5AVSB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 3.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avsB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avsB02
1CZQA 4AUWA 5APSA 2Q3IA 3MD0A 1A02J 4AYCA 1OWAA 5APTA 2R5BA 3P7KA 1HBWA 3V5BA 3TYYA 2WT7A 1MUUA 3NFQA 1S9KD 2ZXEB 3OAKA 4M3LA 2WT7B 2QM7A 2XU6A 1H8AA 2C9NY 3M9BA 3KDPB 3M0AA 1G2CB 1GTWA 3NTNA 3L36A 3HTKA 4RETB 1J2JB 2WPSA 4GKGA 3P32A 1JUNA 3NXSA 2VRSA 3VMYA 1JNMA 5AVUB 4DZOA 2P7JA 2P67A 2Z5IA 3M06A 1FOSF 1CSBA 1X8YA 3WGVB 4XE5B 5AW0B 1FOSE 3UIAA 2C9LY 4LC1A 2YNYA 3A3YB 2Q5UA 2P2UA 3M9HA 5AVSB 1GU4A 2QM8A 3I5CA 3VN0A 2Z5HA 3NMDA 2WPQA 5AVXB 2WPRA 1GZLA 1GK6A 2KP8A 2XZRA 5APYA 5AVWB 5APWA 3T97A 3WGUB 4EOTA 2ZFCA 1HUCA 3M91A 3SWFA 5AW9B 1SLQA 2R32A 4AQRD 1KQLA 2W6AA 1OXZA 3VMXA 2R5DA 2WWWA 1IO4A 5CMZA 5AVRB 1HJBA 2BASA 5AVZB 2E43A 5AW2B 1HWTC 1FAVA 4B86A 3VYIA 5AW4B 3B8EB 4RESB 4JYBA 4HYTB 2H7HA 4C7NA 3VTPC 5AVYB 3V4QA 5AVQB 1SP4A 4C7NB 2R3CA 2Q7CA 1MFZA 3VMZA 5AVVB 1NAFA 1DH3A 1T2KD 5AW6B 1S9KE 5APUA 5APVA 5AW8B 3TNUB 3P8MC 3V4WA 3M0DA 2WTYA 5AW3B 1GK4A 3IR9A 1CI6A 3TK1A 4I2LC 3KQGA 3L35A 1A02F 1CI6B 1H88A 2YO2A 4C46A 1MV8A 2IPPA 1GD2E 5APQA 4JYCA 5AW5B 3L37A 2JJLA 3A7OA 3A5TA 4KHXA 1H89A 4GT1A 1NWQA 3MGNA 5APXA 2W27A 1GU5A 2N9BA 4I6MC 2E42A 3LIEA 3O8ZA 3HE5A 3A2AA 1YYCA 3LIDA 3TNUA 5AW7B 3HE5B 3HE4A 2YO3A 1T2KC 5AVTB 5AW1B 3HE4B 2XV5A
chains in the Genus database with same CATH superfamily
4N86A 1VZHA 3AC0A 3V2PA 1JE6A 4W7YA 4P5KB 1PX4A 2HUHA 3BUBA 4U3FE 2DBLL 1GAFH 2DW5A 2WN3A 4AT6B 5T1LB 1LO5B 1FJPA 2BY2A 4IRSB 3MBXL 3MJ8A 1D5IL 4KNUA 4G7YL 4AM0B 3IJSA 1L0NE 4G11A 4XVUD 3JWNC 1UWEH 1HHGB 5DS8B 1EMTL 1JPGA 1Q82Q 2GT9A 3IU3A 2LQRA 1BBJB 1F11A 3VTTA 1CVSC 1IIIA 2DEWX 2X38A 3IB4A 3RGVB 2OFQA 5CFHA 5B4MC 2Y06L 5EC2A 2GK0A 3KVPA 4YBLB 4PWGA 4LOEA 5CGYD 1EHLH 3DTDA 1KGCD 4ODXB 2UY6A 5EU6E 2CWRA 5EIQA 2J3SA 5CCGD 4HPHA 1TTGA 4KUZH 3CZGA 2UXTA 3ESOA 2OXGA 1U58A 1ZPLA 1HH9B 1EO5A 1KIPB 2DQHH 2Q3AA 3QWOC 4KROD 3EBHA 4OCXH 2VXSL 4HSAC 2B5IB 3E6HB 4L8SB 3L1OL 5F6HJ 2FWUA 2AXJA 5KYWB 1VA9A 4YLQT 4IRZH 3X13B 5FKPA 2C7FA 5DVLA 4PJ0E 1I8IA 4EOTA 5CLZA 5T1MB 3A23A 3B9EA 1DSWA 1E4HA 1UM4H 3GEFA 4F57H 1GSMA 2C4FT 2N1TD 4TUKL 4X9FA 1HE7A 2HG5A 2FBJL 1KB5H 1CXEA 2N9YB 4HUCA 3K4DA 4OGQB 1C08A 2G5BA 3VTMA 1A9VA 1PLGL 2ZTBA 4OZ4B 2O93L 5B66E 1CD1A 1A6PA 4F7KA 3MPCA 5AYUH 3BVUA 2CLZA 3G6DL 2XN2A 3QQ3A 2ITCA 1N9PA 2Z31D 4Q14A 4FKKA 4OQTL 2I7SA 2PWGA 1XF3A 2C7UB 3QUKB 4MA1B 2BERA 4Y8AA 2O1JA 5IVZA 1I3GL 5KG9A 1A14H 1YNTA 3OR6B 2OCJA 2DMHA 5AB0A 4WO4B 2A6IA 1PG7W 3O6LH 4XCYA 5EA0L 5GGRY 5ILTH 1VFMA 1QRND 1YEJH 2DYRB 4Z0XA 1LTSC 1LO4H 3P4OA 2F5BL 4JM4L 4PTTB 4HJ0D 4LARL 3T0XA 1SQVE 5CEZH 5INDB 1FRGL 2G75A 2XQYA 3SGJC 3THML 2ENQA 4AYFA 2VLMD 2BLFA 4N0RA 1FAIL 1J0YA 4FE9A 1JCVA 4KHXA 5JR1L 2D31A 1NCOA 2A9NL 1SXSA 3MREA 4JPSA 2YC1A 4AK1A 4E9XA 4IHOB 4JJHA 2V2WA 4NQDA 1HH6A 2WK2A 3VI3F 4D3CL 4J5VA 5AG8A 2IQAA 3ZDYB 1SDDB 1H5BA 3OKNB 4BK8A 3V5KB 2KZ1B 4HXAH 4LCYA 2NRGA 4NAMA 4U05A 3K74B 1ZHBB 1A4JA 1YEDB 4AUYA 1SQBE 5F7LB 5LGJA 3NIFB 5ITFA 1FYTE 2XKMA 1R5WA 4FG6D 1A6TA 5DD6A 3RX5A 3LV3A 5ESAB 4TLFA 2BSTB 3P11H 3T4AB 1KEMH 2D03L 1ZV9A 3T97B 3KS0H 1JMXA 3SWYA 2QEXP 2ZYHA 1YY8B 1YNKL 3TIDB 1XDTT 4PG9B 5KUKA 2E76B 2ADYA 4Z7AA 4U3FJ 3MA7A 2IAMC 3ZQWA 5MP6H 9CGTA 2XQBL 1ANUA 3HAEH 1ACYL 2NT0A 2CNYA 4WW2A 1L0NJ 3H2WA 1C1EL 5E94A 5GZND 2YOAA 4NXSA 4GKZB 1N59A 3LD8C 3TA3C 1NGMB 4QGTA 4GW1A 2VZOA 5DQDL 3A6OA 4GMTL 4NJ9H 3UBXI 1YRKA 3L4WA 1D5IH 1IC5H 4G7YH 5E1IA 2UXVA 4PW3A 5I17A 1DE4A 4HH8A 4JFVA 2BX5A 3JSSA 3QDGD 4Z7OE 3BN9C 1N10A 3G6JF 2AS5M 1L4AD 1IM3B 3DURB 1Z9NA 2BIHA 4AIZA 5IUCA 1EVUA 2W88A 1J9RA 1P7QD 5DHVA 3BVVA 3P9WB 3RU8L 3GO1H 4L3FA 1IGIL 1N67A 4N2LA 1LT9A 2FATL 2Z8RA 4GW5B 5DJAA 3WY4A 3H1HD 3QUHA 3RWGA 2PKDA 4RESB 1PGRB 3MRNB 2XRAH 3K2IA 4NDMA 1KXQE 4PFEA 2ZCHH 3VXRA 2HLAB 5AVYB 1AQDA 1XL6A 3MCLL 3TBYB 2FXOA 1KTLA 1FG9C 5FS5A 3T2PA 4A38A 2FBWC 1MFAL 1UD5A 3GMMB 2FLRT 1MFVA 4IOIB 5I26A 2Y23A 4YSQA 2D4DA 1ZT7A 2VDNH 2MTAA 2Y7OA 3BFOA 3EW3B 3KXFB 5T3XL 3JWNE 3ELQA 4AEEA 3CFBB 2AZAA 3L3OA 4XNQB 4MTMA 3BCDA 2DRUA 4JGMA 3L1OH 4MD0B 4PREA 5CCKL 4PGCB 3MNZB 2WWOA 1S7WB 3GJFK 4X6CF 4XB3A 4B9JA 4E0RA 1FC2D 3KPRD 4Y9CA 5J0BA 1FV1B 2IJ0C 4IJ3C 2NXYB 4TUKH 2HFTA 3BUQA 3FU7B 1QPKA 1OLLA 3S98A 1YI2P 1DQML 1JXDA 1RUKH 2FBJH 2X4OA 5E79E 2B1HL 2XYCA 4NOFA 5C07D 5AB2A 4UT7L 5FO9B 2QJKC 2EDBA 1T2QL 1VQ5P 3MRLB 5B1JC 1DO5A 1PS3A 1BFVL 4IMKA 2EZ0D 4PJAF 3G6DH 1RU9L 4N0UA 2DQ6A 4HBCL 5EEVA 3QULA 3BW9A 2KDGA 1AGDB 2K37A 4F9LC 2JELL 3WFEL 4OQTH 3WD5H 2BY0A 4PP2A 1SQVJ 2YO3A 3B5NC 1W16A 2O5YL 3B8YA 3H1ID 2HTLD 2VAJA 1IJ9A 4Y1AA 3VFSB 5LKNA 1UB5B 5J6GA 1I3GH 2FT6A 3FTVA 1ZXGA 3QAZB 2XV6B 1N8RQ 3L74E 4DFHA 2MPVA 4RNRA 5E5MB 3VXNA 4GUPA 4DESA 5IEKB 2F5BH 1HAUA 3ENEA 1MDAA 5IOPB 5CJBA 4PD4E 1KTKE 4NO5B 1M1SA 3MUHL 4HIXL 4IGBD 4F15B 1M05A 1FAIH 1SYSA 3WNIA 2I24N 3BFQG 5JR1H 2ENJA 4R7NB 2QSIA 3QHZL 4R0LA 5GS0D 1TMQA 1QUNA 2A9NH 1SVFA 3L3JB 2P7TB 2P67A 5DLML 5FUZH 3VMAA 