1FZBA

Crystal structure of crosslinked fragment d
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
EDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBRINOGEN
publication title Crystal structures of fragment D from human fibrinogen and its crosslinked counterpart from fibrin.
pubmed doi rcsb
molecule tags Blood coagulation
total genus 27
structure length 81
sequence length 81
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzbA00
1JY3N 1RF0A 3HUSA 1LWUB 3BVHA 1M1JA 1FZGA 1LWUC 3GHGA 2XNXA 1RE4A 2H43A 3E1IA 1RF0C 3HUSB 1JY3P 3GHGB 3HUSC 1M1JB 1FZEA 1RE3A 1M1JC 1JY3O 3GHGC 3H32A 2Z4EA 2A45G 1RE4C 3H32B 2HODA 1RE3C 1W2EA 1RF1A 1N86A 2HODB 1N73A 2OYHA 1T3UA 1RF1B 2A45I 1JY2N 1RF1C 1FZCA 1N73B 1LTJA 2OYHB 1LT9A 1N73C 1FZAA 2OYIA 2Q9IA 2OYHC 1FZCB 1LTJB 2HLOA 2FFDA 2HPCA 1JY2P 1FZCC 2OYIB 1LT9B 1LTJC 1FZFA 1LT9C 2FFDB 1JY2O 2A45H 2OYIC 2HPCB 2FFDC 1LWUA 1FZBA
chains in the Genus database with same CATH superfamily
2WSFJ 4W7ZA 3LW5H 1BCCG 1S9KE 4GT1A 3TGUJ 3QWOC 2IFMA 3H1JJ 1BDCA 2RN0A 2OYIA 1FZCB 3TGUD 2RKLA 3H1JD 5CCGD 2PP6A 3L71J 1LWUA 4U7JA 1NGMB 2KXPB 2JDIH 2WMMA 1SQXE 1IC2A 3L71D 1LTBC 1E5WA 3JCUE 3RGUA 3TNUA 1SQVE 4JF7A 3Q1MA 1H8AA 1LP1A 1JTHA 1SQQK 3N4XA 3R4YA 4EDFA 2QJPB 4ZKUA 2O3JA 5GTHH 5KAFH 1PGQA 1BSHA 3CXHD 1CZQA 5H2FH 3KQGA 3AEAC 2OYIB 3LW5J 4XA4A 1LWUB 3KPEA 3G71P 1IFIA 1P84D 2Z4EA 1NU1K 3A7OA 2G3AA 1Q81Q 1VQ5P 3ITKA 4GDOA 1BE3E 2WZ7A 3TNUB 3R2PA 3RL0D 2KB7P 2IBZD 3EQ2A 1J1EB 2E76C 2HPCB 3FXDA 2N1TC 3IN6A 3KZIH 2MJZA 2XU6A 3HE4A 1KQGB 1PGOA 2E75C 1J1DC 5DJUB 3S4RA 2ZVOB 1JCCA 5AVUB 1Z56A 3AEDC 1L0LK 1CSBA 1BDDA 1SQXG 4NPEA 1JY2O 2AXTE 3M0AA 5AVYB 3FGAD 1ZV8A 3OA7A 3V2QA 1GU4A 2RMZA 3U59A 1W5CE 3M0DA 4N3YB 4PJ0E 3AE5C 4LLHA 4D6TJ 4LGDE 3CC2P 3CI9A 1DEEG 4AUWA 3Q5PA 1KYOE 2ZAEB 4D6TD 5AVZB 4AYCA 1SS1A 1FAVA 4K35A 2BCCD 3VMZA 3HE4B 3G9RA 3BRVB 5APUA 1N73A 1L0NK 3H1KE 2PFXA 1LTJA 3K5BA 2D2CC 3GMAA 4GOEA 1GK4A 5KLIB 2KOGA 2K37A 2BASA 3V4WA 1VQNP 2Q7CA 3G6EP 4W80A 2AEFA 1VQLP 1PGPA 4H0LC 2CPBA 2W6JH 1GTWA 3L73E 3L4FA 3HD7D 3C1LA 5KLVK 1X22A 2NPSD 1FZGA 5TISH 3AE2C 1XTCC 4LC1A 1KB9D 4L75A 4Y99C 3WU2H 2YKOA 2QJKC 1N73B 1ZR4A 1KMIZ 1LTJB 1S5LH 1YJNP 1LNQA 1M57D 2N1TB 4I6MC 2JR8A 1T3JA 3AE4C 1UIXA 3A0HE 3P7KA 1HWTC 1NTKJ 1NYHA 3CMAP 1M1JC 3CWBJ 1OWAA 2E75B 3JC22 3S9OA 3Q2YA 1NTKD 5M1BA 1L4AA 1VQ6P 3GF3A 3CWBD 1CI6A 3M9QA 2Y0CA 1IFJA 2FKWB 4WB4A 2QG4A 3L75E 3H1KG 3RBZA 5AW9B 3JSVC 1KILA 4PV1B 3H1IJ 4EIJA 3U1CA 2IX7C 4IL6H 3H1ID 2LXBA 1SQBJ 1HJBA 3GHGA 1LTIC 2J59M 1SQBD 1OMIA 1JMBA 1BCCJ 2R3CA 1HBWA 1L4AB 5AVVB 3CCUP 1BCCD 1LTGC 2ZFCA 3CCJP 1YITP 5GTHE 2E74D 5AVQB 1S3JA 1JUNA 2Q1KA 1K8AQ 1RH5B 1YI2P 1KILB 1RHZB 2JEEA 4UB6H 1HJ0A 2MKVA 1Q2NA 4WWIA 2IDBA 3GHGB 3MGNA 4HKZH 2IBZG 3OJAB 4Y99B 3AE9C 5CJ4A 1JO5A 3GG2A 5E79H 1USEA 2V4HA 2K9JB 4ASWA 3A3YB 2FYZA 1ZW0A 1DD3A 4R4MA 1FZBA 1YBKA 2R5DA 4I2LC 4U3FE 4XFJA 4GIFA 1IFPA 1M1JB 1LTTC 4YXDC 2YXRB 2FYUJ 1OW7A 1Q90D 4OGQC 3O6QB 5CHXA 1NJIQ 3MIWA 5AVXB 2N9YB 2OARA 1IK7A 3C9IA 3HRNA 3V2NA 1IFNA 3N7NA 4N6JA 2YXQB 1X8YA 4DZOA 4H44C 2E5TA 2QVAA 2WSCJ 1IO4A 3SSUA 1MV8A 2BCCG 2WTYA 4DT0A 1SQXJ 1SQPJ 1JOCA 3T97A 1YYCA 1RF0C 2R5BA 1SQXD 2RH0A 1PPJG 1EQ7A 2E76D 5APSA 1URQA 2YKQA 1A02J 1FZCC 2K9YA 1KYOI 1LT9C 5APYA 3GW6A 3RL0g 3AECC 1GMJA 2P67A 4QMAA 1RE4A 1VQ8P 1JCDA 4PD4H 1T2KC 1OVVA 2JKVA 1RE3C 1NTMK 1SQQE 3P32A 2XKMA 2W8ZA 3A5TA 5DJTB 2FFDA 1SFCC 4RJTA 1N7SD 3CCEP 4XE5B 2QJPC 1PV3A 3T97B 2W6BA 2Z5IA 1VF5D 3WU2E 1YTZI 2OGUA 3IF4A 3AEBC 2ZXEB 2Y0EA 1RF1A 2IPPA 1S5LE 2AEJA 1ZXGA 1URQB 4L73A 1NU1E 2OYIC 3BCCJ 2M8RA 2M3BA 1WMKA 1MZ9A 3B5NA 1JNMA 1LWUC 3L74G 2QA4P 1VQ4P 2C9NY 1W2BO 1BGYE 2D2CD 1FBMA 1RQUA 3B71A 4TT3H 2FFDB 1J1EC 4H0LD 3G4SP 3W68A 1EDJA 5CCHA 2P58A 5KJ7A 1L0LE 4L74A 3D71A 1RF1B 4IL6E 1AVYA 3SWYA 2Q5UA 3CXHH 3L37A 1GW4A 1BSNA 4I1LA 2Q3EA 1JB0J 2O1JA 4N78E 2ZXXA 3KXDA 3B5NB 1JY3P 3VMXA 3FWLA 3GF7A 1A02F 1P84H 