4H0LB

Cytochrome b6f complex crystal structure from mastigocladus laminosus with n-side inhibitor nqno
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4h0lB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h0lB01
2ZT9B 2QJKC 4RKUJ 2O01J 5KKZC 2WSFJ 2E74B 2WPVB 3C8VA 2QJYC 1Q90D 3LW5J 2YIUC 4I7ZB 4OGQB 2QIWA 5L8RJ 2WSCJ 2D2CB 2QJPC 4H13B 1JB0J 2K9YA 2E76B 4KT0J 5KLIC 2WSEJ 2FYNC 4Y28J 4H44B 1S5LX 4H0LB 4PV1B 2QSIA 1VF5B 1ZRTE 4IL6X 2E75B
chains in the Genus database with same CATH superfamily
1EDKA 1IO4A 1ZSPA 1HJBA 1N32B 1I5XA 3U1AA 2GM4A 3L70G 3FWNA 1YEWA 1ZR2A 3R4YA 3UO3A 1NTKH 4EI2A 4LFCB 1IXMA 1Q6UA 1F4MA 5KLVD 1M56B 4Z1MH 1OCRB 1FXKB 2UXCO 3SJCC 3HE5A 2WPQA 1LP1A 1AR5A 5LOVA 1JMKC 1G2CA 1CXZB 3A0BE 4F4LA 2P22C 3CXHH 1XHZA 3ABUA 3D8CA 3LDDA 5B66Z 2A45G 1HH0A 2Z0AA 1KB9I 5H9CA 4I0XB 4B3SO 4KJMA 2B1IA 1SQXK 4D6TH 1AVYA 1SQXJ 1GAXA 5GTIE 3OW2O 1OHHG 2XU6A 2KQXA 4EEQA 1EFRG 4WY4B 1I94O 3CCMP 1HWTC 1L0NH 1VF6C 3DXRA 2W6AA 3H1LH 2QEXP 1DX7A 5LYJA 4J7ZA 4TV9B 2K1AA 1VF5B 4PD4F 4MN4C 3CCUP 1H2NA 1K97A 2IYOA 4AUWA 3HKEA 2WITA 5AVRB 1FAVA 3KQGA 1WMKA 3RYCB 2W6IG 3L75D 1KC8Q 3G6EV 3L74D 4LWSB 4KUMA 2YUAA 2QJKB 2F1MA 1GTWA 2YEVB 2QE7G 4JI4O 4TLFA 1JR9A 1PP9H 3DSQA 4JF7A 4GX5A 4OWFA 2O57A 5KAIE 3LNNA 3P8CE 2A06E 4BRYA 4O4JA 2EINB 1N34O 1X4TA 2DYRB 3L72D 4KP4A 3CCSV 2V7QG 1PNKA 3PP5A 1OVUA 3SYAA 5L3CA 2KG7A 3RL0g 1HNWO 2Q3EA 3AE2C 3CXHD 4UB8E 1NU1G 2CPBA 2EBOA 2YIBA 4E4EA 1M56C 3TK1A 3HB3B 3ABMB 1A02J 1FXKC 3A8TA 1Q43A 4WBNA 4HBNA 2E5YA 3TGUH 3EVKA 4JAVA 1BHBA 3WUTA 1HGZA 5KLVE 4D6TD 2J5UA 4QJFB 1BGYG 2Z5IA 2LJ2A 3G67A 1KU9A 4I55A 4JI6O 1N73A 1NTKK 3LNMB 4DR1B 1L4AA 3H9VA 3U59A 1S5JA 2EIJB 1L0ND 3S3XA 3JD2A 3JAKB 3H1LD 1GK6A 1FJKA 2QVAA 1I0HA 2NPSB 1KYOI 3RW0A 5AW2B 2IU0A 1S1CX 4KL1A 1ZOYC 4X1YB 4WY4C 4CBCA 4ASWA 2WLIA 1HJ0A 5KMGB 4WB4A 3SJAC 3F89A 3A0RA 1HDJA 5K1XA 3L36A 3Q2YA 3HD7D 1ZL8B 1PP9D 1VF5C 3K06A 1X0TA 1AVOA 2Q1KA 3RYIB 2HYNA 1DLBA 3M7MX 3VQXA 1IBMO 3AE8C 2UU9B 1RQVA 3CD6P 2AHYA 3APOA 3H1HE 1IXBA 2QJKC 5C39A 5FL7G 4X66B 2RMZA 3BABA 1NHLA 3T2MA 1NO4A 1NI8A 1GN6A 1LTJB 1YQ3C 3OD4A 3KZIE 1W0JG 3L75E 2EINC 3HE5B 2ILMA 3ZRWA 1LP1B 3L74E 1Y76A 2DYRC 2RDCA 4B3TO 1G2CB 1SQQH 1X79B 4ZOLA 3BRCA 5B1OA 3TGUD 1FS0E 3SWFA 1VDFA 4I6MC 4X62B 3ZRXA 3A0HZ 2ZR3A 2JO1A 2KXPB 1BQZA 1G1JA 2JWDA 1OVVA 4CS3A 5LBQA 3WU2E 2PYLA 2O1KA 5LP6B 1QR8A 1SQVK 1P4RA 3CXHE 1YTZI 3CI9A 1GMGA 5KJ7C 3WUVA 3B8NA 1YF2A 1PL5A 3P7KA 5FPOA 2W6JH 1COWG 4DRXA 3OW2U 1WJZA 4PD4I 4I4TB 3CCJP 2A06G 1XOUA 1AQ5A 5AVTB 3T1HO 1JY3O 2IJJA 3CCRP 1YTZT 4UV9A 4CZZA 1KUQA 1GN4A 2EIJC 2JIZG 4WFHA 3ZBHA 4QMAA 2WSCH 4D6TE 2A3QA 5KX5A 3BVOA 2ZT9D 3GF7A 4PJ0H 1Y6XA 1NTMJ 3K3WA 1M9NA 5LMUO 4RUFA 4DV1B 2FXPA 5HFLA 4X89A 1KBHA 5KHIA 1L0NE 3ZN0A 2KSJA 1VQMP 2M5AA 2F95B 2WSSG 3H1LE 3V5BA 4LNUA 1AFOA 2CTWA 2WSFH 3DC5A 3AG2C 2O3JA 3BCCH 3OAAG 4DR2O 2PGDA 4AILC 1LTAC 2BSKB 2ZVNB 4O4JB 1QX8A 1XDCA 1BT8A 2WA3A 2BCCJ 3CCMV 1XL4A 3X2QB 2KG7B 2V4DA 1XMQB 2QEXV 4O9BA 1SQQD 3AEBC 3G71P 2HJFC 4IHJA 4X88A 1PP9E 1LTJC 1JA8A 3CCUV 1VF7A 2CTPA 1SQBK 1RF0A 2HFEC 2B5UA 1YI2P 3UKMA 2YXYA 5L3GA 5AW6B 2E3CA 2CE4A 1JPXA 2HLDG 4GUNA 3T1YB 1QLEB 1SA0B 1SQBJ 3JATA 1USEA 1URQD 1MMMA 5M1BA 2UXXA 4X8AA 2UUBO 1BSNA 4HH2A 4JPZB 3ZN1A 1N73B 2WPDG 1BCCJ 1JEKA 2Y4TA 2Q8VA 2Y69C 3W7UA 4C7UA 1L4AB 3OJAB 1Z5WA 4TWKA 5LP6C 3LIDA 4L75A 5APTA 3TGUE 4WVZA 2UXNA 3H1HG 3O8ZA 2AXTZ 2FTKA 4AYCA 3KYQA 4RKUJ 4KHPB 1VIBA 4U7NA 3ZCCA 3CCEP 3SPHA 2JJLA 1XHXA 3L75G 4JI7B 2HEPA 2WLIB 3FX7A 1OXZA 1Q86Q 1JCHA 4YXWH 2ZR2A 3FB5C 3EXAA 2Z4EA 3J80N 4ZKUA 1MKMA 1H38A 1FS0G 1TVKB 3BCCD 4DUZB 1NTKG 2UXBO 1YJ9V 3MGNA 4RESB 4N21A 2GUSA 4PDRA 4Y28J 1N8RQ 4PI0A 1Q81Q 2GSMB 5JVDB 2P58A 5IYDO 3PN1A 3V2QA 3TF5A 2EJRA 4LF8O 4R8CA 3W68A 5AVZB 2R9IA 3M9BA 4YPCA 1MA1A 3D3QA 4C7NA 4O4HA 1O9GA 2D2CD 5KKZB 3X2QC 4GDOA 1FPOA 3OT7A 3HTKB 4D6TG 2FYUH 1KFNA 1GK9A 1P84I 3VBBA 4DXWA 1GO3F 1MUUA 2C0WA 4N6JA 1S4XA 3B8MA 1YVWA 1L0LK 3CD6V 1QLEC 3CE2A 4U3FH 3U0ZA 3A0BZ 1SQQE 1UFIA 2HG5D 2IBZG 2KLVA 2KS1A 3VN0A 4DW1A 1J5EB 1LUWA 1R3KC 3M06A 4B3MO 1L0LJ 1W2BO 3F7VC 3GWOA 1QGKB 4L74A 3I56P 5H6RA 1N73C 1P7BA 3GHGA 4TT3H 4IIJA 3ABLB 2W8ZA 1L4AC 3JAWA 1N7SA 4DCKA 1HNXB 3O6QA 1JY3N 3FB6C 4H33A 1AI7A 1PP9G 2UWJE 3P3NA 2Z5UA 5GTIZ 3H1IJ 3IR9A 1H89A 4NYKA 4DO2A 4H0LB 1H8HG 1VQNV 2Y9ZA 4PA4A 2UUAO 3SR2C 1SQVG 3CC4P 4YY3O 1JCCA 1NS1A 2XASA 1SFCD 4MT8A 4GIFA 2XHBA 1FOSF 4LF4O 1CI6A 4JAUA 5E79H 2ZIOA 2Y0IA 4FLVA 1BE3G 3TETA 2R3SA 4PJ0E 1KECA 1PV0A 3CCJV 3UIAA 3BVHA 5DN6G 3CCRV 1CSBA 2FL4A 2R5DA 3ZHSA 4IHJB 3HKDA 4NXMB 1GH6A 4BR6A 3BCCE 4JI8B 1HBWA 2P10A 4PV1B 2CDYA 1WPXA 1EZVD 2B89A 2FFDA 5KAIZ 2I1KA 1XREA 3JALB 2E74C 5AW1B 1BZKA 2O1JA 1G1XB 5LA6B 4GKKB 1JTHB 5KKZC 2XNXA 4ABMA 1VQMV 3L35A 2MJZA 1GD2E 1SP4A 2FXMA 4U3FD 3RL0D 1F23A 1HR0B 1R1BA 1KC8W 3OEHG 4UB8Z 4YHHB 3D36A 5EYPB 1JVMA 5AVVB 3K59A 4X64B 2Q3IA 3MDSA 1TGOA 1XNRO 2ZDIC 4NXNO 3G71V 3VP8A 3VTPC 3OTFA 1VMGA 1R6TA 1THZA 3RYHA 1S5LX 1CW5A 1SQBG 2OYIA 3OGCC 3WFVA 4DYLA 1M57D 1RE3C 2JEUA 1YI2V 2ATKC 2FYUK 2YKQA 4X20A 3ABLC 1QQCA 1Q82Q 3RN4A 2OCHA 1BCCG 1ZLZA 3RYFA 4ZHQA 2YI8A 2UUCB 4LF5B 2Q5ZA 2LFRA 5B1BB 4MS2A 2XDJA 4LH7A 3Q5PA 4H0LC 2YXRB 3CCVP 1M5IA 2OT5A 4JQ0D 1FZFA 2QTOA 2Q7EA 3CRMA 3S1KA 5DECA 4FM1A 1DK1A 3AECC 3L71H 2JDIG 1SQFA 1WP8A 5LGTA 4IYIA 4FFKA 1AJQA 2ITAA 3CX5F 2VQEB 4C7NB 4X65O 3BHPA 4GX0A 4F6RB 1VF6A 1XL6A 2IJKA 3AEIA 1OCZB 4PA7A 1JY2P 1S5LH 1SKVA 5APXA 4LF9O 1D5AA 2OCCB 3KZIZ 1H2LA 2IX7C 4J10A 3O9OA 5ITZA 2KLUA 3L70J 3LW5H 2W6JG 1T6AA 3JYCA 1LTTC 4PA3A 2DOSA 3T97B 1N2DC 4JV5B 3OGIB 3SSUA 2ZM6B 3JASA 2DQ0A 1GZLA 1QNMA 4J9YB 1SS1A 1I7FA 4AI8A 4X1KB 1AR1B 4MTXA 2ZNJA 2O01J 1EZVE 2ITCC 4GCZA 4BW5A 2GTSA 1DD4A 3KXDA 3FAVA 3GW6A 4PHZA 3GHGB 2POHA 3AE3C 4XDKA 4Q6GA 3JAWB 4Z1VA 4CC6A 2BTOA 1CZQA 1T5EA 2W83C 4U3FE 1HW7A 4NPEA 2M3BA 2YXLA 4OXSA 1FXKA 2DE0X 2PP6A 3BCCG 2QKSA 3M91A 1K9MQ 4LF6O 2CGNA 2YXHA 4IYHA 2Y0CA 3K0DA 3FXEA 1PIXA 3ZX6A 1CI6B 1E79G 4ZBMA 5B1BC 3L71D 2F23A 2P1JA 1W5CE 1GW3A 1Y8AA 2G3AA 3K04A 3I56V 4HB1A 1JJOA 3V6IA 4DK0A 2OTLP 1OWAA 1WLEA 1KB9F 3W7TA 2PI5A 3Q5SA 2LFSA 4HJGH 5D5QA 1PGQA 4DR7B 2FFDB 2RCVA 2KZJA 1OMIA 2ZFCA 2Q5UA 4WY4A 2Y48A 4DOJA 2NN4A 2JKVA 1OCZC 3CC4V 1SERA 1NH2D 3MAQA 2IDBA 3ETQA 5K1PA 4G28B 1R3LC 1NU1K 4PD4H 3S9OA 2PUSA 2XOKG 2V7QJ 2Q67A 2R72A 3K5LA 4JYAO 2OCCC 1KYOD 2HVKC 2IH3C 4OGQD 5KTBA 4WFEA 2OIEA 1M93A 1WNSA 1S3JA 4CH3A 3RYCA 4GODA 1NU1J 4LWSA 5K5GB 4FFBB 2YEVA 3QF7A 4DV7O 2PTMA 3H01A 1IZ3A 3WB1A 1R8EA 2K9YA 1IFIA 2OYIB 2KIKA 2UXDO 3RK3D 4IT5A 5EIBC 1KMIZ 1IBKO 3P3PA 4PDMA 2AW9A 5A2QN 1IC2A 3GHGC 2L6LA 3OUSA 3DC6A 1NWQA 1N7SC 1RHZB 3RYFB 5LMNO 1GW4A 