1FZBA

Crystal structure of crosslinked fragment d
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
EDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood coagulation
molecule keywords FIBRINOGEN
publication title Crystal structures of fragment D from human fibrinogen and its crosslinked counterpart from fibrin.
pubmed doi rcsb
total genus 27
structure length 81
sequence length 81
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzbA00
2OYHA 1JY3O 1RF0A 3HUSB 1M1JB 1RE3C 1JY2O 1N86A 1LWUB 1FZGA 1N73B 1FZCB 3BVHA 1W2EA 2A45G 2OYIB 1LTJC 1LT9A 2FFDA 1FZEA 2XNXA 3E1IA 1M1JA 3H32B 1LWUA 3HUSA 1N73A 2Z4EA 1FZCA 2HODB 1RF1C 2OYIA 1RE4C 3GHGC 1LTJB 3H32A 1FZAA 1JY3N 1RE3A 2A45H 2HODA 1RF1B 2OYHC 1JY2N 1RF0C 1JY3P 2A45I 2H43A 1LTJA 1JY2P 3GHGB 2HPCB 1LT9C 2FFDC 1RF1A 1FZFA 1T3UA 3HUSC 2OYHB 1M1JC 1FZBA 1RE4A 1LWUC 1N73C 3GHGA 1FZCC 2HLOA 2HPCA 2OYIC 2Q9IA 1LT9B 2FFDB
chains in the Genus database with same CATH superfamily
1EZVG 3P7KA 3FGAD 1L0NG 2WQYC 2PAJA 2ZYAA 3CWBG 2ZVNB 4IL6E 2JR8A 3MZWB 2YXQB 1ZN5A 2KS1B 3K5BA 2WSEH 3MD0A 3L37A 2SPZA 4OGQC 3IF4A 2Z5HA 1MFZA 1LT1A 2ZYGA 2V7QH 2IZ1A 4ZMDA 4PD4H 3PJSK 1CI6A 4A7PA 3Q5RA 1L2PA 5C39A 2OARA 5H2FE 1FDMA 1HVVA 2NPSC 3VMZA 3A7OA 1FZBA 2R3SA 4EYYQ 2HPCA 5AVUB 1SQPD 2XU6A 2K88A 4QMAA 3RK3E 5H2FH 3M9QA 5AW8B 1G1JA 1H89A 4YXDC 5CJ0A 4AUWA 2Y0DA 1IFIA 3H1LG 2C9NY 1NOHA 3CC2P 3AEEC 1BCCJ 2AXTH 2E74B 4XA4A 1U7MA 2IBZG 3AEBC 2JO1A 4IFDK 3KDPB 1HH0A 1CI6B 1LP1B 2A45G 1L0LE 2E5TA 1OX3A 2Z4EA 3T97A 2Q3EA 3L75G 4IL6X 1KD1Q 2O3JA 3GHGB 1PFIA 1SQXD 1RF1A 3H1JG 1J1EC 1GD2E 3VP9A 1JY3O 1PIXA 3I56P 1VQ6P 1K9MQ 2YNYA 2QSIA 3AE8C 1NU1G 1IFPA 2Y9ZA 4H44C 5TISH 4U7JA 3RBXA 4ZKPA 3KXDA 2HYNA 1BSHA 1M90Q 1L0LD 3H1KD 1URQA 4EOTA 1KQFB 4LC1A 2O1KA 5CCGD 3B5ND 3NFQA 2D2CD 1M56D 1KILE 1VQMP 1RE4A 4NPDA 3JC22 2KB7P 3L74G 3S4RA 3CXHE 5TJHA 1SQBE 2RKLA 3P32A 2GUVA 3M0AA 3Q5PA 3G3ZA 3CWBJ 3CCRP 2G8YA 4PJ0E 1SQVK 2E75D 5APXA 2M3EA 4YXWH 1RQVA 2M0BA 3G6EP 5KJ7D 3CXHH 5APSA 4C7NB 1SFCA 1HJ0A 1LTGC 3TNUA 5APVA 1L4AA 5E79H 3TGUJ 1HGVA 1FE6A 4HH2A 4I6MC 1QVGO 1K05A 5KAIE 1HGZA 1D7MA 1EDKA 2WITA 1RE3C 3FXEA 2I1KA 4PJ0H 1ZOYC 3VMAA 2E74C 3NMDA 1IK9A 1EZVI 3FX0A 1H8AA 1KFMA 1IK7A 4RKUJ 1SQVJ 3CX5D 1BCCD 1QL1A 3I55P 3H1HE 3AE9C 2E43A 3JCUH 3CCQP 2FXOA 2IDBA 5CCGC 1W2EA 5KAIH 4O9BA 1J1DB 1FZEA 3GHGC 3MUDC 1M1KQ 1Q7YQ 2CPSA 1SLQA 1P84I 1VF5B 1NKZB 3Q2YA 3CD6P 2WZ7A 1BE3G 4GODA 2OQQA 3L70G 3MTUE 1SFCB 2LR2A 2FYZA 5AW4B 1NVOA 3RGUA 4KT0J 1T2KD 1HUCA 1QEXA 1N2DC 1GW4A 5BU5A 1RHZB 1PP9D 2N9BA 1W5CE 1DEBA 1T6AA 3L75J 5KLIB 1OVVA 3CCUP 3GLMA 3MGNA 2HODA 2P1JA 1ZP0C 2YKOA 2NRGA 1CZQA 1QL2A 3PTZA 3TGUE 3BCCJ 2IBZI 1R8EA 2IPPA 2UWJE 2A45I 3HE4A 2A06D 1LTJA 5B5EE 3AE6C 1KB9E 2PFXA 2PGDA 3M0DA 1EZVD 1W2BO 1KYOI 2HR3A 1L0ND 3IR9A 4H0LD 3CWBD 1WT6A 1SQVE 3KQGA 3L74J 3TK1A 1AJYA 2JWDA 1NJIQ 1M57D 4GOFA 1FZFA 4KJMA 3RL0D 1KB9H 5AVSB 1KQGB 4TT3H 1P84D 3KHUA 1E5WA 4GT1A 2RN0A 2WSFH 1T2KC 1YITP 2J5UA 2WT7A 4H13D 3GMAA 4JYBA 1XTCC 5B66E 2JKVA 2XNDH 2KXPB 1GZLA 1J1DC 4WVZA 4U3FG 1VQ5P 4L73A 2H7HA 2CK3H 1AQ5A 1VF5C 1USEA 4OWFA 4EDFA 2BEQD 4WWIA 2BASA 3R2PA 5B66H 1SFCC 1SQBG 1HWTC 3P8CE 3MP7B 3H1LD 1LWUA 1NGMB 4M3LA 2QM7A 3EWKA 1JTHB 1Y47A 1SQXK 3L4FA 1SQQE 3ZDMA 4OH8B 4CPGA 3KPEA 1NTZG 4ASWA 5KLIC 3TYYA 3A2AA 2ZYDA 2QA4P 2B87A 5AW1B 1N73A 1FZCA 3WUVA 1YIJP 3L75D 2BCCG 5AW3B 1OIPA 4UB6H 1BSNA 1AA0A 2GA1A 2LXCB 2QM8A 3HD7A 1N8RQ 4GKGA 4HYTB 1JMBA 3VYIA 2ZXEB 3SFDC 1NU1D 3H32B 3JSVC 3IN6A 3B8EB 3HTKA 1IZNB 2K9JA 3BCCD 2KOGA 3BATA 3H1HG 4WY4A 1AV1A 3L71G 1ZW0A 3P8MC 3CPWO 4GIFA 2YKQA 4HB1A 3PH0A 3G4SP 3VN0A 3G71P 3NTNA 3Q1MA 2AEJA 5DJTB 2M5AA 2N1TB 1DEEG 3C8VA 4HJGH 1KORA 2FYUG 3H1KJ 3L74D 3O6QA 2IYPA 5KAFE 4PV1B 1KQSO 5APQA 3EFGA 1Q81Q 1SQPE 1EXJA 1S2EA 2KSJA 2QJPB 1PV3A 1KMIZ 2W90A 3C9IA 2PRRA 1NTKK 5APWA 1GL2A 3AECC 2W83C 1USDA 3V4WA 2N9YB 5DJUB 4L74A 1OXZA 3A0BE 4IL6H 1MV8A 