5AVSB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 3.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avsB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avsB02
1GK6A 2YO2A 1SP4A 4I2LC 2P7JA 3UIAA 1HJBA 4C46A 3V4QA 1JUNA 3VMYA 1NAFA 3VMZA 3OAKA 3A3YB 1MV8A 3B8EB 3LIDA 1SLQA 5AVWB 1HBWA 1MFZA 2XV5A 1MUUA 4I6MC 3TNUB 2WT7A 1NWQA 2Q3IA 1KQLA 5APXA 3VMXA 3P32A 1OWAA 1H88A 3L37A 5AVXB 5AVQB 5AW6B 4AYCA 4DZOA 2JJLA 1CZQA 2WT7B 2XU6A 2YO3A 1FOSF 3VYIA 2YNYA 3O8ZA 3M0AA 3L36A 5APWA 4GKGA 2QM8A 4HYTB 2WPRA 4EOTA 1S9KD 3M91A 1T2KD 3L35A 2C9NY 2WPSA 1X8YA 5AVYB 4JYBA 3HE4A 2R32A 5AVSB 2BASA 3T97A 5AW7B 5AVTB 1YYCA 3HE4B 5AW2B 4M3LA 4XE5B 3P8MC 3A5TA 2C9LY 5AW1B 2Z5IA 4LC1A 1A02F 1GU5A 3KDPB 3WGVB 1GZLA 2ZXEB 1HUCA 3TK1A 3LIEA 2N9BA 2WWWA 2Q7CA 4C7NB 4RETB 3V4WA 5AW5B 5APUA 1GK4A 2Z5HA 3MD0A 3NFQA 2E43A 3WGUB 2QM7A 2R3CA 3HE5A 3I5CA 5APSA 2KP8A 2P2UA 3KQGA 3TNUA 5AW9B 3SWFA 2H7HA 3IR9A 2WPQA 3VTPC 3HE5B 3TYYA 3V5BA 5AVRB 5APTA 2P67A 5APYA 1IO4A 2WTYA 2E42A 4KHXA 2R5DA 5AW3B 1CI6B 3M9HA 1A02J 3P7KA 5CMZA 5AVUB 4B86A 2VRSA 2IPPA 1GD2E 1CSBA 5AVZB 1T2KC 2W27A 1H8AA 4AUWA 3NMDA 3A2AA 1JNMA 3NXSA 3A7OA 1G2CB 5APVA 1H89A 5AVVB 2Q5UA 2ZFCA 1S9KE 1GTWA 3MGNA 1OXZA 3M9BA 5APQA 1FOSE 1HWTC 2W6AA 3HTKA 1FAVA 3M06A 2R5BA 3VN0A 1DH3A 5AW0B 2XZRA 3M0DA 1GU4A 4C7NA 5AW8B 1J2JB 4RESB 5AW4B 3NTNA 4GT1A 1CI6A 4JYCA 4AQRD
chains in the Genus database with same CATH superfamily
2Y2YA 2YD8A 1LE9A 4GW4A 4Z3IA 4I9XA 1MW1A 2ADIA 4YFEA 1IBBA 1K5NB 2A83A 1RULH 1YITP 4PJBB 3HEIB 2V2XA 3I6KB 3FCUB 3MUZ1 4NKIH 2LXBA 2IJ0C 4WK4B 5CMAA 3R8BB 3WXWH 1IC4H 3B37A 1ZWIB 4X80L 1DN0B 3IDJB 5MEPA 1RULL 1PIXA 4O2EB 5FYJD 2I7OA 2GBVA 1OZTG 3OC8A 3STZA 3DSFH 4UQDA 2OX5B 3CXDH 1BMGA 3QI9B 3EKCA 3LPWA 4GAFB 4PGDA 3ERXA 6PCYA 1TQSA 3A67L 4FQXD 1YJ9P 3L7EA 3Q1EA 1YI2P 2OXHB 1B0RB 3VFRA 3WFHA 4XP9L 3RP1A 1CLZL 2NY2B 1BF8A 1AGFA 1AQ5A 3QHFH 4Q56A 5AW7B 3V0GA 1WG3A 3FFOA 2LQRA 2VW6A 3WNJA 1VCAA 1VERA 5E4EC 2MCMA 2FVNA 2VZOA 4QKXB 5D9SB 4HG4K 4L4VD 2VXQA 3IPBA 2GFBA 3ZR5A 3V6BR 4AXWB 3ZGIA 2EVJA 3E1F1 1VKXA 4NO3B 4PQXA 4DP6X 2C1PA 3KZIH 2M83A 3FT3A 3GJFB 4I18C 3V9FA 1G0DA 4LNRB 2FUQA 4HF5L 1UOVA 1KELL 4HIEB 4KROD 1EWHA 5FB8B 2FGZA 4HS3A 4FLRA 4D0DB 1OD9A 1L0YA 4Y5XC 1LTAC 2KSEA 4ELMF 2R0ZH 1G43A 1U92B 3KYMA 1ZANL 4HKJA 4NZUH 1T1YA 1V27A 4OWFA 3RWCA 3VI4B 1YEDA 3V4VA 2ZKWA 1MKMA 3L70D 3BT2L 4AVIA 4WI5A 2XZQH 1G87A 3QVAA 5L88H 5I71C 2HODA 3PH0A 4W9JC 4E2OA 1QNZL 4J3OH 3OJVC 2FSEB 4R5VA 3O9WB 3VSQA 2DW5A 1TSRA 2F5BH 3QPXL 4BFGA 1CICC 1E4WL 1QW8A 1T3FA 2XG4A 3NK4A 3DRTB 1YTZT 1JN6A 3MOQA 4LLUB 1LVEA 2QVTA 2JVUA 4DW2H 4KH9A 3QWOB 4ZFZB 4PJAA 1EC5A 2F7PA 3KPRD 4OFIA 2J44A 3ULUF 5HJ3B 1ZIBA 4R8WL 1MIML 1FBIL 4KKPA 5DVOA 1L5GA 5A16A 4OI7A 3SFEC 3DARA 3ZN6A 1AKJA 3QDGA 3WNPA 2LKMA 1XL6A 4JFZH 4UB0H 3GSXB 4N87A 1NCDL 4GRLB 4LSPL 1D6EA 1EXUB 4J1UA 3AVEA 3D39E 3CN2A 1PJ9A 2CRYA 1KBPA 1HZLA 1IJNA 1LO4H 2ALAA 2YUVA 4OZGB 3V55A 1KQSO 1JWSB 4FXKA 4PJGE 1SQVE 4MJHA 2XSKA 4PVLA 1Q72H 1YHQP 3Q6GH 5IUSA 5AW4B 1HOCA 4AT6A 4GH7B 2A73A 3U9UB 4U2ZA 3UAAA 1VCBC 3ATEA 3I3BA 2V7HB 3EO9H 2WXOA 32C2A 5IHUH 1KY6A 1ZT7B 2Q7NA 2ZCHH 3DECA 4MJ2A 5KW9L 3UDWA 5EA0L 2AJXL 2X0VA 2ZSVA 2DQIL 4B6ZA 5DFTA 3O41B 3IFLL 5GRJH 1L3WA 2J20A 3LPOA 3WFDH 2EDOA 3VI4A 3O8XA 5BOJA 5I17A 5MEOA 5DRZA 1F0LA 3B4SA 4GXVL 3O2WH 5H8DA 1MLBA 1W9XA 2Q8AH 5DA0B 2VAJA 4L1HA 4PHZA 4S10A 2WM0A 2F08A 4HETA 2QADC 3F12B 4DGVL 1JPFB 3N06B 4H44D 3HZKA 1M90Q 5DEFA 2V4HA 5LBSH 3TX4A 4ZUVA 3VMAA 2UWEF 4LARL 3IMRA 3KJ6H 3QNFA 2IBZE 1II4E 2EIKB 5DJDA 4PWFA 1E3XA 4ODBD 1H0TA 1NPUA 4F2MB 2H0PA 3CFNA 4HD5A 3DOIA 2RGSA 4GSRA 4JANB 4WJ5A 3TBVA 4PMFA 3V5KA 1ZD6A 5DJ0A 1K6QH 1L9SA 3B9KB 3N1QC 3T2PA 1DVXA 3FSAA 4FQ1H 5APUA 4HBQA 3DO7B 4HFUL 5C0NC 3DBXB 3V52L 4KV5E 4PV1B 4Y16D 1UCTA 2P8MB 5DRXA 5EPMA 4GW5B 5EEXA 4WZ9A 4AKPA 3B2VH 3H32B 1MFEL 3GJEA 3JCUH 1KGCD 2MIZA 1S7XB 1NSNL 1QWHA 4K2UL 5F97E 3WJMB 4IKIA 1XB6A 2O61A 1Z9NA 3MUGB 3LCYA 1VQ5P 3ZZQA 1JGUL 3Q2LA 1U30A 3NRFA 3ZO9A 5T5FL 4G8GE 1VQLP 2C34A 4N1EA 3QIWA 2NMSA 2IFFH 2EYSA 5HVHC 3FTWA 1ZLSL 4FGMA 2IBGA 4IRZL 1O6SA 2FEDD 1WWBX 4FLSA 1YMMA 3D48R 2ZXWB 4XMLH 1ZV2A 3OKKB 2R2CA 1G1JA 1AGDA 3T3MF 1VF5D 2IWEA 3VX1A 5E1AA 3PFUA 3VQ2C 4NS0A 4YHZL 2FBOJ 2VW4A 4HAFA 1OE3A 4QT5B 1NMAL 3EGXB 1P4IH 5H94B 4POYA 1B0GA 1OGSA 1PF3A 4Y4KA 2UZYB 4QJ3B 4AEHL 1MWAH 2VERA 1SLVA 3CVBA 1QWUA 3TT1L 3HE7D 3WKYA 2ZT9C 1JS4A 4MMYB 3MV9B 3OZLA 5TFSH 5EDSA 2ENPA 3UP6A 1U93A 4AW4A 2FD6L 3GXPA 2ADGA 3RFZC 3GHEH 5C0BB 2B4CC 1DLFL 1INDL 2YLHA 3EIFA 3MZGB 2WN2A 1WITA 4PWKA 5FGCE 5J12C 1GZHC 3L95A 1AC6A 1DEEB 1K4CA 2X2JA 5D6DA 4Z7WA 4HALA 4XOCA 5CCHA 1QRNA 3UDWC 2IBZY 2JELL 2EC8A 4C46A 1P1ZB 1I75A 1J5OL 3U9PH 1B4JL 3A3YB 1AIFB 1SXCA 3FXIC 4ONHA 4KJPC 4PRBA 3S36X 4TUKH 4EQ3A 2UY6B 1S7XA 3E2HC 4JY5L 3B9EA 4U1IB 1CU4H 4OCLC 1FNAA 5J6GA 5H37A 5IB2A 2A9DA 2K8QA 2J2ZB 2KLVA 2KLSA 4TNGA 3N50A 1OAUH 3HG1D 3TH4T 1NTKK 1SQPK 3TCXA 3TNNA 2KK7A 3IDGB 3FO1A 3QDAA 1KXHA 5DJ8A 3NJJA 3WEXA 5KAQF 4Q6IC 