZA 3AE8C 4GOEA 2Q73A 3PHLA 1BT8A 1PPJG 3CWBH 1Q7YW 1ZRTE 2ZT9B 3KYQA 1YXBA 4B7EA 3KZIH 2EBOA 1BGYE 1L0LJ 4DV2O 2NLJC 1N36O 5GTIE 1XEQA 1GU4A 3VQWA 4FIPC 5B5EZ 4CS4A 4UVBA 4JAAA 3PLNA 5KTBA 4I7ZB 1X0TA 1Y4MA 4BW5A 1Y74A 3BASA 4UB6Z 3VMYA 2FYZA 3L36A 3RL0D 5H9CA 2FYUE 4HAMA 1KMIZ 1H2NA 4CH3A 2EINB 1NU1K 3CXCU 3JAKB 2RNBA 2WITA 5EBLC 4L73A 4J80A 1SQXE 1BSMA 4WFBV 2QJYB 5JJNB 4L8JA 2YKQA 2POHA 1Q8IA 2Q7HA 1NT2B 4WY4D 3B77A 1KP3A 4P2ZA 5AW0B 2UXBB 2ARHA 4HNAB 4N3YB 4X89A 4Z1MH 3FB5C 2CAZC 3PP5A 4UFZA 2Y9ZA 1IBLO 1W0JG 1A02J 2NPSA 1K5QA 1AI4A 1WB7A 5L3DA 2P4KA 3BATA 1IX9A 2ILMA 3JAMN 2UXCO 3I55V 3CCEV 1VQMP 4G27B 2KK7A 1DLBA 1G8MA 1QVFO 1FOSE 1JPXA 1BCCH 2XASA 2P58A 1OMIA 4TV9A 3O6QA 4B3SB 2CPBA 2XKMA 3UO2A 4LFCB 1GL2C 1IK7A 5LGNA 1N7LA 4JI5O 4XE5B 5AW1B 2AEMA 3VMXA 2Y0IA 2OYIB 2P1JA 1F51A 4JI4B 1FFXB 5KLVK 1FZFA 2Q5ZA 3PH0A 4O2BB 2LGQA 1W5CE 4Z1VA 4UXNA 1F7YA 1NHLA 4OX9B 2BE3A 2E75C 1YHQV 1H89A 3RK3C 1H8AA 2HLDG 2WT7A 4PD4E 2AHYA 4D6TH 2QJYC 1NU1D 1SESA 4CZZA 5LP6C 1SQBD 3A0HE 3EHBB 1PNLA 1GW3A 3N2GA 4B3MO 1G1IA 3NMDA 1USDA 2UUCO 1YZBA 4ASWA 3N2KB 2YI8A 1FZEA 1P7BA 3L74H 3CWBG 4K35A 2PGGA 2KUBA 5KLIB 1RE3C 1SQQE 2OTKE 1Q82W 2BCCG 2FYNB 1M1JA 1M8OB 3T1YB 2KSEA 3N7NA 3OUFA 2IBZH 1SFCA 3SGIA 5EK0A 1JY2O 5KKZC 1S5LX 3AEDC 1Q81Q 1Y66A 1KILB 1S9KD 5B66Z 4WCEV 5AW9B 3GB7C 3SPCA 4D7TA 1JY3O 3STLC 1OZ0A 2JVDA 2WLJA 2OYIC 3STZC 3JYCA 1GL2A 2Y48A 4UV9A 5B1OA 2QTSA 4I50B 1Q3EA 1RM1C 1JCCA 1N33O 4L75A 1EZVH 3V2RA 2GUZB 1GZLA 3F5WC 4LF9O 3OD4A 1L0NG 1NTME 3CI9A 3JALA 1NTMJ 2HVKC 2YIDA 1SQXD 4TV8B 3L72G 4I5SA 3HTKB 3JCZA 1T3JA 4EI2A 3CMEV 1FD9A 2GSMB 2K3RA 1JMMA 1M4UA 3SJQC 1SFCD 2ITAA 5DN6G 1L2PA 4LGDE 4Y28J 1BHBA 3B2EE 1FDOA 5AVUB 5KAIE 4G28B 2A45H 2DQ3A 5LMNB 2NZ2A 3W7SA 2FYUG 1L4AC 3MHHC 4YIPA 2VS0A 1NR7A 2K9JB 1K5SA 4JPZB 3GHGC 5AVZB 3OMAB 1I5YA 1MNGA 3BCCG 5KAIZ 2B1GA 1QGKB 3RYCA 2ZE7A 2YDEA 5KJ7D 2AW9A 3W7WA 4IOIH 1VQMV 1B6QA 5JH7B 1J2JB 4JQ0D 1KFNA 2CH7A 3E89A 2JGDA 4LLHA 3JD1A 3TCUA 2NNUA 3K0GA 1H2MA 3R66A 1Q90D 1PPJH 3E8FA 2YIUC 3U1CA 1SQXG 3L72D 1RF1B 2V7QH 2XAFA 3AE2C 3G4SV 2Q7CA 2BTQB 2WPRA 4OH8B 1XNQO 2H43A 1LNQA 1S5LZ 5B66E 5BMVA 4DR3B 4IIJB 2B87A 4TWKA 2HODA 5AVSB 3RYFA 3CCSV 3W67A 1M56B 1QLEB 2KZIA 1XDCA 2N1TA 3DC5A 3P8CD 1NO4A 2VQEO 1FS0G 4H44B 2F4VB 1R3JC 1YITP 1SQPH 4AYCA 1FAFA 5CBHA 4JI7B 2PZSA 5D5PA 5HFLA 5IJ0B 2E75B 3FWLA 3ZRVA 1IC2A 2Q6AA 4X1IB 4LR3A 1HWYA 3UO3A 4WY4A 5L8RJ 3GWKC 4HYOA 4J7KA 4K8ZA 3A2AA 4JASA 2IJHA 1L0LK 2Y69B 4PDRA 4Z1MG 1VF5B 1YI2V 3I5DA 3CXHH 3E8BA 4JI7O 1BMFG 1OCCC 3DXRA 3L70D 1TUBA 1TGOA 3A0HZ 1PZQA 4IFMA 1S4XA 3K3WA 4EFBA 5D5QA 3CC2V 1L0ND 2LR2A 3CX5F 4MTGA 1IVSA 1N7SA 1J1EC 1DF4A 2E5YA 1P84E 3EVKA 1FZAA 2FB5A 2QWRB 3FB6C 1RQVA 3GLMA 3JSLA 3T4DA 2QGNA 3CCVV 2CUGA 1R1BA 2QWNB 5JQGB 1SQBE 2G8YA 3P3NA 3OTOO 1KYOE 2CH7B 1NAFA 3BCCJ 5TISH 1PGPA 1S9KE 4JTDB 4TT3H 3T1CA 5DECA 2P90A 4PDVA 3ZHTA 2I1JA 4FLXA 2WSCH 4RO0A 1Y8AA 3ASOB 1EDIA 2A06G 2AEFA 2WVRA 2VRZA 3EFGA 3L70G 1VF6C 3Q1MA 2JKVA 3CC7P 2YS8A 3AG3B 4LNUA 1LUWA 1S2EA 1RH5B 1JY3N 3SYCA 4X1KB 3ZIAG 1WA8B 1S5HC 1LWUB 5CMZA 1PV0A 4KL1A 4LC1A 1NVPB 1YDXA 1BQZA 1L0LD 2JS5A 3CB2A 2OWOA 1WNSA 3H1HE 1Z2GA 2MKVA 3GW6A 1QL1A 1MA1A 2VQFB 2RMKB 4FLYA 2HKOA 2KS1A 5EC1C 2AEJA 1SQBG 2EIMC 1IBMO 2LJ2A 4PV1B 2WLKA 3Q4HB 4WFFA 3A7OA 4DV6O 1IBKB 1L0NK 2ZT9C 3ETGA 5IJ0A 4DRXB 3RK3D 5H2FZ 3ABLB 4ZOLA 2DJVA 5LP6A 3CCLP 3GVMA 1N7SC 2M0BA 1SERA 3H1ID 4DR7B 2R9AA 3HUSB 1E1QG 3EFFK 2F93B 3CYOA 1CW5A 2HHHO 2Z5IA 3M91A 4NPDA 5CCHA 4X88A 4EEQA 1IBKO 2Y4TA 3JASA 2O3JA 3H1HD 3K08A 2K1AA 3H1LD 1PPJE 4FFKA 5LGTA 1ZW0A 1VQLV 2ITCC 4QJFB 1VIBA 2KQXA 2I1KA 1JMKC 1SS3A 3K5MA 3WB1A 2IZ0A 1N73C 2JJ1G 3L73E 4F4LA 1EXIA 1GM8A 3L73J 2P10A 1AP6A 3KDPB 1R6TA 3JATA 3I56P 3CP1A 3V4QA 4O9BA 1SZXA 3LSSA 4RKUJ 2ZINA 1HW7A 2WSSH 3UQ8A 1K3EA 4CS3A 2ZM6O 3II6A 2R3SA 1M9NA 2WLLA 3SYOA 4LH7A 4DR5O 5DEDA 2ZYGA 3ABUA 1JY3P 4KT0J 1Z5WA 3AEFC 1WRGA 1Q82Q 1B3QA 3OW2O 2F66C 1M56D 5BR8B 1QLED 4L76A 5AW3B 2QWPB 4J41A 3OEHG 1BGYJ 1KILE 2O01H 3AG2B 5IYDO 1EDJA 2Q9LA 1VQ5V 1JY2P 2Z5HA 1AFOA 2Y0PA 2UU9O 3P3PA 3IFXA 5CCGC 3A0BH 1Q81W 3A8TA 1HGVA 1V54B 2UUBB 1LTJA 3ZHUA 1FDIA 1SQXH 3UKMA 4X8AA 1KTMA 2YIBA 2QM7A 4NTXA 1M90Q 4YJ3B 1VQ8V 4DV4B 4B3SO 4YPCA 1ZMEC 1UIXA 1SETA 5KAFZ 4UCTA 2FMLA 3JAKA 2R70A 4DRXA 4U7JA 2OYOA 3V2NA 3ZHQA 4I9WA 4K0KO 1I5XA 1VQ6P 1LTBC 2BSKB 1KB9H 5KX5A 1KZUB 4BIOA 1V55B 2HVJC 2IBZE 4FLWA 4GYCB 5A9GA 1BGYG 3H1JD 5GTHE 1OX3A 1B06A 3CCQV 3ZMTA 1JX9A 1MZ9A 2A79B 1SQQH 4NTWA 5IE9A 2DYSC 3T1YO 1QR9A 1P4RA 1MSWD 2Q9IA 4LFBB 5IWAO 1AP5A 2XV5A 2A7WA 1EZVE 3FWNA 1JFFB 1A32A 4PD4I 1RM1B 1FXKA 2N74A 2C0WA 3MUDA 3H1IH 1JTHB 3AE4C 3H1IJ 2JEEA 4DW1A 3L9DA 1M1KW 5APSA 3HE4A 2IFMA 4PD4H 1PL4A 1RQUA 4JBZA 4DV3B 3K5BA 3L71G 2ZVOB 3VP8A 4PV1C 4O4HB 4OXSA 3OMNB 2CTRA 2M8RA 2A0LA 2E76C 5H6QA 3GF7A 1JCDA 3E8HA 2OYQA 3LNNA 4N21A 4GKJB 2WPDG 4UCRA 2ZKOA 4W7ZA 4ICGA 4GODA 1KYOI 2WA4A 2YIBD 1P84H 1NAYA 5DJUB 4MTOA 