1N7SA 2H43A 5AW5B 4ASVA 2N1TD 1KZUB 4H44D 1JOCA 2QIWA 4B86A 1PGPA 4PV1D 1FBMA 1OFCX 1NTZK 3B5NA 2WPQA 3OAKA 2O1JA 2JWAA 1NTKJ 1S3JA 2O01H 1LTBC 1SQXE 4PD4D 2V4HA 2KLUA 2Y0CA 1X22A 1LGHB 3AE1C 3NXSA 4YTPC 3E1IA 1WRGA 3D6ZA 2OYIA 3I5CA 2AEFA 1HF9A 1H0TA 1H88A 2VRSA 3QWOC 4I1LA 5CBNA 1GL2B 1NTMG 4DT0A 1BE3D 2M8RA 4JF7A 2Q5UA 1NTZJ 3H1KE 1PGOA 2OGUA 5KJ7A 3CI9A 1FZAA 4JPZB 3LW5H 1YJ9P 2HPCB 1KILA 2KYVA 5GTIE 4NPEA 3SSUA 2LXBA 1YI2P 3HE5A 2MJZA 4ZNCA 1E79H 2M3BA 2P67A 3CXHI 1PP9J 2N1TC 1CW5A 1T8ZA 3W67A 2Q6QA 2E74D 1A02J 1PPJG 3Q3DA 4PV1C 1L0NK 1YYCA 3RBZA 3L73G 4BRYA 1GDTA 4N6JA 4DCKA 2QJPC 2E76B 1SQQG 1BGYG 1GK6A 1ZMEC 5CJ4A 3C1LA 1GMJA 1CSBA 3T97B 4C46A 2FYUJ 3U59A 3CLQA 1N7LA 3H1IG 1KILB 3M06A 1RF1B 1L0NJ 1FDIA 2K1AA 5AW9B 4DOJA 3CX5E 4D6TG 1BCCE 2YXRB 2WTYA 1RF0A 3V5BA 1KC8Q 2WMMA 5BVZA 4DJGA 2E76D 1IO4A 1FOSE 2KIKA 2NZ2A 5KLVG 4LGDE 3AEDC 4W7ZA 1Q82Q 1URQB 3RK3C 4U3FD 3CX5H 1NTKD 2YIUB 1OW7A 2Y9YA 2P2UA 4WBAA 3UIAA 1XTGB 1GL2C 1LTSC 3L72G 4W80A 3CCJP 1LNQA 2QE7H 3LIDA 1PP9E 2OYHA 2P58A 1VQLP 1QVFO 3CL3D 1VQ9P 1LT9A 3GW6A 1M1JA 2L91A 2H89C 1Q86Q 1FJPA 1Z56A 1NTZD 1JCCA 3CCEP 3D71A 3AEGC 3H1LJ 3S9OA 1NH4A 2ZJSE 1NU1K 1VQNP 2WSSH 4GOEA 3TNUB 1VQPP 1NYHA 3WMM0 2BCCD 1L4AB 1DX7A 3QH9A 3AE3C 5AVWB 2AEMA 4HKZH 1LJ2A 2A06E 1JM0A 1ZLLA 1OZHA 2C0XA 1KB9I 1EZVE 5CCHA 1IFMA 2QVAA 3WUUA 2IFNA 1L0NE 2E76C 5AVZB 1S1CX 2KNCA 3CWBE 3H1JJ 2B89A 2B9BA 2XV5A 1M7LA 2I8DA 3L71D 1K73Q 1VF5D 1RH5B 3CCMP 1NU1J 1LT9B 3PP5A 1GU5A 1P84E 1SFCD 1KILC 1RF1C 1L4AD 2DW3A 2XZRA 4Z1MH 2QJKB 3L73J 1DD3A 1JUNA 2FYUD 1VDFA 3SWYA 3VMXA 1AFOA 1HTLC 2WPSA 5AW2B 1L0LG 5K5GB 2CPBA 1S72P 1DIPA 2WSCJ 2XDJA 1URQC 5B5EH 4K3AA 2YIUC 2KNCB 1ZRTD 2NPSA 4W7YA 1FAVA 5AVRB 2HODB 1OW8A 3H1LE 1RE4C 3LIEA 5AVYB 3O8ZA 1K04A 1RQUA 1T3JA 2ZVOB 4OVNF 4ZKUA 2QEXP 1FC2C 2OTLP 2ZXXA 3HE4B 3TF5A 1LTJB 3Q5SA 3L75E 3BRTB 4UB8E 3WU2E 3CMAP 3S1KA 1S9KE 1X79B 5AVTB 2WSEJ 2KUBA 1G2CA 1SS1A 5APUA 2K3RA 4I7ZB 1L4AC 2E5YA 1QX8A 2KP8A 1NU1E 2V7QJ 2R32A 4BWNA 1FDOA 3BCCE 1NTMD 2IBZD 4UB8H 3WU2H 2WWWA 4N78D 1MZ9A 2ZT9B 5CBOA 4AQRD 1HBWA 3H6PA 2WT7B 1X9VA 3AEFC 3ABVC 1KYOD 1JY2N 1BE3J 3V4QA 3VTPC 3PLNA 1S9KD 1LT9C 4GDOA 2J59M 3L70J 3H1JD 3B4SA 3OA7A 1NKNA 1FOSF 1NAYA 3L74E 1YJWP 1KFNA 2QJKC 2KSEA 3M91A 2E42A 3EQ2A 2K9YA 2YMKA 2C0WA 1VQ7P 1PPJD 2KS1A 1IC2A 2QG4A 2XKMA 5GTHE 3L73D 1ZR2A 1LWUB 1J2JB 2KZJA 2ITAA 1BGYD 5CCHC 1Q90D 4YPCA 1OWAA 2Q9IA 1GU4A 2B87B 2OTKE 5GTHH 1N73B 1FZCB 2ZAEB 1FU1A 4R4LA 4Y99B 5AW6B 3H1ID 2W6AA 4LLHA 4IOIH 1JY2P 3HD7B 2KI7B 3CC4P 3AE5C 4D6TD 2FYNB 5AVXB 1EDIA 4PD4E 2Z5IA 1U7JA 1LTJC 1JO5A 3HTKB 2HG5D 2K9JB 3M0DC 5KAFH 1YHQP 1VQOP 3HRNA 1RE3A 3N7NA 4WY4B 5KLVD 4I7ZC 1M8OB 1SQBK 4R4MA 4RO0A 1RY3A 2IX7C 3OW2O 1BE3E 3TGUG 3EFFK 3L70E 5AVVB 2IFMA 1BDDA 1LP1A 3F5HA 4N3YB 2M5AB 3L72D 5CCGA 3HD7D 1X0TA 4U3FJ 1VL2A 3GHGA 3A0BH 3O6QB 2ZT9C 3MUDA 2GUSA 1R5SA 2WPVB 1SQVG 2AXTE 3RK3B 4WY4D 1SQBJ 2FXMA 2AXCA 1S5LX 3M9BA 1LTAC 4XFJA 3SWFA 2W27A 2FXPA 3CCSP 3L70D 1N7SB 4EIJA 2W8ZA 1LWUC 2BCCJ 3HUSA 5TISE 3B5NB 3RK3D 2D2CB 2ZFCA 2IZ0A 3KZIE 2OTJP 2FYUK 1U57A 1AVOA 5M1BA 4JQ0D 2C9LY 1N73C 1GL2D 2Y0EA 1FZCC 1JEKA 1VPCA 4KHXA 4Y99C 5GTIH 2OYIB 1KQLA 3MHVA 2PP6A 3CX5I 1H0TB 3H1HJ 3L71J 1SVFA 3HD7C 1N7SD 4C7NA 2FYNC 3BCCG 4JYCA 3KZIH 4TLFA 2GM4A 3BRVB 2HLOA 2E75B 2FBWC 1G1IA 3RL0g 1JY2O 1IFNA 2R5DA 1TU3F 1QGKB 1ZV8A 4U3FE 1YTZT 3F89A 4WY4C 1NTKE 2K37A 1R5LA 1Q2NA 1YTZI 1JB0J 2BEZF 3IFMA 1JNMA 4RESB 3II6A 3BASA 3HE5B 3A0HE 1LTIC 2QJYB 3HUSB 1EQ7A 1UIXA 1EDLA 5E79E 2R3CA 5EFWB 5APYA 3FWNA 4RJTA 1NO4A 4JBZA 1KN7A 3ITKA 2QRXA 1NTZE 2FY8A 4BRYB 4Y28J 3A0HH 1FZGA 1ZR4A 4IFMA 2BCCE 2OYOA 1KILD 3M9HA 1NTMK 1PGJA 1Y9BA 5APTA 3JCUE 2JEEA 3MIWA 3CXHD 2MKVA 1SQBD 3D70A 2R44A 1N7SC 1SQPG 4WB4A 1X8YA 1HJBA 2WSFJ 2I1JA 3SFEC 3V2PA 3B71A 1LTTC 3L71E 3PHLA 1NAFA 2KLVA 3L36A 5KKZB 3B5NC 1URQD 3U1CA 2D2CC 1BDCA 1VQ8P 2HFED 3V2QA 1NTMJ 5CMZA 2RH0A 3SWKA 