3L73J

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
total genus 23
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3l73J00
1SQVJ 1P84I 3TGUJ 3CWBJ 3L70J 1EZVI 2IBZI 3H1JJ 1SQBJ 3L71J 1KYOI 1SQPJ 1L0NJ 1BGYJ 3H1HJ 3L75J 1BE3J 5KLVJ 3H1IJ 3BCCJ 3CXHI 4PD4I 1BCCJ 3H1LJ 3L74J 1NU1J 2BCCJ 4U3FJ 3CX5I 1SQQJ 1PP9J 1NTKJ 1NTMJ 2FYUJ 3H1KJ 3L73J 4D6TJ 3L72J 1KB9I 1SQXJ 1L0LJ 1NTZJ
chains in the Genus database with same CATH superfamily
1SQVD 1SQXG 3VMAA 4N78D 5APWA 1NAFA 3L37A 1M7LA 5CHXA 2YKPA 4UB8H 1PL5A 1QEXA 3H1LD 2OTJP 3CD6P 1EZVE 4YTPC 1VQ5P 4Z1MH 1KYOD 2PAJA 5B66E 2Q6QA 3BCCE 3PTZA 3RK2D 2E75D 1XTGB 5L8RJ 2QJYC 2FBWC 1PP9D 2W27A 2W8ZA 4WY4A 1VQKP 2E76C 3AE8C 3Q5PA 2FXOA 2B9BA 2H89C 5BVZA 5CBOA 3CMEP 2N1TA 1SVFA 3E7KA 2D2CD 3H1IG 5H2FH 4JPZB 2HYNA 4GKGA 1NO4A 2KUBA 2M5AA 2WPSA 5M1BA 1AV1A 1KILB 3CXHD 3CCUP 1S5LE 2C9NY 1SQQE 4Y99B 3KDPB 4WWIA 2QSIA 3A7OA 1CI6B 1USDA 1L0NJ 3GHGB 1ZN5A 2BCCE 5AW3B 3JSVC 1SQQK 2O3JA 4GT1A 1VF5D 1PV3A 2AEMA 3N7NA 4H44B 4JYBA 1UIIA 1YBKA 1S1CX 1CSBA 1LP1A 3H1JJ 2KK7A 3CPWO 3RK3C 3L75J 5KLIC 1NGMB 5BU5A 1OXZA 5K5GB 2NPSB 3GW6A 2ZJSE 3BRVB 2AXTH 4PV1C 1GK6A 1A02F 1SQXJ 1HH0A 3PP5A 1IFIA 1T3UA 5AVZB 3H32B 4HH2A 1NU1E 3H1LE 3MGNA 5APTA 2A06E 1URQA 1M8OB 1YYCA 1JEKA 5E79H 1N7SC 4IL6X 1SQVK 1OVVA 3V6IA 2P10A 2O1KA 1N73A 1QGKB 1SQBG 1LGHB 3B5NB 3L74E 3CX5H 1NU1K 1QX8A 3WUVA 1PP9E 3RL0B 1AFOA 4L73A 5CJ0A 1BCCG 3HE4A 1PPJD 1JUNA 1ZP0C 2N1TC 4IOIH 5AVRB 1ZMEC 2DW3A 2KI7B 1J1EB 4UB6E 2FXMA 3D6ZA 4XE5B 2GUSA 2UWJE 5B5EH 1IK9A 3AE7C 2IBZI 2OARA 3E1RA 2E5TA 4PD4I 1BE3G 2WSCJ 3I56P 1NTMJ 1E79H 1SLQA 2Z4EA 5APUA 4I7ZC 4WB4A 3IR9A 1SQPG 1HGZA 4MN4C 1A02J 1RQVA 3E1IA 3H6PA 1WT6A 2QJYB 3VMZA 4U7JA 2HFED 3L70D 1ZR4A 1EZVI 1MV8A 2E76B 2KZJA 3GF7A 1LTGC 2KZIA 3I5CA 3KHUA 1HUCA 1AVOA 2P67A 5C39A 3A3YB 3L72G 1G1JA 1URQC 3D71A 4DJGA 3I55P 3L71G 1J1DC 3TYYA 3HD7D 1KC8Q 2P7JA 1VQ7P 1N73C 5GTIE 1LWUA 5DJTB 4IFDK 3BATA 3U1AA 1SQBJ 3CWBG 2RN0A 2KSJA 1NKNA 2KNCA 2HPCB 2WSCH 2O01J 3LIEA 2VRSA 1OWAA 3VTPC 2R44A 2B87B 2E75C 3RK2C 1VQMP 2IBZD 2KSEA 4UB8E 1LT9A 3Q1MA 4PD4D 2E42A 5KLVD 1MFZA 3SWFA 3B4SA 1YJ9P 1LTSC 5KAIH 3RK3B 3V5BA 5KLIB 1L0LE 4BWNA 3PHLA 2WPQA 2D2CC 2KXPB 1NOHA 2IFNA 2N9YB 3CX5D 1IZNB 1VDFA 2L91A 2K3RA 1JOCA 1SFCD 1OX3A 1NTZE 1P84H 2WVRA 3FWNA 1EZVD 3CWBE 3CCSP 3TNUA 3GHGC 3AE6C 4A7PA 4TT3H 1S72P 3H1HE 1SQPJ 3LW5J 1AJYA 1OW7A 3BCCD 2YNYA 1EDJA 2P1JA 5AVQB 5H2FE 4WY4B 3GMAA 2FYUG 3H1KG 1LTBC 2JDIH 1U7JA 3AEGC 3IN6A 3Q5SA 4NPEA 1KYOI 2N1TB 2K9JA 2Y0CA 3KYQA 2NPSC 3WUTA 2O01H 2LXBA 2WSFJ 1YQ3C 2AEFA 2QM7A 1OMIA 3L73E 2M5AB 3L72J 4PJ0H 3MHVA 2CK3H 1XTCC 4ZKPA 2WT7A 5AW6B 4NPFX 1X9VA 1FJPA 3L71J 1LWUC 1DX7A 1QLED 2LXCB 2IZ1A 2BEZF 2K37A 1VPCA 3RL0g 3CI9A 3CCRP 4RJTA 2RMZA 3HD7A 1NVOA 2M8RA 4OGQD 3EWKA 1L0NG 4I7ZB 