5AVSB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 3.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avsB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avsB02
3IR9A 5APSA 3VN0A 1T2KC 3P32A 3A5TA 3LIDA 2YO3A 2XV5A 3TK1A 1MFZA 3VMZA 3HTKA 2WTYA 2E42A 1H88A 2Q5UA 3A3YB 1KQLA 2QM8A 5AW2B 1GU5A 1NWQA 1SLQA 1SP4A 1T2KD 5CMZA 2WPRA 5APWA 4AYCA 1CZQA 2H7HA 3M0DA 3KQGA 2IPPA 2WWWA 3HE5A 3MGNA 5AVYB 3V4WA 1A02J 5AVZB 4HYTB 1CI6B 3VYIA 1GD2E 5APYA 3B8EB 2XU6A 2Z5IA 2W6AA 3WGUB 1JNMA 5AVSB 1S9KD 3L37A 4C7NB 2E43A 3UIAA 2WT7A 5APXA 3M91A 5AVXB 4AQRD 4RETB 1DH3A 5AVQB 1GK6A 2ZFCA 3WGVB 2YO2A 3NFQA 5AVWB 2Q7CA 3TNUB 1A02F 2P7JA 4EOTA 1NAFA 5AW7B 4KHXA 5AW5B 1FAVA 3VMYA 5AW1B 3V4QA 1H8AA 1CSBA 4M3LA 1CI6A 5AVTB 3TYYA 1MUUA 1FOSE 1HJBA 5AVUB 2JJLA 5APUA 2R32A 5AVRB 3O8ZA 3M9HA 3HE4B 5AVVB 3MD0A 2N9BA 2VRSA 3L35A 1X8YA 1GZLA 1J2JB 3M0AA 5AW9B 1FOSF 3TNUA 5APQA 3M9BA 1HUCA 3LIEA 1JUNA 1OXZA 3KDPB 1YYCA 4JYBA 2W27A 2P2UA 4XE5B 5AW0B 3A7OA 3P8MC 5APVA 3T97A 4B86A 2C9LY 2Z5HA 2BASA 1GTWA 4DZOA 1GK4A 2ZXEB 1HBWA 3HE4A 3A2AA 2XZRA 3I5CA 3V5BA 5AW8B 3OAKA 2R3CA 2YNYA 4C7NA 4GKGA 5AW6B 2WT7B 2Q3IA 1G2CB 4GT1A 3VMXA 3M06A 4AUWA 2P67A 2R5BA 2C9NY 3NXSA 1S9KE 3NMDA 5AW3B 2KP8A 5APTA 1H89A 1OWAA 2WPSA 3NTNA 3VTPC 4C46A 4JYCA 1HWTC 4LC1A 1IO4A 3P7KA 3HE5B 1GU4A 3SWFA 4RESB 2R5DA 5AW4B 4I2LC 4I6MC 2QM7A 1MV8A 2WPQA 3L36A
chains in the Genus database with same CATH superfamily
2ADGA 2WXFA 1G9HA 1NL0H 3EDFA 3EGSB 2YO3A 3KH4A 4OUOA 3DNKA 3CLFL 4KK8D 2A2QT 5JYLA 1J05A 4D9RD 2VTFA 1LE5A 3KPQB 3AE9C 1I9IH 2H1PH 4XNZC 1GZHC 4Y2LA 2Q5UA 2DWXA 1MFCL 4MDJB 4O02A 4BUQA 1R0AH 5J56B 4ZSOE 1JVLA 1HS6A 1KCSL 1KGXA 2QQKH 4QXUH 5F7WC 3JUYA 4H8PA 4LOVA 4JO5A 4OGYH 3U7YH 4ANUA 3RY5A 3ZQ9A 5IJBC 4BZ1H 2RA1A 1A6TA 1ZV2A 3LZNA 1VHPA 5DHYB 3T1FA 2WN3A 3UG3A 3M8OH 4AQZA 4B9FA 5I5IA 2NTFB 3VI4B 1KG0A 2X4PB 4MZ2A 4PREB 4X4MA 3DSFH 2XA8L 3TJEH 2YMOA 4G43A 4JFFD 4ZUTB 2GSGA 4FF9A 5J1AA 2WT7A 3W0WD 2ITEA 4GQ9L 3MJ9A 4G9DB 2VZ3A 2GTQA 2KUTA 4XAWL 1RIHH 2CO7B 2R9HC 3RNQA 2YO2A 3ALWA 4GBXC 1LYQA 2V7QJ 5FFLA 2M83A 4NM4H 2ZCKH 1I9RH 3V5KA 1G94A 5DSCB 5LGYA 2WXNA 4PJIA 1DCLA 3F7RA 3ESPA 5ICUA 1CGWA 4D6TG 3BT0A 4U1LA 3TYYA 3HR5B 3RLSA 4PI0A 1KBGH 4LDLB 3QORC 4RGNC 3N43B 4Q97A 5B8CB 4U7MA 3TV3H 1MRCH 1SJXA 5D2NE 4FZ8H 1GZLA 1FHNA 3HD7A 3EUDA 3VFMB 3NABL 3LW5H 1L9NA 5BRPA 4RIRB 2BSBA 2G3XA 3VYPA 5DMIL 4KZ0A 3G5YB 1A6UL 1PG7X 3ZKXC 3VA6A 4E9RA 3N91A 4FN0A 2VXUL 1R3LA 2B87B 3U1SL 5CGMA 3LZLA 1URQC 4XPTH 3IB4A 2AQSA 5M1BA 5EF2A 4HOWA 1XXFC 5KBMA 3L3JB 1IC0A 4DK3A 3IDIA 1MAMH 1Z66A 1FZOA 2CLZA 3Q1MA 4P2RA 3ZOAA 4LGPB 1Z9SB 1BX2B 4Z3JA 2UV3A 4PJXE 1LP1A 1XIWD 4JO3L 4PS3A 1UKTA 1E5UI 3IDGA 1QO3B 3AJ7A 1BV8A 3FX0A 4UB0L 1U8KA 1SMOA 1QUNB 2Q76A 3EFDH 1AHMA 1UG9A 2VZTA 4G8EA 2XNXA 5GHWL 2JKTM 5D2LA 4LKXA 4QRPD 2NDGA 2ZKMX 1LP9A 2F7RA 1MXGA 1E30A 4ALAH 1J0YA 4RWHA 2BLFA 3TCTA 2YPLD 1I8KA 3DMMC 1E4WH 3ABVC 4PGCA 5CJXC 5IROD 5EU6B 5C97A 4WW2A 5DFVC 3PGDA 3HB3C 1MN4A 1ZOYC 5MHSD 2PP7A 2XXGA 4IBYA 1EZUA 3BKML 4K5PA 1NEUA 4KHTL 2AQNA 1BF5A 4GG8A 2DV6A 3OKOB 4WI9A 4WHYG 4JJHA 3RY6A 1JP5A 2J6EA 5ITFA 3VJ6A 1RK0B 1T7ZA 1JN6B 2VW4A 3VI3A 3P4NA 5F0LB 3KPTA 5AAMC 1PZDA 1S3JA 2G75A 1T2XA 4KX9A 3HZYB 2H8PB 5B3NA 3RTQC 2AQ3A 4NFCA 3T6VA 4UM9D 5DJ6A 1JGLH 4FLRA 4N8CL 2KYVA 2X7LB 1I82A 2N0MA 3FCSB 4GQRA 3MRPA 3QEQA 1IFMA 3L3HA 1KPUB 1E2ZA 3LZFH 3M17B 4XPAH 1XGQB 2B4CH 1HK6A 2CGRL 3AUWB 3IFNL 2GJ6A 5DUBB 3GEWB 4L9LA 4UU9A 3QO0B 5CKGA 1N7MH 4S1RL 4FTVA 5K39A 2YN5A 1ZHKA 1JGDB 3H1HE 2AI0H 2YD6A 2A0LC 2N7SA 4ZFFA 3IGUA 4L3FA 4I7ZC 2IOOA 5TFSH 1KXTB 5AW7B 4HK0B 4P57A 3J8F7 1C12B 3VFSB 4KXDA 3UDWC 4JBSA 5D71L 4HIJA 5C0CB 2HYNA 3CU7A 1H8AA 1U8JB 2E27L 3HAEA 3MLZL 4WTZA 4YDKL 4C56D 4JO2L 1F6AA 1P7KB 3QZWG 3QQ9D 4DFHA 3C60B 4BSJA 3IN2A 1PG7W 4M7LL 1KCUL 2N3JA 3UABA 1JCVA 3HLAA 2WKLA 4OKVA 3D8MA 4XOAA 7FABL 1PD6A 2B7DT 3APDA 2V9QA 1P7QB 3MR9B 2AABL 1VSCA 1EGJH 5FO7A 1NMCC 3PQYD 3NSJA 4D8OA 5LAXA 1PG7L 5CZKA 1WAEA 3VQ2C 5M94B 3QJTB 1ZEAH 3QPXL 3JCUE 4IOSD 3WNLA 1W8OA 4BZYA 3BMWA 3A0OA 4OF7A 3ULVF 1UD2A 5GGTH 3EYQD 4WY4D 3S5LB 3RX5A 1KULA 5JOFB 2Y7OA 3MV8A 3P3YA 2X40A 3A2AA 1KXVC 4XWOD 5C3TA 3TO4B 4B3VA 1XBRA 4G8GD 3L71J 5C08A 1OT4A 4UNTA 1JXJA 3PAYA 1BGXH 2V3EA 1O6SB 1LT9C 2G5RA 1OKEA 1HINH 1R5VA 3CIQA 3ROLA 5T33L 1OD7A 5ACLA 2XJLA 3ZE2E 4ZO9A 3MRRA 4UZSA 3GHGC 5DEFA 5C6TL 1ESOA 4XP5H 2K7QA 4OVUA 5EF1A 1KBVA 3US1A 2QJPC 4PJ9B 3UXFA 1OO2A 1RUKL 2LE9A 1GPOH 4XBEH 3OAWA 1NCUA 1EJ6A 1N0XH 2VR5A 3VN0A 1EZVD 1SQBE 1XZ0B 3PHOA 4JANB 5KSBA 2F8IA 1XF3B 3K1DA 1BJ1H 3B3BA 4ODUA 2UX7A 3NN8B 3FU8A 4S2SA 4BZ2A 1C5BH 5E5MA 3B5NB 3VWJC 2AK4E 2H5UA 4FYSA 4XH2B 3CX5J 3MGAA 3L4FA 4OCMC 4U7SA 3Q6FA 4A1RA 4QOKD 3VFRB 3CC5A 1VQOP 1HFUA 3I9AA 1C16B 3ZDMA 2HX7A 1L0LE 2EJ1A 4KDVA 4GUOA 1CR9H 1X44A 1L0NK 1FNHA 3BYYA 2X3AA 4O9HH 4OLUL 2V5TA 4JF7A 5AB0A 3WFBL 2BVOA 5KS9B 4Z7VA 4KVPA 5KUMA 4P04A 1TZIB 3QVAA 1OP3H 3TU6A 4N68A 5K93A 3MNWB 4YHKH 3SDAD 3TV8A 5F9WB 4C7RA 2NXZC 2VXSL 4MMZC 5HI3C 1X6NA 