3N4XA 2W6JH 3CCLP 1PGQA 2L5GB 1FJKA 2RMZA 2FYUE 2OYIC 1OW6A 3A5TA 1NWQA 2O01N 1NHLA 2FFDA 1SQQK 3E1RA 1JMMA 1AQTA 2E75C 3W68A 3H1HD 3RK2B 2OYHB 1SQXG 3GF3A 4H0LB 5KJ7C 1M1JB 2JDIH 2KZIA 1YQ3C 4I2LC 1ZRTE 2WPRA 3AEAC 1VQKP 1GK4A 2H8PD 2QJYC 3HUSC 3RL0B 1ZXGA 1SQQJ 1BGYJ 2W6BA 2KK7A 4K35A 3H1KG 1UIIA 5KLVK 1P84H 4H13B 3RK2D 4AYCA 3PRJA 3USSA 2YKPA 2FFDB 5CHXA 3H1IJ 2YMYA 1OMIA 1AVYA 1YQ4C 4D6TJ 1JTHA 3VMYA 4DZOA 1SQPK 2J58A 1NTME 2YO2A 2IBZE 3A3YB 1Y8AA 4N78E 1FS0E 3TGUD 1N86A 3V6IA 3L35A 2XNXA 5KLVJ 4EI2A 1GW3A 3H25A 3AE7C 1RF0C 1KB9D 3D6YA 3VP8A 1KYOE 1DH3A 5KKZC 3KYQA 5CCHD 4L75A 1S4XA 1OVUA 3H1JE 4OGQB 1SQVD 1MKMA 3G9RA 3L72J 2Q7CA 1NTKG 5L8RJ 1EXIA 2B88A 3H32A 2A45H 1JY3N 1IFJA 4NPFX 1SQPJ 4XE5B 1PPJE 1BCCG 1KYOH 5KTBA 2Q3IA 2NPSB 3VOPA 3U1AA 3E7KA 1KV4A 3L73E 3BVHA 4UB6E 3TSIA 1K8AQ 1EDJA 1QLED 3RK2C 1IFDA 2OYHC 1BGYE 3WUTA 2IYOA 3CC7P 4H0LC 1M1JC 2WVRA 2LKMA 2N1TA 4OGQD 3TDKA 1IJDB 2O01J 3AE2C 2P7JA 1PL5A 1YBKA 4BXLA 3H1IE 3FXDA 3RL0C 3R4YA 1G2CB 2G3AA 1YJNP 1T3UA 2JJLA 1OVRA 1DD4A 1L0LK 4L76A 1PP9G 2P10A 2NPSD 3CMEP 4D6TE 2JP3A 3P8CD 3FWLA 5AVQB 2ZT9D 4H13C 1SQXJ 4PD4I 1SQQD 2WSCH 3IAOA 1JY3P 3V2RA 1VQ4P 1S5LE 2FKWB 2YO3A 2FFDC 5KLVE 1A02F 3LW5J 3AE4C 1KTMA 1MUUA 1SP4A 1WMKA 5BU8B 4C7RA 5AW7B 1EC5A 1J1EB 1JCDA 3GF7A 3OJAB 1GTWA 3V2NA 5AW0B 2H88C 3CCVP 2R5BA 1PZQA 4IFFA 2POHA 1L0LJ 3L72E 4H44B 4MN4C 2A06G 3GG2A 1MFTA 1S5LH 2Q1KA
chains in the Genus database with same CATH topology
1NH4A 3P7KA 4KHXA 4Y99C 1NU1K 2OYIB 1KQLA 2PP6A 2PAJA 3TNUB 3WMM0 2H7HA 1AQ5A 1SVFA 1L4AB 3HD7C 1N7SD 1DX7A 1ZN5A 3MD0A 2WSEH 4C7NA 3L37A 2BASA 4JYCA 3R2PA 5AVWB 2GM4A 1ZLLA 3BRVB 2HLOA 1SFCC 2Z5HA 2C0XA 1G1IA 5CCHA 1MFZA 1JY2O 1IFMA 1IFNA 2R5DA 2IFNA 1HWTC 3P8CE 5AVZB 1ZV8A 1YTZT 1LWUA 4WY4C 4M3LA 2QM7A 1CI6A 1JTHB 2OARA 1YTZI 2XV5A 1JNMA 1SQXK 3IFMA 3L4FA 1FDMA 4RESB 1M7LA 4OH8B 1HVVA 2NPSC 3II6A 3BASA 3VMZA 3A7OA 3KPEA 3HE5B 1FZBA 2HPCA 1LTIC 3TYYA 1LT9B 3A2AA 3PP5A 3HUSB 1EQ7A 5AVUB 2XU6A 1GU5A 5AW1B 1SFCD 1KILC 1RF1C 1N73A 1FZCA 2R3CA 1L4AD 2XZRA 5AW3B 5APYA 1NO4A 1JUNA 2QM8A 1VDFA 3HD7A 3SWYA 3VMXA 3M9QA 1AFOA 4GKGA 5AW8B 1HTLC 2WPSA 1G1JA 4HYTB 5AW2B 1H89A 1FZGA 5CJ0A 1ZR4A 2CPBA 2ZXEB 3VYIA 4AUWA 3H32B 1IFIA 4IFMA 2C9NY 1NOHA 3B8EB 3HTKA 1KILD 3M9HA 1NTMK 4XA4A 5APTA 2KOGA 3BATA 4WY4A 2XDJA 1URQC 2JEEA 3MIWA 3P8MC 4IFDK 3KDPB 1HH0A 4GIFA 1CI6B 2YKQA 2NPSA 2A45G 4W7YA 1N7SC 1FAVA 5AVRB 2Z4EA 2HODB 3VN0A 3T97A 1RE4C 3LIEA 3NTNA 4WB4A 1X8YA 1HJBA 2I1JA 5AVYB 3O8ZA 3V2PA 3GHGB 1PFIA 2N1TB 1RF1A 1LTTC 1J1EC 1NAFA 2KLVA 1T3JA 1GD2E 3VP9A 3L36A 1JY3O 3B5NC 1URQD 3U1CA 5APQA 4ZKUA 3EFGA 2YNYA 2HFED 3V2QA 3HE4B 1LTJB 5CMZA 3BRTB 2KSJA 3N4XA 4ZKPA 2L5GB 1S9KE 1X79B 5AVTB 1FJKA 2HYNA 3C9IA 1G2CA 2OYIC 5APUA 3A5TA 1NTKK 1NWQA 5APWA 1GL2A 1L4AC 1NHLA 2FFDA 1SQQK 1URQA 4EOTA 3V4WA 4LC1A 2O1KA 1JMMA 5CCGD 3B5ND 2KP8A 3NFQA 1OXZA 1MV8A 1N7SA 2R32A 2H43A 5AW5B 2N1TD 3RK2B 1KZUB 2OYHB 1RE4A 1JOCA 2WWWA 4N78D 2KB7P 4B86A 5KJ7C 1MZ9A 1M1JB 1FBMA 4AQRD 4I2LC 2WPRA 1HBWA 3H6PA 3P32A 2WT7B 2GUVA 1X9VA 3M0AA 1NTZK 3B5NA 1GK4A 1JY2N 2WPQA 3G3ZA 2H8PD 3V4QA 3VTPC 3OAKA 1S9KD 1LT9C 2O1JA 2J59M 3HUSC 2O01H 1LTBC 3OA7A 3RL0B 1SQVK 1NKNA 5APXA 1FOSF 1LGHB 1KFNA 2W6BA 3NXSA 3E1IA 1WRGA 5KJ7D 5APSA 2OYIA 4C7NB 3M91A 3I5CA 2E42A 1SFCA 3EQ2A 5KLVK 1LTGC 3TNUA 5APVA 2C0WA 1L4AA 2VRSA 1H88A 4I1LA 3RK2D 4AYCA 1IC2A 1GL2B 2XKMA 1HGVA 4HH2A 4I6MC 2YKPA 2FFDB 1HGZA 1ZR2A 2M8RA 2WITA 5CHXA 4JF7A 1RE3C 1LWUB 2I1KA 1J2JB 2Q5UA 2YMYA 3NMDA 1IK9A 5KJ7A 3CI9A 1FZAA 5CCHC 1JTHA 1H8AA 3LW5H 1KFMA 3VMYA 2HPCB 1KILA 2KYVA 1OWAA 1QL1A 4DZOA 2E43A 1SQPK 2J58A 2YO2A 2Q9IA 1GU4A 3A3YB 3HE5A 4N78E 2MJZA 1N86A 1N73B 5CCGC 1FZCB 3L35A 1W2EA 4O9BA 1FU1A 1J1DB 1FZEA 2XNXA 2M3BA 4Y99B 2P67A 1GW3A 1GZLA 5AW6B 3GHGC 2W6AA 2N1TC 1CW5A 2CPSA 1T8ZA 4LLHA 1RF0C 1SLQA 1JY2P 3HD7B 3VP8A 1DH3A 1A02J 3KYQA 1NKZB 5CCHD 1L0NK 5AVXB 1YYCA 2WZ7A 1GDTA 