2IYOA 4RKUJ 3H1KJ 4JQ0D 2FBWC 2YIUB 1OIPA 2E42A 1NTKK 3H1KD 3WUUA 2IZ0A 1LT9B 1AJYA 5KTBA 1EXJA 1L0NE 1NTZK 3H1HE 1N8RQ 3BATA 2Q3IA 5AW2B 2ZT9D 1NO4A 1YQ3C 1VQPP 2A06E 3L73D 5APXA 2O01J 2PRRA 1SFCB 4UB6E 3Q3DA 1JM0A 5KLIC 4M3LA 3SFDC 1YHQP 5K5GB 2POHA 3H32A 5KLVE 2L5GB 1MFZA 1VQ9P 3M0DC 1KC8Q 5E79E 1SQBK 2KYVA 4UB8H 3L72E 4Y28J 1L0LG 1KFMA 1NH4A 3CX5I 5KAIH 3RK3E 3SWFA 4HYTB 3MD0A 4JYCA 2HODA 1U57A 3G3ZA 1N73C 5CMZA 4JYBA 1LTJC 3RBXA 1LP1B 4HH2A 1JTHB 5APTA 5APVA 3P8CD 1SLQA 3MHVA 3H32B 1GL2A 1MFTA 2I1KA 1FDOA 1L0NG 1QL1A 1ZN5A 3EWKA 3U1AA 2WSSH 1X79B 3V5BA 2K88A 2K1AA 2J58A 1KILE 2A06G 2Y0DA 1KB9H 1SQVG 3H1LE 1M56D 2HODB 3RK2B 4PV1C 3RK3C 2KUBA 1JY2P 2HG5D 2BCCJ 2WVRA 2FYUK 4OVNF 2PGDA 1DH3A 4ZNCA 1HF9A 4OGQD 1NKNA 2W27A 1GL2B 2KLVA 2E43A 1L4AC 1ZR2A 2IYPA 4H13C 2A45H 1PPJD 2JWAA 4H44D 1OVRA 5B66H 3Q5SA 3CX5D 1BE3G 3NMDA 1QL2A 4OWFA 1U7JA 2FXPA 3TGUE 1SQPK 3I56P 3H1JE 3L36A 1KILC 4L76A 3HTKA 1FE6A 2AXCA 1QVGO 1LTSC 2YKPA 5EFWB 1EXIA 2HR3A 1ZRTE 3L71E 5B5EH 1FS0E 3D70A 2XNDH 1FZEA 4U3FD 3GHGC 1T3UA 2R44A 4C46A 3OW2O 1TU3F 2JO1A 1N7SA 1T2KD 2QE7H 1IFDA 2R32A 2N9BA 3H1LG 2P7JA 4KHXA 4RO0A 2ZYAA 3L74J 1HGZA 3L74D 3WUTA 3HTKB 1NAYA 2KSEA 1VQ7P 1GD2E 1P84E 3A0BH 1OFCX 1H88A 2M3EA 1N86A 1S4XA 3RK3B 4C7NA 3AEEC 2I8DA 2H89C 3L73G 2XZRA 1SQQD 2WPSA 2V7QJ 4H13B 1CI6B 4GOFA 4WY4A 1NTME 1EC5A 2ZYDA 1IJDB 3AE1C 2QSIA 3EFGA 3OAKA 2Y9ZA 5KAFE 2CPSA 1DIPA 1T8ZA 4DOJA 1QLED 1VL2A 4UB8E 5H2FE 1AFOA 1VQKP 2WSCH 1N2DC 1FOSF 1NU1D 5CCGA 3Q5RA 2XNXA 1KFNA 2LKMA 1FDMA 3D6YA 3TK1A 3AE7C 3L75G 3JCUH 1KQSO 1URQC 3KZIE 1H0TA 4WY4B 1L2PA 1AQ5A 3CCRP 1HH0A 2KNCA 1L0LD 1RE4C 3VP8A 2OYHA 2C0XA 2B88A 2H88C 3V4QA 1QGKB 1KQFB 2FFDC 1OW6A 1KB9E 4N78D 2DW3A 4IFFA 4MN4C 3V2PA 1S9KD 3PTZA 1OVUA 1RF1C 1NTMG 1E79H 2ZYGA 2M0BA 1H0TB 1KORA 3HE5A 2IZ1A 1L0ND 1NTKE 2KZIA 3B5NC 4IFMA 1HUCA 2KNCB 4IFDK 4ASVA 1NTZE 1M1KQ 1SQVJ 2A06D 2N1TD 2YIUC 3MUDA 1FZFA 1JMMA 1Q86Q 2QRXA 1SQVD 5B66E 3CC7P 1Y47A 3IAOA 3HUSA 2E75D 4AQRD 2YMKA 5CCHC 3FX0A 5KJ7C 5KLVD 1NAFA 5GTIH 1M90Q 1KZUB 1LTAC 3L70E 4EOTA 1AV1A 5AW6B 5B5EE 1IK9A 4U3FG 1KTMA 5TISE 3RL0B 3LIEA 2R3SA 3HE5B 5AVTB 1SQBE 5BVZA 3VTPC 4PV1D 1GU5A 3D6ZA 1BCCE 1BE3J 5AW0B 3CCLP 5AW4B 1BE3D 1N7LA 2B9BA 1SP4A 1PP9E 2UWJE 3E1IA 3M9BA 1L4AD 3B8EB 1NOHA 3CPWO 2LR2A 2QJYB 2VRSA 4KJMA 2OTJP 1Y8AA 3AE3C 2NRGA 5AW3B 3HD7A 1RY3A 1IFMA 2O01H 3A0BE 4YPCA 2NPSA 1NTZG 1KV4A 1OXZA 1QEXA 2SPZA 1KILD 3H1LJ 1MUUA 3H1LD 2QM7A 2XV5A 4EYYQ 2Q9IA 1PGJA 5APWA 1KYOD 3C8VA 1SQQG 2KLUA 3A0HH 3L70G 1LT1A 5AW1B 2C0WA 1S72P 3RK2C 2FYUE 1LGHB 1FZAA 2HLOA 1K04A 2J5UA 3FXEA 2NPSB 1NVOA 2QM8A 3W67A 1ZOYC 3LIDA 5KKZB 1UIIA 2KS1A 3L73J 2WSEJ 1Q82Q 1NU1G 2W6AA 3F89A 1GL2C 4BRYA 1PP9G 5CBNA 3CC4P 1WT6A 1ZRTD 1SQPE 1BGYG 3I5CA 3MZWB 2P10A 3TF5A 3TDKA 2KZJA 4C7RA 1YIJP 1U7MA 1PFIA 2K3RA 1EDLA 2HPCA 1PIXA 4BWNA 3VMAA 5TJHA 1Q7YQ 3AE8C 3E1RA 1W2EA 3II6A 3VOPA 3CCVP 2KS1B 2YO3A 1GZLA 4EI2A 1FU1A 1USDA 4BRYB 1XTGB 3L75J 4JBZA 3L75D 2FYUG 3CX5H 4I7ZC 1VPCA 3SWKA 3PHLA 3H1HG 3BCCE 3BVHA 1KB9I 1EZVE 4GKGA 4ZMDA 1CW5A 1GDTA 1DD4A 2FYNB 2E74B 1X0TA 1URQD 1HTLC 4R4LA 1SQPG 4Z1MH 1YJWP 1NTMJ 5BU5A 1KD1Q 2KIKA 5KLVG 1NTMD 4PD4E 1N7SC 1VDFA 5GTIE 1ZMEC 1R5LA 3L72G 1VF5C 2A45I 3S1KA 2Z5HA 1KQLA 3CCQP 1T6AA 3IFMA 1ZP0C 1FC2C 2OTKE 2P1JA 2ZVNB 3I55P 3M91A 1HVVA 1OX3A 1SQXK 1AVOA 5CJ0A 2N1TA 3PJSK 1NWQA 3B5ND 4U3FJ 2AEMA 2JWDA 1PZQA 1ZLLA 1SQVK 4WBAA 2KSJA 2B89A 3VYIA 3BCCG 4O9BA 4JPZB 1EZVG 4RESB 5CCHD 1LJ2A 2V7QH 5KJ7D 2P2UA 4WY4C 2WQYC 3ZDMA 2Y9YA 4I7ZB 3VP9A 3CXHE 1SFCD 2C9LY 4OH8B 2PAJA 2YMYA 2GUSA 4HB1A 3L35A 2E76B 1NHLA 2I1JA 1WRGA 5CCGC 4K3AA 2JP3A 3F5HA 3FWNA 4DJGA 2M5AA 3MP7B 1RQVA 1J1DB 3AEGC 2BEZF 3EFFK 1NTZJ 1FJKA 3KHUA 2ZT9C 1NTZD 2IBZE 2FXMA 2OQQA 2H8PD 3P8CE 1N7SB 3TGUG 5AVWB 3H1JG 2O01N 1OZHA 2GA1A 1SQQJ 1R8EA 1VF5B 5AW8B 3L70J 2OYHC 2Q6QA 3L71G 3NXSA 3L70D 5AVRB 3VN0A 1JY3N 3UIAA 2ITAA 3PH0A 4TLFA 2BEQD 