1X22A 4R4LA 3WUUA 2JS5A 2XT9A 2A0LA 1GN3A 3ASNB 2ADQB 4QE7A 1GU4A 4FM2A 5IY5B 3P30A 5LHHA 2YO3A 1S72P 5LGNA 3CX5I 2Q0OC 2C0XA 2WMMA 1JQ0A 2FBWC 2P67A 2OQQA 1V54B 4GKJB 4RO2A 3P32A 1V55B 1GMJA 1SQPH 3SFDC 4A7PA 5BU8B 2FYUG 4YIPA 3IFXA 2BEQD 1WA8B 1JFFB 5AW4B 3STZC 3IAYA 2Z5HA 2PGGA 2EILC 3V4QA 2CH7B 1AQTA 3T4ZA 4U3FG 3E8GA 3L71E 2Q9IA 4I7ZB 4IL6H 5ITZB 2NPSA 4PD4D 2FFDC 4TSFG 1RQUA 2R44A 4LBEC 1JO5A 1OW7A 1B04A 5EBMC 4X1YA 2SPZA 4HKZH 3CCVV 4D7SA 2YIUB 2DQ3A 1IBLB 3E8FA 2A79B 1DEBA 1SVFA 5KMGA 4TT3G 1H2GA 3B71A 4JBZA 1KYOF 3VQYA 3R2PA 1ZL8A 5HFMA 2QJ1A 1AI5A 2QWQB 5BR8O 4TOIA 1WB7A 2XAFA 3KCYA 5EZYA 1QLNA 3D36C 1N8RW 1RY3A 3FAVB 3LSSA 1Q81W 2IJIA 2K9JB 2M3EA 3I55P 3RBZA 1SC5B 3CWBH 1H88A 5CA1B 4FK5C 4MW8A 4JYCA 1N33B 1LTJA 2FYZA 3BA9A 4XFJA 2ZVOB 1KYOE 3M9QA 2EIMB 3CS5A 3L72H 4EFBA 5JQGA 2OYIC 3WU2H 1Q5OA 3K9AA 1NKDA 4K3AA 1ZWIC 4DV6B 4LF7B 1OCCB 1GM8A 4NTWA 1EC5A 2YKPA 2F4VB 4WFAV 3VMAA 2YMKA 1VQ5P 2ZQMA 4BWAA 3MHVA 3ASNC 3SDLA 4ZIBA 3RVZA 5TISH 1EN4A 5AG2A 2DWDC 2HHHO 5IY5C 1M56D 4J7JA 1FU1A 4RQEA 4HNAA 1SQPD 3B8EB 5LP6A 4K0KO 5CBOA 3CCLP 3VMXA 2N04A 2FKXA 3JD4A 1JM0A 2E5LO 2AEMA 3ZDMA 1PKXA 1NAFA 1KV4A 2A45I 5KLVK 1V55C 2HODB 4I4TA 4D7TA 1YYCA 2ZXWB 4ICGA 2N74A 4PJ0Z 3SYCA 1XILA 2Q9LA 2IZ1A 5GONB 1K8AW 1Q6IA 3JSVC 1XNQO 4DV2O 3OA7A 1ZX3A 2LP7A 1K05A 1GM9A 5H2FH 1OW8A 1FDOA 3GLMA 1GKFA 1YXBA 2HJDA 2P7TC 1UIIA 2WVRA 4PI2A 3FKSG 2OTLV 3VQWA 2ZINA 2XAHA 2YSUB 3W7XA 4WY4D 2ETNA 2Q73A 1K33A 3JARB 4JI1B 2JP3A 3AG4C 4ZNCA 1J95A 1J1EB 4XDLA 3CWBD 4PD4E 4DR5B 1OX3A 2BSKA 2R3CA 4WWIA 1CP9A 1VP7A 1VF5D 4O4LA 4H44B 5LXTB 3RBXA 1RH5B 2Y0PA 1S2EA 1VQ7P 2BOCC 2EZOA 1TAEA 4B7KA 1MABG 1OCRC 5JWPA 4DV3B 4DR3B 1KILB 1LWUB 4W80A 1US6A 3H1HJ 4JTCB 1SA0A 5LHGA 4FLUA 5CCHA 3AK2A 2PAJA 1NQTA 2QJYB 3TDKA 1R6NA 3LUTB 3BATA 3L75J 4DV5O 2AXCA 5IYCO 4UVAA 3GMAA 1KD1Q 1SZXA 1RP3B 2YKOA 2KB1A 3OMNB 1RE4C 2JEEA 3M8AA 1HNZB 3AEAC 1KORA 3ABTA 3BASA 4Y99B 2LGQA 5BXZA 1FYJA 3KKYA 1K92A 1NTMH 2MW2B 1GTOA 1NTKJ 2GHYA 2QGNA 2VQFO 3CMEP 1H0TB 1HF9A 4QGPA 4I1LA 2KNCB 1PNLA 5KJ7D 4P9PA 1Q82W 1SQPE 4NKGB 4I9WA 5CBGA 3DTUB 1KFMA 2ZXWC 3TYYA 1S72V 1X8YA 3SPGA 4JI5O 1YITP 2DYSB 3U10A 4KHXA 4LP8A 3D71A 1FFXB 1VQPP 3TCUA 5EZYB 1TVKA 4P9OA 4LFAB 5AW0B 4IL6E 1N32O 3I5CA 3N2GA 4MVOA 4D6TJ 2AEFA 2DMXA 2P90A 2KP8A 5JVDA 1A02F 4LFCO 1L0NK 4W7YA 1J1EC 5JQGB 1AI4A 3E1RA 1OIPA 4J42A 2CK3H 4J7KA 1L0NJ 2JR8A 2LGWA 1NKNA 3JD1A 1PM9A 1ZV8A 4H44C 5AW7B 1SRYA 5FLXN 3B2EE 5LL6Y 3ABVC 4ASVA 3CWBE 1DF5A 3HTKA 2RNBA 5L3EA 1ORQC 2N05A 3ABMC 3L72E 4IFFA 1KILC 1LWUC 1JY3P 1PV3A 4HNAB 1GL2B 3H1KH 4YXDC 2LW1A 3I55V 2HFED 3TXSA 1PP9J 3F5WC 2ZDIA 5CB4A 1NH4A 1P84F 2QJYC 4X9QA 1NTMD 1G1IA 1SQVJ 4O4IB 2XAJA 2B1GA 1EDIA 3MTUE 1RE3A 3H1JH 2IYPA 1XUQA 1M8OB 3C9IA 5TISE 4Y99C 4MVRA 4I50B 3SYQA 1JOYA 1X59A 5JJNB 1BE3J 2XNDG 3CP1A 2OTKE 4GYCB 1BHAA 1VQ5V 2BASA 1K9MW 2NPSC 1G4YB 2ZT9B 1T8ZA 1OVRA 2BCCD 3SGIA 5E79Z 2JJ1G 2RKLA 4NPDA 3CCLV 3UT5B 2QR4A 3E2EA 2DYSC 1FDIA 1IJDB 2Q7GA 5CBNA 4BIZA 4UVBA 5KLVG 1Q7YW 5H2FE 4O4LB 1JB0J 3MUDC 3CHXA 4JI3B 2PRRA 4J9ZB 5CN0A 5TJHA 3Q4HA 5APUA 2E75B 1ZAUA 1QR9A 1QVFO 2QKCA 3C3TA 3JALA 2OYHA 3MHSC 1AI6A 3V2PA 1N36O 2WTYA 2H8PC 5LA6A 2FY8A 1JTHA 3D6ZA 1ROPA 1NTZH 5J9PC 2KZIA 3H1KD 4HYOA 3A2FA 4RWUA 1XBLA 1DIPA 1K4CC 3LDEA 2JGDA 5EYPA 4DR1O 2XAGA 5IJ9A 1K4DC 4PELA 2YIBD 1BSMA 1GL2C 1PGOA 3H1JD 3K5BA 1A32A 4NPFX 1EBOA 3AG7A 3WMM0 4DV0B 1VQ7V 1SQQK 1QLED 3F5TA 2HKOA 4AHCA 2ZYDA 3PLNA 5CA0B 4CS2A 1YJNP 1Q3EA 1SQQJ 2JEXA 3L74G 2Y9YA 1NKZB 1NTME 1L4AD 2GV9A 3JD3A 4GX1A 3JCUZ 5APVA 1AJYA 4Z1MG 2UU9O 1F51A 3N2GB 1OFCX 5J2TA 3L72G 2R70A 1TA8A 2Q6AA 3ML0A 4X66O 1YTFB 2B9BA 5CCGC 2WLJA 1MSWD 5KHHA 2FYNB 3MP7B 3R66A 1S5LZ 3CMEV 2BCCE 1FBMA 4Q20A 1I08A 3CX5H 4F6RA 3A7OA 2JRIA 3APQA 3L73H 4LLHA 1YITV 3WG7B 2WSCJ 1VQKP 3QO8A 4FMTA 4QE9A 1NTZD 4X62O 4DUYB 1L0LD 5AW3B 1AROP 1EZVH 5IDJA 2E75C 1HWYA 3K58A 4W7ZA 3SPIA 1VQPV 4LFBB 3IC7A 4B7EA 1RM1B 1IFJA 5APWA 2IJHA 3T97A 5CCHC 2E74D 4HYTB 3J81N 1G8MA 4UCRA 1L0NG 3O65A 5CB4B 1OV9A 1FJGB 3BCCJ 1QBZA 2WZ7A 4X1KA 3H1LG 1ZUQA 1VQ9P 2YC0A 4BXLA 1AR4A 3L37A 1MZ9A 1YHQP 3PJSK 3KHUA 4DV4B 3H1KE 5AW5B 4FJCC 5EK0A 3I5DA 5KUKA 2W0XA 3MZWB 1LTGC 5KHJA 2K3RA 1ZRTD 3JD0A 2Q7CA 2IBZI 1BDCA 4DV1O 3AEEC 1Y4MA 5JCOC 1LGHB 3H1JE 1LJ2A 5AVYB 2OTJP 2LW7A 2IW5A 3QVNA 3HKBA 3LIEA 1SFCB 4MVQA 4DR6B 2ZNIA 5B5EH 4JTDB 1CEZA 5B1AB 1S76D 1PZQA 3CX5D 4L87A 4JZGA 1XMQO 5KAFH 1S0VA 2FKWB 1RPOA 1GRJA 4TUYB 4H0LD 3FX0A 4P2ZA 3RFRA 1KB9H 2HP8A 3EFGA 3L70H 3B5NB 3L73D 4GKGA 3TGUG 3Q4HB 2FYNC 1P49A 1FOSE 2XUMA 1EXJA 1OW6A 1ZN5A 2WLHA 3AG3B 4K35A 2QM4A 2OYHB 1QVFU 4JYYA 4GOEA 1HVVA 3CYOA 2GA1A 1VARA 1FDMA 2Q69A 3WG7C 1T3JA 1Q8IA 4WCEV 3CRCA 3HR0A 2L91A 3B4SA 3BAAA 2FB5A 2JGDB 3BRVB 5IJ9B 4JGSA 2JJ2G 1PPJD 5AVWB 1EQ7A 1RM1C 2N1TB 2XTAA 2KYVA 4FFBA 4NVPA 1NTZE 1Z2GA 2RN9A 2G38A 4GX2A 2R5BA 4KHPO 4QNHB 4B3RB 3TNUB 2E42A 3G80A 4W4KA 1LTSC 1YCIA 3ZHTA 4JI7O 3UM7A 2Q7HA 1XMOB 4CS4A 3CL3D 1VQLP 1R3IC 1N0JA 5DEDA 2FYUJ 2ZXEB 2RN0A 4O2AB 4CH4A 4DUZO 2VWKA 1WT6A 1O9HA 2QKAA 3V2RA 3CCQP 1TU3F 1KKDA 1VQOP 3BPZA 2WAMA 5J2TB 1U97A 2YO2A 4U3FJ 2CK3G 2QJPB 3II6A 3H25A 1KD1W 2UXDB 5A9GA 4KXRA 1SQQG 1ZRTE 5L3DA 2QE7H 1KB9D 3L70D 3K57A 4DR4B 1FZAA 2AXTH 5LHIA 3NMDA 3CCEV 4JI0B 4IL6Z 4FZ0A 1WA8A 5B1AC 1JFFA 2DN9A 2RQ6A 3FYEB 1YJNV 1ENVA 4UFZA 1IZNB 1SLQA 3LDCA 3RK2B 3KG2A 2CH7A 2DW4A 2CAZC 3B5NC 2QIWA 4XA4A 2EULA 1YIJP 4PV1C 2ZD9A 3H6PA 1B6QA 2QDOA 4FLYA 3CX5E 2PFXA 1M90Q 2H88C 4JTAB 4JZ2A 2OYHC 1YZBA 1XTCC 2H89C 1QL1A 2EZPA 4MTOA 3L73E 1J5EO 1YQ4C 1AP5A 2RMKB 4RQFA 4UB6H 1KYOH 2J58A 1BGYH 3OTOB 4L76A 3ZEDA 1W2BU 2PF4E 4MVSA 1KQGB 3HUSB 2GUZB 2OGUA 1M1JB 1UPGA 3JSLA 4NB5A 4UXNA 4JI2B 2K9JA 2N1TC 1BSHA 1K3EA 3WU2Z 1QU7A 3OAKA 1HNXO 3PRJA 5CA1A 4WF9V 4J11A 4UCSA 2B9ZA 1FZGA 1NVPD 4OPHA 1SF9A 1R6KA 5CHXA 3K5NA 1PPJE 4IFMA 1JY2O 1UJWB 3SJQC 3SPCA 1IFMA 5EIBD 1SZTA 2IH1C 1P7GA 5IJ0A 5TISZ 4RUEA 1DTOA 3HKBB 3K5OA 1M7LA 4AQYB 4RAIA 3K5MA 1VQ9V 1N7SD 1ZTEA 3E83A 1Y47A 2HVJC 1RE4A 4L8JA 2W27A 2NNUA 3AE5C 2XZRA 4OVNF 1DH3A 1YHQV 4TQDA 3V4WA 3CLQA 4NXMO 2ZE7A 5BY1A 3CC2P 1RSOB 2YMYA 4WFFA 2X6CA 2UXCB 4JI8O 1BQ0A 2HLOA 1F7YA 2E76B 2VRZA 2KKWA 2JWAA 3GWKC 1Y67A 2HODA 1PFIA 3ZMVA 5B5EE 3FB8C 1KQLA 3W7SA 1NU1D 1S5HC 1AJNA 5H2FZ 2WSEH 3HKCB 2JS3A 2OYOA 4PDLA 2X7RB 2J59M 2OTJV 1W2EA 4R4MA 5GONA 5KAFE 1HR0O 2YIAA 3RK2C 4U7JA 5BU5A 4B3SB 1KB9E 3L70E 1VQ6P 1NJIQ 4YHHO 3OFNG 1V9PA 5CA3A 1SS3A 1VL2A 2L35A 4PDVA 1PGJA 3FYIB 1BGYD 1HUCA 1L1FA 2R32A 3ETDA 3JARA 3L71J 2P06A 3N2KB 4YXWG 2NLJC 2X0LA 1I94B 4FLTA 2K88A 3R65A 2JVDA 3CC7P 3J7AU 3HUSC 4IL6X 3H32B 3NTNA 4MVMA 5LXTA 1M1JC 1HTLC 3IF4A 1KKCA 2WA4A 