3D70A 3S9OA 1FDMA 2BCCD 2RKLA 4Y28J 2WWWA 1LT9C 2AXTE 5AW5B 1KD1Q 2FY8A 3L36A 3M9QA 2ZYAA 2A45G 2K1AA 1LP1B 4OVNF 4XA4A 4LGDE 1RE4A 4DT0A 3LW5H 1VQ4P 5KJ7C 3H1ID 1FBMA 3VP9A 3D6YA 5E79E 1OZHA 2WMMA 2NZ2A 2JWAA 1ZR2A 1IO4A 1W2BO 1S2EA 3O6QA 5AW4B 2W6JH 4W80A 2E5YA 3CX5E 3IFMA 5KLVK 3PJSK 1JNMA 4EDFA 1URQB 4ZKUA 1RE3A 1NU1D 2M3BA 1FZFA 2A06D 1J1DB 4D6TG 4RKUJ 3AE4C 2ITAA 4YXWH 2LKMA 3GF3A 3V4WA 3V2PA 1GZLA 1ZRTD 1N73B 1M1KQ 1L0NE 3CCLP 4ASWA 1FZEA 4HKZH 4HYTB 2C0XA 1ZW0A 2H8PD 3L74D 4M3LA 2OTLP 3HE4B 2FYUJ 2P2UA 3H1KJ 5B5EE 4H13D 2FYZA 3H1JE 1HF9A 3RK2B 2E75B 2FFDA 3L75E 1IFMA 3G9RA 2LR2A 4KHXA 1BGYJ 1K73Q 1YI2P 3AEEC 1LTAC 2YXQB 4U3FG 2QA4P 3HUSA 1SQXE 5KAFH 3CCVP 1IJDB 2BASA 1S5LX 1FOSF 1YITP 3M91A 3TGUG 1PGPA 2D2CB 1Y8AA 2HODA 2M0BA 2JJLA 1NTMG 3HD7C 1VQLP 2CPBA 3A0BH 3V2NA 3AEBC 1EC5A 1FAVA 1NJIQ 5BU8B 1NH4A 3CCQP 2AEJA 1RF0A 1BCCD 1EDKA 1RE4C 2WTYA 3IAOA 1GW3A 2V7QJ 2ZT9D 1L4AD 2H43A 3KPEA 3H1IE 1VF5B 2ZVNB 2Y9ZA 2ZAEB 3II6A 3G6EP 2PFXA 1FZCA 3CCJP 1EQ7A 2YKOA 4H0LD 5AVUB 2KS1A 2Q9IA 1YTZT 1IFJA 1RE3C 1ZXGA 2HLOA 1G2CA 3C1LA 4C7NA 1IC2A 1BE3D 4DCKA 1NTME 1AVYA 1KB9H 1LWUB 4D6TJ 1ZRTE 2G8YA 4L75A 1LJ2A 2CPSA 3FWLA 1R5LA 2MKVA 3OA7A 1K9MQ 2XDJA 4WY4C 2KNCB 3VMXA 5KAIE 2AXCA 3LIDA 2OTKE 3RL0D 2ZYGA 3S1KA 1JB0J 3WUUA 1EDIA 1HJBA 1JM0A 1FU1A 1LT9B 1NYHA 3A0HH 4YXDC 1H8AA 4EI2A 3C9IA 2K9YA 3B8EB 3HUSC 2QJPC 3KZIH 1N2DC 4U3FJ 1GMJA 1P84E 2A45H 1L0LD 1NHLA 2V7QH 5APQA 3ZDMA 3EQ2A 3M0AA 3TGUJ 2YMYA 4DZOA 2QG4A 1KILE 3BASA 1LT1A 1YJNP 2GUVA 3SFEC 3PH0A 3TNUB 1NTZD 1CZQA 1RF0C 2HR3A 1SQBE 1JY2N 1SQVJ 3CWBD 3FXEA 3H1HD 3VOPA 5TISH 1BCCE 4BRYA 3H1LJ 3CX5I 4PJ0E 2ZXEB 2Y0EA 1NTKG 1VQNP 2KP8A 2XU6A 2GA1A 4OGQC 1VQOP 2WZ7A 3TDKA 1JTHA 2QM8A 2K9JB 1TU3F 1SS1A 5AW0B 3GG2A 1MFTA 2FYNC 1EXIA 1W5CE 3MP7B 1PGQA 3L73D 1WMKA 1L4AA 2WT7B 2I1KA 4O9BA 1X79B 1PPJG 4OH8B 1J2JB 3N4XA 1LNQA 1BE3E 2HG5D 1K8AQ 2C9LY 2J59M 3WU2H 3P8CE 4XFJA 3G4SP 2Q1KA 1SQPE 3HD7B 3VP8A 3O8ZA 1VL2A 1KFNA 3JCUH 1LTTC 4GOFA 3AE5C 1HBWA 1DIPA 3MUDA 1KQSO 3EFFK 2KLVA 4YPCA 1SQPK 3IF4A 1CW5A 3CC7P 4H13C 1RF1A 1Q86Q 1KB9D 5KKZC 5CCGD 3L72E 4N6JA 5AW9B 3O6QB 1KYOH 1GL2D 3AE3C 3L71E 4LLHA 4EYYQ 3L70G 1YJWP 4PV1D 1H89A 1N86A 4IL6H 2YKQA 2QEXP 1L0LK 3F5HA 1HWTC 1BSNA 3CMAP 4ZMDA 1EDLA 3SWKA 2E43A 1Q7YQ 1L0ND 1EXJA 1NKZB 1N7SD 1SFCB 2KLUA 5KAFE 1ZOYC 3HTKA 1NTKJ 2E74D 3L35A 3CLQA 1QVFO 1FC2C 1H0TA 1NTZK 2Y0DA 1VF5C 2FFDB 3H1JD 3CXHH 1QL2A 3L75D 5KTBA 1T2KD 2PP6A 2ZT9C 1L4AC 2PGDA 1BGYG 3HUSB 2QJPB 4LC1A 1KQGB 1X0TA 2WPRA 3A0BE 2JP3A 1SQXD 4ZNCA 1HGVA 2W6BA 3BRTB 2KIKA 2IBZG 1YQ4C 3ITKA 4H0LC 1IFNA 1UIXA 5GTHH 5KLVG 2HODB 3U1CA 2C0WA 1IFPA 3M0DA 1JMMA 2QRXA 1DD4A 5TJHA 2FKWB 4JQ0D 1PZQA 1JCDA 5AVYB 2WQYC 2K88A 3S4RA 3MUDC 3CCEP 2NRGA 1KQLA 2FYUE 3H1KE 3USSA 1X8YA 1LTJA 3WMM0 1RF1C 1PFIA 