2Z5IA 3MTUE 1LTJC 1SFCB 1JO5A 2Q7CA 2FYZA 4N6JA 5AW4B 3HTKB 2HG5D 3M0DC 3H32A 3HRNA 2A45H 1JY3N 1RE3A 3N7NA 1HUCA 1T2KD 4WY4B 1GK6A 1IFJA 1N2DC 1GW4A 5CJ4A 5BU5A 2N9BA 1SQBK 1DEBA 4XE5B 5KTBA 2Q3IA 2NPSB 3VOPA 3U1AA 1RY3A 2IX7C 1CSBA 3BVHA 4C46A 5AVVB 3TSIA 2IFMA 3U59A 4N3YB 3CLQA 1N7LA 3RK2C 1IFDA 3MGNA 1KILB 2HODA 3M06A 1RF1B 2OYHC 5CCGA 3HD7D 2P1JA 1M1JC 3GHGA 2YKOA 3MUDA 2LKMA 2N1TA 5AW9B 4DOJA 2GUSA 2WTYA 1RF0A 1CZQA 1IJDB 3V5BA 1QL2A 5BVZA 2P7JA 3RK3B 2IPPA 1IO4A 1FOSE 4WY4D 2A45I 3HE4A 3RL0C 1LTJA 1G2CB 2FXMA 1T3UA 4LGDE 2JJLA 3M0DA 3M9BA 1L0LK 1LTAC 2NPSD 4W7ZA 3SWFA 1URQB 2W27A 3IR9A 3P8CD 3RK3C 5AVQB 1WT6A 2P2UA 1N7SB 3KQGA 4WBAA 3UIAA 2WSCH 1XTGB 1GL2C 1JY3P 3V2RA 1LTSC 3TK1A 2FKWB 4EIJA 2YO3A 4W80A 2FFDC 1FZFA 1A02F 1LWUC 3LIDA 1MUUA 1SP4A 3RL0D 5AVSB 5BU8B 4C7RA 2OYHA 5AW7B 1J1EB 1JCDA 3CL3D 3OJAB 1E5WA 1LT9A 4GT1A 1M1JA 1T2KC 2WSFH 3HUSA 1GTWA 3V2NA 3B5NB 5AW0B 3RK3D 1FJPA 2ZFCA 2R5BA 4IFFA 2WT7A 2FYUK 2POHA 1Z56A 4JYBA 1XTCC 1JCCA 2C9LY 1N73C 1GL2D 1FZCC 1VPCA 1J1DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OYH A;  1JY3 O;  1RF0 A;  3HUS B;  1M1J B;  1RE3 C;  1JY2 O;  1N86 A;  1LWU B;  1FZG A;  1N73 B;  1FZC B;  3BVH A;  1W2E A;  2A45 G;  2OYI B;  1LTJ C;  1LT9 A;  2FFD A;  1FZE A;  2XNX A;  3E1I A;  1M1J A;  3H32 B;  1LWU A;  3HUS A;  1N73 A;  2Z4E A;  1FZC A;  2HOD B;  1RF1 C;  2OYI A;  1RE4 C;  3GHG C;  1LTJ B;  3H32 A;  1FZA A;  1JY3 N;  1RE3 A;  2A45 H;  2HOD A;  1RF1 B;  2OYH C;  1JY2 N;  1RF0 C;  1JY3 P;  2A45 I;  2H43 A;  1LTJ A;  1JY2 P;  3GHG B;  2HPC B;  1LT9 C;  2FFD C;  1RF1 A;  1FZF A;  1T3U A;  3HUS C;  2OYH B;  1M1J C;  1FZB A;  1RE4 A;  1LWU C;  1N73 C;  3GHG A;  1FZC C;  2HLO A;  2HPC A;  2OYI C;  2Q9I A;  1LT9 B;  2FFD B; 
#chains in the Genus database with same CATH topology
 1EZV G;  3P7K A;  3FGA D;  1L0N G;  2WQY C;  2PAJ A;  2ZYA A;  3CWB G;  2ZVN B;  4IL6 E;  2JR8 A;  3MZW B;  2YXQ B;  1ZN5 A;  2KS1 B;  3K5B A;  2WSE H;  3MD0 A;  3L37 A;  2SPZ A;  4OGQ C;  3IF4 A;  2Z5H A;  1MFZ A;  1LT1 A;  2ZYG A;  2V7Q H;  2IZ1 A;  4ZMD A;  4PD4 H;  3PJS K;  1CI6 A;  4A7P A;  3Q5R A;  1L2P A;  5C39 A;  2OAR A;  5H2F E;  1FDM A;  1HVV A;  2NPS C;  3VMZ A;  3A7O A;  1FZB A;  2R3S A;  4EYY Q;  2HPC A;  5AVU B;  1SQP D;  2XU6 A;  2K88 A;  4QMA A;  3RK3 E;  5H2F H;  3M9Q A;  5AW8 B;  1G1J A;  1H89 A;  4YXD C;  5CJ0 A;  4AUW A;  2Y0D A;  1IFI A;  3H1L G;  2C9N Y;  1NOH A;  3CC2 P;  3AEE C;  1BCC J;  2AXT H;  2E74 B;  4XA4 A;  1U7M A;  2IBZ G;  3AEB C;  2JO1 A;  4IFD K;  3KDP B;  1HH0 A;  1CI6 B;  1LP1 B;  2A45 G;  1L0L E;  2E5T A;  1OX3 A;  2Z4E A;  3T97 A;  2Q3E A;  3L75 G;  4IL6 X;  1KD1 Q;  2O3J A;  3GHG B;  1PFI A;  1SQX D;  1RF1 A;  3H1J G;  1J1E C;  1GD2 E;  3VP9 A;  1JY3 O;  1PIX A;  3I56 P;  1VQ6 P;  1K9M Q;  2YNY A;  2QSI A;  3AE8 C;  1NU1 G;  1IFP A;  2Y9Z A;  4H44 C;  5TIS H;  4U7J A;  3RBX A;  4ZKP A;  3KXD A;  2HYN A;  1BSH A;  1M90 Q;  1L0L D;  3H1K D;  1URQ A;  4EOT A;  1KQF B;  4LC1 A;  2O1K A;  5CCG D;  3B5N D;  3NFQ A;  2D2C D;  1M56 D;  1KIL E;  1VQM P;  1RE4 A;  4NPD A;  3JC2 2;  2KB7 P;  3L74 G;  3S4R A;  3CXH E;  5TJH A;  1SQB E;  2RKL A;  3P32 A;  2GUV A;  3M0A A;  3Q5P A;  3G3Z A;  3CWB J;  3CCR P;  2G8Y A;  4PJ0 E;  1SQV K;  2E75 D;  5APX A;  2M3E A;  4YXW H;  1RQV A;  2M0B A;  3G6E P;  5KJ7 D;  3CXH H;  5APS A;  4C7N B;  1SFC A;  1HJ0 A;  1LTG C;  3TNU A;  5APV A;  1L4A A;  5E79 H;  3TGU J;  1HGV A;  1FE6 A;  4HH2 A;  4I6M C;  1QVG O;  1K05 A;  5KAI E;  1HGZ A;  1D7M A;  1EDK A;  2WIT A;  1RE3 C;  3FXE A;  2I1K A;  4PJ0 H;  1ZOY C;  3VMA A;  2E74 C;  3NMD A;  1IK9 A;  1EZV I;  3FX0 A;  1H8A A;  1KFM A;  1IK7 A;  4RKU J;  1SQV J;  3CX5 D;  1BCC D;  1QL1 A;  3I55 P;  3H1H E;  3AE9 C;  2E43 A;  3JCU H;  3CCQ P;  2FXO A;  2IDB A;  5CCG C;  1W2E A;  5KAI H;  4O9B A;  1J1D B;  1FZE A;  3GHG C;  3MUD C;  1M1K Q;  