3GRGA 3TH4T 1SQBJ 1DFBL 1VQNP 3L73G 2IBZY 2WB7A 1UEMA 3LYRA 3MNVA 4G8IA 4PJ5B 1NBYA 4YPGB 3DVGA 3U1AA 4ZTPL 3LKPA 4KZEH 4PJDF 1DQVA 4KHXL 5FOJA 1TVBB 4MXVE 1HN1A 1NC2D 4W4OC 3NIDE 2FX7L 4MB1A 1QASA 3FONA 4WU7A 1UD6A 1X5AA 1MCOH 1GHFL 3HS0A 3HC4H 1RVFL 1PGJA 4MQTB 4ZS7H 3ULUL 1ERNA 1U8OA 5D5ME 2XV2A 15C8H 3NJGA 3L5IA 4RWHA 2E75C 3FQWA 3OKMA 1KC8Q 5GQBA 1U92A 3VXTA 2D03H 3QNYB 5DJCA 4BZ1A 1BVKA 5IMLB 3SPJA 3S37X 5F6IB 2K9YA 1IFGA 1WFMA 4HCGA 4OZGA 3OZ9L 1N73C 2PYEA 3QORD 5D96C 2X6CA 2WWWA 4H8WC 3U36A 4MJIE 1GL2B 4ZT1A 5MENA 2BASA 3ECBB 3C60A 3O4OB 4DPRA 3KLAB 4IU2B 4XRCB 2FECL 3T6QC 4U1MB 3VRLE 1EIBA 2XQBH 2D0FA 1J9CT 4FNRA 1J05B 3TCLA 1VQLP 2JR8A 1ACYH 2X53A 4X50A 4PWIA 5A2CA 2WM0A 3C2SA 2W9LA 2KQNA 2ROXA 1TZIA 3LEXB 4BSVA 4P2QA 4ZG1A 4GMTH 1U8KA 4PWHA 2X2YA 1KDIA 1XBDA 1X5KA 1RSYA 1U0QA 3UCQA 1IE4A 1AGCA 4FHBD 3TZVA 3GF7A 3LRMA 3PWPD 1J5OL 1FO0A 1SQQK 1XZ0A 5CD5C 2FGZA 3WUUA 4G42A 3SIKA 2ENYA 1TOXA 2Y2WA 2ZIDA 1AFVL 4KVNH 2H5UA 1PP9E 2XWXA 3O4LB 5DEGB 4X4YA 2G2RA 4Z7UF 3M17A 2E74B 3RP1A 1IGIH 1A1MA 1HXYA 1IC0A 1J8RA 2QSVA 3OHXA 5D71L 2BP5M 3U46A 3V0EA 2Y9ZA 3DHPA 4KY1H 4XOEA 3BQUC 4YDIL 3MCLH 3PWVA 5FUCE 4N8UA 2EE6A 3QQDB 5CSZA 1X5FA 2DWXA 5MEOA 5ACZA 4OUUA 4UM8A 2C0WA 3TEZA 4DZBA 5F9OL 4JRYA 3WAKA 4NFBA 4NO3A 2CQVA 4OCYH 1RIVH 4WLCA 3MZTA 3N41F 5T3XH 2Y0EA 2BP0B 4DKFL 4U1LA 4B7IA 2R15A 3K6SA 2W92A 4L4VE 5CCKH 5ETUA 4UAOB 2V2TA 5F3FA 5IVNA 5JW4N 4XMXA 1N8ZA 1KLFA 4H1LG 5KSAC 3MUZ1 4NQEA 4WNJA 4YSUA 5BOJA 4TVPD 1LJMA 3JWOH 2R2HA 4R7DB 1JZFA 1UH2A 1I8MA 1WO2A 2O6DA 4MDIB 4U6VL 4W81A 1UWYA 2JQAA 4X4ME 3EYUH 5C92A 1T2QH 2HPOA 3MV7A 5G2NA 4JKPL 1J8HB 1EUTA 3RDTD 5E2TL 2R51A 2WKOF 3TC9A 4E9QA 1RU9H 2X42A 1ORSA 2OR9L 4HBCH 2BOBB 4LSSL 5DVMA 5EOQH 3EJRA 4ZUTA 2JELH 4F7TA 3WFEH 3JTBA 4ZUWA 3ULVL 5EC1B 1GRWA 1GGCL 3IXTA 3FHQA 5I1IH 3TBBA 1T0OA 3CX5H 1X9LA 5AVXB 3KLDA 3KAAA 2KZJA 2ZWZA 2EYSB 1A1NA 3Q5RA 4NC1E 4PWEA 4HLZH 4ZNCA 2AVFA 1PZQA 2P42B 3BZFA 3WHE1 4XNMB 3KPTA 4NFCA 4YAQA 4ZXBD 5JYMA 4X7EC 1FWXA 1JV2A 3C09C 4HIXH 2AMUA 3N42B 3UCRA 5EOCL 4NT6A 2VLLA 2IDTA 4GRWF 3FUDA 2OA9A 4OI7A 2APFA 3P9MB 3OM3B 2OJZH 3IDYC 4UT9H 3W0WD 2XY2A 3QHZH 3U7YL 1GH7A 2M1KA 3FU6A 4NN7B 1CFVH 1X22A 1MOEA 5DLMH 5J7CC 4R83A 3IDJA 1UWXH 5BXFB 2BEZF 1DFBH 3II2A 3QFJB 3CX5I 5GRZA 4DKAA 5JHAA 1DEDA 4AG4L 1BLNB 1OFCX 5GRVL 1YJNP 4KHXH 4WVRA 4PMFA 4APQD 4JY5H 1AQHA 2FX7H 2OBGA 1QBLL 3QJHA 5I8CA 2AITA 1GHFH 4BEIA 3OWRA 3PL6D 2AQQA 1RVFH 5E1HB 3WU1A 4E9LA 4ANWA 3Q1EA 4MQXD 3TCTA 1T04B 4NI3A 2I9TB 1TETH 1OSZA 4K5PA 4PRNB 1F1GA 2NUPB 1AO7E 2LFGA 2M8RA 3ZKSD 3KPNB 5I15H 3QGVA 5MERA 1YJWP 1DN2A 3D7PA 5IHWA 2Q9OA 1KGYE 3H4HA 1AD0B 3VACA 5JXAL 1H0TB 1ZJBA 1FSKB 1CK0H 4QHLA 1M7DA 3QE5A 1OVUA 2NNXA 4ZS6C 4BZ1L 3DTXA 1SXNA 3VI4B 4K23L 3BZ4B 1RLWA 4BQ8A 2QADC 4Y4FC 4JUSA 3UMNA 5LGHL 1I7TB 2PXYD 4ZK8A 2H8PB 4KO9A 3FYIB 3QG7H 1YG9A 2AK4B 2VR9A 3CPLA 2XXCB 4ELDA 3FTWA 4Z3EA 3DKHA 1RQVA 1LO0L 2WINA 1LO3H 2NCEA 2UVFA 2ATPB 3OAKA 3PQYD 4N0FA 4KBPA 3BGMA 1J5OH 4QAWA 3TGUD 5F7KC 2H2SD 2ZE0A 3HC0B 3CCMP 4MGXA 3K8LA 3QQNA 2FECI 3NFPA 2GJJA 4K0OA 4MAUH 4PWFA 3BZ5A 3IK2A 2D0GA 1KCVH 3VH8G 25C8L 5F7DA 5K9JL 4XP4L 3SGEH 2IBZD 1K8IB 2IZ1A 2I60L 1SQQE 1FO0L 3OPZL 4LLMB 2E4FA 4X6DE 1WEJL 1BFSA 4HSCX 4U1SB 5IKCA 5CMAA 5F9OH 3TEXA 5EIIA 3P3SA 1FYTA 4DKFH 1YTZI 3Q43A 1BVLA 2CO1A 4R3SB 3RTQD 5I1AA 1JCDA 2YD3A 1HHKA 1MZZA 4R7LA 2FFDC 4BSWA 1JAEA 1L9TA 4N6RB 3EFGA 1S8DB 3L3KA 3Q5OA 3LVEA 4F9PA 2ZFCA 4FFZA 2R56H 2YAMA 3CIQA 3HVDA 3J8F7 3KYOB 3L3GB 2BP8A 3W56A 3H3BC 3QIBA 4U6VH 1RY3A 4I7ZB 3FDWA 5AAWA 3BPLC 1Z9PA 1IGTB 1ACCA 5CEYA 4GBXC 1ZHKB 5MEPA 1PKQB 4KK5D 1GYAA 4M4PA 5AW2B 5HHMD 2OR9H 1VACA 1JTOA 2ZYRA 4LSSH 1MCIA 4S1DC 3KZ8A 3T6WA 2WXNA 2VR8A 5E7FA 3ULVH 3TF5A 1GGCH 1X5JA 3FRUB 3V4UL 2R1YA 3MBWB 4EO5A 3DBXA 3KH4A 3DGGB 1T4WA 3MLTA 1MCKA 3JWNG 4EIBA 3FFCB 4W1TA 2IH8A 5L4JA 4YIQB 3QK0A 4CC0A 2X4PB 3UJIH 4OI8A 5DD1H 4KXBA 3DOIA 3VFWB 2QGCA 3T1FA 2AQTA 4PJFB 5KTEL 2VLKB 3HG1E 1U2YA 4JEGB 4WHTB 5EOCH 1EWHA 2IADA 2KZKA 3MBEB 3OKKA 5G5DA 1B9ZA 5L6YL 1KYOI 1BQLL 4AQ1C 2A6KB 4HJJL 1I3UA 5C2UB 4KKLD 4EIUA 4Y4KA 2E59A 4M5SA 3U7YH 1MVUA 1BDDA 1ZVHA 4C57C 4JLRB 2FX9L 1JP5A 3FMGL 2X7LA 4RGND 4EIJA 4Z3JA 4JJ5A 5DZNA 4GXUM 5BMFL 2XXGA 1WTGT 3QUYA 1KJVB 4LGRB 1HYSC 4AG4H 4RFOL 2JCCA 4YBQD 3CZKA 3WMQA 4G43A 2DLIA 2YWZA 2FCBA 2WXKA 1HH0A 4UB6H 5L2KE 2AC0A 3OC8A 1QBLH 5JPMA 1M53A 4UTAA 3L74G 1HXKA 3P9LA 4F91B 3K71A 4OFQA 1NTKK 1ZLUH 4XX5A 4MNQD 2ZXEB 2IQ9L 1E5UI 4D0DA 1J8KA 3CUPA 1RL1A 3VWJD 5GS2D 3WELA 5D1QD 4MYPA 5DUPH 2JKTM 3CFTA 5DF0A 1DLHA 2N7BA 1JK9B 1FE6A 1H19A 3FAWA 3TBVB 3HI6L 1MCEA 3ZO9A 4JVUA 2EVGA 2M8XA 2Q3XA 1J1PH 1GMJA 1NUGA 3DK2A 2OMTB 2XFXB 1D5RA 2H3NB 2QEJA 3FQNA 4UZUA 4ODBD 4XWOD 4BZ1H 2HSIA 1OGTB 1TMCB 4K23H 3EYVB 2YMKA 1IQWL 4A6YA 3OSVA 2PN5A 3HI1A 1DVFC 3P2DA 5EBMA 5LGHH 4A04A 4RIRB 4Z7QB 5C0JB 3IDXL 4UU9B 2EC8A 1OGSA 5DC9B 3UAJD 1YMMA 4ORZC 2VM4A 4JE0A 1S9KC 2Z4QB 2JKWA 5MI0C 2JKJA 5TE4L 4NKMA 4NPJA 1TTFA 2AF2A 3CFMA 1QLRA 3DPBB 3FQYA 5DC4B 3V4VA 3CCVP 