3MLVH 3A4EA 2XX1A 1A6TA 5CD5C 5JOPD 4PLJD 2XJKA 3DSNB 2FCBA 4LCWA 3KYQA 1HTYA 4CA4A 1P7HL 1EZVE 5CGBA 2IG2L 1RURH 2VXSH 2WLZA 3QDHA 5EB9A 3LD8B 1VGKB 2G4EA 2GYSA 2VXVL 3IFNH 2FX8H 1X9UA 5KSBF 2D3JA 3V2RA 2VLKB 4PD4E 1YEKL 3HZVB 4S0HA 1F1AA 3MMEA 3ZL4L 1UJ3A 4NNYA 1UA6H 4O2FB 4HWBA 3NGBB 3UG3A 3AE4C 1AMYA 3HD7A 1TJHL 4KX7A 4XZUA 3S4SG 2X4UB 2PCFA 3S5LG 4Q97A 4L8CA 1D2OA 5IP4A 2QM7A 4K7PH 3D0AA 4LBEB 1QO3B 1PP9D 3BRFA 4GMTH 4GQQA 1OZHA 4PP2A 1JXFA 1ZHNA 4HUUA 5B3JE 3BXNB 1M9SA 5CBEA 3MNWA 2FWOB 1AO7B 1NGXB 5E00B 5KBPA 3CN3A 4JHWH 5KBLA 4P23D 1LT9B 1NAYA 1IV8A 5DJ2A 3M45A 1BFTA 3E1IA 1XD0A 1YVLA 2PXYC 5FCSH 4ODVL 4RMTA 2EVHA 1JTHB 3RY6C 2YEQA 4B27A 1CICB 4K0OA 3EH3B 3HUSA 2PYED 3L3JB 4BXLA 3WJJC 4IBYA 3X3FL 1QBAA 2GCYA 2PO6D 3IDNB 5A3IC 3QO1A 4OZIA 4XCYB 5ID0A 1PGPA 4TUKL 3DO7A 3AROA 4P57A 4KKAC 5DWUH 2ICCA 3A22A 5KYYA 3GXNA 3BN9C 1BJMA 2F7IA 4ZW8A 3H2PA 3U1SL 1MXDA 2LLGA 3RGBA 1UZ6F 1CMOA 1MZYA 3D12B 3B3IA 3UBXA 1JAEA 1MKFA 5I1DB 2P8PA 3UAJC 3V5DB 4NN5C 2HPCA 1Q7YQ 4FQXC 3FQ2A 4YH6A 1QZNA 3E2HB 2BM3A 1CYXA 2C9PA 5F88A 5FO8B 1KZUB 3NCXA 1ZY9A 3HUJA 1GGCL 1GMJA 2XYBA 2XA3A 2RFXB 4JHZA 1WTLA 3LZFH 4WF7A 4HUMB 1Z9MA 1T7ZA 4ISVA 1KXVA 2D7OA 2FL5B 3FWNA 1FBMA 1DP0A 3UZQB 4I2LC 4PJEA 1X5IA 2XDHA 1Z5YD 3QZWB 3FX0A 3ARYA 3ECVA 4GLRH 2BVQA 5I8EB 1U8JA 5EF3A 4N3TA 3ET9F 2OGUA 2FHCA 2VSCA 1CZ8H 1ED3B 1QLEB 4QUOA 4X6DF 1RZPA 3Q9QA 2VYRE 3LS4H 3T3PE 5C7XH 3D3VA 1YNLL 1CDYA 4GIPD 3IDYB 5AVXB 4MXWL 7PCYA 1IL1A 4HJSA 2GABA 4PRHD 3TGUG 4EVNA 3VYOA 3RY4A 3T3PF 1LLAA 3UYPB 3T0EA 1X5ZA 3IETA 3L3OA 5EBMA 4BH7A 1ADQA 5CCHC 1R34A 3OXSB 4ZAKA 3VQLA 4AI7A 4WV1A 3PP3H 5ID0B 1U58B 3FO0L 4JL2A 3H1JG 2BOBB 3SDXB 4F57L 4FXGC 2HYMA 2ZUVA 1RFDH 2Y5TA 3K46A 4I9WD 2K9YA 3GXUB 4F8PA 3IMVA 2GKIA 4FCAA 2P8PB 1J48A 3NZ8A 4NRXB 3NJKA 2V2TB 3EGSB 3O0RL 3L2LA 2J5WA 1U57A 4OJCA 1XO8A 3DUUA 2GSMB 2E9GA 4IOSD 3CL3D 1DVFB 1QI3A 2YA0A 3O6FA 3VRLF 1C5DB 3N0AA 4UAOB 2HN7B 2W0KA 3TO4B 2OXGA 4N25A 1Q0XL 3ATAA 4BRJA 4KKLD 3HI6H 1P5UA 3LKOA 4AW7A 4M3HA 4MXWH 2BY2A 1I1AA 4MDRA 4PGDB 3KPSA 1N8ZA 3VI4F 1LP1A 5CUSH 3IMUA 1BE3J 1G1OA 3ZDMA 4QR7A 1J10A 4Q58C 2HKAA 3HUSC 3L74J 5APTA 1AQDA 2EYSB 4Y2OA 2ED9A 2EEBA 1XCWA 4WFGD 3OW2O 1QSFB 2QV2A 5CJBA 3TF4A 4P4RA 4GKZB 2W92A 1U41A 3KGRA 4GRWH 2Q2EB 4XO8A 2W6BA 5JA8B 1MCKA 4U3FJ 3WTUA 2B8OT 1CL7L 3BAIA 3SBWA 3CDZA 2C1PB 3GJFA 3S3DB 3PWPD 3U30C 4RO0A 1PP9E 2AEQH 3PQYB 1BQSA 3MRHB 4L75A 1XGTA 3UERA 4UDTA 1L0LJ 5DQJA 1WA1X 2TRHA 5FR3A 2C3VA 1Z5LA 2DWEB 1HDMB 4YWGH 3T0DA 1I8KA 4N2DA 2VGLM 3OWRA 2Z7UA 3QQ3B 4JFXB 3CDGB 1J9TA 2GJ6E 1MRCH 4ZMWA 2I8DA 1GHFH 2P5EB 4OZGF 1IVLA 1J87A 2ENJA 4HDIA 4YPJA 3O4LE 1JTHA 2QTEA 3FCGA 2CDEB 4NWUL 4OF6A 4IBSA 4EUPG 4CSPA 3T0ED 2IXQA 3KLDA 4MMZB 4F33B 3DC0A 4ZRGA 5IIEA 3PF2A 5ENWB 1BE3E 3ARED 1YEEH 3KBHE 1MFAL 1R3IH 2O6PA 4XCYA 3QWOA 4Z7UB 4ZFZA 1ZHBA 5D4JA 2B1HL 1A0QH 4NZJA 3S4RA 4YXWH 4WFFD 4X6EB 2J72A 2ADIB 4JDVA 4FQHB 3C6LA 3DJZA 3AU1B 4PJBA 3PU7A 3EOTH 2CDGA 3FU7A 2YMKA 1H88A 1JSYA 1IQDA 3APFA 2DYPA 4PR5A 3TEWA 2X9ZA 4UU9B 4Y2LA 5GHWL 1BAFL 2VCOA 2YO3A 5F9OH 2FFDA 4G80B 5H4YA 4M9PA 3ELAT 5ANHA 1SM3H 1HJ0A 3K6IA 1N6QL 4PJ8A 4XFJA 2XA8L 3APDA 1M1JA 1BBJA 3AY4A 3PAZA 4KMQA 4QRUA 1C16A 3LPGA 3BAKA 4M93C 5E8DL 2ERJC 5D1ZD 1X5MA 1KGYE 2C9SA 2AK4A 2AI0H 2L3BA 4UOZA 2DQFB 1RP9A 5DJ6A 5TE4L 4OJFH 4ATWA 3IJHA 1FYTA 3CGTA 2WWWA 1X0TA 1QHOA 2OYHB 3ARDA 5HDLA 5J6HA 1F00I 3Q2VA 2Z5HA 4NQSB 1OAUL 1MCNA 2XWBB 1BFOA 35C8H 1S9WA 2H4EA 4GSDH 2MNUA 4L1BA 4HKXA 1VFOA 5D5ME 1PBYA 1J1XH 5EBMB 2V37A 3RKPA 2HLAA 3DIFB 1T80A 4JN2A 1SQVD 4ZSOB 3OJ2C 3DBSA 4DCKA 2WZ5A 5AW9B 4F1SA 4YR6B 1A1OA 1NAKL 1HWGB 4KXZH 1L9PA 2FB4H 3SYPA 2ID5A 1F5WA 4E9VA 4A39A 3AWGA 3SDYH 3CH1A 3IAQA 2VXTL 3SKMB 2GCYB 3P7KA 2IDTA 2KHAA 2GC7C 4HIPA 4QCIB 4D9RE 3TBVB 1EO7A 3H9HA 3L5XL 5BQDA 3TO2A 1I9IL 3EFDH 2DEXX 5KJ7C 3K6NA 4N8VA 1E27A 3NQIA 2GUSA 3HMWL 3OWEA 4KQ3L 1FH2A 2A6DA 1OF2B 4JKLA 3VRIB 3MNMA 1M57D 4XN1A 2F68X 1E4XH 4M29A 2VSKB 3S0PA 4KPHH 3VE0B 3QBTB 4N8PA 4D0BB 1M7DB 4JFVA 1NMAH 3U46A 2ZTBA 3EO1B 1AQHA 3Q1MA 1DJGA 1G9ML 3MBXL 3NP4A 4JFDB 4LKCB 5IB5A 3KYOB 5I1LB 1VFAA 1FAVA 1SMOA 1XL4A 1V55B 1OSEA 2R0WL 4Y2OB 5EU6B 1C12A 4Q2ZB 4F2ME 5T1LB 1DEDA 4F15C 2Q6WA 2BMKB 2J8HA 2OZ4A 2E9BA 3I6LE 5CEYB 3MV8B 1CN4A 2VLJB 4U6YB 4OF5A 4YPGA 1F90L 5BJTB 1U6AH 2WLHA 4R0LB 1E90A 4G42A 1KJMB 4NOBA 5KBDA 2Z92A 4PW9A 3UTSA 3D9AL 4K3JL 1G9EA 1GR7A 1QFPA 3KR3H 3V4LA 2N1TB 1GGIH 1SOKA 1IVTA 2CPSA 4S1QL 1MFZA 4YIQA 1R5VA 2G4GA 1N7SB 4GG6B 2CUHA 3X13B 5IMKA 5IVOA 4XCEA 4Y4KC 1HDMA 4FFTA 3CCSP 1YMME 1OX3A 2GEQA 1NLBL 1FL5B 2HPOA 4WK0B 5CCGC 5CILH 2K7QA 5J6SA 5IJKC 3ME0A 1BVZA 1HX0A 2XICA 5CLZA 3VW3H 2X7LA 4I77H 4YHIB 3SKNA 1FSKB 4GKSB 1SNRA 4MMZA 2BOBA 5KSUA 1XR9B 3EYOA 4KQ3H 3HNTL 2NR6D 4I1LA 3MYZA 1XF2B 1QP1A 1IC5H 3VXMA 1NCBH 4BZYA 2E75B 1BSIA 2V8LA 3HB3C 3ISYA 4H8WL 4ZUWA 3NCCB 4D0BA 5HGBB 1XXDC 2ZXEB 1DQKA 3ZRSA 4NENB 4TXVB 2I9TA 1NINA 1YN7B 3ECWA 3HE7C 3P4OB 4FHBD 4HOXA 4Z7WE 2MTAA 9PCYA 3DKHA 3I75B 4YDZA 1T03H 3BISA 4KKNA 4L73A 1T2QL 