3EQ2A 3IN6A 3ETGA 2UUCO 4LF5O 1M1KQ 3CJHB 2Y0DA 1H2SB 1E1QG 2Z3YA 3WB2A 1LTBC 3PHLA 3LW5J 5AVXB 3GVMA 1KILA 1LWUA 2V4HA 3SWYA 3WB0A 5D5PA 1U7JA 4NTXA 4JI4B 1SQXH 2R9RB 3FWLA 3FD9A 1MFTA 4P30A 1N34B 2WSSH 1K73Q 1PGPA 1TUBB 2VQEO 3QO5A 3E8BA 2ZE8A 1EZVG 1HNWB 3TSIA 4J41A 4B08A 1H8AA 4JF3A 1VQLV 1S9KD 3EHBB 2K1EA 2WT7B 3VMYA 1IVSA 3M0DC 5KA5A 1JNMA 2E43A 3ZHRA 1N7LA 2E76C 1H0TA 4O2BB 2EX3A 4MW3A 2KNCA 4IOIH 1LUVA 1Q86W 2AXTE 1KN7A 3CCQV 2VRSA 5AVUB 1VQOV 4H13B 4JV5O 4YIOA 2KI7B 2ZM6O 4TV8B 3Q5RA 3K03A 4DV5B 4UCUA 4JI6B 4MTFA 1IFNA 1XQ8A 1FFXA 5AW8B 4W4LA 4EYYQ 1NBMG 2WLNA 3MUDA 2L5GB 5EC2C 2DJVA 4DW0A 5IWAO 3AE6C 2A06D 1QVGO 1L2PA 3AE9C 3DGEA 4XDJA 2X6AA 3BA8A 4UB6E 2ARHA 2B87B 1BS3A 3AE4C 1BGYE 4QPJA 1YIJV 3STLC 3CRQA 1DEEG 3LSUA 4EIJA 5IJ0B 1IK7A 2LXCB 1SQXD 2DW3A 5JH7B 3F5HA 1JY2N 2F93B 1NGMB 1CPYA 1IBMB 3RK3E 3PTZA 4OX9O 3F7YC 1GL2A 3BRTB 2ZAEB 3AG1B 1T2KC 1FXHA 2QM8A 3OR7C 3UCSC 1P84H 1V54C 4DR7O 4B3TB 4U7OA 5CBHA 4O4IA 4KFMA 1KTMA 2W90A 5DM6V 4ZI7A 4I50A 1B06A 4GLXA 5KLVJ 1N0NA 4BIUA 5GTHH 5J2UB 1I5YA 5FNVB 2PYJA 5KHKA 4I7ZC 3D3IA 5IYBO 3HRNA 5L3FA 1Q90D 1S9KE 4H13C 2YIUC 3S3WA 1SQPK 4LH6A 3L4FA 2QWOB 3UT5A 5CCGA 4EB6A 3FFQA 2P5OA 2F43G 3CC2V 1IFDA 2YICA 2IBZH 3ZMUA 3GB7C 3L9DA 3FGAD 1SQPJ 1Y66A 1K5QA 3OR6C 3T1HB 3H1HD 2YDEA 1R3JC 1RF1A 3KDPB 3VYIA 2WLLB 1ZW0A 2NR5A 5LMUB 1VQ6V 2EIMC 1Q6HA 3L71G 4U3JB 1K7DA 3G4SP 1VQ4P 2OYQA 1LT1A 3KCXA 2B88A 3ZJZA 4DR2B 1NTKD 1HP8A 1OCCC 1SQVH 3ZIAG 4GZRB 1IURA 3ABKB 2H7HA 2O01N 4H44D 4GKJO 2ADPA 1URQA 2YI9A 1FC2C 1NYHA 2P7JA 1P84D 1XI1A 3L74J 3QO7A 3CC7V 1BE3H 2Y4UA 3D70A 1SQXE 3SWKA 1KILD 1JX9A 3AG1C 5C8YB 3AE7C 3CWBJ 4CH6A 3MHHC 2X6BA 2AEJA 4MVZA 3RWRD 1N86A 2LR2A 5AVSB 1URFA 2LQTA 4LC1A 3L72J 2NZ2A 4R50A 5CA0A 1QL2A 1N36B 2BOBC 2QTSA 1W59A 5JCOA 3QWOC 1IBLO 4J80A 2GUVA 3FB7C 2UUBB 3PH0A 3AEFC 1YJ9P 3B09A 4JAAA 1WN7A 2EIKB 3CSXA 2XV5A 2BCCH 1PNMA 4K8XA 3HD7B 4FLWA 4HZ3A 4BW9A 2IBZD 5EBWC 4CH5A 5AVQB 3K08A 2NPSD 1MFZA 3ZRSA 4IFDK 4X1IB 5IE9A 1N33O 1QVGU 1QHTA 4LR3A 3AK3A 3K79A 3QTCA 2M0BA 1R5SA 1SQBH 3AG2B 4DV6O 1D2DA 4LF7O 4UV8A 5BMVA 1MNGA 1MZFA 1UIXA 3H1LJ 4FIPC 3IAOA 4LGDE 2C9LY 2WLMA 2F4VO 1Y74A 4DJGA 1J1DB 4I9QA 1BCCH 2UXBB 1SQVD 2KB7P 5IYZA 2ZCEA 1M90W 5EBLC 3E89A 5H6QA 5GW7A 1SESA 3CEIA 3GG2A 2WPRA 1T3UA 3P8MC 5CJ4A 5C93A 4LF8B 2CTQA 1BE3D 4C7RA 4A5UB 2QSAA 3ABKC 2H8PD 4FZ1A 5LOVB 1S77D 3B77A 3BY6A 2FMLA 1F4NA 3CXHF 4B86A 2JDIH 5L3BA 1FZEA 3CRRA 4GT1A 4DT0A 4ZI7B 2IFMA 3THOA 1NTKE 1EM1A 1D5NA 3USSA 4QIWF 1LR1A 4UCTA 1EXIA 1VQNP 5B66H 1GL2D 5CJ0A 2Y69B 4EOTA 1P84E 1JMMA 3M9HA 2P2UA 2M8RA 3TGUJ 3VP9A 3OMIB 1KILE 5B5EZ 4JI1O 4EB6B 4YJ2A 4B3MB 1GK4A 1Z5VA 1FZCA 1JUNA 1SFCA 2EIKC 5KAFZ 4DR5O 4K8ZA 5GTHE 3DXRB 4N23A 4PA9A 3HD7C 2MKVA 3ZHQA 1TUEB 1NTMK 4N78D 2RH0A 4BAYA 5LYJB 4JPRA 1JCDA 1SQBD 1RF1B 3HKEB 4TUYA 4EDFA 1SQXG 3CB2A 5APYA 3QNEA 3B5NA 2ZXXA 1LT9A 2YXQB 3OEEG 4DV3O 4FLZA 2IBZE 5CCGD 3G6BA 4DR3O 1BCCD 2UUAB 4WBAA 4YY3B 5APQA 1KP3A 1Y9BA 3CMAP 2QA4P 1GM7A 2GTAA 1ZLLA 3C8VA 1SQPG 1DGSA 1L8DA 3TJTA 4LF4B 3A5TA 1NJIW 2MK3A 1L0LH 4BRYB 1XEQA 1J1DC 2F66C 4BIOA 1URQB 3UQ8A 4RJTA 2YIDA 2E5TA 1HNZO 1E5WA 1E79H 2LKMA 4KT0J 1ZP0C 3U1CA 2VS0A 2E75D 2W0FC 2CGOA 3RT3C 2N1TA 2LO1A 1FD9A 4FM0A 2IM9A 3H1IH 3IJ4A 4ASUG 1SQVE 4WBNB 2QRXA 3D6YA 3V2NA 3TNUA 5CCHD 1JOCA 1K04A 3SPJA 3G4SV 2Q68A 3OMAB 1VQ4V 5CMUA 3E7KA 1BE3E 3IC9A 1M1KW 4CC5A 1KQFB 4I55B 4OH8B 4YJ3A 3HE4A 5B1NA 5L8RJ 4QPKA 2FXOA 2PI4A 4O2AA 4LFAO 1IK9A 3CWBG 3A3YB 2I1JA 4AQRD 2ZT9C 1HGVA 3H1KJ 2WWWA 2YS8A 1XNRB 3ITKA 4NXNB 1K73W 2EJ7A 3MD0A 2KSDA 2AGAA 1W0KG 1EN6A 2C9NY 3SFEC 2WPVB 3H1JJ 4UUJC 1DF4A 1RPRA 3ASOB 3EWKA 2V1DA 4YTPC 5BMVB 2C2AA 2GDSA 1Q2NA 5AW9B 4UCVA 1RF1C 4CPGA 2D2CB 4WFBV 4ZKPA 1Y74B 3M99B 1MOFA 5JJEB 5IYZB 1YTFD 4N78E 3RGBA 2IPPA 2KOGA 4UB6Z 2K37A 3CXHI 1SQBE 1X9VA 3BFRA 5E1AC 3JAMN 5KLIB 3FXDA 2WSFJ 4TQFA 2E74B 2Q4PA 4IGGA 3ZRWB 4G27B 1Y76B 5KUMA 3H1ID 4X65B 1BCCE 1URQC 2QWRB 2CUGA 2M6YA 1PPJH 1GN2A 4ZOLB 2JK5C 3HUSA 1GU5A 1OJHA 2GUZA 1FAFA 1PD3A 1M1JA 3QH9A 1M4UA 2IU3A 2P6JA 3RVYA 4LF9B 2GBOA 4PA6A 1MSDA 1SQGA 3NXSA 1NOHA 1H2KA 1J2JB 1BMFG 1NTZK 2N9BA 2PZSA 2Q0AA 4I2LC 2CPSA 1NZ6A 3A0HH 3CPWO 1MG1A 4G2KA 3E22A 3M0AA 1OZ0A 4OPAA 3W7WA 4DRXB 1NTZJ 4R6ZA 3SYPA 4YJ2B 3C1LA 1FZCB 3N4XA 3UO2A 1FZBA 5B66E 2ZYGA 1YJWP 5KX5B 4JI3O 1KP2A 1K8AQ 3OE7G 1OZHA 3M0DA 3KPEA 1RSOA 2BTQA 3NFQA 1LT9B 3E1IA 2QSIA 1B3QA 2M5AB 4LF6B 4LNUB 1U7MA 3ASOC 3T1YO 1XTGB 1IDSA 3HKCA 2O01H 2WPSA 2P4VA 1NAYA 2D2CC 2PY5A 2QWNB 2A45H 2LXBA 3K9SA 3RL0B 4L73A 1NTMG 3B5ND 3T4DA 1N4CA 1U96A 3E8HA 4FLXA 5KLIC 1AA0A 4PV1D 4DV0O 2FYUD 1L0LE 4I5SA 1EZJA 2HG5C 1DD3A 3N2KA 3N7NA 2HR3A 2QM7A 2ZE5A 4HAMA 2G8YA 3JATB 2QA4V 2BCCG 3CMAV 3H32A 1M57B 3K0GA 3L73J 1LTIC 4NTYA 4MSWC 5DJUB 4YJ3B 3HE4B 4JYAB 5BVZA 2N1TD 3H1IE 3IFMA 3CJHA 1U57A 3SJBC 4FPPA 1KQSO 1PL0A 2HPCA 1ZR4A 3ZHVA 1VQ8P 4DV7B 2W6BA 3S4RA 1FZCC 1WPBA 1SFCC 1IBKB 5IT9N 1TUBA 4F6EA 4C46A 5B3SB 2A7WA 5BZBA 5LMNB 1H2MA 2V7QH 3AEGC 2WT7A 4DUYO 3H1KG 1K5SA 2KSEA 2Q6QA 4LFBO 3CRAA 3HPLC 1WAZA 3ZMSA 1D7MA 1LT9C 2H43A 4O2BA 1NU1H 1LNQA 1YSCA 3W67A 1KZUB 1FXVA 3ETEA 3AG3C 3ZRVA 2D3OW 3JCUH 1ZMEC 2AHZA 3JSNA 1G6UA 3T1CA 3H1JG 2QG4A 4TV8A 4XBFA 1FJGO 5APSA 1VEWA 4ZKIA 4O4HB 4N3YB 3RL0C 2DWEC 3RK2D 3ZHUA 1EDJA 5CBFA 4DV4O 2RJZA 4DZOA 1RFYA 1USDA 3AE1C 4JYBA 1RF0C 1BDDA 4M3LA 1VQKV 1AP6A 1QEXA 2B87A 2KS1B 1NVPB 2I8DA 4EFEA 3B40A 4H37A 3E22B 3CPWU 1H8EG 1M57C 4ZMDA 1Z56A 4RO0A 2FYUE 5JH7A 5BR8B 1YBKA 3A0BH 2ZE6A 4IIJB 1FFTB 4DR6O 1N7SB 1GDTA 3O6QB 5FPRA 3A0HE 1WP7A 4JASA 2JGUA 3ZMTA 5IWAB 1MV8A 2ODMA 4FVMA 4LCUC 4BWNA 3RGUA 3U11A 2QJPC 2BTQB 1AJPA 1NTZG 1L0LG 2YNYA 5B3SC 5GTHZ 2Y0EA 2WQYC 3NR7A 1QCEA 1NR1A 3OM3B 5GTIH 1WRGA 1AV1A 4GKKO 3E35A 4UVCA 3EFFK 1JJ2U 1IFPA 3Q1MA 2QWPB 3ZS8C 4I0XA 1EN5A 1NH2B 3ZMZA 3G6EP 5J2UA 1Q7YQ 5FNVA 1JMBA 2HHHB 4OX9B 3H1IG 3VOUA 4K0KB 1FKAO 4X64O 2EILB 4OGQB 3HKDB 5JJJB 5H5NA 1YJWV 2E76D 2BE3A 2E5LB 3N27A 5CMZA 1SETA 4WFGA 5E79E 2H94A 1AVMA 2IFNA 4B3RO 3CCSP 1R73A 1OCOB 2KK7A 1VPCA 4E2LA 3AK1A 2N9YB 2R9AA 3C3SA 5LGUA 1XMOO 3RK3B 3VMZA 4TV9A 2ITDC 1PL4A 1WB8A 3JCZA 4R7CA 5DJTB 1XNQB 4DV2B 5KAIH 2A06H 2K9PA 2NRGA 2WLLA 4UCOA 2XNDH 4DK1A 2HPCB 1KQSU 3IGAC 3JC22 3Q3DA 1EDLA 4U3JA 4UB8H 1R5LA 1NVOA 3LSQA 3C90A 2OARA 3BEHA 2P4KA 3RYHB 2AZ0A 2H3OA 1AILA 3L73G 4DR4O 2BEZF 4X20B 1BGYJ 3E86A 2XAQA 1FE6A 3SYOA 3G9RA 4MVUA 4JI0O 5KLVH 2VWJA 4ZHQB 2IZ0A 3ICXA 5KHGA 5C8YA 1NT2B 3QG5A 3OUFA 4XE5B 1ZXGA 1T2KD 3G3ZA 5KA6A 4EKWA 2ZKOA 5KJ7A 1FJPA 1IX9A 1NR7A 1VQ8V 2AZ2A 1PPJG 2ZIMA 3VOPA 2CTRA 1EZVI 2ZYAA 3AEDC 2A9HA 4NR1A 1AB3A 3OTOO 3HD7A 3GF3A 1NU1E 3A2AA 4JI2O 2XKMA 4OGQC 3JAKA 1MZEA 3JCUE 2VQFB 4X1IA 5EC1C 3VQVA 2ZJSE 1E1RG 3P8CD 4H13D 2OWOA 4MTGA 1OCOC 2WLKA 3H1HH 5F2VO 2OIGA 3TXQA 4Z2WA 3CXCU 3JASB 4JI5B 3KZIH 3RK3C 3AG4B 1YDXA 1S5LE 2WSEJ 3MIWA 5EFWB 2KUBA 4GOFA 1BL8A 3L75H 2M7WA 3RYIA 3L74H 4AQYO 1K34A
