4H0LB

Cytochrome b6f complex crystal structure from mastigocladus laminosus with n-side inhibitor nqno
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4h0lB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h0lB01
4I7ZB 4IL6X 4H0LB 2E75B 2WPVB 3LW5J 4KT0J 4Y28J 2QJPC 2QSIA 1ZRTE 4OGQB 5KKZC 2ZT9B 5L8RJ 2FYNC 2E74B 2YIUC 5KLIC 2O01J 2WSFJ 4H44B 4H13B 4PV1B 2QJKC 4RKUJ 2QJYC 2QIWA 1S5LX 2WSEJ 1JB0J 2K9YA 3C8VA 2WSCJ 1VF5B 2E76B 1Q90D 2D2CB
chains in the Genus database with same CATH superfamily
2B87A 3H1KJ 1A32A 4JI2B 4HBNA 2Z5UA 5EK0A 1VQ8P 4IFFA 3AG1C 4UFZA 1NTZD 1M56C 2EIMB 5GTHH 4CC6A 2PFXA 3TXSA 4X1YB 5APSA 3L74H 1BMFG 3T1HO 3PTZA 3MZWB 1USDA 2AEMA 3CCEV 4PD4E 1JEKA 4UXNA 3RYCA 4IOIH 5BZBA 5KLVK 1HNXB 4DW1A 3R2PA 1IVSA 1FZBA 3ZHRA 3K5MA 3ZMZA 1Q6IA 2L5GB 2W6BA 1QR8A 2ETNA 2KXPB 4DV0O 3TSIA 4NXNB 4N78E 2YKPA 3SPHA 4JZ2A 4WBAA 2KZJA 1L0LH 4HYOA 1EZVE 1JVMA 2ZT9B 1OCZC 4LH7A 3WB2A 2A45H 2ZE6A 3K57A 1MUUA 3CXHF 3SWKA 2LKMA 4EEQA 1K8AW 1M1KW 4GKKB 2BTQA 1Y9BA 1EXIA 1LWUB 4I50A 1SFCB 5D5PA 2Q67A 5AW8B 3LUTB 4HYTB 3MHSC 1GU5A 4JI8O 1CI6B 3C8VA 3WUTA 1IC2A 2KSJA 1FZCB 2MKVA 5EFWB 3Q5PA 4D7SA 3CC7V 2V7QH 3CRAA 3RL0B 2W6JG 2RKLA 1GMGA 2QSIA 1WRGA 4FLVA 2ZYGA 2JWAA 4H13C 1VQLP 1VQKV 1VF6A 1L0LG 2A3QA 4B3SO 2DYSC 3OM3B 4DUZB 1Q7YW 5CCGD 2XAJA 1YI2P 3QG5A 3FXEA 4YXWH 4WY4D 4X64O 1MFZA 5KHIA 1GK6A 1MZEA 2P06A 1AQTA 1M7LA 3MUDA 3P8MC 2OCCC 1WA8B 1DD3A 4I9QA 3NR7A 3H1JH 2VQFB 4I0XB 1QGKB 2ZVOB 2DWEC 3SYOA 3O9OA 4FLZA 3P8CE 2ZM6O 1AQ5A 4DR3B 1S3JA 3BATA 3SR2C 1LWUC 1M56D 2UUAB 2ADPA 1NTKK 4C7RA 4DUYB 3UT5B 1NH2B 1X9VA 1BCCG 1SQBG 3HD7A 1JJOA 1KQLA 4UB8Z 3CCMV 1G1IA 1BCCD 1SQQJ 1YTZT 1YBKA 2JEXA 2BCCE 4ZKPA 2WLJA 1PPJG 4LF5B 2BEZF 1W2EA 3GHGA 3WU2E 4MVZA 1RE3C 4ABMA 3FX0A 2ZD9A 4AQYB 2DWDC 2NN4A 1KZUB 1Y47A 2Z4EA 5JJJB 2BTOA 1FFXA 5LGTA 3RK2C 1EN4A 4PI2A 2AXTE 1BE3D 2CGNA 4KP4A 5KLIC 1CP9A 1LTAC 1FDIA 2Q7CA 2YI8A 3SPJA 1MSWD 3H1JJ 3I5CA 3BHPA 1VEWA 1QEXA 4MN4C 4QPKA 5CBFA 4DV7B 2PGGA 3UO3A 2M5AB 3CX5E 2XUMA 3ZDMA 3FAVA 5H2FZ 1D7MA 5AVUB 3JYCA 3BPZA 2XU6A 4H44D 5JJEB 3L72D 3A3YB 1KILC 1ZLZA 4LH6A 4CH4A 1OCRC 2X0LA 2JS5A 4TV8A 3BEHA 4DV5B 1L4AA 1QCEA 3CC4P 2EZPA 2Q0AA 1RHZB 5CMUA 1SKVA 2ZR2A 3HTKB 2CTPA 2KB7P 3LIDA 1OCRB 1DD4A 4PA7A 5JQGB 1SS3A 1SQPG 3A0HH 1KKDA 2N1TC 2QJYC 3HKBA 3M8AA 1GL2D 1E79G 2N1TA 3D36A 1PP9H 2ZXWB 3W67A 1Q5OA 3BABA 2DW3A 4P9PA 1Q90D 4BW9A 3H1HG 1Y76A 2Y0DA 5KLIB 4O2AA 1SS1A 1BS3A 1GN4A 2EILB 3QTCA 2WPSA 3WB0A 2GA1A 4J7JA 1LP1B 5APVA 4GYCB 4LF6B 4FIPC 1PM9A 4LF8B 2UU9B 2ZCEA 2R5DA 1N33O 4H33A 2WSFJ 3D36C 1NU1K 2G38A 1AR4A 1KORA 1G6UA 2AGAA 3OAKA 4DR7O 2XNXA 4HKZH 4TV9A 2QJPB 3V2NA 3ZMVA 3SJBC 3VN0A 1BSNA 1GW4A 4QE9A 5BR8O 2PZSA 5E1AC 1XNQB 3ZHVA 1ROPA 3HKEA 1PGOA 3FB5C 4EFEA 1NH2D 4X62O 3WU2Z 1MV8A 2JRIA 4X1IA 3AEAC 2R70A 1KILA 3CX5H 2CPBA 1SQXE 3CE2A 2UXXA 4I5SA 1VQNP 1ZSPA 2F23A 1KILE 4HNAA 1F4MA 2P5OA 2A06E 3H1HH 1RSOA 1TUBA 4EKWA 3W7WA 3I56V 3IN6A 4DJGA 3LSQA 2EZOA 3JD1A 3K5LA 4H44C 4NPDA 2FYUJ 5LHGA 4R8CA 2WT7A 3B40A 1KFNA 2GHYA 3FB6C 2DYSB 2CPSA 5DJUB 3G9RA 3KDPB 3AE7C 1SQBD 4N3YB 5BVZA 4H37A 1AI5A 1BZKA 2FYUG 2B89A 1LT9B 2N74A 4X20B 3VMYA 1R1BA 4X65O 2CH7A 5TJHA 3N2KA 1Q8IA 4IHJA 3BRTB 5APQA 1DEEG 4WFAV 3EFGA 2KZIA 5C8YB 2W8ZA 5A2QN 5KJ7A 3M91A 5IYZA 2XOKG 4X89A 3TNUA 1RM1B 1S72P 3TETA 5KHJA 1SQPD 4B3TO 4DZOA 1M4UA 1N8RW 3OEEG 4FLTA 1QNMA 1G1JA 2Q5ZA 3N2GA 2E3CA 5LP6A 3TJTA 1EDIA 1R5LA 2LGQA 5IYDO 4DV6O 1RY3A 4K8XA 2UWJE 4I50B 3L71H 4DK0A 1QR9A 1W0JG 4KFMA 5AVTB 1N36O 3ICXA 4U3JB 4DV2O 3E89A 2JGDB 3OFNG 1RQUA 2RCVA 3E8BA 5HFLA 3FB7C 4GCZA 2JP3A 1OCZB 1Y4MA 1LTBC 3IFMA 2EJ7A 2K88A 5KTBA 1JPXA 1Z5WA 1VQMP 1YJNV 5J2TA 3J81N 1XHZA 2MW2B 2OIGA 3W7TA 4L76A 1DIPA 4DRXA 3GMAA 4I1LA 1TVKB 5B3SB 4DR7B 3D70A 5FPRA 1YIJV 1KP2A 5APTA 4C46A 2XT9A 1P84I 4J80A 1K9MW 2GUZA 1R3LC 1AJNA 2QE7H 2JO1A 2YEVB 2Q5UA 5GONB 4JI1O 3U11A 4LFCO 1T5EA 1TUEB 2VRZA 2Q6QA 1XMOB 2RQ6A 1HGVA 3VMXA 4DOJA 3AG1B 3NXSA 1YITV 4B7KA 1FAVA 2Q68A 1FJKA 3AE8C 4WB4A 3OR7C 1T2KD 2OTLV 2WLLA 2F66C 4BWNA 5CCHC 1VQPP 5KAIZ 1FXKB 4U3FD 3V5BA 1N0JA 1S5LE 3IGAC 4MVRA 1NS1A 1X59A 2IJKA 4UVBA 1GD2E 4MVUA 1VQ4V 3LDEA 3UCSC 1ZW0A 3U59A 2Q4PA 3IJ4A 1N4CA 1T8ZA 4WY4C 1J1DC 1SESA 4OXSA 1BHBA 2G8YA 1N7SB 3JD4A 1NO4A 3JALA 2IBZI 3AE5C 1PPJD 4FM0A 3IR9A 1EC5A 2ZQMA 4WFHA 3JASA 1EN6A 4C7NA 2ZE7A 4IT5A 1GL2C 5AVXB 3CC2P 2CH7B 5BU8B 1ZRTE 1ZXGA 3L73G 4TQDA 1U97A 4WWIA 5AG2A 3HRNA 3MUDC 4YIPA 2CAZC 2Y0EA 3A0HE 2YXLA 1HWYA 4LR3A 2PRRA 3P7KA 1OWAA 3ZMUA 1PNMA 5LOVA 1K8AQ 3P30A 2ZDIA 2CDYA 4R4MA 1FFXB 1IBMB 2Y0CA 1B6QA 4AILC 3CHXA 3AEGC 1RFYA 3L75E 4QPJA 4BWAA 3BASA 3V2PA 3CPWO 1Q86W 3ZCCA 5KKZC 2WLKA 1LNQA 4LCUC 4IL6H 1HJBA 2J58A 2FFDA 1M57B 3BAAA 5CA0A 3ZEDA 4IYHA 3JCUZ 1H0TA 1XBLA 4YTPC 4WFBV 4OGQD 3L75G 2YXRB 2Y0IA 3IC9A 1HP8A 2R3SA 3H1ID 1VIBA 1ZUQA 3G71P 3D6ZA 1N33B 2Z5HA 5FPOA 5LA6B 1NJIW 4TLFA 1PL0A 2E42A 4YY3O 4CS2A 2HR3A 4TV8B 4LGDE 2DJVA 3JSVC 4BIUA 2KK7A 2NR5A 4FPPA 2DMXA 3CCSP 2YIUB 2BCCH 4PJ0Z 5KAIE 2KUBA 1EZJA 4L74A 1EDLA 5IYCO 1SRYA 3F89A 2XNDH 1BCCE 5JCOA 2ITCC 3OA7A 2YNYA 3CJHA 3ETGA 2E5YA 2ZXXA 3L74E 1G4YB 3ABLC 4AUWA 1JOYA 5H2FE 3L70H 3RYFB 3ABKC 1Z2GA 4YJ3B 5EYPA 2VQEB 2YMYA 4PJ0E 3BCCE 2CTQA 1SQBJ 2L35A 3UM7A 3A0BZ 4DV1B 4B3RB 2PAJA 1RF0A 1H2GA 2NPSB 1QLEB 1JFFA 1NBMG 1LWUA 2UXDB 3SSUA 2W6IG 4MTGA 2W0FC 1HTLC 2ADQB 1IFDA 1AA0A 3QWOC 4J11A 3K59A 1JCCA 4GOEA 2XKMA 3HKDB 3AK3A 2HEPA 1HH0A 3VQVA 1RPRA 2KLUA 4I4TA 5IJ0B 1Q3EA 2L6LA 1THZA 2YDEA 1VQMV 2ZE8A 2G3AA 4DR6B 1XDCA 1SP4A 3K9AA 2H88C 3SJAC 2KSEA 1S9KE 3SPGA 3CC7P 4MTXA 1PKXA 1ZLLA 2AZ2A 1SZXA 1S0VA 2E74C 1HBWA 3ASOB 1NTMD 1G2CA 1YIJP 3E8HA 1XMOO 1YTFB 2Q7HA 3IC7A 4FK5C 1PV3A 3KZIE 2IPPA 5LOVB 1WA8A 4WVZA 3ZBHA 2ITAA 5KAFE 3QO5A 1NOHA 4NXMB 2F1MA 2QTSA 4X8AA 1KV4A 2H94A 3Q1MA 4JYAB 5AVQB 4LF5O 4JPRA 2K9YA 5IJ9A 5EC2C 2B88A 1M9NA 1VQPV 2A06G 1GK4A 3JATA 4I7ZB 4DR6O 2KKWA 1QVFO 1SA0A 2XASA 5DEDA 5B1NA 3CCRV 4GX0A 1N7SC 3ETDA 3L74D 3S3XA 4B08A 5L3CA 1N7SA 1K73Q 4ZKUA 2N04A 1AV1A 2FL4A 4WBNA 5AVYB 2ZJSE 4G27B 1HNWB 4JBZA 3JASB 1UIIA 3X2QB 1SQXK 3CPWU 3SYQA 4YPCA 1B3QA 1WB7A 1VQ5V 4W7ZA 1LGHB 1I5YA 5L3EA 5GTHE 4UCUA 1FZGA 4I7ZC 1LUWA 3OAAG 5BR8B 1BE3E 1AVMA 2VWKA 4QMAA 5KLVG 1TUBB 4Y99C 2FMLA 2UXBO 4UB8H 3TYYA 3CC2V 2ZXEB 3L4FA 4HB1A 1N2DC 4EFBA 1EM1A 4EB6B 4XE5B 2B1IA 2N1TD 2UXCB 2FTKA 4AI8A 3UQ8A 2UU9O 1CI6A 4TV9B 3R66A 2W83C 3JAKB 4B3MB 1D2DA 3AE6C 2WSEJ 3TGUG 5M1BA 4LF9O 2V1DA 1KQFB 4E2LA 1Q81Q 4W80A 4TT3G 1US6A 3ZX6A 2W0XA 1NHLA 2GM4A 3A7OA 3B2EE 2Q73A 1W59A 2IDBA 1SQQH 1PD3A 5L8RJ 2C9NY 4DV1O 4B3RO 5ITZA 1OX3A 1NTMG 3Q4HB 2OIEA 3OR6C 1RF1B 2MJZA 1WAZA 3SFEC 2PY5A 3ZRVA 4EYYQ 