4M6MH 4YSPA 2VM3A 4Y7OC 1I1AB 3BCCD 2GW5A 4LCWD 1RQVA 5JQIB 1A7QH 1ND0A 2Z93A 2NZ9C 4MQXC 2Y1YA 4KK9D 5I82A 1KB3A 3Q48A 3O6QB 4Y9EA 4HUKB 1XF3B 5H4ZA 1V10A 2WZAA 5DK2B 3P4MB 5J13B 3TYYA 3EDKA 4FERA 3LNFA 2CO6B 1FLRL 2JLLA 3HAEG 3M0DC 1NMBL 1THCA 4EI5B 4CAGA 5LXGL 2RBLA 2CDFA 3JV4B 1XWVA 2XU9A 2YC1B 3PWNA 5LG6A 3G5VB 4BCXA 3GKZA 4FX5A 4CRPA 5CGMA 1IFPA 4NN7C 2ITDA 2QQNH 5EU4A 3U1PA 5HI3C 3U6XS 4G7YL 3Q5SA 1PPJE 5SX4H 1NCGA 3B2UC 1R5LA 4BFOA 4OD1H 4N0FA 1S7SB 5H35A 1ETZB 4KK6C 4YX2H 1SJEB 1YDPA 5IG7B 3WTWA 1NTDA 1ACCA 2VL5B 3CU7A 4WI6A 4ZSOA 4L5FL 4NNPH 1FNSH 1NBZA 2D0FA 2A77L 4TQHA 5HDBE 5CR8A 3QCTL 1MUJA 2O5YL 1OXZA 3LSOB 2OMZA 2YPVA 1VFBB 1NGXA 2VMDA 4JDEB 2XWXA 3EGXA 4RISL 4MB4A 2YPLE 4JRXB 3FT1A 4L3EA 4N85A 5T1KB 3PWLA 3L4VA 5B1JC 2JE8A 2M3EA 4LLVA 3UEQA 2EYTA 1NGZB 3V4VL 5A43C 1B3IA 3HUSB 1FYTD 3IJYB 5PCYA 4XPFH 2GPZA 4Z7QF 3V0VA 2GY5A 4WW1A 2DJUA 3UIAA 5DYFA 4OUUA 3MLRH 4U0QB 3V0IA 4DUXA 4EZKA 2VQ1B 5DK2A 1HBWA 4HH9B 3CWBE 1BSHA 1IZNB 3VE0A 4HJGB 5CFHA 1I1RA 5F89B 5C0JA 4H0LC 4MMXA 2WXJA 4AUYA 1UGNA 3L72E 3QGVA 2DRUA 4XC3H 4IRSB 1N73C 3WLBB 3L5IA 3ETTA 4M62L 1OL0A 4Y5YA 4K8RH 2PPDA 1KCRH 5C0GA 1UWYA 2VJXA 1ZEAL 2BEQD 3ARXA 3ES6B 1N70A 2RIKA 2Y7OA 2ORBL 3BPCA 2PW1A 4RRPG 2N1TD 1J8HD 2VL5A 2N1TA 3ML9A 4EI2A 3D51A 3RUGF 3H54A 2NY5H 2E9JA 4GG6A 4W9CC 1R33A 3BCCJ 1WZ1L 5KYUB 1MJUH 2ZP9A 3BH4A 2HJFA 4Z77B 4UQ3A 4AY0A 4GAGH 4MJ5B 5ELIA 4MMZC 1KYOH 1L2PA 1AIZA 2X1PA 1ZLUH 2P48B 3ZVVA 2MJWA 3LVEA 5EO1A 2C3XA 2PCFB 2NT1A 2DWXA 1RZIB 3CH8A 4MNHA 4KMTL 5F3HB 4R7DA 2X4OA 4JQXA 3KXFD 5I6MA 1OVVA 5IF0A 3FAWA 2X4PA 3ESMA 4TVPL 1SQ2N 4BZ1H 1HH6A 3LXCA 3LMJL 3SDYL 1ZT4A 3QXWA 4HH9A 1EUTA 3TGXA 5J0BA 3USSA 1M57B 1RMFH 1PZAA 1WFUA 2WB1A 2ZX6A 1EAJA 4ZQKA 2Y9YA 1E27B 6TAAA 5B1BB 3U4AA 1NU1G 3OKYA 5DYOB 3WIIH 3QA3A 5KANI 4P4KA 5I8CA 2QG4A 1HL8A 2NUTA 2AXFB 3NQKA 1SQQE 4J28A 4PBXA 5B4MC 5HPMA 1CJYA 4LGSB 4JHAH 4AX3A 4KH2A 1WBXB 4MS6A 2G0KA 4P05A 5LGJB 3CX5I 3FU5A 5L6YL 1WC7A 1VPOL 2EC9U 3WFBH 1C08B 1LEKB 4IL6X 4XXWC 1DFBL 1NAMH 2CNYA 3GSRA 4OFDA 4X5XB 4ZMAT 1RE4C 1EZVD 4B53A 3VVVA 3QR2A 1M3JA 4BKSC 4BQCA 1KV7A 1JF1A 3BHBA 2BZ7A 3M0DA 4D94A 5I5IA 3BRTB 3O8XC 3D50A 3K72A 3GSNA 3CCEP 1NQBA 3TA3B 2R56L 4RZCA 2B5IC 3QO0B 4L0PB 2Q87A 1IAII 1X9LA 2EDMA 1NUFA 2E74B 3P9MA 4MA8L 1PZ2A 3GI8L 1W91A 2V8MA 3I02A 4L8BA 1A9EB 3HA0A 4M4RB 5CIPH 1HNGA 2VMEA 5D93B 2NXZD 1U3HC 2OKMA 1AQ8A 5BVJA 3DOHA 4JO4H 2JTDA 1XH1A 1CDBA 1O5DT 2CR6A 4DT0A 3R19A 2L91A 2G3AA 3Q1SH 2ZONA 3RLSA 4RMUA 3EFFK 1UUNA 2E59A 1IL1B 4N2EA 4P2OB 3RNKA 2N59A 3V4PB 5CD3B 4WV1C 2FK9A 5HGAA 3V6OE 3K2MC 3MAWA 4HJJL 5CCKL 4HKZH 1LK2B 2BSSB 2ZJSE 4GDOA 1TVHA 3KBPA 5D4QA 5AOLA 5ACLA 5DLML 4ZBJA 3VFSB 3X3FH 5I8CB 2Z7YA 3WJLA 4MJIE 5HHMB 4RAUB 5LCVH 4YSQA 2Z5IA 3FTZA 1TU3F 3MRDA 3NYKA 5AZEL 1MRCL 1JE6A 3KDPB 5IVXE 4P5TA 4NSKB 5BS0E 3MR9A 5HHQA 2XG5B 2AJZB 4JKWA 4NHCL 3QIBD 1KY7A 1YECL 3DXAE 1INQA 1NCHA 1BYOA 5CP3H 1HSBB 4N4YB 5C08D 1LM8V 3ROOA 2WYHA 4QTHA 1LD9B 2X89A 4BWTA 3ARGD 4JL1A 4QHMB 1JNHB 1KTBA 1HNYA 3O3UN 4K7PL 1F4HA 5MEND 4MNQB 3BZFA 3ZTJH 2DBLL 3HVNA 1L4AB 1JM0A 3FF8A 3IR9A 2HJKB 2Y5EA 5FGSA 1NTMG 3RZWA 3TVMB 4P5SA 4URTB 4WWKB 1Z9OA 3VWKB 4XXCC 3U0PA 4HHAB 4HQQL 3BUIA 2B77A 2BCKA 4MXVF 1XBDA 1OAJA 1TJXA 2YXRB 3RGVC 1Z6JT 4TQEL 3SDDA 5DFVD 5D1QA 2B1OA 4OUOA 4E42A 2VXSL 3L1OL 1BJ8A 3LH2H 4MN4C 5TGBB 5FYKH 5IEKA 3RZCD 5H2FE 5DRNB 5BOZG 5J6HB 2JQMA 4LIQL 5JNYB 4UQBA 1KIPB 3H0TB 2BIOA 5C1MB 1LHZA 2R2BA 1N6VA 4ZMZA 4KQ4H 4C56D 2HLOA 1BXUA 2BZCA 4GXUM 4LMQE 4NO5B 4YDVB 4FD0A 3MRHA 4XPAL 1KB5A 1A64A 4PJ7E 2PO6B 1E9QA 2X38A 5FK9B 1CDGA 3MLXL 2JCCE 1QBML 4JY5H 3RK2B 3MRDB 1AV1A 1QLEH 3OR6B 4M1DL 1LE9B 3RK2D 5BZZA 1C5CH 1OSZA 3ARDD 1NM4A 1RFDL 3PYCA 3QB7C 4Q9BA 3F6IA 5GXBB 4GT1A 2WLMA 3QWOC 5DJCB 4UM8B 3CVHB 4OGAD 3ZTNL 3ISWA 3WTSA 4TVPH 4JFFA 4P2AA 4WI0A 3OTTA 3H1ID 1E5BA 3HIZA 4MJ4A 3AJ7A 2DKUA 2O72A 2WN3A 2D7PA 3X11A 2XY2A 2JP3A 2GEEA 2J1YA 1BCCJ 2ICWA 3GJEB 4YUEH 1KEGH 5AALA 2AJYH 1RZJL 4NWTH 5CJQL 3MUGA 1MEXH 1P4IL 2BCKB 3D69B 5EO0B 3GSRB 3L36A 3KPOB 4OLUL 3EOBB 5IQ7H 2P43B 3ULSB 2WPRA 2I1JA 4N20A 1EBPA 5IQ9B 1MOEA 1T2KD 4M6AA 5IROC 5JHDD 2KQMA 2NQ3A 3FUJA 4UNVA 5HBBA 2EDDA 3GBDA 4WEUD 4K3AA 1DEBA 2FYUK 5I30H 2WCGA 2FYUD 3EYFB 2WTOA 2DQDH 4NGHL 1CURA 5I24A 1LP9F 3BCCE 1NEZB 2QVKA 2EADA 1DBAL 5BZXA 3PG2A 5SX4I 4U6VL 3CSFA 2ALWA 5DHVB 1HFUA 1JPST 4BFEA 1GZLA 3IU4H 5D7EA 2OL3H 2VDPH 4Y4FB 4ZFOA 2BSEA 2BNRB 2B0SL 2VZ3A 1SLUA 4A2HA 3QQ4A 3KE0A 3CFIC 1OP3H 2NY0D 1ZA3A 3GB7A 1IIIA 4HJ0D 2L7UA 4NHUB 4DUWA 4N5UA 5EIIA 1L7IL 2BVOA 1RF0A 4PWJA 3BKYH 5L7XH 5L9DL 3REVA 3T08A 2P26A 5DWUL 4BK8A 2J4WL 2W9DL 2MKLC 4JO3L 3N2JA 2OJ1A 4N90E 1FIGH 5D5MB 3QE5A 2OTJP 4N3UA 2ZYIA 3NESA 4UTBL 5HJDA 4N9GB 4QHLB 2I85A 4OLZH 1T8ZA 2XV0A 4UDUB 4UQ2A 1PZ3A 2K1AA 1CXLA 2Z8SA 4AEEA 4KK9C 5AKRA 4N8CH 1L9RA 5KJ4A 4DKFH 2BHYA 2J88H 4NUQA 5FA4A 4ZKPA 4DEUA 5DJXA 1XIWA 3FMGL 2IADA 3JTSA 4FXTA 3WCYA 2IPTH 1YEHH 2ZOLB 2A9MH 1NGMB 4AGOA 3QIUA 1EFXD 2X6BA 4F7CB 3S3PA 4E9LA 4AUWA 3QZWG 1I8AA 