chains in the Genus database with same CATH topology
2ZT9B 2BEQD 2E74D 2O01J 3Q1MA 1DD4A 2G8YA 3IN6A 4I7ZC 3AE3C 3SFEC 2WPVB 3R4YA 1FDIA 1S1CX 1Q90D 4Z1MH 1ZOYC 3LW5J 4H13C 2YIUC 4I7ZB 3EWKA 4YTPC 5M1BA 1HJ0A 4OGQB 1U57A 1RQUA 2E76D 2QIWA 1OW7A 2D2CB 3Q2YA 1VF5C 3FGAD 1JB0J 4PV1C 3GMAA 2H88C 3B71A 3AEAC 3AE8C 1KORA 1EXIA 2P10A 4PV1B 2H89C 3AEEC 1RQVA 1YQ4C 2E74C 2E75B 2QJKC 4RKUJ 1PIXA 5KKZC 2WSFJ 1YQ3C 2E74B 1KILE 1KQGB 1HF9A 2G3AA 3D6ZA 2E76C 3AEGC 4XFJA 3Q3DA 1DIPA 1MKMA 2MKVA 3Q5SA 4H13B 4H44D 4H0LD 3D71A 1NYHA 3Q5RA 1OMIA 2FYNC 4Y28J 2JO1A 1EXJA 1OW6A 1S5LX 1ZMEC 2BEZF 1VF5B 2YMKA 3D70A 2IDBA 3G9RA 3AE7C 1WMKA 3S9OA 1Y9BA 2V7QJ 1PL5A 3C8VA 4OGQD 2NZ2A 3AE5C 3AE6C 2D2CD 3AE9C 3AE1C 4GDOA 3Q5PA 4H44C 3AE4C 4H0LC 3AEFC 1R8EA 2E76B 2K9YA 3ABVC 1AJYA 4KT0J 1ZP0C 2E75D 1IK7A 1KMIZ 3AECC 3RL0g 3AEDC 2ZT9D 3GF7A 2QSIA 1NGMB 3AE2C 1K05A 3RK3E 1PV3A 4R4MA 3GF3A 2FXPA 4YXDC 3D6YA 1OW8A 1FDOA 3GLMA 1K04A 4OGQC 4R4LA 4U7JA 2QJYC 2D2CC 1VL2A 4TT3H 1KQFB 4H13D 2JP3A 5L8RJ 2J5UA 2WSCJ 1TU3F 3IAOA 3O6QA 1UIXA 2QJPC 2E75C 2FBWC 1KTMA 1VF5D 2OQQA 2WSEJ 4PV1D 5KLIC 3T97B 2ZT9C 3AEBC 4H44B 3H25A 4H0LB 1GMJA 2WQYC 3SFDC 1DD3A 1ZRTE 4IL6X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZT9 B;  2QJK C;  4RKU J;  2O01 J;  5KKZ C;  2WSF J;  2E74 B;  2WPV B;  3C8V A;  2QJY C;  1Q90 D;  3LW5 J;  2YIU C;  4I7Z B;  4OGQ B;  2QIW A;  5L8R J;  2WSC J;  2D2C B;  2QJP C;  4H13 B;  1JB0 J;  2K9Y A;  2E76 B;  4KT0 J;  5KLI C;  2WSE J;  2FYN C;  4Y28 J;  4H44 B;  1S5L X;  4H0L B;  4PV1 B;  2QSI A;  1VF5 B;  1ZRT E;  4IL6 X;  2E75 B; 
#chains in the Genus database with same CATH topology
 1EDK A;  1IO4 A;  1ZSP A;  1HJB A;  1N32 B;  1I5X A;  3U1A A;  2GM4 A;  3L70 G;  3FWN A;  1YEW A;  1ZR2 A;  3R4Y A;  3UO3 A;  1NTK H;  4EI2 A;  4LFC B;  1IXM A;  1Q6U A;  1F4M A;  5KLV D;  1M56 B;  4Z1M H;  1OCR B;  1FXK B;  2UXC O;  3SJC C;  3HE5 A;  2WPQ A;  1LP1 A;  1AR5 A;  5LOV A;  1JMK C;  1G2C A;  1CXZ B;  3A0B E;  4F4L A;  2P22 C;  3CXH H;  1XHZ A;  3ABU A;  3D8C A;  3LDD A;  5B66 Z;  2A45 G;  1HH0 A;  2Z0A A;  1KB9 I;  5H9C A;  4I0X B;  4B3S O;  4KJM A;  2B1I A;  1SQX K;  4D6T H;  1AVY A;  1SQX J;  1GAX A;  5GTI E;  3OW2 O;  1OHH G;  2XU6 A;  2KQX A;  4EEQ A;  1EFR G;  4WY4 B;  1I94 O;  3CCM P;  1HWT C;  1L0N H;  1VF6 C;  3DXR A;  2W6A A;  3H1L H;  2QEX P;  1DX7 A;  5LYJ A;  4J7Z A;  4TV9 B;  2K1A A;  1VF5 B;  4PD4 F;  4MN4 C;  3CCU P;  1H2N A;  1K97 A;  2IYO A;  4AUW A;  3HKE A;  2WIT A;  5AVR B;  1FAV A;  3KQG A;  1WMK A;  3RYC B;  2W6I G;  3L75 D;  1KC8 Q;  3G6E V;  3L74 D;  4LWS B;  4KUM A;  2YUA A;  2QJK B;  2F1M A;  1GTW A;  2YEV B;  2QE7 G;  4JI4 O;  4TLF A;  1JR9 A;  1PP9 H;  3DSQ A;  4JF7 A;  4GX5 A;  4OWF A;  2O57 A;  5KAI E;  3LNN A;  3P8C E;  2A06 E;  4BRY A;  4O4J A;  2EIN B;  1N34 O;  1X4T A;  2DYR B;  3L72 D;  4KP4 A;  3CCS V;  2V7Q G;  1PNK A;  3PP5 A;  1OVU A;  3SYA A;  5L3C A;  2KG7 A;  3RL0 g;  1HNW O;  2Q3E A;  3AE2 C;  3CXH D;  4UB8 E;  1NU1 G;  2CPB A;  2EBO A;  2YIB A;  4E4E A;  1M56 C;  3TK1 A;  3HB3 B;  3ABM B;  1A02 J;  1FXK C;  3A8T A;  1Q43 A;  4WBN A;  4HBN A;  2E5Y A;  3TGU H;  3EVK A;  4JAV A;  1BHB A;  3WUT A;  1HGZ A;  5KLV E;  4D6T D;  2J5U A;  4QJF B;  1BGY G;  2Z5I A;  2LJ2 A;  3G67 A;  1KU9 A;  4I55 A;  4JI6 O;  1N73 A;  1NTK K;  3LNM B;  4DR1 B;  1L4A A;  3H9V A;  3U59 A;  1S5J A;  2EIJ B;  1L0N D;  3S3X A;  3JD2 A;  3JAK B;  3H1L D;  1GK6 A;  1FJK A;  2QVA A;  1I0H A;  2NPS B;  1KYO I;  3RW0 A;  5AW2 B;  2IU0 A;  1S1C X;  4KL1 A;  1ZOY C;  4X1Y B;  4WY4 C;  4CBC A;  4ASW A;  2WLI A;  1HJ0 A;  5KMG B;  4WB4 A;  3SJA C;  3F89 A;  3A0R A;  1HDJ A;  5K1X A;  3L36 A;  3Q2Y A;  3HD7 D;  1ZL8 B;  1PP9 D;  1VF5 C;  3K06 A;  1X0T A;  1AVO A;  2Q1K A;  3RYI B;  2HYN A;  1DLB A;  3M7M X;  3VQX A;  1IBM O;  3AE8 C;  2UU9 B;  1RQV A;  3CD6 P;  2AHY A;  3APO A;  3H1H E;  1IXB A;  2QJK C;  5C39 A;  5FL7 G;  4X66 B;  2RMZ A;  3BAB A;  1NHL A;  3T2M A;  1NO4 A;  1NI8 A;  1GN6 A;  1LTJ B;  1YQ3 C;  3OD4 A;  3KZI E;  1W0J G;  3L75 E;  2EIN C;  3HE5 B;  2ILM A;  3ZRW A;  1LP1 B;  3L74 E;  1Y76 A;  2DYR C;  2RDC A;  4B3T O;  1G2C B;  1SQQ H;  1X79 B;  4ZOL A;  3BRC A;  5B1O A;  3TGU D;  1FS0 E;  3SWF A;  1VDF A;  4I6M C;  4X62 B;  3ZRX A;  3A0H Z;  2ZR3 A;  2JO1 A;  2KXP B;  1BQZ A;  1G1J A;  2JWD A;  1OVV A;  4CS3 A;  5LBQ A;  3WU2 E;  2PYL A;  2O1K A;  5LP6 B;  1QR8 A;  1SQV K;  1P4R A;  3CXH E;  1YTZ I;  3CI9 A;  1GMG A;  5KJ7 C;  3WUV A;  3B8N A;  1YF2 A;  1PL5 A;  3P7K A;  5FPO A;  2W6J H;  1COW G;  4DRX A;  3OW2 U;  1WJZ A;  4PD4 I;  4I4T B;  3CCJ P;  2A06 G;  1XOU A;  1AQ5 A;  5AVT B;  3T1H O;  1JY3 O;  2IJJ A;  3CCR P;  1YTZ T;  4UV9 A;  4CZZ A;  1KUQ A;  1GN4 A;  2EIJ C;  2JIZ G;  4WFH A;  3ZBH A;  4QMA A;  2WSC H;  4D6T E;  2A3Q A;  5KX5 A;  3BVO A;  2ZT9 D;  3GF7 A;  4PJ0 H;  1Y6X A;  1NTM J;  3K3W A;  1M9N A;  5LMU O;  4RUF A;  4DV1 B;  2FXP A;  5HFL A;  4X89 A;  1KBH A;  5KHI A;  1L0N E;  3ZN0 A;  2KSJ A;  1VQM P;  2M5A A;  2F95 B;  2WSS G;  3H1L E;  3V5B A;  4LNU A;  1AFO A;  2CTW A;  2WSF H;  3DC5 A;  3AG2 C;  2O3J A;  3BCC H;  3OAA G;  4DR2 O;  2PGD A;  4AIL C;  1LTA C;  2BSK B;  2ZVN B;  4O4J B;  1QX8 A;  1XDC A;  1BT8 A;  2WA3 A;  2BCC J;  3CCM V;  1XL4 A;  3X2Q B;  2KG7 B;  2V4D A;  1XMQ B;  2QEX V;  4O9B A;  1SQQ D;  3AEB C;  3G71 P;  2HJF C;  4IHJ A;  4X88 A;  1PP9 E;  1LTJ C;  1JA8 A;  3CCU V;  1VF7 A;  2CTP A;  1SQB K;  1RF0 A;  2HFE C;  2B5U A;  1YI2 P;  3UKM A;  2YXY A;  5L3G A;  5AW6 B;  2E3C A;  2CE4 A;  1JPX A;  2HLD G;  4GUN A;  3T1Y B;  1QLE B;  1SA0 B;  1SQB J;  3JAT A;  1USE A;  1URQ D;  1MMM A;  5M1B A;  2UXX A;  4X8A A;  2UUB O;  1BSN A;  4HH2 A;  4JPZ B;  3ZN1 A;  1N73 B;  2WPD G;  1BCC J;  1JEK A;  2Y4T A;  2Q8V A;  2Y69 C;  3W7U A;  4C7U A;  1L4A B;  3OJA B;  1Z5W A;  4TWK A;  5LP6 C;  3LID A;  4L75 A;  5APT A;  3TGU E;  4WVZ A;  2UXN A;  3H1H G;  3O8Z A;  2AXT Z;  2FTK A;  4AYC A;  3KYQ A;  4RKU J;  4KHP B;  1VIB A;  4U7N A;  3ZCC A;  3CCE P;  3SPH A;  2JJL A;  1XHX A;  3L75 G;  4JI7 B;  2HEP A;  2WLI B;  3FX7 A;  1OXZ A;  1Q86 Q;  1JCH A;  4YXW H;  2ZR2 A;  3FB5 C;  3EXA A;  2Z4E A;  3J80 N;  4ZKU A;  1MKM A;  1H38 A;  1FS0 G;  1TVK B;  3BCC D;  4DUZ B;  1NTK G;  2UXB O;  1YJ9 V;  3MGN A;  4RES B;  4N21 A;  2GUS A;  4PDR A;  4Y28 J;  1N8R Q;  4PI0 