3JYBA 1UXWA 5IVXE 1SQQJ 3WNOA 3PDGA 2D9QB 4Z3IA 5AZ2L 4LGSB 5F6HI 4XPTH 2X2IA 4P2RE 2E7HA 1KPRB 5K1VA 3F01A 3KD4A 5LN4A 4F8QA 3I55P 1CT8A 25C8H 5IOKA 2Y7SA 5K9JH 3EJYC 4XP4H 3S3CB 1N12A 2JQMA 3KGUA 4L9DA 4CVXB 2O61A 1OGAB 4PJ6A 1AHKA 3CSYB 2I60H 1RK0B 1FO0H 1O9VA 2P48B 3NACL 3OPZH 4LCIH 5E9NA 3VXME 1XV8A 3KL3A 1DDTA 1U21A 5EZIH 3LS5L 4PSRA 2HODA 3MR9A 2XTJC 4QKTA 4E41A 3RFZC 1BD2E 1J5HA 2YLKA 2F53B 3VMZA 3ARED 3D39E 3HC3L 1PQZB 3NG5A 4ZMNA 1R17A 4GKNA 1S7TB 4ZMYA 3AQDA 2KBGA 4APXB 1FUNA 1RZ8B 4AQOA 2NDGA 1II4E 4PUBL 4U7SA 3WAJA 4IOFC 1URLA 1PP9G 3IRZA 2EDJA 2FUQA 4D0CA 1FL6A 4YBHA 5KJ7E 2JKRM 2H2PC 4FFZL 2BPBA 2YQ2A 2WQWA 4NO0B 1Q90A 1U8CA 2RB8A 4BKLA 1QLED 5GGQL 3ATFA 4QPEA 3D51A 1OIOA 3FB8A 5A6LA 3GSXA 2KMWA 4TNWK 4F7MA 1BGYJ 2OK0L 1AXIB 3JWOC 1CDBA 4DP7X 5EZLB 4WJ5A 2OYHA 5TK2A 3WNPA 2C1OA 5BUPA 5IQ9A 5E1GA 4E9YA 2AV7B 2VLJE 3V5DB 5CBOA 1WBXB 1TU3F 4JS7A 5FO2A 1RJYB 4DEUA 5JZ7D 1F4AA 2FEDD 5EUOB 1T89C 1RUPL 3OJAB 4QRTA 2VQ1B 3D25A 5IB4A 5KTEH 4L37B 2NY7L 3B7RL 3II3A 1NKGA 4N3TA 5L6YH 4YHYC 1BQLH 2VDQL 2IX7C 4HJJH 3H1KD 5FA3A 2PPAA 1XCWA 3ZDXF 1B3JA 5IJVB 1U30A 3L3DB 4OF0A 1CFBA 3D30A 5K93A 2FX9H 3FMGH 3BJ91 1BCCJ 2FYNC 3QWQB 5E6IA 1B6UA 3T3PE 2RH0A 2AJSL 4K3JL 2VQUA 4OJAA 1R5VA 1S3RA 5GGRA 3PGCB 1ZS2A 4RFOH 1ZLEA 3H1ZA 4L4VA 3V7AE 3T71A 2FYUE 5FYKL 4AZ8A 5A6IA 5L8JB 4JNXA 3WL9A 1NDMB 3WU2E 3V6ZB 5KBMA 4RCAA 2CDGA 1USZA 1VFBB 3GIZL 1WMKA 4D0BA 5DZ9A 2NW2A 4NQCB 1QEWA 2O5NA 3ESVF 3I3BA 4BH7A 5L2KD 4X4MA 2AXHA 3H54A 1P2CA 4M6OH 2BVOB 3KH3A 3TO2A 3FCUB 3GJFA 3P73B 5JPNA 4LZKA 2Z92B 3V2AR 1BEYH 1T6BX 4DK5A 1FH2A 3IMVA 2R39A 1OM9A 1SLWA 4UTAL 5DHYA 2JIXB 1U8QA 2X70B 3HE6B 4RH4A 4JBZA 1OSEA 1SEBA 3V55A 3HI6H 1I8KA 2BCKA 3BEWA 5FKAA 1MUJB 5FCUL 1KORA 2BM3A 4HETA 1KXTB 4LPXA 4OFVA 4WCYL 4X0KB 3C08L 2YAQA 4XXWA 1LE5A 5DMGC 1JGUH 5AVQB 1XWVA 3CN2A 1IQWH 2X4TB 1H5BC 1R5LA 3ZZSA 4BH8A 1AGEA 4ZFQA 2H32A 3IDXH 4JZJC 1PIFA 1VFAB 2CRIA 5IWLA 5EBLB 1FU1A 1EUUA 3L71E 3BPNC 1I7UB 3I74A 4JN1L 4RRPA 4A39A 3H6PA 1WA1X 4ZOEA 3GTNA 3ABKB 3FT3A 4QD2E 5TE4H 1GPOH 4A6YL 1AD9A 1JY2P 2KH2B 4Z1PA 1T66D 2HVBA 1T3FB 3LN4B 4W9HC 5F21B 5AZ2H 5I5RA 1AIZA 2BWDA 1USQA 1F58L 2EDEA 3UTSE 3LHAA 5ABDE 3NP3A 4V1DB 1OD9A 1E9OA 4AGOA 1LO2L 5CAYB 2ZT9B 3GXUB 3NRQA 3U1PA 1NPJA 1XSOA 3V4VL 3FJTA 4J8RA 3NACH 5JTWA 1SOXA 3CBRA 2BXZA 2X89D 3LS5H 3ZYIA 3ISWA 1YUHB 4CVZB 3NFSH 1MH5A 1T2XA 2UWEB 3T65B 1GR7A 2VXTL 3P3TA 1TNNA 3HZKA 3AADB 4Z7WF 3D69A 5HGAA 5APSA 3S8FB 4NUQA 2VDRL 2WY3B 3WEAA 1JY3N 3OKOB 5JHDD 2R44A 2VAAA 1LEGA 2CPCA 5FWRA 4B9PA 3LN5A 3NFQA 2A74B 3NPSC 4EI5B 2R69L 1AO7A 1T0MA 2XC8A 3Q1SL 4PUBH 4R4MA 1GZPB 1FORH 3O3UN 1OP3H 2BCCD 2P1JA 3TV3L 3D4ZA 3FQ2A 3KEHA 1N7SD 3QR0A 3UG4A 3UG3A 5LXVA 1TQCC 2BW5A 1NFDF 1Y47A 3KBHE 4XPGL 3UEZA 4K15A 2H88C 1A7QL 3C8KA 2PYFB 3MJWA 2WNXA 3GIVB 1NTMD 3I2CL 3K5BA 5D8JL 1MIEH 2LLGA 5GGQH 4DGIL 5DJDB 2NY2C 4CL7A 2J58A 2VITA 1EEZA 1EDHA 3USSA 2VL5A 1DBJH 3N44F 4QJ3B 3CCEP 2XN1A 2B59A 1OAJA 1ZA6A 2OK0H 3FOMA 1JIBA 3D3VD 4DJMA 1XF2A 4AXWB 4HFUL 1JPTL 3UTTE 1F45A 3U59A 5DMKA 2ZNWA 2O3JA 2CCLA 5FHBL 2OYMA 4JFYB 7CGTA 3W37A 1E8XA 1HHJB 1L0LE 3GMPA 3PAVA 1WA2X 4OF6A 3RWIB 3G04B 4QJ4B 4OM0L 1I85A 2NY7H 4MHHI 4JF7A 2WIMA 3Q9QA 4WNQB 2WVSA 5I82A 4PVBA 5DWUL 1J5CA 2VDQH 4X6DA 4BK5C 5JDJA 2XBTA 4PYGA 3F2LA 3W67A 5GTIE 2TRYA 1YAIA 1PY0A 1IARB 1IKFH 2DM7A 2HX9A 3FB7A 4M1GL 1YQVL 4FNSA 1FZMA 2OI9C 4K3JH 2FEJA 4NPEA 5EU3A 5JO5B 2NLJB 4K5OA 5FYKH 2JI1A 3NEXA 2WBJD 4JHZA 2PPDA 4KVPA 1E5WA 3GIZH 4LHUA 4J2QA 2QA4P 4N2EA 4HS8L 1NAMA 1NTKJ 4FNUA 3AXHA 2M26A 4ZSOE 2H0PA 2N01B 1QTSA 5GIRA 4UTCA 5HVHB 2NNAB 2D8KA 4UBDD 5E9DE 1R3KA 2OXHA 1LWUA 4C83B 4UTAH 5HDBB 2CPSA 2VNCA 4N8PA 3UDWC 5D7KD 1BREA 4TUJB 3VXSE 5FCUH 3UYRL 4YSAA 3EDEA 4G9DB 3ES6A 4PR5A 2CUIA 4AIXA 2BNRA 1HT6A 5KVMC 2F18A 3QJUB 1CFQA 2BSEA 2BRRL 1PJWA 4YSDA 2RAMA 4AE0A 1FFOB 4DOJA 5GSRA 5EEUA 5G4OA 3VQ1C 1U58B 4KJWD 3HS0C 4P4KD 5A40E 3WO4B 4JN1H 1YEKL 2X28A 1LP9F 4UM9A 1J5DA 4NCC1 2E5EA 1QSVA 1DUZB 4S1SL 5BJTB 2C3VB 2VR5A 4LSTL 4YSPA 4AQZA 5CJ5A 4D9QD 3ET9F 5C7XL 2LLLA 5FDWB 3T1WA 1E9PB 2DLGA 4X5XB 3KLKA 3T8VA 5CZVH 5JQIB 2A06E 2Y1ZA 1J10A 4FGMA 3GS7A 4H13D 1ZLSL 3ETBJ 3MV8D 1LO2H 4DVBA 1ML0A 3L75E 4HDIA 4LU5L 1KCRL 2P5WA 5D7LA 4OGYL 2Y36H 4N90D 5T1KB 5A2IH 3SDYH 3GZOA 4GEJA 5HYQB 1KQFB 2CLZB 5GGTL 3CCUP 2VXTH 2Q86B 1IJDB 2FX8L 3T4YA 5E6ZA 2HRPL 2YZ1A 3JC22 3L16A 3RB5A 3SPIA 4DPCX 4DP2X 1XF3B 3O6FB 3MUGA 3PV6A 1OF2B 1W6WA 1KILA 1D5XA 1WFTA 1JVKA 2A45G 3ZTDC 1IQDB 1YNTB 3TZVC 2Y7NA 3EGSB 3IMUA 5KG9B 4N5EC 5DA0B 1XCQA 1NSNL 2DYPD 2R69H 2WQUA 3LRSA 1CQKA 1NCCH 3IDMB 2RFXA 2A6IB 3Q1SH 4QO1A 2UXFA 4Y9GA 4Z0XB 5LDSA 2PO6D 3P4OB 4NPYB 1G1JA 3X3GH 1G7MA 3EADA 3QDJD 1K73Q 2F5AL 2AQNA 2G0KA 4XPGH 2G75B 3L1FA 4PJ8B 5HDRA 3BWAA 1HJBA 1QFPA 3I2CH 5C6TL 3FOLA 2CO4A 5EPMB 4Y2OA 1H8LA 2R23A 4DGIH 2YAEA 3DMMC 1KULA 2D31B 1D9KA 3A21A 3PWJA 1S78D 1T2KD 2CO7B 5HHXL 1WAAE 5IFHL 4NQDB 3IKCA 1Z0NA 5APVA 5IB5B 3BZEB 1G9MH 3DUUA 3FTGB 4HFUH 5IVXA 1JPTH 3HAEG 1HJ0A 2AXCA 4WAFA 