2IDBA 1JY3N 1N8RQ 5EFWB 1GDTA 1RH5B 1EZVG 4C7RA 4OGQB 1BGYE 2QE7H 1U7MA 2L5GB 4N3YB 3A5TA 2KOGA 2IPPA 3K5BA 1KB9E 1FZCB 2O01N 3P7KA 3BCCG 3V2QA 2KS1B 1Y47A 3RK3E 2OYOA 2FYNB 3H25A 2R5BA 2OYHB 3TGUD 1Q2NA 3SWYA 1K05A 4GDOA 3EFGA 1G2CB 4C7NB 1Z56A 3L70J 3V2RA 1VQ6P 2MJZA 2KB7P 5CCGA 2WSFH 3TSIA 1NTMD 4EOTA 4B86A 3A0HE 2JWDA 1GL2A 3VYIA 1QVGO 4EIJA 3KZIE 4KJMA 4JBZA 1KV4A 3AEFC 1OVUA 3R2PA 3W67A 3T97A 1SFCA 2OYIA 3L4FA 1OVRA 1SQQG 1GU5A 2YXRB 1ZLLA 3HE5A 2XZRA 1L0NK 2G3AA 1N7SA 4GIFA 2V4HA 1FZGA 1BDDA 2PRRA 2B89A 4H13B 3SSUA 2QJKB 2BCCG 1RY3A 5CCHD 3MTUE 1P84D 3MD0A 5KKZB 4I2LC 1D7MA 3G71P 3M0DC 5TISE 2R32A 1OW8A 4GODA 5KLVJ 5AW7B 1KILD 4D6TE 2Z5HA 3NFQA 3NMDA 2W90A 5AW2B 1SQXK 2YO3A 2Q3EA 2JO1A 1SQBD 1LTJC 1SQVG 4DOJA 4BRYB 1M1JA 2B88A 1W2EA 1N7LA 1FOSE 3CL3D 4RO0A 1NU1G 3H1LG 3CCMP 2A06G 3NXSA 2IYOA 4H44D 1JTHB 2SPZA 1HTLC 1T6AA 3F89A 2JKVA 5AW1B 1AA0A 2O1JA 4U3FE 3MIWA 2YIUC 3BCCJ 2W83C 3WU2E 3L74G 1S9KE 2ZT9B 1PP9G 1L4AB 3TGUE 1FS0E 2IFMA 2NPSD 2J58A 2M3EA 5CCGC 1JY2P 2OYHA 3JCUE 1RQUA 3NTNA 4GOEA 3M06A 1MKMA 1GL2C 1FE6A 4H0LB 3TF5A 1AQTA 1VQPP 1OIPA 1SQVE 4N78E 1KN7A 3P8CD 1SFCC 2OYIC 1SQPD 4PD4H 2YO2A 3TK1A 4IFMA 2QIWA 1KMIZ 3B5ND 1NTMK 1NTKD 3RGUA 1SQQJ 1S3JA 2FFDC 1KYOE 5CBNA 1X22A 3V4QA 4W7YA 4AQRD 1HVVA 1DD3A 1AQ5A 2E74C 1RF1B 3GLMA 2XKMA 4IL6E 1PIXA 1QL1A 4W7ZA 2BCCJ 5CMZA 1JY2O 3L72D 3RBXA 2BEQD 5KJ7D 3AECC 1T2KC 4R4MA 4WBAA 1KTMA 2N9BA 2Q5UA 1JCCA 5B66H 3L71D 4L76A 3M9BA 1USEA 3H1IJ 1KORA 1E5WA 5APYA 5CCHA 2GM4A 2ZVOB 3CC4P 1KB9I 1M1JC 3OW2O 3QH9A 4AUWA 3CC2P 3A2AA 3C8VA 3AE1C 3CXHE 3KQGA 1FJKA 4JF7A 4IFFA 1R8EA 1NAYA 1KILA 3HTKB 1FZBA 1M57D 3W68A 1NU1J 2IX7C 2WSEJ 1H0TB 4L74A 1Y9BA 5AVTB 4K35A 1R5SA 1BDCA 1SQBK 1OFCX 1FZCC 2H7HA 3AE9C 2XV5A 3Q3DA 5GTHE 1CI6A 2E76D 1G1IA 1M90Q 1K04A 1S4XA 3GHGA 3L74J 2WPVB 1S5LH 1DEEG 5DJUB 1PP9J 2OYHC 3FGAD 3AEDC 4HB1A 1M56D 3QWOC 2A45I 3SFDC 1RHZB 2Q3IA 2OGUA 4JYCA 4I6MC 2W6AA 2NPSA 2Y9YA 5AW8B 1L0LG 1T8ZA 1IK7A 5CJ4A 2POHA 2ZFCA 2FXPA 2OQQA 3R4YA 3H32A 1LTJB 1NTKE 2ZYDA 1L2PA 1BSHA 1OW6A 2FYUD 3H1KD 3FX0A 3G3ZA 1KZUB 4R4LA 1NTZG 5AVXB 3M9HA 1IFDA 4TLFA 1BGYD 2XNXA 4RESB 2QJKC 3B5NA 1MZ9A 2Q7CA 2JEEA 3H1HG 1NTKK 2I8DA 1BCCJ 2I1JA 2WSEH 2R3CA 1FZAA 3VN0A 1HJ0A 2YIUB 1PPJE 1PGOA 3RK3D 1GTWA 5CCHC 4QMAA 4BXLA 2J5UA 3B71A 1FDIA 2RH0A 4WVZA 5KJ7A 1GL2B 3PLNA 3RBZA 1T3JA 2H88C 2IZ0A 1DH3A 1SP4A 1KILC 1YIJP 1JMBA 3L73G 1JY3P 3MZWB 4PV1B 5APVA 1GU4A 1GW4A 3KXDA 2R3SA 4Y99C 2YMKA 1BE3J 3T97B 2OYIB 1Q81Q 3OAKA 1KQFB 3P8MC 4UB6H 4WY4D 3AEAC 3HE5B 4I1LA 3HRNA 2P58A 1N7SB 4KT0J 1KFMA 1Q90D 3Q5RA 5AVSB 3PRJA 2KYVA 1DEBA 1Q82Q 4H44C 2E74B 2N1TD 4OWFA 4ASVA 3L70E 3JC22 4K3AA 3P32A 2WITA 4HJGH 3U59A 1MUUA 1FDOA 3VMYA 2JR8A 5AVVB 1JY3O 4D6TD 1NWQA 1VQ8P 1L0LJ 1P84I 1YTZI 1M1JB 1YHQP 3OJAB 5AVWB 4C46A 1SQQD 1ZV8A 5APSA 2WSSH 1GK4A 3Q2YA 1NTZJ 3B5NC 2ZXXA 3AE2C 3CWBJ 3FXDA 2IYPA 2XNDH 1GD2E 3RL0C 3H1HJ 2R5DA 3CXHI 3ABVC 4U3FD 2FYUK 1U57A 2HPCA 1WRGA 1VQ9P 2IBZE 1S9KD 1H88A 2QVAA 5GTIH 2B87A 5APXA 1PGJA 2Z5IA 4PD4E 1J1EC 3UIAA 5KLVE 3H1JG 4AYCA 4NPDA 3L75G 1URQD 3BVHA 4CPGA 1JO5A 1LTIC 3L73J