4JFSA 4MZRA 3MV7B 3UGEA 3A7OA 3RX9A 3KLSA 4IOIH 2GITB 1FZFA 1TJHH 4AG4H 4YX2L 1JHLH 3BZFB 4OCRL 2B9AA 3VFVA 3OKNB 1AG0A 2Z34A 3GLZA 1M71A 1BZ9A 4ZODA 3BHBB 1HHIA 4BFIB 1CK0H 4LPVA 3PLNA 1V05A 1K05A 4PRHE 2GBAA 2WXNA 1TG8A 4OVVA 5E2TL 2QFRA 5DU7A 3WFEH 3CFJB 4GI6A 3CC7P 2KH2B 5KW9H 1OAKH 4XZUB 3KGTA 4MNGA 4PJ0H 4UIMA 2LFGA 2HT2C 3RG1C 5LVEA 4F8OA 4PRHB 1SQXD 2NY3D 3DURB 4I88A 4YZFE 1CVSC 3CFBA 1ZSDA 4R0LA 4O02L 5KS9E 3UTTE 1U3ZA 2WT7A 1KYOI 3F64A 4Z3FA 2VDPB 1ZLEA 3MRQA 4KY2A 1OB1A 5E2VL 3L74D 4N0RA 5JPMA 1JI2A 4O58L 2AFNA 1CDCA 1VFBA 4PY8I 2AXGB 2VC2H 4OLWL 4B60A 4G5ZH 2XFXA 1S5IH 4TQIA 2OFQA 4XA4A 5I1GL 1X44A 2DICA 3H9YA 3PXHA 4RMSA 2EC9T 4XMKL 2F1AA 2CUMA 2HFEB 3IE4A 1TOXA 1J0ZA 3KWUA 2ATKB 2FQEA 2YPLA 3T0EC 4H8PA 3BQUB 3D4CA 2DH3A 3TWCL 1H3UA 2OSLA 4P3DA 3UBXB 5F1KC 1T2JA 3CCMP 4K23H 4IBUA 3H1LE 4P5KB 2X05A 1W72H 1U2CA 2P8MA 4LCVA 4O2CB 3HB3D 2BO0A 3MQIA 4X9GA 1CTOA 3RJQB 2WUBL 2AVGA 2FWUA 2DB8A 3G9RA 4PRNA 2NLJB 3DV4A 3CX5H 4CU8A 4PJHE 1TCRA 1M7LA 4GG8B 4FNLH 4WUUD 4XNYL 3SJVB 5I6PA 1BVLB 2BHFA 4OFVA 5T1LA 1TSHA 3AW5A 3HG3A 5TPWL 3KR3L 3TZVD 2WTRA 4C8XA 2EH7H 3EBIA 1PMYA 1RZ8A 1B2WH 4TSAH 3R7QA 3AT9A 1A7NL 2D2CD 4XO5A 2PR4H 1H3VA 1D5ZA 2IFFL 1N68A 2VE6A 3U6XA 4Q0XH 1JGVL 1OAKL 3KGUA 5EWIL 4L1TA 3S88L 1MFCH 3NIDB 3PQYD 3JTTB 1K2DA 2X5PA 3NCBB 1MLCB 4Y19D 2K6WA 2ICWJ 4H44C 3LKPA 2DL2A 3JWNH 4KHTH 3IFPB 1NTZK 4A68A 4YAQA 2VXUH 1PDKB 3W0WB 1O6VA 5CU9A 2BSBA 4N5ED 5DI8A 4LKXA 3V4PH 2UZYA 4GIFA 2HFFB 1JD9A 1MRFH 2X41A 3QJUB 1H89A 5IK3B 4HISA 2PYFB 4IU2B 4YDLC 4Y28J 2EUWA 2EXWD 1CB4A 4GG6E 5MP6L 2NY1D 3FK3A 4FQPA 4PRIE 1XTCC 4ELKA 4JFEA 3WNIA 3FZUC 2JKTM 2X9WA 3CFCL 3MRPA 4AZUA 1D9KB 5FS5A 4PS7A 1JZ6A 1BEYH 1G84A 4X9FA 3VGBA 3RB7A 1DSWA 3CWBD 1PAMA 2XTJE 4Y9GA 3AS2A 4FHJA 2VUOA 2V9UA 1ZGLB 2YBGA 1QUNB 1MJUL 4L4TE 1FRGL 1M56D 3VFOB 4QAMB 1JVLA 2NY7L 4UOW0 1M3IA 3H53A 3H9SE 4KZDH 1HCZA 1RK0A 2O6CA 2K7PA 1BQUA 5IBTH 4LLDA 1B6DA 5B39G 3RX8A 2FXOA 2ZX5A 3VNYA 5L9DH 1QSED 4YVNA 1T22A 1IFHL 2XU6A 5JW5B 1AD9A 2QQKH 3BPOB 3Q05A 4HWEL 1ET8A 2DQIH 4PBDA 4GP4B 1N18A 4IJ3B 5F89A 3WY3A 5IOPB 4XC3L 1E7UA 1UM5L 2K6ZA 1JF1B 4YBQD 1HQRB 4NFBA 3UJTH 5I73C 5C6WH 1U0QA 2AEOA 2I69A 3CFCH 3EJTA 1AQMA 3AY2A 2WLYA 1D6VL 3LQMA 5B4MD 3WNLA 3QS3A 4Y8DC 4Z7NE 2B87B 3MMEB 2JB6A 3FTUA 5AW1B 3NIGB 4AUUA 4YSEA 3ZHKA 1LQBC 3HD7B 1LDSA 1NCWH 1G2CA 4TNWK 3TO4C 3X1BA 5KVDH 3MODH 1MWAA 1BM3L 1HHHA 2CK2A 1E28A 5SWQB 4YOKA 3A0BE 1S7RA 1KIUA 3CG8A 5GPRA 3BVNB 1TTCA 4L76A 4JNXA 2FXMA 4KROC 1BREA 3ZDXF 3GBLA 3MUDC 1YA5A 1SFCA 2YN5A 4DAGH 4UQAA 4FXGB 2DIJA 2V3DA 4N2OA 4NZDA 4DN3L 2IGFH 4KWUA 5DZVA 1S7TB 1H8SA 4LB8A 4Q8BA 3T8MA 3FB5A 1G7LB 3HPLB 3U25A 4AQEB 1IC0A 1WWCA 1ODAA 2C9QA 2J8OA 3R2PA 4YZWA 3SDCD 4BUHA 5HYSB 5K59E 3GWJA 4X6EA 4N2HA 3FQXB 1DEEA 1K4CB 1WHOA 3GSQA 1SQQD 2WSKA 3FQUB 3FYEB 1S7WB 5ADPH 2BS9A 2G30A 2CHXA 1R17A 4FG6C 3EFGA 1T4KB 3O6LL 4MA3A 4PV1D 1CXEA 4CSZA 2VO5A 3JV0A 3LYRA 1SQVG 2HTKC 1T83C 2IOOA 1UZGA 2H6UA 3U1CA 4CN6A 3E6FA 2VDNB 3VFVB 4K23L 4X7SH 4G11A 5FV1L 5IMMB 1BBJB 3CLEL 3CQPA 1URQD 2I1KA 4FI8A 2KUTA 4DEPB 3TF5A 1HHIB 2GSGA 3GIVB 1KWGA 1WBZA 4WW2B 5GGSY 5ACZB 4HJGH 3UXFA 3J27A 4WWKA 4PRDB 3EJYC 5KAQG 1SHMA 4NQUA 5F3FA 1CLYH 3HHSB 2X53A 1A1NA 2X6UA 3DROB 2Q5BA 2BNQD 2XWRA 4OIBA 1BFVL 2OMXB 3GZKA 3MO1B 4OY9A 3VFGL 3N43F 4JRYB 5FYLD 3NP3A 3W68A 3KPSD 4YE4L 3ZHLA 5KBNC 2E0PA 2JK5B 2W07A 1CLZH 3FQ1A 1PCSA 1KJVB 3VMYA 1FQ9C 2A38A 2OL3B 5HYJD 3FU8A 3KCPB 4JFHD 2Q6QA 1A4KA 3LPPA 2VLKD 4X7TA 2ZYAA 4YBHA 2BP0A 3SYAA 5BZWA 5KKZB 5K9OB 3QUMH 4MAUL 1LWUB 2FZ3B 4DUVA 5TF1H 5T3XL 1YJNP 5DC0A 3UPRB 2IBZG 5KYWA 4ETYA 2I27N 1G7JB 4YFLI 3BLBA 1RAMA 3L3KB 2WZ0A 4UOQA 4NO5A 2NXYB 5JQ6L 1BQHA 4U1SA 5TDPA 3JWDH 2J1KA 2FGWH 3SPCA 2C7UB 2O5ZH 2WLNA 4ZX4A 1CI3M 4ZDHB 4U0RB 1GIGL 4J2QA 4PD4D 4H0LB 3PNRB 5J56B 3FJTA 2N7BA 3IT8D 1YEGL 1WFIA 4YDIH 4D8OA 5JOFA 2EUZA 1KSRA 2VLRD 4Y1AE 1ZRUA 2YAEA 3B5TA 2N9YB 4HIIB 3HNVL 5GRWA 3R0MA 5IMMA 5KVDE 1AZZC 4I2XB 4O4YH 3VXNB 3PL6C 4IL6H 3RKDD 3TYGL 1N5YL 1YPZB 5DCCA 1IAIL 5HXMA 5JLZA 4TSCL 1G7HA 2R69A 3PWVA 5IHHA 4IBZA 1ZRTD 3U4KA 2I07A 1CD1A 3LX9A 2HVKB 4HV8B 1AE6L 3EADA 3VRLE 2LAGB 3QFJD 2Y07L 2BFVL 2KBGA 3T0BA 4QTHB 1CGTA 5E5LA 1A4BA 5CEYA 2EE3A 3A24A 1R75A 2E4FA 2R2HA 1U8HA 4Y7MA 3HG5A 4YNYB 2Y0CA 3CUPB 3V7AE 5J57B 5FHAH 5DUMH 2CLZA 2F7OA 3FQTA 1JZ8A 3HG0A 4NYLB 4DCQA 4DGIL 5F8QC 2YFOA 1KNOA 4EDXA 2LW3A 1XGQA 1YJDC 5MHSD 1PDKA 3W0WA 1JG9A 3RZCB 5DJYB 3TT3L 1G7PB 4DERA 3B7RL 1OGAD 4J3BA 1OVUA 3D3VD 3D6GA 1EJ8A 1IGCL 4QY8B 1T0OA 3I3EA 3LKRA 2EYRA 3NSDA 3EDDA 4YK4B 4XNBA 5FFOA 3K6DA 4ICWA 1RUML 2OBGA 3H0TA 3ZMNA 2VN5A 4GIAA 3QIWD 3T0EB 3VN0A 3ZE0E 1H0DB 4N28A 4FMFA 3DRQA 4IU3B 4GKOA 1ML0A 1YEGH 4LF3B 4JKNA 5BRZB 3LRSA 2V2WA 5KVGE 4G8EA 4KTDH 1XIWB 3ZLQC 4RA3A 2GK2A 1KILC 4XP6H 3OKEA 4Y19A 2XWJA 2VH5L 5AZ2H 1ODUA 5IW3A 3VG0H 2IOMA 4R83A 1EZVG 4YUEL 3Q0HA 3GZPA 4WY4A 2Q1EA 5FGRA 2O6DA 3KLKA 3MV7A 2ERJB 4U05A 2B2XH 2W0FA 4NO2A 3FHAA 4WIQA 1U8HB 5KSBB 3L6FB 1M2VB 4PS8A 5C39A 1YJWP 1S7UB 3RUGB 2DLFH 