5AVSB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 3.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avsB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avsB02
1J2JB 2C9LY 3A2AA 1GTWA 2P67A 1HWTC 2R5DA 1FOSE 3NXSA 3L36A 5CMZA 3MD0A 3UIAA 3OAKA 3NTNA 1HUCA 2WWWA 4I2LC 1CZQA 2W27A 1A02F 1H88A 3P7KA 1H89A 1YYCA 4GT1A 4XE5B 3V4QA 4RETB 3M91A 3WGVB 1OXZA 3TK1A 1CI6A 1KQLA 2YNYA 3VYIA 2XU6A 2QM7A 3A5TA 1FAVA 3TYYA 4C46A 1CSBA 1X8YA 2Z5HA 1GK6A 2KP8A 2JJLA 3O8ZA 3WGUB 3V4WA 5APQA 3TNUA 5AVRB 3A3YB 1SLQA 5AVZB 5AVXB 1IO4A 5AVVB 1S9KE 3L35A 2WT7A 5AW6B 5APXA 4EOTA 3VN0A 2IPPA 2R3CA 5APTA 1A02J 4KHXA 1FOSF 2ZFCA 3P32A 3V5BA 1NAFA 5AVTB 3A7OA 3B8EB 2XZRA 3M9HA 3HE4A 3I5CA 4RESB 2Z5IA 3P8MC 5AW5B 2YO3A 4DZOA 1HBWA 4AYCA 2WPQA 1MFZA 3HTKA 3KQGA 1G2CB 5AVQB 1CI6B 4AUWA 2W6AA 3HE5A 3M0DA 4AQRD 1SP4A 1GZLA 3VMZA 1DH3A 2P2UA 4C7NA 5AW4B 1T2KC 2N9BA 5AVYB 3TNUB 3NMDA 2E42A 2C9NY 4GKGA 4JYCA 2Q3IA 2R32A 2WPSA 2VRSA 2H7HA 2WT7B 1GK4A 1GU4A 2E43A 1HJBA 5AW9B 5AW3B 3KDPB 2QM8A 5AW2B 1NWQA 5APUA 5AVSB 2Q7CA 2BASA 5APYA 4M3LA 5AW8B 5AW0B 1H8AA 2WTYA 3HE4B 1T2KD 2ZXEB 5APSA 2Q5UA 3NFQA 2WPRA 3M0AA 3VMYA 4JYBA 1MUUA 1GU5A 3VMXA 4B86A 5AVWB 4I6MC 1JUNA 3IR9A 3T97A 1OWAA 3HE5B 3LIEA 3LIDA 3M9BA 5AW7B 4LC1A 3SWFA 3L37A 4C7NB 1JNMA 2R5BA 2YO2A 5APVA 5AVUB 5AW1B 3M06A 1MV8A 2P7JA 4HYTB 1GD2E 5APWA 3VTPC 2XV5A 1S9KD 3MGNA
chains in the Genus database with same CATH superfamily
1YYLL 4MA8L 1GW6A 2PXYC 1MWAL 3OLGA 2ZPKH 2JWAA 2C3VA 4I3GA 3LTVA 2NQDA 1AHKA 4GXVH 2PN5A 3RK3B 2FATH 3ARBD 4IGBD 1RQ5A 1E5WA 1T04A 3H6JA 4NJAH 1SJXA 4ETQB 1DBML 1AD0B 2Q8AL 1VIWA 3LNIA 1BVKA 2CRZA 5I66A 3D51A 2EICA 5KOMC 5DRXA 3T97B 1T4KA 2J1KA 1F00I 1CTNA 2Q0ZX 3PHSA 3V7MA 4WO4D 1R19A 3H1JJ 1QHPA 4YDIH 3EH5B 2D0HA 3FOLB 3NMEA 4JDZA 5KYWB 5GGVH 4G6KH 3TIDB 2DKMA 4PLJC 2NRGA 4XPBL 2VZSA 3UTSE 3VWKD 1JPTH 3MRGB 2YKKA 1ZLWH 1R75A 3ZYJA 2WSDA 2X89D 4ZMNA 5C9JA 2EXYD 4PRHD 2DS4A 4RAUB 4K94H 1DBBL 1HNFA 3GXMA 4TLKA 2QLVB 4V1DA 3D39A 1K85A 3C60B 4J3SA 3T0EB 3F62A 5MERB 1CWVA 2FNBA 4RX4D 5DJAB 1SQQG 4F9PC 2AMUA 3P4MB 4URTB 2P5WA 1NAKH 1UENA 3SDAA 5C6PB 2V2XB 4HKBB 4YK4B 4WY7L 2KHAA 4I13B 4UM8A 5IJCC 1Y18B 5ESQA 1J0ZA 2PPAA 4X6CA 3UG3A 5J5EA 5IB1B 3BAJA 3QE5A 1Y7VA 2W0PA 3ZN6A 3U2JA 5C3IA 1DQDH 5JIHA 5T1DL 1P4BH 4E41A 2AVFA 3KM1A 1S9XB 4U1JB 7FABL 3G5VA 1AXSA 5IEKA 5T5FA 3ZPDA 2HVJA 3H53A 5MP6H 1AD9B 1GA2A 4EKJA 5TGBA 4OD3L 2OTJP 3H9HB 4G6AC 3BGFB 2DQCH 4HWZA 1M53A 4BZYA 4QJ3B 1SHXA 4ACPA 4E9LA 1T0NB 3VFGH 4HSAC 3ZDXB 2Q7AA 2WLKA 4M43H 1KPUA 4Y19E 3GMPA 5E9DD 4LCCA 5IMOA 3W39A 5IQOA 2C9PA 3IPEA 4IK6A 3BYTA 1CGUA 3H1HG 1YNTB 3HE7C 4GSXA 2A73A 1YTZT 1HCZA 5GGVY 3EJRA 1MHHB 3PWPA 4RGNC 4XX5A 3HD7C 3CDYA 1CXFA 4GW1A 3JWOC 1LEGA 4K3GA 2FEEL 4PY8I 3MKKA 2N9YB 2VXUL 1KYOK 2HPOA 5IB4A 4YTPC 3P3YA 1SQQK 3BUYB 1DSFL 1YNTF 3RTQB 3ZRFC 5I18L 3F58H 4YE4H 1SEQH 2G5BB 5HVGB 3KPPB 3I2CH 4YL9A 2AJSH 5E1GA 1TQTA 3PH0A 2N3JA 1G6RA 1QFHA 1RF1B 3HI5H 4GG6B 4ORZC 3H56A 3FT1A 3KYNB 2OSXA 1N64L 2F74A 3TCLA 2H0FA 2HFED 3IDGA 2FYNC 1E2ZA 4BH8A 2GEQA 1HH6A 2Z7ZA 5HDBB 3GTNA 1MI5D 1H89A 3GK8L 4KZ0A 2QPUA 3C09B 2BVYA 2XPYA 2CGRL 5DC0A 5DWUH 3RK2B 4Z9KB 5EBMB 3OHXA 5EEYA 1KDJA 4JO8A 1NYHA 4L76A 4KRPD 5KLIB 2C3WA 2VXQA 3EH1A 2I60L 4GINA 3RU8H 3CWBJ 3PHQA 4P5TC 3E80A 2CDEA 3UPRB 1TNMA 2D2CD 4O58L 3BFOA 2Q7YA 2JE8A 1K8IB 4UQ2B 3KYMA 3FT4A 5HDBF 5CJ5A 5EOCH 4Y9BA 5D4QA 5T5FH 3FQNA 2YAOA 4AQ1A 5APXA 1NBVL 2IBZX 3GSRB 5I71B 2YAQA 1ZV2A 3BVVA 5H4YA 4R4BA 2FO4A 5HHVL 3IXAA 5AAMC 3F12A 4YHML 3CN3A 4OLYL 3L9BA 3JTBA 1NBCA 4X4ME 4BXSV 3GXIA 1GZHC 2W80C 2X88A 3I9AA 3O6ML 5BV7H 2QVKA 2G30A 3FUHA 1AKJB 1B4JH 4PB0L 4A7TA 1IBGL 3MBXL 1N6UA 1Z9MA 1JGDA 1HEZB 2G5RA 4JFXB 4FERA 4UQ3B 1G4MA 4IRZL 4NP4L 4WI7A 1MXDA 1KB5A 4M6NL 5AKTA 5ITBL 2BWIA 4L9LC 1LWUC 3QXAA 3H25A 2E74C 1CD1A 1E9OA 2V5YA 1SYSB 1UATA 1FGVL 2GSMB 2Z92B 1BGYE 5DEFB 3T0WA 1JD7A 2ZKYA 1BJ1H 3MLSH 2ZX6A 3IF1A 3WIFA 4ODHL 1LP9A 3B71A 1G0YR 1TG8A 3IJ9A 1AXIB 1CZ8H 3EFOA 3BPCA 1RXLA 4TUJB 1P84K 3FBKA 5D7JB 5KBPA 5C7XL 5D96B 4U3XA 5FK9B 1N5YH 3VGBA 4MWFB 4UINH 4HJ0C 3O6FD 1O7VA 3ARBB 4ATWA 3L73G 4XWOD 4BV1A 4ZTOL 4IGBB 3SKOA 4OLZH 3S8FB 2PCPB 4X9BA 2XN9D 3WIHA 4Z7VA 4WGWB 5F9WB 5GGUB 5JQIB 4HOZA 1ID2A 4YO0A 1CR9L 1D7DA 2K7QA 3HZKA 3KW8A 3DKHA 4I3SL 4P49A 3UJIH 4U3FJ 5ESVA 3KLDA 4AYGA 4WO4B 3V9CA 2D0FA 4K8RC 4P2CG 1YEJH 4XP1H 4X4XB 2JKRM 4HUUA 4MD5A 1BF8A 3QEUA 1CVRA 1RFDL 2R56L 4P9HH 3BAYA 2VERN 3GKWL 1INEH 5JOPE 3O6LH 2VERA 4G1EB 2IQ9L 8FABA 4WU7A 3JWNH 4G3YH 3VWKB 3RY6C 3BEWA 5I0VA 1RUKH 2VDPL 2YZ8A 4YQXL 1QLFA 4NGHL 3IFNH 4PRHB 1S7VB 3EYQC 1IAIH 4N6JA 2QSIA 3S34L 2J21A 2IYOA 3IJYB 2IPTL 2IPUK 2KZIA 2IAMA 5EBWB 5B4MD 5FLVA 2OPCA 2OX5A 2JIXD 4HIXH 1NCBH 8CGTA 2OTUB 4NPYA 3QUZA 4Y5YA 2I26N 1LTJA 4NQVB 3FF7A 3LKSB 4G42A 3M7OA 1ZK9A 4LRNH 3SPGA 4U6TA 4AYBA 3F3HA 3K3QA 5C07E 4F24A 4RIRA 5DD3H 4EZLA 4DKDC 4KVCH 4WCYL 4DCQB 3RIKA 5FW8A 3IMVA 2CK3H 4FTVA 3G6DH 2RH0A 1YLBB 3CCQP 3KWXA 4JQVA 2NZ1A 3QNZA 1TPXB 3RVVD 3B8EB 3KWTA 2EC9U 