3VP9A 1S1CX 2O3JA 1AILA 4U3JA 4UVCA 1BQ0A 1GMJA 1NTMJ 4K0KB 3H1HD 4W7YA 1I08A 4IFDK 5KHGA 5IWAO 1GN2A 4O4HA 1VQ9P 4IL6E 2Y4TA 2Z3YA 1ENVA 2E76B 2WPRA 1QVFU 1KUQA 4D6TD 1FAFA 4N6JA 2LW7A 2KYVA 3BRCA 1BGYD 2L91A 3OW2O 4MVOA 1BE3J 2W6AA 2W90A 3M9QA 5LL6Y 1SQBH 3O65A 1S5HC 4JI6B 2P6JA 3A2FA 2WAMA 1KFMA 1L4AB 1R5SA 1KC8W 1QVGU 2IX7C 5EYPB 1LT9C 4QJFB 2CK3G 3JATB 3OE7G 2HPCA 3CLQA 2GTAA 4J7KA 1S9KD 4H13D 2JJ2G 5LA6A 3C90A 4LBEC 2OTLP 1SQPH 2UUBO 1NTME 2F95B 3T2MA 2WPVB 1BSHA 4O4JB 3K5NA 1R8EA 3HE5A 2Z5IA 1IFNA 1SZTA 3JARB 3OTOB 3Q3DA 1M5IA 3SYPA 3CRCA 1SQVD 1IXMA 4ZOLA 3V4WA 5KUKA 1BT8A 1KP3A 2D2CC 3B8MA 3O6QA 2ZT9D 3CD6P 2DQ0A 3CCMP 1VF5C 2WSSH 3A8TA 3L72G 2FB5A 4UB6Z 2JKVA 3NTNA 1FC2C 1LTGC 4DT0A 2IBZH 2AZ0A 1NAFA 4FFBA 1SERA 3OJAB 3H01A 3CXHE 1OJHA 4ASVA 5K5GB 2KG7A 2X6BA 3DXRA 1MKMA 1AR5A 2K1EA 2BCCD 3HD7D 1HGZA 4EI2A 4CH5A 3CCUP 3ZMTA 1N32B 1GAXA 2KS1A 2ZAEB 5B1BC 4ZNCA 4P30A 4R7CA 2ZDIC 1LTTC 1WMKA 4H0LC 2A0LA 3H1LG 5GTIH 2YIBD 1JY2O 1GW3A 1KQGB 1FS0E 1H88A 5KAFH 2QJKC 5KA5A 2KNCB 1P84F 2OWOA 2RH0A 3M99B 4UV9A 1P84E 1TAEA 1ZL8A 2H8PC 1LT9A 3O8ZA 3I55V 4RUFA 5DN6G 1L0LD 2VRSA 4K0KO 2POHA 1P84H 4XBFA 3ZRXA 2YICA 1M1JA 3VBBA 3L72E 2WT7B 1M1JC 3ZRSA 4GDOA 1Q7YQ 5GTHZ 1NU1D 1P7BA 3E2EA 1KQSO 1IO4A 1SQQG 2PP6A 3H1JG 4UCRA 4DUYO 3IF4A 5LHHA 4DYLA 3CCQV 4JPZB 3K0GA 3EVKA 1SQVE 3AEBC 3WMM0 5E79E 5CBOA 1FXKC 3LW5H 1YJNP 3FB8C 2LFSA 1KILB 5FNVB 2FBWC 3C3TA 3K5BA 3KPEA 4N21A 4BAYA 3L71E 2Q9LA 3L37A 1UIXA 3OUSA 3BCCH 5IE9A 4OGQB 5LBQA 1Q86Q 3L70E 1IK7A 1P4RA 3KG2A 2R5BA 4XDKA 4LFCB 2IBZE 5LHIA 4DUZO 1VQOV 1URQA 4BIOA 5CBNA 4FZ1A 2QWPB 1SA0B 1YXBA 3RW0A 2M5AA 3K79A 3K5OA 2QDOA 2WPQA 2RDCA 3B5NB 3L9DA 3E35A 3M9BA 3VYIA 4QNHB 3USSA 3ZHTA 3SFDC 5KLVH 2UXBB 5C39A 3E1IA 3CRMA 1EDKA 2M3EA 4JI8B 2HJFC 1L0NG 2OQQA 3HUSB 2MK3A 2A45G 2DYRB 2LW1A 3B5NA 5TISZ 2HVKC 4I9WA 1NJIQ 2HLDG 3CCLV 3GHGB 3RK3C 4AYCA 3L75J 1JUNA 3U0ZA 4L87A 2JEEA 2VQFO 1QX8A 1P49A 5BXZA 5DECA 1RE4C 3RN4A 4X88A 4XDLA 1ZTEA 1XILA 2KQXA 1OCCC 1WLEA 2X6AA 5JQGA 2VWJA 3B5NC 4DV0B 1KILD 2OYHB 3AG7A 2VQEO 1SVFA 2CUGA 1J95A 1DF4A 4CH3A 1FZAA 2FYNB 1AP6A 1R73A 4NYKA 1QVGO 5CA1B 1U7JA 2WLNA 5AVWB 4OX9B 2PYLA 4JV5O 1K05A 2VS0A 3FD9A 2P22C 2Q9IA 3IAOA 4NPFX 1Y6XA 2AHZA 1JNMA 4H13B 1NR1A 4LF7O 3CS5A 4X20A 3JD0A 1X8YA 1N32O 1ZL8B 2JVDA 3TGUJ 3AEFC 4GIFA 5AW4B 1FZCC 2P1JA 3T4DA 2YIAA 1ZP0C 2QWOB 2DOSA 4JTCB 5GONA 1SFCC 2WLMA 3OMNB 1LJ2A 2Y9YA 4B86A 3RYIB 3CWBD 4O4IA 1AP5A 4ZI7B 2IU0A 3FFQA 1NTZE 3H1IE 2IH1C 2OT5A 3B8NA 3B8EB 4FFKA 3STZC 1BDCA 4JAAA 1SQBK 3JSNA 3OTOO 2QKCA 5IYBO 2KLVA 4K8ZA 4Z1MG 3WUVA 2CK3H 4UUJC 2WTYA 3LSSA 4U3FH 1MFTA 2SPZA 1ZR2A 4I4TB 2Q3IA 3FWLA 3H1LJ 2QJPC 1NKDA 1Q82Q 2K9PA 3JCZA 3LDCA 5D5QA 1K7DA 1NH4A 2NZ2A 3AG4C 5KUMA 1JCDA 2GBOA 4HAMA 1SQVH 1LTSC 1E1QG 4PDLA 1M8OB 3ZN1A 4ZMDA 3D71A 3BA9A 2WSCH 1GDTA 1CEZA 4ZBMA 2QM8A 1VF6C 3L35A 5K1XA 2NPSA 1NGMB 4DV4O 3HUSA 1MOFA 1RPOA 3TNUB 4JI3B 2UXNA 4J41A 3K3WA 1NTZG 1OV9A 4PA6A 1YYCA 3LNNA 1J2JB 2N1TB 1AI6A 2IBZD 1L0NK 4M3LA 1Y66A 5AVSB 1PL4A 4HJGH 2IYOA 2ZINA 3MAQA 3OMAB 3LNMB 3ZS8C 4KHPO 1NVPD 4KHPB 4PI0A 1KQSU 1URFA 2C2AA 2R44A 1SFCA 2B87B 1J5EO 3IAYA 5CN0A 1O9GA 3CCQP 1S2EA 1H2MA 4I6MC 3SPIA 2Q3EA 3U1AA 1D5AA 3F7YC 5KA6A 3JCUH 4DR1O 1L4AC 4YXWG 3SWFA 4NTWA 1H8HG 4YJ2B 5LXTA 4LF8O 3CMAP 4JI6O 2DN9A 1Q81W 4PD4D 3ITKA 4XDJA 1H0TB 2QM4A 1YQ3C 1YTZI 1BSMA 3THOA 1X0TA 5H9CA 4HNAB 2C0XA 1N73C 4RUEA 3RGBA 2OTKE 1FXHA 1VF7A 5CA3A 3HE4B 1MNGA 3M0DA 3RBXA 4WFEA 3ML0A 1OCOC 4PHZA 1MSDA 4KXRA 4JI0B 3KCXA 2OYHC 3WUUA 4N78D 3H1IH 1VQ7P 2GV9A 5JJNB 1F4NA 4DO2A 1HW7A 2AXTZ 4PA4A 5EBMC 2ZVNB 1GN3A 1NU1H 2ZFCA 3F5HA 3PP5A 2PYJA 3U1CA 3M7MX 1RF1C 3B71A 2WLIA 3M06A 1LTJB 5DJTB 4RWUA 2JDIG 1AR1B 4X9QA 2FXMA 1WT6A 1YTFD 3FYEB 3H1HJ 3T1YB 1NTMK 4RAIA 3N27A 3HUSC 5KMGB 5LMNO 2BE3A 1OZHA 5LYJB 1UPGA 4Z2WA 2QRXA 2RNBA 2E5LB 2JK5C 3C1LA 3K9SA 1OVRA 2A7WA 1KC8Q 3UIAA 2ITDC 1I7FA 2DQ3A 1SQGA 1URQB 1MZFA 3G80A 4EB6A 4B3MO 2M3BA 1NWQA 4CBCA 3TCUA 2QWQB 4P9OA 1U57A 2OCCB 3JAWA 1KD1W 4NB5A 4U7OA 4MS2A 4JYAO 1L0NJ 2FKXA 3F5TA 1JY3N 4WBNB 3A0RA 4L75A 5LP6B 2BEQD 2HG5D 3RYHB 1KTMA 4PD4F 4PDVA 1WN7A 1TGOA 2XTAA 4JI1B 1K04A 2O01H 2E43A 2HJDA 2Z0AA 2WA3A 4OPHA 1M90W 4JZGA 1S5LZ 5IWAB 5KJ7C 2DE0X 1N34O 1SQXH 4K3AA 3M0DC 3RL0C 1VARA 3KCYA 4FM1A 1VPCA 1FJGB 1XMQO 3WB1A 2EIKC 4IL6X 5AW7B 1ZRTD 5KAFZ 3L73D 2I1KA 3H1IJ 3L74J 5C8YA 3AG3B 3PN1A 1NI8A 2LXCB 2H3OA 4W4KA 5B1OA 3NMDA 5APYA 1FKAO 4DR3O 3ABMB 1IFPA 2KIKA 2OYIA 2N05A 4NXNO 4F4LA 3E86A 1ZV8A 1DK1A 3SDLA 2O01J 1HF9A 4DRXB 1XTGB 1Y74A 1Z56A 1XTCC 2PI5A 2ZT9C 4R4LA 2ZIMA 1L0NH 2QJKB 4TT3H 1OW8A 4KUMA 3HKCB 1YJ9P 1FPOA 1SQVK 5B5EE 2K9JA 1HWTC 1YSCA 2K37A 1TA8A 2P7TC 2YUAA 2BSKB 3G67A 1HNXO 3ASOC 4GT1A 4MW8A 4ZHQB 1HVVA 1OFCX 3CWBH 2B9ZA 1GK9A 4DR4O 1ZX3A 3HKCA 3SPCA 1M56B 2EIMC 4EIJA 1PNKA 2WPDG 3ETEA 2W6JH 1NTZJ 3DSQA 4L73A 3FKSG 1ZAUA 2A9HA 4GX5A 4LF4O 3CX5F 3H25A 4HH2A 4LP8A 1R3JC 4MVQA 2XZRA 2RMZA 4GZRB 3BVOA 2H8PD 1FBMA 1HNZO 1SF9A 1JMBA 3E8GA 1SQVJ 4I55A 1V54C 3A0BH 3A2AA 4G28B 3Q5RA 3CD6V 1JTHA 3RL0g 3V2QA 5GTIE 3ZRWA 3QNEA 2OYQA 2UXDO 5B1AC 1EZVD 3L72J 4WY4A 4O2AB 4J9ZB 3RWRD 1S77D 1S76D 2CTRA 3D6YA 1AVYA 1N7SD 3H1KD 3HPLC 2LXBA 2A45I 3MGNA 1ZR4A 4YIOA 3HTKA 1A02J 3OD4A 4IGGA 1IZNB 3D8CA 3RYHA 2IFMA 1VQKP 2FYUK 1WP8A 1JO5A 3H32A 3P32A 4CPGA 3BA8A 3WG7B 4A7PA 3CCSV 3GB7C 3C9IA 2DW4A 4LWSA 3EXAA 4RQFA 4YY3B 1NTZH 1BHAA 4CZZA 1T3UA 1QU7A 3S4RA 5LMNB 5AW0B 1PP9J 5KLVJ 1GM8A 2A06D 2WWWA 5H2FH 2QWNB 4TUYB 1Y74B 4DR5B 1T6AA 4O4LA 4IFMA 1VQ4P 4JI4B 2E5TA 3VP8A 2FFDC 1E5WA 3P8CD 3CRRA 4DR2O 1RE4A 2JR8A 5L3GA 3RYIA 1NTZK 1Q6HA 2XAQA 5FL7G 2V4HA 2ZM6B 1SQBE 5TISH 2YO3A 4JQ0D 4NTYA 3MTUE 1DLBA 5AW2B 1UFIA 1JY2P 3C3SA 4JF7A 4FLXA 3VQWA 1EZVH 4Z1MH 3G6BA 2XNDG 4X66B 1IBMO 5J2TB 1FZEA 2O01N 1I94B 2QKSA 3GF7A 4IYIA 2V4DA 1GM9A 1IDSA 3AK2A 3HKBB 3M0AA 1WNSA 4Q6GA 3VQXA 1F7YA 3DGEA 1JY3P 4AQYO 1FDOA 2PUSA 2WMMA 2JS3A 1OW6A 2JGUA 2QTOA 2PTMA 2XHBA 1OIPA 1YEWA 4BR6A 1S72V 3H32B 2ZNIA 1G1XB 2JEUA 2IJHA 1SQPK 5A9GA 2J59M 1NQTA 1DH3A 2EIJC 3LSUA 4G2KA 4LNUB 2QEXV 4GKGA 4ZI7A 1YHQV 1XQ8A 2WLLB 1EQ7A 1HUCA 3N2KB 1ZN5A 5B5EH 2LGWA 3EWKA 3P3NA 3CCLP 1Q82W 5B1AB 1VQ6P 1LUVA 1JTHB 3ZHSA 2KNCA 4X1KB 1W2BO 5B66E 1AVOA 3L71G 1PP9E 2UUBB 4F6RB 1HR0B 2JJ1G 1W2BU 1BE3G 1L0NE 2GUVA 5CCGA 1HDJA 3SGIA 1FZCA 5CCGC 4I55B 1G8MA 1HNZB 2Y4UA 4O2BA 5KX5B 4DV7O 1WP7A 3V6IA 5B66H 1OMIA 4PD4I 2Q8VA 2F4VB 3CCJP 3Q2YA 1Z5VA 1QL2A 4DR4B 4MVSA 2UXCO 2FYZA 1X4TA 4QE7A 2Y69B 2HFED 3HD7C 1IFJA 1N34B 5B3SC 1MZ9A 3H1JD 2I8DA 5F2VO 1GTOA 3SYAA 4GODA 5CB4A 3BY6A 1RE3A 1JFFB 3RK2D 4YXDC 3ZMSA 3L73H 1PGQA 3QF7A 3SYCA 2OYOA 4OX9O 2OGUA 1BGYJ 1SQQK 