1SF9A 4CC6A 4DT0A 3CRQA 3CMAP 1TUEB 4PJ0Z 4PHZA 5B66H 1Y9BA 2CTQA 1AQ5A 1G4YB 4PDMA 2WSSG 4RUEA 3L70H 4PELA 2E76B 3UCSC 2WLIB 2BOCC 1GW4A 1XQ8A 4ZI7A 2W6AA 2WSFJ 5BVZA 1H2KA 1NS1A 3C3SA 5JJEB 4D6TE 1GMJA 1AV1A 2CGOA 2KSDA 3L71J 1VF7A 3OAKA 5AG2A 5L3GA 1XBLA 1AI6A 4FM1A 4DR4B 3AG7A 1FZGA 4DV1O 2GM4A 3K03A 1BE3H 1LTTC 5AW7B 4JZ2A 2QWQB 1NTKE 1S5JA 2OTLV 2ZYDA 5EBWC 5KJ7C 3UT5A 1DEBA 4PA6A 1RSOB 2R9IA 1GL2B 2FYUH 3MIWA 2G3AA 3Q2YA 2KNCA 2KI7B 2FFDA 3E1IA 3OTFA 2YSUB 4I50A 3IFMA 3S3XA 5L3FA 1SQVD 4DZOA 2FYUK 1Y47A 1DF5A 1JFFA 1VF5C 1JO5A 4H13B 4I0XA 5KAFE 1EN4A 1MFTA 4TV8A 2IPPA 3TGUD 3A5TA 3CX5H 1YJ9V 1D5NA 1N32B 4YY3B 3OT7A 1WA8A 4MVMA 1LWUA 1PP9D 2IX7C 3IN6A 2X6BA 4GDOA 3H1IG 4ZNCA 2IJKA 1W2EA 3LW5J 1L0NJ 2MJZA 1WAZA 4WB4A 2VQFO 1H2LA 2Q5UA 2PUSA 1DH3A 2YXYA 3RYCB 1M57B 2Q69A 4UCUA 1EZVD 1OW6A 4NVPA 1KC8W 1K34A 1JCHA 2FTKA 2JDIG 2ZDIC 4MS2A 4PJ0H 1YJWV 2ATKC 4OVNF 1N2DC 3G71P 3CCJP 2BCCH 5DJTB 4HNAA 1SQBH 2YIUB 1GTWA 1YHQP 3D6YA 1GN2A 4JI5B 3CWBE 4JF7A 2Z4EA 3ETDA 4ZI7B 1KN7A 2YEVB 5C8YB 1ENVA 1M57C 2L91A 5AVWB 1VQKV 4O4IA 2X6AA 4P30A 1VF6A 2EILB 4QE7A 2OYHC 1S72V 1HWTC 3RYFB 4LP8A 1W59A 1HNXO 4AHCA 1M5IA 4LF7B 2C9NY 2RN9A 3L71D 4C7NA 3B5NB 2IDBA 4EB6A 5EYPA 1K73Q 3JATB 3JD0A 4MTFA 1U7JA 4BWNA 1OVUA 2BEZF 1EBOA 2M7WA 3ABKC 2PF4E 1M90W 1NR1A 5B1AC 2IH1C 4PDLA 2IJJA 3RN4A 2CTPA 1YTZT 1L0LH 4I0XB 2XOKG 5CBFA 2WSEJ 3E1RA 2CGNA 1VQ6V 2IFNA 1K05A 5CCGA 1OCOC 3AE1C 3CD6P 5K1PA 3I5CA 2Q0AA 5AW2B 4JI1O 1LTAC 2Z0AA 2J59M 2VWKA 3ZBHA 5LL6Y 3G67A 3ZS8C 1XILA 1SQPK 1MSDA 3KHUA 4ZKPA 2A06E 2QRXA 1J1DB 2QJPB 2PI4A 1J95A 4QPJA 3HD7A 5LXTB 4Y99C 1SQVH 2Y0CA 3F7VC
chains in the Genus database with same CATH topology
3AEEC 1YQ4C 4IL6X 4TT3H 3B71A 3AE6C 1UIXA 1ZMEC 4Y28J 1FDOA 1VF5C 1YQ3C 3D71A 4H13B 4U7JA 2NZ2A 2WPVB 1OW7A 3ABVC 1PIXA 3AE7C 4YTPC 4Z1MH 3Q1MA 1AJYA 2K9YA 2D2CC 3AE5C 3D6ZA 1R8EA 4H0LB 3IN6A 1KORA 2JP3A 2QSIA 4GDOA 1MKMA 2JO1A 3LW5J 4YXDC 2J5UA 1PL5A 3AE3C 2MKVA 1OMIA 1PV3A 2QIWA 3O6QA 4PV1D 3AEBC 1IK7A 4PV1B 4OGQD 2ZT9C 2H89C 1EXJA 1OW6A 1Q90D 2YIUC 5M1BA 3SFEC 3T97B 2V7QJ 3AE4C 5KLIC 4R4MA 3AE2C 2H88C 2E75C 4H13D 1RQUA 2FXPA 1U57A 3AE9C 3Q5RA 2QJYC 3D6YA 3AEAC 4OGQC 1ZP0C 3IAOA 1OW8A 4I7ZC 4PV1C 2BEQD 3FGAD 4R4LA 3S9OA 3EWKA 2E76C 2FBWC 3GF7A 4H44B 1K04A 1KQFB 1JB0J 2D2CB 1DIPA 1ZOYC 3RK3E 2QJPC 2E75B 2O01J 1EXIA 2P10A 4XFJA 1DD4A 2ZT9D 2IDBA 3GMAA 3RL0g 5L8RJ 2WQYC 4OGQB 5KKZC 1Y9BA 1HF9A 1S5LX 3AEDC 3R4YA 1VF5B 3AE8C 4RKUJ 1NGMB 1WMKA 2BEZF 2FYNC 2E76B 1VF5D 3C8VA 3Q5SA 1ZRTE 2E76D 1VL2A 3Q3DA 2WSFJ 3Q5PA 2ZT9B 2QJKC 4KT0J 1GMJA 1DD3A 1NYHA 2WSCJ 2WSEJ 2E74C 3AEFC 4H0LD 3D70A 2YMKA 4I7ZB 1K05A 2D2CD 2OQQA 3G9RA 3AE1C 1KQGB 2E75D 1KILE 2E74D 1HJ0A 3SFDC 4H44D 3GLMA 1RQVA 2E74B 1KMIZ 3H25A 1TU3F 2G3AA 1FDIA 3GF3A 3Q2YA 3AEGC 4H13C 2G8YA 3AECC 4H0LC 1S1CX 4H44C 1KTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZRT E;  2QIW A;  2WSF J;  4IL6 X;  2ZT9 B;  2QJK C;  4H44 B;  4KT0 J;  4PV1 B;  4Y28 J;  2WSC J;  2WSE J;  4H13 B;  1JB0 J;  2D2C B;  2WPV B;  4I7Z B;  1Q90 D;  2YIU C;  2QJP C;  2E75 B;  2O01 J;  5KLI C;  2K9Y A;  5L8R J;  2E74 B;  4H0L B;  4OGQ B;  5KKZ C;  1S5L X;  2QSI A;  2QJY C;  1VF5 B;  4RKU J;  3LW5 J;  2FYN C;  2E76 B;  3C8V A; 
#chains in the Genus database with same CATH topology
 2DQ0 A;  1SQV J;  1YQ4 C;  1HTL C;  3K06 A;  3QTC A;  1NTZ D;  1VQN V;  1SQV E;  2UXN A;  2K9P A;  1M57 D;  3D71 A;  1KEC A;  1XOU A;  3JCU E;  4FM0 A;  4DR6 B;  3IF4 A;  4A7P A;  2WPV B;  2XUM A;  3BPZ A;  1OCR C;  3ETQ A;  3PRJ A;  4LWS A;  3LDE A;  3RVZ A;  3B8N A;  4O4L A;  4RO2 A;  3AE5 C;  2E43 A;  3HE5 A;  1HUC A;  4I9Q A;  4A5U B;  1ZX3 A;  1KB9 D;  3E86 A;  2RCV A;  3CCU P;  4MVQ A;  4NR1 A;  2A3Q A;  1AI7 A;  3M06 A;  3WB2 A;  4I2L C;  3WMM 0;  2KB1 A;  2OCC C;  1X9V A;  4K3A A;  4JYY A;  2QA4 V;  3T1H O;  4B3M B;  4PV1 D;  1SQG A;  3T4Z A;  3WFV A;  5LMU O;  5LP6 B;  4IL6 Z;  3RYH A;  4EFE A;  1NU1 J;  1QEX A;  1QLN A;  3MP7 B;  3IJ4 A;  5KHK A;  4U3F D;  3FFQ A;  3AG1 C;  4TQF A;  1SQQ K;  1K73 W;  5CHX A;  1YEW A;  2Y4U A;  4KP4 A;  1JTH A;  3HB3 B;  2V7Q G;  2WA3 A;  5IJ9 A;  3L75 G;  2WPS A;  3SWK A;  3C3T A;  3FXD A;  4H13 D;  3BRC A;  4Y99 B;  3HKD B;  1U7M A;  3F5H A;  2N9B A;  1VQ9 P;  4PD4 D;  1KD1 W;  4FFB B;  4GX5 A;  5EZY A;  2A06 H;  2YXL A;  4UUJ C;  1FS0 E;  4ZBM A;  2J58 A;  3V4W A;  3DC6 A;  2PY5 A;  2N1T D;  3HUS C;  3LDD A;  3ITK A;  1LP1 A;  2HHH B;  2M5A A;  4KHP B;  3FKS G;  4RWU A;  1Q6I A;  1HNW B;  3HD7 D;  2YMY A;  1AJP A;  3CS5 A;  3OM3 B;  3H1J J;  5KLV H;  1QNM A;  1HBW A;  5JVD A;  1BHA A;  5C39 A;  1HF9 A;  1HR0 O;  3FX0 A;  2H8P D;  5FL7 G;  1EDL A;  2IM9 A;  5C93 A;  5LXT A;  1WMK A;  2L35 A;  2B88 A;  2FYN C;  2Q6Q A;  2ZIO A;  2EIJ C;  1O9H A;  4BAY A;  5B5E H;  1XRE A;  1XNR O;  2EIL C;  4JTA B;  3CC2 P;  1ZL8 A;  1DD3 A;  3K9A A;  4H0L D;  5KJ7 A;  2HJF C;  2YMK A;  4IFD K;  