1OOWA 3OMZA 1YG9A 1HHGA 4LHQB 3N1GC 3QEGH 4Z95L 4HCIA 3T3PE 4JCLA 2KB7P 4LXFA 1RJZB 1XSOA 3LRHA 4JY5H 5BVPL 3Q3GB 2UWEA 3PHOA 4G8GA 1K8AQ 1H0TB 2PYEA 3GRWA 5DK3A 5E9DB 1F8TL 1AY1L 4I0PA 5E4OA 5AW4B 3RBZA 2VDNB 5EO9B 4JG1H 1EPFA 2FLMA 3NACH 5K39B 1BQUA 1PSKH 3GBMH 3V10A 3S3CB 4XCEA 1NCIA 1M6OB 5SWZD 4LB8A 4FNPA 5I5JA 1QBAA 4Z78A 1K5WA 2JXMB 4W7ZA 1EHNA 2APFA 3FQUA 4FNQA 1U2YA 3DOSB 1TJGL 4N78D 5I71C 5KJ7D 1XGUB 2FWUA 4PVMA 4XBGB 1J10A 3QDJB 3RDJA 4I8DA 1I8KB 1NFIA 2WAQA 1KTCA 4I4WB 3U2IA 5KAQF 2AJUH 3OZ9L 5ETUB 4WK4B 3HAEB 1X9VA 1QVOA 2WPRA 1ETZB 1WEJL 1WG3A 4IIQB 3RKPA 2V2WB 2LR2A 1CDUA 3JTSB 4POZD 1DQQB 4P46D 4PY7B 5F6IC 3VMXA 3OJDB 3ILQD 5JDJA 4ZMTA 3F8UB 4YXKL 1I4FB 1J1EB 5KYYA 2CRMA 1MI5B 3NVQA 2YEZB 2NSMA 4YL4A 2OYPA 2NY2D 3TH4T 1CBVL 3BRFA 2BVOA 1N73C 3Q1MA 3N43B 1YQ3C 4KRPB 2E9IA 3BH9B 3B3BA 1ZGLM 3OKOA 2X4QB 4LPTA 1KJVB 2D2CB 4KPHH 4NUJB 3BRDA 3IDXH 1CG9A 3KHQA 1ZA6A 3QZLA 1EO8H 3BN9D 4WTXA 3VM5A 1MFEH 1NMAH 1ZV9A 4EN3C 4PRPD 2BSRB 4GQZA 4U6VH 1FOSE 4A2HA 4F7CB 5I28A 3GI8L 1OSPL 2XIIA 1OTTD 1RU9L 3N43F 3HS0B 2QADD 3HZ3A 3DX6B 4K9EC 2J2ZA 4ZW6A 4BQCA 1CICA 3RK3C 5BW7C 2FTAA 5CFAA 1HXYB 2ZUWA 1MRCL 2XPGA 2NNXA 1P9MC 1HL4A 2CRIA 3GRWH 2W59A 3LQAH 3P30H 3F85A 4L3AA 2FGWH 2G8YA 2VR7A 1FL6A 1C5CH 4PJCB 5JHLA 1X3DA 2RFXA 1MIEL 1T03L 2XZCL 2RALA 3WKQA 2ATPB 3KPQB 3O3AB 3HLAB 5IVXE 1IV8A 1P1ZA 2BOBB 2KSJA 1M05A 2JI3A 3IFOA 2JB6B 4JGMA 3LS5H 4KK9D 5BNXD 1OW7A 2JQZA 3PHAA 4KQ4H 4X9FA 4BQ6A 5KG9A 1LE9B 1E2WA 4GRMA 2A0LC 4K2UH 1E0OB 3TPUA 4F8LA 5BJTA 2IFFL 3HE4A 3GSUA 3H32B 1QUPA 5HYJD 1RF0C 3GLAA 3RWCB 1HBWA 4XB8A 4NM4H 4OCSL 5C8JA 3C60C 1N7MH 1MCWW 3T0EC 3MLYL 4UOQA 2Q6WB 1ACXA 1U8LA 3K7UA 4Z7WA 1RURL 3O6FB 4YK4C 5D72H 1EIBA 2C9UA 2IDTA 1QW8A 3GXPA 1CDYA 4FF9A 3CCRP 1G7MB 1L5GA 3OJAB 1MDTA 1HWHB 35C8L 1I9JH 4U1MB 4W9EC 4WEBL 5C2BH 2H3NA 5L4JA 3W3BA 3GD1C 3CLWA 4HIJB 5F3BA 1J1OL 4HUVB 1X5GA 1O6TA 3LRSB 1FBMA 2B1HL 1E9PA 2CR3A 2D7NA 5CHNB 4MS6A 3V4PL 2B89A 2DMCA 3BGFC 5AW8B 1J1PH 5CSGA 3F5HA 1PEZA 1JGUH 3IDUA 5EUOA 2WLLB 2X9ZA 3GHEH 1WT5A 4FQ2L 2BY2A 5DA0B 4JYBA 5FHAH 3I75A 4XP5H 3MLPA 5IHWA 3OKEA 3BWAA 1AGEA 1H8NA 1EUUA 3QZWA 2FSEB 3MRPA 1DUZA 1NGYB 1Z66A 3EJSA 3QG7H 5JPNB 1QASA 4OZHA 4JFFA 1BFVL 1CF8H 4LLDB 4AC2A 3FQ4A 3DOIA 4Y19B 1G0DA 3V79C 2KZJA 2JIXB 2NZIA 1I1AA 2VXTH 4QKTA 1IFDA 5IQ7L 1UZ6E 4IS6B 4MCZA 1KULA 6FABH 3AZUA 2H32B 3VOPA 2DQTL 3SYAA 3H42L 3NJNA 3HG1E 2B0SH 3TESA 2Y0SA 1G9EA 3L3KB 4E9QA 1P69B 3TEUA 4AYEC 1OARL 3K6IA 3MFFA 5FC9A 1GIGL 3BZ5A 1PZUB 1M1XB 4H8PA 3F7RA 3CFMA 3ESPA 2GVYA 1USEA 4ZG1A 3SO3B 4HIQA 1UGNA 4TVPH 3W9EA 3LRKA 1RF1C 15C8L 3VXUD 1CZQA 3IDMA 3L3OB 4S0TD 3W9DA 3KEDA 4XMKH 3V6BR 1Z9OA 3HRZA 1A4AA 1OD9A 2X7LB 2Y5QA 1EVUA 1T7XA 3FO9B 5EA0L 5DZLA 3CFUA 1F11B 2KQNA 1MHPL 3RK2C 1EZLA 4NAMA 1CE6A 5D7LA 5DUPH 5KLIC 2CR6A 1K3IA 1A6AB 2GTWA 1JEKA 2ZKXA 3ET9F 5DRNA 5KVGE 1OP3K 1ZLSH 1NLDH 3D08A 1RZIB 1U8CA 4X50A 1T1ZB 5D9SA 4MQ7B 1G9NL 2NNAB 2UUDH 1LTBC 1JNHA 4WTWA 3VXPA 3JTTA 4ANUA 4X6EB 2MHAA 1C5BH 3IBEA 1UWFA 1KG0B 2XOTA 3MN8A 4JQXC 5SWZB 5CUSL 4DP1X 5E5MB 2EECA 4FL4C 5FUOL 2ADJB 4R7LA 1U8QA 2AK4E 2V8MA 3IAQA 2H45A 3OBAA 1WC7A 5H2BB 3OR7B 4GFTB 4KJPC 4NZDA 4OLUH 3U6RB 3ISWA 1S46A 2UY7A 3DETC 2Y06L 1A7PH 3N5AA 3WNLA 1BD2E 1LT9C 2A83A 2XDJA 3FCBA 2A74C 3COOA 2BSEA 2CO4A 1WS7A 4P46B 5C92A 4FZEL 5F1NB 1PFCA 3ZDZB 1NMBL 4N20A 5F7MC 1UEMA 1HCYA 3FK3A 4NKOB 1NHLA 1I9EA 2OZNA 4AGMA 3TN0A 2OK0H 2E7LA 5E4EB 3Q8AA 4J1UB 3B8SA 4GRLB 4HK0A 2Z8WC 1KILA 4HWBA 3VXME 1TYJA 1WZ1L 1NEZG 4ZPTA 2ZT9B 3Q5OA 1J12A 3SE6A 5DD5H 1EEYA 3HI6H 3ZDZF 1IGCH 4Z7OE 2X2JA 4PRPB 4IBVA 4BDVA 4N2CA 3QO1B 4NOFA 1IFGA 2WINA 1R0AH 5C0DA 1EDIA 4M7LT 5D7JC 2ZD0A 4HKXA 1P6FA 3QDMA 2BZDA 4Z7AA 2UZYA 5EF1A 5IFJA 2VQ4A 2UXVA 5D7IA 2IWKA 3ARBC 4MD4B 3WN5A 3CFQA 4IGBC 2E59A 4LAQH 1MFCL 4IOSD 1HF9A 3O9WD 1DDHA 5F9WC 5CP3H 4L74A 2IDCA 2GITA 1UG9A 2ZXAA 1N4XL 3D8MA 5D1XA 4C4KO 3QORD 2NYZA 3L2MA 2C9LY 1QYGH 2H89C 2QFRA 3CHQA 4HGWB 2Y2TA 4IJTA 3WU1A 3L75E 1KJMA 4LL4A 4JFPB 4K73A 1UM5L 4RISH 5DJDA 3ETBF 5FCSH 1P84I 1P7QD 3G7TA 4G5ZL 1XF2A 2FYZA 3CVHL 5TK4A 3GJFA 1HN1A 2N56A 1FGNH 4FFVC 1NBZB 5DJ8B 1I7TB 2EXYC 3INUL 3LH2H 3FYIB 3O11B 4LGSB 3QH3A 4NN7C 1LWHA 3SKMA 4OCMC 4RRPG 3UAFA 2X9WA 4X80H 4NXSA 1KB9I 1DLFH 3GNMH 2AXFB 2FT8A 4YHPB 2Z91B 1R5LA 2EDBA 2HUEA 4LARL 5E6SB 1PV3A 4ZD3L 5EEUA 3AB0B 3IGAA 3QRGH 1I8IA 4JN1H 1IQDB 4JVPA 1JY3O 2IBGA 3BSHA 2K9YA 4QHMA 4KMLB 1KCLA 4ANWA 3B83A 1MUJA 2R29H 3M07A 3UTTE 3OLDA 2BMKB 2XVGA 4U3SB 2B3RA 3VQLA 3STLB 3OKMB 2J4WH 4ZXBA 3WMM0 1XVSA 2V9UA 4MA8H 4QF1A 1S7XB 3VI3A 4C56E 4MJID 3AE2C 2E7MA 5LXGH 4UOW0 2AJXH 1LO4L 1TPXC 3UFIA 2OXGA 4N90D 4L5FE 2BCKB 2CPBA 4ODXA 3T65A 3K1KC 5CZKA 2Q8AH 1A1MA 2Y6TE 1O5DT 3RDTD 1N9PA 4XVJH 4GP5B 3SE8H 4QAMB 1J1XH 5EU6D 4NUQA 9CGTA 1DBAL 2Q10A 2F15A 3ZR5A 2HMID 3RA7H 5CCHA 4PJ5E 1HQ4B 4LFHD 2ZNXA 2ICWJ 1OOAA 1OEZW 4AZ8B 4XWGL 3L2LA 1UD3A 5E9NA 1QSFA 1L4IA 4LSDA 5KEZA 2GT9A 5DVKA 5I73C 4D9RD 4OCRH 5CCGC 5KS9E 3JWOL 1H8AA 4JFDE 1CFVL 5FFGA 2ZXEB 5H8DA 