chains in the Genus database with same CATH topology
1SQVJ 1P84I 3TGUJ 3CWBJ 3L70J 1EZVI 2IBZI 3H1JJ 1SQBJ 3L71J 1KYOI 1SQPJ 1L0NJ 1BGYJ 3H1HJ 3L75J 1BE3J 5KLVJ 3H1IJ 3BCCJ 3CXHI 4PD4I 1BCCJ 3H1LJ 3L74J 1NU1J 2BCCJ 4U3FJ 3CX5I 1SQQJ 1PP9J 1NTKJ 1NTMJ 2FYUJ 3H1KJ 3L73J 4D6TJ 3L72J 1KB9I 1SQXJ 1L0LJ 1NTZJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQV J;  1P84 I;  3TGU J;  3CWB J;  3L70 J;  1EZV I;  2IBZ I;  3H1J J;  1SQB J;  3L71 J;  1KYO I;  1SQP J;  1L0N J;  1BGY J;  3H1H J;  3L75 J;  1BE3 J;  5KLV J;  3H1I J;  3BCC J;  3CXH I;  4PD4 I;  1BCC J;  3H1L J;  3L74 J;  1NU1 J;  2BCC J;  4U3F J;  3CX5 I;  1SQQ J;  1PP9 J;  1NTK J;  1NTM J;  2FYU J;  3H1K J;  3L73 J;  4D6T J;  3L72 J;  1KB9 I;  1SQX J;  1L0L J;  1NTZ J; 
#chains in the Genus database with same CATH topology
 1SQV D;  1SQX G;  3VMA A;  4N78 D;  5APW A;  1NAF A;  3L37 A;  1M7L A;  5CHX A;  2YKP A;  4UB8 H;  1PL5 A;  1QEX A;  3H1L D;  2OTJ P;  3CD6 P;  1EZV E;  4YTP C;  1VQ5 P;  4Z1M H;  1KYO D;  2PAJ A;  5B66 E;  2Q6Q A;  3BCC E;  3PTZ A;  3RK2 D;  2E75 D;  1XTG B;  5L8R J;  2QJY C;  2FBW C;  1PP9 D;  2W27 A;  2W8Z A;  4WY4 A;  1VQK P;  2E76 C;  3AE8 C;  3Q5P A;  2FXO A;  2B9B A;  2H89 C;  5BVZ A;  5CBO A;  3CME P;  2N1T A;  1SVF A;  3E7K A;  2D2C D;  3H1I G;  5H2F H;  4JPZ B;  2HYN A;  4GKG A;  1NO4 A;  2KUB A;  2M5A A;  2WPS A;  5M1B A;  1AV1 A;  1KIL B;  3CXH D;  3CCU P;  1S5L E;  2C9N Y;  1SQQ E;  4Y99 B;  3KDP B;  4WWI A;  2QSI A;  3A7O A;  1CI6 B;  1USD A;  1L0N J;  3GHG B;  1ZN5 A;  2BCC E;  5AW3 B;  3JSV C;  1SQQ K;  2O3J A;  4GT1 A;  1VF5 D;  1PV3 A;  2AEM A;  3N7N A;  4H44 B;  4JYB A;  1UII A;  1YBK A;  1S1C X;  1CSB A;  1LP1 A;  3H1J J;  2KK7 A;  3CPW O;  3RK3 C;  3L75 J;  5KLI C;  1NGM B;  5BU5 A;  1OXZ A;  5K5G B;  2NPS B;  3GW6 A;  2ZJS E;  3BRV B;  2AXT H;  4PV1 C;  1GK6 A;  1A02 F;  1SQX J;  1HH0 A;  3PP5 A;  1IFI A;  1T3U A;  5AVZ B;  3H32 B;  4HH2 A;  1NU1 E;  3H1L E;  3MGN A;  5APT A;  2A06 E;  1URQ A;  1M8O B;  1YYC A;  1JEK A;  5E79 H;  1N7S C;  4IL6 X;  1SQV K;  1OVV A;  3V6I A;  2P10 A;  2O1K A;  1N73 A;  1QGK B;  1SQB G;  1LGH B;  3B5N B;  3L74 E;  3CX5 H;  1NU1 K;  1QX8 A;  3WUV A;  1PP9 E;  3RL0 B;  1AFO A;  4L73 A;  5CJ0 A;  1BCC G;  3HE4 A;  1PPJ D;  1JUN A;  1ZP0 C;  2N1T C;  4IOI H;  5AVR B;  1ZME C;  2DW3 A;  2KI7 B;  1J1E B;  4UB6 E;  2FXM A;  3D6Z A;  4XE5 B;  2GUS A;  2UWJ E;  5B5E H;  1IK9 A;  3AE7 C;  2IBZ I;  2OAR A;  3E1R A;  2E5T A;  