4PBWD 3RILA 2F19H 5I75B 1RZFL 3MRGB 4WFFE 4GW4B 5DMIL 3MXVH 4JZNA 5AYQA 4IIQC 3DROA 4GQZA 2B3IA 1E67A 4X4ZA 5D1ZB 4BFBD 3FOMB 5I0XA 4B0MB 4JPIB 1OXYA 4EN2A 2JB6B 3VP8A 4G8IB 3SPVA 3D05A 4AK1A 3ZYJA 3BT0A 5HDRA 1K73Q 3OPZH 2HFTA 4NZ8A 5CJOL 4ENED 4TL5A 3G6JE 1Z2KA 1Q0YH 5FWQA 4ZX6A 2A6JB 2WNGA 4NPYB 3FSZA 2CO7B 2NUPB 3NACL 3KL5A 4K9EL 2AKRB 2DWTA 4LGPB 1M53A 1X5AA 4JS7A 5FYKL 2OMNA 4XOAA 1HHJB 2EO1A 3NH7L 4L29A 5C6PB 4LL9A 2C7UA 2WYIA 2KUBA 4JO3H 2F54D 1BF2A 1WGOA 4WWID 3RBXA 3K1KC 3MNZB 1J1OH 2V3FA 3F5WA 4G8GB 5FCUH 2J5LC 5HYJE 2EIZA 1KTLB 2OTWA 2VLKE 2XI9A 3QUZB 4MGXA 4POUB 4KQ0A 5DZAA 1LO3L 5B38G 3DYPA 3JC22 2EE6A 3FQWB 3SOBL 2HR3A 3BN3B 3O2VL 5KWYC 2IMMA 4N9GA 4QHLA 4Z3GA 1JPFA 4G6AD 5D1XA 4CKQA 4RNRB 1FO0B 2IGFL 2D0GA 3DX6A 3VG0L 4K3EL 3CSPA 1NA8A 3MYJB 4Z7VE 4AGNA 1NVOA 1H3PH 1TMQA 5GJTL 1XTMA 4TNVF 5G4OA 1SZNA 3WFCH 5D93C 3O45A 4KNQA 3HN3A 1KTMA 4PLKD 3TH3T 4UILH 2BDNL 1LTGC 4PEEA 2DLEA 3BAEH 3EBGA 3QFJB 3ZDZE 5APVA 5KUKA 3FKUS 1AYOA 2B88A 3CXHD 5KVGL 4UINL 4I18B 4G43A 2E47A 2P5WD 3ARQA 4HU2A 4KXAA 1DIPA 5J1AA 1JN6B 2A6IB 3A6BH 5L0QC 1AZCA 5HDQL 1L0NJ 2A0LC 2CLVB 1FNEB 2WWMD 3GTNA 2XZRA 2EIEA 4JRYA 1E6JH 1GPOH 1Q9WA 3BP7A 3AITA 4TQPA 3UTTD 2HMIC 2PXYB 3EGDB 3WEAA 4H2AA 3B7SA 4MZ2A 1J0JA 5GIRA 1Q94A 4NN6B 4JG0L 4X6FA 4U1KB 3H42L 3STBA 4Y4FD 3GMMA 2ODHA 3FUHA 4F91B 1J05B 4K2UH 1VEOA 2JCCF 1YEJL 1AZNA 1TF4A 3P9WB 4F20A 3H1JE 3Q8FA 2ZPKH 2B1AH 1RJZB 3RWIA 3ILPA 3RPKA 5JPNB 3UBGA 2C4FU 1BCCE 4KUZL 1HZHH 2EDHA 5F0PB 2WWNA 4N0YL 4EIZC 5APWA 1FZCC 1A4CA 1ZHKA 2HLAB 3DGDA 3QG6B 4PRIB 5DUML 4R7VA 4BH8B 1AIFA 2WGXA 2XJLA 1URLA 3QH9A 2JXMA 3QC5X 4KNTA 3PWUB 3WLWD 3TDKA 3EUUA 4JKPH 5CNHA 1R3LA 4IOIB 2HG5D 2UWJE 5D7KD 4AL8L 4GEIA 5E6UB 5DUPH 4OLVL 3ARDC 4P5MB 5GS1C 3OAZK 4IHBA 5C0ND 4MLSA 5CN2A 4FQLL 3WU2H 3MCG1 5I8KH 2ZWLT 1K04A 4WLCA 1H8LA 2X10A 1E8YA 2OJEA 4LSDA 1KC8Q 3MLUH 3SN6N 5FLVA 3V0WL 5C0FA 5F8RC 2CCWA 4LOEA 3VYPA 4V1DD 4NQEB 4TN9A 5E8OA 5IKCA 2M8XA 3IDJA 2R1XA 5MEPB 4OCWL 1HIML 4I3SL 5B1AB 2Q8AL 3ZBMA 2FX7L 4P59L 3TBYB 3RUGA 1TDQA 1XF3A 4PUBH 2NR6A 4V33A 4TSBL 4O51A 4OD2A 2GG1A 4ZNEA 4GMSL 1J0YA 1K9TA 2ZUUA 3BFOA 2GQHA 2L8AA 2WK2A 5D96B 1NCOA 1ROCA 3SGJC 1SFDA 3E7KA 4DP8X 3HLKA 2HUHA 3GS0A 4PREB 1HXMB 2H3NA 1NTZE 2WTRB 2BC4A 3FTGA 4NT6A 2DZEA 3WYRA 1UQSB 2MPAH 3FTSA 4LSUH 4FJZA 4DK6A 2E7MA 5SX5K 3U1SH 1X5KA 1LTBC 2ZT9B 2RKLA 2D2OA 4KO9A 5AZEH 3ZQWA 4ESKA 1S9VB 1U9KA 1KB9J 1IQWH 2A6KA 1CSBA 1P4LB 5DURD 3MRLB 3FRUB 3IPFA 4NQEE 1XDTT 5D1XC 4WGVB 1DQML 1BE3G 5EH1A 4NQDA 2APWA 4CC0A 1BFVH 1A22B 5KVEL 5D7IB 5DJDB 2Z1KA 2GT9A 1QYGH 2PYFA 4E9XA 1T66D 2W60B 4D3CH 2NXYD 2V5RA 3MRFA 2FSEA 4RAUA 3L16A 2GTWB 3W9DA 1EDIA 2R7EB 3PABB 1MQKH 4GO9A 1MPAH 4ASVA 2HX7A 2J21A 3NUKA 5KOMC 3ZKSD 1N59A 3GSQB 1BIIA 3RIFK 4AIZB 1PZ5B 1WHPA 3WMPA 4LQFH 1GCFA 4XMVA 1P84I 4KJYA 4MCZB 4QRTA 4OZGE 5C8JB 3FUIA 2C9VA 4DT2A 4NDMA 4U3SB 1LP9B 3LW5J 2R56H 1T0NA 4GAYB 2ZCLL 2XXFA 4WWPA 2VXVH 3S9DB 2AZAA 4PB0L 4QHNA 4ISVB 1ONQA 2XN9A 1JFQL 4GO6B 2IPKB 3KYNB 4OZFG 3SE9H 4PJEB 5I1HH 1QFWI 4M8QB 4PJGA 3M7FB 3V0DA 2Y7QB 2E7BA 4EIBA 4HPOH 2IZ1A 1ZK9A 3BDBA 5EORH 3UC0L 3RWDB 3EYSL 4JG1L 3V4VH 2B5IB 1KZYA 4X8XA 4WO4C 5I1AA 5GS1A 1GY1A 3V4UH 1X5GA 1I9EA 2QKIA 1UH4A 3V8OA 4BFJA 4DFHA 1MIEL 1FAIH 3BD4A 4QXUL 2W94A 2O6EA 1ADQH 2HPCB 4XE5B 4U1MB 3IMBA 2IF7A 1ZRTE 5I9QC 3UMNA 3AUWB 3S96A 3CXHE 4W7YA 2AQ2A 1IAOB 3QHZH 2QJYB 4A6YH 1R3JB 4P9MH 4U2YA 5HHNB 1UXSB 5J5EA 2QVMA 3QZLA 5D7IA 2Z31C 4LHUD 4MZIA 4X0KB 3NSYA 4I7ZC 1FE8L 2H26B 4PV9A 5EU5B 5F7NC 4WV1B 1U93B 2CKBH 3LDBC 3MGOA 1HYRC 1T1ZB 2FEEI 3U0TA 3CZNA 2NSXA 4B9JA 1NTKD 1SQPD 3OL2A 4Q9RL 4X4KA 2NW2B 5L4IA 1SQBD 3VFWB 2P1YA 4ZUVB 4D3CL 4WY7L 5I2IA 4MD0A 4E9TA 2AXWA 1JY2N 4KRMB 5TE6H 5T3ZD 1A9VA 2MRYA 4PJCF 2D4DA 5JZ7C 3BJLA 2VC2B 1ASPA 1BZOA 3GO1L 4KXCA 3IDIA 1IFHH 1NU1J 4GAYA 4QRQA 4MHHG 4A6YL 1G9NL 2J5UA 5I66A 3ARWA 1S8DB 3IKCA 4P46A 1J8KA 1T6WA 4NJ9H 4IYKA 4QHNB 3TBSB 2W59A 4G6MH 1TQCB 3VGFA 3WL9A 1I85A 4ZFGL 3F58H 1IEAB 8FABB 2CIIB 1CL7I 3C5ZD 4EUPH 1NO4A 1NCAL 1BF5A 2R29A 1BDYA 2FWSA 3GK8H 2I32A 4LSUL 4PIRF 3C8KB 4UIKL 1MJ8L 4BSVB 5T5FH 4J8RA 2CA4A 3E6FB 3KWVA 1GCYA 4AZ8A 3QFGA 4ZTOL 2DD8H 1KFNA 1USZA 3E38A 1JV2A 4J4PA 5C08A 1U42A 2RH0A 3RKDC 5M95B 2BPBA 1U8IA 3BWZA 1YNTA 3PL6D 3I6GA 1F58H 3QNYB 3D87B 3G08B 3ORJA 2DQDL 1U3YA 2MQ3A 5C0GB 2E7CA 4RFNC 1FG2A 1ETJA 3II6A 3ARGC 1MI5A 4C4KT 1NFIB 5I6XC 1DZBA 4LBEA 2XWZA 3DX4A 5C0CD 1G7IB 1Y9BA 3CVCA 1ZDSA 1A2YA 1U8MA 4C83A 1GAFL 3RWIB 4KITB 2VLLA 1J8HE 2KT6A 3IFOA 3QJZA 4JY6B 4QY8A 1CFSB 4X7TB 4OB5L 4MQTB 4XCCH 1QFUH 2AQNA 2GSIB 3BAJA 2J71A 4KK6D 2JJLA 2YGQA 5FEBA 1HOEA 3FFCB 2ZVNB 3MV9D 3MX0A 1MJ8H 4MX7A 2BJMH 3SDCB 1E4JA 1Y7VA 3VXTB 1MAKA 3ECQA 2R0LL 3PQYA 4XR8C 1U8JB 2C9NY 2IALB 4MKTA 2BP5M 3PWPE 5JDSA 3CDCA 3CV5A 4WEBL 3N9GL 4NLAA 5AVTB 3UTZB 2Y25A 3TBTA 5AW2B 1SOXA 1M7IB 4G6ML 1AQKH 2WVSA 4KK5D 5C0FB 3G5YA 4CJ1A 1TENA 4J3OC 2JKVA 2ZYGA 3CDFA 4GUPA 1RU9L 4NIYE 3QUKA 1FVDB 1XSOA 1AFVH 1BD2A 1CGUA 3QQDB 4WHYH 1ZGLP 4WCYH 2DLTA 