1V27A 2ENYA 4EZJA 1NKNA 2AXGA 1DBBH 1GC1L 2YBRB 5CZXD 2XNXA 1WZLA 2QVTA 3FO2B 5KSVB 3QCTL 1IGTA 3Q6FB 4MCYB 1A4KA 1B2WL 3LKOA 2AK4D 1KB9E 4AYFA 1OP5H 1TT6A 5F9OL 2NY0D 1WH0A 1XEUA 4YHNA 1KGCD 1EEZB 4WY7H 5HGAB 1BD2D 3UTZA 3ZX1A 5E79H 1HKLL 1OVRA 2ITFA 5TJWK 2Q8BL 2D7MA 5DMKB 3NTCH 3MJWA 2YD0A 5EF0A 5T1DH 1IL1B 4BRVA 4XC1L 1NFAA 2W65A 3VVWA 4BGDA 1RULH 3RZWA 2D2CC 1BCCJ 1Q9OB 2KUTA 2OJZH 4OZFH 1TSRA 3TFKD 2CH8A 1N18A 3VACA 1XF3B 1TYEB 3PWLA 2WOBA 3UIAA 3FSVA 2LOEA 3CLQA 4H88L 4XNZB 2X4UB 3MLTA 1E8XA 4A66A 4FFWC 1PNDA 3GSNB 1BIHA 4MJJA 2EVJA 1H3XA 4HAFA 5CJ8A 5LBSL 4PJDA 2OJEB 4CDGC 2I8DA 1J5OL 1V55B 2DBJA 5HHNB 2KK7A 3TBYA 2C1PA 4FQLL 3V4WA 3VW3H 5F44A 1EJOL 5A2CA 3TNUA 5AVRB 5IOPB 1QTSA 5IP4A 1B2YA 1YECL 1B0RB 3SJVD 4GUPB 2A1WL 2JFCA 2BSSA 5B3NA 4FOMA 1SXZA 4R7NB 1KYOD 2VXUH 3A23A 4OGZA 5CINL 3RWEB 3Q43A 1AIFB 3BPNB 1SQQD 4R97B 5J4MA 1E5AA 4YGVB 1JYNA 1FOSF 4JFWA 5FWQA 1F6FB 5I18H 2EDHA 3LKRB 3DX3A 5GS0H 4V2CB 4L8CA 2BY1A 3ZO0A 5CEYA 4WRLA 5HYEA 1JNJA 1N64H 4LNVA 2OL3A 1MFZA 3TVMD 4Z7UA 5IVXB 4G11A 4AUWA 1C16A 4OF0A 4PEEA 3GK8H 4WUUA 3UIZA 4AVHA 3EYUH 4QTHB 3BKYL 3CFEB 5CJXC 3ZTNH 2K6WA 3ZQWA 5I6OA 5K9KA 3VH8G 1R3LB 1RZ7H 1S7WB 3EO1B 2VDKH 2A6KA 4MDIA 3T6ZA 1Q9WA 1XGQB 4FG0A 2ZSVB 3UAEA 1JF1A 1KDIA 4DGIL 4LSVL 4O58H 5HJ3A 1WTGT 3O6FC 3FU7A 2DWDB 1FDLL 1T3JA 3EF7A 4H2AA 4XWOC 5IVXF 1BQHB 4MQTB 1KEMH 2V5TA 1KJ2B 3H1HD 1CFTB 1JZFA 3F64A 4EUPH 5BS0A 1R5IA 2IANA 3CFKB 2C1OA 3VCLB 3FOMB 1G1YA 1ZLLA 3BCDA 5TE4H 4D2NA 2A38A 2VRQA 2AEOA 2F54A 3MTRA 4ZFQA 1AS8A 3NEEA 2MOVA 3TF5A 1HIML 1V7ML 2KH2B 4L4VA 3NAAL 4OLYH 5D7KE 1OLLA 5BMFH 4Y8AA 2GY5A 2VSKB 3F00A 3MVSA 5E2JA 1SJVA 1AZCA 1JUNA 4AEFA 1P7QB 1IBGH 2A4ZA 4UNVA 4DTGL 4ABQA 3TO2A 3ELQA 1NOHA 4NS0A 3D05A 5C0GA 4A39A 1SQVD 3B4SA 1U3ZA 3SGEH 2H88C 4PV1D 3WUUA 2N01B 1BGXL 4OKVA 5JPNC 3EBAA 4M5ZH 2R1YB 4M6NH 2LAAA 1XH3B 3KNBA 1MFUA 1QMUA 2HLAB 3GKZA 2B08A 4Y16A 5IROD 2P26A 3N85H 3H3PL 4BKLA 3IS0X 1F2XK 4DZBB 1NWOA 1WRFA 4ODHH 4LEOA 4R8WL 4FXKB 4PGDA 2B5IB 3GMLA 4YR6B 3WLWD 5LGHL 2AGJL 3WDHA 4R5XA 5J1SC 3H2PA 4CVXB 2L4OA 1EC5A 4L3EE 2C4XA 4GO8A 2XVLA 2YD7A 2NLJB 2RQEA 5CIPB 1CFNA 1YYCA 1P84D 4BRYB 1KC8Q 5DDHB 1NTMG 3SO3C 2OL3H 1ZK5A 2IDBA 3GHPA 4R4LA 5C7XH 2GTQA 5DU7A 3TYYA 4MJIB 5IHUH 2ICEC 4GSDL 1I3GL 2ZSWB 3ZE0E 4D6TE 1G7QB 5EPMA 2EDEA 4ZTOH 1NO4A 2A4CA 3PWUB 4DN4H 2NW3B 1JERA 1QATA 5B66H 2V7NA 4S0SD 5IKCB 4DGYH 3QUXD 2FWOB 4I3SH 1UZ6F 3QQ4B 1OD7A 4P4KA 2A06E 2ZWKA 3RDTB 1QPXA 4G9DA 2B9BA 4CPGA 3OL2A 5KSBA 3P0YL 5EU6B 2I69A 2V2TA 4NBZB 1W15A 2J73A 3FUMA 4PP1D 1RFDH 1D5XB 5DZJA 5K33A 4ISVB 3GKWH 2VDMB 3O3DB 2YKLL 2IQ9H 3L70D 2XZQH 1T7ZA 3ARVA 1JDDA 1XTCC 2G4GA 3QULA 4JR9H 4YDKH 3CZFB 4P2RE 2WUCL 5GIRA 2F53D 4FLRA 3PWVA 1RIHL 2FAUA 5KJ7C 5IQ9A 3OB8A 1YIJP 1Z2KA 3RUGB 4N2NA 1NJ9B 3DV6B 4PG9B 5FYJE 2JI2A 2MJWA 4HFUL 1S8DA 5AQ0A 2NPSA 3H3BC 3A22A 1YPZE 3MXWL 3KLSA 3MR9B 2AK4B 1C8QA 4POZC 2EIMB 2CUIA 4P46C 5K69A 4TQ8A 1NTMK 1ONQA 2NY0B 2WT7B 5K1NA 4J3OG 2D7OA 1BD2B 3HR5B 5DS8A 2IOOA 4GRLC 4HSCX 4ZPVA 2R0ZH 1KZQA 3Q6GL 4NCC2 1ZAGA 3L73D 1KCVH 3RUGF 2WPGA 2VZOA 1A6TA 2FHCA 4AW4A 2VR5A 2ZT9C 2OYIB 3H2WA 1FZCB 4FQHB 4GIAA 4RMQA 3ME0B 1A65A 4F8TA 2BDNH 3BN9C 1S5LX 1JOCA 1I3UA 5JDSB 1AAJA 3VXMB 3HHMA 3RY4A 3H7BA 3M1OA 1UD4A 4L75A 4Z95H 4WI5A 1T3UA 1NTZJ 5CILH 1OTTC 1J88A 5DUJA 1NIEA 3RZCB 4DP2X 1F90L 2X4SB 1ID5I 3VI4E 4Z7OB 1Y1UA 4JRXD 1F8TH 3Q8FA 4NO3B 1AY1H 2P5PA 2X38A 4N6RB 4QD2E 5FW7A 4EO5A 2R23A 3P40A 1P7HL 5HDOA 1IC7L 4FNSA 3RRQA 4K9EL 5DTFA 3KHUA 1MCQA 3QJFA 4R7DA 1CQYA 3MBEA 5FHBH 1IM9A 3MCLH 5JW4M 4HFWA 4GT0A 3SJVB 4HB1A 4P57B 3FXIC 3TOPA 4K3AA 3BP6A 5E7BA 1WFJA 1YN6B 1OCRB 3EFFA 3ZHKA 1C5DA 3QUML 5AOZA 4N0UE 3NTNA 4Z7OF 2ITDA 1TJGH 3MV8A 4XZUB 5FUCE 3V0VB 1AOHA 3HIZA 1IC5L 4FKHA 1UOVA 4KNTA 5GTIE 4CADA 4EQ3A 5FM5M 4KK9C 4XBMA 1WEJH 4UZGA 3QA3A 1FBIL 4QRQB 1FDIA 5D7SH 5F89A 4EDXA 2EVIA 3TVMB 2I27N 1E4KA 4NKQB 4GXUN 4JY6B 2FH8A 3I9IA 2ZAEB 3BDYL 5AVZB 1CL7L 2YLHA 3G5ZB 5I24A 1NCCH 1WBZA 4PP2A 4TL4A 3S0PA 1JK9A 4LSTH 3FH8A 2AJYL 1DVFD 1EO7A 1U95B 1YEIH 3SPVA 5H35A 1DTUA 4JHUA 4XP9L 2ZOLA 1V3JA 4FRWA 3RL2A 3VO0A 6CGTA 1ZLVH 1UYWL 1RZ8B 1BEXA 2HUHA 3AB0C 3TGUJ 3H6AA 1OSEA 4K55A 5ADPH 4LP5A 1U33A 3LKPA 4JG0L 5GJTL 5KVFH 1ZLDA 3TP4A 2N0KA 4X9YA 1BZ9B 2XLLA 1QNIA 3GI8H 4G7VL 4NRYB 5I2IB 3EUDA 2Z0UA 1GCYA 2VLRD 5KYUB 2DWSA 3PJNA 2GEEA 5TPWL 1AV1A 3ZO9A 4EXPX 1SMDA 3B2VL 3N9GL 3EBHA 3RWGA 1AQKL 4N2BA 3L54A 4IBYA 4AQZA 4LOEA 1LD9B 4ZTPL 4F7TB 1UXWA 3AE1C 1ZV8A 2BNRD 3CHRA 1B4RA 4HJGA 1R5VA 3JVFC 5INDA 1EAJA 4L0YA 2RTTA 5LGKA 2ENSA 4LCWA 1MIEH 1TZGL 3OX8B 1XSIA 3OTTA 1T03H 3M6DA 4FNTA 5ADOL 1EBPA 3OVUB 4MXQD 4EXKA 2HXAA 3HZYA 3TCXA 4NIYE 3JCUE 4OR1A 4XP4H 4FQCH 5F7NC 4KVNL 1JPGA 2CHNA 2WSEH 1VZHA 5BZZA 1EO5A 4ASVA 1YRKA 4C4BA 1IAIM 3ML9A 5E1AB 3FAXA 4PJ5B 1LNUB 4QRTA 3AY4A 2M2DA 5I76A 3CDFA 4F92B 2VM9A 1NIAA 4W93A 1NVOA 3ITKA 1UWYA 2P24B 2VLKD 3QFJA 4AZUA 1ZCRA 2ROXA 3MLYH 1BXVA 3IDYC 3G9RA 5APVA 5KLVG 4G1MB 4LLWA 4P2RD 5TFSH 2YXQB 4ELMA 1U7JA 4JFDB 1UJ3A 3V95A 