A;  1Q81 Q;  2GSM B;  5JVD B;  2P58 A;  5IYD O;  3PN1 A;  3V2Q A;  3TF5 A;  2EJR A;  4LF8 O;  4R8C A;  3W68 A;  5AVZ B;  2R9I A;  3M9B A;  4YPC A;  1MA1 A;  3D3Q A;  4C7N A;  4O4H A;  1O9G A;  2D2C D;  5KKZ B;  3X2Q C;  4GDO A;  1FPO A;  3OT7 A;  3HTK B;  4D6T G;  2FYU H;  1KFN A;  1GK9 A;  1P84 I;  3VBB A;  4DXW A;  1GO3 F;  1MUU A;  2C0W A;  4N6J A;  1S4X A;  3B8M A;  1YVW A;  1L0L K;  3CD6 V;  1QLE C;  3CE2 A;  4U3F H;  3U0Z A;  3A0B Z;  1SQQ E;  1UFI A;  2HG5 D;  2IBZ G;  2KLV A;  2KS1 A;  3VN0 A;  4DW1 A;  1J5E B;  1LUW A;  1R3K C;  3M06 A;  4B3M O;  1L0L J;  1W2B O;  3F7V C;  3GWO A;  1QGK B;  4L74 A;  3I56 P;  5H6R A;  1N73 C;  1P7B A;  3GHG A;  4TT3 H;  4IIJ A;  3ABL B;  2W8Z A;  1L4A C;  3JAW A;  1N7S A;  4DCK A;  1HNX B;  3O6Q A;  1JY3 N;  3FB6 C;  4H33 A;  1AI7 A;  1PP9 G;  2UWJ E;  3P3N A;  2Z5U A;  5GTI Z;  3H1I J;  3IR9 A;  1H89 A;  4NYK A;  4DO2 A;  4H0L B;  1H8H G;  1VQN V;  2Y9Z A;  4PA4 A;  2UUA O;  3SR2 C;  1SQV G;  3CC4 P;  4YY3 O;  1JCC A;  1NS1 A;  2XAS A;  1SFC D;  4MT8 A;  4GIF A;  2XHB A;  1FOS F;  4LF4 O;  1CI6 A;  4JAU A;  5E79 H;  2ZIO A;  2Y0I A;  4FLV A;  1BE3 G;  3TET A;  2R3S A;  4PJ0 E;  1KEC A;  1PV0 A;  3CCJ V;  3UIA A;  3BVH A;  5DN6 G;  3CCR V;  1CSB A;  2FL4 A;  2R5D A;  3ZHS A;  4IHJ B;  3HKD A;  4NXM B;  1GH6 A;  4BR6 A;  3BCC E;  4JI8 B;  1HBW A;  2P10 A;  4PV1 B;  2CDY A;  1WPX A;  1EZV D;  2B89 A;  2FFD A;  5KAI Z;  2I1K A;  1XRE A;  3JAL B;  2E74 C;  5AW1 B;  1BZK A;  2O1J A;  1G1X B;  5LA6 B;  4GKK B;  1JTH B;  5KKZ C;  2XNX A;  4ABM A;  1VQM V;  3L35 A;  2MJZ A;  1GD2 E;  1SP4 A;  2FXM A;  4U3F D;  3RL0 D;  1F23 A;  1HR0 B;  1R1B A;  1KC8 W;  3OEH G;  4UB8 Z;  4YHH B;  3D36 A;  5EYP B;  1JVM A;  5AVV B;  3K59 A;  4X64 B;  2Q3I A;  3MDS A;  1TGO A;  1XNR O;  2ZDI C;  4NXN O;  3G71 V;  3VP8 A;  3VTP C;  3OTF A;  1VMG A;  1R6T A;  1THZ A;  3RYH A;  1S5L X;  1CW5 A;  1SQB G;  2OYI A;  3OGC C;  3WFV A;  4DYL A;  1M57 D;  1RE3 C;  2JEU A;  1YI2 V;  2ATK C;  2FYU K;  2YKQ A;  4X20 A;  3ABL C;  1QQC A;  1Q82 Q;  3RN4 A;  2OCH A;  1BCC G;  1ZLZ A;  3RYF A;  4ZHQ A;  2YI8 A;  2UUC B;  4LF5 B;  2Q5Z A;  2LFR A;  5B1B B;  4MS2 A;  2XDJ A;  4LH7 A;  3Q5P A;  4H0L C;  2YXR B;  3CCV P;  1M5I A;  2OT5 A;  4JQ0 D;  1FZF A;  2QTO A;  2Q7E A;  3CRM A;  3S1K A;  5DEC A;  4FM1 A;  1DK1 A;  3AEC C;  3L71 H;  2JDI G;  1SQF A;  1WP8 A;  5LGT A;  4IYI A;  4FFK A;  1AJQ A;  2ITA A;  3CX5 F;  2VQE B;  4C7N B;  4X65 O;  3BHP A;  4GX0 A;  4F6R B;  1VF6 A;  1XL6 A;  2IJK A;  3AEI A;  1OCZ B;  4PA7 A;  1JY2 P;  1S5L H;  1SKV A;  5APX A;  4LF9 O;  1D5A A;  2OCC B;  3KZI Z;  1H2L A;  2IX7 C;  4J10 A;  3O9O A;  5ITZ A;  2KLU A;  3L70 J;  3LW5 H;  2W6J G;  1T6A A;  3JYC A;  1LTT C;  4PA3 A;  2DOS A;  3T97 B;  1N2D C;  4JV5 B;  3OGI B;  3SSU A;  2ZM6 B;  3JAS A;  2DQ0 A;  1GZL A;  1QNM A;  4J9Y B;  1SS1 A;  1I7F A;  4AI8 A;  4X1K B;  1AR1 B;  4MTX A;  2ZNJ A;  2O01 J;  1EZV E;  2ITC C;  4GCZ A;  4BW5 A;  2GTS A;  1DD4 A;  3KXD A;  3FAV A;  3GW6 A;  4PHZ A;  3GHG B;  2POH A;  3AE3 C;  4XDK A;  4Q6G A;  3JAW B;  4Z1V A;  4CC6 A;  2BTO A;  1CZQ A;  1T5E A;  2W83 C;  4U3F E;  1HW7 A;  4NPE A;  2M3B A;  2YXL A;  4OXS A;  1FXK A;  2DE0 X;  2PP6 A;  3BCC G;  2QKS A;  3M91 A;  1K9M Q;  4LF6 O;  2CGN A;  2YXH A;  4IYH A;  2Y0C A;  3K0D A;  3FXE A;  1PIX A;  3ZX6 A;  1CI6 B;  1E79 G;  4ZBM A;  5B1B C;  3L71 D;  2F23 A;  2P1J A;  1W5C E;  1GW3 A;  1Y8A A;  2G3A A;  3K04 A;  3I56 V;  4HB1 A;  1JJO A;  3V6I A;  4DK0 A;  2OTL P;  1OWA A;  1WLE A;  1KB9 F;  3W7T A;  2PI5 A;  3Q5S A;  2LFS A;  4HJG H;  5D5Q A;  1PGQ A;  4DR7 B;  2FFD B;  2RCV A;  2KZJ A;  1OMI A;  2ZFC A;  2Q5U A;  4WY4 A;  2Y48 A;  4DOJ A;  2NN4 A;  2JKV A;  1OCZ C;  3CC4 V;  1SER A;  1NH2 D;  3MAQ A;  2IDB A;  3ETQ A;  5K1P A;  4G28 B;  1R3L C;  1NU1 K;  4PD4 H;  3S9O A;  2PUS A;  2XOK G;  2V7Q J;  2Q67 A;  2R72 A;  3K5L A;  4JYA O;  2OCC C;  1KYO D;  2HVK C;  2IH3 C;  4OGQ D;  5KTB A;  4WFE A;  2OIE A;  1M93 A;  1WNS A;  1S3J A;  4CH3 A;  3RYC A;  4GOD A;  1NU1 J;  4LWS A;  5K5G B;  4FFB B;  2YEV A;  3QF7 A;  4DV7 O;  2PTM A;  3H01 A;  1IZ3 A;  3WB1 A;  1R8E A;  2K9Y A;  1IFI A;  2OYI B;  2KIK A;  2UXD O;  3RK3 D;  4IT5 A;  5EIB C;  1KMI Z;  1IBK O;  3P3P A;  4PDM A;  2AW9 A;  5A2Q N;  1IC2 A;  3GHG C;  2L6L A;  3OUS A;  3DC6 A;  1NWQ A;  1N7S C;  1RHZ B;  3RYF B;  5LMN O;  1GW4 A;  1X22 A;  4R4L A;  3WUU A;  2JS5 A;  2XT9 A;  2A0L A;  1GN3 A;  3ASN B;  2ADQ B;  4QE7 A;  1GU4 A;  4FM2 A;  5IY5 B;  3P30 A;  5LHH A;  2YO3 A;  1S72 P;  5LGN A;  3CX5 I;  2Q0O C;  2C0X A;  2WMM A;  1JQ0 A;  2FBW C;  2P67 A;  2OQQ A;  1V54 B;  4GKJ B;  4RO2 A;  3P32 A;  1V55 B;  1GMJ A;  1SQP H;  3SFD C;  4A7P A;  5BU8 B;  2FYU G;  4YIP A;  3IFX A;  2BEQ D;  1WA8 B;  1JFF B;  5AW4 B;  3STZ C;  3IAY A;  2Z5H A;  2PGG A;  2EIL C;  3V4Q A;  2CH7 B;  1AQT A;  3T4Z A;  4U3F G;  3E8G A;  3L71 E;  2Q9I A;  4I7Z B;  4IL6 H;  5ITZ B;  2NPS A;  4PD4 D;  2FFD C;  4TSF G;  1RQU A;  2R44 A;  4LBE C;  1JO5 A;  1OW7 A;  1B04 A;  5EBM C;  4X1Y A;  2SPZ A;  4HKZ H;  3CCV V;  4D7S A;  2YIU B;  2DQ3 A;  1IBL B;  3E8F A;  2A79 B;  1DEB A;  1SVF A;  5KMG A;  4TT3 G;  1H2G A;  3B71 A;  4JBZ A;  1KYO F;  3VQY A;  3R2P A;  1ZL8 A;  5HFM A;  2QJ1 A;  1AI5 A;  2QWQ B;  5BR8 O;  4TOI A;  1WB7 A;  2XAF A;  3KCY A;  5EZY A;  1QLN A;  3D36 C;  1N8R W;  1RY3 A;  3FAV B;  3LSS A;  1Q81 W;  2IJI A;  2K9J B;  2M3E A;  3I55 P;  3RBZ A;  1SC5 B;  3CWB H;  1H88 A;  5CA1 B;  4FK5 C;  4MW8 A;  4JYC A;  1N33 B;  1LTJ A;  2FYZ A;  3BA9 A;  4XFJ A;  2ZVO B;  1KYO E;  3M9Q A;  2EIM B;  3CS5 A;  3L72 H;  4EFB A;  5JQG A;  2OYI C;  3WU2 H;  1Q5O A;  3K9A A;  1NKD A;  4K3A A;  1ZWI C;  4DV6 B;  4LF7 B;  1OCC B;  1GM8 A;  4NTW A;  1EC5 A;  2YKP A;  2F4V B;  4WFA V;  3VMA A;  2YMK A;  1VQ5 P;  2ZQM A;  4BWA A;  3MHV A;  3ASN C;  3SDL A;  4ZIB A;  3RVZ A;  5TIS H;  1EN4 A;  5AG2 A;  2DWD C;  2HHH O;  5IY5 C;  1M56 D;  4J7J A;  1FU1 A;  4RQE A;  4HNA A;  1SQP D;  3B8E B;  5LP6 A;  4K0K O;  5CBO A;  3CCL P;  3VMX A;  2N04 A;  2FKX A;  3JD4 A;  1JM0 A;  2E5L O;  2AEM A;  3ZDM A;  1PKX A;  1NAF A;  1KV4 A;  2A45 I;  5KLV K;  1V55 C;  2HOD B;  4I4T A;  4D7T A;  1YYC A;  2ZXW B;  4ICG A;  2N74 A;  4PJ0 Z;  3SYC A;  1XIL A;  2Q9L A;  2IZ1 A;  5GON B;  1K8A W;  1Q6I A;  3JSV C;  1XNQ O;  4DV2 O;  3OA7 A;  1ZX3 A;  2LP7 A;  1K05 A;  1GM9 A;  5H2F H;  1OW8 A;  1FDO A;  3GLM A;  1GKF A;  1YXB A;  2HJD A;  2P7T C;  1UII A;  2WVR A;  4PI2 A;  3FKS G;  2OTL V;  3VQW A;  2ZIN A;  2XAH A;  2YSU B;  3W7X A;  4WY4 D;  2ETN A;  