4J7ZA 3A0BE 3GG2A 3S3WA 3H1KE 2JGDA 1XHXA 4JI7O 4GKKO 4FZ0A 3PH0A 3V4QA 2BASA 3W7SA 1VP7A 3SJCC 1XUQA 3ABUA 4X1YA 3D3QA 2OTJP 1BGYG 4RJTA 5EIBC 2QEXP 1GN6A 3H1IG 4Y28J 4ZOLB 3RYCB 1YCIA 3AEIA 3W7XA 2PGDA 4U7NA 1IURA 2FY8A 1KECA 2IW5A 3CL3D 3L71J 3RYFA 3ABKB 1JR9A 1AFOA 3UO2A 4WFFA 1GZLA 4EDFA 1R3IC 3D3IA 2KP8A 3ABMC 3LIEA 3I56P 3KQGA 5CJ4A 2E75C 1VQ9V 2EIKB 2EINB 4BW5A 2YKQA 4BRYB 4UB6H 1AI7A 1L4AD 1R6TA 5JH7A 1JMMA 4ICGA 1KYOF 5J9PC 1VQOP 4DV3O 1K92A 1FXVA 2OYHA 3CCEP 5AVRB 2LJ2A 3AE4C 4H44B 1W0KG 2E76D 2B5UA 3E22A 5EZYB 1PP9G 5ITZB 3TGUH 5CBGA 3CRQA 1JY3O 3TXQA 2IYPA 2OYIC 2D2CD 2WSCJ 3EQ2A 1URQD 1K3EA 1N73A 3G6EV 2LR2A 2FFDB 5JVDB 4YHHO 4KT0J 1SQPE 4ZIBA 3SJQC 1KN7A 4EOTA 2HHHB 1KKCA 1Y8AA 2EBOA 3HR0A 2E5LO 4F6EA 4Q20A 2KB1A 2RMKB 2E74D 1K97A 3AE3C 1WB8A 4RO2A 1JOCA 3GHGC 3RK3B 1M90Q 4MTFA 1GTWA 1IBKO 3A5TA 2DYRC 1K33A 3VQYA 4FVMA 3JAKA 4TSFG 3RT3C 1EZVG 1NVOA 4DV5O 3AEEC 2QR4A 3GWKC 3FXDA 3G3ZA 3OTFA 3Q5SA 3WG7C 3G71V 4LFBO 5K1PA 1L0LE 3H1KG 4DV4B 4X65B 1N73B 4NPEA 5GTIZ 1KYOD 2EILC 5TISE 2R9RB 2Q0OC 3CX5I 1EBOA 5DM6V 2P4VA 2A06H 1KMIZ 4JYBA 4OPAA 1YITP 1M1KQ 2YXHA 4D6TG 4ASUG 3H1LE 1WPXA 3TF5A 2YXQB 4WY4B 1K5QA 1H2SB 2HG5C 3G6EP 4UCTA 4JI4O 2WSEH 1AJQA 3S1KA 3L75H 1FDMA 4GUNA 1VL2A 1SQFA 2ZNJA 3CB2A 1OXZA 1WJZA 3CP1A 3PLNA 1NVPB 1NAYA 2I1JA 1MA1A 2LP7A 4MT8A 3I5DA 3K08A 1IXBA 3N4XA 1V55C 2P4KA 2H89C 2Q7GA 3CCVP 2AXCA 1Q43A 1N0NA 2WLIB 1K34A 2N9YB 2FKWB 3MIWA 4UB8E 2LFRA 5H6QA 5C93A 2QKAA 2OARA 4FMTA 4O4HB 2UUCO 2WITA 4LF7B 1KB9D 3JCUE 3RK2B 4O9BA 3S9OA 1JA8A 2HFEC 3BRVB 4FFBB 3FX7A 2JDIH 1NZ6A 2P2UA 3ZJZA 1AJPA 4DR1B 3E1RA 3QH9A 3DXRB 2AEJA 2FYUE 3K58A 1KYOH 4AQRD 2ZR3A 3AG4B 1NU1G 4FLWA 2A79B 1IBKB 5L3FA 1PGPA 3P3PA 5GW7A 5KLVD 1BGYH 3TDKA 1H8EG 3E22B 5EZYA 3OGIB 3NFQA 5EC1C 2P7JA 1E79H 2QVAA 3PJSK 3STLC 1NTKH 2JWDA 4O2BB 3APOA 1S4XA 2P10A 4QGPA 4D6TE 3H1LD 3AE1C 5CCHD 3AG3C 4QIWF 2W27A 2NPSD 1EN5A 1V55B 3CJHB 4GKJO 1BCCJ 3L75D 1LP1A 3CWBG 2QM7A 1MG1A 4O4IB 4BRYA 1JY2N 5EIBD 3HE5B 3ZHQA 2KSDA 3JSLA 3R4YA 2M7WA 3CMEP 3UKMA 3VOUA 4CS3A 1KU9A 3MHVA 1B06A 3BVHA 2IM9A 4MW3A 4PA3A 4GLXA 4PV1D 4CC5A 1Q2NA 1MMMA 4X1KA 3JALB 2O1KA 4HZ3A 4LF4B 3CMAV 1SFCD 4JV5B 5LP6C 4X64B 1IFIA 5CHXA 3OMIB 3OT7A 1L0LK 1ORQC 2LO1A 4NXMO 1FS0G 2O1JA 4OVNF 5AW1B 4BIZA 5AW9B 1CW5A 1TU3F 1XL4A 2BTQB 2IH3C 1GH6A 3TGUE 1OVVA 1EXJA 2M0BA 1KB9H 5EBWC 3GF3A 3GW6A 1KB9E 4UV8A 1FXKA 4CS4A 5LMUB 4MTOA 4DK1A 1RSOB 2K9JB 4GX1A 2F93B 2R3CA 4LLHA 1VF5D 2J5UA 2E76C 4JYCA 2YI9A 3CXHD 2BOBC 4JTAB 1EDJA 1SQXG 1NYHA 2HKOA 4W4LA 1DGSA 1OW7A 3CI9A 1FOSF 1PPJH 1N36B 1OCCB 1M57D 3CSXA 2YEVA 2YC0A 2BCCJ 1RQVA 2ATKC 1PL5A 3L36A 5CJ0A 3KXDA 1LTJC 1DX7A 1NTKD 2YS8A 2P58A 1LTJA 1P7GA 3DC6A 1JJ2U 3CYOA 4OWFA 1FJGO 3B77A 1TVKA 1XI1A 3V2RA 4O4LB 3T1YO 4IL6Z 5LMUO 2K1AA 5AVVB 4J42A 2QJ1A 4DV3B 4JAUA 3RFRA 1OCOB 2ILMA 2IBZG 1I0HA 1PZQA 1VQ8V 2CTWA 4LWSB 5IJ0A 1Y76B 2WSSG 1ZOYC 2YKOA 1ZMEC 2JJLA 3OW2U 2HODB 1IBLB 4UCVA 1X79B 2IFNA 1DEBA 1SQPJ 4PA9A 3QVNA 5H5NA 3N7NA 4OGQC 4WF9V 2QJYB 2V7QG 3AK1A 1NKNA 1GKFA 1SQQE 4IIJB 2EINC 1U96A 2AEFA 2OTJV 2D3OW 2HODA 5J2UB 3EFFK 3ASNB 2E75B 1ZWIC 3L71D 1GL2A 5BU5A 1XREA 4DCKA 4DV6B 3CXHH 5JH7B 4Z1VA 2FYUD 3L70D 1PNLA 3JD2A 1M1JB 1AROP 3FAVB 4DR5O 1K5SA 1N86A 3LDDA 2M8RA 1JX9A 4JI7B 2B9BA 1S5LX 2PI4A 1EFRG 2YSUB 1RF0C 1F23A 2YMKA 3FGAD 1LR1A 1O9HA 4U3FJ 1N8RQ 3AECC 4TUYA 3ETQA 4C7UA 1X22A 2RJZA 1JMKC 5AVZB 4PJ0H 5KHHA 4TOIA 3W7UA 5JVDA 1VQLV 3KKYA 5JCOC 2CE4A 4JI2O 4JI0O 3L74G 2AHYA 1UJWB 3OUFA 1IK9A 5HFMA 4NVPA 2BSKA 1YJWP 3E7KA 5KAIH 4ZHQA 4P2ZA 3W68A 2Y69C 4PDMA 1IJDB 2XDJA 3HD7B 3E8FA 2O57A 1VF5B 3AE2C 5IY5B 2KS1B 3GLMA 1PP9D 1S5LH 1YDXA 1KD1Q 4GKJB 2KI7B 2YO2A 2Q6AA 1R6KA 3A0HZ 1W5CE 4NKGB 3G4SP 3BCCG 2PF4E 4I0XA 1V9PA 2HPCB 1T2KC 2EJRA 2NRGA 3APQA 3ZHUA 2IJJA 2NPSC 1I5XA 1IFMA 3CMEV 3BCCJ 3DC5A 4GX2A 1JB0J 5EBLC 2R72A 1D5NA 3CCJV 1N7LA 3ABLB 4CH6A 1U7MA 2R9AA 2ZE5A 1YZBA 3J7AU 5KHKA 4U3FE 5IDJA 5L3BA 3JD3A 2YXYA 2FYNC 3WU2H 2WLHA 2YIUC 5AW3B 4C7NB 4LFBB 1K4DC 4B3SB 4KJMA 1R6NA 4MVMA 1IBLO 1BQZA 1IX9A 1NU1J 1YJWV 3CXCU 1GU4A 2HYNA 5BMVA 4IIJA 2GTSA 1RH5B 1SQXJ 3H9VA 3QO7A 5J2UA 1XNRB 2XAFA 2GDSA 1JCHA 2XAHA 3JAWB 3TK1A 4RESB 1PPJE 1LT1A 2X6CA 5CMZA 3LW5J 1PGJA 3T1CA 4A5UB 3RGUA 2UUAO 3CCRP 1H89A 2P67A 1XEQA 1RP3B 1JM0A 1BCCH 1QL1A 2WSFH 5E79H 3MDSA 1M57C 1J1EB 1H2NA 1NR7A 2IU3A 3BFRA 3II6A 1M93A 1B04A 2LQTA 3JARA 1RF1A 1SQQD 4BXLA 1XOUA 4H0LD 3RK3E 2WVRA 4I2LC 1R3KC 3CXHI 3H6PA 1MABG 1XMQB 1HJ0A 3B09A 3AEDC 2OYIB 4LFAB 2F43G 1BDDA 3CCUV 1BL8A 2RN9A 1AI4A 1LTIC 3JAMN 1WPBA 1K4CC 3K0DA 4LNUA 3AG2B 5APXA 2Q7EA 2V7QJ 2Y0PA 1NT2B 2GSMB 4Y99B 1H8AA 2AW9A 4JI5B 5FNVA 3H1HE 1AJYA 2C9LY 2H7HA 4WCEV 4PDRA 3HE4A 3KHUA 4PV1C 2H43A 1GL2B 3X2QC 4K35A 3CWBE 1OVUA 1VMGA 1YVWA 3ABVC 3L73J 2Q1KA 5BMVB 2QA4P 3I55P 1FJPA 4DV2B 1YHQP 2QE7G 2HLOA 2R32A 1CXZB 2EX3A 2N9BA 2BCCG 1SC5B 2M6YA 5BY1A 5IT9N 1L8DA 5IJ9B 2ZYAA 2ZKOA 1VQNV 1S5JA 1L2PA 4IHJB 4B3TB 3K03A 4PD4H 4ZKIA 2ARHA 1FE6A 3GVMA 2FXOA 5IYZB 3KZIZ 5LYJA 4D7TA 4RQEA 3AE9C 3T1HB 1DF5A 4H0LB 1PFIA 2X7RB 1CZQA 3AG2C 1NTMH 5B1BB 3RK3D 4JF3A 3F5WC 5AW5B 5JWPA 2B1GA 2E74B 4LFAO 4JI5O 1YQ4C 3MD0A 2NLJC 2F4VO 1QQCA 2ZYDA 4UCSA 1G2CB 4LF6O 3ABTA 3ZN0A 1F51A 3UT5A 1KB9I 3F7VC 2IZ1A 3T4ZA 2QG4A 4X66O 2WQYC 5CB4B 3E83A 5B66Z 1HNWO 1AB3A 4ASWA 1J1EC 2ZIOA 2D2CB 1HR0O 1H2KA 4TQFA 2R9IA 1FYJA 3M9HA 5CA0B 3O6QB 4L8JA 1YF2A 2BOCC 1SLQA 1QLEC 3EHBB 4YJ3A 1QLNA 2IZ0A 3N2GB 1QLED 3H1LH 2OCHA 3G4SV 1NTKJ 4DXWA 1Y67A 2YIBA 5KX5A 5B5EZ 5FLXN 1PV0A 3TGUD 4X62B 4OH8B 3CCVV 4GOFA 1NTKG 3SWYA 1P84D 2CGOA 3K04A 3KZIH 5CCHA 1VQ5P 1GM7A 4O4JA 2AXTH 4U3FG 2EIJB 4UCOA 5E79Z 1YJ9V 1CSBA 5KJ7D 4J9YB 1GRJA 3DTUB 1XNRO 3MHHC 2Q69A 1RM1C 5APUA 3HB3B 3MP7B 2UUCB 1KB9F 1SQXD 1NU1E 3OGCC 1L0ND 1K73W 5KLVE 4N23A 3JC22 5LGUA 3RL0D 2GUSA 4JAVA 1A02F 1FOSE 4R50A 2QGNA 4WFGA 3CWBJ 4B7EA 1YI2V 4NR1A 3BCCD 5CA1A 4RKUJ 1L0LJ 2KOGA 1VQ7V 1T3JA 5APWA 1KYOI 5L3DA 4FLYA 2Y48A 4MSWC 4X1IB 3K06A 3VTPC 4FLUA 1Q6UA 2QWRB 2XV5A 1KBHA 3R65A 1URQC 4JGSA 2ODMA 5H6RA 4KHXA 3H1JE 2K3RA 5KKZB 3HKDA 5CBHA 1L1FA 1VQ6V 1XL6A 3PHLA 1BE3H 1GO3F 1J5EB 1E1RG 1XNQO 2KG7B 3FWNA 1QBZA 2Y9ZA 4JI3O 3RVZA 2HP8A 5IY5C 2XAGA 4TWKA 2HHHO 1IZ3A 1CPYA 3CEIA 3Q4HA 2RN0A 1SETA 4PELA 1FD9A 3GWOA 3L72H 3OEHG 4DW0A 2EULA 4D6TH 4UB6E 1DTOA 4LF9B 2GUZB 2IJIA 1FZFA 1FFTB 4FJCC 1SQVG 3B5ND 4E4EA 4F6RA 2HVJC 1I94O 3PRJA 3VOPA 1H2LA 2NNUA 4XFJA 1OHHG 2JIZG 1OZ0A 5LGNA 4FM2A 1NKZB 2C0WA 1USEA 4XA4A 3H1KH 4RO0A 3J80N 3L70G 1KYOE 4NTXA 3U10A 3L73E 4UVAA 2FXPA 1JQ0A 2QIWA 1COWG 2E75D 4LC1A 5AW6B 4DR2B 1J1DB 3T97B 2QSAA 3VMAA 4R6ZA 3L70J 3RVYA 3FYIB 3RBZA 2WZ7A 3KYQA 1NTKE 2ZXWC 2QA4V 4AHCA 4JASA 1PIXA 2P90A 3CC4V 3WFVA 1K9MQ 4JTDB 5LXTB 4YJ2A 4KL1A 3ZIAG 1BGYE 1EZVI 3QO8A 4YHHB 3ZRWB 3ASNC 1V54B 1FU1A 3T97A 1QHTA 2FYUH 4PV1B 3B4SA 3VMZA 2WA4A 4U7JA 3HKEB 1H38A 1VDFA 3IFXA 4J10A 4D6TJ 4JYYA 2YIDA 3CX5D 5KMGA
