3L73J

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 23
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3l73J00
3H1LJ 4U3FJ 1NTZJ 3L74J 3L71J 1NTMJ 3BCCJ 1PP9J 1L0NJ 1SQQJ 3L75J 1P84I 3CXHI 2FYUJ 2BCCJ 3H1KJ 1KYOI 1BGYJ 1SQVJ 1NTKJ 3TGUJ 3H1JJ 1L0LJ 3H1HJ 3L73J 1KB9I 1BCCJ 3CX5I 3L70J 3H1IJ 3CWBJ 1BE3J 1EZVI 5KLVJ 1SQXJ 4D6TJ 2IBZI 1NU1J 1SQBJ 1SQPJ 3L72J 4PD4I
chains in the Genus database with same CATH superfamily
3B71A 4EOTA 4CPGA 1BE3E 1NJIQ 3FGAD 3A0HH 4ASVA 4K35A 3I56P 2ZVOB 4D6TD 1NOHA 3AE7C 4GKGA 1PP9G 1NU1J 4OGQD 3P7KA 3L72J 1OW6A 2KLVA 2P10A 2IZ1A 2QG4A 3LIEA 1P84I 1T3JA 1PGQA 1L4AD 3H1ID 2ZT9C 1OW8A 3E1RA 1JY3N 5TISE 2HPCA 1N73B 4XE5B 3ZDMA 4GOFA 2AEMA 4I7ZB 1NYHA 3MTUE 1KN7A 2QVAA 4U3FJ 3M0AA 1YJWP 2JR8A 3RK2C 1SQVD 4H13D 1L4AB 1FJKA 2Q6QA 3Q1MA 5KJ7D 1RE3C 1FS0E 1M1JA 1NTKK 1SFCD 3MHVA 1NTMD 3CI9A 1FZCC 1RF0C 1YYCA 1PIXA 2JWDA 1JCCA 2N1TA 4H13B 2ZT9D 1T2KC 3OAKA 5CCGC 3CXHE 3L74E 2OYIB 1P84H 2R5DA 5KLVJ 1SFCB 2XZRA 3HTKA 3KQGA 2ZXEB 1LT9C 1LTIC 2VRSA 5GTHE 2QJPC 2IPPA 3CCSP 1YTZI 4L76A 1LT1A 4HKZH 2H7HA 3AE3C 2Q3IA 4C46A 1HWTC 2FYUE 1KB9E 2D2CD 2M8RA 1GL2C 4GDOA 1NKNA 3VYIA 2P58A 1ZLLA 4PJ0E 5CCGD 2Q9IA 2NRGA 2YNYA 3SWYA 1D7MA 4H44C 4D6TG 1SQQJ 3HE4A 1Q7YQ 1KD1Q 3AEDC 2I1JA 1PP9E 1H88A 1LTTC 2D2CB 1EDKA 1PGPA 1NTZD 5KAFH 1J1DC 1KFMA 4M3LA 1DIPA 3JSVC 1HBWA 3T97B 4MN4C 1YQ3C 4WB4A 2ZJSE 1FZFA 2FY8A 2B87B 1YI2P 2RKLA 3K5BA 1UIXA 1GL2D 2OTKE 2XV5A 2K3RA 1SQVG 3TF5A 1K8AQ 4H44D 2HG5D 1OFCX 2KS1B 1AQ5A 1H0TB 3QWOC 3F5HA 1NTMG 1LTGC 1SQBD 4Y99B 1QLED 2KUBA 2WWWA 1X8YA 2KYVA 1RQVA 1W2EA 1MKMA 3HUSB 4WY4D 3VP8A 3KXDA 3PHLA 2NZ2A 2N1TC 1OWAA 2LKMA 1HTLC 1S3JA 2R32A 2O01J 2WSCH 4I6MC 3C8VA 2PFXA 3USSA 3D6ZA 3EWKA 4WY4B 4TLFA 1JY2N 2Q7CA 2BCCJ 1YJNP 2IFNA 3L4FA 1CI6B 2Q5UA 4Y28J 1FZBA 3H1JJ 2BASA 4A7PA 5AW5B 3MZWB 3H1IJ 3RK3D 1LTSC 3B4SA 3H1LD 2KZIA 4GODA 3SWKA 5M1BA 3BRVB 4B86A 3BVHA 5C39A 4IFDK 2N1TD 4D6TE 1PL5A 2Q3EA 3GF7A 5KKZB 1HGVA 2QJYC 1SS1A 1SQXD 4JYBA 3AECC 3CWBJ 3RK3B 4OVNF 2H43A 3S1KA 1U7JA 1LWUA 1NTMJ 2JDIH 3TGUD 4HB1A 1GZLA 4IL6E 1KV4A 1DD4A 4PD4D 1VQLP 2SPZA 3RGUA 2K9JB 2V7QH 1R8EA 3L36A 1SQVE 3KPEA 2WPQA 1BGYD 1JM0A 4RESB 2A45G 3RL0B 1SQBG 2W27A 4TT3H 3L70D 3GG2A 1NTME 3B5ND 1BSNA 4PV1D 2M5AA 1KILD 4HH2A 4R4MA 2MKVA 3D71A 1JTHB 4H0LD 1BDDA 1FDMA 4YXWH 1DX7A 2WPSA 1KILB 4DZOA 3L72D 3S4RA 3TNUB 2H89C 4KT0J 1L0LK 3MP7B 1NTZJ 2OYOA 3VMZA 3KZIH 3VP9A 5APVA 3H1LG 5AVUB 2KI7B 2O3JA 4U3FD 2FYZA 1W2BO 2CPBA 1YIJP 2UWJE 1SQXG 5E79H 3O6QB 5CBOA 1EQ7A 2Y9ZA 2OGUA 1T6AA 3CCQP 2P2UA 3F89A 2W90A 4WVZA 2PAJA 2KNCA 2KLUA 2P1JA 1ZR4A 3AE6C 1GD2E 1L0ND 2QRXA 5TJHA 1NH4A 1LWUC 1JY3O 1AV1A 4Z1MH 3A5TA 1USDA 3BATA 1SQBE 5APYA 3PJSK 3V2QA 2OYIA 5BU5A 4BRYA 2FYUK 2WSSH 3C1LA 2OARA 3CL3D 3OJAB 1N7LA 1Y8AA 1EDJA 1SQQD 2E75D 