2Q73 A;  1K33 A;  3JAR B;  4JI1 B;  2JP3 A;  3AG4 C;  4ZNC A;  1J95 A;  1J1E B;  4XDL A;  3CWB D;  4PD4 E;  4DR5 B;  1OX3 A;  2BSK A;  2R3C A;  4WWI A;  1CP9 A;  1VP7 A;  1VF5 D;  4O4L A;  4H44 B;  5LXT B;  3RBX A;  1RH5 B;  2Y0P A;  1S2E A;  1VQ7 P;  2BOC C;  2EZO A;  1TAE A;  4B7K A;  1MAB G;  1OCR C;  5JWP A;  4DV3 B;  4DR3 B;  1KIL B;  1LWU B;  4W80 A;  1US6 A;  3H1H J;  4JTC B;  1SA0 A;  5LHG A;  4FLU A;  5CCH A;  3AK2 A;  2PAJ A;  1NQT A;  2QJY B;  3TDK A;  1R6N A;  3LUT B;  3BAT A;  3L75 J;  4DV5 O;  2AXC A;  5IYC O;  4UVA A;  3GMA A;  1KD1 Q;  1SZX A;  1RP3 B;  2YKO A;  2KB1 A;  3OMN B;  1RE4 C;  2JEE A;  3M8A A;  1HNZ B;  3AEA C;  1KOR A;  3ABT A;  3BAS A;  4Y99 B;  2LGQ A;  5BXZ A;  1FYJ A;  3KKY A;  1K92 A;  1NTM H;  2MW2 B;  1GTO A;  1NTK J;  2GHY A;  2QGN A;  2VQF O;  3CME P;  1H0T B;  1HF9 A;  4QGP A;  4I1L A;  2KNC B;  1PNL A;  5KJ7 D;  4P9P A;  1Q82 W;  1SQP E;  4NKG B;  4I9W A;  5CBG A;  3DTU B;  1KFM A;  2ZXW C;  3TYY A;  1S72 V;  1X8Y A;  3SPG A;  4JI5 O;  1YIT P;  2DYS B;  3U10 A;  4KHX A;  4LP8 A;  3D71 A;  1FFX B;  1VQP P;  3TCU A;  5EZY B;  1TVK A;  4P9O A;  4LFA B;  5AW0 B;  4IL6 E;  1N32 O;  3I5C A;  3N2G A;  4MVO A;  4D6T J;  2AEF A;  2DMX A;  2P90 A;  2KP8 A;  5JVD A;  1A02 F;  4LFC O;  1L0N K;  4W7Y A;  1J1E C;  5JQG B;  1AI4 A;  3E1R A;  1OIP A;  4J42 A;  2CK3 H;  4J7K A;  1L0N J;  2JR8 A;  2LGW A;  1NKN A;  3JD1 A;  1PM9 A;  1ZV8 A;  4H44 C;  5AW7 B;  1SRY A;  5FLX N;  3B2E E;  5LL6 Y;  3ABV C;  4ASV A;  3CWB E;  1DF5 A;  3HTK A;  2RNB A;  5L3E A;  1ORQ C;  2N05 A;  3ABM C;  3L72 E;  4IFF A;  1KIL C;  1LWU C;  1JY3 P;  1PV3 A;  4HNA B;  1GL2 B;  3H1K H;  4YXD C;  2LW1 A;  3I55 V;  2HFE D;  3TXS A;  1PP9 J;  3F5W C;  2ZDI A;  5CB4 A;  1NH4 A;  1P84 F;  2QJY C;  4X9Q A;  1NTM D;  1G1I A;  1SQV J;  4O4I B;  2XAJ A;  2B1G A;  1EDI A;  3MTU E;  1RE3 A;  3H1J H;  2IYP A;  1XUQ A;  1M8O B;  3C9I A;  5TIS E;  4Y99 C;  4MVR A;  4I50 B;  3SYQ A;  1JOY A;  1X59 A;  5JJN B;  1BE3 J;  2XND G;  3CP1 A;  2OTK E;  4GYC B;  1BHA A;  1VQ5 V;  2BAS A;  1K9M W;  2NPS C;  1G4Y B;  2ZT9 B;  1T8Z A;  1OVR A;  2BCC D;  3SGI A;  5E79 Z;  2JJ1 G;  2RKL A;  4NPD A;  3CCL V;  3UT5 B;  2QR4 A;  3E2E A;  2DYS C;  1FDI A;  1IJD B;  2Q7G A;  5CBN A;  4BIZ A;  4UVB A;  5KLV G;  1Q7Y W;  5H2F E;  4O4L B;  1JB0 J;  3MUD C;  3CHX A;  4JI3 B;  2PRR A;  4J9Z B;  5CN0 A;  5TJH A;  3Q4H A;  5APU A;  2E75 B;  1ZAU A;  1QR9 A;  1QVF O;  2QKC A;  3C3T A;  3JAL A;  2OYH A;  3MHS C;  1AI6 A;  3V2P A;  1N36 O;  2WTY A;  2H8P C;  5LA6 A;  2FY8 A;  1JTH A;  3D6Z A;  1ROP A;  1NTZ H;  5J9P C;  2KZI A;  3H1K D;  4HYO A;  3A2F A;  4RWU A;  1XBL A;  1DIP A;  1K4C C;  3LDE A;  2JGD A;  5EYP A;  4DR1 O;  2XAG A;  5IJ9 A;  1K4D C;  4PEL A;  2YIB D;  1BSM A;  1GL2 C;  1PGO A;  3H1J D;  3K5B A;  1A32 A;  4NPF X;  1EBO A;  3AG7 A;  3WMM 0;  4DV0 B;  1VQ7 V;  1SQQ K;  1QLE D;  3F5T A;  2HKO A;  4AHC A;  2ZYD A;  3PLN A;  5CA0 B;  4CS2 A;  1YJN P;  1Q3E A;  1SQQ J;  2JEX A;  3L74 G;  2Y9Y A;  1NKZ B;  1NTM E;  1L4A D;  2GV9 A;  3JD3 A;  4GX1 A;  3JCU Z;  5APV A;  1AJY A;  4Z1M G;  2UU9 O;  1F51 A;  3N2G B;  1OFC X;  5J2T A;  3L72 G;  2R70 A;  1TA8 A;  2Q6A A;  3ML0 A;  4X66 O;  1YTF B;  2B9B A;  5CCG C;  2WLJ A;  1MSW D;  5KHH A;  2FYN B;  3MP7 B;  3R66 A;  1S5L Z;  3CME V;  2BCC E;  1FBM A;  4Q20 A;  1I08 A;  3CX5 H;  4F6R A;  3A7O A;  2JRI A;  3APQ A;  3L73 H;  4LLH A;  1YIT V;  3WG7 B;  2WSC J;  1VQK P;  3QO8 A;  4FMT A;  4QE9 A;  1NTZ D;  4X62 O;  4DUY B;  1L0L D;  5AW3 B;  1ARO P;  1EZV H;  5IDJ A;  2E75 C;  1HWY A;  3K58 A;  4W7Z A;  3SPI A;  1VQP V;  4LFB B;  3IC7 A;  4B7E A;  1RM1 B;  1IFJ A;  5APW A;  2IJH A;  3T97 A;  5CCH C;  2E74 D;  4HYT B;  3J81 N;  1G8M A;  4UCR A;  1L0N G;  3O65 A;  5CB4 B;  1OV9 A;  1FJG B;  3BCC J;  1QBZ A;  2WZ7 A;  4X1K A;  3H1L G;  1ZUQ A;  1VQ9 P;  2YC0 A;  4BXL A;  1AR4 A;  3L37 A;  1MZ9 A;  1YHQ P;  3PJS K;  3KHU A;  4DV4 B;  3H1K E;  5AW5 B;  4FJC C;  5EK0 A;  3I5D A;  5KUK A;  2W0X A;  3MZW B;  1LTG C;  5KHJ A;  2K3R A;  1ZRT D;  3JD0 A;  2Q7C A;  2IBZ I;  1BDC A;  4DV1 O;  3AEE C;  1Y4M A;  5JCO C;  1LGH B;  3H1J E;  1LJ2 A;  5AVY B;  2OTJ P;  2LW7 A;  2IW5 A;  3QVN A;  3HKB A;  3LIE A;  1SFC B;  4MVQ A;  4DR6 B;  2ZNI A;  5B5E H;  4JTD B;  1CEZ A;  5B1A B;  1S76 D;  1PZQ A;  3CX5 D;  4L87 A;  4JZG A;  1XMQ O;  5KAF H;  1S0V A;  2FKW B;  1RPO A;  1GRJ A;  4TUY B;  4H0L D;  3FX0 A;  4P2Z A;  3RFR A;  1KB9 H;  2HP8 A;  3EFG A;  3L70 H;  3B5N B;  3L73 D;  4GKG A;  3TGU G;  3Q4H B;  2FYN C;  1P49 A;  1FOS E;  2XUM A;  1EXJ A;  1OW6 A;  1ZN5 A;  2WLH A;  3AG3 B;  4K35 A;  2QM4 A;  2OYH B;  1QVF U;  4JYY A;  4GOE A;  1HVV A;  3CYO A;  2GA1 A;  1VAR A;  1FDM A;  2Q69 A;  3WG7 C;  1T3J A;  1Q8I A;  4WCE V;  3CRC A;  3HR0 A;  2L91 A;  3B4S A;  3BAA A;  2FB5 A;  2JGD B;  3BRV B;  5IJ9 B;  4JGS A;  2JJ2 G;  1PPJ D;  5AVW B;  1EQ7 A;  1RM1 C;  2N1T B;  2XTA A;  2KYV A;  4FFB A;  4NVP A;  1NTZ E;  1Z2G A;  2RN9 A;  2G38 A;  4GX2 A;  2R5B A;  4KHP O;  4QNH B;  4B3R B;  3TNU B;  2E42 A;  3G80 A;  4W4K A;  1LTS C;  1YCI A;  3ZHT A;  4JI7 O;  3UM7 A;  2Q7H A;  1XMO B;  4CS4 A;  3CL3 D;  1VQL P;  1R3I C;  1N0J A;  5DED A;  2FYU J;  2ZXE B;  2RN0 A;  4O2A B;  4CH4 A;  4DUZ O;  2VWK A;  1WT6 A;  1O9H A;  2QKA A;  3V2R A;  3CCQ P;  1TU3 F;  1KKD A;  1VQO P;  3BPZ A;  2WAM A;  5J2T B;  1U97 A;  2YO2 A;  4U3F J;  2CK3 G;  2QJP B;  3II6 A;  3H25 A;  1KD1 W;  2UXD B;  5A9G A;  4KXR A;  1SQQ G;  1ZRT E;  5L3D A;  2QE7 H;  1KB9 D;  3L70 D;  3K57 A;  4DR4 B;  1FZA A;  2AXT H;  5LHI A;  3NMD A;  3CCE V;  4JI0 B;  4IL6 Z;  4FZ0 A;  1WA8 A;  5B1A C;  1JFF A;  2DN9 A;  2RQ6 A;  3FYE B;  1YJN V;  1ENV A;  4UFZ A;  1IZN B;  1SLQ A;  3LDC A;  3RK2 B;  3KG2 A;  2CH7 A;  2DW4 A;  2CAZ C;  3B5N C;  2QIW A;  4XA4 A;  2EUL A;  1YIJ P;  4PV1 C;  2ZD9 A;  3H6P A;  1B6Q A;  2QDO A;  4FLY A;  3CX5 E;  2PFX A;  1M90 Q;  2H88 C;  4JTA B;  4JZ2 A;  2OYH C;  1YZB A;  1XTC C;  2H89 C;  1QL1 A;  2EZP A;  4MTO A;  3L73 E;  1J5E O;  1YQ4 C;  1AP5 A;  2RMK B;  4RQF A;  4UB6 H;  1KYO H;  2J58 A;  1BGY H;  3OTO B;  4L76 A;  3ZED A;  1W2B U;  2PF4 E;  4MVS A;  1KQG B;  3HUS B;  2GUZ B;  2OGU A;  1M1J B;  1UPG A;  3JSL A;  4NB5 A;  4UXN A;  4JI2 B;  2K9J A;  2N1T C;  1BSH A;  1K3E A;  3WU2 Z;  1QU7 A;  3OAK A;  1HNX O;  3PRJ A;  5CA1 A;  4WF9 V;  4J11 A;  4UCS A;  2B9Z A;  1FZG A;  1NVP D;  4OPH A;  1SF9 A;  1R6K A;  5CHX A;  3K5N A;  1PPJ E;  4IFM A;  1JY2 O;  1UJW B;  3SJQ C;  3SPC A;  1IFM A;  5EIB D;  1SZT A;  2IH1 C;  1P7G A;  5IJ0 A;  