1NH2 D;  5CJ4 A;  2OIE A;  3L35 A;  3L74 E;  3KZI Z;  1NTZ J;  1Q43 A;  2HJD A;  4B3T B;  3SFD C;  5LA6 A;  4F6R A;  4X66 O;  1H38 A;  3GF3 A;  2RN0 A;  3TDK A;  1NTM D;  3JAR A;  3HKB A;  4XDJ A;  1SQP D;  3M9Q A;  4X1I A;  3ZRX A;  2Q7G A;  5APU A;  5B1N A;  3OTO B;  1FFX A;  1IXM A;  4WY4 B;  4D6T D;  2UXX A;  3OAA G;  3AE6 C;  3MD0 A;  1NU1 H;  2IBZ G;  1XUQ A;  3MAQ A;  4RAI A;  3JSN A;  1OW7 A;  1WP7 A;  4DUY O;  4JI8 B;  4CPG A;  4UB8 E;  2AXT Z;  2NN4 A;  5IT9 N;  2Q7E A;  3RT3 C;  2JS3 A;  3ASN B;  5IJ9 B;  4JZG A;  2AXC A;  3N2G B;  3WUU A;  4GX1 A;  3X2Q B;  3CX5 D;  4GIF A;  4ZMD A;  2LKM A;  3N2K A;  1GM7 A;  2W8Z A;  4DV7 B;  5APV A;  1CP9 A;  2P2U A;  1NTK G;  2GUV A;  1TVK A;  4F6E A;  4LF5 O;  1E79 H;  4IT5 A;  5KX5 B;  2E5L O;  2OCH A;  1H8E G;  1N32 O;  4R7C A;  2KSJ A;  3HE4 B;  4U3F J;  3OFN G;  1HGZ A;  3H1K H;  4MTX A;  2RQ6 A;  1BZK A;  3NR7 A;  4U3F E;  1E5W A;  1PM9 A;  1X79 B;  3L72 H;  1GTO A;  2BCC D;  4AQR D;  4BIZ A;  1NZ6 A;  1CI6 A;  4HB1 A;  3VN0 A;  1GRJ A;  4BWA A;  3MZW B;  4FPP A;  3MGN A;  4OPH A;  2A06 D;  4D7S A;  3D3Q A;  1ZV8 A;  2HG5 D;  1L8D A;  4ASU G;  1XMQ B;  2OIG A;  3GHG B;  4HJG H;  3HKE B;  3CPW O;  2E5T A;  1KU9 A;  1OCC B;  3RYI B;  2WLH A;  2AHZ A;  1Y74 B;  1NJI Q;  3RK3 E;  3JAL B;  3KPE A;  1BGY H;  2O01 J;  1XMQ O;  2WTY A;  4B7K A;  1MUU A;  2QG4 A;  5KLV G;  4C7N B;  3BA8 A;  3V2P A;  3CWB D;  4NPE A;  4LCU C;  1IZ3 A;  1XTG B;  3H1K G;  4ABM A;  3JAW B;  5KHI A;  3H1L E;  1Q7Y Q;  5B1B C;  3LW5 H;  1HH0 A;  1BCC D;  4DCK A;  2ZDI A;  2FKW B;  1ZTE A;  2Q8V A;  3CCR V;  3H01 A;  3HR0 A;  2VRS A;  1KQG B;  5CCG D;  1AA0 A;  4EIJ A;  2E74 D;  3L71 E;  1MZF A;  2I8D A;  3ML0 A;  4EOT A;  2JRI A;  3H1H H;  4DR4 O;  2HPC A;  4HYT B;  4YHH B;  1TU3 F;  1S3J A;  3ZHV A;  1TAE A;  1H0T A;  3AEC C;  1EN5 A;  2KXP B;  1TVK B;  4TUY A;  4H0L C;  5CA1 B;  3Q5P A;  2QR4 A;  3O6Q B;  1P84 I;  4I1L A;  4B3R B;  2PYL A;  3UT5 B;  1A02 F;  4QPK A;  1EN6 A;  1YJN V;  4LF9 B;  4ZHQ A;  2KNC B;  1FFT B;  2ZYA A;  2YC0 A;  2ZD9 A;  3F7Y C;  3AE7 C;  3H1H G;  1AVM A;  3K59 A;  2Q1K A;  3CCJ V;  3DTU B;  3G71 V;  1QVG U;  1KFM A;  3AG1 B;  1FC2 C;  2VWJ A;  3KXD A;  3P7K A;  3CX5 E;  2GUS A;  3E22 B;  2JO1 A;  5K1X A;  3WUV A;  4YXD C;  2X7R B;  3GHG A;  2O1K A;  1K8A Q;  4JYA B;  4UCV A;  1SQF A;  4PA7 A;  2KB7 P;  3RBZ A;  1LWU C;  4NPF X;  1OCZ B;  4QIW F;  2PI5 A;  2IU3 A;  2ZXX A;  5AVV B;  4I6M C;  1PD3 A;  4JI8 O;  1Y6X A;  5EC2 C;  1R73 A;  1KQS U;  4JI3 B;  3KG2 A;  4YJ3 A;  4JYA O;  5IY5 B;  4JF3 A;  5E1A C;  1O9G A;  3OJA B;  3VMZ A;  1R3K C;  2KOG A;  1TUB B;  1L0L G;  2HR3 A;  1KP2 A;  1K9M W;  1VQ9 V;  3P30 A;  3CXH E;  2L5G B;  3F89 A;  4LF6 O;  1FBM A;  3WG7 B;  3VBB A;  3HKD A;  1BCC G;  2FXM A;  3U1A A;  5JCO A;  1QCE A;  3WU2 H;  3H1H J;  2ZCE A;  1K8A W;  3AEA C;  2JEX A;  1KYO D;  3DGE A;  3A0B E;  4DR1 O;  2K88 A;  2P6J A;  4M3L A;  1USE A;  3B5N A;  4EB6 B;  3ZMS A;  4U7O A;  3R2P A;  2LQT A;  3BCC D;  2OCC B;  1UPG A;  3ABT A;  4UCS A;  2DWD C;  2W6J H;  5IYC O;  2YXR B;  5KLV D;  3EXA A;  4UVC A;  3ZCC A;  4ASV A;  2YI9 A;  4X62 O;  1OIP A;  4O4I B;  1KD1 Q;  3GG2 A;  1GN6 A;  1YCI A;  2LFS A;  1MMM A;  4TUY B;  1AQT A;  2P22 C;  2ZAE B;  2HFE C;  4W7Y A;  1JMB A;  4DUZ O;  5LOV B;  2PAJ A;  2IJI A;  3Q5S A;  3HPL C;  1KKC A;  5LYJ B;  3UM7 A;  3G80 A;  3LSU A;  1YVW A;  2ZE6 A;  2C2A A;  3U11 A;  4DV5 B;  3B09 A;  3CCM P;  2OTJ P;  1URQ A;  1T2K C;  1YIT V;  2OQQ A;  1SZT A;  1AJQ A;  1ZLL A;  3BA9 A;  1WPB A;  3P32 A;  3T1H B;  4K0K B;  2IYP A;  3WU2 E;  2E75 D;  3BAB A;  4BIU A;  1QHT A;  1JOC A;  3W68 A;  4QGP A;  5J2U A;  2WPQ A;  5B3S B;  3SPG A;  2UUA O;  2HEP A;  5CA3 A;  3G6E V;  2LXC B;  3BAA A;  5TIS Z;  2M3B A;  2RH0 A;  4O2A B;  1MV8 A;  3JSV C;  3FX7 A;  3TXS A;  1KB9 I;  3IR9 A;  1S1C X;  1R3I C;  1PNM A;  4AI8 A;  1NTM K;  3RFR A;  3TSI A;  4DYL A;  4O4L B;  3JD4 A;  1AJN A;  2LO1 A;  3L71 H;  2R32 A;  1OVV A;  4J9Y B;  4LF8 B;  1KIL C;  3C9I A;  5EIB D;  2NPS B;  1AJY A;  2F95 B;  2QM8 A;  3OGI B;  2PP6 A;  1KB9 E;  4DV3 O;  3JC2 2;  2XAQ A;  3RYH B;  3VYI A;  3L75 J;  1N8R Q;  1EZV I;  1N4C A;  4IIJ A;  2ADQ B;  3AG3 C;  4ZKI A;  4TV9 B;  4WWI A;  2N1T B;  1PGJ A;  1WP8 A;  2QIW A;  1ZXG A;  3ASO C;  1VQ8 P;  1L1F A;  5CN0 A;  1UJW B;  2EJR A;  3B40 A;  1AIL A;  4U7N A;  2ZR2 A;  4BR6 A;  2WLM A;  4Z2W A;  3RK2 C;  2H3O A;  3A0R A;  4IYH A;  2QKS A;  3ZN0 A;  4GKJ O;  2IYO A;  3SFE C;  4O2B A;  4LF4 O;  1LGH B;  1V54 C;  3I56 V;  2AXT H;  4MSW C;  3E2E A;  4PA4 A;  2FXP A;  5APX A;  1U57 A;  2FXO A;  3D8C A;  4D6T J;  3LSQ A;  2Q68 A;  2W6I G;  2XAG A;  3CRA A;  1XL6 A;  1AVO A;  5LOV A;  3CX5 I;  1LTJ C;  1SQP E;  1N7S D;  4KHX A;  1KBH A;  4W80 A;  3HKE A;  1P84 F;  1YJN P;  2EIK B;  3LUT B;  2QA4 P;  2AZ0 A;  3A3Y B;  2V4H A;  1X59 