1Q7Y Q;  2CPS A;  1SLQ A;  1P84 I;  1VF5 B;  1NKZ B;  3Q2Y A;  3CD6 P;  2WZ7 A;  1BE3 G;  4GOD A;  2OQQ A;  3L70 G;  3MTU E;  1SFC B;  2LR2 A;  2FYZ A;  5AW4 B;  1NVO A;  3RGU A;  4KT0 J;  1T2K D;  1HUC A;  1QEX A;  1N2D C;  1GW4 A;  5BU5 A;  1RHZ B;  1PP9 D;  2N9B A;  1W5C E;  1DEB A;  1T6A A;  3L75 J;  5KLI B;  1OVV A;  3CCU P;  3GLM A;  3MGN A;  2HOD A;  2P1J A;  1ZP0 C;  2YKO A;  2NRG A;  1CZQ A;  1QL2 A;  3PTZ A;  3TGU E;  3BCC J;  2IBZ I;  1R8E A;  2IPP A;  2UWJ E;  2A45 I;  3HE4 A;  2A06 D;  1LTJ A;  5B5E E;  3AE6 C;  1KB9 E;  2PFX A;  2PGD A;  3M0D A;  1EZV D;  1W2B O;  1KYO I;  2HR3 A;  1L0N D;  3IR9 A;  4H0L D;  3CWB D;  1WT6 A;  1SQV E;  3KQG A;  3L74 J;  3TK1 A;  1AJY A;  2JWD A;  1NJI Q;  1M57 D;  4GOF A;  1FZF A;  4KJM A;  3RL0 D;  1KB9 H;  5AVS B;  1KQG B;  4TT3 H;  1P84 D;  3KHU A;  1E5W A;  4GT1 A;  2RN0 A;  2WSF H;  1T2K C;  1YIT P;  2J5U A;  2WT7 A;  4H13 D;  3GMA A;  4JYB A;  1XTC C;  5B66 E;  2JKV A;  2XND H;  2KXP B;  1GZL A;  1J1D C;  4WVZ A;  4U3F G;  1VQ5 P;  4L73 A;  2H7H A;  2CK3 H;  1AQ5 A;  1VF5 C;  1USE A;  4OWF A;  4EDF A;  2BEQ D;  4WWI A;  2BAS A;  3R2P A;  5B66 H;  1SFC C;  1SQB G;  1HWT C;  3P8C E;  3MP7 B;  3H1L D;  1LWU A;  1NGM B;  4M3L A;  2QM7 A;  3EWK A;  1JTH B;  1Y47 A;  1SQX K;  3L4F A;  1SQQ E;  3ZDM A;  4OH8 B;  4CPG A;  3KPE A;  1NTZ G;  4ASW A;  5KLI C;  3TYY A;  3A2A A;  2ZYD A;  2QA4 P;  2B87 A;  5AW1 B;  1N73 A;  1FZC A;  3WUV A;  1YIJ P;  3L75 D;  2BCC G;  5AW3 B;  1OIP A;  4UB6 H;  1BSN A;  1AA0 A;  2GA1 A;  2LXC B;  2QM8 A;  3HD7 A;  1N8R Q;  4GKG A;  4HYT B;  1JMB A;  3VYI A;  2ZXE B;  3SFD C;  1NU1 D;  3H32 B;  3JSV C;  3IN6 A;  3B8E B;  3HTK A;  1IZN B;  2K9J A;  3BCC D;  2KOG A;  3BAT A;  3H1H G;  4WY4 A;  1AV1 A;  3L71 G;  1ZW0 A;  3P8M C;  3CPW O;  4GIF A;  2YKQ A;  4HB1 A;  3PH0 A;  3G4S P;  3VN0 A;  3G71 P;  3NTN A;  3Q1M A;  2AEJ A;  5DJT B;  2M5A A;  2N1T B;  1DEE G;  3C8V A;  4HJG H;  1KOR A;  2FYU G;  3H1K J;  3L74 D;  3O6Q A;  2IYP A;  5KAF E;  4PV1 B;  1KQS O;  5APQ A;  3EFG A;  1Q81 Q;  1SQP E;  1EXJ A;  1S2E A;  2KSJ A;  2QJP B;  1PV3 A;  1KMI Z;  2W90 A;  3C9I A;  2PRR A;  1NTK K;  5APW A;  1GL2 A;  3AEC C;  2W83 C;  1USD A;  3V4W A;  2N9Y B;  5DJU B;  4L74 A;  1OXZ A;  3A0B E;  4IL6 H;  1MV8 A;  1N7S A;  2H43 A;  5AW5 B;  4ASV A;  2N1T D;  1KZU B;  4H44 D;  1JOC A;  2QIW A;  4B86 A;  1PGP A;  4PV1 D;  1FBM A;  1OFC X;  1NTZ K;  3B5N A;  2WPQ A;  3OAK A;  2O1J A;  2JWA A;  1NTK J;  1S3J A;  2O01 H;  1LTB C;  1SQX E;  4PD4 D;  2V4H A;  2KLU A;  2Y0C A;  1X22 A;  1LGH B;  3AE1 C;  3NXS A;  4YTP C;  3E1I A;  1WRG A;  3D6Z A;  2OYI A;  3I5C A;  2AEF A;  1HF9 A;  1H0T A;  1H88 A;  2VRS A;  3QWO C;  4I1L A;  5CBN A;  1GL2 B;  1NTM G;  4DT0 A;  1BE3 D;  2M8R A;  4JF7 A;  2Q5U A;  1NTZ J;  3H1K E;  1PGO A;  2OGU A;  5KJ7 A;  3CI9 A;  1FZA A;  4JPZ B;  3LW5 H;  1YJ9 P;  2HPC B;  1KIL A;  2KYV A;  5GTI E;  4NPE A;  3SSU A;  2LXB A;  1YI2 P;  3HE5 A;  2MJZ A;  4ZNC A;  1E79 H;  2M3B A;  2P67 A;  3CXH I;  1PP9 J;  2N1T C;  1CW5 A;  1T8Z A;  3W67 A;  2Q6Q A;  2E74 D;  1A02 J;  1PPJ G;  3Q3D A;  4PV1 C;  1L0N K;  1YYC A;  3RBZ A;  3L73 G;  4BRY A;  1GDT A;  4N6J A;  4DCK A;  2QJP C;  2E76 B;  1SQQ G;  1BGY G;  1GK6 A;  1ZME C;  5CJ4 A;  3C1L A;  1GMJ A;  1CSB A;  3T97 B;  4C46 A;  2FYU J;  3U59 A;  3CLQ A;  1N7L A;  3H1I G;  1KIL B;  3M06 A;  1RF1 B;  1L0N J;  1FDI A;  2K1A A;  5AW9 B;  4DOJ A;  3CX5 E;  4D6T G;  1BCC E;  2YXR B;  2WTY A;  1RF0 A;  3V5B A;  1KC8 Q;  2WMM A;  5BVZ A;  4DJG A;  2E76 D;  1IO4 A;  1FOS E;  2KIK A;  2NZ2 A;  5KLV G;  4LGD E;  3AED C;  4W7Z A;  1Q82 Q;  1URQ B;  3RK3 C;  4U3F D;  3CX5 H;  1NTK D;  2YIU B;  1OW7 A;  2Y9Y A;  2P2U A;  4WBA A;  3UIA A;  1XTG B;  1GL2 C;  1LTS C;  3L72 G;  4W80 A;  3CCJ P;  1LNQ A;  2QE7 H;  3LID A;  1PP9 E;  2OYH A;  2P58 A;  1VQL P;  1QVF O;  3CL3 