2D7NA 2HFGH 4KK6D 1PX4A 3BO8A 4YGVA 2FLMA 2IBZY 3HRZA 3QA3B 4KHXA 4POZD 3FQXB 4HKBA 2FFDA 1KZQA 4AITA 3BH4A 4MJ5A 4UQIM 1PZBA 5BVPH 5IIEB 3NPZB 2BNRE 5B39B 1BW8A 3V6IA 1FC2D 1JV2B 2IIJA 4IIZA 2B1AH 1PX8A 3GGWA 4CU6A 5EU4B 2NCEA 1KYDA 2XN0A 3HMWL 1G9ML 1X5JA 4DPBX 4H0LB 1A6AA 3ES6A 1GAFH 4JRYB 1SFHA 1CDGA 3VWKA 1F5WA 1N12A 2PWFA 4UT6A 1B4JL 4AQ8C 1A7OH 1QBLH 2BHZA 3Q1EA 1NCDH 2WB7A 3SY0A 3CPWO 1X5LA 3DTXA 3N55A 3KDPB 3NA9H 2VH5L 3S5ZA 1IBFA 1ED3B 4CL7A 5GRJH 3IJ7A 1PSKH 4K23L 4YPCA 4Z7NE 1ZK9A 3W82A 3VFPB 4TUKL 5DA4A 1INQB 2NR6A 4O2EA 1AIFB 2XQ0A 2KNCB 4OD2A 1TZHB 2ZYAA 2FYYB 1U8IA 1MI5D 4HFWA 4I9WD 1J9QA 3HC4L 4OCSL 1ZMEC 5IM7B 3ZMRA 1A4JB 4KJPC 2V5SA 2R5BA 1ZDSA 1ZJBA 5CCHA 1LO2H 2NX5A 2VDQL 3H0TA 3BVWA 1V10A 2AW2A 5D9SA 2UX6A 1NBYB 4EOWH 2DL2A 2RH0A 3P4MB 1HSBA 3SWYA 2IXQB 4JFDB 2IFGA 2R51A 3LHPH 2FGWH 1UVQA 4OH8B 2B20A 1ZGLM 1GGCH 2Y9YA 4DP7X 1UJ3C 2QJKB 5T1KA 5FYLH 4AYGA 3ELQA 4X9FA 1L9SA 3F65A 4PV8A 5CXPA 1AAJA 4I89A 3MJ8B 2E47A 5DJ0A 4MWFB 1L4AB 2CNZA 1CYWA 4LPTA 5D70H 1MFZA 1IGCL 2DMKA 1BPVA 3H1JE 5ACZA 3CD6P 1I7TA 4MMYB 3CH8A 1FFPB 2P80D 5CHNA 5E56A 4ELMB 4RGMC 3KNBA 5F88A 2IFNA 3ZPDA 1PW3A 1WFOA 3GSVB 4UAOB 4DP6X 3IJEB 5J11C 4YXKL 4X99B 4HBCL 3KBEA 2KXPB 3KXFB 4KKNA 4WUKH 5CJQL 3T6ZA 4I1RA 5J06A 2Z7UA 4ATTA 3DKHA 3WHXA 3VYOA 4DP2X 5T5NG 5EBWA 5KVEH 2Z5IA 2FLRT 3LN5A 1KENL 2SPZA 2WSFH 2NUTB 4HWNA 5E8EB 2WLIB 4HB1A 2OI9C 5K59E 3NJXA 2Z8SA 4N90E 1S7SA 4K9EC 3CDCA 4JPIA 2EXWD 1T22B 2CBTA 1YEJH 3RWFA 4ZMTA 3CWBE 2P5WE 1H6FA 2GBVA 3I9GL 1Z32X 5JHDD 2ICWJ 4W9IC 2NY2D 4DAGL 5EN2A 4P0DA 2V2TB 4L5FL 3PHLA 1GDTA 3C08L 4RMWA 4G82A 3MLUH 4MHHI 3HKZA 1RFDH 3U30C 1YEDA 5DZLA 4AMWA 2YSSB 4IRZL 4WWKA 2KK7A 2CKBH 3F85A 4LCWA 2IYOA 1T5KA 3G9AB 2OMWB 1JUFB 2DY2A 3CXHH 1ZLUK 4G83A 1OMIA 4YEEA 4KZDH 1FSKB 3G6JF 1I1RA 1QRND 3M9BA 3BSZA 3L54A 5D7LB 4FI7A 2PCPA 4M3JA 3ABKB 3BRFA 1MREH 5ADOH 3CU1A 2JI1A 4OQTA 5A6MA 5BVJB 2WINB 2NNRA 2E74D 3MV9E 4CADB 1XZWA 1CF8H 1BLNA 3BOVA 4U1KB 1MCEA 2J1KA 5EZIH 3EDKA 5EUOF 5SX5K 1MCKA 1GL2C 2DLFL 4TM9A 3MNDA 2EUZA 3PDGA 3IDXL 2DLHA 1L6ZA 4KX7A 3UC2A 2CKBB 4DUXA 1N7LA 2P8MA 3L48A 1J8RA 4JKPL 1BMGA 3G6AB 3ARGB 3WUTA 4OIIL 2CU9A 4R90H 2COVD 3HOGA 2N56A 3THMH 3NTNA 4C46A 3ZYIA 4APQB 4HUWB 3M1OA 4XNUH 1SQQD 4L3CB 3FB8A 5KVGL 2I5YH 4M8UA 3MTRA 1LO4H 1AHWA 1JPTL 5K5GB 1MNUL 3KBFA 3KGRA 3S8WA 4JVWA 1PX3A 4RA3A 3HBGA 1OAYH 5F9JB 5KKZB 4JUSA 4XWGL 2YKQA 4PJ5A 1WWAX 1G6VK 1N7SC 3F7YA 3DYPA 3INUH 5HD8D 1YEFL 3BRTB 4ZJ9A 2WVVA 5TGBB 3IKKA 2BRRL 4Z77B 5AW2B 1UHVA 3V52L 4QF1A 2NT0A 4NFBA 4NM8L 5CU9A 1J1PH 5BZWA 3L3IA 3QWQB 3L70G 2GUVA 1PKQB 1FGNH 3NIGF 2V17L 1IKNC 1BOYA 4IRSB 4D8PA 4PJCB 1YEGH 4TLUA 1NKZB 4Z7UA 3RA7H 4RFNB 3FFCB 4ACTA 1RZ8B 4C57C 4PRIA 1ZT4B 3HUSB 1HXMB 5SV4A 4CN6A 5E70A 4KAQL 5GGRB 3I56P 2PO6B 4XB7A 4M6NH 1F00I 5ADPL 4F92B 1BQLL 1UM5H 2QQLH 3DX4A 2XJKA 2W9DH 5DD1L 4KROD 1YEKH 1AR1C 2FBRA 2O5YL 4L8BB 4PB0H 1YYMH 4W7YA 5FWRA 4M4RB 3G08A 3T2NL 1SFCC 2FJHA 1GSKA 2VDKL 2HUEA 2CCVA 2BCMA 2EO1A 4GI6A 2W91A 4GT7A 4L0YA 2P5EA 4K5OA 3BFQG 4H44B 5C0EB 1JRHL 4N3UA 3SDCD 4P2RE 2C0WA 2F53A 3HI6H 4KKCC 2LABA 5E1GA 1U3HD 2YRPA 3KEDA 3LZRA 1KN2L 1X5HA 1YN6B 3ZN6A 1JHKL 2J56A 4L37A 1E2WA 4PB9L 4PTTB 5E79E 3WEXA 4BUGA 4G3YL 3ARDD 5IW3A 2C3XA 4R7LA 5L6YH 4EDXB 3L95A 2DQJL 2F5AL 4XP4H 4YE0A 5D2LE 3ROOB 2AXHA 5F7UA 2HRGA 3NJFA 3BP5B 2WP3O 4H8UA 1MCBA 1QSEE 3PFQA 4XO8A 4M7LT 3RKDD 4DEWA 4X6DB 2ERJB 2QQQA 5HGBB 4TRPL 2LVEA 3FZUC 2P58A 5MI0B 3PHQB 4M7JL 4FKKA 1ZTMA 2ADFL 5DD6B 2H0EA 1NFKA 3V6FA 4W9KC 1JZEA 4AM0B 5ICYB 3QUYB 4JQ0D 4C54A 4Z78A 1TZAA 1JCKA 3VI3E 5K9KA 3PPEA 3SBQA 2J1YA 3FULA 4KU1A 1HXKA 4GW4B 5I0ZA 3TNNB 2BY1A 1XL4A 2IBGA 5F7HA 4XCYA 4Z3IA 2YGVA 3VMOA 1BQUA 1J05B 1L0XA 2OJZH 3U1QA 2G4GA 5CBAB 2O6CA 4AUJA 3NSCA 2GABA 3QEQE 3ZRCC 3CHPA 1D7DA 3DX1A 4AVKA 5CN3A 4XCFL 3GLEA 4GRMA 1DVXA 3GUTB 2TRHA 4HG4K 5I1IL 1A6TB 1ICTA 1RQVA 2WXHA 5KOVC 2VDMH 3T1FB 3B2DC 3O8XB 3DOHA 1J5OH 2ZE0A 4LCIH 1KG0B 1U8MA 1T2KC 3GZQA 4OB5L 3M7OA 1NMBL 4OZIA 4JFVA 5J1AB 2GSGB 3EJTA 5F7EH 4BH8A 5GSRA 1H0TA 3HTKA 3K7UA 3QXWA 5KYXA 2IPUG 3RNQB 1JV5A 1O7VA 3S36X 4GXFA 4B9KC 2YUZA 5CMZA 1N0LA 1ZP0C 2AEJA 2R56H 3BZDA 4I3GA 1SVCP 1S7XA 1XF2A 3HEIB 4N24A 5DGQA 3V5KB 5L8LB 3D3VB 4G59C 1CDIA 4WNJA 4KMTH 4PJIB 4DQOL 1NTZG 1CICD 3NOIA 3QJUB 3N7NA 1F58L 2N1TA 4JMNA 4LEBA 2YIHA 4P3DB 2KSJA 2A6KB 1HWGB 3VXNA 4NP4L 2VDRL 5AG8A 4NPDA 3DVIA 5DD3H 1OQOA 4JZJA 5CBEA 1E6JL 3GBNH 2VDMB 1WUZA 2JWYA 4G11A 4O2FA 3LZQA 4NKOA 1CK0L 4NP9A 1GHFH 3RDJA 2VM9A 1TTUA 3PL6D 2XKSA 4CVXA 1V7NL 1SM3H 2BIMA 4YQXH 4TSCL 2NY0D 3KYKH 2VRAA 4LCCC 3UPCA 2ROXA 4PRHA 3IDIB 4J3XA 4YPGA 2ZXGA 2CLZB 3GJEA 1I3UA 5C08E 1DLHB 3JT2A 3WNMA 4PMFA 3OB0K 1H3TA 1LP1B 2J6EH 4Y16D 5FECA 3IDGB 3WN6A 1SBBA 1NJ9A 5C0DA 3PJSA 5I26A 1U8KB 3HA0A 3WHE0 2Q76B 1SJEA 3LH9A 1OZUA 2F61A 2OYIA 3HE7D 4G8EB 1OXZA 1BHGA 3FN9A 3KPNA 1VFOA 3BT2H 1LP9B 5AW0B 4S1SH 1MW0A 2XCMC 2JKJA 1G1OA 3WIIH 1EFQA 1I8KB 2KSEA 1ACZA 1J0ZA 3STZA 3KVPA 3TN0C 3AM8A 5KSBE 3PGDB 5HYJD 3MFGB 1T4KA 5SV3A 