3EOTL 1D5ZA 2VWEE 4MCMA 3MBWA 5EDSA 1RURH 3T4AA 4F33B 4BELD 4UM9D 5ICUA 3IKKA 1QEWA 4PSPA 1TENA 35C8H 3MYJB 5L7XH 3QUXB 4F1ZA 1GJWA 1U8PA 1XIWB 2QSTA 5DS1A 1E5CA 3FH5A 1GR7A 1GAFL 2WQAA 5KANI 3AC0A 5KS9F 2WJ7A 4QRPD 2B1HH 3V4PH 1AZRA 1HOCB 1PZ3A 4AL8L 4N8PA 4XNZC 3I9PA 2BCCJ 2YC1B 1T6BX 5JNYA 2CKBL 4RKUJ 5IJKA 5BZDB 4FQ2H 2K4AA 4FA8A 4UB0L 1NBYA 1G87A 2AZUA 4MJ5B 5KBKA 2EDJA 2AKRA 4FQJL 4LL1A 4N2OA 2F53B 2BC4A 4QGYA 1JZ8A 3UBXI 5LGJB 1ADQL 4XVUD 4HJGH 5BQ7B 1S4XA 3RTLA 1E42A 4AH2B 1E67A 3DI3B 3OWEA 4FHKA 1W9XA 4DP8X 2JTYA 1OANA 2R2HA 2YAFA 5EWIL 4QNPF 4JKPL 3IJHB 2R3CA 3DARA 3S96A 4XB7A 2Q86B 3WKMH 1J7VR 5IQ7H 1JZ3A 2WZ6A 1TETL 2DIBA 2DQTH 2AAVA 5KAFE 4Z3EA 5KLVK 3BPNC 4R97C 1SBBA 2OMWA 3ZDYE 3DIFB 5L8JB 2HTLD 1F13A 1NGWA 3AEEC 4I89A 1AA0A 1URQB 2GJ6A 5HGBB 3S4SG 2CSPA 4YXHH 3IMBA 1QSEE 4X99B 3V0IA 1JN6B 4OLWL 4YAQB 3SHSA 1VEMA 2WCGA 3LSOA 4A04A 3HA0A 1D9KA 1SP4A 3WO4C 2P2UA 3DYPA 5KVMC 1SY6A 4GQ9H 1QOKA 4ZMPA 2LV4A 1JZ7A 3WAKA 4AXWB 2BP3A 4LSUH 1ZT4B 1MHPH 4GH7B 1SUHA 3G04B 4LRIC 1KPRA 5M1BA 3KBEA 5F7FA 1QEXA 1QTYT 4JRXB 1U30A 3GC3A 2W92A 3LZRA 5L2KE 1YEWA 3I6LE 3QB7C 4JFED 3WCYA 5AOLA 4AJVA 4PJIA 4X5WA 5IB3B 1AR1B 1QNZL 3GJEA 5JIMA 4KNQA 1AVYA 3HVDA 1ZDSA 1JGIA 3CDGB 1FNHA 3HS8A 4TVUA 2WTYA 2EEDA 4IRJA 1BPLB 2ARJQ 4IOIB 4TL5A 3QJZA 4KGJA 1ZW0A 2BWDA 1J0IA 1XQ4A 3RIAK 2WSFJ 4IJ3B 2X3AA 2Y06H 1A21A 4PJXA 4BSVB 2NNRA 3AE4C 3FHAA 3PE9A 3TL5A 2V9QA 1CK0H 4XR8C 3CX5I 2CHWA 3NOIA 1S9VA 4HX1B 4BRJA 3UO1L 4RMSA 4RFOL 3L3IA 5JW5B 5BRZA 1JZ6A 2O5YL 4HS6A 2QJYB 3U7AA 4F58L 1YY8B 4DGVL 4OM1L 3RVXC 5C0ND 4ZX5A 2KERA 4OF7A 4GLRH 2VLLA 4LPCA 4ABVA 1M2VA 4UTAA 1DVFB 3FB5A 1OO2A 3CC5B 3CD4A 2R0LL 3FB8A 4WGVB 4I18B 2UV3A 2W9EL 4LSPL 5D2LE 4B9ZA 3QUYD 3EO0A 1KTLA 4F9PA 1RUPL 1OGTB 2P42B 2B3IA 2B5IC 2AITA 4FYSA 2DLGA 3P7KA 3P3UA 4OM0H 4AGQA 4A7VA 3QWRA 2ODIA 3EXLA 4WWID 2ESVE 4FLOA 1LQBC 4YDVA 3CJJA 4NKMB 3BSZA 1TZOA 4NWUL 1SVCP 3D3VE 4P8QA 2XQBH 4DZ8A 1CXEA 2VLRB 1L6XA 4PS4H 5AZUA 4GRWH 3A6CL 1SLQA 3B7SA 5ACZA 2YWYA 4YHZH 2OA9A 5I9QB 1A7OH 1PY0A 5TJHA 4Y88A 1XCQA 1ZHKA 4DT0A 2VR4A 2LU4A 2QSCL 4NQCE 1U92A 2AJZA 2J44A 4XMXA 2ADFH 2BNRB 2C4FU 2IH1A 2M1KA 3RWFA 5I1HL 3RDTC 1G7JB 4G9FA 3HE7A 5J6GB 1A6WL 3B5GA 4HCRH 5JIDA 2ADGA 3PJSK 1JWSA 5CJOL 1LJ2A 5C0FA 2HMIC 3HD7A 3H9SE 3WKPA 2HPTA 2HYNA 1GZPA 4PJAE 4Y5XC 3CX5E 2CUHA 4PRIA 5ESAA 3CVHH 1L9MA 3ZE0F 2EO7A 3H1IG 1DH3A 3N50A 4U6HB 2VL5B 5K9JL 3ARWA 2YARA 3GSWA 4L4TD 3INUH 5E08L 2X10A 2V3DA 3N1PC 1Q90D 3WD5H 4W4OC 5CZXC 2KZ1B 2Y9RT 4NKDB 3TT1L 1DN2A 4TSBL 2VLKB 3PGCA 2WVRA 3LEVH 1BXAA 3P73A 4PJEA 1NTKJ 4P2RB 3H1KG 3FPYA 5ABAA 5EF2A 2BS71 4LARH 4LQFH 1AS7A 3GSQB 4BK5A 2UY6B 3V9FA 3SIKA 2EIDA 5CD3B 5DFWH 4UM9B 4GQQA 3MO1B 4PN6A 5ITFA 3MIWA 2VW6A 5L88H 2P44B 3NBNA 4NZTL 1LTXA 1AQ5A 4PB9L 3PS6A 4NDMB 4P5TA 1LE5A 2OYIC 1FZCC 2ZYSA 5ABDE 5DHYB 2W07A 4XNMA 1LO4H 3TFKC 1WFUA 3UTQB 2POHA 3WFCL 4AUJA 2A77H 4JZOB 3ULVD 1BCIA 5AVUB 1YPZF 2GTZB 3MROA 5KVEL 1FJKA 4A2GA 1HH0A 1ORSB 3RZCC 4PD4H 1MCFA 1SDDA 4OD2B 4FHJA 3CVIL 3RAJH 4NZUL 3SPJA 3QI9C 1PG7H 2FK9A 4FI8A 4HOMA 2IBZG 3VUAA 4K7PX 2Y3NA 3GHBL 4K35A 1GZHA 3P2BA 4EIZC 4KKAC 3X1NA 1U2HA 2Z7YA 3AG3B 1X7QA 3CMGA 1S7RB 2GI0A 2AABL 4TQPA 1CUOA 2A45H 3U7WL 2HJKB 1VERA 3SKNB 3JWOH 1PP9E 3L71J 3MUDC 4B9CA 1DANU 1YN7A 1D5IL 2I9LB 3VD2A 1RIVL 1IKNA 1QACA 5FYKD 2ICWA 2QZ5A 3ZL4H 1WHPA 1AMYA 3QCTH 2YS4A 3BPOB 1NMCB 3X12A 4HKZA 4TRPL 5IESH 3VI4F 2VDLL 1TQWA 2ENQA 5L6YH 1NDGA 1M1SA 3OKDB 3ROOB 4H0LC 1Z0NA 4N5ED 2Y7QB 3FRUA 2OAAA 1T5WB 1B90A 2VMJA 4V1DE 4ONFL 3F7PC 3JV6B 3D39E 3HUSC 1J11A 2R69L 5HDQH 3C2AL 2YRBA 4RH4A 4CVWA 1GDTA 1F6AA 2FECL 3PIQA 4XC1H 2P5WE 4ODVH 4YFLI 1V5JA 4JDVB 2AEQH 4JFEB 5I0DA 2F8XC 5BZWA 5ALBH 3S36H 4H88H 2EJ1A 4L29B 1WSST 2EABA 4IRSD 2OZ4A 3GO1L 1P0SE 2ZX7A 2FXMA 3HNVL 3T3ME 5B8CC 2HA1A 5KZCD 1TJXA 4E41E 5B1AB 3T1WA 3FTSA 3D87B 3WS3A 4U33A 5GGSB 1Y07A 5JXAL 1G7IA 4WUKL 4KXZI 3WOVA 2Y6SD 2Y5TA 4HDIA 3ULSB 3DSFL 5AAWC 2UXGA 3ZIYA 1MY5A 1R3JB 3AE9C 3LW5H 1ANUA 3I6GA 3UGXA 3V55A 3U79A 1BLNA 2HFFB 1WD9A 3U1SH 1MQKH 1YECH 2XJLA 2J6EA 3BO8A 2CRYA 1S5LH 3HBPA 3V6ZA 2WWNA 5DK2B 1X7SA 4M6OH 5TISE 2O5ZH 4NEHB 4FLSA 4KTDH 2VRAA 3DHMA 3PWPE 3VQMA 2DQIL 3TBTA 5IROC 4KMQA 3U9PL 1NL0H 5D93B 3QQ9C 2CCWA 2HN7A 5F3FA 4JFTA 3QUYB 2MQCA 1XBDA 1AR2A 5CMAB 2YUZA 4KDTC 3WLWC 5J3HD 1UADC 4R0LB 4MBRA 2KNCB 4M7JH 1RUQL 3NFPA 3D4GA 3G6JA 3KJ6L 4XPAH 4MA7H 3A6OA 3MV11 1ED3A 1MV8A 1KNOA 1LMKA 2KUBA 3U4BL 1NUNB 3V2PA 3CPLB 1DBJL 1LM8V 3EOAB 3H7LA 4M02A 5EO1B 2OR9L 3WIIL 2J5LB 5FGBC 4GSRA 1ZHLA 1NC4A 2NQCA 3NGBB 4ICXA 3MKGA 4UCFA 2EQDA 2NTFB 3QUXC 5T1KA 2PLTA 1XIWC 1ND0B 3E8VA 5GZNA 5JXEA 2JK5A 2DMGA 2FWSA 1A7BA 1EZVY 1EVTC 1E7VA 1GGUA 2A9NH 2EE9A 4WSGA 1V7MH 1BQSA 3NAAH 1HXMA 5L9DH 3H1JG 3EJPA 4NERA 1CCZA 1CFQA 3VJ6A 4FXTA 3PP3H 4K8RH 5D8JL 4GW4B 1MCNA 1QG3A 3BE1H 1NEZB 2R0WL 3L5WB 3E1ZA 3MRNA 1Z5LA 5T33L 5K9QI 2G75B 4L4TB 4AYID 4FD0A 3X17A 1GTNA 2GY7B 1A22B 2PR9A 4HGMA 4O02H 2OV0A 3RX7A 4ZTEA 1JY3P 1ACYL 4QXUH 2ZP9A 3NFSH 5HHOA 1PL5A 