2J59M 4Y1SA 4WY4B 5DYOA 3ESUF 1OF0A 3C87A 1C16B 1OCRB 2AV7A 1TZGL 4R90L 2VZSA 4IFMA 1BZ7B 1U4EA 2MPVA 3L5XH 4FQCH 1KEML 3CPLA 3U4EA 1A14H 1N0XH 2VDML 5APSA 5C9JB 1NIFA 5C7XL 2P2UA 1URQA 1AD0A 2ZJSH 4FQHA 4NQCB 3LN5B 1NOFA 3B34A 1GTFA 3HW7A 3EFFB 1GZHA 2AJSL 3MREB 4YJZL 3KPLA 4DH2A 2DYPB 2VC2L 1N86A 3OX8B 4OLWH 2HX8A 4EN3B 3X3GL 3MOAH 1S9KC 3EW3B 1OOAA 1BDDA 2FX9L 3FT2A 1EAPA 2LLLA 1KYFA 3C60C 2P8LA 4OZHE 4HKXB 3SYQA 3FCTB 2ROXA 3TGUJ 3G4SP 1SEQH 2C3HA 1FE6A 2FUTA 3BPNB 3VQMA 5GJTH 3S5LA 4LZKA 2CKBA 5GJSL 5E1AB 3I56P 3BP5B 3SJVE 3GBNL 4KVNH 1IC5L 3H1LD 4HU8A 4B9IA 1JJUA 4G1EA 1AI1H 1G7PA 1KCWA 4G6FD 3HBPA 1AGBA 3RK3B 5I1HL 4OJFL 2DJ4A 2R1YA 5TE4H 3L72J 1MCFA 3QG7L 1ASOA 2JB5H 3WBDA 1OGTA 4O02A 2E75C 5DO2C 3CWBG 4UM8A 1AS8A 2AQQA 5F72S 2HJLB 3WTYA 3HG1A 4NUJB 5BVZA 5DD6B 2CXGA 2FEEL 3FN9A 4J23A 4XMPH 4QLRA 1CS6A 1X7QB 5CCKH 4OM1L 4UBDC 2N0KA 5KJRL 2NZ2A 1IEAA 2IAMA 3KG5A 1XCTA 3L70J 3N0PB 5BQ7B 5I8OL 3T8XA 3LN4B 1MF2L 5MERB 4PV8B 4DPRA 4AEIL 1MPAL 3F7KA 4HSCX 5KYYB 1WCBA 2OZ4H 4KBPA 1MQKL 1DQQB 3MA9H 4UWQB 4AGQA 2YPVL 2EIBA 3FMGH 2W90A 1LEIA 4JHBA 3KLAA 4AEIH 1QBLL 2IXQB 5EUOB 5IIEB 5GSRB 1OW0A 4C58B 1QFWH 4RMBA 2GFBB 3DGCR 4K94C 3T6XA 4TMPA 4C4KO 2QBWA 4LFHG 3NSXA 4O2EA 3DYMA 5HDBF 3SWKA 3G5XA 3S2CA 2ZAHA 3APMA 1ASQA 1X8YA 2OM5A 3A67H 3HE6D 2Z4EA 1NCIA 1CFQA 2NXYC 4MDIA 2ADFH 1U8NA 3CPUA 4XB7A 3ARTA 3TESA 4HHAA 4I87A 4LBAA 1C8QA 3VACA 2FQGA 43CAA 1KJ2H 1GZPA 2HUEA 4U1KA 2K6YA 3WMQA 5I5MA 2ZXCA 1BQ5A 1UT1A 1QHPA 5GS0D 2HFFA 1PYWB 1MHPH 4EBQH 2B0SH 2UY7B 1BSNA 3OXRB 1AS6A 2CK3H 4FQ2L 4OFYA 2JMRA 3KNBA 3D3VB 4HT1H 4JRXD 3BVHA 5DO2D 5AUMB 4JHAL 1UH3A 4FOMA 2AF2A 4U6YA 4K15A 2DEWX 3D4YA 4PRAA 1ZKAA 3IAGC 1X6LA 2AJUH 5FDWA 3OA7A 4XPHL 5LAPA 4GMSH 3N7NA 1DX7A 4UBDD 1S5LE 1F11B 4D6TD 4MD0B 3WTXA 5I76B 1W0WB 4K7PX 5JDSB 2NY5C 2OR9H 2BS71 4S11A 1KILE 1HILA 2XYCA 3O2DH 3TONA 3H25A 3MNVB 5ADOL 5BZDB 4C4BA 3H1IJ 3DX1A 2JKRM 1SQQG 4HIHB 4OSUL 4P5MA 5E6ZA 4GYBA 1DANU 1BGYD 5AOMA 3LMJH 2WTYA 3L54A 5EF1A 4Y1AB 4A6YA 2C3GA 4BGLA 3W67A 1E5CA 1GDTA 3CI9A 2WSPA 3NN8A 3ABLB 2HVJA 3PRJA 2QE7H 1PPIA 2ENYA 4HMDA 3DUUB 3MRMA 4N24A 1FL6B 3UZVB 5CEXB 1ET5A 3OLEA 1WIPA 1A1MA 2ZXGA 1HOCB 3M1CA 4WDIB 4LDEB 2WC7A 4M9OA 4QGYA 3LDBB 5CEZL 1M71B 2QHRH 4WCYL 3BAXA 5DO8A 4I7ZB 4JO2L 4Q74A 3S37H 3L3GB 4E41A 3O3BA 4PD4K 1AD0B 3BEVB 3CVIH 5DVPA 3FGAD 3M9BA 9CGTA 4FQQB 4RWYH 1U8IB 1LP9E 2CO3A 2OJZL 3C6EA 3N55A 3RUGE 1PX4A 2CUAA 3GSUA 5FOBB 5EOCJ 4N1HB 1N7SC 4TPRL 5IR1A 4RGNC 5CBOA 2KSJA 1RF1C 4AM0B 1S7SA 1MI5B 1UKTA 2HLFD 4O9BA 1FNEA 4GKNA 3RIAF 3FB7B 2OX5A 2PMZA 1SQXE 1ED3A 3INOA 1BVKB 1RIHL 3ESVF 3F7YA 2Q7YB 3SBWC 1UWEL 4EDWL 4P07A 4X2UA 3PJSB 2JJWA 4DOHB 4ZMTA 3DDFA 1KF9B 3NMEA 2IDQA 1LXMA 1JY3N 3B2MA 2R0KL 2DN7A 2EDTA 2V9TA 4WTZG 5BZDA 2DI8A 4QMAA 3ZO0A 3IGAB 2IAND 2H1PH 4IEFA 2JFCA 3A0HH 3IYLW 5KN5B 4CN1A 4BQ9A 1HKLL 2OSYA 1HU8A 1TJGL 3BKMH 4N6RB 1MCSA 3IVKA 2Y1AA 4OD3H 3QEQD 3AS3A 2VAAB 4TS6A 2WUCL 5KSVA 1P7KB 1NM9A 4LNRA 2VM9A 3P30L 5D7SL 4GSXA 3IXAB 4QLWA 1RPUA 1UOWA 4HJEA 2OTKE 4PY7A 4Z7QE 2ZKXA 3AQYA 2F58H 2C9LY 2V2TA 4I89A 4L74A 1JPTH 3VOPA 4HZLA 5T3XH 1NTME 2EQDA 1YNTF 1VQNP 2J3SA 4AV5A 4I48B 1QPKA 4N8UA 1OIOA 2W65B 4NHCH 3JSVC 1OAYL 2R1WA 3VG9B 2DH2A 2KERA 4KKLC 5ESAB 2EO9A 4MB5A 3OSKA 1BOGB 2O1AA 1D5XB 2YZ8A 4KKRA 4IKLA 5HYIA 3HBZA 4QGTA 2FYNB 3OKNA 5B5EE 1FO0L 4DP5X 2ZJSL 1PLGL 3RJDA 4LT7A 2W95A 2YPLD 3E3QC 3U6RA 2F0CA 2AK4E 4XPTL 3UTSB 1FORL 1LTJB 3FL7A 4G82A 1NBVL 4YHPA 1ID5I 2SEBA 4EE2A 5L2JB 5I1IL 2WQ8A 4FKKA 1FYTE 3X1GA 3MOBH 1NLDH 3EO9L 6PAZA 1QA9A 1KYAA 4KRLB 3LB6C 4KGLA 4LAJH 4PIBA 3BH8A 4NP4H 3SDAD 5KYWB 1KG0B 3WHE1 4WGKA 1AHWC 4FRWA 2CR0A 3UTSE 5BVPL 3NCMA 3BPNC 2R3SA 4B95C 3ULVE 3HI1A 2QTVA 1BD2D 1I8UA 3WD5H 3S8FB 4LP5A 1NGYA 5ADPL 1MN4A 2ZX9A 4XP1L 4XOEA 1NKRA 2HRPH 4X4MA 1M1KQ 3W2DL 1X5LA 3H3PL 1G5AA 4YSUA 4ANXA 1D5BA 2VABB 5IVXF 1USEA 1RY3A 2BRRH 3LAFA 2D8KA 1QQDB 3CZUB 2E56A 4K3DL 2BX5A 4KZCA 3B1TA 3APNA 3L48A 3U7WL 5I1EL 3I2CL 3ROLA 2WQYC 1CQYA 3CSGA 3S1KA 5IB2B 3IU3B 1YN7A 1J2JB 1P2CA 3SZ6A 2HT3C 2ICEB 1RZGA 4YGVB 4AH2B 4EO5A 4JBSA 4PRPD 3T09A 2YA1A 2HH0H 3QJHA 4G9DA 4EKJA 2R83A 1FC1A 2F5BL 2Y7NA 5DHXB 4UM9A 5SX5H 1UXWB 5EZIH 3D18A 1KBWA 4EEEA 2JIXB 5IF0B 3OSVA 2H2PC 3QJQB 5KZCD 1MDTA 4L23A 1LT9C 4L2YA 3VNZA 1L0QA 1UFUA 4YSRA 1MNUH 3AWFA 1I7UA 2D73A 2CO6A 2F8VA 1ZVSB 1NCTA 2PLTA 1UVQA 3FU9A 4PCYA 1USDA 1IGTA 5J9PA 2VLME 4UB8E 2KOGA 4MTMA 4CVZA 4F2MA 2VOTA 2C5DC 4M8VA 1TJMA 1ONQB 2XN9B 3DA0A 4P4KB 1JTPA 3QNZB 4TVPE 3VXUE 3RL0B 1KTRL 5J06A 1F90H 5DTFA 1E2ZA 3PV6A 4MA7H 5CXPA 3DBXA 4B50A 3MACL 3TNMA 1MCJA 2G2PA 2DQFA 2BS8A 3L73G 2P5ED 4PJIF 5SWZA 4Q6KA 3J8F7 1C08A 2ZZUT 3JXAA 4DHLA 4FADA 4Z7VF 1K4DB 1T5WB 4P3CL 5C08E 3BVNA 4HGKC 2MCAA 2G60H 4HUVA 2AQRA 3S97C 5HYJB 1CE6A 4JG9A 4NQCE 4K55A 1S9XB 1J11A 2H0JA 1CD9B 1SQBJ 3I50L 1A6AB 3N6YA 3N85L 3JWOC 4AWJC 4LLVB 5KAFE 1A5FH 1KCRL 5E4OA 3SDCA 5EHFA 3FOLB 3MACH 3FT9A 4HKBB 2DLIA 3DMMA 3VO0A 3LZRA 4L3CA 5I5JA 4FNSA 5I6KA 1KLGA 3WU1A 5B8CB 3BIKB 4KKQA 2WCPA 