1K05A 4IOIH 2M5AB 3TYYA 2G8YA 2WT7A 1HGVA 3P8MC 5AW7B 1YQ4C 3M9HA 1M7LA 3NTNA 1YJ9P 2D2CB 2K9JA 3A2AA 1IZNB 1NU1J 4D6TE 4C7NB 3CMEP 3MTUE 5KAIE 1PP9J 2XDJA 4CPGA 4KT0J 1M1JA 2BCCE 3RL0C 1PP9D 3BASA 1H89A 1YTZT 2IFNA 3RK2D 4H0LB 1BGYJ 3IR9A 3O6QA 3H6PA 1GW3A 3SFEC 1BGYD 1PPJE 5L8RJ 3GLMA 2W90A 3MUDC 1DX7A 2GUVA 3CX5E 1PL5A 1L0LJ 3HUSC 1X9VA 3USSA 1GL2D 2QJYC 3AE6C 1JEKA 1FDIA 2QJKB 5AVSB 1DEBA 1MKMA 1S1CX 2WT7B 2YO2A 2H7HA 2NZ2A 2E5YA 1G2CA 2H43A 1FOSE 2WPVB 3B4SA 2KK7A 4BXLA 2ZT9B 3M06A 1OW8A 2FYUD 2JJLA 3QH9A 3WUVA 2LXCB 1L0NJ 2OYOA 3NFQA 4B86A 3H1HJ 2KI7B 1EZVI 2FY8A 1G1IA 3CL3D 3H1HD 1AQTA 4YXWH 1EDKA 3CWBE 3TSIA 4D6TG 3ABVC 3L74E 2OYHB 2FXOA 4WVZA 1VQOP 2HYNA 3KDPB 2WWWA 2OTLP 3HD7C 3PP5A 3H25A 4PD4I 2QEXP 2O1KA 2AXTH 5CBOA 2NPSC 1G2CB 5KLVJ 1QX8A 1SQPD 5KKZC 4DCKA 1JY2N 3AEFC 4PJ0H 3L72J 2HFED 3H1IE 2B87A 2ZJSE 1AA0A 3L72D 2WPQA 2KP8A 1K9MQ 1KYOH 1D7MA 4YTPC 3CLQA 4NPFX 3BRTB 3PRJA 1G1JA 1M8OB 1NKZB 4A7PA 3RK3D 3CCSP 4NPDA 3V2RA 1S5LX 2GM4A 2QIWA 2CK3H 3HUSB 2WSFH 4GODA 5BU8B 4H13D 2W83C 3CD6P 1KN7A 2WSEH 3WMM0 5APQA 1NTKG 2B87B 4ZKPA 1RF0A 3CWBG 3BCCD 1VQMP 3KYQA 3V6IA 1EZVD 1GK6A 2A45G 1FJPA 5C39A 1QVFO 3CXHI 1EDIA 4OGQB 1FZCA 1LT9A 2L91A 1S2EA 2WITA 3CCMP 4IL6X 5AW5B 3O8ZA 4W7YA 1P84I 2WPRA 2YNYA 4PD4D 1RE3A 1JY3O 4H44B 3H1IG 3E7KA 1Y9BA 2FYNC 2E74C 1K73Q 3VMYA 1SVFA 1SFCA 4HJGH 2IBZI 3PLNA 4WY4D 1SQBG 1R5SA 1J2JB 3HD7B
chains in the Genus database with same CATH topology
4W7ZA 3LW5H 1JOCA 3T97A 1N7SC 1YYCA 1RF0C 1VDFA 1S9KE 2R5BA 2XZRA 4GT1A 1EQ7A 2IFMA 2A45I 5APSA 1URQA 2YKQA 2Z5HA 2WPSA 2OYIA 1A02J 1FZCB 1CI6B 1KQLA 1FZCC 5CCGD 1LT9C 3IFMA 5APYA 2PP6A 4WY4A 1LWUA 1IJDB 2P67A 3EFGA 3OAKA 1RE4A 1IC2A 2CPSA 1JCDA 2P1JA 1T8ZA 1T2KC 1LTBC 4DOJA 1E5WA 1RE3C 1NTMK 3P32A 2XKMA 3A5TA 3M91A 1HVVA 1AFOA 1SQXK 3TNUA 4JF7A 1H8AA 2FFDA 1SFCC 5CJ0A 2N1TA 2WSCH 1JTHA 1N2DC 1N7SD 1NWQA 4XE5B 1FOSF 3B5ND 1SQQK 5CCGA 3N4XA 2XNXA 1ZLLA 4ZKUA 1SQVK 2W6BA 2Z5IA 1YTZI 4WBAA 1KFNA 2KSJA 2ZXEB 1RF1A 2IPPA 3VYIA 2LKMA 1FDMA 3TK1A 1CZQA 3KQGA 1URQB 4O9BA 2OYIB 1URQC 4RESB 2OYIC 5CCHD 2M8RA 4XA4A 2M3BA 4WY4B 5KJ7D 1LWUB 1MZ9A 2P2UA 3B5NA 4WY4C 1JNMA 1AQ5A 3KPEA 1LWUC 1IFIA 2Z4EA 1HH0A 1NU1K 1RE4C 3A7OA 2C9NY 3VP8A 3VP9A 2OYHA 1SFCD 2C0XA 2C9LY 4OH8B 3V4QA 2PAJA 2WZ7A 2YMYA 2GUSA 3TNUB 3R2PA 1FBMA 3L35A 3RL0D 2KB7P 3EQ2A 2FFDB 1J1EB 2HPCB 2FFDC 1J1EC 2N1TC 2I1JA 1NHLA 1WRGA 5CCHA 5CCGC 5KJ7A 2MJZA 4N78D 2XU6A 3HE4A 4IFFA 3V2PA 1J1DB 1S9KD 1J1DC 1FJKA 1RF1B 1JCCA 5AVUB 1RF1C 1Z56A 3SWYA 2Q5UA 1L0LK 3L37A 1CSBA 1GW4A 1JY2O 2FXMA 3M0AA 4I1LA 5AVYB 3HE5A 2H8PD 2O1JA 4N78E 3P8CE 1ZV8A 1N7SB 3OA7A 3V2QA 1GU4A 3B5NB 1JY3P 3U59A 3VMXA 3B5NC 5AVWB 4IFMA 3M0DA 1A02F 4N3YB 1HUCA 4IFDK 5AW8B 2OYHC 1NTKK 2E42A 3NXSA 2N1TD 4LLHA 3MUDA 4LGDE 3CI9A 4AUWA 1LT9B 1FZFA 1JMMA 5AVRB 5KTBA 3VN0A 1JY3N 1NTZK 3HUSA 4AQRD 3UIAA 5AVZB 4AYCA 1FAVA 3BATA 3VMZA 5CCHC 3HE4B 2Q3IA 5KJ7C 5AW2B 3TYYA 3BRVB 5APUA 1NAFA 1N73A 1NO4A 1L0NK 2WT7A 1HGVA 3P8MC 5AW7B 1KZUB 1LTJA 1M7LA 3M9HA 1LTAC 3NTNA 5APXA 1SFCB 3A2AA 4EOTA 5AW6B 1IK9A 1GK4A 4C7NB 3MTUE 2KOGA 2XDJA 2BASA 3V4WA 3RL0B 3LIEA 1M1JA 4M3LA 3HE5B 5AVTB 3RL0C 2Q7CA 3BASA 4W80A 1H89A 1YTZT 2IFNA 5BVZA 3VTPC 3H32A 2POHA 3RK2D 2L5GB 1MFZA 2CPBA 3IR9A 1GU5A 1GTWA 3M0DC 3H6PA 3L4FA 1GW3A 1SQBK 2KYVA 3HD7D 5AW0B 5AW4B 5KLVK 1N7LA 2NPSD 1SP4A 1KFMA 1DX7A 1NH4A 2GUVA 1FZGA 3E1IA 3HUSC 1X9VA 1XTCC 3M9BA 4LC1A 3SWFA 1L4AD 3B8EB 1NOHA 1GL2D 4HYTB 3MD0A 4JYCA 2HODA 2VRSA 4Y99C 3G3ZA 2YKOA 5AVSB 1N73B 1DEBA 2WT7B 1ZR4A 1N73C 5CMZA 1LTJB 4JYBA 5AW3B 3HD7A 2YO2A 1LTJC 2H7HA 1RY3A 1IFMA 2N1TB 2O01H 4HH2A 4I6MC 1JTHB 2NPSA 1T3JA 5APTA 1G2CA 3P7KA 1HWTC 2H43A 5APVA 3P8CD 1M1JC 1OWAA 1OXZA 1SLQA 1FOSE 1KILD 3H32B 1L4AA 1GL2A 1MUUA 1CI6A 2I1KA 3M9QA 2QM7A 2XV5A 3M06A 1QL1A 2Q9IA 1ZN5A 1IFJA 3U1AA 1X79B 2FKWB 2JJLA 4WB4A 5APWA 3V5BA 3NFQA 4B86A 2J58A 1G1IA 3CL3D 5AW9B 5AW1B 3TSIA 