A;  4MVR A;  1FXH A;  5IY5 C;  3ABL C;  4L74 A;  2W6J G;  3ZN1 A;  1LTJ B;  3APO A;  4JI2 O;  1ROP A;  1RE4 C;  2KP8 A;  3THO A;  2OTL P;  4DJG A;  2ETN A;  4XFJ A;  4Q20 A;  4YJ2 A;  1IFD A;  5APQ A;  3RL0 g;  5H2F H;  1N73 A;  1YI2 P;  4N6J A;  3QF7 A;  3PN1 A;  4J11 A;  1PGO A;  2IZ1 A;  4FMT A;  2QKC A;  1SQB J;  1NGM B;  4NXM B;  1VF5 D;  2CTW A;  2HLO A;  4XDK A;  4OPA A;  1EQ7 A;  1P7G A;  4FLZ A;  1Q2N A;  4WF9 V;  1FZC B;  5JVD B;  4FLU A;  2Q3E A;  4JGS A;  3CRC A;  1OFC X;  2X0L A;  4R6Z A;  1W2B U;  1EDK A;  2D2C D;  5BXZ A;  3ZMV A;  2ZM6 B;  4JI1 B;  2ZR3 A;  3BHP A;  1NTZ K;  2FFD C;  4MT8 A;  1GAX A;  4PI0 A;  3LIE A;  1N33 B;  2XND H;  2R5B A;  4H44 D;  5E79 E;  1D5A A;  3CCE P;  5HFM A;  3CC4 P;  3F5T A;  3CXH F;  4HKZ H;  4YHH O;  3H25 A;  3TJT A;  4WFA V;  5AVY B;  3MTU E;  2JJL A;  4XBF A;  1SQV G;  1H0T B;  3OE7 G;  1HP8 A;  2UXB O;  4NKG B;  5CA1 A;  2H8P C;  4MVO A;  1CSB A;  4LFA B;  1AI5 A;  2ZE8 A;  5EYP B;  1VAR A;  1BE3 G;  1FU1 A;  3HTK A;  1Q6H A;  3CE2 A;  2KKW A;  1IFJ A;  3E7K A;  4W4K A;  1PL0 A;  1YQ3 C;  3CPW U;  3TGU H;  4ZHQ B;  3HKB B;  1H88 A;  5F2V O;  1RPO A;  4LH6 A;  5KKZ B;  4FJC C;  3CLQ A;  1TA8 A;  1ZLZ A;  3KKY A;  3UIA A;  3L4F A;  5J2T A;  2ZE5 A;  3B8E B;  4FM2 A;  1J5E O;  1Q86 W;  2BTO A;  1I94 B;  1CEZ A;  4JAV A;  2FY8 A;  2UXD B;  1VQK P;  1VP7 A;  1PV3 A;  4X1Y B;  4GT1 A;  3AEB C;  3CME P;  2JR8 A;  2HG5 C;  5KHG A;  1XTC C;  4CH5 A;  4I4T B;  2ZXW C;  5GW7 A;  2YO3 A;  3HD7 B;  3KZI E;  5GTI H;  5JCO C;  2V7Q J;  5TJH A;  1PKX A;  5AVQ B;  1KIL D;  1NTM G;  3B8M A;  1DK1 A;  2H88 C;  2P7J A;  3QO8 A;  3RGU A;  2P67 A;  1ZWI C;  3RYI A;  1I0H A;  5BMV B;  3B5N C;  2B87 B;  1OWA A;  2KIK A;  4WFG A;  2RDC A;  1Q6U A;  2QVA A;  3IAO A;  2LFR A;  3ABM C;  2HOD B;  1EM1 A;  4CH6 A;  3HE5 B;  3B5N D;  3H1K J;  4JV5 B;  4RUF A;  2LW7 A;  5LBQ A;  4KUM A;  5IYZ A;  2IH3 C;  2P7T C;  1PNK A;  2LGW A;  1PFI A;  3T97 A;  2EIM B;  1BSN A;  4UV8 A;  3CCV P;  3GMA A;  1G1J A;  2WAM A;  3WUT A;  1FAV A;  5KA6 A;  3EQ2 A;  2WQY C;  4OGQ B;  1RY3 A;  2W0F C;  2IBZ D;  3R4Y A;  5KUK A;  5CCH D;  1DGS A;  1H8H G;  4GX2 A;  4X64 B;  3CCU V;  1QVG O;  3K58 A;  2WWW A;  4JI4 O;  2WMM A;  2P4V A;  1HVV A;  5IDJ A;  4MVU A;  4DV4 O;  1L0N H;  4GX0 A;  3QO5 A;  4HH2 A;  3CCS P;  4PD4 F;  1BCC E;  2WLN A;  2DYR B;  2WSE H;  1FZB A;  1CZQ A;  3VP9 A;  5KUM A;  3ETE A;  4DK1 A;  5BU5 A;  3CC7 V;  2LXB A;  1MOF A;  2UUB O;  1BE3 J;  5CBO A;  4J10 A;  1KQL A;  5KHJ A;  1AR4 A;  1K92 A;  5FNV B;  1HNX B;  4LF7 O;  3TGU E;  4YIO A;  3AK2 A;  5H5N A;  4HBN A;  1HJ0 A;  3G4S P;  4ZIB A;  5J2T B;  2ZNI A;  3K5O A;  3C1L A;  1T5E A;  2UUC B;  1G2C B;  2YIA A;  4W4L A;  4B3R O;  1JY2 N;  4IL6 E;  1Q86 Q;  1M1K Q;  4YXW H;  1M93 A;  5KHH A;  3DSQ A;  5KAF H;  5JQG A;  1R5S A;  1S5L E;  5APY A;  1IBL B;  1MAB G;  1Z5V A;  3AEE C;  2F23 A;  1R5L A;  4KHP O;  1FE6 A;  2NR5 A;  1S0V A;  1GDT A;  2QKA A;  2A45 I;  4WBN A;  4GKG A;  3OR6 C;  1J1D C;  1KB9 F;  4IHJ B;  3SDL A;  3AG4 B;  3ABV C;  4NTY A;  3M99 B;  4UVA A;  1K97 A;  2FL4 A;  3BVH A;  3USS A;  3VQY A;  3L74 D;  2D2C C;  3D6Z A;  3H6P A;  2L6L A;  4H0L B;  2BCC J;  1XNQ B;  1D7M A;  1K33 A;  2M3E A;  1OJH A;  1MKM A;  1GKF A;  5LHG A;  3H1J E;  1YIJ V;  1OVR A;  1E79 G;  2ZVN B;  3AE3 C;  3V5B A;  5LA6 B;  4F6R B;  5KAI H;  1RFY A;  1IUR A;  1NQT A;  1JOY A;  4GKK O;  1GD2 E;  2ZNJ A;  1AR5 A;  3T97 B;  3CRM A;  2QEX V;  4ZOL B;  3M7M X;  4X66 B;  4UCO A;  2K9J A;  3N4X A;  3AEI A;  1US6 A;  3OR7 C;  1N8R W;  2GA1 A;  3HUS A;  3RK2 D;  3O8Z A;  2YUA A;  1U96 A;  2CK3 H;  3CSX A;  4R8C A;  3AK1 A;  4FZ0 A;  4JPR A;  1NH2 B;  3GWO A;  4B86 A;  3HKC A;  3D36 A;  3IGA C;  2OT5 A;  5CA0 B;  4E4E A;  1NTZ E;  2UUA B;  4U3J A;  3EWK A;  1OHH G;  3P8C E;  1SA0 A;  4JYB A;  2PRR A;  1IFP A;  1NBM G;  4JTC B;  1L4A D;  5KLV E;  4LBE C;  1BSH A;  1EZJ A;  2EJ7 A;  2QJP C;  3L75 D;  3KCX A;  4XDL A;  5KLV J;  3CMA V;  4FZ1 A;  1RF1 A;  5EIB C;  1JJ2 U;  2R44 A;  1G2C A;  5KMG A;  5EFW B;  4JYC A;  1K4D C;  1YJW P;  2FYU J;  3TNU A;  3RK2 B;  2OYI A;  4P9O A;  1J5E B;  1FXV A;  4C7U A;  4QE9 A;  4JI3 O;  2JGU A;  1WT6 A;  3CCQ P;  3H9V A;  4LWS B;  1FZC A;  5J2U B;  4FLT A;  2IU0 A;  4IHJ A;  5BY1 A;  2E74 C;  5GTH H;  3MUD C;  1BE3 D;  1VEW A;  3ABK B;  3G9R A;  4MVS A;  4QMA A;  2DWE C;  1KKD A;  3CHX A;  1KC8 Q;  3LDC A;  3I55 P;  2W27 A;  3NXS A;  2E74 B;  3CRR A;  1S77 D;  1QL2 A;  3ASN C;  2R5D A;  3W7T A;  3W7X A;  1YIJ P;  2QTO A;  4MW8 A;  3X2Q C;  1LT9 B;  1ZUQ A;  5CCH C;  2A9H A;  4DR7 O;  4MN4 C;  4LFC O;  3CXH I;  1RE3 A;  2HFE D;  4O2A A;  1RE4 A;  2GBO A;  3ZRW A;  1ZR4 A;  1VQP V;  3CEI A;  1COW G;  3CCM V;  2OTJ V;  2A45 G;  3L74 J;  2V4D A;  3TXQ A;  3L72 E;  1SFC C;  3BEH A;  1KYO F;  2W0X A;  3JCU H;  3K9S A;  1JUN A;  1R8E A;  4DW0 