4PD4 I;  1BE3 G;  2WSC J;  3I56 P;  1NTM J;  1E79 H;  1SLQ A;  2Z4E A;  5APU A;  4I7Z C;  4WB4 A;  3IR9 A;  1SQP G;  1HGZ A;  4MN4 C;  1A02 J;  1RQV A;  3E1I A;  3H6P A;  1WT6 A;  2QJY B;  3VMZ A;  4U7J A;  2HFE D;  3L70 D;  1ZR4 A;  1EZV I;  1MV8 A;  2E76 B;  2KZJ A;  3GF7 A;  1LTG C;  2KZI A;  3I5C A;  3KHU A;  1HUC A;  1AVO A;  2P67 A;  5C39 A;  3A3Y B;  3L72 G;  1G1J A;  1URQ C;  3D71 A;  4DJG A;  3I55 P;  3L71 G;  1J1D C;  3TYY A;  3HD7 D;  1KC8 Q;  2P7J A;  1VQ7 P;  1N73 C;  5GTI E;  1LWU A;  5DJT B;  4IFD K;  3BAT A;  3U1A A;  1SQB J;  3CWB G;  2RN0 A;  2KSJ A;  1NKN A;  2KNC A;  2HPC B;  2WSC H;  2O01 J;  3LIE A;  2VRS A;  1OWA A;  3VTP C;  2R44 A;  2B87 B;  2E75 C;  3RK2 C;  1VQM P;  2IBZ D;  2KSE A;  4UB8 E;  1LT9 A;  3Q1M A;  4PD4 D;  2E42 A;  5KLV D;  1MFZ A;  3SWF A;  3B4S A;  1YJ9 P;  1LTS C;  5KAI H;  3RK3 B;  3V5B A;  5KLI B;  1L0L E;  4BWN A;  3PHL A;  2WPQ A;  2D2C C;  2KXP B;  1NOH A;  2IFN A;  2N9Y B;  3CX5 D;  1IZN B;  1VDF A;  2L91 A;  2K3R A;  1JOC A;  1SFC D;  1OX3 A;  1NTZ E;  1P84 H;  2WVR A;  3FWN A;  1EZV D;  3CWB E;  3CCS P;  3TNU A;  3GHG C;  3AE6 C;  4A7P A;  4TT3 H;  1S72 P;  3H1H E;  1SQP J;  3LW5 J;  1AJY A;  1OW7 A;  3BCC D;  2YNY A;  1EDJ A;  2P1J A;  5AVQ B;  5H2F E;  4WY4 B;  3GMA A;  2FYU G;  3H1K G;  1LTB C;  2JDI H;  1U7J A;  3AEG C;  3IN6 A;  3Q5S A;  4NPE A;  1KYO I;  2N1T B;  2K9J A;  2Y0C A;  3KYQ A;  2NPS C;  3WUT A;  2O01 H;  2LXB A;  2WSF J;  1YQ3 C;  2AEF A;  2QM7 A;  1OMI A;  3L73 E;  2M5A B;  3L72 J;  4PJ0 H;  3MHV A;  2CK3 H;  1XTC C;  4ZKP A;  2WT7 A;  5AW6 B;  4NPF X;  1X9V A;  1FJP A;  3L71 J;  1LWU C;  1DX7 A;  1QLE D;  2LXC B;  2IZ1 A;  2BEZ F;  2K37 A;  1VPC A;  3RL0 g;  3CI9 A;  3CCR P;  4RJT A;  2RMZ A;  3HD7 A;  1NVO A;  2M8R A;  4OGQ D;  3EWK A;  1L0N G;  4I7Z B;  3D70 A;  3S9O A;  1FDM A;  2BCC D;  2RKL A;  4Y28 J;  2WWW A;  1LT9 C;  2AXT E;  5AW5 B;  1KD1 Q;  2FY8 A;  3L36 A;  3M9Q A;  2ZYA A;  2A45 G;  2K1A A;  1LP1 B;  4OVN F;  4XA4 A;  4LGD E;  1RE4 A;  4DT0 A;  3LW5 H;  1VQ4 P;  5KJ7 C;  3H1I D;  1FBM A;  3VP9 A;  3D6Y A;  5E79 E;  1OZH A;  2WMM A;  2NZ2 A;  2JWA A;  1ZR2 A;  1IO4 A;  1W2B O;  1S2E A;  3O6Q A;  5AW4 B;  2W6J H;  4W80 A;  2E5Y A;  3CX5 E;  3IFM A;  5KLV K;  3PJS K;  1JNM A;  4EDF A;  1URQ B;  4ZKU A;  1RE3 A;  1NU1 D;  2M3B A;  1FZF A;  2A06 D;  1J1D B;  4D6T G;  4RKU J;  3AE4 C;  2ITA A;  4YXW H;  2LKM A;  3GF3 A;  3V4W A;  3V2P A;  1GZL A;  1ZRT D;  1N73 B;  1M1K Q;  1L0N E;  3CCL P;  4ASW A;  1FZE A;  4HKZ H;  4HYT B;  2C0X A;  1ZW0 A;  2H8P D;  3L74 D;  4M3L A;  2OTL P;  3HE4 B;  2FYU J;  2P2U A;  3H1K J;  5B5E E;  4H13 D;  2FYZ A;  3H1J E;  1HF9 A;  3RK2 B;  2E75 B;  2FFD A;  3L75 E;  1IFM A;  3G9R A;  2LR2 A;  4KHX A;  1BGY J;  1K73 Q;  1YI2 