5TIS Z;  4RUE A;  1DTO A;  3HKB B;  3K5O A;  1M7L A;  4AQY B;  4RAI A;  3K5M A;  1VQ9 V;  1N7S D;  1ZTE A;  3E83 A;  1Y47 A;  2HVJ C;  1RE4 A;  4L8J A;  2W27 A;  2NNU A;  3AE5 C;  2XZR A;  4OVN F;  1DH3 A;  1YHQ V;  4TQD A;  3V4W A;  3CLQ A;  4NXM O;  2ZE7 A;  5BY1 A;  3CC2 P;  1RSO B;  2YMY A;  4WFF A;  2X6C A;  2UXC B;  4JI8 O;  1BQ0 A;  2HLO A;  1F7Y A;  2E76 B;  2VRZ A;  2KKW A;  2JWA A;  3GWK C;  1Y67 A;  2HOD A;  1PFI A;  3ZMV A;  5B5E E;  3FB8 C;  1KQL A;  3W7S A;  1NU1 D;  1S5H C;  1AJN A;  5H2F Z;  2WSE H;  3HKC B;  2JS3 A;  2OYO A;  4PDL A;  2X7R B;  2J59 M;  2OTJ V;  1W2E A;  4R4M A;  5GON A;  5KAF E;  1HR0 O;  2YIA A;  3RK2 C;  4U7J A;  5BU5 A;  4B3S B;  1KB9 E;  3L70 E;  1VQ6 P;  1NJI Q;  4YHH O;  3OFN G;  1V9P A;  5CA3 A;  1SS3 A;  1VL2 A;  2L35 A;  4PDV A;  1PGJ A;  3FYI B;  1BGY D;  1HUC A;  1L1F A;  2R32 A;  3ETD A;  3JAR A;  3L71 J;  2P06 A;  3N2K B;  4YXW G;  2NLJ C;  2X0L A;  1I94 B;  4FLT A;  2K88 A;  3R65 A;  2JVD A;  3CC7 P;  3J7A U;  3HUS C;  4IL6 X;  3H32 B;  3NTN A;  4MVM A;  5LXT A;  1M1J C;  1HTL C;  3IF4 A;  1KKC A;  2WA4 A;  3EQ2 A;  3IN6 A;  3ETG A;  2UUC O;  4LF5 O;  1M1K Q;  3CJH B;  2Y0D A;  1H2S B;  1E1Q G;  2Z3Y A;  3WB2 A;  1LTB C;  3PHL A;  3LW5 J;  5AVX B;  3GVM A;  1KIL A;  1LWU A;  2V4H A;  3SWY A;  3WB0 A;  5D5P A;  1U7J A;  4NTX A;  4JI4 B;  1SQX H;  2R9R B;  3FWL A;  3FD9 A;  1MFT A;  4P30 A;  1N34 B;  2WSS H;  1K73 Q;  1PGP A;  1TUB B;  2VQE O;  3QO5 A;  3E8B A;  2ZE8 A;  1EZV G;  1HNW B;  3TSI A;  4J41 A;  4B08 A;  1H8A A;  4JF3 A;  1VQL V;  1S9K D;  3EHB B;  2K1E A;  2WT7 B;  3VMY A;  1IVS A;  3M0D C;  5KA5 A;  1JNM A;  2E43 A;  3ZHR A;  1N7L A;  2E76 C;  1H0T A;  4O2B B;  2EX3 A;  4MW3 A;  2KNC A;  4IOI H;  1LUV A;  1Q86 W;  2AXT E;  1KN7 A;  3CCQ V;  2VRS A;  5AVU B;  1VQO V;  4H13 B;  4JV5 O;  4YIO A;  2KI7 B;  2ZM6 O;  4TV8 B;  3Q5R A;  3K03 A;  4DV5 B;  4UCU A;  4JI6 B;  4MTF A;  1IFN A;  1XQ8 A;  1FFX A;  5AW8 B;  4W4L A;  4EYY Q;  1NBM G;  2WLN A;  3MUD A;  2L5G B;  5EC2 C;  2DJV A;  4DW0 A;  5IWA O;  3AE6 C;  2A06 D;  1QVG O;  1L2P A;  3AE9 C;  3DGE A;  4XDJ A;  2X6A A;  3BA8 A;  4UB6 E;  2ARH A;  2B87 B;  1BS3 A;  3AE4 C;  1BGY E;  4QPJ A;  1YIJ V;  3STL C;  3CRQ A;  1DEE G;  3LSU A;  4EIJ A;  5IJ0 B;  1IK7 A;  2LXC B;  1SQX D;  2DW3 A;  5JH7 B;  3F5H A;  1JY2 N;  2F93 B;  1NGM B;  1CPY A;  1IBM B;  3RK3 E;  3PTZ A;  4OX9 O;  3F7Y C;  1GL2 A;  3BRT B;  2ZAE B;  3AG1 B;  1T2K C;  1FXH A;  2QM8 A;  3OR7 C;  3UCS C;  1P84 H;  1V54 C;  4DR7 O;  4B3T B;  4U7O A;  5CBH A;  4O4I A;  4KFM A;  1KTM A;  2W90 A;  5DM6 V;  4ZI7 A;  4I50 A;  1B06 A;  4GLX A;  5KLV J;  1N0N A;  4BIU A;  5GTH H;  5J2U B;  1I5Y A;  5FNV B;  2PYJ A;  5KHK A;  4I7Z C;  3D3I A;  5IYB O;  3HRN A;  5L3F A;  1Q90 D;  1S9K E;  4H13 C;  2YIU C;  3S3W A;  1SQP K;  4LH6 A;  3L4F A;  2QWO B;  3UT5 A;  5CCG A;  4EB6 A;  3FFQ A;  2P5O A;  2F43 G;  3CC2 V;  1IFD A;  2YIC A;  2IBZ H;  3ZMU A;  3GB7 C;  3L9D A;  3FGA D;  1SQP J;  1Y66 A;  1K5Q A;  3OR6 C;  3T1H B;  3H1H D;  2YDE A;  1R3J C;  1RF1 A;  3KDP B;  3VYI A;  2WLL B;  1ZW0 A;  2NR5 A;  5LMU B;  1VQ6 V;  2EIM C;  1Q6H A;  3L71 G;  4U3J B;  1K7D A;  3G4S P;  1VQ4 P;  2OYQ A;  1LT1 A;  3KCX A;  2B88 A;  3ZJZ A;  4DR2 B;  1NTK D;  1HP8 A;  1OCC C;  1SQV H;  3ZIA G;  4GZR B;  1IUR A;  3ABK B;  2H7H A;  2O01 N;  4H44 D;  4GKJ O;  2ADP A;  1URQ A;  2YI9 A;  1FC2 C;  1NYH A;  2P7J A;  1P84 D;  1XI1 A;  3L74 J;  3QO7 A;  3CC7 V;  1BE3 H;  2Y4U A;  3D70 A;  1SQX E;  3SWK A;  1KIL D;  1JX9 A;  3AG1 C;  5C8Y B;  3AE7 C;  3CWB J;  4CH6 A;  3MHH C;  2X6B A;  2AEJ A;  4MVZ A;  3RWR D;  1N86 A;  2LR2 A;  5AVS B;  1URF A;  2LQT A;  4LC1 A;  3L72 J;  2NZ2 A;  4R50 A;  5CA0 A;  1QL2 A;  1N36 B;  2BOB C;  2QTS A;  1W59 A;  5JCO A;  3QWO C;  1IBL O;  4J80 A;  2GUV A;  3FB7 C;  2UUB B;  3PH0 A;  3AEF C;  1YJ9 P;  3B09 A;  4JAA A;  1WN7 A;  2EIK B;  3CSX A;  2XV5 A;  2BCC H;  1PNM A;  4K8X A;  3HD7 B;  4FLW A;  4HZ3 A;  4BW9 A;  2IBZ D;  5EBW C;  4CH5 A;  5AVQ B;  3K08 A;  2NPS D;  1MFZ A;  3ZRS A;  4IFD K;  4X1I B;  5IE9 A;  1N33 O;  1QVG U;  1QHT A;  4LR3 A;  3AK3 A;  3K79 A;  3QTC A;  2M0B A;  1R5S A;  1SQB H;  3AG2 B;  4DV6 O;  1D2D A;  4LF7 O;  4UV8 A;  5BMV A;  1MNG A;  1MZF A;  1UIX A;  3H1L J;  4FIP C;  3IAO A;  4LGD E;  2C9L Y;  2WLM A;  2F4V O;  1Y74 A;  4DJG A;  1J1D B;  4I9Q A;  1BCC H;  2UXB B;  1SQV D;  2KB7 P;  5IYZ A;  2ZCE A;  1M90 W;  5EBL C;  3E89 A;  5H6Q A;  5GW7 A;  1SES A;  3CEI A;  3GG2 A;  2WPR A;  1T3U A;  3P8M C;  5CJ4 A;  5C93 A;  4LF8 B;  2CTQ A;  1BE3 D;  4C7R A;  4A5U B;  2QSA A;  3ABK C;  2H8P D;  4FZ1 A;  5LOV B;  1S77 D;  3B77 A;  3BY6 A;  2FML A;  1F4N A;  3CXH F;  4B86 A;  2JDI H;  5L3B A;  1FZE A;  3CRR A;  4GT1 A;  4DT0 A;  4ZI7 B;  2IFM A;  3THO A;  1NTK E;  1EM1 A;  1D5N A;  3USS A;  4QIW F;  1LR1 A;  4UCT A;  1EXI A;  1VQN P;  5B66 H;  1GL2 D;  5CJ0 A;  2Y69 B;  4EOT A;  1P84 E;  1JMM A;  3M9H A;  2P2U A;  2M8R A;  3TGU J;  3VP9 A;  3OMI B;  1KIL E;  5B5E Z;  4JI1 O;  4EB6 B;  4YJ2 A;  4B3M B;  1GK4 A;  1Z5V A;  1FZC A;  1JUN A;  1SFC A;  2EIK C;  5KAF Z;  4DR5 O;  4K8Z A;  5GTH E;  3DXR B;  4N23 A;  4PA9 A;  3HD7 C;  2MKV A;  3ZHQ A;  1TUE B;  1NTM K;  4N78 D;  2RH0 A;  4BAY A;  5LYJ B;  4JPR A;  1JCD A;  1SQB D;  1RF1 B;  3HKE B;  4TUY A;  4EDF A;  1SQX G;  3CB2 A;  5APY A;  3QNE A;  3B5N A;  2ZXX A;  1LT9 A;  2YXQ B;  3OEE G;  4DV3 O;  4FLZ A;  2IBZ E;  5CCG D;  3G6B A;  4DR3 O;  1BCC D;  2UUA B;  4WBA A;  4YY3 B;  5APQ A;  1KP3 A;  1Y9B A;  3CMA P;  2QA4 P;  1GM7 A;  2GTA A;  1ZLL A;  3C8V A;  1SQP G;  1DGS A;  1L8D A;  3TJT A;  4LF4 B;  3A5T A;  1NJI W;  2MK3 A;  1L0L H;  4BRY B;  1XEQ A;  1J1D C;  2F66 C;  4BIO A;  1URQ B;  3UQ8 A;  4RJT A;  2YID A;  2E5T A;  1HNZ O;  1E5W A;  1E79 H;  2LKM A;  4KT0 J;  1ZP0 C;  3U1C A;  2VS0 A;  2E75 D;  2W0F C;  2CGO A;  3RT3 C;  2N1T A;  2LO1 A;  1FD9 A;  4FM0 A;  2IM9 A;  3H1I H;  3IJ4 A;  4ASU G;  1SQV E;  4WBN B;  2QRX A;  3D6Y A;  3V2N A;  3TNU A;  5CCH D;  1JOC A;  1K04 A;  3SPJ A;  3G4S V;  2Q68 A;  3OMA B;  1VQ4 V;  5CMU A;  3E7K A;  1BE3 E;  3IC9 A;  1M1K W;  4CC5 A;  1KQF B;  4I55 B;  4OH8 B;  4YJ3 A;  3HE4 A;  5B1N A;  5L8R J;  4QPK A;  2FXO A;  2PI4 A;  4O2A A;  4LFA O;  1IK9 A;  3CWB G;  3A3Y B;  2I1J A;  4AQR D;  2ZT9 C;  1HGV A;  3H1K J;  2WWW A;  2YS8 A;  1XNR B;  3ITK A;  4NXN B;  1K73 W;  2EJ7 A;  3MD0 A;  2KSD A;  2AGA A;  1W0K G;  1EN6 A;  2C9N Y;  3SFE C;  2WPV B;  3H1J J;  4UUJ C;  1DF4 A;  1RPR A;  3ASO B;  3EWK A;  2V1D A;  4YTP C;  5BMV B;  2C2A A;  2GDS