1MHCB 4QKXB 2FXPA 5FHBH 5J12B 4P2RA 3OXSB 5FM5M 4LCYB 3X11A 2XFGB 4F8NA 3L48A 4MDJA 3ZT6A 5K9KA 2XN9D 2MOVA 3NFNA 4YHNB 1KTMA 3EDKA 1Z9SB 3WYRA 5LGJB 3QEQE 3TEWA 5DZVA 5DWUH 3VXMA 5JUEH 1P6FA 4JO3L 3LV3B 3T2QA 2FJSA 2O1AA 2OTPA 3ZHFA 4BELD 2QHRH 3RWJA 3T2NL 4QGYA 1BEXA 3WHE0 5LDUA 4M1GH 2EXYC 1YQVH 3D39A 4XTRC 1OTSD 2YD7A 4PJCB 3TDKA 1GZHA 1BFOA 3L70J 3FUFA 4F93B 5E1AB 1RZFL 3MA7B 2R9HC 4RWYH 4B9YA 3AQZA 4J3TA 4JFQA 1A8JH 2ADIA 1NANI 4OBRA 4NHUA 1NBCA 1XH2A 1BF2A 3TO4B 2H41A 4AGNA 2CNZA 2UYLB 5F44A 4HS8H 1WZAA 3MLXH 5E94B 2XPZA 4JGNA 1CICD 2F7RA 1U7JA 1HL5A 1OAZL 4XHJD 4ZTOH 2YUWA 4GINA 3DC0A 1PY4A 1GDTA 1N18A 1T2JA 1XH3B 2HX8A 5EDSA 3CXHD 4GAJL 2ZUYA 2DLHA 3AAZB 4GLRH 4KQ0A 2LOEA 5AVUB 1DL7H 1PAMA 1NAML 5CN1A 1DJWA 2AERT 3B1UA 3UYRH 4AIZB 1QSZA 3HB3D 4NC2B 4PRPE 4D7PA 5ID1A 1WIPA 1K05A 3GJFH 4POZD 5K9QI 3QIUD 4KTDH 4MMZA 2E47A 4PJGB 1G6RA 1NZRA 3TBTB 1EERB 1TU2A 3DV6A 2FYUG 1MRCH 4YDMA 5EOTB 2VWEC 3CWBJ 4AEIL 5I66A 4NDMB 1UVQB 3SGDI 3VXRB 2PR4H 3DSNB 4RAHA 5KS9F 1GGBL 1FF5A 5HHNA 2WXFA 1YEKH 2PLTA 3IXAA 4Q58C 1QSED 1ZT7B 1K3ZA 3D48R 3F00A 3PNRB 1J1EB 4GLRI 3TN0A 3L3OB 4S1SH 2K9JB 4LSTH 1KJ3L 4CC4C 2H32H 1AOHA 1ZK9A 2OL3A 3LRLA 5J6HB 3BYYA 4PJ9D 5CGYC 4Y9BA 4RRPM 1Z66A 1S5HB 4BFFA 4I1PA 4TVPH 5HYJE 5CCGC 3WJJA 4I9WE 5LB1A 5HHQA 1ZLSH 4DN3L 4F7EA 2HZHA 4W7ZA 1KLGA 3Q5TA 3V0VB 4YMPA 1KCRH 1OE3A 4YHML 4PJDE 2Q7CA 4OB5L 5ACLA 2J55A 5GGTH 4ZQKB 4A7PA 5B39G 2MQ0A 1N4XH 2HRPH 1I3RA 4L1BA 3ARFD 5FO8A 1NIFA 3TOPA 1TTBA 4PP2B 4W6YB 1P5UA 4L3EB 1IGFL 2N1TC 3IF4A 4QRUB 3H2PA 4XNXL 2BNQB 2EEFA 2J4WL 5CKGA 1NSNH 1MFBH 1ZEAH 2Z1PA 4HJUA 1SQXK 1NINA 1K5WA 2OZ4A 2Y6SD 4EUPA 3SDCD 3GMRB 1UJ3A 1DVXA 3WIAA 4MN4C 1NCHA 3GPEA 3ZUCA 5APXA 2YD6A 4LDLB 2Z31C 3N40P 5AOZA 5C6TH 1QO3A 3ERXA 3HUJB 4HK3J 1XL4A 2ADJA 1S1CX 3DHMA 2OQJA 2WWKT 3GSUA 1DQQA 1WBYB 3QDMA 2IWKA 1Z9OA 2CUHA 2DTSA 4GUCA 4R0LB 1GVIA 1KDJA 5F9JB 1FDMA 6PCYA 4FQ2L 4GAYA 1JNLL 5E8OA 5HHXH 3ZR5A 3A67H 3UTPD 4MS8C 5IFHH 4HJ0C 1MHEA 3LEVL 1FLRH 3MNVB 4JRXA 4ZW8A 1MIML 1S9YA 3DVGB 4HS6B 4CKQA 5ANHA 3H9SD 1AZUA 2X6AA 4WFGE 1KCWA 4PB9L 3UTSA 1CFSB 3KGSA 3FONB 4WU7B 3H1JJ 1U9KA 4X5RA 2E8YA 5DVOA 1LYQA 3D52A 2B20A 3KBEA 1K4DB 1U8OB 4A7UA 4GKSA 1E0OB 4YDJA 1KFAL 1X5XA 3I75A 4JO3H 5I1GL 4U1KB 5IHBA 1AOZA 2W59A 1R5SA 2EDTA 1U92B 4L4TD 3TNMA 3LXBA 4XAKD 3WKQA 1G0DA 3NCYS 4DPBX 3GF3A 5SWSB 1IFPA 2WVUA 1DVTA 2DS4A 2PYEB 3GI9L 3OGOE 2WO4A 4Y99C 5D4QA 4PI0A 5EU7C 3NZSA 3QUXA 5MENB 3WN6A 3O6KH 4NYLA 5F96H 4KC3B 5KUMA 3IAOA 1SHMA 3NMDA 3BAYA 1ZIBA 4FG6C 4FHKA 4OLYL 4P23B 3S4SG 3WMM0 2VW4A 3R7RA 4HIHB 5ALCL 5HI5D 1D7DA 2ZJSE 1G4MA 3RVVD 3HJ0A 1KIQA 4AJWA 2BVTA 5GJTH 1L0LG 1GGUA 4XFJA 1KT2B 3LZFL 5H2BB 3GEWB 5DRXA 2IH3B 1QABA 3BSZA 1OAZH 3QFDB 3WV0A 3IJYA 3CVHB 1ZRTE 4U6TA 4XN7A 1PTZA 5C1MB 1XF4A 2MKVA 4GAJH 2P8MA 3VXUD 1EAPA 4URTB 3G5XB 4M00A 3B3BA 1NAMH 5AVZB 3WKNA 4P9MH 4PRBA 4TLSA 5LGKA 1WVZA 2B88A 2IF7A 4HUKB 2WKGA 3MRQB 4P46D 4WWKA 5PCYA 3V4QA 4FDWA 2XYBA 5GZNC 1FNGA 4RFEA 4WQOA 3U6RB 3FB5A 3OHXB 4LLQB 2J8UB 3UTTA 1NAFA 1IL1A 1YY9D 2C3XA 3IRPX 4A2HA 5DVKA 5AW6B 2OYIC 3E6FA 3AECC 3DX9B 4WNSA 4HEPG 2X2HA 4XC3L 5JPMC 3O3AA 4N22A 3CXHJ 2B39A 4OUUB 4UM8B 4DZBB 4H25A 4UQ3A 1Z56A 3R06B 4PJHF 4TXVB 1G6RL 1SXBA 1C16B 3KQGA 4LL4A 5F7MC 3MJ9A 4GRWE 3D2UA 5ABAA 1T7YA 5ETUB 4FMVA 3QPQC 2V2TB 5IMKA 3BRTB 3K2UH 4HLZG 2GM4A 2D7PA 3O3EB 3TTSA 4TRPL 2CA3A 4PJXF 3DXAA 4WKXA 1MFMA 4YSTA 5I19H 2FR4B 2Y2YA 3HE5B 4TULL 5FYLL 2OL3L 2FGWL 4UILH 4X80L 1YN6A 3HG3A 4WU5A 3BCCD 4OU3A 4X5QA 4ZSOA 4F7TB 1HS6A 4ZUWB 1FC2C 2WCSA 5K39B 5LBSH 1XIWD 5E9DA 1KACB 1UD8A 3V0HA 5E4EB 2J4WH 3L4VA 4H1LB 1RK1B 2OW6A 4NQTA 4JHUA 4FNQA 3VXSA 1FL5A 3IFOB 3PDDA 1J0IA 4NLAA 4HH2A 3JTSB 1PX3A 1H3PL 2WO3B 1UATA 1XEUA 2EYRA 3H7BA 4WWID 2ORBL 4HWEH 4HOMA 3G9VA 1T83A 1IBDA 4M6NL 3DX3A 5EU6B 2HTLC 3HMXA 1GW0A 2OZ4L 2JI2A 2WQVA 3BDYH 3EJZC 4WI8A 2OGUA 3U0PA 2R8SL 4CUCA 3CCQP 2QM8A 1FZKB 1L9OA 3O11A 1FH5L 2ENPA 1FNEB 5CO1A 4HEME 4U3SB 5B22A 4HH9B 3LEVH 1IAMA 3PFQA 5FYJE 3F7VB 1MIMH 3KPOB 4G8FB 2VW6A 4DEPB 1EDQA 1NBVH 5I24A 2G2NA 4IGBC 4NZJA 4PB9H 4Q0XH 2DLTA 3VD2A 2ZXAA 4J3OD 1JI2A 5I8CB 1HNFA 4PVNA 1G7PA 2B4CL 2Y3NA 2VIRA 2EYTA 1O0VA 4YVNA 5EB9A 4F37K 5I1GH 3MMEB 4ODWA 3SCMD 3H85A 1M7UA 2MQGA 2EXTA 4LAJH 5FFLA 1DJSA 3UOAB 1G9MC 1XMWA 3D6YA 4HUUA 2ZVNB 3BRVB 5MERB 1K9MQ 3QJZA 1S9WB 1XR8A 1F6LL 3TGXA 2VLME 1NCUA 3T0EE 2BVUA 1BXUA 4HT1H 3HKFA 4NKDA 4QHLB 1R33A 4ZMVA 4N2HA 2DQTL 4LIQE 1EZVE 4HIPA 4RGOH 3DTXB 4Y4HA 4J3SA 43CAA 5F1IB 1WT5C 1UOLA 1N86A 1ZTXE 1T1WA 3NSJA 3VFUA 5LG1A 5GRJL 1SN0A 1PYWA 2DWDB 3OZKA 4I2LC 1VKXA 3C75A 1ICTA 2PABA 2QPDB 1JVLA 2WZ6A 3QORC 3IJEB 1VQ4P 4XMPH 2DWTA 4AOFA 1PJ9A 3MGNA 1NAYA 4WFHD 1FG2A 1HJCA 4M8QA 1ZR2A 4XXCA 4PCSA 1ZLVK 3O8ZA 2JMRA 4HCRA 3OV6A 3BSZL 1YYCA 1G7LA 5E6IC 1WAAA 3PHOB 3SDDA 2Z1KA 5JDSA 1T7VA 5C09D 5JW4M 3CVCA 1EXIA 4G3YL 4EVNA 3F58L 2VDPB 1JNJA 2NYYC 4LRNL 4WSJA 1E7UA 1RZ7H 3ZDZE 1QTPA 3RL1A 1TFHA 4XC3H 2WSCJ 3PWUA 4M03A 1I9IL 4XT1C 1O6TA 1MCPH 4RMTA 4FAAB 5IKCB 2ITAA 4XWGL 