1KILA 2HODB 3RK2B 2C0WA 4EIJA 3RK2C 2OYHB 1LGHB 1FZAA 3RK3C 2IX7C 3U1CA 2HLOA 1JY2P 2HG5D 2HYNA 3KDPB 2WWWA 3HD7C 3PP5A 1HJBA 2NPSB 2FYUK 2O1KA 3GHGA 1LTIC 2QM8A 2NPSC 1G2CB 3LIDA 1DH3A 2J59M 1NKNA 2W27A 2R3CA 1HBWA 1L4AB 2W6AA 1GL2B 2KLVA 2E43A 1L4AC 1JY2N 5AVVB 1GL2C 2HFED 1LTGC 2ZFCA 1ZR2A 2A45H 2WPQA 2KP8A 1WT6A 3I5CA 5AVQB 3CLQA 3BRTB 1JUNA 1G1JA 4C7RA 3NMDA 1NKZB 1QL2A 3RK3D 1PFIA 1KILB 1SQPK 3L36A 1KILC 2JEEA 3HTKA 3V2RA 2HPCA 1LTSC 2YKPA 2GM4A 3HUSB 3GHGB 1FZEA 2WSFH 3GHGC 3MGNA 5BU8B 1W2EA 3II6A 3OJAB 4Y99B 3VOPA 1T3UA 2YO3A 5CJ4A 1GZLA 1FU1A 1JO5A 2WSEH 3WMM0 1XTGB 5APQA 3A3YB 4C46A 2FYZA 1N7SA 1T2KD 4ZKPA 1FZBA 1IFDA 1RF0A 2R5DA 2R32A 2N9BA 4I2LC 3KYQA 2P7JA 4KHXA 4GIFA 1M1JB 1GK6A 1LTTC 2A45G 1FJPA 1VPCA 1FZCA 1LT9A 1HGZA 5CHXA 2WITA 3HTKB 3MIWA 5AVXB 1GD2E 5AW5B 3O8ZA 2OARA 3BVHA 4W7YA 3C9IA 3HRNA 4GKGA 2WPRA 2YNYA 1RE3A 1GDTA 3V2NA 1IFNA 3N7NA 1CW5A 1JY3O 4N6JA 1X8YA 4DZOA 1H88A 1N86A 1URQD 3VMYA 1SVFA 1SFCA 1HTLC 1IO4A 3RK3B 1MV8A 4C7NA 4WY4D 5BU5A 3HD7B 1J2JB 2WTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY3 N;  1RF0 A;  3HUS A;  1LWU B;  3BVH A;  1M1J A;  1FZG A;  1LWU C;  3GHG A;  2XNX A;  1RE4 A;  2H43 A;  3E1I A;  1RF0 C;  3HUS B;  1JY3 P;  3GHG B;  3HUS C;  1M1J B;  1FZE A;  1RE3 A;  1M1J C;  1JY3 O;  3GHG C;  3H32 A;  2Z4E A;  2A45 G;  1RE4 C;  3H32 B;  2HOD A;  1RE3 C;  1W2E A;  1RF1 A;  1N86 A;  2HOD B;  1N73 A;  2OYH A;  1T3U A;  1RF1 B;  2A45 I;  1JY2 N;  1RF1 C;  1FZC A;  1N73 B;  1LTJ A;  2OYH B;  1LT9 A;  1N73 C;  1FZA A;  2OYI A;  2Q9I A;  2OYH C;  1FZC B;  1LTJ B;  2HLO A;  2FFD A;  2HPC A;  1JY2 P;  1FZC C;  2OYI B;  1LT9 B;  1LTJ C;  1FZF A;  1LT9 C;  2FFD B;  1JY2 O;  2A45 H;  2OYI C;  2HPC B;  2FFD C;  1LWU A;  1FZB A; 
#chains in the Genus database with same CATH topology
 2WSF J;  4W7Z A;  3LW5 H;  1BCC G;  1S9K E;  4GT1 A;  3TGU J;  3QWO C;  2IFM A;  3H1J J;  1BDC A;  2RN0 A;  2OYI A;  1FZC B;  3TGU D;  2RKL A;  3H1J D;  5CCG D;  2PP6 A;  3L71 J;  1LWU A;  4U7J A;  1NGM B;  2KXP B;  2JDI H;  2WMM A;  1SQX E;  1IC2 A;  3L71 D;  1LTB C;  1E5W A;  3JCU E;  3RGU A;  3TNU A;  1SQV E;  4JF7 A;  3Q1M A;  1H8A A;  1LP1 A;  1JTH A;  1SQQ K;  3N4X A;  3R4Y A;  4EDF A;  2QJP B;  4ZKU A;  2O3J A;  5GTH H;  5KAF H;  1PGQ A;  1BSH A;  3CXH D;  1CZQ A;  5H2F H;  3KQG A;  3AEA C;  2OYI B;  3LW5 J;  4XA4 A;  1LWU B;  3KPE A;  3G71 P;  1IFI A;  1P84 D;  2Z4E A;  1NU1 K;  3A7O A;  2G3A A;  1Q81 Q;  1VQ5 P;  3ITK A;  4GDO A;  1BE3 E;  2WZ7 A;  3TNU B;  3R2P A;  3RL0 D;  2KB7 P;  2IBZ D;  3EQ2 A;  1J1E B;  2E76 C;  2HPC B;  3FXD A;  2N1T C;  3IN6 A;  3KZI H;  2MJZ A;  2XU6 A;  3HE4 A;  1KQG B;  1PGO A;  2E75 C;  1J1D C;  5DJU B;  3S4R A;  2ZVO B;  1JCC A;  5AVU B;  1Z56 A;  3AED C;  1L0L K;  1CSB A;  1BDD A;  1SQX G;  4NPE A;  1JY2 O;  2AXT E;  3M0A A;  5AVY B;  3FGA D;  1ZV8 A;  3OA7 A;  3V2Q A;  1GU4 A;  2RMZ A;  3U59 A;  1W5C E;  3M0D A;  4N3Y B;  4PJ0 E;  3AE5 C;  4LLH A;  4D6T J;  4LGD E;  3CC2 P;  3CI9 A;  1DEE G;  4AUW A;  3Q5P A;  1KYO E;  2ZAE B;  4D6T D;  5AVZ B;  4AYC A;  1SS1 A;  1FAV A;  4K35 A;  2BCC D;  3VMZ A;  3HE4 B;  3G9R A;  3BRV B;  5APU A;  1N73 A;  1L0N K;  3H1K E;  2PFX A;  1LTJ A;  3K5B A;  2D2C C;  3GMA A;  4GOE A;  1GK4 A;  5KLI B;  2KOG A;  2K37 A;  2BAS A;  3V4W A;  1VQN P;  2Q7C A;  3G6E P;  4W80 A;  2AEF A;  1VQL P;  1PGP A;  4H0L C;  2CPB A;  2W6J H;  1GTW A;  3L73 E;  3L4F A;  3HD7 D;  3C1L A;  5KLV K;  1X22 A;  2NPS D;  1FZG A;  5TIS H;  3AE2 C;  1XTC C;  4LC1 A;  1KB9 D;  4L75 A;  4Y99 C;  3WU2 H;  2YKO A;  2QJK C;  1N73 B;  1ZR4 A;  1KMI Z;  1LTJ B;  1S5L H;  1YJN P;  1LNQ A;  1M57 D;  2N1T B;  4I6M C;  2JR8 A;  1T3J A;  3AE4 C;  1UIX A;  3A0H E;  3P7K A;  1HWT C;  1NTK J;  1NYH A;  3CMA P;  1M1J C;  3CWB J;  1OWA A;  2E75 B;  3JC2 2;  3S9O A;  3Q2Y A;  1NTK D;  5M1B A;  1L4A A;  1VQ6 P;  3GF3 A;  3CWB