4QXGL 4RA0C 3H3PH 1TU3F 1HYSC 4NQXB 2I07A 2WAHA 4MB3A 1QFWH 3F7VB 5HPMA 4W81A 4R8WH 2UX6A 5CS7A 5LGHH 2WQUA 1VKXB 2FJGA 3MNVA 4R90H 1N8ZA 3KPOB 4NNXB 3QNXB 2VKXA 3ARFD 3REWA 4CU7A 1FVDB 2WMPA 3T1FB 4BJLA 1AHWA 4UBDD 2X6MA 4NQSB 2YXRB 4BZ2L 1URQC 5FS5A 4QI3A 3ARGD 5ICXB 4BCXA 4NZRL 1H9VA 3DVNB 3BKML 4OFPA 1QO3A 4GSDH 3U9UB 1I3GH 1MCLA 3ZDYB 1DQLL 4HLZG 1MHEB 4PRAA 2HJFA 2X4PB 5DMGC 4WFGE 3WXWL 3DXAA 4H8WC 5EIQA 5EC1A 3VFWA 5LG1A 1RZGB 1QKZL 5F1SA 2Y24A 3ATBA 2BIOA 2Q2LA 4Y4FD 3SDXB 4BSJA 4WFEE 3HKZA 2DI7A 3P0YH 3VXTB 4N2MA 3ZDYF 4OH8B 2CDGB 3P54A 1TIUA 1ZWIB 1AR1C 4K3DL 2PABA 1AD0A 1EJ8A 3AXLB 3TV8A 3RFZC 3ULVF 1CURA 5E2TH 1S7SB 2JB5L 2R4SL 2QTVA 4Z8FH 3T97A 3SE3C 3SEPA 4HQQL 4R2GB 3S3PA 4ZMYA 1JTHB 3SDXF 1RIHH 1ETJA 3P3TA 4BH7B 2QHLA 3FOLA 4IJ3C 5KSAC 3M06A 4S1SL 4XMPL 3S35L 5KYWA 4YVNA 2VABB 2XKUA 4EDFA 3ILDA 3NSYA 4HFUH 3SBWC 3J2PA 4IL6X 1L9OA 1TZ8A 4MASA 3CC7P 5IREA 2ZCLL 2WLIB 3MRGA 3TBSB 2ODHA 1NTMD 2QJYC 1GYAA 2DQJL 2JVUA 3FTXA 4TQEL 1HESA 1MZYA 5ECJE 3A67H 1X9UA 3W11D 5A3IC 3O6QB 2IWGA 3ZKND 2FDBP 3Q6GH 4EE2A 7PCYA 5KVDE 3C60A 2DD8L 4WEEA 4I18C 4Y5VB 2P5ED 3T0EA 4HAGA 5DJAA 2DDQL 3P4MA 1OXZA 1OAYH 4NLAA 2V2XA 3CWBG 1LP1A 4HKBA 1XH2A 1Y18A 2R1XA 3DRQA 2OARA 2Z5HA 4LIQE 5IB1A 1THCA 5D2LB 1SDYA 4IRSB 1NU1J 3KS0H 4YLCA 4E2OA 4DUXA 1N7SA 1HGVA 5DZOA 3BVNA 2G2RB 1RZPA 3JSSA 4S10A 4JFUA 5KBNC 3O45A 4FTVE 1S9XA 4U1JA 5F7BA 3C5JB 3HG5A 5I15H 4MB5A 4NO0A 3ZE1B 1AD9A 3D2UD 5IW1B 3K2UL 4PJ0E 3H9HA 3ZZSA 1GL2D 4NJ9H 5K59F 1NJIQ 5I9QC 1IC7H 3OKYA 1GYVA 5KLVE 4K9EH 3CPWO 3G4SP 5D2LF 5AL8A 1QD0A 3HE6C 1PGOA 1FZJB 2NR6D 4OZ4B 1WA2X 2D03H 2UWEE 4G8GE 3L74G 2PYEE 6PCYA 4L48A 4V33A 3ZE1F 1QX8A 1YNTA 4NQCB 4XNUL 4MAUH 4CBZA 3NRFA 4ZFOL 5AVQB 4LAJH 4MXQC 1MHHA 4WI0B 4DQOL 1IC5H 5SWSE 2D4FA 4J3OD 2ZJSE 4LLYB 1MFVA 5F6HJ 2ADIA 1ZVHA 3HG2A 1N2DC 5EO0A 4GUCA 3AQYA 4ZS7L 4OTXL 1YMMD 1YEEL 3NJHA 2HVKB 1X5IA 2KBGA 2UZPA 3BUYA 4LKCB 4WJG3 3RTQA 3PV7A 1CL7H 4XHJD 2WSCJ 2G5BA 4B9IA 2ZCZA 3KPPA 1Q1JH 2JJTA 3TM6A 4PJBB 5CJQH 3E8UL 1RF1A 1Q1PA 4XP9H 2I5YH 2JKJA 4GG6A 3KYNA 4UV7H 3T09A 1OW6A 4F80A 5D70H 2ENPA 5BQDA 4MFHA 5FXCH 3SZKC 4A7PA 4FXGB 4JL2A 4K0OA 4U4IA 5C0RL 1IE5A 1SXNA 4PJAF 3NP4A 3NQKA 1FSKC 2DKUA 4G7VH 4KQ0A 5BUGA 4PJBF 3AGVA 1FFQA 1KACB 1KBGL 2X70B 1F1GA 3I3BA 3MZTA 5TPWH 3UPRA 4LC1A 2X1XR 3S37L 4PAZA 2KLVA 1P4LB 1UCBH 3N9GH 1AQ8A 1K8IA 1M7XA 4U3FG 2Z1PA 3NIGB 2FIKB 4QIRA 1TTFA 1TZAA 3U1CA 4JQXA 3M88A 3UZEC 2DQDL 3ROLB 2MJZA 3GSRA 2XQYA 1XGTA 1TZGH 1SHWA 3K6DA 1C7SA 1J8HD 4JO2L 2WVVB 3VXNB 3PJLA 1UUSA 3GF7A 4KH2A 5KTEH 2C3VB 1AKJA 1VDFA 3VMOA 4WFED 5DLLA 4KVNH 5T3ZL 3C8DA 1XGYL 4JFXA 4KX9A 4UQ3A 3RL0g 3VH8B 4WEUD 1G9HA 5DQDL 3ARFB 4KAQL 4H1LH 1MPAH 3QPXH 4NQUA 5LNGA 1FFOB 1HI6B 2CHXA 3NRPA 3VRJB 3LHPL 1BVKB 3BQVA 3H0TB 2X40A 4L3CB 5H94B 1SYSA 5HI5D 5I66B 5DEFA 5DK0B 2Z92A 1HZHL 3LRGA 4S1DD 1F58L 3BVXA 5C08D 3BPOC 1XXFC 2FXOA 3V52L 4AYDC 3NCFB 2FBOJ 3QISA 4TVPE 1UM6L 3W2DL 3FSOA 4IKJA 3N41F 3MV7E 3RPKA 2X53A 2ZX9A 4ZO8A 4A2FA 3BVDB 3GF8A 1USZA 5AVTB 1LGVA 4TUJA 4YSTA 5CLZA 3UEQA 5FK9A 2O6PA 3EO9L 2PYFB 2IOMA 3NRQA 4MWFA 3TJEL 5AB1A 2AEPL 3UROR 3ARBA 3BDXA 3ULUE 4V1DB 3NJKA 4UWQB 5DGQA 4IGBA 3M1CA 2RN0A 2PCPA 3B4NA 3MLXH 2YSSB 5DYOA 4CMHC 1ZR4A 2W1NA 4G72B 4Z3GA 3B5ND 4UB0H 2YGQA 3HC3L 3SDAB 4X5LA 2FEJA 4UM8B 2K1AA 1UWXH 1J0YA 4WO4A 2OMXB 1SYVB 3MLUH 5B38G 1FH2A 3IJSB 3NCWA 4X4XA 3T3MB 4N3YB 1U3HD 5T3XD 1ADQH 5TF0A 5EUOE 4UQ9A 1JOIA 5F9AC 5IEKB 1ZANH 1XCWA 4ZYKB 5F3HB 1O6SB 3RGVD 5JMOC 2AERT 3TV3L 3AU1B 4JKPH 3VWKA 2ATAA 4QUOA 3SBPA 3LKNB 1XTGB 4YHLL 2X89A 1OZHA 4N8VG 2H2PD 4Q6YA 3CX2A 1TETH 5F9JB 5I1GH 4PRHA 1L6PA 3MUY1 1VF5D 1S7VA 4OZHE 4JFFE 5H2FE 3HBQA 4FLHA 3MJ9A 3T3MF 1PZDA 5EZLB 2XXMB 3MZWB 5D93C 5E1IA 3O2DL 2E3VA 4W6WB 3IJYA 4LCCB 3VFTB 5EBWA 2P5EB 2IBZI 4IBTA 4JN2B 3QUYC 4OLWH 2OTUA 4HT1L 1PLBA 2X6VA 1MCOL 3BMVA 4NQVA 4OCWL 1DL7H 3LKSA 4P2OD 2P52A 2D7QA 4R0LC 1Q9KB 2JKLA 2B4CL 5SWSD 1LEGB 5A43C 2HRGA 1BE3G 4FI6A 3PDGA 5EORH 3TZVD 5KN5B 2FD6L 1DEDA 1FNSL 2MCPL 5T3ZD 1E43A 4HV8B 4DCQA 1M9WA 1NAMB 3KL5A 3V5KA 4YSCA 2YFOA 3D2UB 3ZRCC 2J5LC 1GL2B 2ZQKA 2EKJA 1UQSB 3WS6A 3NGBC 3I6SA 1CLOH 1CBJA 3D12B 5GISL 3FH7A 2B15A 2V5MA 5D7LE 5EU7E 3TCLB 3IDGB 3RYMA 3WNIA 2XU6A 2X1WL 4I77L 1ESOA 5E9DA 5LUMA 4JO3L 1H0TA 5H37H 4FE9A 5DSCB 1AGFB 1INQA 1KYOJ 1PYWB 1SXBA 2KP8A 2IWEA 3ERXA 2AJ3B 4FQIL 4X4ZA 1A8JH 3OHXB 4PRBA 2JJSC 5EO9A 2XWZA 1RE4C 3AEBC 1ZLEA 3FO0L 3P2TA 5K39A 4PWIA 3AACA 1G1IA 1I8LC 3PHQB 3FUEA 2NZ9C 3IMWA 2P3YA 4LLQA 3D0VB 1M6OA 1PLCA 3NABL 2Q7YB 1NM9A 2KPWA 1KTJA 2JXMA 3AT9A 3KYMB 3QFGA 4O00A 3ZE2E 1AXTL 2O5YH 1I1RA 4PM1A 4F58H 3VD9A 3OV6A 3DOSA 1YMMB 2N7AA 1TU2B 3FQNB 1G9MC 4XBGA 2KYVA 2R2CA 3QDJA 3A6BL 1I8KA 3PDOB 5ETUA 5L0QB 4AKQA 1ETZA 2QPSA 4IIQA 4K7PY 2FO4B 1RSYA 2V2WA 2IBZE 2GM4A 2Y1AA 2D73A 1AP2A 1DQQA 3JTSA 1DP0A 4NM8H 4PY7A 3OJDA 4X4YB 4ZNEA 2HFEA 2P8LB 3MJ9H 2DJMA 1JGVH 1I4FA 3SGDH 3GIVB 1Q0XH 1W2BO 1MI5A 1A5FH 2YEZA 1VCAA 4JHWL 3T0VA 5DJYB 4AE0A 4AK1A 5JUEL 3H1HJ 2DAVA 3N40F 1SDAB 4J3WA 