5IEHA 1JD7A 3IFNL 1FZBA 4XB7A 1FYTB 1G6RH 3AGWA 2DN7A 5FCSH 1VPCA 5I1AB 4R4BA 1HHKB 1F4XL 2GJ6D 3VG9C 2EDWA 5JPNC 1P4BH 3WNLA 3FFDA 3B7TA 3GNMH 1JRHH 3P32A 3T5WA 3EJUA 4XOCA 2CHZA 4ETYA 3VH8B 3FKUS 3WIFA 2BP8B 2BO0A 4N8VG 4NWUH 4OCMC 4DAGL 2F1AA 4W9EC 3FCSB 3MJ9L 4TRPH 3U82B 3OBAA 3RZCD 1ND0A 3IAQA 2YIUB 1S7XA 3FUIA 4P5TD 4XXWC 1M7IB 5GRUH 4TULH 2P46B 5FYLH 2OL3H 5EN2A 3QDGE 2FGWH 2GTQA 5K33A 4MLIA 4X80H 1QLEH 5ISZA 1VACB 1M57D 2V17L 3B9KB 1MLBA 2XICA 3BWZA 1HHIA 4G5ZL 4TNGA 2CK2A 5IWLC 3ULSA 2EVJA 4HGKC 4NNYB 3U2JA 3HZMA 3W9DB 5CCHD 1BVNP 4U4IA 3H1HE 4U1NA 4ZRGA 1SQXJ 4KJYB 4Z7OB 2BVPB 1M9SA 5B38A 2AW2A 2OMXA 3QI9B 2N56A 4ZMQA 3O45A 3RDTC 4PJIE 2VQTA 4XAWH 2EH7L 2UXGA 3NA4A 3Q3DA 1FL3B 1LTTC 2GW5A 5G5DB 4M6NH 4JPWL 3K2KA 4FJ6A 2OZ4H 3LJ3A 1TITA 1N70A 4YGVA 4EUPH 5TF0A 1CF8H 2FWSA 5DK0B 3KPRE 1E6OH 4JKKA 1FH5H 5AVVB 1MVUB 2SODB 1K9TA 3BYTA 4JO2L 1M1JA 4MJHA 1XAKA 1F56A 3RK3C 1VPOH 2X7LB 3LKOA 4XNUL 1P9MA 5L8LB 1ET7A 5DD3L 3QUYB 4LB8A 3WS6A 1I82A 4OVNF 3HMXL 4ZXBC 1DQTA 5ECGA 3GBEA 1HWGB 5J6SA 1NDGA 1N3NB 1TQWA 2A77L 4OAWA 4EN2A 5HYJA 4JK0D 1O6SB 1A6ZA 4E5XG 2Z7YA 3QVAA 2K9FB 3ITKA 3D4GA 4Y16D 2WITA 4QT5A 1HEJC 5AFAA 1GU5A 3WENA 4BYHA 1MN4A 3KLLA 3OKDA 5F97E 3EOTL 3CHRA 3QWOB 4DW2H 1BQHA 5EO1B 4APQC 5LBGA 1MNUL 4S1QH 4ISVB 2CGRL 4ODSL 4A2GA 1KPUA 3VG0L 3PJLA 4FKEA 3PL6C 2CMRL 3O0LA 1NL0L 2ZYSA 2AQ2A 4MQXC 1QQDB 5LCVH 5SWZB 4PGEB 2LVCA 1LILA 4A6YB 5D7JD 5EBMB 4NZUH 5D1ZD 1KZQA 1VDFA 1QA9A 3ESUF 4LVOC 3BE1L 2C9NY 3QEUA 4G80B 4F27A 4OZIE 1KLUA 2FK9A 3N0PB 3M0DC 4N4YB 2VLRE 4QRPD 4DK6A 1A4BA 2WMPA 1I7ZA 3ROOA 2UZIH 2P5ED 3MRPB 5I6MA 1NKNA 2HFEA 2D3LA 2WXGA 1IC4L 4C54A 4QJ5B 5JORA 4CVWA 4JPIA 1PV3A 1CJYA 1X8YA 3TLRA 2CO6A 3U0TB 1KCSH 3MRJA 3W39A 2PXYC 3KPQB 4G1MA 4G8EA 3M9HA 2XKSA 4M43L 4EXPX 4LRNH 1BAWA 3GBNL 2NPSA 3TYFB 3ARSA 4NBYB 4UDTA 2AK1L 3WJLC 3J7HA 4HCRL 4OR1A 1E27B 1KCUH 1NJ9B 1NM4A 2OSLA 4RFNC 4G8GD 3ZJAA 3SWKA 3HE7D 5D5MB 2GUYA 3GF8A 1PZDA 4C56A 2QR0A 3RWDA 4AQRD 1YC7A 2COQA 3OSKA 5FA4B 1I7RA 3LQMA 4GRLD 4GG8B 3ZDXE 3VFPA 1MI5A 3GMOA 1TPXC 5E8NA 1OE1A 4NERA 4MJIB 5E5LA 2YIHA 3LTVA 4RX4A 2FKWB 5F9AC 1JNNH 2KS1A 4KRPC 3QZOA 4CN6A 4DKEL 1ES0A 3PWPE 3VGBA 1USDA 1T6WA 3I6LE 5B1BB 4B5ZA 3MV11 1CZ8L 1PZCA 1HHHB 2V17H 3HD7A 2MCMA 5FECA 3G08A 3K6DA 1RPUA 1BX2B 4EYYQ 1E65A 1SUHA 3V6OC 1XGYH 4QHMB 1EBAA 4MRBA 4X7FC 5E2JA 3D34A 4U6XA 4F7MB 2YD8A 5IROD 2QG4A 2A7BA 1BXVA 4GXVL 4WJ5B 5DZOA 5F9WC 1F3DJ 2ESVB 4KJQC 4FTVE 1VERA 2EXWC 3N06B 2HJFB 2FE0A 5E6YA 4ZFFA 1RHHB 1OP5H 3KR3L 4KK5C 1IFNA 4NQUA 2MTPA 4I89A 4MJ5A 2MQ3A 3HBZA 1U36A 3SY0A 5G55A 5J4MA 1G9NC 2IPKB 1MNNA 3MRIA 4ADIA 5C0AB 3OHMB 4JPWH 3NDZE 2WSFJ 1BZ7A 3POHA 3HNVL 4R97C 3LNGA 1C9SA 5DJ2B 1YBKA 1X5YA 3HPLA 4WO0A 4YQXH 4DIXA 2UZXA 1AXSA 2JJWA 4KPHL 5DD3H 3SBQA 1OWAA 1QFWL 3CFCL 2VCOA 3RGHA 1IGYB 3CQPA 3HMXH 3MOQA 4AZ8B 4M1DL 4FNLL 1KILC 3R4YA 2GVYA 4XPFL 3WL9B 4OF8A 4WI2A 3MLRL 2GTWA 1BM3L 2D9CA 3WG7B 3LNFA 2AEQL 4N2GA 4PJ7B 1RLBA 3IMBA 1GTWA 2D2OA 2NW2B 1SF5A 3LZRA 4ODUB 3MRDA 3D0LB 3BVNA 5TQ2L 2AKRA 5ABZA 5C0EA 5IQOA 1R4XA 1QHQA 1B2YA 1KB9K 4NRZB 1G7HB 3GD1C 4UUJB 1MNUH 4Z7WE 5I8EA 3RRQA 1I8KB 5F0PB 4MAYD 5FKAB 1D9KC 3SYAA 1HSAA 2CGRH 1T20A 4KK8D 2PW1B 1ZSDB 5CJ4A 1T80A 1M8OB 3ELAT 3IDGB 5T5NF 2CMRH 4F8PA 3LPFA 4HHAA 4RMVA 1LE5B 1NCBL 3BXNA 1XFPA 4IJ3B 4UINH 1K5NB 1FDLL 1NEZA 4I5BB 3VWJC 4BGDA 4XI5D 1YNLL 5D1QC 4YR6A 3KXDA 3BE1H 4L1TA 4XVSL 1YMHA 2GTZA 1QBML 2J1WA 2OSXA 4UNTA 3TVMA 1NFDE 4HIIA 3ZE1E 4B95C 4MA8L 4YXKL 5A6MA 2R3SA 3VXOA 5CIPB 4MCZB 2A6DB 2PCFA 1QHOA 3QXDA 4PS8A 4TLTA 4R7VA 4MD5B 4F5CE 3KW8A 1AD9B 3LS4L 4J12A 4XWOC 4HGWA 2UZYA 1TNMA 3CC5B 3ISYA 4M56A 1XTCC 3C5ZB 4MJ6A 1LWRA 1ZHNA 4TQHA 4OD2B 3K4AA 5BRZA 2Q6WA 4L8DA 3PXJA 1A1OB 2EIEA 3D50A 2GITB 3GBNH 3ARDA 4XZUA 2H6PA 4FQHB 1RUAL 3F3HA 2L04A 2AK1H 2X4RB 3P2BA 4IOSD 1BE3D 3CQFA 5SWQB 1MH5B 4HCRH 4Y5XA 5E8EB 3GUFA 4MVBC 4TMPA 3CFKB 3D69B 3CZJA 3O9WD 4N8CH 3RIKA 2XTSA 5E00B 1C5BH 1LEGB 1J9SA 1T5KA 4LCUA 3UIYA 2E9GA 2V5TA 5TQ0L 1SQPD 2IANB 3VX0A 3PAUA 1CB4A 4XZ4A 4K35A 5DGQA 1E40A 3SO3C 3QW9A 2XNXA 3S8GB 1V3KA 3SD2A 4Z7VF 4F58L 1F1DA 3GSOB 3MYJA 3T0EA 1B90A 1DX7A 1L0QA 5BZDA 3B56A 3BCFA 3N1QC 3HW7A 3AREC 4DKEH 3MKGA 3Q1MA 4HIEA 4MMZC 4R84A 5CGBA 3ZW3A 3PNWA 3FQUA 3L7EB 1ZKAA 3TGUE 3CFDA 3D18B 3OAWA 5IK3B 3QJFB 4TSAL 1CZ8H 1HQ4B 1KBGL 4ANKA 4ATTA 4J3OF 1Y8AA 4JDVB 2E75B 3Q7JA 4U1JB 1EEZB 2PTTA 2O5XH 2VL5B 1YJDH 5D2LE 1JK8A 3MX0B 1BGXL 1MJ7L 4LCWE 1U8NB 4FJYA 1F41A 5DCCA 2CHNA 1XF2B 1BLIA 2ZJSL 1BG1A 2B1AL 4LF3A 2BC4A 2R59A 4WSGA 3KR3H 2CE6A 4G6FB 3L7FA 1OK0A 3G6AA 4YHPA 5EBGA 3PGFL 4PLNC 4YZFF 3NGBB 5IF0B 3LRGA 3VD0A 3ZL4L 7FABL 1JCCA 3JUYA 1NBZA 5TTRA 3UIAA 4Z95H 5AOLA 4A7GF 4X6DB 2WLLA 1VFUA 4MSWB 2J7LA 3V6OE 3P4NA 1I3VA 3N43B 3SDXE 4MD4A 5H2FH 2XA8L 2ZSWB 3GPSA 2VC2L 1ASQA 3K6NA 1QFWM 4KPHH 5JZ7C 1FZMB 1LP9E 3CFCH 2FEDC 1S7RB 3M8OH 5LAXB 4L05A 3TONA 1VGKB 4M1DH 2XWZA 4FNLH 4XPFH 4PLJD 1N0XL 3MLRH 3H1HG 3DUSA 4LSUL 4N2NA 5TK4A 4FQXA 4DVRL 5F0JB 2AEQH 3N91A 1RJZA 5GRYA 