A;  1Q2N A;  5AW9 B;  4UCV A;  1RF1 C;  4CPG A;  2D2C B;  4WFB V;  4ZKP A;  1Y74 B;  3M99 B;  1MOF A;  5JJE B;  5IYZ B;  1YTF D;  4N78 E;  3RGB A;  2IPP A;  2KOG A;  4UB6 Z;  2K37 A;  3CXH I;  1SQB E;  1X9V A;  3BFR A;  5E1A C;  3JAM N;  5KLI B;  3FXD A;  2WSF J;  4TQF A;  2E74 B;  2Q4P A;  4IGG A;  3ZRW B;  4G27 B;  1Y76 B;  5KUM A;  3H1I D;  4X65 B;  1BCC E;  1URQ C;  2QWR B;  2CUG A;  2M6Y A;  1PPJ H;  1GN2 A;  4ZOL B;  2JK5 C;  3HUS A;  1GU5 A;  1OJH A;  2GUZ A;  1FAF A;  1PD3 A;  1M1J A;  3QH9 A;  1M4U A;  2IU3 A;  2P6J A;  3RVY A;  4LF9 B;  2GBO A;  4PA6 A;  1MSD A;  1SQG A;  3NXS A;  1NOH A;  1H2K A;  1J2J B;  1BMF G;  1NTZ K;  2N9B A;  2PZS A;  2Q0A A;  4I2L C;  2CPS A;  1NZ6 A;  3A0H H;  3CPW O;  1MG1 A;  4G2K A;  3E22 A;  3M0A A;  1OZ0 A;  4OPA A;  3W7W A;  4DRX B;  1NTZ J;  4R6Z A;  3SYP A;  4YJ2 B;  3C1L A;  1FZC B;  3N4X A;  3UO2 A;  1FZB A;  5B66 E;  2ZYG A;  1YJW P;  5KX5 B;  4JI3 O;  1KP2 A;  1K8A Q;  3OE7 G;  1OZH A;  3M0D A;  3KPE A;  1RSO A;  2BTQ A;  3NFQ A;  1LT9 B;  3E1I A;  2QSI A;  1B3Q A;  2M5A B;  4LF6 B;  4LNU B;  1U7M A;  3ASO C;  3T1Y O;  1XTG B;  1IDS A;  3HKC A;  2O01 H;  2WPS A;  2P4V A;  1NAY A;  2D2C C;  2PY5 A;  2QWN B;  2A45 H;  2LXB A;  3K9S A;  3RL0 B;  4L73 A;  1NTM G;  3B5N D;  3T4D A;  1N4C A;  1U96 A;  3E8H A;  4FLX A;  5KLI C;  1AA0 A;  4PV1 D;  4DV0 O;  2FYU D;  1L0L E;  4I5S A;  1EZJ A;  2HG5 C;  1DD3 A;  3N2K A;  3N7N A;  2HR3 A;  2QM7 A;  2ZE5 A;  4HAM A;  2G8Y A;  3JAT B;  2QA4 V;  2BCC G;  3CMA V;  3H32 A;  1M57 B;  3K0G A;  3L73 J;  1LTI C;  4NTY A;  4MSW C;  5DJU B;  4YJ3 B;  3HE4 B;  4JYA B;  5BVZ A;  2N1T D;  3H1I E;  3IFM A;  3CJH A;  1U57 A;  3SJB C;  4FPP A;  1KQS O;  1PL0 A;  2HPC A;  1ZR4 A;  3ZHV A;  1VQ8 P;  4DV7 B;  2W6B A;  3S4R A;  1FZC C;  1WPB A;  1SFC C;  1IBK B;  5IT9 N;  1TUB A;  4F6E A;  4C46 A;  5B3S B;  2A7W A;  5BZB A;  5LMN B;  1H2M A;  2V7Q H;  3AEG C;  2WT7 A;  4DUY O;  3H1K G;  1K5S A;  2KSE A;  2Q6Q A;  4LFB O;  3CRA A;  3HPL C;  1WAZ A;  3ZMS A;  1D7M A;  1LT9 C;  2H43 A;  4O2B A;  1NU1 H;  1LNQ A;  1YSC A;  3W67 A;  1KZU B;  1FXV A;  3ETE A;  3AG3 C;  3ZRV A;  2D3O W;  3JCU H;  1ZME C;  2AHZ A;  3JSN A;  1G6U A;  3T1C A;  3H1J G;  2QG4 A;  4TV8 A;  4XBF A;  1FJG O;  5APS A;  1VEW A;  4ZKI A;  4O4H B;  4N3Y B;  3RL0 C;  2DWE C;  3RK2 D;  3ZHU A;  1EDJ A;  5CBF A;  4DV4 O;  2RJZ A;  4DZO A;  1RFY A;  1USD A;  3AE1 C;  4JYB A;  1RF0 C;  1BDD A;  4M3L A;  1VQK V;  1AP6 A;  1QEX A;  2B87 A;  2KS1 B;  1NVP B;  2I8D A;  4EFE A;  3B40 A;  4H37 A;  3E22 B;  3CPW U;  1H8E G;  1M57 C;  4ZMD A;  1Z56 A;  4RO0 A;  2FYU E;  5JH7 A;  5BR8 B;  1YBK A;  3A0B H;  2ZE6 A;  4IIJ B;  1FFT B;  4DR6 O;  1N7S B;  1GDT A;  3O6Q B;  5FPR A;  3A0H E;  1WP7 A;  4JAS A;  2JGU A;  3ZMT A;  5IWA B;  1MV8 A;  2ODM A;  4FVM A;  4LCU C;  4BWN A;  3RGU A;  3U11 A;  2QJP C;  2BTQ B;  1AJP A;  1NTZ G;  1L0L G;  2YNY A;  5B3S C;  5GTH Z;  2Y0E A;  2WQY C;  3NR7 A;  1QCE A;  1NR1 A;  3OM3 B;  5GTI H;  1WRG A;  1AV1 A;  4GKK O;  3E35 A;  4UVC A;  3EFF K;  1JJ2 U;  1IFP A;  3Q1M A;  2QWP B;  3ZS8 C;  4I0X A;  1EN5 A;  1NH2 B;  3ZMZ A;  3G6E P;  5J2U A;  1Q7Y Q;  5FNV A;  1JMB A;  2HHH B;  4OX9 B;  3H1I G;  3VOU A;  4K0K B;  1FKA O;  4X64 O;  2EIL B;  4OGQ B;  3HKD B;  5JJJ B;  5H5N A;  1YJW V;  2E76 D;  2BE3 A;  2E5L B;  3N27 A;  5CMZ A;  1SET A;  4WFG A;  5E79 E;  2H94 A;  1AVM A;  2IFN A;  4B3R O;  3CCS P;  1R73 A;  1OCO B;  2KK7 A;  1VPC A;  4E2L A;  3AK1 A;  2N9Y B;  2R9A A;  3C3S A;  5LGU A;  1XMO O;  3RK3 B;  3VMZ A;  4TV9 A;  2ITD C;  1PL4 A;  1WB8 A;  3JCZ A;  4R7C A;  5DJT B;  1XNQ B;  4DV2 B;  5KAI H;  2A06 H;  2K9P A;  2NRG A;  2WLL A;  4UCO A;  2XND H;  4DK1 A;  2HPC B;  1KQS U;  3IGA C;  3JC2 2;  3Q3D A;  1EDL A;  4U3J A;  4UB8 H;  1R5L A;  1NVO A;  3LSQ A;  3C90 A;  2OAR A;  3BEH A;  2P4K A;  3RYH B;  2AZ0 A;  2H3O A;  1AIL A;  3L73 G;  4DR4 O;  2BEZ F;  4X20 B;  1BGY J;  3E86 A;  2XAQ A;  1FE6 A;  3SYO A;  3G9R A;  4MVU A;  4JI0 O;  5KLV H;  2VWJ A;  4ZHQ B;  2IZ0 A;  3ICX A;  5KHG A;  5C8Y A;  1NT2 B;  3QG5 A;  3OUF A;  4XE5 B;  1ZXG A;  1T2K D;  3G3Z A;  5KA6 A;  4EKW A;  2ZKO A;  5KJ7 A;  1FJP A;  1IX9 A;  1NR7 A;  1VQ8 V;  2AZ2 A;  1PPJ G;  2ZIM A;  3VOP A;  2CTR A;  1EZV I;  2ZYA A;  3AED C;  2A9H A;  4NR1 A;  1AB3 A;  3OTO O;  3HD7 A;  3GF3 A;  1NU1 E;  3A2A A;  4JI2 O;  2XKM A;  4OGQ C;  3JAK A;  1MZE A;  3JCU E;  2VQF B;  4X1I A;  5EC1 C;  3VQV A;  2ZJS E;  1E1R G;  3P8C D;  4H13 D;  2OWO A;  4MTG A;  1OCO C;  2WLK A;  3H1H H;  5F2V O;  2OIG A;  3TXQ A;  4Z2W A;  3CXC U;  3JAS B;  4JI5 B;  3KZI H;  3RK3 C;  3AG4 B;  1YDX A;  1S5L E;  2WSE J;  3MIW A;  5EFW B;  2KUB A;  4GOF A;  1BL8 A;  3L75 H;  2M7W A;  3RYI A;  3L74 H;  4AQY O;  1K34 A; 
#chains in the Genus database with same CATH homology
 2ZT9 B;  2BEQ D;  2E74 D;  2O01 J;  3Q1M A;  1DD4 A;  2G8Y A;  3IN6 A;  4I7Z C;  3AE3 C;  3SFE C;  2WPV B;  3R4Y A;  1FDI A;  1S1C X;  1Q90 D;  4Z1M H;  1ZOY C;  3LW5 J;  4H13 C;  2YIU C;  4I7Z B;  3EWK A;  4YTP C;  5M1B A;  1HJ0 A;  4OGQ B;  1U57 A;  1RQU A;  2E76 D;  2QIW A;  1OW7 A;  2D2C B;  3Q2Y A;  1VF5 C;  3FGA D;  1JB0 J;  4PV1 C;  3GMA A;  2H88 C;  3B71 A;  3AEA C;  3AE8 C;  1KOR A;  1EXI A;  2P10 A;  4PV1 B;  2H89 C;  3AEE C;  1RQV A;  1YQ4 C;  2E74 C;  2E75 B;  2QJK C;  4RKU J;  1PIX A;  5KKZ C;  2WSF J;  1YQ3 C;  2E74 B;  1KIL E;  1KQG B;  1HF9 A;  2G3A A;  3D6Z A;  2E76 C;  3AEG C;  4XFJ A;  3Q3D A;  1DIP A;  1MKM A;  2MKV A;  3Q5S A;  4H13 B;  4H44 D;  4H0L D;  3D71 A;  1NYH A;  3Q5R A;  1OMI A;  2FYN C;  4Y28 J;  2JO1 A;  1EXJ A;  1OW6 A;  1S5L X;  1ZME C;  2BEZ F;  1VF5 B;  2YMK A;  3D70 A;  2IDB A;  3G9R A;  3AE7 C;  1WMK A;  3S9O A;  1Y9B A;  2V7Q J;  1PL5 A;  3C8V A;  4OGQ D;  2NZ2 A;  3AE5 C;  3AE6 C;  2D2C D;  3AE9 C;  3AE1 C;  4GDO A;  3Q5P A;  4H44 C;  3AE4 C;  4H0L C;  3AEF C;  1R8E A;  2E76 B;  2K9Y A;  3ABV C;  1AJY A;  4KT0 J;  1ZP0 C;  2E75 D;  1IK7 A;  1KMI Z;  3AEC C;  3RL0 g;  3AED C;  2ZT9 D;  3GF7 A;  2QSI A;  1NGM B;  3AE2 C;  1K05 A;  3RK3 E;  1PV3 A;  4R4M A;  3GF3 A;  2FXP A;  4YXD C;  3D6Y A;  1OW8 A;  1FDO A;  3GLM A;  1K04 A;  4OGQ C;  4R4L A;  4U7J A;  2QJY C;  2D2C C;  1VL2 A;  4TT3 H;  1KQF B;  4H13 D;  2JP3 A;  5L8R J;  2J5U A;  2WSC J;  1TU3 F;  3IAO A;  3O6Q A;  1UIX A;  2QJP C;  2E75 C;  2FBW C;  1KTM A;  1VF5 D;  2OQQ A;  2WSE J;  4PV1 D;  5KLI C;  3T97 B;  2ZT9 C;  3AEB C;  4H44 B;  3H25 A;  4H0L B;  1GMJ A;  2WQY C;  3SFD C;  1DD3 A;  1ZRT E;  4IL6 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...