2E76B 2WPVB 1NU1G 3CXHI 3FWLA 4N6JA 3E1IA 3L72G 2M3BA 3VMXA 1SQPD 4IL6X 1RF0A 1EXJA 2OYHB 3ITKA 5TISH 2IYOA 2E75B 2FFDB 1WRGA 5AVZB 3M9QA 1FAVA 3RK3E 1GMJA 3H1LE 4U3FG 3TGUJ 1ZR2A 2NPSA 1P84D 1DD3A 1LP1A 5APSA 5B66E 3N7NA 2YXQB 5AVRB 1SQXE 3Q3DA 1EZVD 1J1EB 1URQA 1BGYJ 2N9YB 3IFMA 1HJ0A 3CPWO 5AVYB 1N86A 1Q2NA 3L70J 3CXHH 3V6IA 3M9HA 1GU5A 2Y0DA 5APUA 2QJKB 3UIAA 5KLVG 1H0TA 1K05A 3IN6A 2WZ7A 1YTZT 3V2NA 5CCHA 4C7NB 4NPDA 1S72P 1DEBA 1L0LJ 5GTHH 3A3YB 4HYTB 1T3UA 3AE8C 1VF5C 1YBKA 1OVUA 1KB9H 3L70E 1FOSF 3HUSA 2BCCD 4DT0A 1U57A 1KFNA 2HODA 1LTJA 1KILE 3H1JD 4PJ0H 3Q5RA 1Q82Q 1YQ4C 1SQQG 2OYIC 1ZN5A 3VOPA 4OGQB 2YIUB 2IZ0A 3LW5J 2QA4P 2GM4A 1NTKD 3HE5B 4L73A 1NU1E 4GIFA 4ASWA 1XTGB 3CC7P 3L72E 5EFWB 2R44A 3CWBD 3SFEC 4YTPC 2GUVA 2JKVA 1KYOD 1VDFA 2W6AA 3GHGB 3KYQA 3U59A 1JY2O 3OA7A 4YXDC 1L0NJ 1S1CX 1WMKA 2IBZD 1S5LE 4R4LA 4U3FE 1HUCA 1G1IA 3CCUP 3RL0g 5AVXB 2HLOA 1SQVK 2C0WA 1S2EA 2WT7B 4KJMA 1DH3A 3W68A 1JB0J 2NPSC 3RK2D 3G4SP 2Z4EA 1JMBA 2J59M 2ZT9B 1N7SA 2ZAEB 1HJBA 3MGNA 3P8CD 2Z5HA 2K9JA 5AVWB 1URQC 1M8OB 4NPFX 2AXCA 1KQLA 2WTYA 3AEEC 3EFFK 1OXZA 1IJDB 1T2KD 3EQ2A 2WQYC 5KLVE 3WUUA 3L73D 3H1HD 5AVVB 3H1KJ 4EDFA 1AQTA 1G2CA 1FZCB 5CCHC 2KK7A 2G3AA 2BCCG 4Y99C 1SQPJ 1FC2C 3TSIA 3H1JG 4I2LC 1JTHA 5KAIE 3H1IG 2KSEA 4ZMDA 4GOEA 3HUSC 1S4XA 2PP6A 2XU6A 2E5YA 5CJ4A 1LTJC 1H89A 1SQQE 1NAYA 3B8EB 1LT9B 1EDLA 1IFIA 3TDKA 2N9BA 3CWBG 3D70A 1SQPE 1KTMA 5AW6B 3AE4C 1RF1A 4IL6H 3QH9A 1GL2B 1EC5A 3HD7A 1DEEG 3WMM0 2IBZG 4H44B 5GTIE 1XTCC 1R5SA 1VQPP 3CX5D 5KLIC 1OW7A 2WSFH 1MFTA 4AYCA 4JBZA 3G71P 2HYNA 3CCLP 1J1DB 1EZVE 1X9VA 3JCUE 3CCEP 1VQ4P 1G1JA 1LTAC 2J58A 3CCMP 4BXLA 2J5UA 1E79H 3M0DA 4U7JA 1N7SC 1L2PA 2HPCB 4JPZB 3W67A 2OTLP 1JNMA 2CPSA 3L35A 2KIKA 2WPRA 1S9KD 1OVVA 2JEEA 4JQ0D 5H2FE 1KQGB 2POHA 1VQOP 3RL0C 1NTKJ 1MUUA 2YO2A 1NTZG 3A0BE 4RO0A 1MFZA 2BCCE 1S5LX 1M1JB 2YKPA 1GW4A 3H1JE 4UB8E 4I1LA 2A45I 3H1IE 2N1TB 4JF7A 4L74A 1OX3A 4O9BA 2M0BA 3AE1C 3HTKB 1A02J 1K04A 5AW4B 3L75D 1QVGO 3CWBE 1SQXK 2AEJA 2WSCJ 1FDOA 1IZNB 1RQUA 1KYOE 3H32A 1VQ9P 1KQSO 1AVYA 2ZYGA 1RF1C 2IBZE 1IK7A 4K3AA 3HD7C 1AVOA 3PTZA 2QJYB 1IK9A 2Y0CA 3R2PA 3HE4B 3CC2P 1L0LD 4LLHA 1GW3A 3CMAP 2A45H 1HGZA 3B5NB 3H1HJ 3L73J 1KC8Q 1M90Q 3WU2E 4W80A 1PFIA 4PV1B 1K9MQ 3Q5PA 1N2DC 2IX7C 3P8CE 4H0LB 1M7LA 2RN0A 2PRRA 2FKWB 1EXIA 3M0DC 3L71D 3L73E 3H1HE 2V7QJ 1NU1K 1OIPA 2ZXXA 3CC4P 1NTZE 1N73A 1AA0A 2W6JH 3AE9C 2WITA 3NFQA 3TGUG 2E74C 2YXRB 3MUDA 5B66H 2E76C 1IFJA 3FXDA 1L4AA 2FYNC 2C0XA 3SSUA 1E5WA 5B5EE 3L75G 3P8MC 2O01N 1OZHA 3GHGA 1BGYG 3A7OA 3M9BA 2FYUD 2WSEH 3L70G 1LJ2A 1RHZB 1SP4A 1YJ9P 5KJ7A 2H8PD 4WBAA 2E5TA 1PZQA 3M06A 5L8RJ 1SFCA 2R5BA 1PGOA 3CX5E 1JUNA 2IYPA 5APWA 1PP9D 2JP3A 2AXTE 1L0LG 5CBNA 2O1JA 5KLVK 3H1KD 1ZMEC 4OWFA 1IFPA 2W6BA 2WVRA 1GK6A 5APQA 