3K1DA 5AVYB 4NBXB 4NWUH 1P7KB 2EH7L 3AAZB 3BH9A 2Y1ZA 2X4QA 3D9AL 1KJVA 4ZFGL 4NUJA 3QXAB 2AQTA 1RUAL 2CO1A 1MREH 1MZZA 2BSRA 4WFHE 1YJNP 4NQQA 4IDJH 3ULVC 2HX9A 1RZFL 3DK2A 4L1TA 1UACL 4TUKH 3HS0A 3QDME 3DX6A 3UC0L 1IX2A 1UT9A 2DOCA 3MV7D 3PREA 1MFDH 3BIKB 4QTFA 1MFNA 1SQVJ 5D7IE 1T3FB 1J8HB 1HILA 4NRXB 4XVSL 3BGAA 4FX5A 1HXYA 5AWNL 3C9NB 1A7QL 3CXHJ 5CFHA 2AANA 2VDRL 1EH9A 2R59A 1J9QA 3O0LA 4Y2OB 2BJML 2MPAL 4PJCA 5D1XE 2VDNH 3QUGA 4DOJA 5BU8B 1NCDL 4R2GC 3SKOB 4ZBJA 5IBTH 3LD8B 2ATPA 3QXWA 4AENB 3HZKB 3HLAA 2EDYA 2BOBA 3VSQA 2JB6A 4TSBH 4KITB 2IFNA 1LE9A 1QI5A 4UQAA 1CVSC 4KJWC 3DVFA 3UMNA 3HAEH 3H32A 2K0RA 1AI1L 3RWCA 4WU7B 4XO9A 3BEWB 5J7CC 4NZTH 1AH1A 4Y5VC 5DJCB 3UYRL 1Q0EA 4PB9H 2Q6WA 2YD2A 1OP9A 2K8MA 3NZUA 3O6FA 4GY4A 3GS7A 3UTOA 2VM3A 2WWMD 4B9FA 5LJYH 4BA8A 4JM0A 2XN9A 1OF2B 5C09E 3LRLA 1G7MA 1NAYA 4U1MA 1S9WB 3B5NB 1LTJB 5KVEH 1DJGA 5IG7B 3VI3E 1FHGA 4HIJA 2FEDD 3L70J 4HUVA 4K5NA 4F8QA 1OSZA 1EA9C 3RJOA 3SDCC 1A02J 1C12B 1KZYA 3LRSA 5B1BB 2F68X 2M0BA 4J8RB 5CHNA 2WVSA 1AVOA 4NZUH 1L6ZA 1O9WA 4KVPA 4ZAKB 1SBSL 3DVIA 3H1ID 1I1CA 4K23L 1PKQB 2WLLA 3I5CA 5DHVH 1ZSDB 2QSQA 2VMDA 1WK0A 1CI5A 3KMDA 3RGVB 1UTDA 4F20A 3GB7B 4XNBA 1JMMA 3NZSA 3U7WH 4JFHE 2FSEA 1FFPB 4RGMB 3H1KD 2DQGH 1VF5B 3MRJB 1NGYA 3ZT5A 1HKFA 3PL6D 3S88L 2BPBA 4DW2H 1D5IH 4LLDA 4M7ZC 1MJ7L 2WLNA 3MUJA 1WUNT 2AV7B 4G8GB 2BIMA 3RJDA 1QSFE 2R32A 1L0LG 2JIXA 4ERSH 2J72A 4I48B 4OFYD 4TRPH 4X0KB 2VDLH 4PCTA 4M4PA 1AC0A 2NNCA 3PWJB 4APXA 4P2OB 3H1JE 3KR3L 3L3KA 5SWSB 4H0GA 1XGRB 3B7UX 4PJ8C 5IB2B 3TZVB 2DM3A 1M1XA 4ONFH 4U1IB 2HB0A 4Z78B 4KTEL 3TBBA 1X5XA 4OJAA 5M94B 5G55A 4IRZA 3L3OA 2APWA 2VC2L 2YQ2A 3SOBL 1EV2E 2X7LA 3RBSA 2I9TB 2OKMA 1F4AA 3L5IA 3FO9A 4FXGC 1QVOB 1F11A 4PS3A 3GO1H 4GMTH 3HNVH 2IBZD 3UDWC 3IVKB 5IFAH 5KYYB 5F97E 1A6AA 1X6NA 4M9OA 4GKSB 1JS4A 1KLUA 2O6DA 1CFBA 1ACCA 4HJUA 1LO3L 2XWTA 4NUGL 5IHHA 2O26U 1RZIA 4GG8B 1T1ZA 2NNAA 4QWWC 4MCNA 2XG5B 4X6EA 5J9PB 4QHUA 5I1KL 2WOYA 1X79B 1KG0A 3B2MA 3K2IA 5SWZA 2DLEA 1QBLL 5E5MA 3GUTA 4PJDE 3S4SB 2ADJA 1D5BB 4HJ1A 4QT5A 1BAWA 4BBWA 1EHAA 2GW5A 4YWGL 2BSCA 3RFRA 5H2BA 5KJ7A 3QCVL 3OR7A 4WFHD 3U6RA 1ASPA 1T0MB 3RIAF 5E6ZA 2DQIH 4PJ6A 4J28A 1GHFH 4DP7X 3NJMA 4KROD 2J2ZB 3Q7JA 2EUWA 1FFNA 4P46A 4HJTA 5F1NA 5APQA 4X8CA 1E30A 4X4MA 2L0DA 4FAAB 4NKOA 1RUQH 3FDWA 3KJ6H 5EZOH 1VFBA 4J1UA 4NZFA 1SMAA 1WBYA 1JDCA 5GRZA 1Y47A 3W38A 3VN0A 4Q9BA 2H32H 2X0WA 3U4BH 5IMKB 1KN2L 4I3RL 2QVMA 1NCAL 3JWDC 1SOXA 1DBJH 4ZSOB 2K88A 3WIIH 2IIJA 1ZRTE 4Z7UE 5SV4A 2NX5E 4N8UA 4PRPA 3FFDB 3LVTA 3VP9A 2BIPA 3QO1A 5AW5B 4OSUH 2H1LM 4EQ2A 4U1GB 2BP0B 4GRMB 1OE3A 4NHCH 2VN5A 2B2XH 2GIYA 5F70A 3MV7B 2X28A 3L45A 4BGLA 5CD5D 1VESA 4W68A 3EG9A 2WGXA 3PJSB 4K71B 2WC7A 1GL4B 3MTXA 2IANE 3PY9A 2BP5M 1FL5B 3RWHB 2BSDA 2RCSL 3VD5A 3SDAC 2GUSA 4ANXA 3FHQA 1OMIA 2IDSA 4QTIL 1IC2A 2F54E 2R0WH 5E1HB 5C09D 4HGWA 4L4VE 1MLBB 4CA4A 1DEEA 2YN3A 2HT2C 3UH8A 1JF5A 4JFPA 3V4VL 2M5AB 1YEFL 1IILE 3ZTJH 3MV01 2AFNA 4UILL 4QXGH 2X87A 3QDGD 1MJUL 1FG2B 2CK0H 2CUAA 1P7BA 2NYYD 4UTBL 1SS1A 3ULUF 4B86A 2WUBH 1NBZA 5EUOB 5DJ8A 4GNKB 1I7TA 4E9VA 1CFMA 1E3XA 4LEBA 2O4EA 4OLXL 4XN8A 2RB8A 1W0WB 1AHMA 4XP6L 3QUHA 3ZKNC 3ZW3A 5I1LB 4BZ2H 4LCCC 2YO2A 2KOGA 1AG0A 1AJ7H 1H6EA 1NOFA 2TSAA 2VQTA 2AXFA 3M8OH 4YHPA 3Q01A 2Z91A 1DUZB 2BS8A 4NZRH 3UCRA 1T2QH 3WLBB 1B0IA 3X14B 4OZHB 4QMAA 5E0FA 1G7PB 1IQDA 2CBPA 5EUOF 3KYAA 5EDXA 4WTQA 2YD6A 3UIYA 4XVTL 1I1AB 3JVGA 3C5SB 2BMKA 3IFMA 1EXJA 3DPBB 4U3SA 3STLA 3OKMA 4CRPA 4PBVC 1S7XA 4UQBA 3H1JD 4RLDA 3EFDL 1IFHL 3DVGB 1ZHNB 1HH9B 4I88A 4OZHF 3M91A 3VWJD 2BCKA 1FP5A 4K3DH 4JO5A 1RJLB 1JIBA 4I0KA 3G71P 3W9DB 5T5NF 4EOWL 4Q14A 3F6LA 3HFFA 2IPKA 1Y6KR 2JB5H 2JJLA 1MDAA 5A7BA 4R4MA 1AJYA 3VX1A 5KSBE 4W7YA 2RBLA 3AG1B 1MRFL 2OMTA 4KK8D 3OHXC 1WBXB 3T8XA 3N55A 5D7LB 3L5XL 4N4YB 1HQ4A 5J1AB 4EDWL 1OPGH 3L72J 3PAYA 4HXBL 5DRNB 2D7TL 4JQIL 4AZ8A 4U3FE 3ZJAA 4G83A 3JWNG 3VRLE 5BVZA 2QGBA 3APFA 1MRDH 1XAUA 4M5SA 3R8QA 3IMUA 2H43A 3KE0A 5MI0B 1NPJA 2ROYA 2X4NB 4C4UA 4HETA 2JI1A 4TQEH 3P4NB 4POUB 4AQ1C 1SNRA 4MDRA 1NGQL 3FTGA 2YBRA 4OZGA 3ETSA 4U1HA 3USSA 3FO2A 5KSVA 2DJ4A 2IQAB 2OYHB 4B6ZA 3Q6FA 4MCYA 5L0QC 3MREA 4KGLA 2DDQH 4XMVA 4NSKB 3DYOA 1YSOA 1JNNH 3OJVC 4OQTL 2P1YA 1EEZA 2Y9ZA 5HGAA 3BKCH 4WHTB 2E42A 1GGBH 2WZ5A 5DMKA 1H8SA 1LMIA 2X41A 4UNTA 4A67A 3TX4A 2WZ7A 4U7JA 1Q81Q 1IL1A 1ZV5A 3L7FB 5FYJL 3ZE2F 3G6EP 3VFMA 3MLRH 4JFYA 2Y3AA 1Q9OA 1GCFA 4HK0B 1YJWP 2VH5H 5ENWA 1XF3A 1E4WH 3FSWA 5FO8B 2X4UA 3QZNA 2WO2B 2YK1L 2PP6A 1P4IH 3HTLX 3GSNA 1EEYB 3QJHB 2ZP8A 5C0EB 3MXVH 2QQKL 4HIHB 1OAUH 2P1JA 4D3CH 1WIUA 1HK6A 3BH8B 2OJEA 3QRBA 4G82A 3LXCA 4BDVB 1JG9A 4QGTA 1MCPH 4XNUH 1K4CB 3AVEA 3VNZA 2R8SL 4MNGA 3P0VL 3FB6A 3QDMB 4KROB 5IOPA 2HTKC 1G4RA 1B0RA 1JJUA 4WWNA 4GO6B 3ZZQA 4DO4A 1NCGA 1QI4A 1SMOA 2P28B 2BVPB 1HINH 1PLAA 2UZIL 2YMOA 4R7NA 5JOFB 5CR8A 3BP5B 2HCZX 3RWEA 1QGKB 3LD8C 5GRVK 1Q2NA 1YEEH 1E6OL 4YGVA 5GGQH 1GY2A 4WO0A 3B7RL 4WU5B 3CWBD 1M9SA 5LN4A 1IBZA 4D9QE 1T83C 3VXSD 3BI9X 4JY4B 1QFWM 