D;  1CI6 A;  3M9Q A;  2Y0C A;  1IFJ A;  2FKW B;  4WB4 A;  2QG4 A;  3L75 E;  3H1K G;  3RBZ A;  5AW9 B;  3JSV C;  1KIL A;  4PV1 B;  3H1I J;  4EIJ A;  3U1C A;  2IX7 C;  4IL6 H;  3H1I D;  2LXB A;  1SQB J;  1HJB A;  3GHG A;  1LTI C;  2J59 M;  1SQB D;  1OMI A;  1JMB A;  1BCC J;  2R3C A;  1HBW A;  1L4A B;  5AVV B;  3CCU P;  1BCC D;  1LTG C;  2ZFC A;  3CCJ P;  1YIT P;  5GTH E;  2E74 D;  5AVQ B;  1S3J A;  1JUN A;  2Q1K A;  1K8A Q;  1RH5 B;  1YI2 P;  1KIL B;  1RHZ B;  2JEE A;  4UB6 H;  1HJ0 A;  2MKV A;  1Q2N A;  4WWI A;  2IDB A;  3GHG B;  3MGN A;  4HKZ H;  2IBZ G;  3OJA B;  4Y99 B;  3AE9 C;  5CJ4 A;  1JO5 A;  3GG2 A;  5E79 H;  1USE A;  2V4H A;  2K9J B;  4ASW A;  3A3Y B;  2FYZ A;  1ZW0 A;  1DD3 A;  4R4M A;  1FZB A;  1YBK A;  2R5D A;  4I2L C;  4U3F E;  4XFJ A;  4GIF A;  1IFP A;  1M1J B;  1LTT C;  4YXD C;  2YXR B;  2FYU J;  1OW7 A;  1Q90 D;  4OGQ C;  3O6Q B;  5CHX A;  1NJI Q;  3MIW A;  5AVX B;  2N9Y B;  2OAR A;  1IK7 A;  3C9I A;  3HRN A;  3V2N A;  1IFN A;  3N7N A;  4N6J A;  2YXQ B;  1X8Y A;  4DZO A;  4H44 C;  2E5T A;  2QVA A;  2WSC J;  1IO4 A;  3SSU A;  1MV8 A;  2BCC G;  2WTY A;  4DT0 A;  1SQX J;  1SQP J;  1JOC A;  3T97 A;  1YYC A;  1RF0 C;  2R5B A;  1SQX D;  2RH0 A;  1PPJ G;  1EQ7 A;  2E76 D;  5APS A;  1URQ A;  2YKQ A;  1A02 J;  1FZC C;  2K9Y A;  1KYO I;  1LT9 C;  5APY A;  3GW6 A;  3RL0 g;  3AEC C;  1GMJ A;  2P67 A;  4QMA A;  1RE4 A;  1VQ8 P;  1JCD A;  4PD4 H;  1T2K C;  1OVV A;  2JKV A;  1RE3 C;  1NTM K;  1SQQ E;  3P32 A;  2XKM A;  2W8Z A;  3A5T A;  5DJT B;  2FFD A;  1SFC C;  4RJT A;  1N7S D;  3CCE P;  4XE5 B;  2QJP C;  1PV3 A;  3T97 B;  2W6B A;  2Z5I A;  1VF5 D;  3WU2 E;  1YTZ I;  2OGU A;  3IF4 A;  3AEB C;  2ZXE B;  2Y0E A;  1RF1 A;  2IPP A;  1S5L E;  2AEJ A;  1ZXG A;  1URQ B;  4L73 A;  1NU1 E;  2OYI C;  3BCC J;  2M8R A;  2M3B A;  1WMK A;  1MZ9 A;  3B5N A;  1JNM A;  1LWU C;  3L74 G;  2QA4 P;  1VQ4 P;  2C9N Y;  1W2B O;  1BGY E;  2D2C D;  1FBM A;  1RQU A;  3B71 A;  4TT3 H;  2FFD B;  1J1E C;  4H0L D;  3G4S P;  3W68 A;  1EDJ A;  5CCH A;  2P58 A;  5KJ7 A;  1L0L E;  4L74 A;  3D71 A;  1RF1 B;  4IL6 E;  1AVY A;  3SWY A;  2Q5U A;  3CXH H;  3L37 A;  1GW4 A;  1BSN A;  4I1L A;  2Q3E A;  1JB0 J;  2O1J A;  4N78 E;  2ZXX A;  3KXD A;  3B5N B;  1JY3 P;  3VMX A;  3FWL A;  3GF7 A;  1A02 F;  1P84 H;  2IYO A;  4RKU J;  3H1K J;  4JQ0 D;  2FBW C;  2YIU B;  1OIP A;  2E42 A;  1NTK K;  3H1K D;  3WUU A;  2IZ0 A;  1LT9 B;  1AJY A;  5KTB A;  1EXJ A;  1L0N E;  1NTZ K;  3H1H E;  1N8R Q;  3BAT A;  2Q3I A;  5AW2 B;  2ZT9 D;  1NO4 A;  1YQ3 C;  1VQP P;  2A06 E;  3L73 D;  5APX A;  2O01 J;  2PRR A;  1SFC B;  4UB6 E;  3Q3D A;  1JM0 A;  5KLI C;  4M3L A;  3SFD C;  1YHQ P;  5K5G B;  2POH A;  3H32 A;  5KLV E;  2L5G B;  1MFZ A;  1VQ9 P;  3M0D C;  1KC8 Q;  5E79 E;  1SQB K;  2KYV A;  4UB8 H;  3L72 E;  4Y28 J;  1L0L G;  1KFM A;  1NH4 A;  3CX5 I;  5KAI H;  3RK3 E;  3SWF A;  4HYT B;  3MD0 A;  4JYC A;  2HOD A;  1U57 A;  3G3Z A;  1N73 C;  5CMZ A;  4JYB A;  1LTJ C;  3RBX A;  1LP1 B;  4HH2 A;  1JTH B;  5APT A;  5APV A;  3P8C D;  1SLQ A;  3MHV A;  3H32 B;  1GL2 A;  1MFT A;  2I1K A;  1FDO A;  1L0N G;  1QL1 A;  1ZN5 A;  3EWK A;  3U1A A;  2WSS H;  1X79 B;  3V5B A;  2K88 A;  2K1A A;  2J58 A;  1KIL E;  2A06 G;  2Y0D A;  1KB9 H;  1SQV G;  3H1L E;  1M56 D;  2HOD B;  3RK2 B;  4PV1 C;  3RK3 C;  2KUB A;  1JY2 P;  2HG5 D;  2BCC J;  2WVR A;  2FYU K;  4OVN F;  2PGD A;  1DH3 A;  4ZNC A;  1HF9 A;  4OGQ D;  1NKN A;  2W27 A;  1GL2 B;  2KLV A;  2E43 A;  1L4A C;  1ZR2 A;  2IYP A;  4H13 C;  2A45 H;  1PPJ D;  2JWA A;  4H44 D;  1OVR A;  5B66 H;  3Q5S A;  3CX5 D;  1BE3 G;  3NMD A;  1QL2 A;  4OWF A;  1U7J A;  2FXP A;  3TGU E;  1SQP K;  3I56 P;  3H1J E;  3L36 A;  1KIL C;  4L76 A;  3HTK A;  1FE6 A;  2AXC A;  1QVG O;  1LTS C;  2YKP A;  5EFW B;  1EXI A;  2HR3 A;  1ZRT E;  3L71 E;  5B5E H;  1FS0 E;  3D70 A;  2XND H;  1FZE A;  4U3F D;  3GHG C;  1T3U A;  