3AE5C 1QX8A 3AEFC 3M91A 3FXEA 2W83C 1NWQA 1QVFO 3BCCJ 1LWUB 2OTJP 2OQQA 4KHXA 4N78D 1QEXA 1SQQK 1BCCJ 1KB9I 1NHLA 1Y47A 3HRNA 3LIDA 2QM8A 3T97A 3I55P 1BDCA 3SWFA 2IDBA 3VN0A 3L75J 1VL2A 3BASA 2B89A 2B87A 4EYYQ 2LXCB 3LW5H 1J2JB 1L0NG 1S5LH 1JEKA 3NXSA 4OH8B 1N73C 3TGUE 1FZEA 1QL1A 4AQRD 1NGMB 4OGQC 4I7ZC 2YIUC 4PD4E 1Z56A 2K9YA 2KS1A 2KB7P 3MUDC 1JCDA 4LGDE 3V2PA 1L4AC 3L75E 1CW5A 1BGYE 1Y9BA 3GHGC 2KOGA 1FU1A 2FBWC 1HF9A 3FWNA 4H13C 3CCVP 3U1CA 2H88C 3PLNA 3EFGA 2L5GB 2R3SA 4EI2A 5AVSB 5KJ7C 3H1KG 5AW7B 1H8AA 1Q90D 3V5BA 1ZRTD 1L0LE 1SFCC 2KXPB 4WY4A 3L71J 1LTBC 1NO4A 2A06D 1A02F 3A2AA 1SQPG 2KP8A 2BEQD 5KAIH 1Q86Q 1CI6A 5AVTB 3ABVC 5AW0B 3II6A 4UB6E 1VF5D 1EZVI 3U1AA 2KNCB 3L37A 3AEGC 5AW9B 4WWIA 2QM7A 1JOCA 3L74J 3MD0A 1FDIA 2QE7H 1NVOA 1KMIZ 3GF3A 3L71E 2IFMA 1PPJD 2HFED 4RKUJ 1VF5B 1FBMA 1ZW0A 3GMAA 4IFMA 3OW2O 1RY3A 2YKOA 3TK1A 1HH0A 3KDPB 2D2CC 1EZVG 3TYYA 3CMEP 4W7ZA 2Z5IA 2FYUJ 1RE4A 2GA1A 5GTIH 4IOIH 1IO4A 1NTMK 1M1KQ 1L0NE 4BRYB 1VQ5P 1OMIA 1X79B 2Y0EA 3A0HE 3RK2B 1JO5A 3AEAC 2MJZA 2BEZF 3JCUH 3N4XA 1PP9J 3V4WA 2YO3A 2ZYDA 2QEXP 2V4HA 5BU8B 1GK4A 1LNQA 2NPSD 2JWAA 2WMMA 2LXBA 1KYOI 2O01H 3B5NA 1URQD 5APTA 5H2FH 2W8ZA 2P67A 1JMMA 1TU3F 1KILA 3H1KE 3CCJP 2NPSB 2IBZI 3TNUA 2ZFCA 1NTKG 3A0BH 3BRTB 1LP1B 2A06G 1U7MA 2K37A 5AVQB 1CSBA 3PP5A 1FZAA 2QJPB 2YMYA 5CHXA 4UB8H 1MV8A 1GDTA 4EIJA 1YHQP 4WY4C 1URQB 1NTZK 1OVRA 4RJTA 5CCHD 1JY2P 1CZQA 1UIIA 2KZJA 3NMDA 2ZVNB 1VQMP 4N78E 1WT6A 1PPJG 3O6QA 2E42A 4YPCA 1ZP0C 1P84E 1LGHB 5KKZC 1KYOH 3G6EP 3RK3C 1M1JC 1VPCA 3VMAA 4AUWA 4N3YB 2HODB 1SQBK 5AW2B 1LTJB 3IAOA 1RE4C 2R3CA 3E7KA 4D6TJ 3R4YA 3WU2H 2XNDH 3L73G 3H1HG 2O1KA 4BWNA 3WUVA 2K1AA 3O8ZA 4DOJA 5KAFE 2XKMA 3GLMA 3S9OA 1KZUB 2AEFA 3BCCD 5KLIB 1SQVJ 1BCCD 1N7SD 2FXPA 2I8DA 1AFOA 1ZRTE 1YITP 1AJYA 2WSFJ 3CX5I 4ZKPA 2CK3H 2OYHA 3AE2C 3B5NC 3KHUA 1NTKE 2YMKA 4PV1C 2A06E 3VTPC 1KILC 1M57D 1KORA 2FFDA 3V2RA 2Q1KA 1VQ6P 1FOSE 1T8ZA 3RL0D 2G8YA 4H0LC 1N7SB 2JO1A 1BE3D 1VQ7P 5AW1B 5B5EH 2B9BA 1PPJE 1X22A 5APXA 3CCRP 1K73Q 2HR3A 1G2CB 1IC2A 2ITAA 3SFDC 4C7RA 1ZV8A 3CX5H 1GU4A 3V4QA 2P7JA 4LC1A 2AXTH 2PGDA 3IF4A 4DCKA 3FX0A 5CJ0A 2LR2A 4C7NA 3CLQA 3I5CA 1NU1D 2ZYAA 1PV3A 3NTNA 3AEBC 4W7YA 1FE6A 3HD7D 4PD4I 1MZ9A 4IFFA 5CMZA 2I1KA 5AW3B 2JJLA 3D6YA 3BCCG 1RF1B 1X0TA 3Q5SA 1IFNA 3CXHD 3HD7B 3L74D 3IR9A 1BCCG 1NAFA 3HE5A 2E43A 1R5LA 1IFDA 2GUSA 2RH0A 3PH0A 3C9IA 2QIWA 5DJUB 3GW6A 1SQBJ 5DJTB 3PRJA 2OYHC 1BE3G 1KB9D 2FXOA 1BSHA 2E75C 2FFDC 4PD4H 1NKZB 5KLVD 1GTWA 1N8RQ 1L0NK 2XNXA 2B88A 2E74D 2WT7A 1IFMA 4ZKUA 1VQKP 1RH5B 3WUTA 2C9LY 2E76D 3Q2YA 1Q81Q 1EDIA 2K88A 2RMZA 2M3EA 1FJPA 1FZGA 1J1EC 2C9NY 2E74B 4JYCA 1USEA 3RBZA 1KQFB 1ZXGA 5KTBA 3H1LJ 5K5GB 3G3ZA 3KZIE 2FYNB 2QSIA 2QJKC 2DW3A 1RE3A 1SLQA 3L71G 1FZCA 1S9KE 3JC22 1QGKB 1SQXJ 5E79E 4UB6H 2L91A 1VQNP 3H6PA 4NPEA 5CCGA 1SQPK 3P32A 1W5CE 1QL2A 3CD6P 2WSEJ 3VMYA 1HVVA 3MIWA 3L74G 2YKQA 3BCCE 5BVZA 4XA4A 3H32B 2XDJA 4GT1A 1BE3J 2M5AB 1LT9A 3H25A 4QMAA 1JY3P 1BCCE 4ZNCA 1SVFA 4XFJA 4HJGH 2Y9YA 4DJGA 2KSJA 1PGJA 1GL2A 4L75A 1VQ8P 2FYUG 1ZOYC 3G9RA 3RBXA 5AW8B 1M56D 2FXMA