5I76A 3NSDA 4M7ZC 5JIHA 3D06A 1EH9A 1F1AA 2NX5A 3UAFA 4RQQB 4KDVA 4RDBA 4ZOBA 3M1CA 3O2DA 5IFJB 5TQ2H 2CGYA 2R0ZL 2GFBB 3U9UA 4ZW3A 2WNWA 1Z32X 3DRTB 4AH2B 4L29A 2OXHB 3X12A 3CXHH 4D9LL 1LWUB 1JY3P 2N1KA 2R4RH 3GSWA 1CL7I 1JERA 4Y5YA 2AXTE 1QFWI 1XF1A 2YD0A 5BV7H 4PRHA 4CADB 1M6OB 2MMXA 5DDHB 5TGBA 4OZFH 4PR5B 1HKLH 4WI4A 3WUTA 1E5AA 2P24B 3QA3B 1NGXB 4HPOL 2ATKB 4OJEH 5JLZA 3SDAA 3Q6FA 1YNLH 5JIQA 3H25A 1XF5B 4IU3B 4NJAL 4PJIA 4V33A 4RGNE 2F54E 2V5MA 4UZSA 5GSRB 4FQLH 3BDBA 3BWUF 5J1AA 3T8XB 2V5YA 1QBMH 2YPLA 3HG1B 2QJPB 4MA8H 4YXKH 1QFUL 4KVCL 3H1IG 4UM9B 1OM3L 3QHTC 4MXQD 3HHMA 4FN0A 1U3HD 3UTOA 3AEGC 5HDQL 3HVNA 5LNDA 4QMAA 1X5IA 4V11A 1KQGB 1NC4A 1QBBA 4OLZL 4MNQE 4H88L 4JFDE 1NU1D 5IV2B 1NGZA 2H1XA 3EZ8A 3MNWB 3F83A 3KGRA 4GI8A 4U0RB 5DQJA 4DVBB 3ARBA 5DI8B 5JXED 2WVTA 4MQSB 5L2KB 1RUAH 1IFHH 1QI4A 4UB8E 4N2IA 4WO4D 3WN5A 1LEIA 3U0WH 2V3FA 1ZE3H 1G84A 2WXQA 1UOWA 1T66C 1SBSL 1ZPUA 2BHYA 2JJSC 5F3BB 1QL2A 1KY6A 3JZYA 4X8XA 5FYJL 3IDYB 3ZQ9A 1SVBA 1X7SA 3WLWC 1A3QA 1S9VB 1NLBH 2KYIA 2JJUA 4U49A 3F04A 3MUGB 5LG6A 3GJEB 3GMQA 4RJTA 3GRWA 4G1EA 5EO0A 5TQ0H 4JY6A 4F37F 1H3VA 2VRSA 1BV8A 4K8RD 3RZWA 4IDJL 4OV5B 2ZCLL 3MRMB 4KY2A 5EUKA 4PP1D 5A43C 1DTUA 1C12B 4F58H 2IFFL 4S1RL 4H7VA 1AGBA 1XSJA 2XG4B 4LC1A 1FHNA 2OX5B 4WWKC 2WLYA 1AC6A 4IBTA 3BWAB 1NVOA 1JZGA 4MMXA 2DIAA 2ADGB 4TSAH 5DTFB 2VZ3A 4Y2DA 3CBJB 5DEJA 4L3CA 1NWOA 5JIMA 5IGXH 5KJRH 4OZIA 4BQCA 4KI5D 5INCB 2VLRA 1ID5I 5KEZA 2YN5A 5GGVY 2VDKL 4DP8X 4ZD3H 2IYPA 1ZTXL 1N7SC 3IKCB 4X42A 2QQKL 3BH8A 3DUUB 2B1AH 1OXZA 4N9GB 1KZYA 4YK4C 5DT1L 1FFNA 5K5YA 4LBAA 4P2RB 4TL5A 4F7PA 3PGFH 4KGLA 1FBMA 4P2OA 3CQQA 3BI9X 3NFNB 3ZL4H 3ZTJH 1HDMB 1IBFA 2B3IA 4ZPVA 2C26A 2X4UB 3ARGD 3VXMB 1WITA 4C7NB 3BASA 1NUNB 4XN4A 5HDLA 3MV9D 2CKBA 2YS4A 1BD2B 1FNHA 4Z5RB 5IESH 2XA8H 2PF6A 2ZYGA 4XN8A 2RKLA 2XV3A 3ROLB 4BUGA 2JNZA 2PP7A 1PDKA 3OW2O 1YTZT 1RP8A 4PV9B 1KBKA 1TCMA 4LLHA 3NJKA 1KTDB 4JB9L 3D85B 4JFQB 4LSUH 4DVRH 4NHUB 1LJ2A 1AJ7L 2IOIA 5I2IA 3Q13A 1DBML 2LAAA 2J8OA 3PXLA 4TSBH 3RAJH 4YWGL 3HCVA 2EC9T 2V8MA 4BA0A 2YBRA 3GKWL 3EG9A 3K8KA 1R19A 4I0PB 4YDKL 4EN3D 3JV0A 4L73A 2F7QA 2JWYA 2VDOL 2POHA 2OMWA 4FULA 3AG1B 3UERA 4HOZA 4D9LH 1T22A 1U91A 4U1GC 4Q2ZA 3S4RA 2CM6A 4AIEA 1KB9J 1O9ZA 3KBFA 3DJSA 3O8XA 3QUZD 3O2DL 4FZ8L 1QLFA 5I6XC 2AXFB 2KLRA 1FGVH 3BAJA 1I8UA 4M48L 4ZUVB 5ID1B 1ED3B 2K0RA 4M5TA 4KXDA 4RA0C 2Y1YA 2LTQC 1HTLC 3H1KE 2IVFC 2WXRA 2XKUA 4LVNC 4MA3B 4XPAH 4FTVA 2WGXA 3DV6B 2VLJB 3ILEA 5F1NB 3VFOA 1V3JA 3OF6A 4UBDC 5C0CD 4N0CC 3SQBB 5KSBF 1HEHC 4Z78A 4GBXB 3CHXA 2NTFB 2P49B 2VDNB 2XCMC 4QOKA 1J1OL 2KB7P 5HHNB 3T0VA 3GSRB 3IXAB 2WPSA 1QFUH 4ZMWA 4BFBD 4EI2A 1MWAA 1OT2A 7PCYA 1OM3H 2H0JA 3B4SA 1UB6A 2NCMA 3EGDB 3TN0B 4JO4L 3ARXA 1SPDA 5HDQH 1QHPA 2ZOTA 1Y18A 1W2BO 5IBUB 1UJTA 3MNMA 3G3LA 4NKIL 1CIDA 2VH5L 4OLZH 4H44B 1AQKL 3WFCL 4G7VL 1EXHA 4OZHF 3L3HA 5IHUH 5KANG 4JDEA 3IDUA 1CDYA 2WQ8A 2HJLA 4TQ8A 2Y07L 1KLGB 5I5MA 3VB9A 2R2BB 3NJLA 3SSUA 4P4KC 3ZZQA 1BDYA 2XUWA 4JREC 2FSEB 1FVEA 4XPBL 5HHOB 3TL5A 3FRPG 4NN5C 1J0KA 3FHEA 4C4UA 5J57B 4JM2A 1QI3A 4XE0A 1I3RB 3WEXB 2FJFA 2EDQA 3GHGA 1P5UB 1T0NA 1U2HA 4J3XA 3E3QC 4H13C 3FX0A 4XNBA 3PP3K 2PMZA 4X4XA 5JW3L 2ZCLH 3AW5A 1JWSA 4AV5A 1YPZA 4Z7WA 2Q0ZX 4XXCC 2IFFH 2OTUA 1TJXA 3UACA 2NY6B 2F9BT 1UJ3B 1A4KB 1HWHB 4QYAA 4PJ5D 2B87B 1G7QA 1IM9D 2E9WA 3GRWL 4U6HA 4W9DC 5AKVA 3ZIMA 3STLA 1AACA 3RK2B 1AKPA 4KT0J 3BGFC 4D6TJ 2OQJB 4HZ1A 5B39B 1V7ML 4FQ1L 4JFEB 3AE4C 4MCMA 1L0PA 4TNVF 2KQMA 1U2CA 3E2HB 3Q6GH 2VDKH 4L9LA 4P8QA 4YHOL 4LKXB 2WUBH 1ORQA 2YO2A 2QQKH 1SJMA 1W72H 1PGOA 4IEFA 4LLDA 3SGKC 2XPGB 2DMBA 1ACXA 2HJKA 2ZAIA 1OARL 3QXWA 3MJ7A 5DT1H 3PGDB 5E2UL 2AEIT 4GKOA 4J3OH 4PS7A 3FF8A 1N6QL 5I73C 1BHGA 3IWVA 2FO8A 4N6JA 2WXOA 1ZGLA 1DVFB 1PKOA 4KX9A 5JHDE 4GOFA 2O01J 1JFQL 1S78C 1YJDC 1LD9A 3VGAC 2AJVL 2WLHA 1T2KC 2DPKA 5IQLA 3TGUG 4NSKA 5TE6L 5I15L 5KYXA 1EZVI 2Q2EB 4UNVA 5BVJA 5D1XE 5SX5H 4G9FA 4OIAA 4O5LL 3AE3C 4PJHE 3QUXB 1UIIA 1MW1A 4NYLB 1MUUA 3AXLB 3NCCB 4H5SB 4KU1A 1NTME 3N6YA 5BS0B 2B14A 2IBZG 2CKBL 4NCDA 3BAKA 3BP4A 1AJ7H 5FYKU 1NTZK 4NPDA 1T1YB 4ALAL 2DQEL 2EAEA 2GCYB 5C08D 1VADB 2VDML 4YWGH 3IETA 3GKWH 1HOEA 1BAFL 5I1EH 1LTJB 3RWFA 1IE5A 3U6XA 5DRXB 1NUDA 5KWYC 2ITEA 3IJYB 1OTSC 4EOWL 1VQMP 3HBQA 3PWNA 4X6EA 4XPHH 4HVBA 2C9VA 3REVB 2P8MB 1EAPB 5DR5L 4AGPA 4RKUJ 2MKLC 1E4XH 4Y7MA 4PRBB 5D2LA 4LCWA 5DFWH 2EUXA 1WZ1L 3AMKA 2ICWB 1FNGB 1B9KA 3QT2A 4RFEB 1CICC 1KXHA 1NMBL 1UT2A 3FB5B 3WS6C 1F13A 4JY4B 3S4SB 4BBWA 1VEMA 1IL1B 5ERWA 5L4IA 4XHJC 3RUGF 2XWTA 4WV1B 1JZEA 4MWFA 4WEMB 3ZVVA 3TJPA 32C2A 3S88L 3O4LE 1CXHA 1LTBC 1E8ZA 5BV7C 1KEGH 4UQDA 1D6VL 1E6JL 3LHPL 2E43A 1Q9KA 2QFRA 3GBDA 1TTRA 2W0FA 4JO4H 3QYNA 2XTLA 5CHNB 3ESNA 3HG0A 2JDIH 3QIUC 3SDXA 3RNKB 5K59F 1LL1A 2AABL 4NKIH 2BVQB 4DGUA 3MNDA 1BVZA 1YDPA 2XWJA 4LOUC 4G7VH 4JAMA 3WFCH 5KBDA 1MWAL 1TVDA 2IAMD 5CLXA 1BECA 2Y07H 4IRJA 4ZPTB 5IW1B 3RG1C 2G30A 2B08A 5FPIA 3TJEL 4ZO9A 1UXMA 2QJDA 3T3MF 3IGFA 3P3RA 3RQ3A 1EFXA 3AE8C 4MCYA 2DQFA 3CVIL 