P;  3AEE C;  1LTA C;  2YXQ B;  4U3F G;  2QA4 P;  3HUS A;  1SQX E;  5KAF H;  3CCV P;  1IJD B;  2BAS A;  1S5L X;  1FOS F;  1YIT P;  3M91 A;  3TGU G;  1PGP A;  2D2C B;  1Y8A A;  2HOD A;  2M0B A;  2JJL A;  1NTM G;  3HD7 C;  1VQL P;  2CPB A;  3A0B H;  3V2N A;  3AEB C;  1EC5 A;  1FAV A;  1NJI Q;  5BU8 B;  1NH4 A;  3CCQ P;  2AEJ A;  1RF0 A;  1BCC D;  1EDK A;  1RE4 C;  2WTY A;  3IAO A;  1GW3 A;  2V7Q J;  2ZT9 D;  1L4A D;  2H43 A;  3KPE A;  3H1I E;  1VF5 B;  2ZVN B;  2Y9Z A;  2ZAE B;  3II6 A;  3G6E P;  2PFX A;  1FZC A;  3CCJ P;  1EQ7 A;  2YKO A;  4H0L D;  5AVU B;  2KS1 A;  2Q9I A;  1YTZ T;  1IFJ A;  1RE3 C;  1ZXG A;  2HLO A;  1G2C A;  3C1L A;  4C7N A;  1IC2 A;  1BE3 D;  4DCK A;  1NTM E;  1AVY A;  1KB9 H;  1LWU B;  4D6T J;  1ZRT E;  2G8Y A;  4L75 A;  1LJ2 A;  2CPS A;  3FWL A;  1R5L A;  2MKV A;  3OA7 A;  1K9M Q;  2XDJ A;  4WY4 C;  2KNC B;  3VMX A;  5KAI E;  2AXC A;  3LID A;  2OTK E;  3RL0 D;  2ZYG A;  3S1K A;  1JB0 J;  3WUU A;  1EDI A;  1HJB A;  1JM0 A;  1FU1 A;  1LT9 B;  1NYH A;  3A0H H;  4YXD C;  1H8A A;  4EI2 A;  3C9I A;  2K9Y A;  3B8E B;  3HUS C;  2QJP C;  3KZI H;  1N2D C;  4U3F J;  1GMJ A;  1P84 E;  2A45 H;  1L0L D;  1NHL A;  2V7Q H;  5APQ A;  3ZDM A;  3EQ2 A;  3M0A A;  3TGU J;  2YMY A;  4DZO A;  2QG4 A;  1KIL E;  3BAS A;  1LT1 A;  1YJN P;  2GUV A;  3SFE C;  3PH0 A;  3TNU B;  1NTZ D;  1CZQ A;  1RF0 C;  2HR3 A;  1SQB E;  1JY2 N;  1SQV J;  3CWB D;  3FXE A;  3H1H D;  3VOP A;  5TIS H;  1BCC E;  4BRY A;  3H1L J;  3CX5 I;  4PJ0 E;  2ZXE B;  2Y0E A;  1NTK G;  1VQN P;  2KP8 A;  2XU6 A;  2GA1 A;  4OGQ C;  1VQO P;  2WZ7 A;  3TDK A;  1JTH A;  2QM8 A;  2K9J B;  1TU3 F;  1SS1 A;  5AW0 B;  3GG2 A;  1MFT A;  2FYN C;  1EXI A;  1W5C E;  3MP7 B;  1PGQ A;  3L73 D;  1WMK A;  1L4A A;  2WT7 B;  2I1K A;  4O9B A;  1X79 B;  1PPJ G;  4OH8 B;  1J2J B;  3N4X A;  1LNQ A;  1BE3 E;  2HG5 D;  1K8A Q;  2C9L Y;  2J59 M;  3WU2 H;  3P8C E;  4XFJ A;  3G4S P;  2Q1K A;  1SQP E;  3HD7 B;  3VP8 A;  3O8Z A;  1VL2 A;  1KFN A;  3JCU H;  1LTT C;  4GOF A;  3AE5 C;  1HBW A;  1DIP A;  3MUD A;  1KQS O;  3EFF K;  2KLV A;  4YPC A;  1SQP K;  3IF4 A;  1CW5 A;  3CC7 P;  4H13 C;  1RF1 A;  1Q86 Q;  1KB9 D;  5KKZ C;  5CCG D;  3L72 E;  4N6J A;  5AW9 B;  3O6Q B;  1KYO H;  1GL2 D;  3AE3 C;  3L71 E;  4LLH A;  4EYY Q;  3L70 G;  1YJW P;  4PV1 D;  1H89 A;  1N86 A;  4IL6 H;  2YKQ A;  2QEX P;  1L0L K;  3F5H A;  1HWT C;  1BSN A;  3CMA P;  4ZMD A;  1EDL A;  3SWK A;  2E43 A;  1Q7Y Q;  1L0N D;  1EXJ A;  1NKZ B;  1N7S D;  1SFC B;  2KLU A;  5KAF E;  1ZOY C;  3HTK A;  1NTK J;  2E74 D;  3L35 A;  3CLQ A;  1QVF O;  1FC2 C;  1H0T A;  1NTZ K;  2Y0D A;  1VF5 C;  2FFD B;  3H1J D;  3CXH H;  1QL2 A;  3L75 D;  5KTB A;  1T2K D;  2PP6 A;  2ZT9 C;  1L4A C;  2PGD A;  1BGY G;  3HUS B;  2QJP B;  4LC1 A;  1KQG B;  1X0T A;  