chains in the Genus database with same CATH topology
3H1LJ 4U3FJ 1NTZJ 3L74J 3L71J 1NTMJ 3BCCJ 1PP9J 1L0NJ 1SQQJ 3L75J 1P84I 3CXHI 2FYUJ 2BCCJ 3H1KJ 1KYOI 1BGYJ 1SQVJ 1NTKJ 3TGUJ 3H1JJ 1L0LJ 3H1HJ 3L73J 1KB9I 1BCCJ 3CX5I 3L70J 3H1IJ 3CWBJ 1BE3J 1EZVI 5KLVJ 1SQXJ 4D6TJ 2IBZI 1NU1J 1SQBJ 1SQPJ 3L72J 4PD4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1L J;  4U3F J;  1NTZ J;  3L74 J;  3L71 J;  1NTM J;  3BCC J;  1PP9 J;  1L0N J;  1SQQ J;  3L75 J;  1P84 I;  3CXH I;  2FYU J;  2BCC J;  3H1K J;  1KYO I;  1BGY J;  1SQV J;  1NTK J;  3TGU J;  3H1J J;  1L0L J;  3H1H J;  3L73 J;  1KB9 I;  1BCC J;  3CX5 I;  3L70 J;  3H1I J;  3CWB J;  1BE3 J;  1EZV I;  5KLV J;  1SQX J;  4D6T J;  2IBZ I;  1NU1 J;  1SQB J;  1SQP J;  3L72 J;  4PD4 I; 
#chains in the Genus database with same CATH topology
 3B71 A;  4EOT A;  4CPG A;  1BE3 E;  1NJI Q;  3FGA D;  3A0H H;  4ASV A;  4K35 A;  3I56 P;  2ZVO B;  4D6T D;  1NOH A;  3AE7 C;  4GKG A;  1PP9 G;  1NU1 J;  4OGQ D;  3P7K A;  3L72 J;  1OW6 A;  2KLV A;  2P10 A;  2IZ1 A;  2QG4 A;  3LIE A;  1P84 I;  1T3J A;  1PGQ A;  1L4A D;  3H1I D;  2ZT9 C;  1OW8 A;  3E1R A;  1JY3 N;  5TIS E;  2HPC A;  1N73 B;  4XE5 B;  3ZDM A;  4GOF A;  2AEM A;  4I7Z B;  1NYH A;  3MTU E;  1KN7 A;  2QVA A;  4U3F J;  3M0A A;  1YJW P;  2JR8 A;  3RK2 C;  1SQV D;  4H13 D;  1L4A B;  1FJK A;  2Q6Q A;  3Q1M A;  5KJ7 D;  1RE3 C;  1FS0 E;  1M1J A;  1NTK K;  1SFC D;  3MHV A;  1NTM D;  3CI9 A;  1FZC C;  1RF0 C;  1YYC A;  1PIX A;  2JWD A;  1JCC A;  2N1T A;  4H13 B;  2ZT9 D;  1T2K C;  3OAK A;  5CCG C;  3CXH E;  3L74 E;  2OYI B;  1P84 H;  2R5D A;  5KLV J;  1SFC B;  2XZR A;  3HTK A;  3KQG A;  2ZXE B;  1LT9 C;  1LTI C;  2VRS A;  5GTH E;  2QJP C;  2IPP A;  3CCS P;  1YTZ I;  4L76 A;  1LT1 A;  4HKZ H;  2H7H A;  3AE3 C;  2Q3I A;  4C46 A;  1HWT C;  2FYU E;  1KB9 E;  2D2C D;  2M8R A;  1GL2 C;  4GDO A;  1NKN A;  3VYI A;  2P58 A;  1ZLL A;  4PJ0 E;  5CCG D;  2Q9I A;  2NRG A;  2YNY A;  3SWY A;  1D7M A;  4H44 C;  4D6T G;  1SQQ J;  3HE4 A;  1Q7Y Q;  1KD1 Q;  3AED C;  2I1J A;  1PP9 E;  1H88 A;  1LTT C;  2D2C B;  1EDK A;  1PGP A;  1NTZ D;  5KAF H;  1J1D C;  1KFM A;  4M3L A;  1DIP A;  3JSV C;  1HBW A;  3T97 B;  4MN4 C;  1YQ3 C;  4WB4 A;  2ZJS E;  1FZF A;  2FY8 A;  2B87 B;  1YI2 P;  2RKL A;  3K5B A;  1UIX A;  1GL2 D;  2OTK E;  2XV5 A;  2K3R A;  1SQV G;  3TF5 A;  1K8A Q;  4H44 D;  2HG5 D;  1OFC X;  2KS1 B;  1AQ5 A;  1H0T B;  3QWO C;  3F5H A;  1NTM G;  1LTG C;  1SQB D;  4Y99 B;  1QLE D;  2KUB A;  