3TA3D 2CDFA 4ZSOB 4KQ3L 1TJIH 4P2CG 4XX1G 5DUBB 3AWFA 2FZ3A 1OT1A 4X4KA 1TYRA 1QVOB 1GIGL 5E9DB 2DWEB 2FYNB 4NENA 3VRIB 3IMSA 3NK4A 5KAFE 2K8MA 4FNTA 1J8HE 4W6XB 5AYTA 3VXSB 1OAQL 4NLHA 3A2AA 3UGXA 4LLVB 4CBZA 1YN7B 1LP1A 1ZE3C 2K4AA 2AMGA 4J4PA 3H7BB 4UIMB 4L48A 4AT6A 2PWFA 5CEXB 1A02N 3X1NA 2L7QA 3ARFC 3VDAA 5T1LA 3SE3A 4IRSA 5KBKA 4FQ1H 4I8DA 1ADQA 2F54A 1E4KC 3A0HE 1HHGA 3I50L 5DS8A 3O11B 4P3CL 2X41A 3PH0A 3MV8E 2GUSA 1RURL 4GXFA 4YHOH 3N0AA 2Y6SC 3U4BL 3ILPB 3SDCC 4IIQC 3RGVA 3L5JA 4GUOA 2ITFA 2KZBA 3EH4B 4HJTA 1A6AA 5LWYH 9PCYA 2FNBA 3FO9B 1OARH 4MDRA 3KZIE 1JGDB 3GXMA 3MXVH 4ODXA 5E2UH 2IWFA 3V4PH 2DEYX 4I85A 1BZ9B 1G7PB 4JFDA 4LEEA 2QVFB 3KLHD 2YXQB 3EUDA 2EYTB 3VI3B 1HH9A 1YJ9P 1QSFD 1KIPA 3QFJE 1AHWC 4JZJB 4LGPB 3W57A 4NGHH 3E6HA 4A7TA 3IGAB 2VJ0A 3FN0L 5KYWA 3X13A 2ED9A 1JHTA 2YKOA 3WDIA 1M1XB 5IR1B 2AK4D 4LP5A 5T1MA 5F7NC 3QIWA 5TDPB 3CCLP 3FW6A 3B5ND 3V2RA 4NQXB 4O5LH 5HHPB 4EZMA 4KK9D 1ZLVH 4FXKC 1U8MB 2YUXA 2NY0C 4NKDB 1IBZA 1OAUL 4U6YB 2FJGB 1IKOP 3H9ZA 4JCWA 1ONQB 1UCTA 2DQEH 2G9HB 2PUQT 3SE4A 3R4DA 2R5DA 4XXDB 2DQIL 1VQ6P 1PYWB 2DTMH 2W60A 3ZDMA 1BAFH 3RL0B 3EF4A 4QXGL 3C6LA 1W5CE 3ARWA 3EFDL 4PG2A 3JV6A 3ZIYA 3WUWB 1FVCA 3L72D 2C7UA 2LU5A 3QUKA 5J5EA 2COVD 3HFMH 4MMYB 1NTZE 1V7NH 5KLVK 2HH0H 4XCEB 5FV2A 5DR5H 5I6LA 3OR6A 1FG2B 3SYPA 1RIHL 2E9BA 4LT7A 1FFTB 5I6OA 4WI6A 2XN9E 3AB0B 2GBUA 1JY2O 2X6VA 4WW1B 5HI5C 3FQRB 1WZ1H 3JYCA 4PTTA 3SDDB 4OJDH 1I8LA 5INDA 5JDSB 2MJZA 1UA6L 2BHUA 1NMBH 3KYMB 1DJIA 2H6UA 5B3SB 1DBAL 2DM2A 3G6JB 4KNSA 1TQCB 1HQRB 3QUML 2WVRA 2IBGA 3TWCL 3DYOA 2OMBA 3DX1A 3RL1B 3VWKB 2X1OA 1AZVA 2NY3B 5C0GB 2HMID 2EUZA 3MXWL 3LZQA 2CAKA 3S88H 3QEQB 3H8NA 3LHPH 1BQSA 4I3RL 3II1A 2OTJP 1SDDA 2EABA 1TENA 3RVXD 3L2MA 3OKNA 3FFDB 4HQQL 4JQXC 3DVNB 3WNKA 2Q7YB 6FABH 3V5KA 4KI5F 1PCSA 1WICA 4ACTA 2I07B 1ZHBA 4P9HL 1MWAH 1YEDA 3WIFB 1BWWA 1FPTH 2UVEA 2EUVA 1DR9A 1W2KT 3CPUA 1B4RA 3FFCD 1PX8A 5DURD 3P7KA 4YHIB 3H1KG 1HBWA 2BSTA 3BP6B 4X6CB 3ZE0F 2GUVA 2A99A 4M8RA 1DVQA 4RA3A 2WAHA 3F7YB 2WT7B 1TJGL 2R2CA 5CUSL 3GMLB 5IHZA 1BYPA 2NPLX 4ZOAA 1MLBB 1OTTD 1HHIB 3M0AA 3P30L 3HTLX 1LXMA 2K7QA 1Y9BA 2ICEB 1YY8A 2LGNA 3TIDA 4JN2B 4PG9A 3ULSB 1HNGA 3WFZA 4HKZB 5CP7B 3A0BH 2HKHH 3B3IB 3BWSA 1INDL 1IC2A 4K7PX 2OZNA 4PJAB 2OI9B 5FHAL 2W83C 5D9SB 1OAQH 4N8VB 4DF9A 1AGFA 4PRPB 1GTFA 2Q5UA 4DZ8B 5ICUA 2CGZA 2QSQA 4GKZA 3TM6A 3VMNA 1A7NL 2Q7AA 2WVVB 2EUWA 5EEZA 4XP1L 4S11A 3DO3A 2W9DL 1R9FA 5EG6C 2YD2A 2XJLA 3PY9A 1XIWC 3CFIC 1ZGLP 2VN4A 4YGVB 1OIPA 4KZ0A 1XSKA 4FG4A 5I1CH 1IM3A 2J1KA 3DURA 4Y5XC 1M1JB 1RURH 1BXXA 2WLJA 3IE9A 4AMKL 3S35H 1JNHA 4DEWA 4L8CB 4PVMA 2JTYA 1URQD 2AJZB 1ADQL 4NKOB 5FAAA 1KIUB 4GW5A 5KSAD 3VMOA 3OR7B 2Y4SA 2AJYH 1N2RA 4BIKA 4UQCA 1UQSB 2HLAA 5F7UA 5HYJB 3TBYA 5HVGB 5E99L 3GMMA 5ICZB 1KJ2B 2PWHA 1AE6H 1CIUA 1I9RH 2F6AA 4IOIA 4M61B 1JV5B 4XNZC 3RIFK 1VFOA 3KXFA 4KO5A 1M90Q 4PJDB 4QT5B 3CFBA 4XNQA 1BDCA 1DYZA 2XKNA 5IZ7A 2D3NA 3OKDB 4PGCA 3FN0H 5AWNH 3MNZA 1S7WA 5D72L 1ZGLM 2J12B 3V4WA 4HGMA 5HP5A 3EUUA 5CKAA 1YHQP 4LSPL 1R75A 3STZB 1FV1A 4J3OC 3WTVA 4TN9A 3FU7A 4I87A 1CLZL 5E6RB 5DJTB 1M7XA 4AYBA 5FO9A 4QRRE 3FBQA 1XB8A 1H88A 3FU0A 3MRLA 2CLVB 4XMKH 5IIEB 1NTZJ 4E5XB 4WY4A 3I9PA 2DQIH 2ZUQC 1QA9B 2NSMA 3S2AA 4CMHC 3RI5K 2LHAA 1AGDA 4QDGA 1UEYA 1HGZA 4QXGH 3DVFA 1HCZA 5CJ8A 3SZ6A 1YEEH 1VIWA 1KTJA 1KG0B 3WDHA 1HVVA 4IYKA 2ZG2A 3GW6A 3ECVA 3VFSA 3H9SE 1UB5A 1JGVL 3ZKXB 2J88H 4XP6L 1RIHH 2EDHA 1B2WL 4JPIB 4JPVL 1OHZA 4AV0A 3FXDA 3FU5A 2YK1L 3UTZB 2BCCG 5C6WH 5IEKA 2C4XA 1IC1A 5IOPA 4HJIA 4XCCL 1AVYA 1CF1A 1UA6H 4GUQA 4Y19B 4HW6A 1L7TL 4NO5A 5KLVE 4QWWD 1MVYA 3O6ML 1NGPL 1A3ZA 4XAKE 1NTMG 1GW3A 5E8PB 1H8AA 3POCA 2NPSB 3QUMH 4JFFE 3S37L 1X9QA 4B41A 2OYOA 3TWCH 4R7NA 1MY7A 2VZTA 5I0YA 2KSJA 3KCPB 3FSWA 5FM8A 2BDNL 3L3JA 2OSLB 2P7TA 3MXWH 1Q38A 1YYLL 4DZOA 3GHEL 4TQEH 2ZPKL 4I3RH 4D8PB 4CN4A 2ZWYA 4YPGA 1IAKA 1OGAE 3L4CA 1BJ1H 1ROWA 2ZUUA 4HQQH 4WZ9A 1TVBA 1ZVYA 3FPXA 3GMOB 1F6AA 3MGTB 3QWRA 4FFTA 5D1XA 5E8NB 3ZT5A 4E9WA 1XBRA 5DC2A 4P9HH 2N7SA 2F53E 3N41B 4TOYL 5FM5O 2QDVA 1BA9A 4ZS6D 1HCVA 4YUEH 5AOMA 2RHEA 2E8ZA 3VXUE 4HD9A 2QADD 4Y4FD 3QNYA 3GBLA 4N1CA 5IMLA 4XC1L 1TJGH 3SDAC 3EBAA 5CUSH 1BVOA 3HD7B 1RMFL 2IGLA 3G08B 4WJG3 3PXHA 4OF3A 1W8EA 1MCQA 4PIRF 2Q87A 1GL2A 3N1PC 3MCYA 1IBBA 1X6LA 2OCFD 3KLAA 4IU2A 1TQVA 4UYPA 4U1MA 4XRCA 1INDH 1CGYA 2VMFA 5FHAH 5DMYA 1NH6A 2EO9A 3ARUA 3MODH 4P5TC 5ADOL 1YITP 1J05A 3DUHA 3RJQB 4ZFFB 4JE4B 3C8DA 3O3BB 3HRZA 4AC4A 1TLMA 3SZKC 1EXUB 2OTKE 2K4WA 2WJ7A 2W9DH 1PLCA 4KOBA 1TJHH 3ARBC 2P26A 2HLFD 3ASWA 4AKOA 1BZ7B 2WANA 2WTYA 3N3EA 4PJEF 1U95B 4ZO6A 5CCHC 2I9LB 3MA9H 2FO4B 2H1PH 1UXSA 1WPCA 2YFNA 4NQCD 5DEFB 1MEXL 4GOSA 4XGZA 2CBTA 3FQTB 3SJVE 4B50A 3O4LA 5DEGA 5EUOE 1MAMH 2IDCA 3GLEA 5JOPD 1KB9H 3VVWA 1EXGA 2XZCH 3ILQC 4GRWB 1YLBB 3I3EA 4WGKA 3NCXA 4KRNA 1O7SA 1O7DE 2VKWA 1ADQH 2JIXD 3GG2A 3HE6D 5KOVC 3U7WH 2GTWB 1KXVA 2N9BA 3LKSB 3QQDA 5E99H 2X6MA 3APFA 2YEZA 1M9WA 1I1RA 1S7VA 2BP0A 1NIAA 3WMSA 5D6CA 3MUJA 4FHJA 4MMXC 