4UM9A 1NIAA 2RTTA 1KCBA 4NKIH 2EIBA 1EBAA 1H5BA 1PBYA 4KKBC 4MNGE 4HC1A 4GG8B 3ATAA 1N2DC 3RL0C 2A77H 5ITFB 4LBEA 3VJ6B 5E2VH 4IHOA 4X5WA 3L71E 2IFMA 5IJDC 4CGTA 3P4NB 1MCDA 1MG2C 2AP2A 5CCKH 3BASA 1RZKC 2ZCHL 1A7QH 1ECZA 3HAEH 5LQBH 5JXEA 1IEAA 1I3GL 2KKQA 3S37L 3QWOA 2UZIL 1A0QL 1ADQA 1T3FA 3UROR 3N2JA 4Z7VE 3TBSA 2VQTA 3MRPB 3L3HB 2X4QB 4R0LC 2XXFA 3VFVA 4PBDA 1NOFA 2YPVL 2WWOA 2FX9L 5KYNA 1K4DA 3QPQC 5JUEH 1IIIA 2GJ6B 4CBPA 4L9LB 4UU9B 2UY7A 4FTVB 5K39B 3GXMA 5KS9F 1ZHKB 1MCHA 4GMTL 4QGTA 1NUFA 2VR9A 4EIZC 1OAKL 1NAKL 1WCBA 3L2LA 4P57B 4GSDL 4Z76A 3PQYA 3Q13A 5C70A 4HIJB 5D1XC 2IMMA 2H2SD 1Q38A 2V9TA 3HAEB 5IEKA 3Q2CA 5CZXC 1F6AB 5C7ZA 3SSGA 3B5GA 4YTPC 3P11H 2FYNC 1DFBH 3GJFH 2W8CA 4I3RL 4EUPA 4IOSA 3HLAB 1RZGA 3OJDA 1ZTXL 5F0MB 3AEEC 5FO7B 4F8TA 3JWNH 3RAJL 2VIRA 5LAXB 5C0FA 1LWUA 4WEUD 3H4HA 3IGFA 4PY7A 1VQKP 1WS8A 2WLLB 1WT5A 4NQDA 4LVHB 5JOPD 1L6PA 4WY7L 3KWVA 2K45A 2FBOJ 4K8RC 5DUML 1UGKA 3U6XS 4ZO6A 2BCKB 1DQJA 3EYOB 1P6WA 2HH0L 3K80A 4NGHL 4Y19E 3UGXA 3MV8B 3I55P 3I6KB 3Q5YA 4ZQTA 5F7NC 2LGNA 2NX5E 1IGFH 1UCBH 3N5AA 3OPUA 2AEPL 3GJFB 3F7PC 5SWZE 2EZ0C 5A7BA 4OV5A 4DSYA 1LDSA 5JLZA 2X28A 2EE2A 1GMJA 3WFDL 4MA3B 3RL0g 1BGYD 1RP9A 1R5VB 2YWYA 4OCYH 4U1SB 1VZHA 4YGAB 5D5MB 3ZTCC 2A6DA 5JDJA 5SX4I 3LRHA 1I8UA 2R69A 2WK2A 1NC4D 1RZJH 3LNHA 2W90A 2B15A 4JE4B 5DEFB 4MCNA 2OARA 5HYIA 3NZSA 5EB9A 3L4WA 4IDLA 3KZIH 1PP9G 4HZAA 1HE8A 2CIIA 3HE6D 1ZRTD 1N64L 4P2CG 2EEBA 3X17A 2HJFA 3J07A 2OFQA 2XX1A 1CD8A 5I75B 1U8LA 1HL4A 1NTZK 1SQPG 3FDWA 4A7TA 1T6BX 3PHOB 3C12A 1H3WM 2HMID 1XCXA 1Z6JT 4AEFA 3STLA 1CLCA 3IS1X 4S2SB 4XNYH 3KLQA 5E5MB 3OHXC 4YX2H 3MX0A 4KHXH 4MBOA 1UXSA 3WEBA 1EAOA 4YFLI 1VF5C 4NJ9L 5I1DA 2WPSA 3QIBA 2A9NH 4GAFB 3BUTA 3CC5B 5LB1A 3SDAA 3Q1SH 1TQWA 2NY5L 1WFUA 4K3AA 1ZLSH 1X4YA 4HHAA 5HVWA 3GWJA 1TQCC 1W72H 1N3NA 1XB3A 3TO2A 4DEPC 1FZGA 2MMXA 2WHVA 2BVOB 2X3BA 2ZXDA 4ORGB 1CFSB 4Z7VB 1J0KA 2Z7ZA 2MCMA 1ZR2A 3LAFA 5DQDL 5LG1A 2LLNA 1IL1A 2Q9OA 2N1KA 3CBRA 2ZJSE 2H6OA 4QD2E 4OF8A 4OGZA 2HJLB 3S36H 3WHE1 1NWPA 4CSPA 5C8JB 3CXDL 4S1DD 5CGBA 1U7MA 1HT6A 3BZ4A 3BO8B 3H25A 1ES0B 3D6GA 3HRZB 4FQJH 4BSVA 3S5LG 1AO7D 4C55A 2VR8A 4M62L 1BJ8A 1AC6A 4ZTOL 2EP6A 1AVYA 4MJ5B 1AYRA 1KLUA 4S0SD 2H26A 1FZBA 2CPCA 4PFEA 4LCWE 1OD9A 1Y07A 3GGWB 3FT9A 4PHZA 3RVWD 2LV4A 1A6AB 1W72B 3NZ8A 3OKKA 3ZDZB 1W5CE 1RH5B 2W65B 2ZOOA 3L16A 3QNXA 3WY3A 3T2PA 4NO2B 3VG0H 1CE1H 5EZOH 4DW2H 4YXHH 3LKOA 4HS8H 3CBKB 2ENSA 4MXQD 4NI6A 2J1WA 2VZUA 4CPGA 4PUBH 2WYHA 1T2JA 2ROYA 3BXNA 3IMSA 3UBXI 1LTSC 5EUKB 3D4GA 5I9QC 5D7KD 2Q8BH 4HH9A 4FLHA 4OM0L 1CC3A 4J3SA 2P8PA 3WEOA 4YSRA 3F58H 2WLMA 1PMYA 4LASL 4XMPH 4OD2B 1MIML 2NSMA 3FUNA 4HFWB 1ACYL 3C2SA 2EH7L 4DK5A 5K69A 3MBED 2E7LC 4NEHB 3MODH 2WSPA 4GP8B 3IPFA 2XPYA 5D1XE 2JJSA 5GS2D 5TE4H 2Z31A 3H0TB 2YS4A 3T2QA 5D9SB 2R4SL 2B1HL 2CO4A 4HGWA 1XIWC 1HSBB 2W5PA 1FHGA 3F00A 3LRLA 1UVQB 5J3HD 1RU9H 4QTHB 2OTWA 1F4WL 4KGJA 4MAZA 2JQAA 4N2FA 4PG2C 3OKMB 4G8AC 1JSYA 1X5AA 4R4ND 4PJ5E 4TVPL 2C3WA 2DM3A 5T1KB 1Z9PA 3ABZA 4HJUA 4PV8B 4QDGA 5B7FA 4WNQA 5IT2H 3ZDXF 2AK1H 3HUJF 1SXBA 3A6BL 4IFMA 3P40A 2EKSA 4RFEA 5DJ0B 2FO1A 5JW3L 3FN0H 4LLYA 4ZMOA 3SFDC 4ABWA 5KAQF 2M8XA 5DMGD 2IPTH 5GS1C 3BEVA 4UTAA 1M9WA 4Z7UE 5EA0L 5HHMD 4HWUA 5ACZB 3MLRH 5DR5L 4M7KH 4AG4L 1TENA 2YBRA 3FT1A 1BDDA 2WUCL 4PRIE 5B39G 5CHNB 4I77L 4OD3L 2Y2YA 1H3VA 3KNBB 1HWTC 1REIA 2J5WA 2NLJA 1LGHB 3ARSA 2M3BA 5D4QA 1KEMH 2DWEA 5JHDA 4HF5H 4EN2A 1LTJB 4MAYD 2VXTH 4M56A 5I30L 3WHXB 2XWRA 4FL4B 5EBWB 2D9CA 3LN5B 3ISYA 3ULUE 1TLMA 3KPRE 4YSUA 3QEGH 2K9JA 2HTKD 3BSZH 1S7SB 4JPIB 3OX8A 2J5UA 2V3FA 5HYEA 4X9BA 5F7DB 4TSBH 2H3NB 3A4EA 3RWFB 1Z0NA 5ESAA 3NFNA 2YRZA 4OQTH 1E67A 4URTB 3FYEB 3ARFA 5FM5O 3UGEA 2IDQA 4BH7B 1QLFA 3C5XA 2Z1PA 1SQQJ 1PZ5A 5EN2B 5F8QC 2Q2LA 3QEUA 5FYKU 5CM1A 3DRTA 4ONFL 1QRNA 4W4OA 4UTCA 1P6AB 2Q3ZA 4TQ8A 1KJ2H 4IKKA 2BZDA 4UUJA 3AT9A 3TH4T 1VJSA 1XCQA 3L7FA 4S0HA 2XKNA 4WWKB 3M1CA 5FXCH 1H3XA 4PM1A 2BO0A 3U25A 4HJSA 3VM5A 2LAAA 3QQ9C 4CU7A 3DURA 4JRLA 1SQPK 4D9RE 4NZRL 2ZT9D 2NXYB 4ONHA 2WB1A 3IDMA 4URKA 3P9WB 2PCPB 3MDJA 3FB5A 4FI6A 4FQCL 2KI7B 4GRLA 2JE8A 5GTIE 4K15A 3IRPX 1XVSA 3MLXL 5F96L 4WJKB 1PLGH 5AYUH 1NIFA 2OQJB 2RAMA 1K6QL 3W5MA 5BNXD 1YHPA 4PJEA 4RDBA 2WKOA 4YHYB 1PJ9A 2BSDA 2OXGA 2Z8WC 4OW6A 5C0GA 4HLZH 1SXSA 1KJ2B 5B8CC 3NAAL 4FKHA 5KZCB 1V8HA 4A6YL 3QXVA 1SS1A 4JFFE 1SDDA 4WY4C 3T3PB 2QPEB 3MUJA 3W0WE 1IKOP 1FIEA 1PQZA 1PY0A 1JNHA 1RULL 2P8MB 2AJXL 4NJAH 4JY5H 4JKMA 1PPIA 3CFEA 3HCVA 1Q7YQ 1CS6A 2J8OA 3R0MA 3QJXA 4JRXD 1JHLH 3MXWL 2F5BH 2Q7YA 1FI8C 1DJSA 3FB8B 3DIFB 5HHQA 1AHWB 2H2PD 5I66A 4FQXD 2A99A 3LRSA 4JDTH 3V10A 5HI4D 3T0EA 4UTBH 4GAAA 4G6MH 2WVVB 3LIZL 1IBYA 4XNMA 4TXVB 4QF1B 4JVUA 3HVDA 3L3IB 1AVOA 1BZEA 3JWDH 3OKLA 3SDDD 2O93L 1BZ9B 1PNCA 2YD4A 4ZDHA 4Y9FA 5E5LA 4D8PB 2BK8A 1IGIH 3WNPA 2PABA 2VN5A 5HY9A 4NB7A 2HTLC 2O72A 1E42A 3FN3A 3AGVA 2WVRA 3FT4B 1KD1Q 3CN1A 3TF5A 1G0DA 2X88A 4UINH 3UJIL 5IVXE 5FX3A 1LMIA 5KN5A 4DEUA 5ANMB 2XRAH 4KQ3H 4OKDA 2C9UA 3WMPA 3CSBA 