D;  1VQ9 P;  1LT9 A;  3GW6 A;  1M1J A;  2L91 A;  2H89 C;  1Q86 Q;  1FJP A;  1Z56 A;  1NTZ D;  1JCC A;  3CCE P;  3D71 A;  3AEG C;  3H1L J;  3S9O A;  1NH4 A;  2ZJS E;  1NU1 K;  1VQN P;  2WSS H;  4GOE A;  3TNU B;  1VQP P;  1NYH A;  3WMM 0;  2BCC D;  1L4A B;  1DX7 A;  3QH9 A;  3AE3 C;  5AVW B;  2AEM A;  4HKZ H;  1LJ2 A;  2A06 E;  1JM0 A;  1ZLL A;  1OZH A;  2C0X A;  1KB9 I;  1EZV E;  5CCH A;  1IFM A;  2QVA A;  3WUU A;  2IFN A;  1L0N E;  2E76 C;  5AVZ B;  1S1C X;  2KNC A;  3CWB E;  3H1J J;  2B89 A;  2B9B A;  2XV5 A;  1M7L A;  2I8D A;  3L71 D;  1K73 Q;  1VF5 D;  1RH5 B;  3CCM P;  1NU1 J;  1LT9 B;  3PP5 A;  1GU5 A;  1P84 E;  1SFC D;  1KIL C;  1RF1 C;  1L4A D;  2DW3 A;  2XZR A;  4Z1M H;  2QJK B;  3L73 J;  1DD3 A;  1JUN A;  2FYU D;  1VDF A;  3SWY A;  3VMX A;  1AFO A;  1HTL C;  2WPS A;  5AW2 B;  1L0L G;  5K5G B;  2CPB A;  1S72 P;  1DIP A;  2WSC J;  2XDJ A;  1URQ C;  5B5E H;  4K3A A;  2YIU C;  2KNC B;  1ZRT D;  2NPS A;  4W7Y A;  1FAV A;  5AVR B;  2HOD B;  1OW8 A;  3H1L E;  1RE4 C;  3LIE A;  5AVY B;  3O8Z A;  1K04 A;  1RQU A;  1T3J A;  2ZVO B;  4OVN F;  4ZKU A;  2QEX P;  1FC2 C;  2OTL P;  2ZXX A;  3HE4 B;  3TF5 A;  1LTJ B;  3Q5S A;  3L75 E;  3BRT B;  4UB8 E;  3WU2 E;  3CMA P;  3S1K A;  1S9K E;  1X79 B;  5AVT B;  2WSE J;  2KUB A;  1G2C A;  1SS1 A;  5APU A;  2K3R A;  4I7Z B;  1L4A C;  2E5Y A;  1QX8 A;  2KP8 A;  1NU1 E;  2V7Q J;  2R32 A;  4BWN A;  1FDO A;  3BCC E;  1NTM D;  2IBZ D;  4UB8 H;  3WU2 H;  2WWW A;  4N78 D;  1MZ9 A;  2ZT9 B;  5CBO A;  4AQR D;  1HBW A;  3H6P A;  2WT7 B;  1X9V A;  3AEF C;  3ABV C;  1KYO D;  1JY2 N;  1BE3 J;  3V4Q A;  3VTP C;  3PLN A;  1S9K D;  1LT9 C;  4GDO A;  2J59 M;  3L70 J;  3H1J D;  3B4S A;  3OA7 A;  1NKN A;  1FOS F;  1NAY A;  3L74 E;  1YJW P;  1KFN A;  2QJK C;  2KSE A;  3M91 A;  2E42 A;  3EQ2 A;  2K9Y A;  2YMK A;  2C0W A;  1VQ7 P;  1PPJ D;  2KS1 A;  1IC2 A;  2QG4 A;  2XKM A;  5GTH E;  3L73 D;  1ZR2 A;  1LWU B;  1J2J B;  2KZJ A;  2ITA A;  1BGY D;  5CCH C;  1Q90 D;  4YPC A;  1OWA A;  2Q9I A;  1GU4 A;  2B87 B;  2OTK E;  5GTH H;  1N73 B;  1FZC B;  2ZAE B;  1FU1 A;  4R4L A;  4Y99 B;  5AW6 B;  3H1I D;  2W6A A;  4LLH A;  4IOI H;  1JY2 P;  3HD7 B;  2KI7 B;  3CC4 P;  3AE5 C;  4D6T D;  2FYN B;  5AVX B;  1EDI A;  4PD4 E;  2Z5I A;  1U7J A;  1LTJ C;  1JO5 A;  3HTK B;  2HG5 D;  2K9J B;  3M0D C;  5KAF H;  1YHQ P;  1VQO P;  3HRN A;  1RE3 A;  3N7N A;  4WY4 B;  5KLV D;  4I7Z C;  1M8O B;  1SQB K;  4R4M A;  4RO0 A;  1RY3 A;  2IX7 C;  3OW2 O;  1BE3 E;  3TGU G;  3EFF K;  3L70 E;  5AVV B;  2IFM A;  1BDD A;  1LP1 A;  3F5H A;  4N3Y B;  2M5A B;  3L72 D;  5CCG A;  3HD7 D;  1X0T A;  4U3F J;  1VL2 A;  3GHG A;  3A0B H;  3O6Q B;  2ZT9 C;  3MUD A;  2GUS A;  1R5S A;  2WPV B;  1SQV G;  2AXT E;  3RK3 B;  4WY4 D;  1SQB J;  2FXM A;  2AXC A;  1S5L X;  3M9B A;  1LTA C;  4XFJ A;  3SWF A;  2W27 A;  2FXP A;  3CCS P;  3L70 D;  1N7S B;  4EIJ A;  2W8Z A;  1LWU C;  2BCC J;  3HUS A;  5TIS E;  3B5N B;  3RK3 D;  2D2C B;  2ZFC A;  2IZ0 A;  3KZI E;  2OTJ P;  2FYU K;  1U57 A;  1AVO A;  5M1B A;  4JQ0 D;  2C9L Y;  1N73 C;  1GL2 D;  2Y0E A;  1FZC C;  1JEK A;  1VPC A;  4KHX A;  4Y99 C;  5GTI H;  2OYI B;  1KQL A;  3MHV A;  2PP6 A;  3CX5 I;  1H0T B;  3H1H J;  3L71 J;  1SVF A;  3HD7 C;  1N7S D;  4C7N A;  2FYN C;  3BCC G;  4JYC A;  3KZI H;  4TLF A;  2GM4 A;  3BRV B;  2HLO A;  2E75 B;  2FBW C;  1G1I A;  3RL0 g;  1JY2 O;  1IFN A;  2R5D A;  1TU3 F;  1QGK B;  1ZV8 A;  4U3F E;  1YTZ T;  3F89 A;  4WY4 C;  1NTK E;  2K37 A;  1R5L A;  1Q2N A;  1YTZ I;  1JB0 J;  2BEZ F;  3IFM A;  1JNM A;  4RES B;  3II6 A;  3BAS A;  3HE5 B;  3A0H E;  1LTI C;  2QJY B;  3HUS B;  1EQ7 A;  1UIX A;  1EDL A;  5E79 E;  2R3C A;  5EFW B;  5APY A;  3FWN A;  4RJT A;  1NO4 A;  4JBZ A;  1KN7 A;  3ITK A;  2QRX A;  1NTZ E;  2FY8 A;  4BRY B;  4Y28 J;  3A0H H;  1FZG A;  1ZR4 A;  4IFM A;  2BCC E;  2OYO A;  1KIL D;  3M9H A;  1NTM K;  1PGJ A;  1Y9B A;  5APT