2WWW A;  1X8Y A;  2KYV A;  1RQV A;  1W2E A;  1MKM A;  3HUS B;  4WY4 D;  3VP8 A;  3KXD A;  3PHL A;  2NZ2 A;  2N1T C;  1OWA A;  2LKM A;  1HTL C;  1S3J A;  2R32 A;  2O01 J;  2WSC H;  4I6M C;  3C8V A;  2PFX A;  3USS A;  3D6Z A;  3EWK A;  4WY4 B;  4TLF A;  1JY2 N;  2Q7C A;  2BCC J;  1YJN P;  2IFN A;  3L4F A;  1CI6 B;  2Q5U A;  4Y28 J;  1FZB A;  3H1J J;  2BAS A;  4A7P A;  5AW5 B;  3MZW B;  3H1I J;  3RK3 D;  1LTS C;  3B4S A;  3H1L D;  2KZI A;  4GOD A;  3SWK A;  5M1B A;  3BRV B;  4B86 A;  3BVH A;  5C39 A;  4IFD K;  2N1T D;  4D6T E;  1PL5 A;  2Q3E A;  3GF7 A;  5KKZ B;  1HGV A;  2QJY C;  1SS1 A;  1SQX D;  4JYB A;  3AEC C;  3CWB J;  3RK3 B;  4OVN F;  2H43 A;  3S1K A;  1U7J A;  1LWU A;  1NTM J;  2JDI H;  3TGU D;  4HB1 A;  1GZL A;  4IL6 E;  1KV4 A;  1DD4 A;  4PD4 D;  1VQL P;  2SPZ A;  3RGU A;  2K9J B;  2V7Q H;  1R8E A;  3L36 A;  1SQV E;  3KPE A;  2WPQ A;  1BGY D;  1JM0 A;  4RES B;  2A45 G;  3RL0 B;  1SQB G;  2W27 A;  4TT3 H;  3L70 D;  3GG2 A;  1NTM E;  3B5N D;  1BSN A;  4PV1 D;  2M5A A;  1KIL D;  4HH2 A;  4R4M A;  2MKV A;  3D71 A;  1JTH B;  4H0L D;  1BDD A;  1FDM A;  4YXW H;  1DX7 A;  2WPS A;  1KIL B;  4DZO A;  3L72 D;  3S4R A;  3TNU B;  2H89 C;  4KT0 J;  1L0L K;  3MP7 B;  1NTZ J;  2OYO A;  3VMZ A;  3KZI H;  3VP9 A;  5APV A;  3H1L G;  5AVU B;  2KI7 B;  2O3J A;  4U3F D;  2FYZ A;  1W2B O;  2CPB A;  1YIJ P;  2UWJ E;  1SQX G;  5E79 H;  3O6Q B;  5CBO A;  1EQ7 A;  2Y9Z A;  2OGU A;  1T6A A;  3CCQ P;  2P2U A;  3F89 A;  2W90 A;  4WVZ A;  2PAJ A;  2KNC A;  2KLU A;  2P1J A;  1ZR4 A;  3AE6 C;  1GD2 E;  1L0N D;  2QRX A;  5TJH A;  1NH4 A;  1LWU C;  1JY3 O;  1AV1 A;  4Z1M H;  3A5T A;  1USD A;  3BAT A;  1SQB E;  5APY A;  3PJS K;  3V2Q A;  2OYI A;  5BU5 A;  4BRY A;  2FYU K;  2WSS H;  3C1L A;  2OAR A;  3CL3 D;  3OJA B;  1N7L A;  1Y8A A;  1EDJ A;  1SQQ D;  2E75 D;  2E76 B;  2WPV B;  1NU1 G;  3CXH I;  3FWL A;  4N6J A;  3E1I A;  3L72 G;  2M3B A;  3VMX A;  1SQP D;  4IL6 X;  1RF0 A;  1EXJ A;  2OYH B;  3ITK A;  5TIS H;  2IYO A;  2E75 B;  2FFD B;  1WRG A;  5AVZ B;  3M9Q A;  1FAV A;  3RK3 E;  1GMJ A;  3H1L E;  4U3F G;  3TGU J;  1ZR2 A;  2NPS A;  1P84 D;  1DD3 A;  1LP1 A;  5APS A;  5B66 E;  3N7N A;  2YXQ B;  5AVR B;  1SQX E;  3Q3D A;  1EZV D;  1J1E B;  1URQ A;  1BGY J;  2N9Y B;  3IFM A;  1HJ0 A;  3CPW O;  5AVY B;  1N86 A;  1Q2N A;  3L70 J;  3CXH H;  3V6I A;  3M9H A;  1GU5 A;  2Y0D A;  5APU A;  2QJK B;  3UIA A;  5KLV G;  1H0T A;  1K05 A;  3IN6 A;  2WZ7 A;  1YTZ T;  3V2N A;  5CCH A;  4C7N B;  4NPD A;  1S72 P;  1DEB A;  1L0L J;  5GTH H;  3A3Y B;  4HYT B;  1T3U A;  3AE8 C;  1VF5 C;  1YBK A;  1OVU A;  1KB9 H;  3L70 E;  1FOS F;  3HUS A;  2BCC D;  4DT0 A;  1U57 A;  1KFN A;  2HOD A;  1LTJ A;  1KIL E;  3H1J D;  4PJ0 H;  3Q5R A;  1Q82 Q;  1YQ4 C;  1SQQ G;  2OYI C;  1ZN5 A;  