chains in the Genus database with same CATH topology
2FBWC 1HJ0A 1U57A 3AECC 3AEDC 3G9RA 1UIXA 2E74C 2QJPC 3AE7C 1ZRTE 4OGQB 2NZ2A 1IK7A 2BEQD 1PV3A 2V7QJ 1KTMA 5KLIC 1FDIA 1K04A 1TU3F 1EXJA 4YXDC 3D71A 3GF3A 1KMIZ 1AJYA 4RKUJ 3Q1MA 4R4MA 2K9YA 4PV1C 3SFDC 1NGMB 4H13D 4H44D 1VF5B 3AE2C 1VF5D 2J5UA 2E76C 3GLMA 3ABVC 4I7ZB 3AEGC 4IL6X 2WPVB 1NYHA 4Y28J 2OQQA 1OW7A 1VL2A 1R8EA 5KKZC 2ZT9B 1RQVA 1PL5A 3Q3DA 1RQUA 1DD4A 2D2CC 3O6QA 2O01J 2ZT9D 1HF9A 4YTPC 1VF5C 2JP3A 2H89C 4OGQD 2ZT9C 1Y9BA 4R4LA 1EXIA 2QJYC 4TT3H 1JB0J 1OW8A 2E75C 4I7ZC 1Q90D 3C8VA 3D6ZA 1MKMA 2MKVA 3AE9C 4Z1MH 3Q5PA 4H0LB 1DIPA 3GMAA 1YQ3C 2QSIA 3D70A 3GF7A 1ZOYC 1ZMEC 4H13C 3S9OA 2FYNC 4XFJA 2E74B 1WMKA 1K05A 1YQ4C 2YIUC 4H0LC 2JO1A 2WSFJ 3IAOA 1FDOA 1KQGB 1OW6A 4H44B 4H13B 1KORA 3AE4C 2E76D 2QJKC 4OGQC 3AE6C 2FXPA 2QIWA 2WSEJ 2E75D 3AE8C 5M1BA 3AEFC 2WQYC 2D2CD 1DD3A 2WSCJ 3T97B 1KQFB 3H25A 2D2CB 3B71A 1ZP0C 2E75B 3Q5SA 3LW5J 4KT0J 1PIXA 2P10A 3AE1C 3EWKA 2IDBA 5L8RJ 3AEAC 4GDOA 3Q5RA 3SFEC 1KILE 2E74D 3RL0g 1S1CX 3AE3C 3IN6A 4PV1B 2BEZF 2G8YA 3R4YA 1GMJA 4U7JA 3AEBC 1S5LX 3AE5C 3D6YA 4H0LD 3AEEC 4H44C 3RK3E 4PV1D 2YMKA 3FGAD 1OMIA 2G3AA 2E76B 2H88C 3Q2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I7Z B;  4IL6 X;  4H0L B;  2E75 B;  2WPV B;  3LW5 J;  4KT0 J;  4Y28 J;  2QJP C;  2QSI A;  1ZRT E;  4OGQ B;  5KKZ C;  2ZT9 B;  5L8R J;  2FYN C;  2E74 B;  2YIU C;  5KLI C;  2O01 J;  2WSF J;  4H44 B;  4H13 B;  4PV1 B;  2QJK C;  4RKU J;  2QJY C;  2QIW A;  1S5L X;  2WSE J;  1JB0 J;  2K9Y A;  3C8V A;  2WSC J;  1VF5 B;  2E76 B;  1Q90 D;  2D2C B; 
#chains in the Genus database with same CATH topology
 2B87 A;  3H1K J;  1A32 A;  4JI2 B;  4HBN A;  2Z5U A;  5EK0 A;  1VQ8 P;  4IFF A;  3AG1 C;  4UFZ A;  1NTZ D;  1M56 C;  2EIM B;  5GTH H;  4CC6 A;  2PFX A;  3TXS A;  4X1Y B;  5APS A;  3L74 H;  1BMF G;  3T1H O;  3PTZ A;  3MZW B;  1USD A;  2AEM A;  3CCE V;  4PD4 E;  1JEK A;  4UXN A;  3RYC A;  4IOI H;  5BZB A;  5KLV K;  1HNX B;  4DW1 A;  3R2P A;  1IVS A;  1FZB A;  3ZHR A;  3K5M A;  3ZMZ A;  1Q6I A;  2L5G B;  2W6B A;  1QR8 A;  2ETN A;  2KXP B;  4DV0 O;  3TSI A;  4NXN B;  4N78 E;  2YKP A;  3SPH A;  4JZ2 A;  4WBA A;  2KZJ A;  1L0L H;  4HYO A;  1EZV E;  1JVM A;  2ZT9 B;  1OCZ C;  4LH7 A;  3WB2 A;  2A45 H;  2ZE6 A;  3K57 A;  1MUU A;  3CXH F;  3SWK A;  2LKM A;  4EEQ A;  1K8A W;  1M1K W;  4GKK B;  2BTQ A;  1Y9B A;  1EXI A;  1LWU B;  4I50 A;  1SFC B;  5D5P A;  2Q67 A;  5AW8 B;  3LUT B;  4HYT B;  3MHS C;  1GU5 A;  4JI8 O;  1CI6 B;  3C8V A;  3WUT A;  1IC2 A;  2KSJ A;  1FZC B;  2MKV A;  5EFW B;  3Q5P A;  4D7S A;  3CC7 V;  2V7Q H;  3CRA A;  3RL0 B;  2W6J G;  2RKL A;  1GMG A;  2QSI A;  1WRG A;  4FLV A;  2ZYG A;  2JWA A;  4H13 C;  1VQL P;  1VQK V;  1VF6 A;  1L0L G;  2A3Q A;  4B3S O;  2DYS C;  3OM3 B;  4DUZ B;  1Q7Y W;  5CCG D;  2XAJ A;  1YI2 P;  3QG5 A;  3FXE A;  4YXW H;  4WY4 D;  4X64 O;  1MFZ A;  5KHI A;  1GK6 A;  1MZE A;  2P06 A;  1AQT A;  1M7L A;  3MUD A;  3P8M C;  2OCC C;  1WA8 B;  1DD3 A;  4I9Q A;  3NR7 A;  3H1J H;  2VQF B;  4I0X B;  1QGK B;  2ZVO B;  2DWE C;  3SYO A;  3O9O A;  4FLZ A;  3P8C E;  2ZM6 O;  1AQ5 A;  4DR3 B;  1S3J A;  3BAT A;  3SR2 C;  1LWU C;  1M56 D;  2UUA B;  2ADP A;  1NTK K;  4C7R A;  4DUY B;  3UT5 B;  1NH2 B;  1X9V A;  1BCC G;  1SQB G;  3HD7 A;  1JJO A;  1KQL A;  4UB8 Z;  3CCM V;  1G1I A;  1BCC D;  1SQQ J;  1YTZ T;  1YBK A;  2JEX A;  2BCC E;  4ZKP A;  2WLJ A;  1PPJ G;  4LF5 B;  2BEZ F;  1W2E A;  3GHG A;  3WU2 E;  4MVZ A;  1RE3 C;  4ABM A;  3FX0 A;  2ZD9 A;  4AQY B;  2DWD C;  2NN4 A;  1KZU B;  1Y47 A;  2Z4E A;  5JJJ B;  2BTO A;  1FFX A;  5LGT A;  3RK2 C;  1EN4 A;  4PI2 A;  2AXT E;  1BE3 D;  2CGN A;  4KP4 A;  5KLI C;  1CP9 A;  1LTA C;  1FDI A;  2Q7C A;  2YI8 A;  3SPJ A;  1MSW D;  3H1J J;  3I5C A;  3BHP A;  1VEW A;  1QEX A;  4MN4 C;  4QPK A;  5CBF A;  4DV7 B;  2PGG A;  3UO3 A;  2M5A B;  3CX5 E;  2XUM A;  3ZDM A;  3FAV A;  5H2F Z;  1D7M A;  5AVU B;  3JYC A;  3BPZ A;  2XU6 A;  4H44 D;  5JJE B;  3L72 D;  3A3Y B;  1KIL C;  1ZLZ A;  4LH6 A;  4CH4 A;  1OCR C;  2X0L A;  2JS5 A;  4TV8 A;  3BEH A;  4DV5 B;  1L4A A;  1QCE A;  3CC4 P;  2EZP A;  2Q0A A;  1RHZ B;  5CMU A;  1SKV A;  2ZR2 A;  3HTK B;  2CTP A;  2KB7 P;  3LID A;  1OCR B;  1DD4 A;  4PA7 A;  5JQG B;  1SS3 A;  1SQP G;  3A0H H;  1KKD A;  2N1T C;  2QJY C;  3HKB A;  3M8A A;  1GL2 D;  1E79 G;  2N1T A;  3D36 A;  1PP9 H;  2ZXW B;  3W67 A;  1Q5O A;  3BAB A;  2DW3 A;  4P9P A;  1Q90 D;  4BW9 A;  3H1H G;  1Y76 A;  2Y0D A;  5KLI B;  4O2A A;  1SS1 A;  1BS3 A;  1GN4 A;  2EIL B;  3QTC A;  2WPS A;  3WB0 A;  2GA1 A;  4J7J A;  1LP1 B;  5APV A;  4GYC B;  4LF6 B;  4FIP C;  1PM9 A;  4LF8 B;  2UU9 B;  2ZCE A;  2R5D A;  1N33 O;  4H33 A;  2WSF J;  3D36 C;  1NU1 K;  2G38 A;  1AR4 A;  1KOR A;  1G6U A;  2AGA A;  3OAK A;  4DR7 O;  2XNX A;  4HKZ H;  4TV9 A;  2QJP B;  3V2N A;  3ZMV A;  3SJB C;  3VN0 A;  1BSN A;  1GW4 A;  4QE9 A;  5BR8 O;  2PZS A;  5E1A C;  1XNQ B;  3ZHV A;  1ROP A;  3HKE A;  1PGO A;  3FB5 C;  4EFE A;  1NH2 D;  4X62 O;  3WU2 Z;  1MV8 A;  2JRI A;  4X1I A;  3AEA C;  2R70 A;  1KIL A;  3CX5 H;  2CPB A;  1SQX E;  3CE2 A;  2UXX A;  4I5S A;  1VQN P;  1ZSP A;  2F23 A;  1KIL E;  4HNA A;  1F4M A;  2P5O A;  2A06 E;  3H1H H;  1RSO A;  1TUB A;  4EKW A;  3W7W A;  3I56 V;  3IN6 A;  4DJG A;  3LSQ A;  2EZO A;  3JD1 A;  3K5L A;  4H44 C;  4NPD A;  2FYU J;  5LHG A;  4R8C A;  2WT7 A;  3B40 A;  1KFN A;  2GHY A;  3FB6 C;  2DYS B;  2CPS A;  5DJU B;  3G9R A;  3KDP B;  3AE7 C;  1SQB D;  4N3Y B;  5BVZ A;  4H37 A;  1AI5 A;  1BZK A;  2FYU G;  2B89 A;  1LT9 B;  2N74 A;  4X20 B;  3VMY A;  1R1B A;  4X65 O;  2CH7 A;  5TJH A;  3N2K A;  1Q8I A;  4IHJ A;  3BRT B;  5APQ A;  1DEE G;  4WFA V;  3EFG A;  2KZI A;  5C8Y B;  2W8Z A;  5A2Q N;  5KJ7 A;  3M91 A;  5IYZ A;  2XOK G;  4X89 A;  3TNU A;  1RM1 B;  1S72 P;  3TET A;  5KHJ A;  1SQP D;  4B3T O;  4DZO A;  1M4U A;  1N8R W;  3OEE G;  4FLT A;  1QNM A;  1G1J A;  2Q5Z A;  3N2G A;  2E3C A;  5LP6 A;  3TJT A;  1EDI A;  1R5L A;  2LGQ A;  5IYD O;  4DV6 O;  1RY3 A;  4K8X A;  2UWJ E;  4I50 B;  3L71 H;  4DK0 A;  1QR9 A;  1W0J G;  4KFM A;  5AVT B;  1N36 O;  3ICX A;  4U3J B;  4DV2 O;  3E89 A;  2JGD B;  3OFN G;  1RQU A;  2RCV A;  3E8B A;  5HFL A;  3FB7 C;  4GCZ A;  2JP3 A;  1OCZ B;  1Y4M A;  1LTB C;  3IFM A;  2EJ7 A;  2K88 A;  5KTB A;  1JPX A;  1Z5W A;  1VQM P;  1YJN V;  5J2T A;  3J81 