3X1EA 2QQNH 2YK1L 3ARDA 4OIFA 2FJHB 4DN4H 3CGTA 4JLRA 2J55A 4OI8A 4DTGH 2YQGA 1HWHB 2P5EB 4QRPE 1WSST 2LTQB 3ZHDA 1KZUB 2F53B 1KY6A 4HALA 4D9LL 3IGLA 5B38B 2YPLE 2W80C 2VDLH 3KBHE 4KK6C 2WM0A 2R1WA 3CXHJ 4L37B 4EZKA 4B0MM 1J87A 4JFUA 2NY7H 3JV0A 1F11A 1A47A 5MHSE 4POZC 2XN9B 3MXVL 3L95B 5F3HA 3DX3A 4I0CC 1RZIA 1FC2C 4HETA 1ULVA 5I6KA 3F01A 5K1NA 4RGOH 2Y9RT 3T0BA 4IL6X 1IJDB 2CA4A 1J1DB 1MIEH 5FM8A 4K07A 1JJUA 2J58A 2WAQA 3GTNA 4PJHB 1UWFA 3KPOA 1D5BA 4DO6A 1MCIA 6FABH 3C60C 1NZRA 1VDFA 3V0WH 2XZQL 3V6FB 4ANWA 4DOHB 5LDSA 5IBLC 2LOEA 3T6WA 1MFDL 4F57L 2VDLB 5K9KB 5DWUL 3OB8A 3PE9A 3K2IA 1BMZA 1X9UA 4V33A 3FGAD 1I9EA 3M0AA 3SGKA 4EIUA 1T04A 2HVBA 4XCYB 3ZL2A 4PJDF 3BCCD 3IFOA 2AQ2A 4OZHE 1OM3H 4R4FH 4POUB 5B21A 4HK3N 5JIIA 3M7FB 4IOIA 3ITKA 5ABAA 2JNZA 4N2AA 1J18A 2GHZA 5F9OL 5KJRH 1CIDA 3KWWB 1BP3B 4FFTA 4R7NA 4GRMB 4UANA 4X4ZA 1JWUA 3X12A 4C56E 3CFKA 5B4MC 2YGOA 1E8ZA 4XC3L 3UBXA 2LR4A 4WUUB 3K0YA 1JK9A 1I8IA 3VTTA 1YNKH 5CINH 2Z8VC 4G7VH 4X42A 1U8MB 3RUGA 4BK5A 4MA1B 3TO4C 1ZLVH 1CICA 2XXCB 2VW6A 1UWXH 1HOEA 1JGUL 3UH8A 3KPSA 3KW7A 4KITB 5EDSA 4OZIB 4FADA 4BH8B 1LTAC 1H0TB 1R24A 3HTKB 4P9HH 4OY9A 1FF5A 1WBXA 4PRPA 3PQYE 3S3BB 4TS6A 5KYXB 3BZFA 2WUBL 3QIUD 4BKSC 4BGDA 3TEXA 2NW2A 2BIQA 5F7BA 2XV6B 2JCCA 1WAAA 3FO0H 1S7XB 4PJBE 1WLHA 5HJ3A 2BMKA 1QFUH 1C5CL 1RUPL 3EHBD 3I6LD 4ZMAT 2X4SA 3RX8A 2N1TB 1XGYL 3PXLA 4PJ9C 1Q94A 4UNIA 3VXNB 2CLRA 5A2JH 3QRGH 5TJHA 2ITDB 4IW4C 4MD5A 1DUZB 4G8GE 2Y5EA 5EC1A 4OFYD 2CO2A 4ICXA 4ZTEA 3B5NC 3RPKA 2D03H 1HCYA 2EE3A 1SQBK 4Y16A 3P02A 2B8OT 3RL2A 1AS6A 4TVPD 1NU1D 2B3IA 2C4FU 3H9ZA 2DYRB 4FQPA 4MZ3A 1CIUA 2EXWC 3ILPA 4UI2A 3I50H 1EEYA 1LK3H 4PRHB 3WN5B 2YKKA 2ZXXA 4YPGB 3TZVA 3RWIA 3N41B 3GJEB 1UATA 4HC1H 2NY2C 5JQ6H 5AEAA 1DBML 3UO1L 3QDGD 1EZVE 2WSDA 3RKPA 4CW1A 5FECB 4NQSA 3T77A 1NJ9B 2HUHA 4KXZI 2GJZA 3PJSB 2ZFCA 2K6ZA 3LY6A 5FC9A 3NFQA 4LARL 3U2SA 4QXGL 4TT3H 2OMVA 3KJ4B 3O3AA 1SJEB 4ZNCD 2OYIB 1HCFX 1BXVA 4JR9L 1A5FL 4B9PA 1ADQH 4O2CA 5HJDA 2IC2A 5I15L 3KPNB 1T5XB 4C83A 4YPJA 4XNDA 4QOKE 5EORL 3QRFM 4KI5F 4UAHA 4G9FD 3MRBB 2R32A 1S4IA 4HKXB 2ICEA 1YZZA 3LB6C 5D93B 2O01J 1AS7A 1IKFH 1IBGL 1S7RA 1T4KB 4H8WC 4FDWA 5BU8B 4XZUA 4AL8L 3PFUA 1KTLA 4IRZA 4MCYA 1H5BB 1QVOB 1CVSC 4U7JA 3OG6B 2E74C 4OU3A 4YDIH 2VXQL 4PR5B 2B2XL 2X53A 5FYKL 2FAUA 2F74A 3QZOA 5I1CH 4LBEB 2VLMD 3J2PA 2CJTA 4YWGL 4IHOB 4X5WB 5DK3A 2C7UA 3D6YA 1UUNA 3QIWA 2HG5D 2DM2A 3ZDYB 3S35L 1IEAB 1SDYA 4NZUH 4Y2DA 1A1OB 1T3FB 3AY4C 3PP5A 3C5SA 1Q81Q 4P2QB 4XBGB 1M1XA 4FNUA 4U3SB 2I25N 2J25A 5LGHL 4CMMA 2KZIA 3HG5A 3NEEA 4E36A 3VD7A 1FAIH 1EQWA 2EYTA 3C9IA 4QT5A 1K4DB 3CHQA 3AEAC 4BWTA 3TPUA 2OYMA 5ALCH 2C5DC 1HCVA 3P0VL 4H0HB 1MWAA 1RUQH 1ODAA 4AGQA 1WZ1H 4GG6A 3GEFA 3SE4C 4KZEH 1SXAA 1WCBB 1RIUH 3TIEA 3UJTH 1NFDB 1IBBA 1XL6A 2E86A 3PQYB 4WKZA 5HD8C 4GY4A 5IEKB 4LL9A 1UKQA 2OTUB 4JFED 3QCVH 1IC4L 5ICXA 1MHEA 5EOCH 2WMMA 4MD0B 2AEFA 5E0FA 4EUPB 3ZL4L 1QWUA 4KC3B 4XGZA 1MI5E 2NZ9D 2ZKXA 4I9WE 1KB9D 4HJTA 4AE0A 3QXAA 1YQVH 1SZNA 2QMKA 1R34A 3D4YA 4FMKA 2VIRB 2R69H 4KUZL 4YLBA 5C0FB 2P1JA 2RBLA 4PY7B 1M6OA 4L23A 3W11D 4NQDB 1QL1A 4M61A 1NA8A 4L4TD 4KROC 3ARQA 4YDZA 1RLWA 3NP3A 4K5LA 4PGBA 5GGSA 3RRQA 1DQJB 2CCLA 4MMXA 3D39B 4LVOB 3W56A 2ED7A 3AE1C 1LILA 4H2AA 4C7NB 2X3CA 1LLAA 5JR1H 3SDCC 2OTJP 5AL8A 1RCYA 3LPFA 1T7WA 2N7BA 3FOLA 3N42F 4OV5B 1GR7A 2I7OA 4LQFH 2FJGA 5LNEA 3PPSA 1TITA 2G3AA 3ATBA 5JLZB 3OQ3B 4ACPA 3RNKB 4IL6H 4BQ8A 5AAWA 5J0BA 4Z7OF 5MENB 2AQ1A 2JMRA 1WCQA 2YD2A 2A6DB 1NC2A 3F8UB 3HNSH 4F9LA 1N5AA 1NCBH 3MRHB 2H1XA 4HT1L 4YFDB 3MYJB 4FHJA 4ODVL 3VE0A 5A16A 3NZHH 4XHJD 2CIIB 1KIPA 4YHZH 1W0VA 4CC4C 4XVJH 2YXWA 2ZSVB 4GAGL 4MS8C 3RKDC 2CHZA 1EHXA 2W60A 3V95A 1U8LB 3DX9B 1JS4A 4IRJA 1B90A 4I4WA 4ANVA 4IKLA 2BSCA 3WU1A 1GMEA 2FNBA 4YHNA 3MUDA 4GFXA 3UMTA 3STLB 2H47C 2Z4TA 3DJRA 2DD8H 4XN4A 1FSKC 4BDVA 1FNSH 1OZHA 3MX0B 5L4FA 4WTZG 3GTVA 1UXSB 3HAEG 3DI3B 4P2OB 4PS4H 3TT3H 5I1DB 3JSSA 4HZ1A 4UV7L 2YGQA 5JHDE 1P9MA 1JZHA 2FJFB 1T1YA 3QIBB 4P5TA 2NPLX 3S98A 3A6OA 1PNDA 2NYYD 4OAWA 4XXWA 4HHAB 1SXCA 2J3SA 4PWKA 4PVMA 2DTMH 3GRWL 3CD4A 3ESNA 1YPZB 3Q2NA 1UM4H 4JM2F 1TETH 4XMKL 1KCRH 1H3PH 1S7UA 4HH8A 4AC2A 5F3BA 2C9NY 3GXUB 4G7QB 1IL1B 1CTOA 3ZLQC 4D0DA 1NCWH 1BEYL 3IVKB 4LHQB 4DZ8A 5I73B 1DVYA 1YY9D 2YMXL 3BWUF 4YSEA 1TUPA 1QRNE 2ESVD 3ARGC 3JTTA 4MDRA 4G5ZL 4I13B 4B6ZA 4BSVB 1ZV8A 4L8SA 3MC0A 2NQDA 4EO5A 5CMAA 1NO4A 4LCUA 2F19L 4XPBH 4EQ2A 1KLUB 2FVNA 3MLWL 2H26B 2JCWA 2X44D 1RSFA 2AJVL 1ORQA 1S1CX 3GQFA 3IR9A 2BHFA 3DGCR 4DWHA 3LQAL 2WXLA 3NZ8B 3BUIA 2ZOLA 3IPEA 3P0GB 3R4RA 3QNXB 3BISA 2E42A 1EX0A 2W1NA 3JWNG 5ETUA 2QVKA 1EANA 1II4E 3LKOB 1Y6MR 1X5XA 2EDTA 5BW7C 1T2QH 3I02A 3RG1C 4PRDB 3EH3B 1RQUA 4R4LA 2MOGA 4IRSC 4M1GH 4XPFH 4PAZA 2X4NB 1JPSL 4PJEE 4Y1AA 2F68X 4HH9B 4P3CL 4RFNC 3UBGA 2H6PA 4KTEH 4QY8A 1J5DA 1MHPL 1LGVA 4WI4A 1SQQE 2P8PB 2CUMA 3RY6C 3HUSC 4ZW5A 3PL6C 1B3IA 4HZLA 2PO6C 3PWJA 5DHVA 1AR2A 4BFFA 2R2HB 5K5YA 3QQDA 3EYSH 1YEIL 1LO3L 5A3IC 4KPHH 3QCUL 5BS0B 4UT9L 4UTAH 5KVFH 