3CD6P 1Z3GL 4L2YA 4Y2DC 1PPIA 3SEPA 1KB9I 2DDQL 3V5BA 3Q0HA 1D7BA 4LSPH 1HSAB 1SEQH 1F6FB 4R7DA 3OAYK 1MRFL 2VQ4A 4MDIA 3K6IA 1T3JA 1ECYA 3F7LA 1WS7A 1DFXA 1OAXL 1CE1L 1RI8A 1G2CB 1NKOA 2G4GA 4WWNA 3ZU8A 1J8HA 4TUOB 2Q2LA 4WKZB 4FI8A 1JDDA 1NEZB 1X4YA 4XP9L 3EJSA 1IGCL 2GSIB 2XZQL 2BOBA 5E51A 3KW7A 3OB0K 5BRPA 1D6EB 1R3LB 4KROB 2GTZB 4P2OC 4GQZA 4R8WL 3RWHB 3RY6A 2ZT9D 3VYNA 2VKXA 2W1NA 2CG9X 1MKFA 3PHQB 3QXDB 5KLVJ 2FBRA 1MHPL 5I1HH 4CGUB 4H26B 3QUGA 3BHBB 1B2WH 3BPOB 3KE0A 1IBYA 1NGYA 4EAEA 3OQ3B 1YECH 2YK1H 4E9TA 2Z6FA 5D7JC 3RE0A 4XNMA 5IB1B 1HYSD 5D1ZC 2NNFA 3DO7B 4XCCH 2X1QA 3KPSD 3KVQA 4L8DB 3V0WL 1L7TH 1NGPH 1E5ZA 3KHUA 5J89A 2J43A 3F8UB 3S37H 4G6KL 3V0GA 3B5HA 3PRZA 2RCSL 2Z31B 4JFZL 4QHUB 1OCCB 3BISA 4QXTB 1YYLH 3CD4A 4V1DE 2CIKA 3GHEH 3QFJA 1I1AA 2ZPKH 2ZKHL 4LDEB 5AW4B 1WGVA 3H56A 1ZTMA 3M88A 1BLNA 5B7EA 1SS1A 5EFIB 4K8RH 4M6MH 1QRNB 3G5ZA 5A2AA 4HLEA 4L23A 2YJLA 4G6ML 1BWMA 3ZHKA 4GIPD 5BZDB 4Z0BL 5ES4B 1A0QH 3O0RL 3LY6A 1T04A 2I9TA 2BFVH 4P0DA 4WFHE 2X05A 2BY1A 2XQYK 3D8MA 3GZPA 3SSGA 4XC1H 1V3MA 1KFGA 2O01H 4RBPK 4PRNA 1RMFH 4K3DL 4PRIE 5E6SB 5FW7A 3S7GA 3WXVH 2NUPA 1E90A 3MACL 3L4TA 5AB9A 1ET8A 1U8HA 2FAUA 4RZCB 5C09E 3KPNA 2YRPA 1KJMB 3FWNA 2QKIB 2BZDA 1M2OA 1R47A 1AD0A 3M46A 3S34L 1PNDA 1V3LA 4Y99B 3CC2P 3BLPX 3VI4A 5I28A 4EQ2A 2Q5BA 5GGSB 1I7TA 4MNHB 4YHPB 1CFMA 3L9EA 3MLUL 2H8PA 5KYNA 2HPCA 2OTWA 2NR6D 4HS3B 1VLXA 4F3FB 2GJ6E 1NBZB 1A02J 1ACZA 4LNRA 3ZDZB 3SYQA 3ZTNL 2ATPA 5BW7A 1CW5A 5IROC 1AS8A 3E0GA 4F92B 2AZUA 3V9FA 3BATA 4MD4B 1MEXH 4HWBH 3HC0A 2XXFA 1QX8A 4L1LA 1MAKA 1B0GB 1Y6KR 4PCYA 5DJ6B 1PAZA 1KC5L 2YPVH 3M1BA 4OZFG 1BQKA 1JUNA 2WHVA 4M5ZL 1JNMA 4LLMA 3JUZA 1YQ4C 2VDOB 4JHWH 1Q9OB 2X10A 3BUIA 4DGVL 1U8PB 3OC5A 1UOVA 2EE9A 4IOFD 1FNSL 1OWRM 2OMZB 5KLIC 2OPCA 1N7ML 2C1PA 3JCUH 4P2AA 4U1SA 1P5VB 1AFOA 1A5FL 3MGOB 4NQVB 1LTAC 2CDEB 4R3SA 4O9HH 1ETB1 5T3XD 3QDGB 4IL6H 4L29B 1S8DA 1JZ4A 2JLPA 2YXWA 1L4AB 4GKLA 3TU6A 1LK2B 1Q0XH 1Z3GH 3FSVA 2WXIA 1NA8A 1PL5A 1LVEA 5IMMB 1P7QB 4Y5YB 3VX1A 1PPJG 1SJHB 3L3GA 4GSDH 1YEFL 3VMPA 3DNKA 3IN6A 4Y9FA 3PP4L 4JPKL 1A9EB 2WIIB 1HIML 4L9LC 1MRFH 4XOBA 5DFTA 4JFTA 4AENB 5GGVL 1OAXH 1CE1H 1IGTA 3WNMA 1ZHKA 1KYFA 4W9CC 4MRCA 7TAAA 4L4JA 1SDAB 5FB8A 4GMSL 4MASA 2D0HA 1DQLH 6PAZA 2AJUL 2HG5D 5KVGH 1CGUA 1CURA 2QQNL 5L8RJ 1Z5LB 3CI9A 4MAYC 2K6WA 5FFOA 1JXFA 4M1CC 3MBWA 4KK8C 3EDDA 4WI3A 3DGGA 1WH0A 5F71A 3H1LJ 3IU4L 3UBHA 1MHPH 5CINH 3CX5D 3KPRB 1TTCA 5TPWL 4YIQA 5ALBL 5KVFL 2X4PA 4Q9RH 3LMJL 3QR2A 1SXCA 4W9KC 1NC4B 3D12B 4FC3E 4O2FB 5C07B 3K5SA 4FCHA 1ODUA 1RE4C 4ZZFA 4N68A 3OGCB 4LE8A 5DUJA 1IZKA 3C87A 4PJFA 2VLKA 4FQQB 4WHTA 4GFTB 5DQJB 5E2VL 2O5ZL 3MBEA 3EHBD 3RWCB 2A6KA 4G6KH 2ZUTA 3WN5B 2RCSH 2LU7A 3FN3A 1WHPA 1CWVA 1CFNB 2X3CA 1VSCA 4JLRA 3WTUA 5IJBC 2EDNA 3RPIA 3PFUA 3GLMA 4OH8B 2ZKHH 4LEOB 4NP4L 3TBCA 1KJVA 1V27A 1WS8A 2BFGA 5DRWB 3WTTA 4OIFA 5EO0B 5CD3B 1KY7A 1UM6L 3ABGA 4LVHB 5C9KA 5KZCD 5I9QB 4NZDA 4IBLT 3RX8A 3T6ZA 3B37A 4QRPE 2AJ3B 4IGBB 6TAAA 4NQDD 4Z0BH 3ULUD 2DZEA 1KGWA 4LASL 2EDDA 3ZTJG 4QRRA 5FFGA 2H4EA 4FS0A 1I9JH 2MOQA 3O9WC 4M7KL 5HJ3B 3I6GB 2LAGB 2BJML 2ZOLA 2VERN 2XV0A 3QCTL 1AXTL 1JK9A 2AQRA 3BFWA 3EH2A 4HMCA 3OLGA 4L3CB 4AK2A 4D9RD 3TBVA 1WG3A 5F7WC 3ZR6A 2P80D 4P9HC 3S34H 4GQRA 4ZMXA 2XFXA 2H3NA 1NC2B 4IKIA 1RJLB 2FD6L 4BFJA 1OGTA 5EH1A 3BVXA 1GYVA 2DM3A 4G8GE 4RIRA 5C0JA 5IJKA 3PHLA 1RERA 3LPGA 1TDQA 4UU9A 5GS1B 5HDWA 3TT3L 4X7SH 2Z4QA 4ZPVB 5JOFB 3E38A 1JGEB 4JFFA 5CLWA 3DPBA 1F00I 3QORB 1SFCA 2CKBB 3K80A 5KSBE 1MFTA 4M62H 1CBVL 4C4BA 1NCWH 1KPRA 4KX7A 5IBLC 3P2TA 4XO3A 5JMRA 1KC5H 1EZVX 1UCBL 5AYQA 2H45A 1OGAA 1QOKA 3CSYA 5DUMH 1RK0A 3ZDXB 1EHNA 3IAGC 1H3UA 2L4OA 3VYIA 3NTCL 4ZW7A 4E2OA 2I32A 2F53A 1N7MH 4W9LC 1IJNA 4M93C 4Y7OC 1GC1C 3CN1A 1CDIA 3W3BA 4J4PC 4L1HA 5C6PB 1PQZA 5T5NG 1XGUB 3VM7A 3PWPB 2X0WA 1S7TA 2OMWB 4CMMB 1M56D 4APXA 2OQQA 4JQ0D 2NY2D 3VXRD 2J20A 3CIAA 1MKMA 1ECZA 3O8XB 5B5EH 2WXLA 3DYPA 3F05A 1ZVNA 1YEFH 4X9GA 5DFVC 3VG9B 4POYA 1T4KA 2D7TL 5E0FA 2X4NB 1SQXG 1HIMH 4YVUA 3RGVC 4HFWB 5GGVH 2O26U 3Q05A 3PS6A 3RURA 3SKNA 1P84K 3TFKC 3VFOB 3PYCA 4NO0A 4GMSH 4YPCA 5A2KH 3BCCG 1KYOD 3V6FB 4Z78B 1JZDC 2NY4B 4G70B 3RFRA 3GQFA 3PV7A 2YA2A 5KYUB 1F90H 3ULVD 3PJSB 4WJKB 4UOJA 2A5UA 4M4RA 1J1DB 1E7VA 1UB6B 2CO2A 3IU4H 4GSQA 1Q0EA 2MJWA 4L8SC 5TPWH 2F58L 5KVFH 1Y18B 2C9PA 3LMJH 3AG4B 1K6QL 1WBXA 3QXUA 3UZEC 3SJVA 3V5DA 1RJYA 4WFFD 5BVPL 2R29A 3DJTA 5EUOA 1RPKA 2X0VA 5D2NE 4LPWA 3GUTB 3CL3D 2VQ1A 3APDA 3G3ZA 4L37A 4Y1AD 3RDTB 1B4JL 2O5ZH 3EGXB 3PAYA 4FXGB 4AMWA 2ZOOA 1G87A 1MJJB 3V52H 3JWDL 3QZWG 1SHXA 3SE4C 1EQ7A 1W80A 1EPFA 3UBFA 3BAWA 3RA7L 2Z5IA 1SNRA 3MFFA 1TCRB 3IS0X 2FJFB 4J3BA 3PGCA 3GHGB 1T0NB 3QXAB 4HCFA 4PJBF 4MA1C 3KYKL 3S2CA 4KJMA 4UWQB 1A25A 3CK0H 5DK2B 3V6ZA 5JXEC 5CP3A 4Z7WB 4LLUA 4J3OG 3SYCA 4JG0L 1VFBA 4WO4C 1OAYH 1NWPA 3RHWK 2W8ZA 3CHPA 5C0BE 1WSST 3OQRA 4LASH 1E5YA 3WGUB 2Q1KA 5D7IE 2XDHA 5I30L 1G7QB 1VEPA 3QH3B 5H37H 2BVOA 5F7AA 3UX9B 4IIZA 4AYDC 1A47A 2R1WB 4M7KH 3P73A 3STLB 1PLAA