N;  1XHZ A;  2MW2 B;  2OIG A;  3W7T A;  4L76 A;  1DIP A;  4DRX A;  3GMA A;  4I1L A;  1TVK B;  5B3S B;  4DR7 B;  3D70 A;  5FPR A;  1YIJ V;  1KP2 A;  5APT A;  4C46 A;  2XT9 A;  1P84 I;  4J80 A;  1K9M W;  2GUZ A;  1R3L C;  1AJN A;  2QE7 H;  2JO1 A;  2YEV B;  2Q5U A;  5GON B;  4JI1 O;  3U11 A;  4LFC O;  1T5E A;  1TUE B;  2VRZ A;  2Q6Q A;  1XMO B;  2RQ6 A;  1HGV A;  3VMX A;  4DOJ A;  3AG1 B;  3NXS A;  1YIT V;  4B7K A;  1FAV A;  2Q68 A;  1FJK A;  3AE8 C;  4WB4 A;  3OR7 C;  1T2K D;  2OTL V;  2WLL A;  2F66 C;  4BWN A;  5CCH C;  1VQP P;  5KAI Z;  1FXK B;  4U3F D;  3V5B A;  1N0J A;  1S5L E;  3IGA C;  4MVR A;  1NS1 A;  1X59 A;  2IJK A;  4UVB A;  1GD2 E;  4MVU A;  1VQ4 V;  3LDE A;  3UCS C;  1ZW0 A;  3U59 A;  2Q4P A;  3IJ4 A;  1N4C A;  1T8Z A;  4WY4 C;  1J1D C;  1SES A;  4OXS A;  1BHB A;  2G8Y A;  1N7S B;  3JD4 A;  1NO4 A;  3JAL A;  2IBZ I;  3AE5 C;  1PPJ D;  4FM0 A;  3IR9 A;  1EC5 A;  2ZQM A;  4WFH A;  3JAS A;  1EN6 A;  4C7N A;  2ZE7 A;  4IT5 A;  1GL2 C;  5AVX B;  3CC2 P;  2CH7 B;  5BU8 B;  1ZRT E;  1ZXG A;  3L73 G;  4TQD A;  1U97 A;  4WWI A;  5AG2 A;  3HRN A;  3MUD C;  4YIP A;  2CAZ C;  2Y0E A;  3A0H E;  2YXL A;  1HWY A;  4LR3 A;  2PRR A;  3P7K A;  1OWA A;  3ZMU A;  1PNM A;  5LOV A;  1K8A Q;  3P30 A;  2ZDI A;  2CDY A;  4R4M A;  1FFX B;  1IBM B;  2Y0C A;  1B6Q A;  4AIL C;  3CHX A;  3AEG C;  1RFY A;  3L75 E;  4QPJ A;  4BWA A;  3BAS A;  3V2P A;  3CPW O;  1Q86 W;  3ZCC A;  5KKZ C;  2WLK A;  1LNQ A;  4LCU C;  4IL6 H;  1HJB A;  2J58 A;  2FFD A;  1M57 B;  3BAA A;  5CA0 A;  3ZED A;  4IYH A;  3JCU Z;  1H0T A;  1XBL A;  4YTP C;  4WFB V;  4OGQ D;  3L75 G;  2YXR B;  2Y0I A;  3IC9 A;  1HP8 A;  2R3S A;  3H1I D;  1VIB A;  1ZUQ A;  3G71 P;  3D6Z A;  1N33 B;  2Z5H A;  5FPO A;  5LA6 B;  1NJI W;  4TLF A;  1PL0 A;  2E42 A;  4YY3 O;  4CS2 A;  2HR3 A;  4TV8 B;  4LGD E;  2DJV A;  3JSV C;  4BIU A;  2KK7 A;  2NR5 A;  4FPP A;  2DMX A;  3CCS P;  2YIU B;  2BCC H;  4PJ0 Z;  5KAI E;  2KUB A;  1EZJ A;  4L74 A;  1EDL A;  5IYC O;  1SRY A;  3F89 A;  2XND H;  1BCC E;  5JCO A;  2ITC C;  3OA7 A;  2YNY A;  3CJH A;  3ETG A;  2E5Y A;  2ZXX A;  3L74 E;  1G4Y B;  3ABL C;  4AUW A;  1JOY A;  5H2F E;  3L70 H;  3RYF B;  3ABK C;  1Z2G A;  4YJ3 B;  5EYP A;  2VQE B;  2YMY A;  4PJ0 E;  3BCC E;  2CTQ A;  1SQB J;  2L35 A;  3UM7 A;  3A0B Z;  4DV1 B;  4B3R B;  2PAJ A;  1RF0 A;  1H2G A;  2NPS B;  1QLE B;  1JFF A;  1NBM G;  1LWU A;  2UXD B;  3SSU A;  2W6I G;  4MTG A;  2W0F C;  1HTL C;  2ADQ B;  1IFD A;  1AA0 A;  3QWO C;  4J11 A;  3K59 A;  1JCC A;  4GOE A;  2XKM A;  3HKD B;  3AK3 A;  2HEP A;  1HH0 A;  3VQV A;  1RPR A;  2KLU A;  4I4T A;  5IJ0 B;  1Q3E A;  2L6L A;  1THZ A;  2YDE A;  1VQM V;  2ZE8 A;  2G3A A;  4DR6 B;  1XDC A;  1SP4 A;  3K9A A;  2H88 C;  3SJA C;  2KSE A;  1S9K E;  3SPG A;  3CC7 P;  4MTX A;  1PKX A;  1ZLL A;  2AZ2 A;  1SZX A;  1S0V A;  2E74 C;  1HBW A;  3ASO B;  1NTM D;  1G2C A;  1YIJ P;  3E8H A;  1XMO O;  1YTF B;  2Q7H A;  3IC7 A;  4FK5 C;  1PV3 A;  3KZI E;  2IPP A;  5LOV B;  1WA8 A;  4WVZ A;  3ZBH A;  2ITA A;  5KAF E;  3QO5 A;  1NOH A;  4NXM B;  2F1M A;  2QTS A;  4X8A A;  1KV4 A;  2H94 A;  3Q1M A;  4JYA B;  5AVQ B;  4LF5 O;  4JPR A;  2K9Y A;  5IJ9 A;  5EC2 C;  2B88 A;  1M9N A;  1VQP V;  2A06 G;  1GK4 A;  3JAT A;  4I7Z B;  4DR6 O;  2KKW A;  1QVF O;  1SA0 A;  2XAS A;  5DED A;  5B1N A;  3CCR V;  4GX0 A;  1N7S C;  3ETD A;  3L74 D;  3S3X A;  4B08 A;  5L3C A;  1N7S A;  1K73 Q;  4ZKU A;  2N04 A;  1AV1 A;  2FL4 A;  4WBN A;  5AVY B;  2ZJS E;  4G27 B;  1HNW B;  4JBZ A;  3JAS B;  1UII A;  3X2Q B;  1SQX K;  3CPW U;  3SYQ A;  4YPC A;  1B3Q A;  1WB7 A;  1VQ5 V;  4W7Z A;  1LGH B;  1I5Y A;  5L3E A;  5GTH E;  4UCU A;  1FZG A;  4I7Z C;  1LUW A;  3OAA G;  5BR8 B;  1BE3 E;  1AVM A;  2VWK A;  4QMA A;  5KLV G;  1TUB B;  4Y99 C;  2FML A;  2UXB O;  4UB8 H;  3TYY A;  3CC2 V;  2ZXE B;  3L4F A;  4HB1 A;  1N2D C;  4EFB A;  1EM1 A;  4EB6 B;  4XE5 B;  2B1I A;  2N1T D;  2UXC B;  2FTK A;  4AI8 A;  3UQ8 A;  2UU9 O;  1CI6 A;  4TV9 B;  3R66 A;  2W83 C;  3JAK B;  4B3M B;  1D2D A;  3AE6 C;  2WSE J;  3TGU G;  5M1B A;  4LF9 O;  2V1D A;  1KQF B;  4E2L A;  1Q81 Q;  4W80 A;  4TT3 G;  1US6 A;  3ZX6 A;  2W0X A;  1NHL A;  2GM4 A;  3A7O A;  3B2E E;  2Q73 A;  1W59 A;  2IDB A;  1SQQ H;  1PD3 A;  5L8R J;  2C9N Y;  4DV1 O;  4B3R O;  5ITZ A;  1OX3 A;  1NTM G;  3Q4H B;  2OIE A;  3OR6 C;  1RF1 B;  2MJZ A;  1WAZ A;  3SFE C;  2PY5 A;  3ZRV A;  4EYY Q;  3VP9 A;  1S1C X;  2O3J A;  1AIL A;  4U3J A;  4UVC A;  1BQ0 A;  1GMJ A;  1NTM J;  4K0K B;  3H1H D;  4W7Y A;  1I08 A;  4IFD K;  5KHG A;  5IWA O;  1GN2 A;  4O4H A;  1VQ9 P;  4IL6 E;  2Y4T A;  2Z3Y A;  1ENV A;  2E76 B;  2WPR A;  1QVF U;  1KUQ A;  4D6T D;  1FAF A;  4N6J A;  2LW7 A;  2KYV A;  3BRC A;  1BGY D;  2L91 A;  3OW2 O;  4MVO A;  1BE3 J;  2W6A A;  2W90 A;  3M9Q A;  5LL6 Y;  1SQB H;  3O65 A;  1S5H C;  4JI6 B;  2P6J A;  3A2F A;  2WAM A;  1KFM A;  1L4A B;  1R5S A;  1KC8 W;  1QVG U;  2IX7 C;  5EYP B;  1LT9 C;  4QJF B;  2CK3 G;  3JAT B;  3OE7 G;  2HPC A;  3CLQ A;  2GTA A;  4J7K A;  1S9K D;  4H13 D;  2JJ2 G;  5LA6 A;  3C90 A;  4LBE C;  2OTL P;  1SQP H;  2UUB O;  1NTM E;  2F95 B;  3T2M A;  2WPV B;  1BSH A;  4O4J B;  3K5N A;  1R8E A;  3HE5 A;  2Z5I A;  1IFN A;  1SZT A;  3JAR B;  3OTO B;  3Q3D A;  1M5I A;  3SYP A;  3CRC A;  1SQV D;  1IXM A;  4ZOL A;  3V4W A;  5KUK A;  1BT8 A;  1KP3 A;  2D2C C;  3B8M A;  3O6Q A;  2ZT9 D;  3CD6 P;  2DQ0 A;  3CCM P;  1VF5 C;  2WSS H;  3A8T A;  3L72 G;  2FB5 A;  4UB6 Z;  2JKV A;  3NTN A;  1FC2 C;  1LTG C;  4DT0 A;  2IBZ H;  2AZ0 A;  1NAF A;  4FFB A;  1SER A;  3OJA B;  3H01 A;  3CXH E;  1OJH A;  4ASV A;  5K5G B;  2KG7 A;  2X6B A;  3DXR A;  1MKM A;  1AR5 A;  2K1E A;  2BCC D;  3HD7 D;  1HGZ A;  4EI2 A;  4CH5 A;  3CCU P;  3ZMT A;  1N32 B;  1GAX A;  2KS1 A;  2ZAE B;  5B1B C;  4ZNC A;  4P30 A;  4R7C A;  2ZDI C;  1LTT C;  1WMK A;  4H0L C;  2A0L A;  3H1L G;  5GTI H;  2YIB D;  1JY2 O;  1GW3 A;  1KQG B;  1FS0 E;  1H88 A;  5KAF H;  2QJK C;  5KA5 A;  2KNC B;  1P84 F;  2OWO A;  2RH0 A;  3M99 B;  4UV9 A;  1P84 E;  1TAE A;  1ZL8 A;  2H8P C;  1LT9 A;  3O8Z A;  3I55 V;  4RUF A;  5DN6 G;  1L0L D;  2VRS A;  4K0K O;  2POH A;  1P84 H;  4XBF A;  3ZRX A;  2YIC A;  1M1J A;  3VBB A;  3L72 E;  2WT7 B;  1M1J C;  3ZRS A;  4GDO A;  1Q7Y Q;  5GTH Z;  1NU1 D;  1P7B A;  3E2E A;  1KQS O;  1IO4 A;  1SQQ G;  2PP6 A;  3H1J G;  4UCR A;  4DUY O;  3IF4 A;  5LHH A;  4DYL A;  3CCQ V;  4JPZ B;  3K0G A;  3EVK A;  1SQV E;  3AEB C;  3WMM 0;  5E79 E;  5CBO A;  1FXK C;  3LW5 H;  1YJN P;  3FB8 C;  2LFS A;  1KIL B;  5FNV B;  2FBW C;  3C3T A;  3K5B A;  3KPE A;  4N21 A;  4BAY A;  3L71 E;  