4FFYL 4G8IB 1N86A 4MXWH 3C75A 1HZHH 5IMOA 2IZ0A 3BPLC 5E2UL 1JB0J 2ATPB 2Z31B 5F71A 1OT2A 2IGFH 3HMXL 4W9LC 1WHOA 2QMJA 2IAMD 4AYFB 4HGWB 4H44C 2XACC 3P69A 1EV2E 1NBQA 2OULB 2QSCL 5DYOA 3TJHD 2OTWB 1P1ZA 1NJIQ 1JNNH 1IO4C 5IHLB 1KY7A 3SDYH 4H0IA 4LSQL 3HE7C 5CGTA 3BKCH 3P54A 5K9OA 1P69B 3L35A 1IFHL 3TBYA 4WNQB 3FUJA 2Y6SC 4J4PD 2BSRA 2X0VA 1IK7A 1EEZA 2HT4C 3BAWA 3IVKA 3SKOA 3CVCA 2O1JA 3WTSA 12E8L 2IAAC 3NFPA 3OKDA 2YUXA 5CEYA 3BEVB 3D05A 3UTSB 4JYBA 1MELA 1KYOD 2YBRB 1FA4A 4H2CA 3L5WA 4DKTA 4JQVC 3D0VB 4ZXBB 5LN8A 1FAKT 1MKFA 4P5MA 3WIHL 2NLJB 4BXVA 5MI0C 1WICA 1VEMA 3HN5A 2DWEB 2CO1A 3P3UA 5LCVL 4X8JA 4HUMB 3K4ZA 1QFWI 2RR3A 4OM1L 1U3YA 4KFMA 4OGXL 1XCWA 4A55A 2VZ1A 4J3OH 4PJXF 3OX8B 2CM6A 4LESA 5E1HB 1INEH 3WU2E 3BWZA 2X9YA 2ZXWB 3G6DL 3NFNB 2JSFA 4F5CA 5DRWB 3H9YA 2LLGA 3OXRA 5D71H 5HGDA 1BE3D 1NEZA 3ARFB 3D52A 2JJUA 3B37A 3NSYA 1QLFB 1QBBA 1KC5L 1PZ5B 3WS6A 2YLKA 3QEUB 4NT6B 4AKOA 1Z3GL 4YXDC 1KACB 1ZANL 4U31A 3MBXL 1RZPA 5FYKD 3A5TA 1JPGA 3LH8A 4APXB 2VN4A 5JORA 3O8XC 3PXJA 3VD4A 3LIUA 1XCQB 3EZ8A 3L7FB 2XKNB 1EXHA 3HC3H 4KNSA 4DF9A 1U4FA 2VNCA 4Z95H 1I8LA 4LOUD 3DURB 3PUUA 4TOYL 3OAUH 4ONHB 3IDMB 3LPOA 2CCWA 1U36A 3FB5B 1FPTH 2YD8A 3GSOA 4OF0A 4FG6C 1G9NC 4GRLB 3FCTA 1VERA 4JN2A 5D72L 5AUMB 1T7YA 3KJ6L 4OJFL 4R3SA 2XETA 4PD4H 4QTIL 1DN0B 3AE2C 2R2EA 3WSQL 1R5IB 1MPAL 3PDOA 3VA2C 2FKWB 2VR3A 3O6LL 1UC6A 3S3SA 3SPVB 4Y9CA 4YZWA 4AGMA 3IE9A 3CXHE 1D5IL 1V55B 5C0GB 1WYJA 2ED6A 2OZ4L 4H5SA 5E7FA 2C8NA 2Q7AA 3AW5A 1SDDB 1P0SE 1EZLA 2FT7A 2L7EA 2WOBA 3KLDA 4X6BA 4HU8A 1AFOA 5EEUA 1ASPA 1JNHB 4HBQA 1DQDL 5D7IE 3TGUD 4LVNB 3V4QA 2XI9A 4QRBA 2IBZI 3CFEB 3HCVB 1K05A 3JC22 3QDMA 2ZOKA 4ONGL 2JV6A 5SX4H 3WMQA 1BCCD 1FDLH 4NSKA 4P23D 5K1VA 2TSBA 2Q7YB 1MFEL 5HHQB 1G6RL 4OH2A 4AYDC 4KNTA 2ZPKH 4YSAA 2QL1A 5T5FL 3V9FA 2VUOA 2HWZH 1YN7B 2MH4A 1T20A 3FO2A 3QWNA 4UQ3A 3ZT6A 1E79H 5B66H 2KLTA 1GOHA 1CO1A 3T0EB 5FA3A 2P46B 3PV6A 4HX1B 1ASQA 3F64A 2Y72A 3K5RA 5EWIH 2BDNL 3BE1H 3ULSA 4BWUA 1E4XI 4GI8A 1IEHA 3OMIB 2CDGA 3OKLB 5CO1A 1KV7A 4NNPH 2HMIC 1NGQH 4KK5D 4EI5A 5HY9B 3O6MH 2UWEE 5E2JA 3MP7B 5JIPA 4FQ2L 4I1NB 1NINA 3DROB 1NFIA 4N2LA 4Q7DA 2ARJB 1WEJL 3TTYA 3V2QA 4OWFA 5IK3A 4B60A 1EXUA 5KN5B 3BCCJ 4DGYL 4LEXL 4B9ZA 1OEZW 1DR9A 2G30A 3BAIA 3ARDB 2K4WA 1H89A 1DBKH 3PGFL 4E68A 4IBUA 5INDB 4JLRB 1FV1A 5EULV 4G72B 3Q06A 1TKWA 4NNXA 4M7ZB 4HXBL 5C86A 4R83A 1U8NA 2DEYX 3CC7P 1IAMA 1SQVJ 3KGTA 4S1DC 5F7LB 3ZE2F 1SYVA 1Z1WA 3UZEA 3R06A 2R1WB 4WIQA 2V7HA 2VDPL 1A4CA 2EDOA 3B9KD 4IMKA 3U4EA 5HYJE 2V5MA 2A6IA 1F11B 1SQVG 1YJDL 1GS7A 3RVUD 4AQEB 4F9PC 4Y4HA 3CZNA 4XNXH 2A9MH 1DZBA 4JMXA 2N9YB 4L9LC 4TKWA 5F3HB 5GJTH 1OOAA 3QGVA 1HHHA 5A43C 2MKLC 4LIQH 2A9CA 3BP7A 4L5FE 1LD9A 2YGNA 1P84H 1GGBH 4ZUWA 2OMYA 2VO8A 2VJ0A 4JS7A 3G4SP 2YEVB 4ODHH 3TS8A 2CJ3A 1OE1A 1MLCA 1U57A 4JGNA 4RFOH 2PWEA 3KPOB 1D5BB 4P4RA 1DQIA 2WMPA 4UB8H 4RAHA 4LAQH 4UQ9A 3O6KH 2E4TA 4HLZG 1IBHA 5FUCE 2G5BA 4NENA 1I7RB 1R6VA 1NICA 1RIVL 1FC1A 4OZ4A 3KWTA 3OAZK 1E4KA 3IFOB 1NU1J 5GTHE 1TJHH 1V3LA 2MNWA 1KXQA 1E5ZA 1NH6A 1X0TA 4N6RA 1SLWA 1S9KC 1CLYH 2YEQA 3MBEC 2JLPA 2AAAA 4OFKA 3VOPA 1T7VA 5AVUB 2OR8A 2C9RA 2WZ0A 1RJLA 4R7NB 3X12B 4ZAKB 3CFKB 5CCGA 1ONQA 1BA9A 1NOLA 1W6WA 5BVZA 3DYOA 3UBXB 3VXOA 1GTNA 5E6UB 3AEFC 3VW3L 4L76A 1I8IB 1EVUA 1BFVL 1D6VL 5E2WH 1AGDA 1OARH 3KGUA 1IBZA 4RZCA 2HRPH 4OI7A 4NRYA 2FE0A 3RUGB 4UQDA 2JF1A 4PLKC 4UZGA 4WHTA 4JKLA 3KPSB 4GG6E 1PPJG 1IQWH 3NQIA 3QW9A 3SBPA 3LS5H 3ZUNC 3IJHA 4HIEB 1WBXB 1E65A 4JCMA 3EFGA 1EFXD 4PRPB 3BZFB 4HAKA 5B38G 2NW2B 2ZUWA 5EUOA 2A4CA 3JWNC 1U3ZA 2JCCB 3VP9A 4JPVL 5KVGE 1KELL 3K46A 5JOPE 5HJ3B 3ZYOA 1H3UA 3SHSA 5DMGC 1AD9A 2MNUA 3OPZL 2X4SB 3C8VA 3FT2B 3H7BA 5I1EH 1K8AQ 3T4AC 1UH4A 3PF2A 3VU2A 4Z7NF 5I75C 2L5GB 3QI9A 1OSZA 4DN3H 5L8JB 1RAMA 2E9WA 3AVEA 3QISA 2ATAA 1RVFH 1V3MA 2Y5TA 4NQCD 4MD5B 4ORZC 4Y28J 4Z7QB 1KSRA 5EC1B 2BFVH 3ZE1B 4GNKB 4OFDA 3COOA 3QUZD 3SBWC 2J88L 1BGYE 2E75D 2O3JA 1AZZC 4Y16B 3GSWA 5CF3A 3SQOH 4XP6L 1ZT1A 5F7FA 3PIQA 2ZWKA 4ZNCA 4IGBA 1QABA 4H20H 2O6EA 4ZNEE 1JFQL 4AIXA 1EEYB 1D5MB 1ZRTE 3Q48A 3TZVB 3RWIB 1XH2A 3QJQB 4LP5A 1F3JB 3T8MA 2NQ3A 2R0KL 4LLAA 1BAFL 2EC9T 2J8UA 4CILA 3AY2A 5KLIC 4Y89A 4CW1B 3B7RL 2PF6A 3T77B 2R4RH 4AIEA 3C5JA 3CDZA 5FDWA 2C9QA 2FQGA 3NQKA 4MB1A 3AE6C 3O3AB 5FO8A 2YIUB 3U2SB 2EUXA 1IC7H 4M5ZH 5HHNB 3WIFA 4O2CB 1DQML 5CZVL 4MRCA 3PP4H 1TU3F 4PLOB 4C83B 5JMOC 4L3ED 5EIIA 1USZA 5ALBH 5CJ5A 5EBGA 2A74A 3LH2L 4ZKUA 2KPWA 1Y47A 1VEPA 2C4XA 2E7CA 1DQQA 2HG5A 2NUPA 4Z7WB 2XY1A 2ZT9C 3EJCA 4K7FA 2ICEB 3LNEA 3QG6B 2DYPA 4BFNA 3RGUA 1UM6H 4XZUB 2J6WA 3EGDA 3A4FA 1P5UC 1KB9J 1KTLB 1WZKA 3BLPX 4TLTA 2AJ3A 3NSDA 4MCYB 3X2QB 1MWAH 1S46A 2IDSA 2MRYA 4UB6H 3FAWA 3QFJD 2VXVH 4FHBD 2NZ1A 3RI5K 2DIBA 2EDXA 1PDKA 3SYOA 2C7UB 5K59F 4FERA 3RK3B 3QIWB 3ABGA 3GI9L 1ZLEA 5AVTB 1UB5A 3TCLB 2R29L 1AO7E 2D4DA 4Y2DB 3DV6A 5KEZA 1R47A 3C5SB 3IDUA 1T6VN 1TIUA 3MZTA 4IEFA 4LVEA 3RGVB 3GD1C 1YNLL 1SPDA 4ZMDA 2Z4EA 1J86A 1IC2A 1E5YA 3U82B 4KXAA 1FJPA 3OC8A 2VE6A 4G6JH 