A;  3JCU E;  2JEE A;  3MIW A;  3CXH D;  2MKV A;  1SQB D;  3D70 A;  2R44 A;  1N7S C;  1SQP G;  4WB4 A;  1X8Y A;  1HJB A;  2WSF J;  2I1J A;  3SFE C;  3V2P A;  3B71 A;  1LTT C;  3L71 E;  3PHL A;  1NAF A;  2KLV A;  3L36 A;  5KKZ B;  3B5N C;  1URQ D;  3U1C A;  2D2C C;  1BDC A;  1VQ8 P;  2HFE D;  3V2Q A;  1NTM J;  5CMZ A;  2RH0 A;  3SWK A;  3N4X A;  2W6J H;  3CCL P;  1PGQ A;  2L5G B;  1FJK A;  2RMZ A;  2FYU E;  2OYI C;  1OW6 A;  3A5T A;  1NWQ A;  2O01 N;  1NHL A;  2FFD A;  1SQQ K;  3E1R A;  1JMM A;  1AQT A;  2E75 C;  3W68 A;  3H1H D;  3RK2 B;  2OYH B;  1SQX G;  3GF3 A;  4H0L B;  5KJ7 C;  1M1J B;  2JDI H;  2KZI A;  1YQ3 C;  4I2L C;  1ZRT E;  2WPR A;  3AEA C;  1VQK P;  1GK4 A;  2H8P D;  2QJY C;  3HUS C;  3RL0 B;  1ZXG A;  1SQQ J;  1BGY J;  2W6B A;  2KK7 A;  4K35 A;  3H1K G;  1UII A;  5KLV K;  1P84 H;  4H13 B;  3RK2 D;  4AYC A;  3PRJ A;  3USS A;  2YKP A;  2FFD B;  5CHX A;  3H1I J;  2YMY A;  1OMI A;  1AVY A;  1YQ4 C;  4D6T J;  1JTH A;  3VMY A;  4DZO A;  1SQP K;  2J58 A;  1NTM E;  2YO2 A;  2IBZ E;  3A3Y B;  1Y8A A;  4N78 E;  1FS0 E;  3TGU D;  1N86 A;  3V6I A;  3L35 A;  2XNX A;  5KLV J;  4EI2 A;  1GW3 A;  3H25 A;  3AE7 C;  1RF0 C;  1KB9 D;  3D6Y A;  3VP8 A;  1KYO E;  1DH3 A;  5KKZ C;  3KYQ A;  5CCH D;  4L75 A;  1S4X A;  1OVU A;  3H1J E;  4OGQ B;  1SQV D;  1MKM A;  3G9R A;  3L72 J;  2Q7C A;  1NTK G;  5L8R J;  1EXI A;  2B88 A;  3H32 A;  2A45 H;  1JY3 N;  1IFJ A;  4NPF X;  1SQP J;  4XE5 B;  1PPJ E;  1BCC G;  1KYO H;  5KTB A;  2Q3I A;  2NPS B;  3VOP A;  3U1A A;  3E7K A;  1KV4 A;  3L73 E;  3BVH A;  4UB6 E;  3TSI A;  1K8A Q;  1EDJ A;  1QLE D;  3RK2 C;  1IFD A;  2OYH C;  1BGY E;  3WUT A;  2IYO A;  3CC7 P;  4H0L C;  1M1J C;  2WVR A;  2LKM A;  2N1T A;  4OGQ D;  3TDK A;  1IJD B;  2O01 J;  3AE2 C;  2P7J A;  1PL5 A;  1YBK A;  4BXL A;  3H1I E;  3FXD A;  3RL0 C;  3R4Y A;  1G2C B;  2G3A A;  1YJN P;  1T3U A;  2JJL A;  1OVR A;  1DD4 A;  1L0L K;  4L76 A;  1PP9 G;  2P10 A;  2NPS D;  3CME P;  4D6T E;  2JP3 A;  3P8C D;  3FWL A;  5AVQ B;  2ZT9 D;  4H13 C;  1SQX J;  4PD4 I;  1SQQ D;  2WSC H;  3IAO A;  1JY3 P;  3V2R A;  1VQ4 P;  1S5L E;  2FKW B;  2YO3 A;  2FFD C;  5KLV E;  1A02 F;  3LW5 J;  3AE4 C;  1KTM A;  1MUU A;  1SP4 A;  1WMK A;  5BU8 B;  4C7R A;  5AW7 B;  1EC5 A;  1J1E B;  1JCD A;  3GF7 A;  3OJA B;  1GTW A;  3V2N A;  5AW0 B;  2H88 C;  3CCV P;  2R5B A;  1PZQ A;  4IFF A;  2POH A;  1L0L J;  3L72 E;  4H44 B;  4MN4 C;  2A06 G;  3GG2 A;  1MFT A;  1S5L H;  2Q1K A; 
#chains in the Genus database with same CATH homology
 1NH4 A;  3P7K A;  4KHX A;  4Y99 C;  1NU1 K;  2OYI B;  1KQL A;  2PP6 A;  2PAJ A;  3TNU B;  3WMM 0;  2H7H A;  1AQ5 A;  1SVF A;  1L4A B;  3HD7 C;  1N7S D;  1DX7 A;  1ZN5 A;  3MD0 A;  2WSE H;  4C7N A;  3L37 A;  2BAS A;  4JYC A;  3R2P A;  5AVW B;  2GM4 A;  1ZLL A;  3BRV B;  2HLO A;  1SFC C;  2Z5H A;  2C0X A;  1G1I A;  5CCH A;  1MFZ A;  1JY2 O;  1IFM A;  1IFN A;  2R5D A;  2IFN A;  1HWT C;  3P8C E;  5AVZ B;  1ZV8 A;  1YTZ T;  1LWU A;  4WY4 C;  4M3L A;  2QM7 A;  1CI6 A;  1JTH B;  2OAR A;  1YTZ I;  2XV5 A;  1JNM A;  1SQX K;  3IFM A;  3L4F A;  1FDM A;  4RES B;  1M7L A;  4OH8 B;  1HVV A;  2NPS C;  3II6 A;  3BAS A;  3VMZ A;  3A7O A;  3KPE A;  3HE5 B;  1FZB A;  2HPC A;  1LTI C;  3TYY A;  1LT9 B;  3A2A A;  3PP5 A;  3HUS B;  1EQ7 A;  5AVU B;  2XU6 A;  1GU5 A;  5AW1 B;  1SFC D;  1KIL C;  1RF1 C;  1N73 A;  1FZC A;  2R3C A;  1L4A D;  2XZR A;  5AW3 B;  5APY A;  1NO4 A;  1JUN A;  2QM8 A;  1VDF A;  3HD7 A;  3SWY A;  3VMX A;  3M9Q A;  1AFO A;  4GKG A;  5AW8 B;  1HTL C;  2WPS A;  1G1J A;  4HYT B;  5AW2 B;  1H89 A;  1FZG A;  5CJ0 A;  1ZR4 A;  2CPB A;  2ZXE B;  3VYI A;  4AUW A;  3H32 B;  1IFI A;  4IFM A;  2C9N Y;  1NOH A;  3B8E B;  3HTK A;  1KIL D;  3M9H A;  1NTM K;  4XA4 A;  5APT A;  2KOG A;  3BAT A;  4WY4 A;  2XDJ A;  1URQ C;  2JEE A;  3MIW A;  3P8M C;  4IFD K;  3KDP B;  1HH0 A;  4GIF A;  1CI6 B;  2YKQ A;  