1JVKA 2H6OA 4Q58C 1M7IA 4YZFE 3MLVL 1ZVYA 5LB1A 1R3IL 3VGGA 9PCYA 3DROB 2ZG3A 1EFXB 3TASA 3WGVB 4KZDL 2WIMA 3AUVA 3CNKA 5FA4B 4YLBA 4MXVE 5MEND 1XF2B 2LU5A 5C0RH 4QTHA 3CFEA 2WQ8A 3IT8D 1R3LA 3LZFL 4Y4HD 1S7WA 3EO1A 1BXUA 3QEQD 4K3JL 2BHZA 1XGQA 4MXWL 3J8F7 3X1FA 2WXNA 2ZOWA 3QH3B 3S37H 2HKHL 1INDL 1OK8A 3L74D 2DWDA 3E38A 4A6YB 4CGTA 2JKWA 1BQHA 4IOSA 3S5YA 3O9WA 3LZPA 3CQFA 3S1KA 4IBLT 1KJ2A 3ZMRA 5BPPA 1X4ZA 1OM9A 1CFTA 3QZOA 3FX0A 2VC2B 4Y5YC 1B3IA 3CFKA 4UQDA 1LTJC 4U05A 3VCLA 1E9QB 3FOMA 1E4XL 5GGRB 1RJYB 2YHGA 4D7PA 3NSCA 3QORA 2W8CA 5CWSB 1Q72L 1DQIA 5C09B 1MUJB 1T6WA 4ZAKC 4I87A 1BBDL 2W6JH 1A64A 5MEPB 4QY8B 2O01H 2Q3ZA 3RGVC 1P7QA 1J5DA 3QDGB 2AQQA 4HS3B 3T5WA 3KBHE 5M95B 2DBLL 4CBPA 1XGYH 2BZ7A 4GAJL 1A9BB 2H2PC 3D25B 3FTUA 3JUYA 3FULA 3S5ZA 1VF5C 3QIWD 4BE6A 2W9DH 1JFQH 2R1YA 1QI3A 3WFEL 2WPSA 1XH3A 1A1MB 2HLAA 4XNDA 4JM4L 5JR1H 4ICWA 1AGCB 2VDOL 2WB1A 3VI3F 4A37A 4QEGA 4DZBA 1TEGA 1HQRB 4I0PC 4KNUA 4P06A 4Q4IA 1RSFA 4XCYB 4NIKB 1RY7B 4FXKA 4YR6A 4FMKA 3WJMB 1Z3GH 4Z7QE 4DOHB 4P2OC 4CVXA 4APQD 1UM6H 3W2DH 1W72B 3U1QA 5AW0B 1NSNH 2XWXA 5CIPA 3FUKA 4ZO6A 4U3FD 4BRYA 2NY3D 5LN8A 2VE6B 3Q44A 1FYTD 4ELME 3S2AA 5IMLA 2YSTA 4MJIA 1H3TA 3ARZA 3HE5B 2ZSWA 3EO9H 1DLHB 3P1VA 4JX0A 1J9SA 5L2JA 1PGRB 1G7QA 2KIKA 5HD8C 2DWEB 2FWLB 3VWJB 1GYUA 4MVBD 3ABMB 3PWUA 4XBPB 5MEOB 1JHKH 2NW3A 2Y9YA 4OVNF 1KOAA 2V33A 2VIRA 1YQ4C 5IKCA 2FWOA 2HRPH 3HC3H 3QQ4A 4NYLB 5DVNA 2IMMA 1TQCB 3RDTA 4DWHA 2OMBA 5EOQL 1KJ2H 3QZMA 5EU6A 4HUXB 3RVTC 3NXSA 2EDOA 2LTQB 2XHNA 4AIXA 6PAZA 4MJ6B 4HA1A 1D5XA 2JP3A 1CPUA 1SVZA 4ISVA 2NCEA 5F7EH 3O3DA 1LVEA 1WWBX 4KC3B 4Y2NA 1WE5A 4M7KH 4UB6E 4YHLH 4GO9A 3CZFA 3T6VA 5EIIG 3HJ0A 2ZKHL 5LVEA 4OFVA 2IXQA 3RUGA 5DT1L 1NJ9A 4PG9A 4G59C 4KMTH 1SQ2N 3LEYL 5J1TC 3FO1B 3MLZL 2AK4A 5GRWA 4NFDA 4PWHA 4N85A 2B16A 1MF2H 1OFCX 2JLPA 2BRRL 2CMRH 4TQHA 5TQ2H 4GBXD 2WT7A 2C1PB 3SE9L 3CI9A 4OCWH 3ZSTA 1JY2P 1L0YA 2ID5A 1BD2A 2B4CH 1FZMB 1QL2A 4NOBA 3HR5A 3I50L 3RVUD 4O2CB 2GJ6E 2X1PA 4Q0XH 2FD6H 3QAZC 1U58B 2BWQA 2MCPH 4KHXL 4OT1L 2KZKA 5JOEA 4GKZB 3U4KA 4PJDF 2WWOA 1BVLB 2OYIA 3QCUL 1FZCA 4M1CD 5CIPH 5JDSA 4QJ5B 3CLFH 4L8CB 4W9HC 1TVHB 4P2AA 4JFVA 4U1GC 2FUTA 5GISH 1YNLL 5I75B 2J6WA 5EZIH 3LPWA 5ICZA 4Z7UB 5KAIE 2X4SA 4I77H 2NX5B 4NO3A 2AJVL 4N6RA 4KI5E 2PETA 4PJIE 4K71C 3MODL 4OU3A 3Q0HA 3HMXL 4MDIB 5FYKU 1IK9A 1TDQA 5CF3A 3DX2A 4RCAA 4F9LA 3SJVA 1N59A 4P57A 2YA1A 3HW7A 3ULUC 1YN6A 3VXRD 4Z7UF 1GSKA 3DHJA 3NCXA 4OWFA 3WMPA 4KX8A 2GK2A 2VDMH 5I0WA 3V0VA 1R5IB 1V05A 1KGIA 5KVGH 4HBCL 3RPIB 3V5HB 2HWZH 2WITA 3IDNA 1SOSA 1KCSH 4ONOA 4AGLA 1BE3D 3LV3B 4NO5B 4DEPB 2WXPA 2Q3EA 3SSGA 1D7CA 4QRQA 5AW7B 1PJ9A 3O8XB 5E5UB 3TVMA 3CSFA 4FFZL 4JY6A 1WT5C 1OXYA 5FKPB 3G5ZA 3EQ2A 4GOFA 1IIIA 3B2UD 2V7HB 3RKDC 5JUEH 1U95A 2XQYK 4KWUA 4QYAA 4Y4HB 5IVZB 3QEQB 1NH6A 1M7LA 3GM0A 3HC0A 1GGCL 3UAJD 3E2HB 3D50A 1DVQA 4ZFGH 1CIDA 4HPOL 2YPVH 1RUAH 2NW2B 4WI2A 3DDFA 5KUMA 4D0DB 2EYTB 2FCBA 4H13D 1BZ9A 1I1AC 4JZNA 2BCCG 1QFOA 2X4OB 4HC1L 4NRYA 2XV2A 4PGDB 5I2IA 5KYUA 1UACH 3SOTA 1SPDA 4G8IB 3BLPX 4MS8C 4TTDD 1BM3L 3CDCA 3RP1A 4WY4D 2VR8A 3T77B 5LBVA 5IR1B 5AAWA 1CFNB 1JPFB 4XVSH 2DLHA 2CIIA 2CBQA 4AI7A 4F7TA 1A9EB 5IZ7A 2VDRH 5I1CL 4QPEA 2GKIA 2BJMH 4JPKH 2MPAH 1KC5L 4MX7A 2YJLA 1IGIL 3OX8A 4G9FE 5I16B 2O61B 5FKAB 3BVTA 3P11L 4FFYA 2UXTA 3QIWB 4XODA 4TNGA 2ED7A 1QX1A 1I8AA 4X5PA 2E5EA 1RY3A 4WFFD 5EU7C 5IROA 4PJHA 3ORJA 3QYNA 5LBSA 2JR8A 4PRIE 4JNXA 4GXVL 5KSBB 2FATL 3V5DB 4KDTA 3ZKXB 4DN3L 2F08A 5D2NB 4F2EA 4APQB 1HZLA 3VGEA 4AV5A 1LNUA 4AJ0A 1CI6B 2CKNA 2ICWI 5F1IB 3US9A 3OPZH 3PXHA 5BCAA 2NY3B 4I5BA 3FT0A 2P24A 4IMKA 3QULB 4PJEE 1MFBH 1P1VA 4A2LA 4G1MA 4HULB 3UYRH 5KS9A 4YDIL 5KSBF 3ZYOA 4RSVA 4HH9B 3G3ZA 1TCMA 5DS2A 5GGVL 4WI8A 4F33A 4G6KL 4IHOB 4ZS6D 4AQAB 2NPSB 1I3VA 1L7TL 2QDWA 1BEYH 1KJ3H 1JPTL 3MYJA 3ZL1A 3FL7A 5K1VA 3QUXA 2WBKA 3VRLF 1XIWA 4ZZKA 1WV7T 2EKSB 2NY6C 3GZQA 1L9RA 2H8PD 3KXFD 4K94L 4OGYH 2E7LC 3BSGA 1NICA 1ADWA 5CN1A 3SN6N 4YDLB 1HOCA 2YEQA 2BXYA 2ZF9A 4J3TA 4ODSH 5ANHA 5FYLD 2YC1A 3D85D 3VG9C 2PKDA 5BZDA 2J8UB 1A02N 3EHBD 2I25N 3MNZA 4MJ5A 3AXHA 1DJXA 4FQQB 1NTMJ 2F53A 4PWFA 1QSZA 1XCXA 5LGJA 3S88H 2EZ0D 4X8JB 2MWCA 1DQDL 2XXCB 1HCFX 1NEUA 4Z6AT 2YD9A 1TOXA 5BQ7A 1HHJA 1G1OA 4P3CL 4AH2A 5MP6L 3DURB 3VFPB 4L5FH 2V17L 3SDYL 4E5XG 4FFYH 2J8UF 1GTWA 3R18A 1NPUA 2BK8A 5K9OB 2CO2A 3VFGL 4JVWA 5HXMA 4ATTA 3F7KA 2ED9A 5FCUL 1FCGA 1MG2C 4M43L 3DIFA 3OC5A 3CDZB 1URQA 5HGBA 1BQ5A 4KTEH 1YCSA 2DV6A 5A16B 1C5DB 4X99A 4AVKA 1E8YA 1JN6A 2XWRA 4YAQA 1OV8A 2ITDB 3EWKA 1UFGA 2GHZA 2NXZD 4PCYA 2OMYB 5E5RB 2H1PH 7CGTA 3BRGC 1T1WB 1P84H 3SY0B 4AV4A 4OV5B 5F88B 4AXWA 3W67A 5B38B 1SOQA 3MRRB 3GMMB 3G04A 5C0CD 5GGTA 4EDXB 5CEZE 5KJRL 1MFAH 4P0DA 1IARB 4EOTA 3MLWL 4JRXA 1IKOP 5ILTL 4YE4L 1X22A 1SEQL 2QJDA 5E2UL 4OZFG 5CD5C 5HHPB 1KB9H 2AJSL 3Q2WA 1X5HA 1LO3H 4NUGH 1USDA 3FTZA 4XO5A 1MLCB 3PP4L 4U1LA 4N22A 3SE3A 1I1YB 1QBLH 5FGCB 1BCCE 1EJ6A 3LKPB 1WJ3A 4IOIA 3VE0B 2YD4A 3VXRB 4WAFA 5DRWB 4ADIA 1O9ZA 4YWGH 1F4HA 1L0LD 