A;  4EKW A;  1RF1 C;  3MHV A;  3JD2 A;  3ZX6 A;  1VQ5 P;  4DV5 O;  3FB8 C;  3SJB C;  2XZR A;  4NXM O;  1XI1 A;  5FPO A;  3RGB A;  4DR6 O;  2J5U A;  1HNZ O;  1AVY A;  4D6T G;  2JK5 C;  3TGU G;  1DX7 A;  5H6R A;  2GHY A;  1QR8 A;  4X1Y A;  2JIZ G;  1LJ2 A;  1SA0 B;  3FYI B;  5CB4 A;  3K5L A;  4G2K A;  1FXK B;  1Y67 A;  4DR3 O;  1CXZ B;  1EXJ A;  3FYE B;  1I94 O;  4J9Z B;  1I08 A;  5M1B A;  2YO2 A;  4X65 B;  1JNM A;  1GH6 A;  5KMG B;  1XHZ A;  2NPS D;  4YY3 O;  2QEX P;  1M56 C;  1QLE C;  1SQX J;  2GDS A;  5LHH A;  4DV6 B;  1JR9 A;  1NTK H;  3AE9 C;  3Q5R A;  3TET A;  1NU1 E;  1D2D A;  2GTS A;  5AW6 B;  4OGQ C;  4L87 A;  3ZJZ A;  1ZP0 C;  1VQL P;  4I7Z C;  4DR1 B;  4DK0 A;  2BEQ D;  1I7F A;  1NKN A;  2Q0O C;  1AR1 B;  2ZFC A;  4FVM A;  1S5L H;  1VQN P;  3KQG A;  4YJ2 B;  3SJC C;  4P9P A;  3QO7 A;  1SQP J;  1L4A A;  1RF0 C;  1JB0 J;  2OGU A;  1PP9 G;  1GN3 A;  1ZOY C;  4IL6 H;  4KJM A;  2C9L Y;  1XNR B;  4WBA A;  1WLE A;  2B1I A;  1NJI W;  2O57 A;  1R6N A;  4TOI A;  1DD4 A;  5GTI Z;  3FXE A;  1P84 D;  1SQQ G;  1GN4 A;  1R6K A;  1HDJ A;  3KCY A;  4DXW A;  4X64 O;  3M0D A;  2QE7 H;  1M1J C;  3C8V A;  3BFR A;  3FAV A;  5GON A;  2BTQ A;  4CS2 A;  3BY6 A;  5AW4 B;  2PFX A;  4LFA O;  2QJK C;  3FB7 C;  3IC7 A;  4GOF A;  1NTZ G;  1V55 C;  1X8Y A;  1OXZ A;  3JCU Z;  4J42 A;  3BCC E;  1B04 A;  2UXD O;  2AGA A;  2X6C A;  2ZJS E;  3J7A U;  5FNV A;  2UWJ E;  4DV0 O;  1QBZ A;  5ITZ A;  1XMO B;  1N0J A;  2G38 A;  2OYH B;  1RSO A;  1QVF U;  4GUN A;  2DN9 A;  3T2M A;  4JI2 B;  1URF A;  3IAY A;  2KG7 A;  1SP4 A;  4TQD A;  2AZ2 A;  3BCC H;  2UU9 B;  1SQQ J;  2CPS A;  3OEE G;  4IL6 X;  3CJH A;  2JWD A;  3QNE A;  1F4N A;  2RJZ A;  4WFE A;  5BU8 B;  1GO3 F;  3AG2 C;  3U59 A;  1WPX A;  1PIX A;  4ZKU A;  2Q67 A;  4WY4 C;  5LYJ A;  3E8G A;  4WVZ A;  4UB8 Z;  4J7J A;  1KQS O;  3L70 J;  4OWF A;  2ZQM A;  3VTP C;  1IO4 A;  1URQ B;  1KOR A;  2QSI A;  1YF2 A;  4O4J B;  1QU7 A;  1Y76 B;  4TSF G;  1NI8 A;  4AQY B;  4CH4 A;  1PL5 A;  5E79 H;  2NRG A;  3M9B A;  1QQC A;  2DMX A;  3B4S A;  4X20 A;  4KXR A;  3K0D A;  1OCO B;  5B1A B;  3PJS K;  5LMN O;  2Y69 C;  3VMA A;  1SLQ A;  4I55 A;  1VMG A;  1JJO A;  2Q4P A;  3AK3 A;  1PP9 J;  2BSK A;  1LTS C;  1YJ9 P;  2ZXW B;  4I4T A;  2QJK B;  3K04 A;  3RVY A;  1PP9 E;  1K9M Q;  3SSU A;  2D3O W;  3MDS A;  2P06 A;  1ZAU A;  3FAV B;  5GON B;  3FGA D;  5L3B A;  4DUZ B;  4R4L A;  2R9R B;  1J1E B;  1NTK K;  1ZL8 B;  3S1K A;  2QE7 G;  1K04 A;  3ZHR A;  4DR2 B;  2D2C B;  1DIP A;  3QVN A;  2V1D A;  5BZB A;  3H1K E;  3OUS A;  4TT3 G;  2QM4 A;  5ITZ B;  2K1E A;  3AG4 C;  3ICX A;  1BL8 A;  4NB5 A;  2MW2 B;  3J80 N;  4NXN B;  4RES B;  1JM0 A;  1GMG A;  5IWA B;  1BQ0 A;  2YXQ B;  1IJD B;  1NWQ A;  1L0L E;  3U10 A;  1URQ C;  5IYB O;  4U3F G;  2RKL A;  4O4H A;  3BRT B;  3WG7 C;  1NYH A;  2KZJ A;  3SYQ A;  4PA9 A;  3WB0 A;  4NXN O;  2BOB C;  2XNX A;  4UB8 H;  5H2F E;  2B9Z A;  1SQQ D;  3L75 E;  5LGU A;  2Y0E A;  5B1B B;  5JJJ B;  3SYA A;  1LT9 C;  3IC9 A;  1FJP A;  1S72 P;  3TF5 A;  2F43 G;  1HJB A;  2DYR C;  3H1L J;  4N78 E;  2XND G;  3SWF A;  1EZV G;  1NVO A;  3QWO C;  4UB6 H;  4AUW A;  3AEG C;  2B9B A;  1EFR G;  4BRY B;  3E35 A;  2B5U A;  3A2F A;  4Q6G A;  1PGQ A;  1VPC A;  1OCR B;  3LNM B;  5BR8 O;  1ARO P;  2DW4 A;  4OX9 O;  1N73 B;  4RQE A;  4H33 A;  1S76 D;  4EDF A;  2XTA A;  1HR0 B;  1F4M A;  2F4V O;  2YIC A;  3RL0 C;  3ZRW B;  2XU6 A;  3ZMZ A;  1JEK A;  1VQ4 P;  5GTH Z;  2WLL B;  3CCR P;  5LHI A;  4JI0 O;  1T6A A;  3ABM B;  1IDS A;  3S3W A;  2H94 A;  3G6E P;  2EX3 A;  2K37 A;  3L75 H;  1LTG C;  5KA5 A;  1FOS F;  1IFN A;  1RPR A;  2M6Y A;  2XAJ A;  5A2Q N;  1LUV A;  5FLX N;  4IFF A;  1XL4 A;  1ZRT D;  2FFD B;  4XA4 A;  3H1L G;  4C7R A;  4CC5 A;  3K57 A;  2JWA A;  4RJT A;  1NKZ B;  4JI0 B;  1VQ7 P;  1X22 A;  5TIS E;  2WT7 B;  1H2S B;  2LP7 A;  2H89 C;  5AVX B;  1VQ4 V;  3SPJ A;  1LTI C;  3WU2 Z;  2VQE B;  4CBC A;  3C90 A;  5CA0 A;  2B89 A;  2N9Y B;  5CBN A;  4R50 A;  3CL3 D;  3H1L H;  4UB6 E;  1NOH A;  3QH9 A;  3QG5 A;  2EZP A;  3NTN A;  2QJ1 A;  3OA7 A;  1LP1 B;  2M5A B;  3S9O A;  2GV9 A;  2N05 A;  3OGC C;  2FBW C;  1VQO P;  2CDY A;  1FPO A;  2IBZ I;  2EIN C;  3H32 A;  1ZR2 A;  1PP9 H;  5L3E A;  2HP8 A;  1KIL A;  1K4C C;  3L73 H;  3ZED A;  1SC5 B;  3H1J H;  3HRN A;  1W2B O;  2ZT9 D;  2E5L B;  4GKK B;  3M8A A;  1HNZ B;  4GZR B;  4JI6 O;  4MVZ A;  4DV7 O;  3R65 A;  1KUQ A;  3CWB J;  5K5G B;  4LNU B;  1VL2 A;  2CE4 A;  2E76 D;  2EZO A;  1P49 A;  1SFC B;  3JD3 A;  4IYI A;  2GUZ A;  4GCZ A;  1FJK A;  2WSC J;  2DOS A;  1ZN5 A;  2H7H A;  1SRY A;  2P5O A;  2EIJ B;  2EUL A;  1F23 A;  2YXH A;  1SKV A;  3D3I A;  1LT1 A;  1NH4 A;  1W0K G;  5CJ0 A;  1FZC C;  3CCL V;  4JI6 B;  1XMO O;  3M9H A;  3RBX A;  4FLV A;  1T2K D;  5IYZ B;  3RW0 A;  3JAR B;  5AW5 B;  4H13 C;  2GTA A;  3RK3 B;  2LW1 A;  2DW3 A;  1NTM H;  2KG7 B;  1YYC A;  2AXT E;  