4RSYA 3TYFB 4HK3J 5LWYL 5F9WB 2YGOA 4UNIA 1Q38A 1N6UA 2GM4A 3B5ND 3DX2A 3NCJL 4WFGE 1R24B 2CR3A 1T4KA 2VWEE 2R69L 4MA3B 3U36A 3QZBA 1WZLA 5KTEL 1RHHB 3Q13A 1AJ7L 5BS0B 1TQWA 1DN0A 4YDIL 3ZW3A 4M61B 3Q2CA 1QASA 1QUNA 4L8DB 1DDHA 1FHGA 4TSBH 5D70L 3FB8A 4PJHF 3TEZA 2EDRA 3QG7H 3GKWH 3QULB 4HUXB 4J6RL 1JZ7A 3TEUA 2VQ4A 3IGUA 1TFPA 2Z7WA 2ZUYA 1MFCL 3NCYS 2CK0H 2PW2B 5ID1B 1I1CA 3CMGA 5L4JA 5D1ZA 3FQYA 2YXVA 4UV7H 3NPSB 2KI6A 2YXWA 4GOEA 2GJJA 5FYLH 3SD2A 2ZT9D 4J27A 4OQ1A 1LNUA 2A9BA 1HSBA 1JFQH 5H2BB 3CWBJ 5IVZB 4I0PA 1HGZA 2Y69B 5LJYH 4Z7NF 3G04A 1AZUA 4FFYL 3SGEH 2M1KA 5AD0B 4XWGH 4LE8A 1BOYA 2FL5A 3RWGA 4G5AA 2FEDC 3I9PA 4XC1H 4XNXL 3LB6D 1NFDE 1E2WA 3VRJB 5GS2H 5LHDA 3CU1A 2OI9B 4FQJL 2B7DT 5FHBH 1SJHA 1UHVA 1OP5K 1PNDA 2QT6A 3IN0A 5GGVH 3KPQB 3NJMA 1A65A 2Q3ZA 4GQ9L 1YQ2A 1ZT4B 3KLHC 3NCEB 4HIXH 3TA3A 5KVEE 1NL0L 1ORQB 2Y9ZA 2POHA 1BX2A 1CFTA 1XR9A 3EYOB 3MRCA 1MWAL 5KG9B 1ADWA 3GC3A 3T2LA 2P1JA 2VISB 3K2IA 5INCA 2HRGA 4UZUA 3U82B 1GGBH 2ICWI 5HYQA 3DX6B 2DQGH 5IROA 3IS1X 4HJIA 2V3EA 4L9LB 3OKDA 2BEZF 2DQEL 4LEOB 3RE0A 1TMCB 1IBGL 3RVWC 3B5GA 3IJSA 3D71A 1A02F 4JFQB 4H13C 2FH8A 2XBDA 4TQ8A 3UACA 2Y5TB 1LT9A 2DYSB 1URZA 3ARFB 3QXUA 2ADYA 1MVUA 4LOUD 3RFRA 5ABDE 5EUOA 3QNXB 3QFJE 4WI0B 3DMMC 3LKSB 1Q9LB 2XT1B 3P30H 3Q3GA 4JFUA 3TNUA 3UO1L 5F6IC 3AE9C 4BDVA 5F7HA 4FTVE 3IK2A 1FCGA 5D7JA 3RWGB 4QHUA 2ETWA 1ZE3C 5JO5B 5L88L 2J73A 2H9GB 2YRZA 5B38B 4OZHF 3HRZB 4BELD 3O41A 4GB9A 5IW6A 3RL1A 3LNIA 4U1LB 3WO3B 2X88A 1NOHA 1TZHB 3TOPA 4YHYB 3NH7H 4H44B 1MI5D 1J7VR 4KTGA 1S9XA 5HTSA 1KBKA 1CDIA 3L4XA 4N2NA 4FL4B 4A37A 3QXVA 4MRBA 4QOKD 4MYPA 3V2QA 3CHOA 4NZRL 4PD4J 3VXOB 1E5UI 4A7SA 3FTYA 1NMCB 4JDEA 4QTIH 1QATA 4X6CB 4L9LA 3W81A 4IU3A 3QZPA 4CSTA 5LKNA 3TWYA 4YFDB 3ZGHA 2I9LB 1LTSC 5IQNA 4YQXH 4Q7DA 1V54B 4PJEF 5C3LD 1EZLA 4F57H 2YWYA 1OVRA 2I5YH 2GITA 2F74A 4UI2A 3O6KL 1KMGA 1LO0L 1FL6A 5EA0H 4I1PA 3BP4B 1CIUA 1KACB 4V1DE 4WY7H 5T1MB 2UUDH 5MEQB 3I9AA 2WSFH 2DMHA 1A66A 5AVWB 3FAXA 1IC4L 1NANH 5J3HD 5AOZA 3PP4H 1EQ7A 2BXYA 1O5PA 4QHUB 5FECB 1KV4A 1R47A 3IJHB 3OHXB 4RWHA 4HZ1A 5HDWA 2ZOKA 3U4BH 1FE8H 3PNWA 4X5XA 4OSUH 1TJIL 4EOTA 3M91A 3Q5RA 1TZHA 4PWGA 3TPUA 4I0PB 4AQ1A 5KVGH 4G8IA 4GQRA 3ZDXB 2BCCJ 1BVNP 1KENH 3IAPA 3O6FB 3OG4B 4HS8L 3P2TA 2OA9A 5IFAL 3BVXA 3O6FD 4I0CC 1FFOB 4H26A 3PDOA 3LZFL 4NQXB 2WBWB 1QR4A 1WQVT 4LEBA 3GMLB 4ZUTB 3CX5D 5D8JL 1LP1B 3WUWA 1M05A 5E2WL 1FF5A 4D9QE 1KCSH 3DGGB 1KB5B 1FZEA 4JFDE 2ZP8A 4MJ5A 2ENSA 1EHKB 1YN6A 2H2PD 4H2CA 4PYHA 1AXTL 1XB3A 1EEYB 2AI0L 4P23B 3KNBB 3VI3E 3HAEB 2X9XA 5ISZE 3IXTA 4ZYKA 1ZSHA 2X4OB 4JDZB 4U6XB 5JW4N 5AKSA 1RV6X 1UACL 3DXAB 5DS2A 5F7EL 2AGJL 2Z91A 1KBGH 1Z3RA 2QSCH 2KZWA 3KH3A 3CFMA 4EI6A 1QFWL 1T20A 4LSQL 2Y0DA 4XXCA 4NJAH 5DK3A 1NKNA 2VDRL 5EOQH 2C4XA 5CIPA 4YC2B 3HC4H 2XWTB 3HMXH 4OV6F 3NAAH 4HAGA 1VF5C 2LLNA 2NUTB 5JR1H 1LMIA 4Q6IA 4D9LH 3EO0B 3ARPA 2XBTA 3OBAA 4AQ1B 4W80A 4G43B 2J6WA 3RWDA 4P9HC 5HVGB 2R4RL 4ZPTB 3VFMA 3QEQE 3NA9H 4HQQH 1I85C 1IEHA 4IFFA 2DQTH 3BESR 3E7JA 4FTDA 1TNMA 4G6KH 4NQXA 3E6HB 5DD0L 5IW1A 4W7ZA 4JZNB 4FAAB 5DMGD 2DLFL 1NUGA 3C6LB 2H9GA 3ILQC 4AITA 1WD8A 3MRKB 4LSTH 1SN5A 3W39B 5IB5B 3WJLC 1UWXK 4PR5B 2ZYHA 4PS4L 3A4FA 5EU3B 4R96A 1QA9B 4PCKA 4PH8A 4GQPH 1SP4A 1HQ4A 3S34L 3SE3A 4QRRD 3L7FB 1HJBA 1OAZH 3FF7A 5GRYA 5IEKB 1D9KD 3WEBA 5IJBC 4CPGA 1XGRA 1MY5A 3EOAA 5E03A 3REVB 4PS4H 4ZXBD 1FDOA 2GIMA 3CHRA 4LEXL 4AXWA 1UFGA 1XF2A 3C6SA 3HFML 1SLQA 2ZYDA 3MKKA 5CO1A 2GI7A 5TK4A 4MAUH 3NJNA 4M43H 1SHXA 4YSDA 4PW4A 3VH8A 1DJSA 5AYUH 1QWNA 3GBMH 3AT8A 3I84A 5FUZL 1PZQA 1Q90A 2A9CA 2YJLA 3DV6B 4MB3A 3VJ6A 5AFAA 5KSAD 4QRSB 3O6MH 1RZQA 2KS0A 3L3JA 2WNWA 5AVYB 1DQLL 2KZKA 3K0YA 3ARGA 4LLQB 5IK3A 1B6UA 1OT1A 3KPPA 3QIBB 5E8PB 2FE0A 2MCG1 3CX5J 4NNXB 4V2CB 2FXPA 4M3LA 1DLFH 4DESA 2NPSB 1O0VA 4FFVC 5EU7E 3H1LJ 3MR9B 4UM9B 4RAVA 4JKPL 4AL8H 2Q86A 1G6RL 4LLMB 5GSVB 2M5AB 2D7TL 3KAAA 3TT1H 3ISRA 1HI6B 1KN7A 3EYVB 3MLSH 3M88A 5FUOH 4J3XA 3V7AG 1UB5A 4MKMA 3B7UX 3OHXA 1EXIA 4W9IC 5TQ2L 2V17L 1CXIA 3FTXA 4I0KA 4WI7A 3KHQA 2Y6TE 3R8QA 2ED7A 3IDXL 1E8XA 4LPUA 1UURA 3MUDA 2Y07H 3CN4A 3M1OA 5ISZB 2G75A 3KPEA 2VLJD 3LEXB 5KJ7D 4HWNA 4PRHA 4U4IA 5SWQA 4LRNH 3NCYP 1I3RA 3MHZA 4JG0H 4OR1A 5KANG 4M7JL 1BIHA 3RGVD 4H1LH 5IVNA 2IH8A 2QZQA 4PJCA 4J2XA 1JRHL 5JXEC 2X89D 1X5XA 2C0XA 3S3SA 4Y4FA 4ZFOB 4A2LA 4EKXA 1VQ8P 1YJDL 3ARBB 3R18A 4ZFOL 5EULV 1BGXL 2X28A 1IGYB 1BVLA 3FFCA 3ARBD 3LEYL 5HSFA 1IKOP 3TA3D 2ZWZA 1KYOJ 3OKLA 3QUXD 2V7NB 5KS9A 3OZKA 1K8IB 3F89A 1TEYA 2NY4B 3HKZA 1ZT1A 4Q14A 4RLDA 4BH7B 3ZDXE 4J7RA 1BGYG 1LYQA 5E95B 1S3KL 4C56E 3U4BL 2W60A 2OYLA 2BIHA 4O5LH 3V9CA 1TFHA 3TBWA 4X8CA 5IMLA 2I24N 2PRRA 1D5BB 1UYWH 3C08H 3F7LA 4H25A 5IQLA 1Y6KR 4UDUA 1XZWA 4UQ2B 5EUOF 3UFIA 3IMSA 5DEFB 3VTAA 4AQAA 5AL8A 4WAFA 3B5NB 1DJZA 2HKHH 4BWUA 1INEL 2FECI 4OCYH 2FO1A 5IEHB 5TF1L 4ASWA 5GS2D 4ZQTA 4U1JA 4MD5A 1JFHA 5AB2A 4MBRA 4R26L 4FA6A 3AECC 1DQLH 1XIWC 4IRSA 2P58A 4F15B 1Y07A 3QARA 1WFOA 3QW9A 1F6LL 3PJSK 3I9IA 4FL4C 3T8VA 2G0LA 5SV3A 