4QT5B 5IR1B 2OP4H 1CWVA 5AAPA 3UBFA 1UUSA 3QJOA 2GTZA 1RL1A 1MWAB 2RMZA 3GMNB 5CIPA 1CT8A 3NYKA 4FQXC 4KKAD 3EYFA 1Y0LB 3A0BE 2KPNA 3LN9A 3R18A 3UAAA 2C7FA 2QEXP 1HH6A 2NYKA 4HPOL 1X5FA 1EZSA 2EDRA 2FQDA 1VEOA 2AEWA 3JTSA 5D7KE 2P44B 4Y88A 5CSZB 1G87A 5JW5A 4JM4H 4YHLH 4JZNA 2N0KA 3EBIA 3G9VA 1MHEB 1UA6L 3E80A 3RDTD 4F37K 3FQWA 5DD1H 5IQ9A 1S7WA 3DVNA 4U1MA 5DHXB 3P73B 3QHZL 2AV7A 2X41A 1S9KE 4U1NA 2G2PA 5DVKA 1E5AA 4XNQA 5EIQA 3QXAB 3WUWA 4BQBA 3LIZA 4PGDA 1KT2A 4U0RB 1YLBB 4XBMA 1CFTA 3JVFC 1WIUA 5D8JL 3U9PL 4Z8FL 4LT7A 1XT5A 4JBZA 1M6OB 1N26A 1AD0B 3JWOH 1VQ9P 4W70A 2V37A 1NLDL 3SFEC 4I6MC 3CCEP 4PGBB 5FW8A 2EDHA 4FFZL 3OKYA 1BQHA 1FJ1A 2X4TA 1LTJC 1CQYA 2F5AH 4MHHG 2R8SH 4WV1A 4EDWH 2IZ1A 3FOLB 1OAXL 1L5GA 5TF0A 5IQMA 2FJGB 1GGIL 3RJOA 4DH2A 3Q7JA 1SP4A 2BNQD 3H1KD 5I8OH 1UA7A 5HHME 4L74A 3GKWL 3WAKA 2ADJB 4TYUA 1NC2B 3L9EA 1P6FA 2F1AA 4PJGE 1RJCA 3V4PA 3NIFE 2GTWA 3POCA 5A16B 1YMMB 3VE0B 1T4WA 3IF4A 3GSUA 3ERXA 3RK2B 1W0VB 1JO5A 1AI1H 3IMBA 1QNZL 5GS0L 3QHFH 3FF7A 4IRJB 4RAUB 4MJJA 5GJSH 4I4WB 3MA7A 3E6FA 4ZW7A 3S48A 4O9BA 5J1SC 4H7VA 3TWCL 1CBVL 2ENPA 4FQ1L 4OFIA 4YHNB 1RI8A 1CGXA 4BDVB 3VD0A 4KGLA 5JQHC 1J9RA 2NXYC 2E8YA 2QLVB 3FUHA 2DWDA 3BAEL 3RJQB 5K9QI 3MMEA 1LO0L 3LKRA 4X6CE 2ZD0A 1HJ0A 4MXVE 1M1KQ 4P5TB 3TA3C 1TNMA 4WSGA 3ARBA 1QSVA 3Q8EA 1PTZA 1B4TA 2L91A 4TUOA 5ILTH 4M93B 4GOEA 1I9JL 3RZCA 3ESMA 4JFHD 5F6IB 2HB0A 3K6OA 3LEVL 3G7TA 4IOFC 4MASA 4AOFA 1CU4H 2O1AA 2I9TB 1S7UB 5LBSA 1DO6A 3EYUL 3L1FA 5BRZD 4LLWA 4X7EC 4DZ8B 3P9MA 2RGSA 1DSFL 3H6AA 5D2LF 4U05A 1AXTL 4KVCL 2WWKO 4FEIA 5GZND 1GK4A 2OJEA 4L8SB 1BBDL 2OLDA 5B1BB 1X5KA 1WMKA 3DHJA 2C9XA 4XMZA 1J8KA 4LCUB 3BYTA 2XC8A 4F7EB 1GYWA 2OMZA 3BIKA 4WW2F 4AGOA 3NJLA 1JZ8A 3SD5A 4E9TA 3QIUC 3EJUA 1X79B 2YNYA 1AHWC 1ORQB 3DX2A 3I74A 3D5OF 5IESL 1RF0C 3TASA 2PYED 2ZOLB 5DURD 3VGBA 2WPVB 3ABMB 4ZFOL 1A66A 5ETUB 2DLTA 3VI3F 1HEZA 1KYOJ 4GAYA 3L9RA 3MGTA 2CRYA 1FNFA 1V7NH 4FE9A 1U33A 4TSCH 1WBZA 2DBJA 2GITB 2X38A 4XN8A 2X0UA 3EH5B 5TH2A 4P4KD 4Y1AB 3GNML 1A3LL 2QM7A 3EZJB 4JRXE 1KEGL 2H6PB 1Q9WA 4WJG3 2IAMA 5AYQA 1S5LE 1ZTXE 2JJTC 1G2CA 3SJVB 2ZCZA 4FQIH 4HZLB 3PWJB 3O9WD 4V1DA 5I16A 1VRSA 5KYYA 5DHVB 1OW6A 2EO9A 3QQDB 4B5EA 3FYIB 4XX1G 1J1EB 1LTXA 4JKNA 3TYGL 4K3GA 1DD4A 5FUZH 15C8L 1SYSA 1ZLVK 3ZE0E 2X6UA 5TE6H 1UWXK 3QUXB 4KXZH 4N8PA 1BE3J 4JG1H 4HJJH 4FYTA 4DPAX 2A9AA 3NACL 2YOAA 4HYTB 1A7NH 4L05A 1MCJA 5DYOB 3JWDC 5JHLL 4GUQA 4ZQKB 2QZ5A 4DOJA 2W6AA 4N8VA 4HP5A 4DP8X 1G7JA 1HL5A 1MNNA 1E50A 1T8ZA 5LGJA 1KC8Q 1D2PA 5K9OB 1FG2A 2JQMA 1DBBH 2ZQKA 3BD3A 3TBYB 2D7TH 2UXTA 4V2BA 3TL5A 3TEYA 1IUZA 3AU1A 2BSRB 1GYUA 4E9VA 2PFXA 2IQ9H 2V2WA 1W91A 3FTXA 3PJSK 3NFPB 5DEZA 3OKDB 5CEYB 4BA0A 1F4YH 1D9KB 1I3GH 1KWGA 2E7MA 1SF5A 4NUQA 5G2NA 2ETWA 1A0QH 4K0OA 4OZGE 2Y06L 1UZ6E 3H3PL 3L5WB 1XR9A 3KM2A 4P5MB 2YA1A 4R7DA 1L3WA 1AQKH 3FBQA 5E4IA 2K3HA 1P1VA 3AGWA 3F62A 3B71A 1WFMA 3HPLA 1XR8A 4HWZA 3TNUA 1I7UA 3IXTB 4GRWE 4PN6A 5E08L 4PGEB 4ECNA 2H7WA 3Q8BA 2CZNA 4PPTA 5D1QA 2A9DA 3LIEA 2VQUA 1X7SA 5I8CA 5C9KA 4J2XA 3TGUJ 3TBCA 3UPRA 2BZCA 4JO8A 5KVDL 4R4BB 3T9WA 3U83A 5L9DL 4P46B 1MDTA 3HI5L 1QYGH 1MH5A 4UYPA 2V33A 3MTUE 1BCCJ 1CURA 3IDJB 3UO8B 1HQRB 5E2TL 1RE3C 2AXTE 5I6MA 4LCVA 2C9AA 1K4CA 4H13B 2GUOA 4NZ8A 1JPGB 5H94A 1MFAH 2H3KA 3MQIA 5JORB 3MOBL 5HGAA 1V7MH 1OAZH 4MA1C 4BWNA 5IGXL 5KSBF 5F9DC 1TCRA 2R1YA 1OVVA 1SVZA 3FW6A 5GGVH 4LSTH 1HILB 2FEJA 3HG1D 5I6XB 5IHZA 1S3RA 3BCCE 1Z5YD 4ODBD 1IFRA 5GZOA 4WI8A 3GSOB 3IKCA 3AREB 3V6OA 3CHRA 3WMSA 5HHVL 2AVGA 3G5VA 1FG9C 3L36A 2X1PA 3VMAA 2I27N 4FG2A 4MNQD 4R3SB 4F7KA 4OCWL 2B16A 4WDIA 3NCMA 4NOBA 3S0PA 2R2EB 3PDOB 5KANG 5C0BA 3NBNA 2RKLA 4Z7VF 3SGJC 3WE6A 1DQTA 4P99A 4GKZA 1HNFA 4P23A 4HCGA 4H5SB 2NZ2A 4YZFE 5EEYA 4W68A 4W9EC 3ZKSD 1KB5L 3P2DA 3DTUB 1EHNA 5TDOA 2WV3A 1NUDA 2CJSA 2YOCA 4P9HC 5HDBE 1EHLL 2M2DA 2BP0B 3RY4A 4RMTA 4XPGL 3BQUA 4LKCB 3QDMB 1V05A 2ZOKB 5IBTH 1YECL 3I6LE 3FBKA 3U4BL 5JHAA 1FH5H 1JMMA 1ZIAA 3E7JA 4PP2B 5FM5M 3WN5C 1N70A 1T1XB 4KT0J 2FATH 2HLFC 4TSAL 4P06A 4E41B 4KOCA 2MHAB 1MRFL 1N2RA 2P5PA 2PR4L 3HKFA 4YHIA 2E7DA 5FGCB 3WXWL 3FO2B 4UQ3B 1EJFA 2Q7CA 1KBPA 3QUML 3PV6B 5TPWH 5BOZG 2E9JA 4X80H 1RY7B 4Y7OC 1HU8A 2WWMD 4Q58C 4QMEA 5FGBC 2NRGA 1H0DA 2G60L 3ULSB 3B34A 1S9XA 1CSBA 3ESUF 2D31B 3NJIA 2OTLP 5HJGA 4D0CB 1YG9A 2CDGB 2E9BA 4N20A 4TVPE 4Q9RL 1NU1E 2FYUD 4A38A 2C1PA 4NQEB 4EI5B 1DVZA 4ZUSB 3EH1A 1P4IL 3ULVD 1C9SA 1TTFA 4KH2A 4N1CA 5D93C 1X8YA 1BFOA 2R27A 32C2A 4JHZA 5DQDH 4HOZA 1WWCA 1LK2A 2VAAA 2GFBB 2VOTA 1F13A 2JB5L 3KPMA 3FU6A 5LAPA 3CQPA 1RHHA 3VNYA 5IK3B 1EXUB 3QDGE 3OLGA 4J3OG 1M1JA 2J5LB 1CDCA 3B9KA 1TCMA 2APVA 4ZOEA 1A1NA 3K6DA 3VFGH 1VQ7P 4QHKI 4R96A 1FV1B 2G0LA 1TKWB 4NNXB 43C9A 2OYHA 2MQCA 4ZW6A 5GS0D 1KPRA 4KUCD 2D2CB 1U8NB 1WP6A 3BLKA 5FHBH 2W0KA 4G9FE 1YY9C 4L1LA 3BUPA 2E59A 3FWNA 1SYVB 2IOMA 2C3HA 2AJZA 2J1XA 3L6FA 3R06B 3GRWA 3SOBL 4R97C 2PXYD 4DNLA 2A6IB 3L5JA 2QHRL 4OLWL 1OSPL 5DS8A 4E9XA 3HZVB 1HESA 4Y4HB 1EO8H 2Q1KA 2WSKA 1N5YL 1LO5A 2K6WA 4ZFZA 4TULH 