1OZH A;  4J7Z A;  5AVR B;  3SWY A;  5J9P C;  4JV5 O;  3B71 A;  1N34 O;  3ZDM A;  3OW2 U;  1VQO V;  3CJH B;  1BGY D;  1RF0 A;  3H1J G;  5AW8 B;  1YTF D;  1ORQ C;  2ZIM A;  1L0N E;  3N27 A;  2WLI A;  4YTP C;  5B5E E;  2BAS A;  2Q3I A;  1QX8 A;  3SPH A;  2MK3 A;  2KYV A;  1GK4 A;  1NKD A;  1IBM B;  3H1I E;  4IGG A;  2DYS B;  4C46 A;  2EIK C;  2ODM A;  4TLF A;  1GL2 D;  3L72 J;  3VOP A;  2W90 A;  1H2G A;  4O4J A;  4AQY O;  2NPS C;  1ZSP A;  1Y76 A;  2E42 A;  3RL0 B;  2OAR A;  3M0A A;  3P8M C;  4OGQ D;  2JJ2 G;  1UFI A;  2UXC B;  5JH7 A;  1HNW O;  1WJZ A;  4B3T O;  1SQV K;  2YNY A;  3H1K D;  4EYY Q;  1JQ0 A;  1FYJ A;  3L74 G;  1CI6 B;  4AIL C;  3G6B A;  4X9Q A;  1SQX K;  2O01 N;  1FXK C;  1SQB K;  1NVP D;  2XT9 A;  1L4A B;  3VQX A;  3A0H H;  4H37 A;  4N23 A;  2CK3 G;  1GK6 A;  2YKO A;  1IZN B;  3K5N A;  1OW8 A;  4JAU A;  5CBG A;  3BRV B;  2Z3Y A;  3TGU J;  1IXB A;  1FKA O;  2JDI H;  4DV2 B;  3FD9 A;  1N36 B;  1GK9 A;  1LR1 A;  2PYJ A;  2KLU A;  4PJ0 E;  1WN7 A;  3ZRS A;  4DV1 B;  3ZHS A;  1AB3 A;  1FDM A;  1NTZ H;  5APT A;  1M1J B;  3TYY A;  5DM6 V;  4WFH A;  1NTK J;  1FJG O;  3O9O A;  3L73 G;  5LMU B;  3SPI A;  3SYP A;  1T8Z A;  2QDO A;  1X4T A;  3ZMU A;  4PI2 A;  4BXL A;  4FFB A;  5EZY B;  3JAW A;  4B08 A;  1N7S B;  3NFQ A;  3Q3D A;  1PPJ D;  4U3F H;  1N34 B;  3U0Z A;  1BDD A;  2YKP A;  2DE0 X;  5EBM C;  2ITD C;  1FJG B;  3M0D C;  4LFB O;  3D70 A;  2XAH A;  4FK5 C;  1T3U A;  3DXR B;  4X62 B;  4LF5 B;  3HKC B;  1NTK D;  2Z5U A;  2YEV A;  5C8Y A;  2Y0D A;  1MG1 A;  5CMU A;  1NU1 G;  3HD7 C;  4U3J B;  1G1X B;  3VQV A;  2FYU D;  2HPC B;  1R3L C;  3APQ A;  3K79 A;  4LF6 B;  3CC4 V;  3V6I A;  5L3C A;  4BRY A;  4DV0 B;  4H44 C;  2R3C A;  4DUY B;  4DO2 A;  2PTM A;  4E2L A;  4K8X A;  1IFM A;  3TNU B;  1BCC J;  3E83 A;  2OYH A;  4BW9 A;  1BE3 E;  4MW3 A;  2QWO B;  4YXW G;  3CD6 V;  4NYK A;  2K9Y A;  2WZ7 A;  3W7U A;  1Q5O A;  4KFM A;  1XHX A;  2KS1 B;  4N78 D;  5APW A;  2RMZ A;  4DOJ A;  1RHZ B;  1GU5 A;  2Y9Y A;  3OMI B;  2JP3 A;  1JA8 A;  3TK1 A;  1IFI A;  3E22 A;  3L70 E;  2F1M A;  1MFZ A;  1KV4 A;  4I55 B;  2QSA A;  1BS3 A;  3O65 A;  2JGD B;  5AVT B;  4X1K A;  3S4R A;  5JWP A;  2PGD A;  3MHS C;  1LT9 A;  1DEE G;  1N86 A;  1WB8 A;  4DR2 O;  4RQF A;  5B3S C;  1CPY A;  3J81 N;  3JAS B;  1G6U A;  1OCZ C;  5KLI C;  4X20 B;  4X65 O;  4HZ3 A;  1YBK A;  1M7L A;  4R4M A;  1THZ A;  1OV9 A;  4QNH B;  3Q4H A;  4PA3 A;  1JVM A;  2BCC E;  3D36 C;  3L37 A;  2W6B A;  1URQ D;  1DTO A;  1V9P A;  5FPR A;  1YTZ I;  3G3Z A;  4LF8 O;  1IK9 A;  2R72 A;  2XDJ A;  1E1R G;  1GM9 A;  1YSC A;  1U97 A;  2C0X A;  3V2Q A;  2N04 A;  1Z56 A;  2KLV A;  2O1J A;  2WSF H;  3LID A;  1KYO H;  2XHB A;  1K7D A;  3PTZ A;  1SQP G;  5E79 Z;  1SS1 A;  1VQ7 V;  2JEU A;  1KQF B;  1BDC A;  1EC5 A;  2HYN A;  1VQP P;  2N1T C;  3H32 B;  3L73 D;  4LF4 B;  3RWR D;  2FKX A;  4GLX A;  3A0B Z;  1SVF A;  2IW5 A;  3SR2 C;  1UII A;  3SJA C;  2ZXE B;  3VOU A;  2ADP A;  2E3C A;  5CB4 B;  4DR5 B;  1RP3 B;  4WBN B;  1VDF A;  3CXH D;  1N0N A;  2W83 C;  1MZE A;  1YTF B;  3BVO A;  2SPZ A;  3AE8 C;  4GOE A;  2Q73 A;  3PHL A;  1BT8 A;  1PPJ G;  3CWB H;  1Q7Y W;  1ZRT E;  2ZT9 B;  3KYQ A;  1YXB A;  4B7E A;  3KZI H;  2EBO A;  1BGY E;  1L0L J;  4DV2 O;  2NLJ C;  1N36 O;  5GTI E;  1XEQ A;  1GU4 A;  3VQW A;  4FIP C;  5B5E Z;  4CS4 A;  4UVB A;  4JAA A;  3PLN A;  5KTB A;  4I7Z B;  1X0T A;  1Y4M A;  4BW5 A;  1Y74 A;  3BAS A;  4UB6 Z;  3VMY A;  2FYZ A;  3L36 A;  3RL0 D;  5H9C A;  2FYU E;  4HAM A;  1KMI Z;  1H2N A;  4CH3 A;  2EIN B;  1NU1 K;  3CXC U;  3JAK B;  2RNB A;  2WIT A;  5EBL C;  4L73 A;  4J80 A;  1SQX E;  1BSM A;  4WFB V;  2QJY B;  5JJN B;  4L8J A;  2YKQ A;  2POH A;  1Q8I A;  2Q7H A;  1NT2 B;  4WY4 D;  3B77 A;  1KP3 A;  4P2Z A;  5AW0 B;  2UXB B;  2ARH A;  4HNA B;  4N3Y B;  4X89 A;  4Z1M H;  3FB5 C;  2CAZ C;  3PP5 A;  4UFZ A;  2Y9Z A;  1IBL O;  1W0J G;  1A02 J;  2NPS A;  1K5Q A;  1AI4 A;  1WB7 A;  5L3D A;  2P4K A;  3BAT A;  1IX9 A;  2ILM A;  3JAM N;  2UXC O;  3I55 V;  3CCE V;  1VQM P;  4G27 B;  2KK7 A;  1DLB A;  1G8M A;  1QVF O;  1FOS E;  1JPX A;  1BCC H;  2XAS A;  2P58 A;  1OMI A;  4TV9 A;  3O6Q A;  4B3S B;  2CPB A;  2XKM A;  3UO2 A;  4LFC B;  1GL2 C;  1IK7 A;  5LGN A;  1N7L A;  4JI5 O;  4XE5 B;  5AW1 B;  2AEM A;  3VMX A;  2Y0I A;  2OYI B;  2P1J A;  1F51 A;  4JI4 B;  1FFX B;  5KLV K;  1FZF A;  2Q5Z A;  3PH0 A;  4O2B B;  2LGQ A;  1W5C E;  4Z1V A;  4UXN A;  1F7Y A;  1NHL A;  4OX9 B;  2BE3 A;  2E75 C;  1YHQ V;  1H89 A;  3RK3 C;  1H8A A;  2HLD G;  2WT7 A;  4PD4 E;  2AHY A;  4D6T H;  2QJY C;  1NU1 D;  1SES A;  4CZZ A;  5LP6 C;  1SQB D;  3A0H E;  3EHB B;  1PNL A;  1GW3 A;  3N2G A;  4B3M O;  1G1I A;  3NMD A;  1USD A;  2UUC O;  1YZB A;  4ASW A;  3N2K B;  2YI8 A;  1FZE A;  1P7B A;  3L74 H;  3CWB G;  4K35 A;  2PGG A;  2KUB A;  5KLI B;  1RE3 C;  1SQQ E;  2OTK E;  1Q82 W;  2BCC G;  2FYN B;  1M1J A;  1M8O B;  