2NPS A;  2A45 G;  4W7Y A;  1N7S C;  1FAV A;  5AVR B;  2Z4E A;  2HOD B;  3VN0 A;  3T97 A;  1RE4 C;  3LIE A;  3NTN A;  4WB4 A;  1X8Y A;  1HJB A;  2I1J A;  5AVY B;  3O8Z A;  3V2P A;  3GHG B;  1PFI A;  2N1T B;  1RF1 A;  1LTT C;  1J1E C;  1NAF A;  2KLV A;  1T3J A;  1GD2 E;  3VP9 A;  3L36 A;  1JY3 O;  3B5N C;  1URQ D;  3U1C A;  5APQ A;  4ZKU A;  3EFG A;  2YNY A;  2HFE D;  3V2Q A;  3HE4 B;  1LTJ B;  5CMZ A;  3BRT B;  2KSJ A;  3N4X A;  4ZKP A;  2L5G B;  1S9K E;  1X79 B;  5AVT B;  1FJK A;  2HYN A;  3C9I A;  1G2C A;  2OYI C;  5APU A;  3A5T A;  1NTK K;  1NWQ A;  5APW A;  1GL2 A;  1L4A C;  1NHL A;  2FFD A;  1SQQ K;  1URQ A;  4EOT A;  3V4W A;  4LC1 A;  2O1K A;  1JMM A;  5CCG D;  3B5N D;  2KP8 A;  3NFQ A;  1OXZ A;  1MV8 A;  1N7S A;  2R32 A;  2H43 A;  5AW5 B;  2N1T D;  3RK2 B;  1KZU B;  2OYH B;  1RE4 A;  1JOC A;  2WWW A;  4N78 D;  2KB7 P;  4B86 A;  5KJ7 C;  1MZ9 A;  1M1J B;  1FBM A;  4AQR D;  4I2L C;  2WPR A;  1HBW A;  3H6P A;  3P32 A;  2WT7 B;  2GUV A;  1X9V A;  3M0A A;  1NTZ K;  3B5N A;  1GK4 A;  1JY2 N;  2WPQ A;  3G3Z A;  2H8P D;  3V4Q A;  3VTP C;  3OAK A;  1S9K D;  1LT9 C;  2O1J A;  2J59 M;  3HUS C;  2O01 H;  1LTB C;  3OA7 A;  3RL0 B;  1SQV K;  1NKN A;  5APX A;  1FOS F;  1LGH B;  1KFN A;  2W6B A;  3NXS A;  3E1I A;  1WRG A;  5KJ7 D;  5APS A;  2OYI A;  4C7N B;  3M91 A;  3I5C A;  2E42 A;  1SFC A;  3EQ2 A;  5KLV K;  1LTG C;  3TNU A;  5APV A;  2C0W A;  1L4A A;  2VRS A;  1H88 A;  4I1L A;  3RK2 D;  4AYC A;  1IC2 A;  1GL2 B;  2XKM A;  1HGV A;  4HH2 A;  4I6M C;  2YKP A;  2FFD B;  1HGZ A;  1ZR2 A;  2M8R A;  2WIT A;  5CHX A;  4JF7 A;  1RE3 C;  1LWU B;  2I1K A;  1J2J B;  2Q5U A;  2YMY A;  3NMD A;  1IK9 A;  5KJ7 A;  3CI9 A;  1FZA A;  5CCH C;  1JTH A;  1H8A A;  3LW5 H;  1KFM A;  3VMY A;  2HPC B;  1KIL A;  2KYV A;  1OWA A;  1QL1 A;  4DZO A;  2E43 A;  1SQP K;  2J58 A;  2YO2 A;  2Q9I A;  1GU4 A;  3A3Y B;  3HE5 A;  4N78 E;  2MJZ A;  1N86 A;  1N73 B;  5CCG C;  1FZC B;  3L35 A;  1W2E A;  4O9B A;  1FU1 A;  1J1D B;  1FZE A;  2XNX A;  2M3B A;  4Y99 B;  2P67 A;  1GW3 A;  1GZL A;  5AW6 B;  3GHG C;  2W6A A;  2N1T C;  1CW5 A;  2CPS A;  1T8Z A;  4LLH A;  1RF0 C;  1SLQ A;  1JY2 P;  3HD7 B;  3VP8 A;  1DH3 A;  1A02 J;  3KYQ A;  1NKZ B;  5CCH D;  1L0N K;  5AVX B;  1YYC A;  2WZ7 A;  1GDT A;  2Z5I A;  3MTU E;  1LTJ C;  1SFC B;  1JO5 A;  2Q7C A;  2FYZ A;  4N6J A;  5AW4 B;  3HTK B;  2HG5 D;  3M0D C;  3H32 A;  3HRN A;  2A45 H;  1JY3 N;  1RE3 A;  3N7N A;  1HUC A;  1T2K D;  4WY4 B;  1GK6 A;  1IFJ A;  1N2D C;  1GW4 A;  5CJ4 A;  5BU5 A;  2N9B A;  1SQB K;  1DEB A;  4XE5 B;  5KTB A;  2Q3I A;  2NPS B;  3VOP A;  3U1A A;  1RY3 A;  2IX7 C;  1CSB A;  3BVH A;  4C46 A;  5AVV B;  3TSI A;  2IFM A;  3U59 A;  4N3Y B;  3CLQ A;  1N7L A;  3RK2 C;  1IFD A;  3MGN A;  1KIL B;  2HOD A;  3M06 A;  1RF1 B;  2OYH C;  5CCG A;  3HD7 D;  2P1J A;  1M1J C;  3GHG A;  2YKO A;  3MUD A;  2LKM A;  2N1T A;  5AW9 B;  4DOJ A;  2GUS A;  2WTY A;  1RF0 A;  1CZQ A;  1IJD B;  3V5B A;  1QL2 A;  5BVZ A;  2P7J A;  3RK3 B;  2IPP A;  1IO4 A;  1FOS E;  4WY4 D;  2A45 I;  3HE4 A;  3RL0 C;  1LTJ A;  1G2C B;  2FXM A;  1T3U A;  4LGD E;  2JJL A;  3M0D A;  3M9B A;  1L0L K;  1LTA C;  2NPS D;  4W7Z A;  3SWF A;  1URQ B;  2W27 A;  3IR9 A;  3P8C D;  3RK3 C;  5AVQ B;  1WT6 A;  2P2U A;  1N7S B;  3KQG A;  4WBA A;  3UIA A;  2WSC H;  1XTG B;  1GL2 C;  1JY3 P;  3V2R A;  1LTS C;  3TK1 A;  2FKW B;  4EIJ A;  2YO3 A;  4W80 A;  2FFD C;  1FZF A;  1A02 F;  1LWU C;  3LID A;  1MUU A;  1SP4 A;  3RL0 D;  5AVS B;  5BU8 B;  4C7R A;  2OYH A;  5AW7 B;  1J1E B;  1JCD A;  3CL3 D;  3OJA B;  1E5W A;  1LT9 A;  4GT1 A;  1M1J A;  1T2K C;  2WSF H;  3HUS A;  1GTW A;  3V2N A;  3B5N B;  5AW0 B;  3RK3 D;  1FJP A;  2ZFC A;  2R5B A;  4IFF A;  2WT7 A;  2FYU K;  2POH A;  1Z56 A;  4JYB A;  1XTC C;  1JCC A;  2C9L Y;  1N73 C;  1GL2 D;  1FZC C;  1VPC A;  1J1D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...