2R44 A;  4C46 A;  3OW2 O;  1TU3 F;  2JO1 A;  1N7S A;  1T2K D;  2QE7 H;  1IFD A;  2R32 A;  2N9B A;  3H1L G;  2P7J A;  4KHX A;  4RO0 A;  2ZYA A;  3L74 J;  1HGZ A;  3L74 D;  3WUT A;  3HTK B;  1NAY A;  2KSE A;  1VQ7 P;  1GD2 E;  1P84 E;  3A0B H;  1OFC X;  1H88 A;  2M3E A;  1N86 A;  1S4X A;  3RK3 B;  4C7N A;  3AEE C;  2I8D A;  2H89 C;  3L73 G;  2XZR A;  1SQQ D;  2WPS A;  2V7Q J;  4H13 B;  1CI6 B;  4GOF A;  4WY4 A;  1NTM E;  1EC5 A;  2ZYD A;  1IJD B;  3AE1 C;  2QSI A;  3EFG A;  3OAK A;  2Y9Z A;  5KAF E;  2CPS A;  1DIP A;  1T8Z A;  4DOJ A;  1QLE D;  1VL2 A;  4UB8 E;  5H2F E;  1AFO A;  1VQK P;  2WSC H;  1N2D C;  1FOS F;  1NU1 D;  5CCG A;  3Q5R A;  2XNX A;  1KFN A;  2LKM A;  1FDM A;  3D6Y A;  3TK1 A;  3AE7 C;  3L75 G;  3JCU H;  1KQS O;  1URQ C;  3KZI E;  1H0T A;  4WY4 B;  1L2P A;  1AQ5 A;  3CCR P;  1HH0 A;  2KNC A;  1L0L D;  1RE4 C;  3VP8 A;  2OYH A;  2C0X A;  2B88 A;  2H88 C;  3V4Q A;  1QGK B;  1KQF B;  2FFD C;  1OW6 A;  1KB9 E;  4N78 D;  2DW3 A;  4IFF A;  4MN4 C;  3V2P A;  1S9K D;  3PTZ A;  1OVU A;  1RF1 C;  1NTM G;  1E79 H;  2ZYG A;  2M0B A;  1H0T B;  1KOR A;  3HE5 A;  2IZ1 A;  1L0N D;  1NTK E;  2KZI A;  3B5N C;  4IFM A;  1HUC A;  2KNC B;  4IFD K;  4ASV A;  1NTZ E;  1M1K Q;  1SQV J;  2A06 D;  2N1T D;  2YIU C;  3MUD A;  1FZF A;  1JMM A;  1Q86 Q;  2QRX A;  1SQV D;  5B66 E;  3CC7 P;  1Y47 A;  3IAO A;  3HUS A;  2E75 D;  4AQR D;  2YMK A;  5CCH C;  3FX0 A;  5KJ7 C;  5KLV D;  1NAF A;  5GTI H;  1M90 Q;  1KZU B;  1LTA C;  3L70 E;  4EOT A;  1AV1 A;  5AW6 B;  5B5E E;  1IK9 A;  4U3F G;  1KTM A;  5TIS E;  3RL0 B;  3LIE A;  2R3S A;  3HE5 B;  5AVT B;  1SQB E;  5BVZ A;  3VTP C;  4PV1 D;  1GU5 A;  3D6Z A;  1BCC E;  1BE3 J;  5AW0 B;  3CCL P;  5AW4 B;  1BE3 D;  1N7L A;  2B9B A;  1SP4 A;  1PP9 E;  2UWJ E;  3E1I A;  3M9B A;  1L4A D;  3B8E B;  1NOH A;  3CPW O;  2LR2 A;  2QJY B;  2VRS A;  4KJM A;  2OTJ P;  1Y8A A;  3AE3 C;  2NRG A;  5AW3 B;  3HD7 A;  1RY3 A;  1IFM A;  2O01 H;  3A0B E;  4YPC A;  2NPS A;  1NTZ G;  1KV4 A;  1OXZ A;  1QEX A;  2SPZ A;  1KIL D;  3H1L J;  1MUU A;  3H1L D;  2QM7 A;  2XV5 A;  4EYY Q;  2Q9I A;  1PGJ A;  5APW A;  1KYO D;  3C8V A;  1SQQ G;  2KLU A;  3A0H H;  3L70 G;  1LT1 A;  5AW1 B;  2C0W A;  1S72 P;  3RK2 C;  2FYU E;  1LGH B;  1FZA A;  2HLO A;  1K04 A;  2J5U A;  3FXE A;  2NPS B;  1NVO A;  2QM8 A;  3W67 A;  1ZOY C;  3LID A;  5KKZ B;  1UII A;  2KS1 A;  3L73 J;  2WSE J;  1Q82 Q;  1NU1 G;  2W6A A;  3F89 A;  1GL2 C;  4BRY A;  1PP9 G;  5CBN A;  3CC4 P;  1WT6 A;  1ZRT D;  1SQP E;  1BGY G;  3I5C A;  3MZW B;  2P10 A;  3TF5 A;  3TDK A;  2KZJ A;  4C7R A;  1YIJ P;  1U7M A;  1PFI A;  2K3R A;  1EDL A;  2HPC A;  1PIX A;  4BWN A;  3VMA A;  5TJH A;  1Q7Y Q;  3AE8 C;  3E1R A;  1W2E A;  3II6 A;  3VOP A;  3CCV P;  2KS1 B;  2YO3 A;  1GZL A;  4EI2 A;  1FU1 A;  1USD A;  4BRY B;  1XTG B;  3L75 J;  4JBZ A;  3L75 D;  2FYU G;  3CX5 H;  4I7Z C;  1VPC A;  3SWK A;  3PHL A;  3H1H G;  3BCC E;  3BVH A;  1KB9 I;  1EZV E;  4GKG A;  4ZMD A;  1CW5 A;  1GDT A;  1DD4 A;  2FYN B;  2E74 B;  1X0T A;  1URQ D;  1HTL C;  4R4L A;  1SQP G;  4Z1M H;  1YJW P;  1NTM J;  5BU5 A;  1KD1 Q;  2KIK A;  5KLV G;  1NTM D;  4PD4 E;  1N7S C;  1VDF A;  5GTI E;  1ZME C;  1R5L A;  3L72 G;  1VF5 C;  2A45 I;  3S1K A;  2Z5H A;  1KQL A;  3CCQ P;  1T6A A;  3IFM A;  1ZP0 C;  1FC2 C;  2OTK E;  2P1J A;  2ZVN B;  3I55 P;  3M91 A;  1HVV A;  1OX3 A;  1SQX K;  1AVO A;  5CJ0 A;  2N1T A;  3PJS K;  1NWQ A;  3B5N D;  4U3F J;  2AEM A;  2JWD A;  1PZQ A;  1ZLL A;  1SQV K;  4WBA A;  2KSJ A;  2B89 A;  3VYI A;  3BCC G;  4O9B A;  4JPZ B;  1EZV G;  4RES B;  5CCH D;  1LJ2 A;  2V7Q H;  5KJ7 D;  2P2U A;  4WY4 C;  2WQY C;  3ZDM A;  2Y9Y A;  4I7Z B;  3VP9 A;  3CXH E;  1SFC D;  2C9L Y;  4OH8 B;  2PAJ A;  2YMY A;  2GUS A;  4HB1 A;  3L35 A;  2E76 B;  1NHL A;  2I1J A;  1WRG A;  5CCG C;  4K3A A;  2JP3 A;  3F5H A;  3FWN A;  4DJG A;  2M5A A;  3MP7 B;  1RQV A;  1J1D