2Q9L A;  3L37 A;  1UIX A;  3OUS A;  3BCC H;  5IE9 A;  4OGQ B;  5LBQ A;  1Q86 Q;  3L70 E;  1IK7 A;  1P4R A;  3KG2 A;  2R5B A;  4XDK A;  4LFC B;  2IBZ E;  5LHI A;  4DUZ O;  1VQO V;  1URQ A;  4BIO A;  5CBN A;  4FZ1 A;  2QWP B;  1SA0 B;  1YXB A;  3RW0 A;  2M5A A;  3K79 A;  3K5O A;  2QDO A;  2WPQ A;  2RDC A;  3B5N B;  3L9D A;  3E35 A;  3M9B A;  3VYI A;  4QNH B;  3USS A;  3ZHT A;  3SFD C;  5KLV H;  2UXB B;  5C39 A;  3E1I A;  3CRM A;  1EDK A;  2M3E A;  4JI8 B;  2HJF C;  1L0N G;  2OQQ A;  3HUS B;  2MK3 A;  2A45 G;  2DYR B;  2LW1 A;  3B5N A;  5TIS Z;  2HVK C;  4I9W A;  1NJI Q;  2HLD G;  3CCL V;  3GHG B;  3RK3 C;  4AYC A;  3L75 J;  1JUN A;  3U0Z A;  4L87 A;  2JEE A;  2VQF O;  1QX8 A;  1P49 A;  5BXZ A;  5DEC A;  1RE4 C;  3RN4 A;  4X88 A;  4XDL A;  1ZTE A;  1XIL A;  2KQX A;  1OCC C;  1WLE A;  2X6A A;  5JQG A;  2VWJ A;  3B5N C;  4DV0 B;  1KIL D;  2OYH B;  3AG7 A;  2VQE O;  1SVF A;  2CUG A;  1J95 A;  1DF4 A;  4CH3 A;  1FZA A;  2FYN B;  1AP6 A;  1R73 A;  4NYK A;  1QVG O;  5CA1 B;  1U7J A;  2WLN A;  5AVW B;  4OX9 B;  2PYL A;  4JV5 O;  1K05 A;  2VS0 A;  3FD9 A;  2P22 C;  2Q9I A;  3IAO A;  4NPF X;  1Y6X A;  2AHZ A;  1JNM A;  4H13 B;  1NR1 A;  4LF7 O;  3CS5 A;  4X20 A;  3JD0 A;  1X8Y A;  1N32 O;  1ZL8 B;  2JVD A;  3TGU J;  3AEF C;  4GIF A;  5AW4 B;  1FZC C;  2P1J A;  3T4D A;  2YIA A;  1ZP0 C;  2QWO B;  2DOS A;  4JTC B;  5GON A;  1SFC C;  2WLM A;  3OMN B;  1LJ2 A;  2Y9Y A;  4B86 A;  3RYI B;  3CWB D;  4O4I A;  1AP5 A;  4ZI7 B;  2IU0 A;  3FFQ A;  1NTZ E;  3H1I E;  2IH1 C;  2OT5 A;  3B8N A;  3B8E B;  4FFK A;  3STZ C;  1BDC A;  4JAA A;  1SQB K;  3JSN A;  3OTO O;  2QKC A;  5IYB O;  2KLV A;  4K8Z A;  4Z1M G;  3WUV A;  2CK3 H;  4UUJ C;  2WTY A;  3LSS A;  4U3F H;  1MFT A;  2SPZ A;  1ZR2 A;  4I4T B;  2Q3I A;  3FWL A;  3H1L J;  2QJP C;  1NKD A;  1Q82 Q;  2K9P A;  3JCZ A;  3LDC A;  5D5Q A;  1K7D A;  1NH4 A;  2NZ2 A;  3AG4 C;  5KUM A;  1JCD A;  2GBO A;  4HAM A;  1SQV H;  1LTS C;  1E1Q G;  4PDL A;  1M8O B;  3ZN1 A;  4ZMD A;  3D71 A;  3BA9 A;  2WSC H;  1GDT A;  1CEZ A;  4ZBM A;  2QM8 A;  1VF6 C;  3L35 A;  5K1X A;  2NPS A;  1NGM B;  4DV4 O;  3HUS A;  1MOF A;  1RPO A;  3TNU B;  4JI3 B;  2UXN A;  4J41 A;  3K3W A;  1NTZ G;  1OV9 A;  4PA6 A;  1YYC A;  3LNN A;  1J2J B;  2N1T B;  1AI6 A;  2IBZ D;  1L0N K;  4M3L A;  1Y66 A;  5AVS B;  1PL4 A;  4HJG H;  2IYO A;  2ZIN A;  3MAQ A;  3OMA B;  3LNM B;  3ZS8 C;  4KHP O;  1NVP D;  4KHP B;  4PI0 A;  1KQS U;  1URF A;  2C2A A;  2R44 A;  1SFC A;  2B87 B;  1J5E O;  3IAY A;  5CN0 A;  1O9G A;  3CCQ P;  1S2E A;  1H2M A;  4I6M C;  3SPI A;  2Q3E A;  3U1A A;  1D5A A;  3F7Y C;  5KA6 A;  3JCU H;  4DR1 O;  1L4A C;  4YXW G;  3SWF A;  4NTW A;  1H8H G;  4YJ2 B;  5LXT A;  4LF8 O;  3CMA P;  4JI6 O;  2DN9 A;  1Q81 W;  4PD4 D;  3ITK A;  4XDJ A;  1H0T B;  2QM4 A;  1YQ3 C;  1YTZ I;  1BSM A;  3THO A;  1X0T A;  5H9C A;  4HNA B;  2C0X A;  1N73 C;  4RUE A;  3RGB A;  2OTK E;  1FXH A;  1VF7 A;  5CA3 A;  3HE4 B;  1MNG A;  3M0D A;  3RBX A;  4WFE A;  3ML0 A;  1OCO C;  4PHZ A;  1MSD A;  4KXR A;  4JI0 B;  3KCX A;  2OYH C;  3WUU A;  4N78 D;  3H1I H;  1VQ7 P;  2GV9 A;  5JJN B;  1F4N A;  4DO2 A;  1HW7 A;  2AXT Z;  4PA4 A;  5EBM C;  2ZVN B;  1GN3 A;  1NU1 H;  2ZFC A;  3F5H A;  3PP5 A;  2PYJ A;  3U1C A;  3M7M X;  1RF1 C;  3B71 A;  2WLI A;  3M06 A;  1LTJ B;  5DJT B;  4RWU A;  2JDI G;  1AR1 B;  4X9Q A;  2FXM A;  1WT6 A;  1YTF D;  3FYE B;  3H1H J;  3T1Y B;  1NTM K;  4RAI A;  3N27 A;  3HUS C;  5KMG B;  5LMN O;  2BE3 A;  1OZH A;  5LYJ B;  1UPG A;  4Z2W A;  2QRX A;  2RNB A;  2E5L B;  2JK5 C;  3C1L A;  3K9S A;  1OVR A;  2A7W A;  1KC8 Q;  3UIA A;  2ITD C;  1I7F A;  2DQ3 A;  1SQG A;  1URQ B;  1MZF A;  3G80 A;  4EB6 A;  4B3M O;  2M3B A;  1NWQ A;  4CBC A;  3TCU A;  2QWQ B;  4P9O A;  1U57 A;  2OCC B;  3JAW A;  1KD1 W;  4NB5 A;  4U7O A;  4MS2 A;  4JYA O;  1L0N J;  2FKX A;  3F5T A;  1JY3 N;  4WBN B;  3A0R A;  4L75 A;  5LP6 B;  2BEQ D;  2HG5 D;  3RYH B;  1KTM A;  4PD4 F;  4PDV A;  1WN7 A;  1TGO A;  2XTA A;  4JI1 B;  1K04 A;  2O01 H;  2E43 A;  2HJD A;  2Z0A A;  2WA3 A;  4OPH A;  1M90 W;  4JZG A;  1S5L Z;  5IWA B;  5KJ7 C;  2DE0 X;  1N34 O;  1SQX H;  4K3A A;  3M0D C;  3RL0 C;  1VAR A;  3KCY A;  4FM1 A;  1VPC A;  1FJG B;  1XMQ O;  3WB1 A;  2EIK C;  4IL6 X;  5AW7 B;  1ZRT D;  5KAF Z;  3L73 D;  2I1K A;  3H1I J;  3L74 J;  5C8Y A;  3AG3 B;  3PN1 A;  1NI8 A;  2LXC B;  2H3O A;  4W4K A;  5B1O A;  3NMD A;  5APY A;  1FKA O;  4DR3 O;  3ABM B;  1IFP A;  2KIK A;  2OYI A;  2N05 A;  4NXN O;  4F4L A;  3E86 A;  1ZV8 A;  1DK1 A;  3SDL A;  2O01 J;  1HF9 A;  4DRX B;  1XTG B;  1Y74 A;  1Z56 A;  1XTC C;  2PI5 A;  2ZT9 C;  4R4L A;  2ZIM A;  1L0N H;  2QJK B;  4TT3 H;  1OW8 A;  4KUM A;  3HKC B;  1YJ9 P;  1FPO A;  1SQV K;  5B5E E;  2K9J A;  1HWT C;  1YSC A;  2K37 A;  1TA8 A;  2P7T C;  2YUA A;  2BSK B;  3G67 A;  1HNX O;  3ASO C;  4GT1 A;  4MW8 A;  4ZHQ B;  1HVV A;  1OFC X;  3CWB H;  2B9Z A;  1GK9 A;  4DR4 O;  1ZX3 A;  3HKC A;  3SPC A;  1M56 B;  2EIM C;  4EIJ A;  1PNK A;  2WPD G;  3ETE A;  2W6J H;  1NTZ J;  3DSQ A;  4L73 A;  3FKS G;  1ZAU A;  2A9H A;  4GX5 A;  4LF4 O;  3CX5 F;  3H25 A;  4HH2 A;  4LP8 A;  1R3J C;  4MVQ A;  2XZR A;  2RMZ A;  4GZR B;  3BVO A;  2H8P D;  1FBM A;  1HNZ O;  1SF9 A;  1JMB A;  3E8G A;  1SQV J;  4I55 A;  1V54 C;  3A0B H;  3A2A A;  4G28 B;  3Q5R A;  3CD6 V;  1JTH A;  3RL0 g;  3V2Q A;  5GTI E;  3ZRW A;  3QNE A;  2OYQ A;  2UXD O;  5B1A C;  1EZV D;  3L72 J;  4WY4 A;  4O2A B;  4J9Z B;  3RWR D;  1S77 D;  1S76 D;  2CTR A;  3D6Y A;  1AVY A;  1N7S D;  3H1K D;  3HPL C;  2LXB A;  2A45 I;  3MGN A;  1ZR4 A;  4YIO A;  3HTK A;  1A02 J;  3OD4 A;  4IGG A;  1IZN B;  3D8C A;  3RYH A;  2IFM A;  1VQK P;  2FYU K;  1WP8 A;  1JO5 A;  3H32 A;  3P32 A;  4CPG A;  3BA8 A;  3WG7 B;  4A7P A;  3CCS V;  3GB7 C;  3C9I A;  2DW4 A;  4LWS A;  3EXA A;  4RQF A;  4YY3 B;  1NTZ H;  1BHA A;  4CZZ A;  1T3U A;  1QU7 A;  3S4R A;  5LMN B;  5AW0 B;  1PP9 J;  5KLV J;  1GM8 A;  2A06 D;  2WWW A;  5H2F H;  2QWN B;  4TUY B;  1Y74 B;  4DR5 B;  1T6A A;  4O4L A;  4IFM A;  1VQ4 P;  4JI4 B;  2E5T A;  3VP8 A;  2FFD C;  1E5W A;  3P8C D;  3CRR A;  4DR2 O;  1RE4 A;  2JR8 A;  5L3G A;  3RYI A;  1NTZ K;  1Q6H A;  2XAQ A;  5FL7 G;  2V4H A;  2ZM6 B;  1SQB E;  5TIS H;  2YO3 A;  4JQ0 D;  4NTY A;  3MTU E;  1DLB A;  5AW2 B;  1UFI A;  1JY2 P;  3C3S A;  4JF7 A;  4FLX A;  3VQW A;  1EZV H;  4Z1M H;  3G6B A;  2XND G;  4X66 B;  1IBM O;  5J2T B;  1FZE A;  2O01 N;  1I94 B;  2QKS A;  3GF7 A;  4IYI A;  2V4D A;  1GM9 A;  1IDS A;  3AK2 A;  3HKB B;  3M0A A;  1WNS A;  4Q6G A;  3VQX A;  1F7Y A;  3DGE A;  1JY3 P;  4AQY O;  1FDO A;  2PUS A;  