3VOP A;  4OGQ B;  2YIU B;  2IZ0 A;  3LW5 J;  2QA4 P;  2GM4 A;  1NTK D;  3HE5 B;  4L73 A;  1NU1 E;  4GIF A;  4ASW A;  1XTG B;  3CC7 P;  3L72 E;  5EFW B;  2R44 A;  3CWB D;  3SFE C;  4YTP C;  2GUV A;  2JKV A;  1KYO D;  1VDF A;  2W6A A;  3GHG B;  3KYQ A;  3U59 A;  1JY2 O;  3OA7 A;  4YXD C;  1L0N J;  1S1C X;  1WMK A;  2IBZ D;  1S5L E;  4R4L A;  4U3F E;  1HUC A;  1G1I A;  3CCU P;  3RL0 g;  5AVX B;  2HLO A;  1SQV K;  2C0W A;  1S2E A;  2WT7 B;  4KJM A;  1DH3 A;  3W68 A;  1JB0 J;  2NPS C;  3RK2 D;  3G4S P;  2Z4E A;  1JMB A;  2J59 M;  2ZT9 B;  1N7S A;  2ZAE B;  1HJB A;  3MGN A;  3P8C D;  2Z5H A;  2K9J A;  5AVW B;  1URQ C;  1M8O B;  4NPF X;  2AXC A;  1KQL A;  2WTY A;  3AEE C;  3EFF K;  1OXZ A;  1IJD B;  1T2K D;  3EQ2 A;  2WQY C;  5KLV E;  3WUU A;  3L73 D;  3H1H D;  5AVV B;  3H1K J;  4EDF A;  1AQT A;  1G2C A;  1FZC B;  5CCH C;  2KK7 A;  2G3A A;  2BCC G;  4Y99 C;  1SQP J;  1FC2 C;  3TSI A;  3H1J G;  4I2L C;  1JTH A;  5KAI E;  3H1I G;  2KSE A;  4ZMD A;  4GOE A;  3HUS C;  1S4X A;  2PP6 A;  2XU6 A;  2E5Y A;  5CJ4 A;  1LTJ C;  1H89 A;  1SQQ E;  1NAY A;  3B8E B;  1LT9 B;  1EDL A;  1IFI A;  3TDK A;  2N9B A;  3CWB G;  3D70 A;  1SQP E;  1KTM A;  5AW6 B;  3AE4 C;  1RF1 A;  4IL6 H;  3QH9 A;  1GL2 B;  1EC5 A;  3HD7 A;  1DEE G;  3WMM 0;  2IBZ G;  4H44 B;  5GTI E;  1XTC C;  1R5S A;  1VQP P;  3CX5 D;  5KLI C;  1OW7 A;  2WSF H;  1MFT A;  4AYC A;  4JBZ A;  3G71 P;  2HYN A;  3CCL P;  1J1D B;  1EZV E;  1X9V A;  3JCU E;  3CCE P;  1VQ4 P;  1G1J A;  1LTA C;  2J58 A;  3CCM P;  4BXL A;  2J5U A;  1E79 H;  3M0D A;  4U7J A;  1N7S C;  1L2P A;  2HPC B;  4JPZ B;  3W67 A;  2OTL P;  1JNM A;  2CPS A;  3L35 A;  2KIK A;  2WPR A;  1S9K D;  1OVV A;  2JEE A;  4JQ0 D;  5H2F E;  1KQG B;  2POH A;  1VQO P;  3RL0 C;  1NTK J;  1MUU A;  2YO2 A;  1NTZ G;  3A0B E;  4RO0 A;  1MFZ A;  2BCC E;  1S5L X;  1M1J B;  2YKP A;  1GW4 A;  3H1J E;  4UB8 E;  4I1L A;  2A45 I;  3H1I E;  2N1T B;  4JF7 A;  4L74 A;  1OX3 A;  4O9B A;  2M0B A;  3AE1 C;  3HTK B;  1A02 J;  1K04 A;  5AW4 B;  3L75 D;  1QVG O;  3CWB E;  1SQX K;  2AEJ A;  2WSC J;  1FDO A;  1IZN B;  1RQU A;  1KYO E;  3H32 A;  1VQ9 P;  1KQS O;  1AVY A;  2ZYG A;  1RF1 C;  2IBZ E;  1IK7 A;  4K3A A;  3HD7 C;  1AVO A;  3PTZ A;  2QJY B;  1IK9 A;  2Y0C A;  3R2P A;  3HE4 B;  3CC2 P;  1L0L D;  4LLH A;  1GW3 A;  3CMA P;  2A45 H;  1HGZ A;  3B5N B;  3H1H J;  3L73 J;  1KC8 Q;  1M90 Q;  3WU2 E;  4W80 A;  1PFI A;  4PV1 B;  1K9M Q;  3Q5P A;  1N2D C;  2IX7 C;  3P8C E;  4H0L B;  1M7L A;  2RN0 A;  2PRR A;  2FKW B;  1EXI A;  3M0D C;  3L71 D;  3L73 E;  3H1H E;  2V7Q J;  1NU1 K;  1OIP A;  2ZXX A;  3CC4 P;  1NTZ E;  1N73 A;  1AA0 A;  2W6J H;  3AE9 C;  2WIT A;  3NFQ A;  3TGU G;  2E74 C;  2YXR B;  3MUD A;  5B66 H;  2E76 C;  1IFJ A;  3FXD A;  1L4A A;  2FYN C;  2C0X A;  3SSU