2WPR A;  3A0B E;  2JP3 A;  1SQX D;  4ZNC A;  1HGV A;  2W6B A;  3BRT B;  2KIK A;  2IBZ G;  1YQ4 C;  3ITK A;  4H0L C;  1IFN A;  1UIX A;  5GTH H;  5KLV G;  2HOD B;  3U1C A;  2C0W A;  1IFP A;  3M0D A;  1JMM A;  2QRX A;  1DD4 A;  5TJH A;  2FKW B;  4JQ0 D;  1PZQ A;  1JCD A;  5AVY B;  2WQY C;  2K88 A;  3S4R A;  3MUD C;  3CCE P;  2NRG A;  1KQL A;  2FYU E;  3H1K E;  3USS A;  1X8Y A;  1LTJ A;  3WMM 0;  1RF1 C;  1PFI A;  2IDB A;  1JY3 N;  1N8R Q;  5EFW B;  1GDT A;  1RH5 B;  1EZV G;  4C7R A;  4OGQ B;  1BGY E;  2QE7 H;  1U7M A;  2L5G B;  4N3Y B;  3A5T A;  2KOG A;  2IPP A;  3K5B A;  1KB9 E;  1FZC B;  2O01 N;  3P7K A;  3BCC G;  3V2Q A;  2KS1 B;  1Y47 A;  3RK3 E;  2OYO A;  2FYN B;  3H25 A;  2R5B A;  2OYH B;  3TGU D;  1Q2N A;  3SWY A;  1K05 A;  4GDO A;  3EFG A;  1G2C B;  4C7N B;  1Z56 A;  3L70 J;  3V2R A;  1VQ6 P;  2MJZ A;  2KB7 P;  5CCG A;  2WSF H;  3TSI A;  1NTM D;  4EOT A;  4B86 A;  3A0H E;  2JWD A;  1GL2 A;  3VYI A;  1QVG O;  4EIJ A;  3KZI E;  4KJM A;  4JBZ A;  1KV4 A;  3AEF C;  1OVU A;  3R2P A;  3W67 A;  3T97 A;  1SFC A;  2OYI A;  3L4F A;  1OVR A;  1SQQ G;  1GU5 A;  2YXR B;  1ZLL A;  3HE5 A;  2XZR A;  1L0N K;  2G3A A;  1N7S A;  4GIF A;  2V4H A;  1FZG A;  1BDD A;  2PRR A;  2B89 A;  4H13 B;  3SSU A;  2QJK B;  2BCC G;  1RY3 A;  5CCH D;  3MTU E;  1P84 D;  3MD0 A;  5KKZ B;  4I2L C;  1D7M A;  3G71 P;  3M0D C;  5TIS E;  2R32 A;  1OW8 A;  4GOD A;  5KLV J;  5AW7 B;  1KIL D;  4D6T E;  2Z5H A;  3NFQ A;  3NMD A;  2W90 A;  5AW2 B;  1SQX K;  2YO3 A;  2Q3E A;  2JO1 A;  1SQB D;  1LTJ C;  1SQV G;  4DOJ A;  4BRY B;  1M1J A;  2B88 A;  1W2E A;  1N7L A;  1FOS E;  3CL3 D;  4RO0 A;  1NU1 G;  3H1L G;  3CCM P;  2A06 G;  3NXS A;  2IYO A;  4H44 D;  1JTH B;  2SPZ A;  1HTL C;  1T6A A;  3F89 A;  2JKV A;  5AW1 B;  1AA0 A;  2O1J A;  4U3F E;  3MIW A;  2YIU C;  3BCC J;  2W83 C;  3WU2 E;  3L74 G;  1S9K E;  2ZT9 B;  1PP9 G;  1L4A B;  3TGU E;  1FS0 E;  2IFM A;  2NPS D;  2J58 A;  2M3E A;  5CCG C;  1JY2 P;  2OYH A;  3JCU E;  1RQU A;  3NTN A;  4GOE A;  3M06 A;  1MKM A;  1GL2 C;  1FE6 A;  4H0L B;  3TF5 A;  1AQT A;  1VQP P;  1OIP A;  1SQV E;  4N78 E;  1KN7 A;  3P8C D;  1SFC C;  2OYI C;  1SQP D;  4PD4 H;  2YO2 A;  3TK1 A;  4IFM A;  2QIW A;  1KMI Z;  3B5N D;  1NTM K;  1NTK D;  3RGU A;  1SQQ J;  1S3J A;  2FFD C;  1KYO E;  5CBN A;  1X22 A;  3V4Q A;  4W7Y A;  4AQR D;  1HVV A;  1DD3 A;  1AQ5 A;  2E74 C;  1RF1 B;  3GLM A;  2XKM A;  4IL6 E;  1PIX A;  1QL1 A;  4W7Z A;  2BCC J;  5CMZ A;  1JY2 O;  3L72 D;  3RBX A;  2BEQ D;  5KJ7 D;  3AEC C;  1T2K C;  4R4M A;  4WBA A;  1KTM A;  2N9B A;  2Q5U A;  1JCC A;  5B66 H;  3L71 D;  4L76 A;  3M9B A;  1USE A;  3H1I J;  1KOR A;  1E5W A;  5APY A;  5CCH A;  2GM4 A;  2ZVO B;  3CC4 P;  1KB9 I;  1M1J C;  3OW2 O;  3QH9 A;  4AUW A;  3CC2 P;  3A2A A;  3C8V A;  3AE1 