4BA8A 3TNMA 2VLME 2PWHA 3BP7B 4N2KA 2I60H 4PD4J 3ILDA 3UCQA 1LD9B 3FSWA 4GKSA 5AKSA 3GMPA 4N0YL 3QS3A 4QRSA 2OMYB 4ZUWB 3X11B 2GI0A 2H0JA 3GC3A 4NQQA 1NCCH 2I1KA 4IIQA 3WUZA 1MLCB 4L4VB 1N19A 5SWSB 3S88L 4NN6C 2WMPB 1HVVA 2WN2A 1FIGH 2QDVA 3MV01 1IAII 1UWEL 4WTQA 1FZMA 2G5BB 4NENB 1AH1A 3JVGA 3SYPA 5LXGL 3RWEA 1Q0XL 3RILA 2P4AB 4OZ4B 3CCVP 3DARA 3ZR6A 1OW8A 3TIDA 5FB8A 1DBJH 2VISA 3U6RA 5KSAD 1FORL 5I0YA 4N6RB 4KOBA 5IQLA 1GD2E 1OCOB 1QBAA 2ZOTA 1UZGA 1QI3A 3ETBJ 5APYA 5E0QA 2WVUA 1O5PA 3EO9H 2AJYL 1RJLB 4XAKD 3BGFB 2AEMA 1ONQB 3KS0J 4JFEE 2ZTBA 2R7EB 3G6JB 3VSUA 1T3UA 1YUHA 4NWUL 1TYEB 3BPOB 2UVEA 1AGDB 3H2WA 1ZT7A 4FP8H 4RZCB 4E42A 4NRYB 2DZEA 4AGPA 5IFJA 2ZG1A 3L17A 3QYCA 2FYZA 4YIQB 4UT9A 1KB9E 1KIUA 4NO0D 3RI5F 4BWWA 4PJ8D 2POHA 3WELA 3SGDI 2DW3A 3DUUA 1KV3A 3APMA 3HMXA 2JI3A 4J4PC 1M56D 4NQCA 5EUOB 4AQ1B 3KHQA 3BPNC 2DQEL 3FQTA 3A22A 3GMQA 4L4TE 4KJWD 4ANXA 3MI6A 4ZO8A 5D96C 5I82A 4DGUA 1KILA 1AD9B 3HIZA 1LE9B 3QUZA 3FU7B 5I30H 4ZS7H 2IMNA 4W6YB 1RPQA 3H7BB 1VPOH 2A38A 4F80A 3BAYA 1G7HA 1BVOA 5FYJL 2XWEA 1OSZB 3QI9B 2ZVNB 1NCIA 1QFWH 1OAUL 3CMEP 1HUCA 1E6OL 4QR7A 2K37A 3WJJC 2WWNA 1MJJA 4Y2OA 5DJ2A 1VDGA 1NDMA 4JHWL 2DI7A 2RJMA 3AZUA 4P2OC 5G55A 1Y1DA 3GSWB 2IH1A 2I7SA 5D7JA 1ZT1B 3QIBC 4DPCX 3FU9A 4XVTH 3WIHA 2AQQA 2CHXA 2D7OA 3DO3A 1FUNA 5H2BA 4IGBB 1XF5B 4F37F 4ZMZA 3RBZA 4GKNA 1AKPA 1W2BO 1WVZA 2D3NA 1OCWH 3KYOA 2XDJA 4HUUA 4L3EA 1TJGL 4Q6YA 4WFGD 3DOSA 1FVDB 4AL8C 3HN3A 1P84J 2J8UB 3NIGB 1PGOA 4HUCA 5EMYA 4F8LA 3C5JB 4FXTA 5FDWB 5I73C 1R3IL 5FO8B 4OFQA 4ZTPL 1LTTC 2ZKHH 3WIFB 5IWLC 3ZMNA 3DLQR 3QFJA 3UBXG 4ESKA 4PLJD 4Z7UF 3QNYA 3FCGA 4KTYA 1OGSA 4XR8C 5LKNA 4K7FB 1ZS8B 2DYPB 2Z93A 4YHMH 3EGDB 3VO0A 3D87B 4RDQF 1JF5A 1PZAA 2NYZA 1PCXA 3VQMA 2AJ3B 4ONOA 4F24A 4KDTA 5DJXB 1SJVA 2M26A 3GXTA 5HYSG 4H26A 2ZWZA 4FZEL 4BCXA 4U1HA 1QMUA 3A4DA 3ULUF 3VFTA 3GBMH 4E5XA 2R9HD 1S7VA 2Q86A 3VD5A 1CGSL 3UIZA 2ESVE 4GBXD 1SBSL 5L2JA 1UB5B 1IGYA 2WY3B 4HU2A 1M9SA 5I0VA 3DV6B 1T0NB 1MW3A 4LRIC 1CD0A 1S7QA 5KAFH 3HFFA 2A45I 4IEFB 2Z0UA 5CWSA 4HPYH 5CD5D 4N28A 1MVYA 4NHCL 2OR7A 5HTSA 3VP8A 1ADWA 2XTJD 4RGND 4DQAA 4XMVA 3VXSD 3VFNA 2VE6B 3DVFA 5AVWB 4EOTA 4F8PA 2NSQA 3H1KJ 3RDTA 2FT6A 1WGOA 3CFDA 4AV4A 1L7IL 3U36B 3H1LG 1CT8B 1HHJA 2OXHA 3EYFB 1CLOL 1JZ4A 3H1IG 1TVDA 1HH6B 3HG2A 4FNPA 5C0AD 3RPBA 1E4XH 3EO0A 2FO4A 5GPRA 3JTSB 5JW5B 4F2MA 2VLJD 1URQD 2Q3AA 2VDOL 4PJDA 5FKPB 3QQ3B 4JZNB 1UEYA 2VRSA 2BIPA 1N8RQ 2BP5M 4P5KA 2XWTA 1NTMG 1XGRA 5IW6B 3FQWB 5IQ9B 1F4AA 1S7WB 3DVNB 4U1MB 3WYRA 5B1KA 1DLFH 2ARWA 3QEHA 2AV7B 4KK5C 3ZTJH 5E9AA 3GB7A 4AW7A 1UXMA 3N85H 4XNQB 2HAZA 5DU7A 1NCHA 3JV4A 3HBZA 4PGDB 3WUWB 2KI6A 2FR4B 4Y5XC 1A9EA 2ZAIA 2Z5HA 1CFTB 3BWAA 1ACXA 2PCFB 2ORBH 4AMKL 3V4PH 1VACA 2A9BA 3C5ZB 3DXAD 4OLEA 5I1KL 4WFED 4OVVA 4ZXBC 4K9EL 1H19A 2VR4A 4KVNL 2DQCH 1J10A 3GXFA 4X9GA 3SOTA 1K72A 3DMMD 1LDPL 2W38A 4HKZA 2Q8AL 3L74G 1BQHB 1FJ1B 2X4TB 5DFVD 3N0AA 3HB3D 4A2MA 3MXVH 2IALB 5MP6H 1SVFA 3WCYA 4EQ3A 2JKVA 1L5GB 4OCRL 4NIKB 4Q0XH 1QQDA 4CVZA 4GDOA 5T1DH 4KWUA 2A83A 2NPSD 2N4IA 3WNJA 2ZUSA 3P9LA 1BSNA 4HH2A 1T89A 3DX6A 1NUGA 5DC0A 1KYOE 3ETSA 4OBSA 3RTQD 3ESVF 1FYTE 1RUMH 4I2XE 4RNRA 4PW4A 3V4PB 3MUZ1 2GTWB 1KLGA 3N44B 3OD3A 4X50A 3GSUB 4OCNC 4BXSV 1H8LA 2NY4B 5HHXL 4NZTH 4WO4A 1JGEA 4PWEA 5LBSH 2L3BA 4O4YL 3IDYC 5HHPA 4LSPH 2CG9X 3E6FB 3W9EB 2HLEB 4AYCA 3KCPA 4IU2B 4JRFA 1L9PA 3BESR 2DWDB 3L3OB 2JB6B 1OLLA 1OTSC 3MMEB 2D2OA 1BE3E 2BS9A 3V0JA 4X7SH 4HJIA 4GRLC 1D5ZA 3AU0A 5T1LA 5FFGA 1IAKB 3WD5H 3VMNA 2E76B 3ARBB 2YEZA 4XN9A 3V7AE 2ZONA 3HNTH 4HA1A 4TUOB 5IJVB 3RZCB 1XCTB 5FYKE 1IVTA 3FNKA 3WTVA 4AYBA 3HHMA 3LQAC 1RJYA 2P7JA 2N01B 3WFCL 1DUYA 2B59B 2BSED 4D7BA 5B1JA 4LLWB 3VXRB 1TEFA 2BC4A 3P9MB 4C4KT 4RSYA 1IGMH 1AY1L 3EF4A 2PYEA 1COBA 1Z56A 5A2FA 2WIIA 4HCRA 1FP5A 3QJHA 5HHOB 2ISDA 2V5YA 5I5JA 3QDJA 4XMKH 4L3AA 1CGYA 5B1AB 4JZOA 1FO0H 3MA9L 1O7DC 1BM3H 1Q72H 4GT0A 1IC5L 4M5TA 2QE7H 1PGJA 3VB9A 2P49B 1P2CA 4KXBA 2QVTA 2WJ7A 1SOQA 3TP4A 3L4TA 3F6IA 1AIZA 3I9PA 5E6IA 3RB5A 4I18B 2FBJL 4GAYB 3F2LA 3MGTB 5CEZL 2K9UA 2VR6A 1ZHLA 3V4UL 4R26L 3TGUE 1I1YB 5JTWA 2BCCJ 4JQIL 3T8XA 1AOZA 1M2VA 1GC1L 4LSRL 1MWOA 5TH2B 5IG7A 4L29A 1RZ7L 4JO1H 1BCCE 1Q9WB 2F15A 2BCCG 2IAMB 2QPSA 2PW2A 4X6FA 4ELDA 5CKAA 1G2CB 2MPAH 1F90L 1KJ3L 3LN4A 4NKMB 3F04A 2HPCA 3UJJH 1SVBA 4V1DB 1FO0B 5I16B 5E9DD 5AW3B 1TU2A 4Z3EA 2AVFA 2DMGA 3FJTA 5AKRA 4Z76B 1A7PL 1SYSB 3FMGH 1S2EA 5I15H 2XZAL 3TVMB 2WQAA 2XQYA 5EORH 4TNVK 2ZIDA 2ICES 2ADYA 1EMTL 1ZR4A 4K3HA 4M7ZC 1CFMA 3T0VA 5FYJD 1NCGA 1H9VA 3MZGB 1CGUA 2KHAA 3F7LA 3O2WL 4WK4B 2WJ5A 2IH3A 5KW9H 3LXCA 2B9BA 4N8VB 3TK1A 1OOWA 3M46A 5LGJB 1CLVA 4PJ6A 2F7PA 4HKJA 3A21A 1KN4H 2PN5A 3AU1B 1LNUA 1TZGH 3X3GL 2HT2C 1B4LA 2BVQA 3MNZA 2GK0B 2V2WB 4RSVA 1NTMK 2W83C 2QADB 3MRNA 1ZGLA 1OW0C 5ISZA 2NXZD 5HI3D 4FNSA 3V6ZA 2J4WH 1N73A 1M7UA 5JNYA 5DZ9A 1LHZA 2W88A 3VSQA 1BDYA 2G9HB 1UEMA 1XGPB 4Z7IA 1C1EH 2JKSA 3K6FA 4R7DB 4GPVA 3SO3B 2ATKB 1SNRA 4GIAA 4XC1H 1UKSA 4JG0H 1CQKA 2FX7L 3HPLB 1O75A 