2WMM A;  2JS3 A;  1OW6 A;  2JGU A;  2QTO A;  2PTM A;  2XHB A;  1OIP A;  1YEW A;  4BR6 A;  1S72 V;  3H32 B;  2ZNI A;  1G1X B;  2JEU A;  2IJH A;  1SQP K;  5A9G A;  2J59 M;  1NQT A;  1DH3 A;  2EIJ C;  3LSU A;  4G2K A;  4LNU B;  2QEX V;  4GKG A;  4ZI7 A;  1YHQ V;  1XQ8 A;  2WLL B;  1EQ7 A;  1HUC A;  3N2K B;  1ZN5 A;  5B5E H;  2LGW A;  3EWK A;  3P3N A;  3CCL P;  1Q82 W;  5B1A B;  1VQ6 P;  1LUV A;  1JTH B;  3ZHS A;  2KNC A;  4X1K B;  1W2B O;  5B66 E;  1AVO A;  3L71 G;  1PP9 E;  2UUB B;  4F6R B;  1HR0 B;  2JJ1 G;  1W2B U;  1BE3 G;  1L0N E;  2GUV A;  5CCG A;  1HDJ A;  3SGI A;  1FZC A;  5CCG C;  4I55 B;  1G8M A;  1HNZ B;  2Y4U A;  4O2B A;  5KX5 B;  4DV7 O;  1WP7 A;  3V6I A;  5B66 H;  1OMI A;  4PD4 I;  2Q8V A;  2F4V B;  3CCJ P;  3Q2Y A;  1Z5V A;  1QL2 A;  4DR4 B;  4MVS A;  2UXC O;  2FYZ A;  1X4T A;  4QE7 A;  2Y69 B;  2HFE D;  3HD7 C;  1IFJ A;  1N34 B;  5B3S C;  1MZ9 A;  3H1J D;  2I8D A;  5F2V O;  1GTO A;  3SYA A;  4GOD A;  5CB4 A;  3BY6 A;  1RE3 A;  1JFF B;  3RK2 D;  4YXD C;  3ZMS A;  3L73 H;  1PGQ A;  3QF7 A;  3SYC A;  2OYO A;  4OX9 O;  2OGU A;  1BGY J;  1SQQ K;  4J7Z A;  3A0B E;  3GG2 A;  3S3W A;  3H1K E;  2JGD A;  1XHX A;  4JI7 O;  4GKK O;  4FZ0 A;  3PH0 A;  3V4Q A;  2BAS A;  3W7S A;  1VP7 A;  3SJC C;  1XUQ A;  3ABU A;  4X1Y A;  3D3Q A;  2OTJ P;  1BGY G;  4RJT A;  5EIB C;  2QEX P;  1GN6 A;  3H1I G;  4Y28 J;  4ZOL B;  3RYC B;  1YCI A;  3AEI A;  3W7X A;  2PGD A;  4U7N A;  1IUR A;  2FY8 A;  1KEC A;  2IW5 A;  3CL3 D;  3L71 J;  3RYF A;  3ABK B;  1JR9 A;  1AFO A;  3UO2 A;  4WFF A;  1GZL A;  4EDF A;  1R3I C;  3D3I A;  2KP8 A;  3ABM C;  3LIE A;  3I56 P;  3KQG A;  5CJ4 A;  2E75 C;  1VQ9 V;  2EIK B;  2EIN B;  4BW5 A;  2YKQ A;  4BRY B;  4UB6 H;  1AI7 A;  1L4A D;  1R6T A;  5JH7 A;  1JMM A;  4ICG A;  1KYO F;  5J9P C;  1VQO P;  4DV3 O;  1K92 A;  1FXV A;  2OYH A;  3CCE P;  5AVR B;  2LJ2 A;  3AE4 C;  4H44 B;  1W0K G;  2E76 D;  2B5U A;  3E22 A;  5EZY B;  1PP9 G;  5ITZ B;  3TGU H;  5CBG A;  3CRQ A;  1JY3 O;  3TXQ A;  2IYP A;  2OYI C;  2D2C D;  2WSC J;  3EQ2 A;  1URQ D;  1K3E A;  1N73 A;  3G6E V;  2LR2 A;  2FFD B;  5JVD B;  4YHH O;  4KT0 J;  1SQP E;  4ZIB A;  3SJQ C;  1KN7 A;  4EOT A;  2HHH B;  1KKC A;  1Y8A A;  2EBO A;  3HR0 A;  2E5L O;  4F6E A;  4Q20 A;  2KB1 A;  2RMK B;  2E74 D;  1K97 A;  3AE3 C;  1WB8 A;  4RO2 A;  1JOC A;  3GHG C;  3RK3 B;  1M90 Q;  4MTF A;  1GTW A;  1IBK O;  3A5T A;  2DYR C;  1K33 A;  3VQY A;  4FVM A;  3JAK A;  4TSF G;  3RT3 C;  1EZV G;  1NVO A;  4DV5 O;  3AEE C;  2QR4 A;  3GWK C;  3FXD A;  3G3Z A;  3OTF A;  3Q5S A;  3WG7 C;  3G71 V;  4LFB O;  5K1P A;  1L0L E;  3H1K G;  4DV4 B;  4X65 B;  1N73 B;  4NPE A;  5GTI Z;  1KYO D;  2EIL C;  5TIS E;  2R9R B;  2Q0O C;  3CX5 I;  1EBO A;  5DM6 V;  2P4V A;  2A06 H;  1KMI Z;  4JYB A;  4OPA A;  1YIT P;  1M1K Q;  2YXH A;  4D6T G;  4ASU G;  3H1L E;  1WPX A;  3TF5 A;  2YXQ B;  4WY4 B;  1K5Q A;  1H2S B;  2HG5 C;  3G6E P;  4UCT A;  4JI4 O;  2WSE H;  1AJQ A;  3S1K A;  3L75 H;  1FDM A;  4GUN A;  1VL2 A;  1SQF A;  2ZNJ A;  3CB2 A;  1OXZ A;  1WJZ A;  3CP1 A;  3PLN A;  1NVP B;  1NAY A;  2I1J A;  1MA1 A;  2LP7 A;  4MT8 A;  3I5D A;  3K08 A;  1IXB A;  3N4X A;  1V55 C;  2P4K A;  2H89 C;  2Q7G A;  3CCV P;  2AXC A;  1Q43 A;  1N0N A;  2WLI B;  1K34 A;  2N9Y B;  2FKW B;  3MIW A;  4UB8 E;  2LFR A;  5H6Q A;  5C93 A;  2QKA A;  2OAR A;  4FMT A;  4O4H B;  2UUC O;  2WIT A;  4LF7 B;  1KB9 D;  3JCU E;  3RK2 B;  4O9B A;  3S9O A;  1JA8 A;  2HFE C;  3BRV B;  4FFB B;  3FX7 A;  2JDI H;  1NZ6 A;  2P2U A;  3ZJZ A;  1AJP A;  4DR1 B;  3E1R A;  3QH9 A;  3DXR B;  2AEJ A;  2FYU E;  3K58 A;  1KYO H;  4AQR D;  2ZR3 A;  3AG4 B;  1NU1 G;  4FLW A;  2A79 B;  1IBK B;  5L3F A;  1PGP A;  3P3P A;  5GW7 A;  5KLV D;  1BGY H;  3TDK A;  1H8E G;  3E22 B;  5EZY A;  3OGI B;  3NFQ A;  5EC1 C;  2P7J A;  1E79 H;  2QVA A;  3PJS K;  3STL C;  1NTK H;  2JWD A;  4O2B B;  3APO A;  1S4X A;  2P10 A;  4QGP A;  4D6T E;  3H1L D;  3AE1 C;  5CCH D;  3AG3 C;  4QIW F;  2W27 A;  2NPS D;  1EN5 A;  1V55 B;  3CJH B;  4GKJ O;  1BCC J;  3L75 D;  1LP1 A;  3CWB G;  2QM7 A;  1MG1 A;  4O4I B;  4BRY A;  1JY2 N;  5EIB D;  3HE5 B;  3ZHQ A;  2KSD A;  3JSL A;  3R4Y A;  2M7W A;  3CME P;  3UKM A;  3VOU A;  4CS3 A;  1KU9 A;  3MHV A;  1B06 A;  3BVH A;  2IM9 A;  4MW3 A;  4PA3 A;  4GLX A;  4PV1 D;  4CC5 A;  1Q2N A;  1MMM A;  4X1K A;  3JAL B;  2O1K A;  4HZ3 A;  4LF4 B;  3CMA V;  1SFC D;  4JV5 B;  5LP6 C;  4X64 B;  1IFI A;  5CHX A;  3OMI B;  3OT7 A;  1L0L K;  1ORQ C;  2LO1 A;  4NXM O;  1FS0 G;  2O1J A;  4OVN F;  5AW1 B;  4BIZ A;  5AW9 B;  1CW5 A;  1TU3 F;  1XL4 A;  2BTQ B;  2IH3 C;  1GH6 A;  3TGU E;  1OVV A;  1EXJ A;  2M0B A;  1KB9 H;  5EBW C;  3GF3 A;  3GW6 A;  1KB9 E;  4UV8 A;  1FXK A;  4CS4 A;  5LMU B;  4MTO A;  4DK1 A;  1RSO B;  2K9J B;  4GX1 A;  2F93 B;  2R3C A;  4LLH A;  1VF5 D;  2J5U A;  2E76 C;  4JYC A;  2YI9 A;  3CXH D;  2BOB C;  4JTA B;  1EDJ A;  1SQX G;  1NYH A;  2HKO A;  4W4L A;  1DGS A;  1OW7 A;  3CI9 A;  1FOS F;  1PPJ H;  1N36 B;  1OCC B;  1M57 D;  3CSX A;  2YEV A;  2YC0 A;  2BCC J;  1RQV A;  2ATK C;  1PL5 A;  3L36 A;  5CJ0 A;  3KXD A;  1LTJ C;  1DX7 A;  1NTK D;  2YS8 A;  2P58 A;  1LTJ A;  1P7G A;  3DC6 A;  1JJ2 U;  3CYO A;  4OWF A;  1FJG O;  3B77 A;  1TVK A;  1XI1 A;  3V2R A;  4O4L B;  3T1Y O;  4IL6 Z;  5LMU O;  2K1A A;  5AVV B;  4J42 A;  2QJ1 A;  4DV3 B;  4JAU A;  3RFR A;  1OCO B;  2ILM A;  2IBZ G;  1I0H A;  1PZQ A;  1VQ8 V;  2CTW A;  4LWS B;  5IJ0 A;  1Y76 B;  2WSS G;  1ZOY C;  2YKO A;  1ZME C;  2JJL A;  3OW2 U;  2HOD B;  1IBL B;  4UCV A;  1X79 B;  2IFN A;  1DEB A;  1SQP J;  4PA9 A;  3QVN A;  5H5N A;  3N7N A;  4OGQ C;  4WF9 V;  2QJY B;  2V7Q G;  3AK1 A;  1NKN A;  1GKF A;  1SQQ E;  4IIJ B;  2EIN C;  1U96 A;  2AEF A;  2OTJ V;  2D3O W;  2HOD A;  5J2U B;  3EFF K;  3ASN B;  2E75 B;  1ZWI C;  3L71 D;  1GL2 A;  5BU5 A;  1XRE A;  4DCK A;  4DV6 B;  3CXH H;  5JH7 B;  4Z1V A;  2FYU D;  3L70 D;  1PNL A;  3JD2 A;  1M1J B;  1ARO P;  3FAV B;  4DR5 O;  1K5S A;  1N86 A;  3LDD A;  2M8R A;  1JX9 A;  4JI7 B;  2B9B A;  1S5L X;  2PI4 A;  1EFR G;  2YSU B;  1RF0 C;  1F23 A;  2YMK A;  3FGA D;  1LR1 A;  1O9H A;  4U3F J;  1N8R Q;  3AEC C;  4TUY A;  3ETQ A;  4C7U A;  1X22 A;  2RJZ A;  1JMK C;  5AVZ B;  4PJ0 H;  5KHH A;  4TOI A;  3W7U A;  5JVD A;  1VQL V;  3KKY A;  5JCO C;  2CE4 A;  4JI2 O;  4JI0 O;  3L74 G;  2AHY A;  1UJW B;  3OUF A;  1IK9 A;  5HFM A;  4NVP A;  2BSK A;  1YJW P;  3E7K A;  5KAI H;  4ZHQ A;  4P2Z A;  3W68 A;  2Y69 C;  4PDM A;  1IJD B;  2XDJ A;  3HD7 B;  3E8F A;  2O57 A;  1VF5 B;  3AE2 C;  5IY5 B;  2KS1 B;  3GLM A;  1PP9 D;  1S5L H;  1YDX A;  1KD1 Q;  4GKJ B;  2KI7 