3T1Y B;  2KSE A;  3N7N A;  3OUF A;  2IBZ H;  1SFC A;  3SGI A;  5EK0 A;  1JY2 O;  5KKZ C;  1S5L X;  3AED C;  1Q81 Q;  1Y66 A;  1KIL B;  1S9K D;  5B66 Z;  4WCE V;  5AW9 B;  3GB7 C;  3SPC A;  4D7T A;  1JY3 O;  3STL C;  1OZ0 A;  2JVD A;  2WLJ A;  2OYI C;  3STZ C;  3JYC A;  1GL2 A;  2Y48 A;  4UV9 A;  5B1O A;  2QTS A;  4I50 B;  1Q3E A;  1RM1 C;  1JCC A;  1N33 O;  4L75 A;  1EZV H;  3V2R A;  2GUZ B;  1GZL A;  3F5W C;  4LF9 O;  3OD4 A;  1L0N G;  1NTM E;  3CI9 A;  3JAL A;  1NTM J;  2HVK C;  2YID A;  1SQX D;  4TV8 B;  3L72 G;  4I5S A;  3HTK B;  3JCZ A;  1T3J A;  4EI2 A;  3CME V;  1FD9 A;  2GSM B;  2K3R A;  1JMM A;  1M4U A;  3SJQ C;  1SFC D;  2ITA A;  5DN6 G;  1L2P A;  4LGD E;  4Y28 J;  1BHB A;  3B2E E;  1FDO A;  5AVU B;  5KAI E;  4G28 B;  2A45 H;  2DQ3 A;  5LMN B;  2NZ2 A;  3W7S A;  2FYU G;  1L4A C;  3MHH C;  4YIP A;  2VS0 A;  1NR7 A;  2K9J B;  1K5S A;  4JPZ B;  3GHG C;  5AVZ B;  3OMA B;  1I5Y A;  1MNG A;  3BCC G;  5KAI Z;  2B1G A;  1QGK B;  3RYC A;  2ZE7 A;  2YDE A;  5KJ7 D;  2AW9 A;  3W7W A;  4IOI H;  1VQM V;  1B6Q A;  5JH7 B;  1J2J B;  4JQ0 D;  1KFN A;  2CH7 A;  3E89 A;  2JGD A;  4LLH A;  3JD1 A;  3TCU A;  2NNU A;  3K0G A;  1H2M A;  3R66 A;  1Q90 D;  1PPJ H;  3E8F A;  2YIU C;  3U1C A;  1SQX G;  3L72 D;  1RF1 B;  2V7Q H;  2XAF A;  3AE2 C;  3G4S V;  2Q7C A;  2BTQ B;  2WPR A;  4OH8 B;  1XNQ O;  2H43 A;  1LNQ A;  1S5L Z;  5B66 E;  5BMV A;  4DR3 B;  4IIJ B;  2B87 A;  4TWK A;  2HOD A;  5AVS B;  3RYF A;  3CCS V;  3W67 A;  1M56 B;  1QLE B;  2KZI A;  1XDC A;  2N1T A;  3DC5 A;  3P8C D;  1NO4 A;  2VQE O;  1FS0 G;  4H44 B;  2F4V B;  1R3J C;  1YIT P;  1SQP H;  4AYC A;  1FAF A;  5CBH A;  4JI7 B;  2PZS A;  5D5P A;  5HFL A;  5IJ0 B;  2E75 B;  3FWL A;  3ZRV A;  1IC2 A;  2Q6A A;  4X1I B;  4LR3 A;  1HWY A;  3UO3 A;  4WY4 A;  5L8R J;  3GWK C;  4HYO A;  4J7K A;  4K8Z A;  3A2A A;  4JAS A;  2IJH A;  1L0L K;  2Y69 B;  4PDR A;  4Z1M G;  1VF5 B;  1YI2 V;  3I5D A;  3CXH H;  3E8B A;  4JI7 O;  1BMF G;  1OCC C;  3DXR A;  3L70 D;  1TUB A;  1TGO A;  3A0H Z;  1PZQ A;  4IFM A;  1S4X A;  3K3W A;  4EFB A;  5D5Q A;  3CC2 V;  1L0N D;  2LR2 A;  3CX5 F;  4MTG A;  1IVS A;  1N7S A;  1J1E C;  1DF4 A;  2E5Y A;  1P84 E;  3EVK A;  1FZA A;  2FB5 A;  2QWR B;  3FB6 C;  1RQV A;  3GLM A;  3JSL A;  3T4D A;  2QGN A;  3CCV V;  2CUG A;  1R1B A;  2QWN B;  5JQG B;  1SQB E;  2G8Y A;  3P3N A;  3OTO O;  1KYO E;  2CH7 B;  1NAF A;  3BCC J;  5TIS H;  1PGP A;  1S9K E;  4JTD B;  4TT3 H;  3T1C A;  5DEC A;  2P90 A;  4PDV A;  3ZHT A;  2I1J A;  4FLX A;  2WSC H;  4RO0 A;  1Y8A A;  3ASO B;  1EDI A;  2A06 G;  2AEF A;  2WVR A;  2VRZ A;  3EFG A;  3L70 G;  1VF6 C;  3Q1M A;  2JKV A;  3CC7 P;  2YS8 A;  3AG3 B;  4LNU A;  1LUW A;  1S2E A;  1RH5 B;  1JY3 N;  3SYC A;  4X1K B;  3ZIA G;  1WA8 B;  1S5H C;  1LWU B;  5CMZ A;  1PV0 A;  4KL1 A;  4LC1 A;  1NVP B;  1YDX A;  1BQZ A;  1L0L D;  2JS5 A;  3CB2 A;  2OWO A;  1WNS A;  3H1H E;  1Z2G A;  2MKV A;  3GW6 A;  1QL1 A;  1MA1 A;  2VQF B;  2RMK B;  4FLY A;  2HKO A;  2KS1 A;  5EC1 C;  2AEJ A;  1SQB G;  2EIM C;  1IBM O;  2LJ2 A;  4PV1 B;  2WLK A;  3Q4H B;  4WFF A;  3A7O A;  4DV6 O;  1IBK B;  1L0N K;  2ZT9 C;  3ETG A;  5IJ0 A;  4DRX B;  3RK3 D;  5H2F Z;  3ABL B;  4ZOL A;  2DJV A;  5LP6 A;  3CCL P;  3GVM A;  1N7S C;  2M0B A;  1SER A;  3H1I D;  4DR7 B;  2R9A A;  3HUS B;  1E1Q G;  3EFF K;  2F93 B;  3CYO A;  1CW5 A;  2HHH O;  2Z5I A;  3M91 A;  4NPD A;  5CCH A;  4X88 A;  4EEQ A;  1IBK O;  2Y4T A;  3JAS A;  2O3J A;  3H1H D;  3K08 A;  2K1A A;  3H1L D;  1PPJ E;  4FFK A;  5LGT A;  1ZW0 A;  1VQL V;  2ITC C;  4QJF B;  1VIB A;  2KQX A;  2I1K A;  1JMK C;  1SS3 A;  3K5M A;  3WB1 A;  2IZ0 A;  1N73 C;  2JJ1 G;  3L73 E;  4F4L A;  1EXI A;  1GM8 A;  3L73 J;  2P10 A;  1AP6 A;  3KDP B;  1R6T A;  3JAT A;  3I56 P;  3CP1 A;  3V4Q A;  4O9B A;  1SZX A;  3LSS A;  4RKU J;  2ZIN A;  1HW7 A;  2WSS H;  3UQ8 A;  1K3E A;  4CS3 A;  2ZM6 O;  3II6 A;  2R3S A;  1M9N A;  2WLL A;  3SYO A;  4LH7 A;  4DR5 O;  5DED A;  2ZYG A;  3ABU A;  1JY3 P;  4KT0 J;  1Z5W A;  3AEF C;  1WRG A;  1Q82 Q;  1B3Q A;  3OW2 O;  2F66 C;  1M56 D;  5BR8 B;  1QLE D;  4L76 A;  5AW3 B;  2QWP B;  4J41 A;  3OEH G;  1BGY J;  1KIL E;  2O01 H;  3AG2 B;  5IYD O;  1EDJ A;  2Q9L A;  1VQ5 V;  1JY2 P;  2Z5H A;  1AFO A;  2Y0P A;  2UU9 O;  3P3P A;  3IFX A;  5CCG C;  3A0B H;  1Q81 W;  3A8T A;  1HGV A;  1V54 B;  2UUB B;  1LTJ A;  3ZHU A;  1FDI A;  1SQX H;  3UKM A;  4X8A A;  1KTM A;  2YIB A;  2QM7 A;  4NTX A;  1M90 Q;  4YJ3 B;  1VQ8 V;  4DV4 B;  4B3S O;  4YPC A;  1ZME C;  1UIX A;  1SET A;  5KAF Z;  4UCT A;  2FML A;  3JAK A;  2R70 A;  4DRX A;  4U7J A;  2OYO A;  3V2N A;  3ZHQ A;  4I9W A;  4K0K O;  1I5X A;  1VQ6 P;  1LTB C;  2BSK B;  1KB9 H;  5KX5 A;  1KZU B;  4BIO A;  1V55 B;  2HVJ C;  2IBZ E;  4FLW A;  4GYC B;  5A9G A;  1BGY G;  3H1J D;  5GTH E;  1OX3 A;  1B06 A;  3CCQ V;  3ZMT A;  1JX9 A;  1MZ9 A;  2A79 B;  1SQQ H;  4NTW A;  5IE9 A;  2DYS C;  3T1Y O;  