1BBDL 4WI4A 1S7VA 4RQQB 1UOKA 4DZOA 5C3TA 4F92B 2IDFA 2FLRT 1IT9H 4ZO9A 5TD4A 4CVUA 1YYLL 2IOIA 2ZKMX 3ZHDA 5FWRA 3EFOA 2Z0UA 4LEXH 1L6XA 1I1AC 2GTZA 1L9MA 1Q4NX 3FTVA 2C1OA 3P4OA 1JP5A 2XNAA 3OMAB 3UJJH 1JGEA 1DBML 4JJ5A 4MAYB 4XO4A 5B7EA 3JYBA 4B96A 5CU5A 4AEFA 4G1MB 3LH2L 2HP4A 3CZFA 3D6YA 2Y06L 1WBZB 5E9NA 4NKMB 1EZVI 3D8MA 5AOKA 4FFZA 1KWKA 4EI5C 5AL0A 1HWWA 3EJJX 1CTNA 4YN3A 5JW5A 2BY1A 1FGVH 2DIEA 2VIRA 1PFIA 2XIIA 3M07A 4AT6B 4ZDHA 2XBZA 3V6ZB 3GMOA 1CD0A 1QNIA 2A6KB 2Y1ZA 4NM8L 2CGRL 4JR9L 5A2FA 3VGEA 3IFNL 4XH2A 3SDCC 1TVDA 1TCMA 3DTXB 4HGWA 3ZDZB 1QBLH 1F2XK 4APQD 3FQRA 3ZTCC 1FBIH 1MIEH 5KG9A 1EAOA 4G6JH 2FZ3A 3TN0D 1BZ8A 1TT6A 2DY2A 4MMYA 5ANMA 4EPSA 1J5HA 4KKCC 2PR4L 2PP8A 1G7JA 1EDQA 3COOA 3DJTA 5DD5H 3ABVC 1S8DA 2FIKA 1BW8A 2VDOL 4I0PC 3T8XB 4NPKA 3IGKA 2A77H 3VFUA 3S6CA 4I5BB 1I82A 4MWFA 2Q10A 2VW7A 4OM1H 4ADIA 1GC1L 3IRPX 5E5RB 5EBLB 5CMZA 1WJ3A 3DVIA 2NY2D 2NNCA 3AGWA 2ZCLH 4B3VA 4L8SC 1NH4A 1RZKC 1UD8A 2VDLH 3GMNA 4FQXB 4JRXA 4LEEA 3GEWB 3HI5H 3D39A 3WN5B 1OGAA 3D39D 4WVZA 3HR5A 1GZQB 1J5OH 3AY4C 3MROB 4KDWA 4OZ4A 4AJWA 1NIEA 3EYUH 3HS0A 3IWUA 3IN6A 1ZXQA 2Y1VA 2B4CL 1NGQH 3PL6A 2DJMA 3L3IA 4LCIH 2J2ZA 4QRUB 1ZK5A 5HDOA 3ZDYE 4L8BB 2WWOA 4M4RA 5DR5L 5LDUA 4OI8A 2OTUB 2CM5A 3V0FA 3GBNH 3QUYD 1WZKA 1J9QA 1E0OB 2IGTA 3QDME 3EHBC 4TYUA 1DJHA 3RL2A 1KIQA 4X99A 4P2RA 1XF4A 4AYMC 1A6TB 3KGSA 5DURB 4GIOA 5EU7C 5I1GH 1BCCG 3NTNA 1KCUH 1NKZB 2WWKT 3AEDC 1IM9D 2OTLP 1ECYA 5FM8A 3F01A 4X4YA 4QRPA 1J1EB 1BXXA 4GUQA 3L70E 1CPUA 1S9WB 3JBG7 1XF5B 3GRWH 2CALA 2X4SA 4U1NA 5EOCL 5I0DA 2OAAA 1WIOA 1AVYA 4XNMA 2P80A 3FB5B 4TNVK 4N22A 1RJYA 4L8CB 1AHMA 2AXGA 1Q81Q 2W83C 1F02I 3RVTC 1JK8A 2EDLA 4OTXL 3WKML 4JGNA 1NJ9B 4A2DA 1EANA 1NC4A 1OY3B 2C8NA 5EBLA 2BSRB 1KJVA 1KTJA 4JN1L 1GGYA 4NC1E 1AO7A 4QT5A 3U9WA 3LXBA 1NSNH 3KWWA 5D7LD 3G5YB 1MFEH 4ETQA 2NPSA 1NKGA 1JVKA 2CQVA 4OV5B 1ITCA 4A38A 2AXTH 2V9QA 1B0WA 2Q2LA 4PUBL 4FP8L 2YXMA 5I26A 4MNHB 1P5VB 1OAQH 2QSIA 1TVBA 1WBYB 3ABKB 3DIVA 4FMKA 4WEBH 3RU8H 2N9BA 3PFQA 3UAJA 4WW2A 1IKFL 3D9AH 1L9QA 3KPRA 3JWDL 4K3JH 1NTZG 2QIWA 2QGEA 5T33L 3EJSA 2F5AH 3EJUA 5JORB 5CFAA 2G5BB 3U2SB 1IM3D 4J3OF 4RVBA 5ESQB 4LSSL 1AD9B 3KWTA 4IOSA 4FQLH 3K4ZA 3UTSD 2Q8BH 1HVXA 2QL1A 2HXAA 4HXBL 4WU7B 4JY4A 3SKUD 3OKMA 1SQBE 1KXVC 5KSAA 2OYKA 5D5MF 2D9CA 5CSGA 1SJXA 4XMZA 5E6SB 1X79B 1WS7A 4XBPB 2Z3FA 1BVKA 4M1GH 3R1GL 1YNTB 2A1WL 3STLB 2D9QB 3T2NH 3JV5A 1N8RQ 3LS5H 2CCLA 4KUZH 4KPHL 2NRGA 1JPEA 1G9NC 2NY4D 5E8NA 4DPAX 2WXPA 1YAZA 4L29B 4P3WA 1Q1PA 3BZEA 3X13A 2OYIB 5K39A 2EECA 3OD3A 5JPNC 3X12B 3IFLH 3DHUA 5ERWB 2DD8L 4JRWA 1ZT1B 5GZOC 4JG5A 4PJAF 4ZTOH 1E5WA 2VZUA 3FFCD 5GISH 1BJ1J 3ARUA 2WSDA 3CLEH 3KL3A 3O8XD 4PTUA 5CJ0A 5KSVB 3DK2A 4BKTC 1CFNB 2OMWB 4CN4A 3E8UH 4GPVA 2OLDA 1WGVA 3HI5L 5APQA 4GRWB 3DOSA 4PY7B 1L0LD 2CIKA 1MNUL 2QELA 2X4UA 3HHMA 2EH8L 4LU5L 1RK1A 2F18A 1DEEG 3SWYA 2Z7ZA 3VFUB 5I30L 3A6BL 4H8UA 3RFZB 4BRYA 1ACXA 2AK1L 5AAPA 2EKSB 2OMUA 1KYOE 5L2KE 1QBBA 1Z3GL 1JY3O 4UANA 1M8OB 1I3UA 1T1YB 3BW9A 2P7TA 1GGBL 4HXAH 3UTQA 4UB0L 2EEFA 1VGEH 1R6VA 3OMIB 1ZAGA 3RDTD 5CD3A 4UT6H 5CJQH 3VDCA 2BNQE 2VNCA 5JDJA 1ND0B 2H1XA 2Z93B 1XH0A 1TYJA 5AKVA 1GOGA 3PHLA 3F00A 1JY3P 2HWZL 2O3JA 5IB3A 5JW4R 4BZ2H 4DPCX 5E1GA 2XRAH 1U8QA 4APXB 4YS4A 4R4BA 3STLA 2E6QA 4KVCL 3LRSB 3MUHL 3TV3L 3O3EB 3H3PH 4BWWA 5C9JA 4EN3D 1SQQJ 4WHYG 5FCUL 1N6QH 3TL5A 3AQZA 3GGWA 4J3WA 2IQAB 4Q9QL 5EOTB 4OW6A 3QEQA 4BK5C 4PJ8D 3NEEA 2Z9TA 4XP5H 1P6WA 4DGYH 3QEGH 4H0GA 3DDGA 5B1JA 5C3IA 4BA0A 4F2EA 3SCMD 2EYRB 3KXDA 1IFGA 2H41A 2XN0A 1KIUB 4ZXBB 4JGUA 3RK2C 1TUPA 4LASL 3F12A 4ANVA 4N8CL 3WUUA 1WP6A 1XGUB 5B3JF 4EF3A 4NLHA 1EDKA 3P3UA 4AMKL 3ZKXC 2DIBA 4WK2B 2NZ9D 2X2YA 3HUJF 4JQIA 1HNFA 5FA4B 1U2HA 1ZA6B 2K70A 4R2GD 3RWHB 1HILB 2AQPA 2Q20A 4N1CA 3GKWL 4WI9A 1T4WA 1IK9A 1BCIA 3QHFL 1OTTC 2AV1B 4PJIB 2O93L 3IDYC 5I6NA 4Z1MH 1CFMA 3FB6A 4ELME 1RUAH 3CDYA 1SPDA 1Q1JH 2R39A 2ZSWA 4XO9A 4CNIB 1AOZA 5E8PA 1SDDA 1BFSA 2FBJH 2NT0A 3ARRA 2WP3O 5E1IA 3IS0X 3WNKA 3ZZLA 4DTGL 4WWKC 5F93C 1IC7L 5DSCB 1RQ5A 3HVDA 2DL9A 3F2LA 1BQLL 4R4FL 3EYQC 4U1GC 3UH8A 1ZHBB 4DF9A 1T20B 3AE5C 1YY9C 3DK0A 3MFFB 4D0CB 1IGTB 3DJSA 3SY6A 3VWKD 5HHOA 5J9PB 1U91A 3D0VA 2H88C 2VKXA 4Z0XB 1X6NA 5C2BL 1O9VA 3OKMB 5JHDB 3DX0A 3VFTB 1W8NA 5LCVL 4NC1C 4F7TB 3S7GA 3ULUL 2K4WA 4P2RB 5EBWA 4F58L 4LNVA 2BERA 3BPCB 2XN1A 3WNNA 1I3RB 5TDOA 4JEGB 2GJZA 4PBVC 3N91A 3PWPB 4HWZB 1XR8B 3DUSB 3MRJA 3VVWA 1E5AA 4K7PY 4OZFH 4QYAA 1RJLB 4NZFA 3D69A 3Q8AA 3P11H 1SFCD 3OAUH 1MFMA 2XTLA 1U33A 1IFJA 2Y3AA 2EEXA 3QT2A 4P2YA 1RH5B 3ULVC 2CO4A 1E9PB 4H8HA 1QEWA 4DZ8A 4R7NA 1JTTA 4JM2A 3L75D 2E7DA 3BRVB 2IFNA 1F41A 2ATKA 1OWAA 3RRQA 1RE4A 3X1NA 3IVKB 2AQ1A 2FRGP 2VDQH 1JYWA 5JXAL 4JB9H 2QGCA 5FYKE 5CR1A 2ESVB 3MTUE 5GIRB 3V8CA 2JKWA 4ADGA 1K5WA 4UOJA 1NIBA 4U6HA 3NA4A 4PSRA 5FFGA 1IAKB 3SO3C 1G6VK 4OV5A 4JQIL 3OHXC 1T0NB 3MYJA 1TQCC 1QSEB 5AWNH 5IEHA 2I7SA 1OT2A 1FFTB 2XTJB 3O45B 3WIAA 4HUXA 3GZOA 1U8PB 2P9RA 3ATBA 1ZR2A 2NY2C 4I2XA 5JXEA 1TYEB 1D7FA 1FJPA