1J8HD 2MQ3A 2VUKA 5BMFL 4HWZB 4TUJB 3TNUB 1I7UB 5J89A 3AAZA 4ZD3L 2WNKA 4YLCA 5D1QB 8CGTA 3E9UA 5EU7C 3O41A 5BV7H 5I8CB 1YEHH 3UPRB 4Y5YA 4FCAA 4QJ4B 4GMSL 4OCLC 3PTZA 4GEIA 3OSVA 4XP9L 1I4FA 3E8VA 4WFHD 5IB1B 1MH5B 1ZWIA 2R29A 4FJYA 4WWID 1AG6A 2HKHH 3HG1A 3OQRA 1DEEA 4KJMA 4ZAKC 2CJUL 4UQAA 3IMWA 4OTXL 4NPKA 3IWUA 5EDXA 1K4CB 4C59B 2GUOB 5H94B 1XF1A 5HGAB 3FSAA 4QAMB 2VYRE 1JK8A 4MNQA 4QWWC 4AY0A 4WENB 5F7KC 1UD4A 1TCRB 4X6EA 3MJ6A 3BRVB 4HULB 4KJPD 3N9GH 5IHZB 4C58B 3UBHA 2YAOA 3P30L 3M0DC 4BE5A 4D7PA 5BV7B 2FYUJ 5FKAB 2EEFA 4KV5E 1NDTA 3R8BB 5IVOA 3O3UN 4JM2A 1BXXA 3IMVA 3G5VB 3GI8L 4DGIL 3UEZA 3D0LA 2A6JA 1FS0E 3ZZ1A 4GKGA 4WDIB 1P53A 2AJUL 1G4MA 1UGNA 2VLRB 1FZCA 3IWVA 3R19A 2ZX7A 4Y5VB 4EI0A 5C0BB 1HJCA 2OK0L 5BQ7A 1YVLA 1DVSA 2PP8A 3IE4A 4OGAC 1P4UA 3U0PA 3WE6B 3JV5A 4ZMWA 4D6TD 4GKZB 4LDOB 3NEOA 3DK0A 4LK4A 5TJWK 5JIMA 2IDCA 5KYWA 2Q3XA 3N40P 4NUGH 1HGVA 4QHMA 5IHUH 3G5XA 4MFHA 3VXUD 2P3YA 4U33A 5KJ4A 2JKRM 3Q8FA 1O7DE 4MJIA 3NH7L 4BQ9A 4Z5RA 1YNTF 3SE8H 3BQUB 5C9JA 5C07D 3H42L 4UMGA 1SY6L 2J21A 4B50A 1NTKJ 1FL3A 2PETA 3DX0A 3OVUB 4I0PA 3UTOA 1A7RL 3B2VH 3CLEH 4FFZA 5TDNA 4NERA 3TZVC 3IJYA 4QRRD 3PYCA 1N2RB 1NTKG 3VDBA 1WQVT 4M29A 4HW6A 4X2UA 1RE4C 2OSLA 1AKJD 5E8DL 4NQCE 1WBYA 5AOKA 1CZ8H 2WXJA 4X7FC 1OL0A 3NRQA 4U4IA 1OPGH 4ZSOA 2YIUC 2CBQA 3B56A 1H0DB 4OJEH 1S9XB 2NNAB 1TQVA 1ZA6A 4OLXH 1JF1A 1CD9B 4JUTA 3CHOA 4GEJA 5TQ0L 2H89C 1ZVSA 4F1SA 3WGUB 5CJ0A 4U1JA 1JIBA 1LXMA 4X8GA 5T8IA 2IVFC 4R7VA 1RZKL 4OLYL 4GW5B 1M8OB 1BFOB 3VGDA 1TG8A 3TOPA 5GGRY 3VUAA 1FRGL 1U3NA 5FCUL 3KPMB 5DXWA 4Y99B 1RHHB 1PFCA 3DA0A 4N5UA 3OJ2C 3D34A 4R84A 1NBVL 1M1JB 4AYID 3OL2A 3PJNA 2PXYA 3NFSL 4K2UL 1A1NB 1E0OB 1FVCA 5B5EE 2H4EA 4AV0A 1ML0A 3RK3C 1MKMA 3QIWC 5FHAL 2YAMA 3ZDXB 3HUJB 43C9B 3ARRA 2AITA 5PCYA 1KPRB 4G6AC 4L3EE 3SKJH 5DLMH 1GGTA 2YKLL 4J3BA 3HNVH 3MCLH 4A37A 2D0HA 4P48A 4UILH 3L6FB 4G6KL 3AS3A 5EBLB 3Q8CA 2ZCLL 5JO5B 3RGVC 1IT9L 3HFML 3UZVB 1DQVA 5D2NA 5GZNC 5AFAA 3BUBA 3TBTA 1GL2D 1GSMA 4WI0A 5DS8B 1MEXL 4N26A 4X5LA 2VMFA 5DWPA 2NNCA 1LO5B 3AXHA 1JBJA 3QFJE 1PGRB 4ZFZB 2CUAA 4WLCA 3TNMB 1WUNT 1LEKA 4HJ1A 3KL3A 4PV1B 5DA0B 3VXMD 4GKSB 5CNHA 3L72G 3AQDA 4HWEH 4QRSB 2EVJA 1BIIA 4KH9A 1CFVL 2RFXA 4EN3A 4CDGC 1NAML 4QRQA 1KJVB 3O6FA 4IIQB 1W2KT 1IZNB 1ORSA 3UMNA 3MUGA 4PJXA 4YHOH 5B7MA 4DERA 1XV8A 3MRCA 1F8TL 4K8RL 4OGQB 1FZMB 4MD4A 4P4KC 3SE3C 3L3KB 4HMDA 1EH9A 4PRBA 4ZFOA 1N7SD 3GK8L 1TNNA 1BSHA 1N59A 3FHEA 1L9RA 1S9WB 2OMNA 4KRPB 1ZK5A 1CLZL 1XH0A 3TIDB 5FB8B 2OMTA 3MV7B 3O9WC 4X4XA 4A2HA 4YSSA 3U6RB 3CFNA 4RKUJ 3U0WH 2UXVA 2BIIA 4HHWA 3TT1H 3U7WL 3T3ME 1QW8A 4L9DA 5TF1H 4K9JA 4YR6A 2LT9A 4XT1C 4GH7B 4UWQB 1YUHB 3KZ8A 1UQSA 4Y4FD 4E42B 5CEZD 3BGMA 4K3EL 4ZBJA 1B0GA 1AR1D 1NMAL 1KIUB 2XWBA 5AVYB 2I24N 2ZYSA 5AAWC 1KQFB 4F2ME 1T03H 5I8KL 2QJYC 5DMKA 1I1AB 4Z0XA 3T1WA 3AFLA 3O3BB 1XD1A 2ZUQB 3BH9A 3CJJA 1MG3C 4XRCA 4Y1TA 3FQTB 5F7YC 2BXYA 5EOTB 5JMRA 4KKCD 3H8NA 1KILB 3JWOC 5FWQA 1QSFD 2GBUA 3QUKA 1KCVL 3UIAA 3KBPA 3QUZB 3SE9H 5APXA 3RK2C 4W4NA 4MAUL 1S4XA 1HIMH 4PJEF 2WKOF 1G7HB 4HIIA 4HJGH 5ANHA 1UT9A 5EH1A 5BO1H 4Y4KD 5EFWB 5D7SL 1T0PB 3E3QE 4DETA 3OW2O 4AQOA 3WLBA 3L5XH 4PRNB 4Y2OB 1XTCC 1PU0A 2BNQE 2AGJL 3H1KE 1NDMB 5BQDA 2Q0ZX 3UTZA 5IB5A 2DQTH 2O5ZL 5JPMB 2IH1B 4KJYA 2D8KA 5D7JB 2ZKWA 1I85C 1PKOA 2E7HA 2KQMA 4A68A 3FZUD 5H2BB 2B88A 4XXWC 2YFOA 3OZ9H 4M93C 4OT1L 1W80A 4HIXL 3KYOB 5CD3A 4HUUB 4L3EB 3DOSB 3S5YA 3CX5D 3SPJA 5FO2A 1WD8A 3H9SB 1B0RA 4O51A 4ODSH 4JJ5A 5E6SB 2RMNA 1C5DB 4HJGB 2H6UA 3D33A 4Q9BA 3QZBA 4FMVA 1ZPUA 5DEGA 4P59H 1YSOA 5FR3A 2Y4SA 1WG3A 4Q4IA 1DBAL 3V5BA 1MCPL 2PYFA 2R1XA 4XZ4A 3A6CH 1BIHA 2KERA 1NM4A 3X14A 1TYRA 5I0WA 5KAIE 1DVFC 4GBXA 3S3PA 1DVQA 3WL9A 2FX8L 2Z93B 4ENZA 2PTVA 4JFHE 3D12B 1AGBA 4OI9A 4M6OL 4WU7A 2Y1YA 1J88A 4MKTA 1UH3A 1EDHA 3RWJB 4RQQA 3II1A 3LEYH 3MBWA 4O5LL 4W9GC 1DQDH 3O3EA 4H26B 5BRZE 2KLVA 1AQMA 4BXLA 4Y19D 4N4YB 3QORA 1AQTA 4E5XB 3VXSA 1S7VB 2Q86B 1IZKA 4HV8A 3A67L 4E9LA 2IANB 2GYSA 4YXLH 3O4OB 4M6MH 3ASNB 1IGYB 4ZW3A 3HN8A 2ZYRA 3H85A 5AENA 4QYOA 5DQJB 5KUKA 1S7QB 2XFXA 4UIMA 4N2NA 3S34H 1QL2A 5CWSB 4G8FA 4EAEA 3S3DB 2P52A 3CZJA 1VGEL 4G42B 1RK1B 5CN1A 5F93C 3VFNB 2PYEE 1P4BL 1E8XA 4MVBC 2V4HA 1WISA 4JPKH 3RDTB 3GHEH 4Z18A 1X5IA 2WTRA 3CFDB 4A2EA 1A02J 2PW1A 3QUXC 1MQKL 1HHJB 2OXHB 3EFFK 4M4PA 2IV8A 2RCSH 3Q2WA 4BK4A 1BPLB 1CF1A 3BVTA 4HKZH 4XMWA 3L5HA 4DO5A 5CUSL 3GSQB 2QR0A 1A7BA 4PJDB 4AEIL 3DJZA 1UXWA 2FWOA 4NKDB 5DUJA 1RZFL 2EIKB 2XNAB 2X12A 1DH3A 1XGRB 3NCFB 4FABL 1A65A 3FH7A 3JTBA 4F33A 4F7PA 4ZPTB 3DMMA 3QUMA 5AOZA 3GB7B 5TQ2L 4L73A 2CHNA 3EOTL 4YLQT 4XVUD 5I5MA 3ULVC 3JV4B 1SHMA 2Y07H 2BJML 1D9KC 5CP7A 4EBQH 3F7QA 1A9EB 3L3GA 1R3KA 3BWAB 3IRCA 3QH3B 3MUY1 3RWCA 3EXJA 2APBA 1FNGA 1VACB 2BNRA 1IE5A 3QP3A 5AZEH 1OY3B 4A04A 1X9RA 4ODTH 1N4XL 1PD1A 5D6CA 5AWNL 4FRWA 5F0PB 4YDLB 1AJYA 1BQ5A 4DKEH 4HKZB 5AAMA 3CVHA 2ZUTA 3RTQA 3DHUA 1L7TH 4IBSA 4OJDH 4OLZL 3RUGF 3ZYZA 4XN7A 4DGVH 5G5DA 4GYBA 3NCYP 4UBDD 5GS0C 2ZP0T 3WKML 4KKBD 5L7XH 2PCYA