A;  1E5W A;  5B5E E;  3L75 G;  3P8M C;  2O01 N;  1OZH A;  3GHG A;  1BGY G;  3A7O A;  3M9B A;  2FYU D;  2WSE H;  3L70 G;  1LJ2 A;  1RHZ B;  1SP4 A;  1YJ9 P;  5KJ7 A;  2H8P D;  4WBA A;  2E5T A;  1PZQ A;  3M06 A;  5L8R J;  1SFC A;  2R5B A;  1PGO A;  3CX5 E;  1JUN A;  2IYP A;  5APW A;  1PP9 D;  2JP3 A;  2AXT E;  1L0L G;  5CBN A;  2O1J A;  5KLV K;  3H1K D;  1ZME C;  4OWF A;  1IFP A;  2W6B A;  2WVR A;  1GK6 A;  5APQ A;  3AE5 C;  1QX8 A;  3AEF C;  3M91 A;  3FXE A;  2W83 C;  1NWQ A;  1QVF O;  3BCC J;  1LWU B;  2OTJ P;  2OQQ A;  4KHX A;  4N78 D;  1QEX A;  1SQQ K;  1BCC J;  1KB9 I;  1NHL A;  1Y47 A;  3HRN A;  3LID A;  2QM8 A;  3T97 A;  3I55 P;  1BDC A;  3SWF A;  2IDB A;  3VN0 A;  3L75 J;  1VL2 A;  3BAS A;  2B89 A;  2B87 A;  4EYY Q;  2LXC B;  3LW5 H;  1J2J B;  1L0N G;  1S5L H;  1JEK A;  3NXS A;  4OH8 B;  1N73 C;  3TGU E;  1FZE A;  1QL1 A;  4AQR D;  1NGM B;  4OGQ C;  4I7Z C;  2YIU C;  4PD4 E;  1Z56 A;  2K9Y A;  2KS1 A;  2KB7 P;  3MUD C;  1JCD A;  4LGD E;  3V2P A;  1L4A C;  3L75 E;  1CW5 A;  1BGY E;  1Y9B A;  3GHG C;  2KOG A;  1FU1 A;  2FBW C;  1HF9 A;  3FWN A;  4H13 C;  3CCV P;  3U1C A;  2H88 C;  3PLN A;  3EFG A;  2L5G B;  2R3S A;  4EI2 A;  5AVS B;  5KJ7 C;  3H1K G;  5AW7 B;  1H8A A;  1Q90 D;  3V5B A;  1ZRT D;  1L0L E;  1SFC C;  2KXP B;  4WY4 A;  3L71 J;  1LTB C;  1NO4 A;  2A06 D;  1A02 F;  3A2A A;  1SQP G;  2KP8 A;  2BEQ D;  5KAI H;  1Q86 Q;  1CI6 A;  5AVT B;  3ABV C;  5AW0 B;  3II6 A;  4UB6 E;  1VF5 D;  1EZV I;  3U1A A;  2KNC B;  3L37 A;  3AEG C;  5AW9 B;  4WWI A;  2QM7 A;  1JOC A;  3L74 J;  3MD0 A;  1FDI A;  2QE7 H;  1NVO A;  1KMI Z;  3GF3 A;  3L71 E;  2IFM A;  1PPJ D;  2HFE D;  4RKU J;  1VF5 B;  1FBM A;  1ZW0 A;  3GMA A;  4IFM A;  3OW2 O;  1RY3 A;  2YKO A;  3TK1 A;  1HH0 A;  3KDP B;  2D2C C;  1EZV G;  3TYY A;  3CME P;  4W7Z A;  2Z5I A;  2FYU J;  1RE4 A;  2GA1 A;  5GTI H;  4IOI H;  1IO4 A;  1NTM K;  1M1K Q;  1L0N E;  4BRY B;  1VQ5 P;  1OMI A;  1X79 B;  2Y0E A;  3A0H E;  3RK2 B;  1JO5 A;  3AEA C;  2MJZ A;  2BEZ F;  3JCU H;  3N4X A;  1PP9 J;  3V4W A;  2YO3 A;  2ZYD A;  2QEX P;  2V4H A;  5BU8 B;  1GK4 A;  1LNQ A;  2NPS D;  2JWA A;  2WMM A;  2LXB A;  1KYO I;  2O01 H;  3B5N A;  1URQ D;  5APT A;  5H2F H;  2W8Z A;  2P67 A;  1JMM A;  1TU3 F;  1KIL A;  3H1K E;  3CCJ P;  2NPS B;  2IBZ I;  3TNU A;  2ZFC A;  1NTK G;  3A0B H;  3BRT B;  1LP1 B;  2A06 G;  1U7M A;  2K37 A;  5AVQ B;  1CSB A;  3PP5 A;  1FZA A;  2QJP B;  2YMY A;  5CHX A;  4UB8 H;  1MV8 A;  1GDT A;  4EIJ A;  1YHQ P;  4WY4 C;  1URQ B;  1NTZ K;  1OVR A;  4RJT A;  5CCH D;  1JY2 P;  1CZQ A;  1UII A;  2KZJ A;  3NMD A;  2ZVN B;  1VQM P;  4N78 E;  1WT6 A;  1PPJ G;  3O6Q A;  2E42 A;  4YPC A;  1ZP0 C;  1P84 E;  1LGH B;  5KKZ C;  1KYO H;  3G6E P;  3RK3 C;  1M1J C;  1VPC A;  3VMA A;  4AUW A;  4N3Y