1QR9 A;  1P4R A;  1MSW D;  2Q9I A;  4LFB B;  5IWA O;  1AP5 A;  2XV5 A;  2A7W A;  1EZV E;  3FWN A;  1JFF B;  1A32 A;  4PD4 I;  1RM1 B;  1FXK A;  2N74 A;  2C0W A;  3MUD A;  3H1I H;  1JTH B;  3AE4 C;  3H1I J;  2JEE A;  4DW1 A;  3L9D A;  1M1K W;  5APS A;  3HE4 A;  2IFM A;  4PD4 H;  1PL4 A;  1RQU A;  4JBZ A;  4DV3 B;  3K5B A;  3L71 G;  2ZVO B;  3VP8 A;  4PV1 C;  4O4H B;  4OXS A;  3OMN B;  2CTR A;  2M8R A;  2A0L A;  2E76 C;  5H6Q A;  3GF7 A;  1JCD A;  3E8H A;  2OYQ A;  3LNN A;  4N21 A;  4GKJ B;  2WPD G;  4UCR A;  2ZKO A;  4W7Z A;  4ICG A;  4GOD A;  1KYO I;  2WA4 A;  2YIB D;  1P84 H;  1NAY A;  5DJU B;  4MTO A;  1SF9 A;  4CC6 A;  4DT0 A;  3CRQ A;  3CMA P;  1TUE B;  4PJ0 Z;  4PHZ A;  5B66 H;  1Y9B A;  2CTQ A;  1AQ5 A;  1G4Y B;  4PDM A;  2WSS G;  4RUE A;  3L70 H;  4PEL A;  2E76 B;  3UCS C;  2WLI B;  2BOC C;  1GW4 A;  1XQ8 A;  4ZI7 A;  2W6A A;  2WSF J;  5BVZ A;  1H2K A;  1NS1 A;  3C3S A;  5JJE B;  4D6T E;  1GMJ A;  1AV1 A;  2CGO A;  2KSD A;  3L71 J;  1VF7 A;  3OAK A;  5AG2 A;  5L3G A;  1XBL A;  1AI6 A;  4FM1 A;  4DR4 B;  3AG7 A;  1FZG A;  4DV1 O;  2GM4 A;  3K03 A;  1BE3 H;  1LTT C;  5AW7 B;  4JZ2 A;  2QWQ B;  1NTK E;  1S5J A;  2OTL V;  2ZYD A;  5EBW C;  5KJ7 C;  3UT5 A;  1DEB A;  4PA6 A;  1RSO B;  2R9I A;  1GL2 B;  2FYU H;  3MIW A;  2G3A A;  3Q2Y A;  2KNC A;  2KI7 B;  2FFD A;  3E1I A;  3OTF A;  2YSU B;  4I50 A;  3IFM A;  3S3X A;  5L3F A;  1SQV D;  4DZO A;  2FYU K;  1Y47 A;  1DF5 A;  1JFF A;  1VF5 C;  1JO5 A;  4H13 B;  4I0X A;  5KAF E;  1EN4 A;  1MFT A;  4TV8 A;  2IPP A;  3TGU D;  3A5T A;  3CX5 H;  1YJ9 V;  1D5N A;  1N32 B;  4YY3 B;  3OT7 A;  1WA8 A;  4MVM A;  1LWU A;  1PP9 D;  2IX7 C;  3IN6 A;  2X6B A;  4GDO A;  3H1I G;  4ZNC A;  2IJK A;  1W2E A;  3LW5 J;  1L0N J;  2MJZ A;  1WAZ A;  4WB4 A;  2VQF O;  1H2L A;  2Q5U A;  2PUS A;  1DH3 A;  2YXY A;  3RYC B;  1M57 B;  2Q69 A;  4UCU A;  1EZV D;  1OW6 A;  4NVP A;  1KC8 W;  1K34 A;  1JCH A;  2FTK A;  2JDI G;  2ZDI C;  4MS2 A;  4PJ0 H;  1YJW V;  2ATK C;  4OVN F;  1N2D C;  3G71 P;  3CCJ P;  2BCC H;  5DJT B;  4HNA A;  1SQB H;  2YIU B;  1GTW A;  1YHQ P;  3D6Y A;  1GN2 A;  4JI5 B;  3CWB E;  4JF7 A;  2Z4E A;  3ETD A;  4ZI7 B;  1KN7 A;  2YEV B;  5C8Y B;  1ENV A;  1M57 C;  2L91 A;  5AVW B;  1VQK V;  4O4I A;  2X6A A;  4P30 A;  1VF6 A;  2EIL B;  4QE7 A;  2OYH C;  1S72 V;  1HWT C;  3RYF B;  4LP8 A;  1W59 A;  1HNX O;  4AHC A;  1M5I A;  4LF7 B;  2C9N Y;  2RN9 A;  3L71 D;  4C7N A;  3B5N B;  2IDB A;  4EB6 A;  5EYP A;  1K73 Q;  3JAT B;  3JD0 A;  4MTF A;  1U7J A;  4BWN A;  1OVU A;  2BEZ F;  1EBO A;  2M7W A;  3ABK C;  2PF4 E;  1M90 W;  1NR1 A;  5B1A C;  2IH1 C;  4PDL A;  2IJJ A;  3RN4 A;  2CTP A;  1YTZ T;  1L0L H;  4I0X B;  2XOK G;  5CBF A;  2WSE J;  3E1R A;  2CGN A;  1VQ6 V;  2IFN A;  1K05 A;  5CCG A;  1OCO C;  3AE1 C;  3CD6 P;  5K1P A;  3I5C A;  2Q0A A;  5AW2 B;  4JI1 O;  1LTA C;  2Z0A A;  2J59 M;  2VWK A;  3ZBH A;  5LL6 Y;  3G67 A;  3ZS8 C;  1XIL A;  1SQP K;  1MSD A;  3KHU A;  4ZKP A;  2A06 E;  2QRX A;  1J1D B;  2QJP B;  2PI4 A;  1J95 A;  4QPJ A;  3HD7 A;  5LXT B;  4Y99 C;  1SQV H;  2Y0C A;  3F7V C; 
#chains in the Genus database with same CATH homology
 3AEE C;  1YQ4 C;  4IL6 X;  4TT3 H;  3B71 A;  3AE6 C;  1UIX A;  1ZME C;  4Y28 J;  1FDO A;  1VF5 C;  1YQ3 C;  3D71 A;  4H13 B;  4U7J A;  2NZ2 A;  2WPV B;  1OW7 A;  3ABV C;  1PIX A;  3AE7 C;  4YTP C;  4Z1M H;  3Q1M A;  1AJY A;  2K9Y A;  2D2C C;  3AE5 C;  3D6Z A;  1R8E A;  4H0L B;  3IN6 A;  1KOR A;  2JP3 A;  2QSI A;  4GDO A;  1MKM A;  2JO1 A;  3LW5 J;  4YXD C;  2J5U A;  1PL5 A;  3AE3 C;  2MKV A;  1OMI A;  1PV3 A;  2QIW A;  3O6Q A;  4PV1 D;  3AEB C;  1IK7 A;  4PV1 B;  4OGQ D;  2ZT9 C;  2H89 C;  1EXJ A;  1OW6 A;  1Q90 D;  2YIU C;  5M1B A;  3SFE C;  3T97 B;  2V7Q J;  3AE4 C;  5KLI C;  4R4M A;  3AE2 C;  2H88 C;  2E75 C;  4H13 D;  1RQU A;  2FXP A;  1U57 A;  3AE9 C;  3Q5R A;  2QJY C;  3D6Y A;  3AEA C;  4OGQ C;  1ZP0 C;  3IAO A;  1OW8 A;  4I7Z C;  4PV1 C;  2BEQ D;  3FGA D;  4R4L A;  3S9O A;  3EWK A;  2E76 C;  2FBW C;  3GF7 A;  4H44 B;  1K04 A;  1KQF B;  1JB0 J;  2D2C B;  1DIP A;  1ZOY C;  3RK3 E;  2QJP C;  2E75 B;  2O01 J;  1EXI A;  2P10 A;  4XFJ A;  1DD4 A;  2ZT9 D;  2IDB A;  3GMA A;  3RL0 g;  5L8R J;  2WQY C;  4OGQ B;  5KKZ C;  1Y9B A;  1HF9 A;  1S5L X;  3AED C;  3R4Y A;  1VF5 B;  3AE8 C;  4RKU J;  1NGM B;  1WMK A;  2BEZ F;  2FYN C;  2E76 B;  1VF5 D;  3C8V A;  3Q5S A;  1ZRT E;  2E76 D;  1VL2 A;  3Q3D A;  2WSF J;  3Q5P A;  2ZT9 B;  2QJK C;  4KT0 J;  1GMJ A;  1DD3 A;  1NYH A;  2WSC J;  2WSE J;  2E74 C;  3AEF C;  4H0L D;  3D70 A;  2YMK A;  4I7Z B;  1K05 A;  2D2C D;  2OQQ A;  3G9R A;  3AE1 C;  1KQG B;  2E75 D;  1KIL E;  2E74 D;  1HJ0 A;  3SFD C;  4H44 D;  3GLM A;  1RQV A;  2E74 B;  1KMI Z;  3H25 A;  1TU3 F;  2G3A A;  1FDI A;  3GF3 A;  3Q2Y A;  3AEG C;  4H13 C;  2G8Y A;  3AEC C;  4H0L C;  1S1C X;  4H44 C;  1KTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...