B;  2YO2 A;  2Q6A A;  1R6K A;  3A0H Z;  1W5C E;  4NKG B;  3G4S P;  3BCC G;  2PF4 E;  4I0X A;  1V9P A;  2HPC B;  1T2K C;  2EJR A;  2NRG A;  3APQ A;  3ZHU A;  2IJJ A;  2NPS C;  1I5X A;  1IFM A;  3CME V;  3BCC J;  3DC5 A;  4GX2 A;  1JB0 J;  5EBL C;  2R72 A;  1D5N A;  3CCJ V;  1N7L A;  3ABL B;  4CH6 A;  1U7M A;  2R9A A;  2ZE5 A;  1YZB A;  3J7A U;  5KHK A;  4U3F E;  5IDJ A;  5L3B A;  3JD3 A;  2YXY A;  2FYN C;  3WU2 H;  2WLH A;  2YIU C;  5AW3 B;  4C7N B;  4LFB B;  1K4D C;  4B3S B;  4KJM A;  1R6N A;  4MVM A;  1IBL O;  1BQZ A;  1IX9 A;  1NU1 J;  1YJW V;  3CXC U;  1GU4 A;  2HYN A;  5BMV A;  4IIJ A;  2GTS A;  1RH5 B;  1SQX J;  3H9V A;  3QO7 A;  5J2U A;  1XNR B;  2XAF A;  2GDS A;  1JCH A;  2XAH A;  3JAW B;  3TK1 A;  4RES B;  1PPJ E;  1LT1 A;  2X6C A;  5CMZ A;  3LW5 J;  1PGJ A;  3T1C A;  4A5U B;  3RGU A;  2UUA O;  3CCR P;  1H89 A;  2P67 A;  1XEQ A;  1RP3 B;  1JM0 A;  1BCC H;  1QL1 A;  2WSF H;  5E79 H;  3MDS A;  1M57 C;  1J1E B;  1H2N A;  1NR7 A;  2IU3 A;  3BFR A;  3II6 A;  1M93 A;  1B04 A;  2LQT A;  3JAR A;  1RF1 A;  1SQQ D;  4BXL A;  1XOU A;  4H0L D;  3RK3 E;  2WVR A;  4I2L C;  1R3K C;  3CXH I;  3H6P A;  1MAB G;  1XMQ B;  1HJ0 A;  3B09 A;  3AED C;  2OYI B;  4LFA B;  2F43 G;  1BDD A;  3CCU V;  1BL8 A;  2RN9 A;  1AI4 A;  1LTI C;  3JAM N;  1WPB A;  1K4C C;  3K0D A;  4LNU A;  3AG2 B;  5APX A;  2Q7E A;  2V7Q J;  2Y0P A;  1NT2 B;  2GSM B;  4Y99 B;  1H8A A;  2AW9 A;  4JI5 B;  5FNV A;  3H1H E;  1AJY A;  2C9L Y;  2H7H A;  4WCE V;  4PDR A;  3HE4 A;  3KHU A;  4PV1 C;  2H43 A;  1GL2 B;  3X2Q C;  4K35 A;  3CWB E;  1OVU A;  1VMG A;  1YVW A;  3ABV C;  3L73 J;  2Q1K A;  5BMV B;  2QA4 P;  3I55 P;  1FJP A;  4DV2 B;  1YHQ P;  2QE7 G;  2HLO A;  2R32 A;  1CXZ B;  2EX3 A;  2N9B A;  2BCC G;  1SC5 B;  2M6Y A;  5BY1 A;  5IT9 N;  1L8D A;  5IJ9 B;  2ZYA A;  2ZKO A;  1VQN V;  1S5J A;  1L2P A;  4IHJ B;  4B3T B;  3K03 A;  4PD4 H;  4ZKI A;  2ARH A;  1FE6 A;  3GVM A;  2FXO A;  5IYZ B;  3KZI Z;  5LYJ A;  4D7T A;  4RQE A;  3AE9 C;  3T1H B;  1DF5 A;  4H0L B;  1PFI A;  2X7R B;  1CZQ A;  3AG2 C;  1NTM H;  5B1B B;  3RK3 D;  4JF3 A;  3F5W C;  5AW5 B;  5JWP A;  2B1G A;  2E74 B;  4LFA O;  4JI5 O;  1YQ4 C;  3MD0 A;  2NLJ C;  2F4V O;  1QQC A;  2ZYD A;  4UCS A;  1G2C B;  4LF6 O;  3ABT A;  3ZN0 A;  1F51 A;  3UT5 A;  1KB9 I;  3F7V C;  2IZ1 A;  3T4Z A;  2QG4 A;  4X66 O;  2WQY C;  5CB4 B;  3E83 A;  5B66 Z;  1HNW O;  1AB3 A;  4ASW A;  1J1E C;  2ZIO A;  2D2C B;  1HR0 O;  1H2K A;  4TQF A;  2R9I A;  1FYJ A;  3M9H A;  5CA0 B;  3O6Q B;  4L8J A;  1YF2 A;  2BOC C;  1SLQ A;  1QLE C;  3EHB B;  4YJ3 A;  1QLN A;  2IZ0 A;  3N2G B;  1QLE D;  3H1L H;  2OCH A;  3G4S V;  1NTK J;  4DXW A;  1Y67 A;  2YIB A;  5KX5 A;  5B5E Z;  5FLX N;  1PV0 A;  3TGU D;  4X62 B;  4OH8 B;  3CCV V;  4GOF A;  1NTK G;  3SWY A;  1P84 D;  2CGO A;  3K04 A;  3KZI H;  5CCH A;  1VQ5 P;  1GM7 A;  4O4J A;  2AXT H;  4U3F G;  2EIJ B;  4UCO A;  5E79 Z;  1YJ9 V;  1CSB A;  5KJ7 D;  4J9Y B;  1GRJ A;  3DTU B;  1XNR O;  3MHH C;  2Q69 A;  1RM1 C;  5APU A;  3HB3 B;  3MP7 B;  2UUC B;  1KB9 F;  1SQX D;  1NU1 E;  3OGC C;  1L0N D;  1K73 W;  5KLV E;  4N23 A;  3JC2 2;  5LGU A;  3RL0 D;  2GUS A;  4JAV A;  1A02 F;  1FOS E;  4R50 A;  2QGN A;  4WFG A;  3CWB J;  4B7E A;  1YI2 V;  4NR1 A;  3BCC D;  5CA1 A;  4RKU J;  1L0L J;  2KOG A;  1VQ7 V;  1T3J A;  5APW A;  1KYO I;  5L3D A;  4FLY A;  2Y48 A;  4MSW C;  4X1I B;  3K06 A;  3VTP C;  4FLU A;  1Q6U A;  2QWR B;  2XV5 A;  1KBH A;  3R65 A;  1URQ C;  4JGS A;  2ODM A;  5H6R A;  4KHX A;  3H1J E;  2K3R A;  5KKZ B;  3HKD A;  5CBH A;  1L1F A;  1VQ6 V;  1XL6 A;  3PHL A;  1BE3 H;  1GO3 F;  1J5E B;  1E1R G;  1XNQ O;  2KG7 B;  3FWN A;  1QBZ A;  2Y9Z A;  4JI3 O;  3RVZ A;  2HP8 A;  5IY5 C;  2XAG A;  4TWK A;  2HHH O;  1IZ3 A;  1CPY A;  3CEI A;  3Q4H A;  2RN0 A;  1SET A;  4PEL A;  1FD9 A;  3GWO A;  3L72 H;  3OEH G;  4DW0 A;  2EUL A;  4D6T H;  4UB6 E;  1DTO A;  4LF9 B;  2GUZ B;  2IJI A;  1FZF A;  1FFT B;  4FJC C;  1SQV G;  3B5N D;  4E4E A;  4F6R A;  2HVJ C;  1I94 O;  3PRJ A;  3VOP A;  1H2L A;  2NNU A;  4XFJ A;  1OHH G;  2JIZ G;  1OZ0 A;  5LGN A;  4FM2 A;  1NKZ B;  2C0W A;  1USE A;  4XA4 A;  3H1K H;  4RO0 A;  3J80 N;  3L70 G;  1KYO E;  4NTX A;  3U10 A;  3L73 E;  4UVA A;  2FXP A;  1JQ0 A;  2QIW A;  1COW G;  2E75 D;  4LC1 A;  5AW6 B;  4DR2 B;  1J1D B;  3T97 B;  2QSA A;  3VMA A;  4R6Z A;  3L70 J;  3RVY A;  3FYI B;  3RBZ A;  2WZ7 A;  3KYQ A;  1NTK E;  2ZXW C;  2QA4 V;  4AHC A;  4JAS A;  1PIX A;  2P90 A;  3CC4 V;  3WFV A;  1K9M Q;  4JTD B;  5LXT B;  4YJ2 A;  4KL1 A;  3ZIA G;  1BGY E;  1EZV I;  3QO8 A;  4YHH B;  3ZRW B;  3ASN C;  1V54 B;  1FU1 A;  3T97 A;  1QHT A;  2FYU H;  4PV1 B;  3B4S A;  3VMZ A;  2WA4 A;  4U7J A;  3HKE B;  1H38 A;  1VDF A;  3IFX A;  4J10 A;  4D6T J;  4JYY A;  2YID A;  3CX5 D;  5KMG A; 
#chains in the Genus database with same CATH homology
 2FBW C;  1HJ0 A;  1U57 A;  3AEC C;  3AED C;  3G9R A;  1UIX A;  2E74 C;  2QJP C;  3AE7 C;  1ZRT E;  4OGQ B;  2NZ2 A;  1IK7 A;  2BEQ D;  1PV3 A;  2V7Q J;  1KTM A;  5KLI C;  1FDI A;  1K04 A;  1TU3 F;  1EXJ A;  4YXD C;  3D71 A;  3GF3 A;  1KMI Z;  1AJY A;  4RKU J;  3Q1M A;  4R4M A;  2K9Y A;  4PV1 C;  3SFD C;  1NGM B;  4H13 D;  4H44 D;  1VF5 B;  3AE2 C;  1VF5 D;  2J5U A;  2E76 C;  3GLM A;  3ABV C;  4I7Z B;  3AEG C;  4IL6 X;  2WPV B;  1NYH A;  4Y28 J;  2OQQ A;  1OW7 A;  1VL2 A;  1R8E A;  5KKZ C;  2ZT9 B;  1RQV A;  1PL5 A;  3Q3D A;  1RQU A;  1DD4 A;  2D2C C;  3O6Q A;  2O01 J;  2ZT9 D;  1HF9 A;  4YTP C;  1VF5 C;  2JP3 A;  2H89 C;  4OGQ D;  2ZT9 C;  1Y9B A;  4R4L A;  1EXI A;  2QJY C;  4TT3 H;  1JB0 J;  1OW8 A;  2E75 C;  4I7Z C;  1Q90 D;  3C8V A;  3D6Z A;  1MKM A;  2MKV A;  3AE9 C;  4Z1M H;  3Q5P A;  4H0L B;  1DIP A;  3GMA A;  1YQ3 C;  2QSI A;  3D70 A;  3GF7 A;  1ZOY C;  1ZME C;  4H13 C;  3S9O A;  2FYN C;  4XFJ A;  2E74 B;  1WMK A;  1K05 A;  1YQ4 C;  2YIU C;  4H0L C;  2JO1 A;  2WSF J;  3IAO A;  1FDO A;  1KQG B;  1OW6 A;  4H44 B;  4H13 B;  1KOR A;  3AE4 C;  2E76 D;  2QJK C;  4OGQ C;  3AE6 C;  2FXP A;  2QIW A;  2WSE J;  2E75 D;  3AE8 C;  5M1B A;  3AEF C;  2WQY C;  2D2C D;  1DD3 A;  2WSC J;  3T97 B;  1KQF B;  3H25 A;  2D2C B;  3B71 A;  1ZP0 C;  2E75 B;  3Q5S A;  3LW5 J;  4KT0 J;  1PIX A;  2P10 A;  3AE1 C;  3EWK A;  2IDB A;  5L8R J;  3AEA C;  4GDO A;  3Q5R A;  3SFE C;  1KIL E;  2E74 D;  3RL0 g;  1S1C X;  3AE3 C;  3IN6 A;  4PV1 B;  2BEZ F;  2G8Y A;  3R4Y A;  1GMJ A;  4U7J A;  3AEB C;  1S5L X;  3AE5 C;  3D6Y A;  4H0L D;  3AEE C;  4H44 C;  3RK3 E;  4PV1 D;  2YMK A;  3FGA D;  1OMI A;  2G3A A;  2E76 B;  2H88 C;  3Q2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...