B;  2HOD B;  1SQB K;  5AW2 B;  1LTJ B;  3IAO A;  1RE4 C;  2R3C A;  3E7K A;  4D6T J;  3R4Y A;  3WU2 H;  2XND H;  3L73 G;  3H1H G;  2O1K A;  4BWN A;  3WUV A;  2K1A A;  3O8Z A;  4DOJ A;  5KAF E;  2XKM A;  3GLM A;  3S9O A;  1KZU B;  2AEF A;  3BCC D;  5KLI B;  1SQV J;  1BCC D;  1N7S D;  2FXP A;  2I8D A;  1AFO A;  1ZRT E;  1YIT P;  1AJY A;  2WSF J;  3CX5 I;  4ZKP A;  2CK3 H;  2OYH A;  3AE2 C;  3B5N C;  3KHU A;  1NTK E;  2YMK A;  4PV1 C;  2A06 E;  3VTP C;  1KIL C;  1M57 D;  1KOR A;  2FFD A;  3V2R A;  2Q1K A;  1VQ6 P;  1FOS E;  1T8Z A;  3RL0 D;  2G8Y A;  4H0L C;  1N7S B;  2JO1 A;  1BE3 D;  1VQ7 P;  5AW1 B;  5B5E H;  2B9B A;  1PPJ E;  1X22 A;  5APX A;  3CCR P;  1K73 Q;  2HR3 A;  1G2C B;  1IC2 A;  2ITA A;  3SFD C;  4C7R A;  1ZV8 A;  3CX5 H;  1GU4 A;  3V4Q A;  2P7J A;  4LC1 A;  2AXT H;  2PGD A;  3IF4 A;  4DCK A;  3FX0 A;  5CJ0 A;  2LR2 A;  4C7N A;  3CLQ A;  3I5C A;  1NU1 D;  2ZYA A;  1PV3 A;  3NTN A;  3AEB C;  4W7Y A;  1FE6 A;  3HD7 D;  4PD4 I;  1MZ9 A;  4IFF A;  5CMZ A;  2I1K A;  5AW3 B;  2JJL A;  3D6Y A;  3BCC G;  1RF1 B;  1X0T A;  3Q5S A;  1IFN A;  3CXH D;  3HD7 B;  3L74 D;  3IR9 A;  1BCC G;  1NAF A;  3HE5 A;  2E43 A;  1R5L A;  1IFD A;  2GUS A;  2RH0 A;  3PH0 A;  3C9I A;  2QIW A;  5DJU B;  3GW6 A;  1SQB J;  5DJT B;  3PRJ A;  2OYH C;  1BE3 G;  1KB9 D;  2FXO A;  1BSH A;  2E75 C;  2FFD C;  4PD4 H;  1NKZ B;  5KLV D;  1GTW A;  1N8R Q;  1L0N K;  2XNX A;  2B88 A;  2E74 D;  2WT7 A;  1IFM A;  4ZKU A;  1VQK P;  1RH5 B;  3WUT A;  2C9L Y;  2E76 D;  3Q2Y A;  1Q81 Q;  1EDI A;  2K88 A;  2RMZ A;  2M3E A;  1FJP A;  1FZG A;  1J1E C;  2C9N Y;  2E74 B;  4JYC A;  1USE A;  3RBZ A;  1KQF B;  1ZXG A;  5KTB A;  3H1L J;  5K5G B;  3G3Z A;  3KZI E;  2FYN B;  2QSI A;  2QJK C;  2DW3 A;  1RE3 A;  1SLQ A;  3L71 G;  1FZC A;  1S9K E;  3JC2 2;  1QGK B;  1SQX J;  5E79 E;  4UB6 H;  2L91 A;  1VQN P;  3H6P A;  4NPE A;  5CCG A;  1SQP K;  3P32 A;  1W5C E;  1QL2 A;  3CD6 P;  2WSE J;  3VMY A;  1HVV A;  3MIW A;  3L74 G;  2YKQ A;  3BCC E;  5BVZ A;  4XA4 A;  3H32 B;  2XDJ A;  4GT1 A;  1BE3 J;  2M5A B;  1LT9 A;  3H25 A;  4QMA A;  1JY3 P;  1BCC E;  4ZNC A;  1SVF A;  4XFJ A;  4HJG H;  2Y9Y A;  4DJG A;  2KSJ A;  1PGJ A;  1GL2 A;  4L75 A;  1VQ8 P;  2FYU G;  1ZOY C;  3G9R A;  3RBX A;  5AW8 B;  1M56 D;  2FXM A; 
#chains in the Genus database with same CATH homology
 3H1L J;  4U3F J;  1NTZ J;  3L74 J;  3L71 J;  1NTM J;  3BCC J;  1PP9 J;  1L0N J;  1SQQ J;  3L75 J;  1P84 I;  3CXH I;  2FYU J;  2BCC J;  3H1K J;  1KYO I;  1BGY J;  1SQV J;  1NTK J;  3TGU J;  3H1J J;  1L0L J;  3H1H J;  3L73 J;  1KB9 I;  1BCC J;  3CX5 I;  3L70 J;  3H1I J;  3CWB J;  1BE3 J;  1EZV I;  5KLV J;  1SQX J;  4D6T J;  2IBZ I;  1NU1 J;  1SQB J;  1SQP J;  3L72 J;  4PD4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...