B;  3AEG C;  2BEZ F;  3EFF K;  1NTZ J;  1FJK A;  3KHU A;  2ZT9 C;  1NTZ D;  2IBZ E;  2FXM A;  2OQQ A;  2H8P D;  3P8C E;  1N7S B;  3TGU G;  5AVW B;  3H1J G;  2O01 N;  1OZH A;  2GA1 A;  1SQQ J;  1R8E A;  1VF5 B;  5AW8 B;  3L70 J;  2OYH C;  2Q6Q A;  3L71 G;  3NXS A;  3L70 D;  5AVR B;  3VN0 A;  1JY3 N;  3UIA A;  2ITA A;  3PH0 A;  4TLF A;  2BEQ D;  1K05 A;  4IOI H;  2M5A B;  3TYY A;  2G8Y A;  2WT7 A;  1HGV A;  3P8M C;  5AW7 B;  1YQ4 C;  3M9H A;  1M7L A;  3NTN A;  1YJ9 P;  2D2C B;  2K9J A;  3A2A A;  1IZN B;  1NU1 J;  4D6T E;  4C7N B;  3CME P;  3MTU E;  5KAI E;  1PP9 J;  2XDJ A;  4CPG A;  4KT0 J;  1M1J A;  2BCC E;  3RL0 C;  1PP9 D;  3BAS A;  1H89 A;  1YTZ T;  2IFN A;  3RK2 D;  4H0L B;  1BGY J;  3IR9 A;  3O6Q A;  3H6P A;  1GW3 A;  3SFE C;  1BGY D;  1PPJ E;  5L8R J;  3GLM A;  2W90 A;  3MUD C;  1DX7 A;  2GUV A;  3CX5 E;  1PL5 A;  1L0L J;  3HUS C;  1X9V A;  3USS A;  1GL2 D;  2QJY C;  3AE6 C;  1JEK A;  1FDI A;  2QJK B;  5AVS B;  1DEB A;  1MKM A;  1S1C X;  2WT7 B;  2YO2 A;  2H7H A;  2NZ2 A;  2E5Y A;  1G2C A;  2H43 A;  1FOS E;  2WPV B;  3B4S A;  2KK7 A;  4BXL A;  2ZT9 B;  3M06 A;  1OW8 A;  2FYU D;  2JJL A;  3QH9 A;  3WUV A;  2LXC B;  1L0N J;  2OYO A;  3NFQ A;  4B86 A;  3H1H J;  2KI7 B;  1EZV I;  2FY8 A;  1G1I A;  3CL3 D;  3H1H D;  1AQT A;  4YXW H;  1EDK A;  3CWB E;  3TSI A;  4D6T G;  3ABV C;  3L74 E;  2OYH B;  2FXO A;  4WVZ A;  1VQO P;  2HYN A;  3KDP B;  2WWW A;  2OTL P;  3HD7 C;  3PP5 A;  3H25 A;  4PD4 I;  2QEX P;  2O1K A;  2AXT H;  5CBO A;  2NPS C;  1G2C B;  5KLV J;  1QX8 A;  1SQP D;  5KKZ C;  4DCK A;  1JY2 N;  3AEF C;  4PJ0 H;  3L72 J;  2HFE D;  3H1I E;  2B87 A;  2ZJS E;  1AA0 A;  3L72 D;  2WPQ A;  2KP8 A;  1K9M Q;  1KYO H;  1D7M A;  4YTP C;  3CLQ A;  4NPF X;  3BRT B;  3PRJ A;  1G1J A;  1M8O B;  1NKZ B;  4A7P A;  3RK3 D;  3CCS P;  4NPD A;  3V2R A;  1S5L X;  2GM4 A;  2QIW A;  2CK3 H;  3HUS B;  2WSF H;  4GOD A;  5BU8 B;  4H13 D;  2W83 C;  3CD6 P;  1KN7 A;  2WSE H;  3WMM 0;  5APQ A;  1NTK G;  2B87 B;  4ZKP A;  1RF0 A;  3CWB G;  3BCC D;  1VQM P;  3KYQ A;  3V6I A;  1EZV D;  1GK6 A;  2A45 G;  1FJP A;  5C39 A;  1QVF O;  3CXH I;  1EDI A;  4OGQ B;  1FZC A;  1LT9 A;  2L91 A;  1S2E A;  2WIT A;  3CCM P;  4IL6 X;  5AW5 B;  3O8Z A;  4W7Y A;  1P84 I;  2WPR A;  2YNY A;  4PD4 D;  1RE3 A;  1JY3 O;  4H44 B;  3H1I G;  3E7K A;  1Y9B A;  2FYN C;  2E74 C;  1K73 Q;  3VMY A;  1SVF A;  1SFC A;  4HJG H;  2IBZ I;  3PLN A;  4WY4 D;  1SQB G;  1R5S A;  1J2J B;  3HD7 B; 
#chains in the Genus database with same CATH homology
 4W7Z A;  3LW5 H;  1JOC A;  3T97 A;  1N7S C;  1YYC A;  1RF0 C;  1VDF A;  1S9K E;  2R5B A;  2XZR A;  4GT1 A;  1EQ7 A;  2IFM A;  2A45 I;  5APS A;  1URQ A;  2YKQ A;  2Z5H A;  2WPS A;  2OYI A;  1A02 J;  1FZC B;  1CI6 B;  1KQL A;  1FZC C;  5CCG D;  1LT9 C;  3IFM A;  5APY A;  2PP6 A;  4WY4 A;  1LWU A;  1IJD B;  2P67 A;  3EFG A;  3OAK A;  1RE4 A;  1IC2 A;  2CPS A;  1JCD A;  2P1J A;  1T8Z A;  1T2K C;  1LTB C;  4DOJ A;  1E5W A;  1RE3 C;  1NTM K;  3P32 A;  2XKM A;  3A5T A;  3M91 A;  1HVV A;  1AFO A;  1SQX K;  3TNU A;  4JF7 A;  1H8A A;  2FFD A;  1SFC C;  5CJ0 A;  2N1T A;  2WSC H;  1JTH A;  1N2D C;  1N7S D;  1NWQ A;  4XE5 B;  1FOS F;  3B5N D;  1SQQ K;  5CCG A;  3N4X A;  2XNX A;  1ZLL A;  4ZKU A;  1SQV K;  2W6B A;  2Z5I A;  1YTZ I;  4WBA A;  1KFN A;  2KSJ A;  2ZXE B;  1RF1 A;  2IPP A;  3VYI A;  2LKM A;  1FDM A;  3TK1 A;  1CZQ A;  3KQG A;  1URQ B;  4O9B A;  2OYI B;  1URQ C;  4RES B;  2OYI C;  5CCH D;  2M8R A;  4XA4 A;  2M3B A;  4WY4 B;  5KJ7 D;  1LWU B;  1MZ9 A;  2P2U A;  3B5N A;  4WY4 C;  1JNM A;  1AQ5 A;  3KPE A;  1LWU C;  1IFI A;  2Z4E A;  1HH0 A;  1NU1 K;  1RE4 C;  3A7O A;  2C9N Y;  3VP8 A;  3VP9 A;  2OYH A;  1SFC D;  2C0X A;  2C9L Y;  4OH8 B;  3V4Q A;  2PAJ A;  2WZ7 A;  2YMY A;  2GUS A;  3TNU B;  3R2P A;  1FBM A;  3L35 A;  3RL0 D;  2KB7 P;  3EQ2 A;  2FFD B;  1J1E B;  2HPC B;  2FFD C;  1J1E C;  