1OK0A 3BD5A 3MOQA 1JB0J 4FMFA 4EF3A 3RU8L 4ZXBC 4BSVA 4AEIL 4MRBA 3WJLC 3CFBB 1Z3RA 4HX1A 2AXCA 1IBHA 3NMDA 3SD2A 5JW5A 3IF4A 4FNUA 4CU6A 2NXYD 4JCMA 1NTKG 1YY8A 4HWUA 5T5FL 4XMUA 4FZ8H 4XNXH 1S2EA 5JHDD 3KDPB 2F5AH 3C6LD 3O4LE 1DVFA 4MSWB 5GPRA 3C8KB 2HZHA 3CC5A 3EJUA 4YGAB 4I18A 4O4YL 4P2QD 2PFXA 2D7PA 1I8MB 3LN5B 4I3RH 1NCAH 1OGTA 4EI6A 1KFMA 1L2PA 4HPYL 4FGMA 1TXKA 3G6JE 1DQML 1N26A 2LHAA 3T8MA 1E5YA 5GXBB 4F37K 4JS7A 4MAZA 5AVWB 3F5WA 1UA3A 4NKMA 4BWWA 3QO0B 3NN8B 4BQ8A 1V3MA 3G5YB 2VLRA 1X9QA 3UYPB 4WY4B 4OBRA 1T66C 2Y69B 2R0KH 3NH7L 5I76B 4H8WH 1FO0B 2ZIDA 3OKKB 3VWJC 1OTSD 4HSQA 1H3UA 2OP4L 4LLWB 5CNHA 1U6AL 3U36B 1WMKA 2BINA 2BNRA 1G7LB 2D2OA 3KPSD 4ZX6A 5EB9A 4EUPG 1EERB 2YD1A 2ZXBA 2RCSH 3RURA 2P67A 4EZKA 4Z7QF 5D4IA 1TQCC 1G6RL 3WHE1 4AMKH 3BD3A 1G7JA 1CZ8L 5J6GA 4U0QB 1EDQA 1WGOA 2Y25A 2LTQC 2YD3A 4KFMA 3ZZLA 1NTKK 3L71G 4GUOA 2WXMA 1N5YL 1YEFH 2LE9A 2C9SA 4LBAA 3AEAC 4UYPA 4K3HA 1MJUH 1BMZA 2VN4A 4OLZL 4U6HA 4UTBH 3SDDD 4XO8A 5TDOB 3RNQA 3UBHA 4LKXB 5I6KA 3UJIL 1NBYB 4EVNB 4XP6H 3WNJA 2VLKA 4IKLA 4FMVA 4RDQG 4JKKA 2AKRB 1YEJL 3LX9A 3QUMA 4P2RA 4XP1L 4WBAA 4AEEA 5MEQA 2R2BB 4HJSA 3GSQA 4P9HL 4ZDHB 3HB3D 1Z32X 5CD3A 3O6LL 2MTAA 4UM9A 1TUPA 2R2HB 3MNMA 4G3YL 5IWLC 3MO1A 4BUQA 3S96B 1ROWA 4XVTH 2WSKA 1RUKL 4RSYA 3MRLB 1NIFA 5DWPA 2ZUSA 3IFNL 4NDMA 5AD0B 1BMWA 1IAIL 2H8PB 2OMWB 4N0YL 4HJEA 4FG6D 4BFEA 4DPCX 4BXVA 2AQSA 1NGWB 3CU7A 3QFDB 3UTQA 1Y6MR 2ADYA 3K2KA 4OFIA 2EYRB 4JJOA 3DXAE 1KB5L 1CD8A 2ENJA 2GTZA 2UWJE 5I75C 3AABA 1H3VA 3ZDMA 1K05A 3MDJA 4A68A 3UZEA 4QOKD 2BVEA 1ORSA 1BFOB 3EHBB 3A0OA 1QLED 2YOAA 5PAZA 5DD3L 1DFBL 2R3SA 5HI4D 2IMNA 2BY3A 5AW9B 3CQQA 4KVCL 3T0AA 5C0AD 2EP6A 2VQUA 3G6DL 4B53A 4EDWH 4R6UA 2YUVA 1JRHI 1S7RA 4NZJA 5C3TA 3JYCA 1G7HB 2Z9TA 2HJKA 1MOEA 3EOBB 3PAUA 3QEGL 2MOQA 3SKNA 1UHVA 4DJMA 2BERA 4I0CC 3ALWA 3NA9H 4JY5L 2PWDA 3MRQA 2GB2A 4N2KA 2VN6A 3EH4B 2V4LA 3TJHD 4HJJL 1OVUA 3BHBB 1JP5A 2H6PA 3SWFA 1MJ8L 2LVEA 2AHIA 4P23D 4YHIA 1T0OA 2NXZB 1N68A 3M9QA 3QQ3B 5C97A 4JG1L 3NACL 3GSOB 3OKDA 1PSKL 3O8XC 2WIIB 3GBML 4K7FB 2Y7QA 4PJIF 3B8YA 1SXSA 3L2NA 3MGNA 1FNLA 1T5WA 4H8VA 4BFRA 3JV6A 2EIZB 3ZZ1A 1PZCA 2XWBA 3N40P 4P3WA 4Y4HC 5C0CB 4U6XB 5FYJH 5CMZA 1MKMA 1VQMP 2VZVA 2VLLB 3BXNB 3E2HC 3NCYS 4JDVA 1KD1Q 2GG1A 4JFEA 4TULL 1IC4L 4KY2A 5GQBA 3FB5B 1RCYA 4XE5B 1N5AA 4L29A 3L5JA 2YMXL 3CZGA 3QP3A 2Z8RA 3TK1A 1KTLB 2G0KA 2YK1H 3EO0B 1DEEG 4BINA 4ZW5A 3BUPA 2H4EA 3AE7C 1PCXA 2QQKH 4H40A 5KVDL 1MXGA 2Q76B 3V7AE 4AQOA 2PO6D 3NIFE 5DXWA 2ZNWA 3ULSA 3CC2P 4D7BA 5HPOA 3U83A 1R3JA 4JHZA 1V8HA 4XRCB 3P0VH 1NTZE 1WF5A 3ZDXE 3IRZA 3RY5A 3IDXL 1EO8L 1MFEL 4RO0A 1U42A 3II2A 1A1NA 5DK2A 2JKXA 4U6VL 2MH4A 4AQ8A 5G4MA 1H5BB 3VDBA 3ASNB 3WFZA 4Q6KA 4I9WD 5JHDB 1QR1A 3C6LB 4XC3H 1I85C 2DEYX 5E95B 4P4KC 3WTSA 3WY3A 1OCOB 3HBZA 4NKIL 4P2QB 4UT9H 3QUYA 2X6AA 1VQ4P 1NKRA 1TVDA 3MLVH 3ZKXC 4X4KA 1JWSB 4BA0A 5B39G 2KNCA 3C2SA 5D2NC 4LPUA 4APQC 3CIQA 3GRWL 3P30L 2ICCA 1IEHA 3ZU8A 1UIIA 2XRAH 1KZUB 4PRIB 4WWIA 1BSHA 1C5CL 1VQ7P 5TQ0L 2NY3C 4OB5L 2C9NY 3GXDA 3H9YA 2C9VA 2OMUB 4GG6E 1S5HA 3CPLA 4KJMA 5JA9A 4K3JH 3EOAA 5EO1A 3FQRB 4I1PA 4MXWH 5GTIH 3V0DA 1FC1A 3ETTA 1NUDA 2WLZA 1INDH 1XGZA 2E7CA 3GXNA 5BVJB 2NPSC 1XF1A 3PGCB 1IGYB 1CJYA 1A7NH 4KQ4L 3KPSB 4NN6B 5GSRA 2NTFA 4K2UL 1UIXA 1QP1A 2QPFA 3POHA 1OP3H 3TCTA 1F6LL 5FO2A 4BZ1A 4DP4X 3BLBA 3TGUE 3BZDA 4YSEA 1KCUH 4UV4H 4ZUTB 1KTDB 2JJSA 3OB0K 4NQDD 1QZNA 2KC0A 2YXFA 2MCAA 1EWHA 2QQQA 1OB1B 3UJTH 2K9JB 3VFUB 1KY6A 5D72L 1ODAA 3LJ3A 4PV8B 4AGNA 4RAVA 1NEZA 3L5WA 1L3NA 2RIKA 4H5SB 4OIIH 3F2LA 3SDDB 1ZS8B 1S5IH 1S9KD 3GS0A 2G75A 4L4TA 4WKZB 2WGNB 1Q90A 4UMGA 4DQAA 3EKCA 3L3HB 1MY7A 3L36A 2VDOH 1A4CA 2IAMD 3U4AA 4FADA 4OIAA 1HJBC 2J1YA 3F01A 1J1PL 3QUZD 3MACH 3V8CA 1JGUL 4A7GF 5E70A 4Y1SA 3HB3B 3KPOA 4NNXA 3QNXA 3PHLA 1K3ZA 1FVDA 5DEZA 3T1FA 3K80A 4DPBX 5FHAL 4XP5L 5LCVA 4KKRA 3RVUC 5CBAB 3MGOB 3DX7B 3X13B 2DMKA 1E79H 3P8CE 1WDAA 1GGTA 1NU1G 2YBGA 3S5LG 5ICXA 5I6XC 2QVAA 5HI3D 3JCUH 1LT1A 1L0PA 1CF8L 5JHLL 2DYRB 2N1KA 2WNWA 1MHEA 2X4PA 1UH3A 3MOBL 3DO7B 2GFBB 3H1IJ 3X12B 2VXTL 1FU1A 1R3KB 5IV2B 1HJ0A 2W91A 6FABL 3IJEB 1RZGA 4QOKB 2B0SL 4Y9CA 1CDJA 5BV7B 1QLEB 1IT9H 3LKQB 3SDXA 4UT6A 5EOQH 3D18B 3VXTA 4NC0B 4GI9A 1A0QL 3D5OF 2CDGA 5GGSY 4TVPL 1ZWIA 4XXCC 4Y4KD 5C0AB 4BZ1H 5HHQB 2AXWA 3AXLA 4XMKL 2V3EA 3PIQB 3GDCA 1MQ8A 4L0PB 1YAIA 1UXLA 1S7SA 3BIBX 1YO4A 4C57C 4EI5B 2BHUA 4RRPA 1TZIB 5FX3A 3VTTA 4XNQA 5HHMD 3N1FC 1B6UA 2H2SD 1JTHA 2PR4H 3WNPA 3CC1A 1S3JA 2BCCE 4BH7A 2ZP0T 2EVGA 5DUPL 2DQEH 2BIIA 3AU0A 5JZ7D 2JH2A 1N0XH 2DRUA 3NPSB 4Q7DA 2VABA 3ULUL 1KXQA 4HS8L 4MB1A 1ETA1 3AROA 3H4HA 4HDIB 1ZLSL 4P23B 1G9MH 2WLIA 1NLDL 1UA6H 3TBSA 5IBUG 1NU1K 4PRHE 3SE9H 3L5HA 1L9NA 1C5BL 3Q8BA 2ORBH 3D70A 3I50H 3B2UC 3BO8B 3Q2NA 3ASOB 4EIGB 2ZOTA 4OT1H 1PLGL 2XWCA 1SF3A 5APSA 2IH9A 3OAUH 4Y5VA 2E8YA 4U6YB 3JXAA 4OLUL 4TF4A 1FC2D 3Q9QA 3QCUH 4NB7A 3UAJC 1VENA 4KKLD 1JYXA 5C1MB 3NJVA 1VQ5P 1JCVA 3O4LB 2HN7B 3ARDD 4PLKC 4IRSA 5KAFH 5EEVA 3NFNB 1AS6A 3FKUS <