C;  3CXH E;  3KQG A;  1FJK A;  4JF7 A;  4IFF A;  1R8E A;  1NAY A;  1KIL A;  3HTK B;  1FZB A;  1M57 D;  3W68 A;  1NU1 J;  2IX7 C;  2WSE J;  1H0T B;  4L74 A;  1Y9B A;  5AVT B;  4K35 A;  1R5S A;  1BDC A;  1SQB K;  1OFC X;  1FZC C;  2H7H A;  3AE9 C;  2XV5 A;  3Q3D A;  5GTH E;  1CI6 A;  2E76 D;  1G1I A;  1M90 Q;  1K04 A;  1S4X A;  3GHG A;  3L74 J;  2WPV B;  1S5L H;  1DEE G;  5DJU B;  1PP9 J;  2OYH C;  3FGA D;  3AED C;  4HB1 A;  1M56 D;  3QWO C;  2A45 I;  3SFD C;  1RHZ B;  2Q3I A;  2OGU A;  4JYC A;  4I6M C;  2W6A A;  2NPS A;  2Y9Y A;  5AW8 B;  1L0L G;  1T8Z A;  1IK7 A;  5CJ4 A;  2POH A;  2ZFC A;  2FXP A;  2OQQ A;  3R4Y A;  3H32 A;  1LTJ B;  1NTK E;  2ZYD A;  1L2P A;  1BSH A;  1OW6 A;  2FYU D;  3H1K D;  3FX0 A;  3G3Z A;  1KZU B;  4R4L A;  1NTZ G;  5AVX B;  3M9H A;  1IFD A;  4TLF A;  1BGY D;  2XNX A;  4RES B;  2QJK C;  3B5N A;  1MZ9 A;  2Q7C A;  2JEE A;  3H1H G;  1NTK K;  2I8D A;  1BCC J;  2I1J A;  2WSE H;  2R3C A;  1FZA A;  3VN0 A;  1HJ0 A;  2YIU B;  1PPJ E;  1PGO A;  3RK3 D;  1GTW A;  5CCH C;  4QMA A;  4BXL A;  2J5U A;  3B71 A;  1FDI A;  2RH0 A;  4WVZ A;  5KJ7 A;  1GL2 B;  3PLN A;  3RBZ A;  1T3J A;  2H88 C;  2IZ0 A;  1DH3 A;  1SP4 A;  1KIL C;  1YIJ P;  1JMB A;  3L73 G;  1JY3 P;  3MZW B;  4PV1 B;  5APV A;  1GU4 A;  1GW4 A;  3KXD A;  2R3S A;  4Y99 C;  2YMK A;  1BE3 J;  3T97 B;  2OYI B;  1Q81 Q;  3OAK A;  1KQF B;  3P8M C;  4UB6 H;  4WY4 D;  3AEA C;  3HE5 B;  4I1L A;  3HRN A;  2P58 A;  1N7S B;  4KT0 J;  1KFM A;  1Q90 D;  3Q5R A;  5AVS B;  3PRJ A;  2KYV A;  1DEB A;  1Q82 Q;  4H44 C;  2E74 B;  2N1T D;  4OWF A;  4ASV A;  3L70 E;  3JC2 2;  4K3A A;  3P32 A;  2WIT A;  4HJG H;  3U59 A;  1MUU A;  1FDO A;  3VMY A;  2JR8 A;  5AVV B;  1JY3 O;  4D6T D;  1NWQ A;  1VQ8 P;  1L0L J;  1P84 I;  1YTZ I;  1M1J B;  1YHQ P;  3OJA B;  5AVW B;  4C46 A;  1SQQ D;  1ZV8 A;  5APS A;  2WSS H;  1GK4 A;  3Q2Y A;  1NTZ J;  3B5N C;  2ZXX A;  3AE2 C;  3CWB J;  3FXD A;  2IYP A;  2XND H;  1GD2 E;  3RL0 C;  3H1H J;  2R5D A;  3CXH I;  3ABV C;  4U3F D;  2FYU K;  1U57 A;  2HPC A;  1WRG A;  1VQ9 P;  2IBZ E;  1S9K D;  1H88 A;  2QVA A;  5GTI H;  2B87 A;  5APX A;  1PGJ A;  2Z5I A;  4PD4 E;  1J1E C;  3UIA A;  5KLV E;  3H1J G;  4AYC A;  4NPD A;  3L75 G;  1URQ D;  3BVH A;  4CPG A;  1JO5 A;  1LTI C;  3L73 J; 
#chains in the Genus database with same CATH homology
 1SQV J;  1P84 I;  3TGU J;  3CWB J;  3L70 J;  1EZV I;  2IBZ I;  3H1J J;  1SQB J;  3L71 J;  1KYO I;  1SQP J;  1L0N J;  1BGY J;  3H1H J;  3L75 J;  1BE3 J;  5KLV J;  3H1I J;  3BCC J;  3CXH I;  4PD4 I;  1BCC J;  3H1L J;  3L74 J;  1NU1 J;  2BCC J;  4U3F J;  3CX5 I;  1SQQ J;  1PP9 J;  1NTK J;  1NTM J;  2FYU J;  3H1K J;  3L73 J;  4D6T J;  3L72 J;  1KB9 I;  1SQX J;  1L0L J;  1NTZ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...