2N1T C;  2I1J A;  1NHL A;  1WRG A;  5CCH A;  5CCG C;  5KJ7 A;  2MJZ A;  4N78 D;  2XU6 A;  3HE4 A;  4IFF A;  3V2P A;  1J1D B;  1S9K D;  1J1D C;  1FJK A;  1RF1 B;  1JCC A;  5AVU B;  1RF1 C;  1Z56 A;  3SWY A;  2Q5U A;  1L0L K;  3L37 A;  1CSB A;  1GW4 A;  1JY2 O;  2FXM A;  3M0A A;  4I1L A;  5AVY B;  3HE5 A;  2H8P D;  2O1J A;  4N78 E;  3P8C E;  1ZV8 A;  1N7S B;  3OA7 A;  3V2Q A;  1GU4 A;  3B5N B;  1JY3 P;  3U59 A;  3VMX A;  3B5N C;  5AVW B;  4IFM A;  3M0D A;  1A02 F;  4N3Y B;  1HUC A;  4IFD K;  5AW8 B;  2OYH C;  1NTK K;  2E42 A;  3NXS A;  2N1T D;  4LLH A;  3MUD A;  4LGD E;  3CI9 A;  4AUW A;  1LT9 B;  1FZF A;  1JMM A;  5AVR B;  5KTB A;  3VN0 A;  1JY3 N;  1NTZ K;  3HUS A;  4AQR D;  3UIA A;  5AVZ B;  4AYC A;  1FAV A;  3BAT A;  3VMZ A;  5CCH C;  3HE4 B;  2Q3I A;  5KJ7 C;  5AW2 B;  3TYY A;  3BRV B;  5APU A;  1NAF A;  1N73 A;  1NO4 A;  1L0N K;  2WT7 A;  1HGV A;  3P8M C;  5AW7 B;  1KZU B;  1LTJ A;  1M7L A;  3M9H A;  1LTA C;  3NTN A;  5APX A;  1SFC B;  3A2A A;  4EOT A;  5AW6 B;  1IK9 A;  1GK4 A;  4C7N B;  3MTU E;  2KOG A;  2XDJ A;  2BAS A;  3V4W A;  3RL0 B;  3LIE A;  1M1J A;  4M3L A;  3HE5 B;  5AVT B;  3RL0 C;  2Q7C A;  3BAS A;  4W80 A;  1H89 A;  1YTZ T;  2IFN A;  5BVZ A;  3VTP C;  3H32 A;  2POH A;  3RK2 D;  2L5G B;  1MFZ A;  2CPB A;  3IR9 A;  1GU5 A;  1GTW A;  3M0D C;  3H6P A;  3L4F A;  1GW3 A;  1SQB K;  2KYV A;  3HD7 D;  5AW0 B;  5AW4 B;  5KLV K;  1N7L A;  2NPS D;  1SP4 A;  1KFM A;  1DX7 A;  1NH4 A;  2GUV A;  1FZG A;  3E1I A;  3HUS C;  1X9V A;  1XTC C;  3M9B A;  4LC1 A;  3SWF A;  1L4A D;  3B8E B;  1NOH A;  1GL2 D;  4HYT B;  3MD0 A;  4JYC A;  2HOD A;  2VRS A;  4Y99 C;  3G3Z A;  2YKO A;  5AVS B;  1N73 B;  1DEB A;  2WT7 B;  1ZR4 A;  1N73 C;  5CMZ A;  1LTJ B;  4JYB A;  5AW3 B;  3HD7 A;  2YO2 A;  1LTJ C;  2H7H A;  1RY3 A;  1IFM A;  2N1T B;  2O01 H;  4HH2 A;  4I6M C;  1JTH B;  2NPS A;  1T3J A;  5APT A;  1G2C A;  3P7K A;  1HWT C;  2H43 A;  5APV A;  3P8C D;  1M1J C;  1OWA A;  1OXZ A;  1SLQ A;  1FOS E;  1KIL D;  3H32 B;  1L4A A;  1GL2 A;  1MUU A;  1CI6 A;  2I1K A;  3M9Q A;  2QM7 A;  2XV5 A;  3M06 A;  1QL1 A;  2Q9I A;  1ZN5 A;  1IFJ A;  3U1A A;  1X79 B;  2FKW B;  2JJL A;  4WB4 A;  5APW A;  3V5B A;  3NFQ A;  4B86 A;  2J58 A;  1G1I A;  3CL3 D;  5AW9 B;  5AW1 B;  3TSI A;  1KIL A;  2HOD B;  3RK2 B;  2C0W A;  4EIJ A;  3RK2 C;  2OYH B;  1LGH B;  1FZA A;  3RK3 C;  2IX7 C;  3U1C A;  2HLO A;  1JY2 P;  2HG5 D;  2HYN A;  3KDP B;  2WWW A;  3HD7 C;  3PP5 A;  1HJB A;  2NPS B;  2FYU K;  2O1K A;  3GHG A;  1LTI C;  2QM8 A;  2NPS C;  1G2C B;  3LID A;  1DH3 A;  2J59 M;  1NKN A;  2W27 A;  2R3C A;  1HBW A;  1L4A B;  2W6A A;  1GL2 B;  2KLV A;  2E43 A;  1L4A C;  1JY2 N;  5AVV B;  1GL2 C;  2HFE D;  1LTG C;  2ZFC A;  1ZR2 A;  2A45 H;  2WPQ A;  2KP8 A;  1WT6 A;  3I5C A;  5AVQ B;  3CLQ A;  3BRT B;  1JUN A;  1G1J A;  4C7R A;  3NMD A;  1NKZ B;  1QL2 A;  3RK3 D;  1PFI A;  1KIL B;  1SQP K;  3L36 A;  1KIL C;  2JEE A;  3HTK A;  3V2R A;  2HPC A;  1LTS C;  2YKP A;  2GM4 A;  3HUS B;  3GHG B;  1FZE A;  2WSF H;  3GHG C;  3MGN A;  5BU8 B;  1W2E A;  3II6 A;  3OJA B;  4Y99 B;  3VOP A;  1T3U A;  2YO3 A;  5CJ4 A;  1GZL A;  1FU1 A;  1JO5 A;  2WSE H;  3WMM 0;  1XTG B;  5APQ A;  3A3Y B;  4C46 A;  2FYZ A;  1N7S A;  1T2K D;  4ZKP A;  1FZB A;  1IFD A;  1RF0 A;  2R5D A;  2R32 A;  2N9B A;  4I2L C;  3KYQ A;  2P7J A;  4KHX A;  4GIF A;  1M1J B;  1GK6 A;  1LTT C;  2A45 G;  1FJP A;  1VPC A;  1FZC A;  1LT9 A;  1HGZ A;  5CHX A;  2WIT A;  3HTK B;  3MIW A;  5AVX B;  1GD2 E;  5AW5 B;  3O8Z A;  2OAR A;  3BVH A;  4W7Y A;  3C9I A;  3HRN A;  4GKG A;  2WPR A;  2YNY A;  1RE3 A;  1GDT A;  3V2N A;  1IFN A;  3N7N A;  1CW5 A;  1JY3 O;  4N6J A;  1X8Y A;  4DZO A;  1H88 A;  1N86 A;  1URQ D;  3VMY A;  1SVF A;  1SFC A;  1HTL C;  1IO4 A;  3RK3 B;  1MV8 A;  4C7N A;  4WY4 D;  5BU5 A;  3HD7 B;  1J2J B;  2WTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...