3PH0A

Crystal structure of the heteromolecular chaperone, asce-ascg, from the type iii secretion system in aeromonas hydrophila
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
65
structure length
60
Chain Sequence
MMTNLETRLSGADPVFARELHAQLVQALGDVKRRLLQQYQQWQQEADAIEAGLNIIEKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords AscE
publication title Crystal structure of the heteromolecular chaperone, AscE-AscG, from the type III secretion system in Aeromonas hydrophila
pubmed doi rcsb
source organism Aeromonas hydrophila
total genus 21
structure length 60
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08988 T3SS_needle_E Type III secretion system, cytoplasmic E component of needle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 3ph0A00
4WWIA 4HB1A 1DEEG 4EYYQ 1U7JA 1Q2NA 3PH0A 1MFTA 5C39A 5CBNA 5DJTB 1EDIA 4GODA 4NPFX 4ASVA 1JM0A 1ZXGA 2B87A 2JWDA 1BDDA 4BXLA 2QRXA 2KI7B 2RKLA 1S3JA 2SPZA 1EDJA 2ZAEB 5EFWB 4GOFA 2UWJE 4HJGH 2R44A 1BDCA 4GOEA 2KUBA 2KIKA 4MN4C 5CBOA 5K5GB 1LT1A 1FC2C 2B87B 3S1KA 2I8DA 1EC5A 2KZIA 1JMBA 3QWOC 1OVVA 1LP1A 1Y47A 2KZJA 2KS1B 1H0TA 4ASWA 4NPDA 2B89A 2M0BA 5DJUB 4IOIH 3FXDA 3RGUA 2LR2A 2M5AA 2P58A 2WMMA 1U7MA 4NPEA 2LXBA 4K35A 3MHVA 1NVOA 3FXEA 1EDLA 4JBZA 2K3RA 4ZMDA 1OVUA 1LP1B 4HKZH 1ZW0A 2OTKE 2LXCB 1H0TB 1OVRA 1SS1A 2Q1KA 1EDKA 2B88A 1X0TA 2M5AB 2HR3A 4KJMA 4K3AA 2QVAA 4CPGA 3ZDMA 3MZWB 4ZNCA
chains in the Genus database with same CATH superfamily
3CCLP 1KZUB 3B5NC 1NTKG 2K9JA 1N73C 1N2DC 2E5YA 2GUVA 1L2PA 2JDIH 4XA4A 3GF7A 3GHGC 1SQVJ 2KXPB 2Y9ZA 1Q7YQ 5APQA 3Q3DA 1M1JB 3AEBC 2QJPC 1GW3A 3CCVP 5KAIE 1RE3A 3HE5B 3VMYA 3H1KE 2QM8A 4BRYB 1AJYA 1JB0J 4WY4A 4HJGH 5AW8B 3O6QA 4GOEA 5H2FE 5KLVJ 1MFZA 1A02F 2E74C 1AV1A 5K5GB 1JTHB 2FYNB 3F89A 1DEBA 3A0HE 4D6TD 1VF5B 3MGNA 1T8ZA 2NPSD 2HPCA 4L74A 5AVSB 3P8CD 2OYHA 1BCCE 1OFCX 1OX3A 3L72E 4IFDK 4IL6X 1W5CE 3H1KG 4A7PA 1SQXJ 3B71A 1RE3C 4U7JA 1S5LE 2YKOA 1OVRA 3L37A 1P84E 2Q5UA 1IFDA 3LIDA 4WY4C 5KLIB 1T2KC 3RBZA 3H1HG 1K04A 3P32A 1HWTC 1NTZK 1RE4C 4KHXA 2WSCJ 2XNXA 1HJBA 4H13D 4JPZB 1JO5A 1BCCG 1L4AB 4JYBA 5AW1B 3L72G 3RK3D 2OYHC 3L70E 2M3EA 1JY2P 3TGUJ 3H6PA 4H44C 3CLQA 1XTCC 1ZOYC 2POHA 2JR8A 3RK2B 1J1DC 2WPVB 2QRXA 3A7OA 5CJ4A 4Y99C 2SPZA 1M8OB 1ZN5A 2IBZG 2KS1A 2P1JA 3V2RA 4H0LD 2KLUA 1VQ4P 2WQYC 2WSEJ 1E5WA 2I8DA 2A45I 5KLVE 2P67A 1NTMD 2E75C 3M9HA 3L70G 1PL5A 3KXDA 2QSIA 1JCDA 1SQVG 3OJAB 2Y0EA 2I1JA 5GTHE 1KQLA 1NOHA 3H25A 2YO2A 5KTBA 1R8EA 1DH3A 1LTSC 1LP1B 3P8MC 4HKZH 3CMEP 2QJKC 1KILA 5APYA 2Q3IA 1BSNA 1FS0E 1MZ9A 5KLVG 1EQ7A 2P7JA 4PJ0E 3ZDMA 2FBWC 3MZWB 5AW0B 1VQ6P 3L71J 5AVQB 2L5GB 1DIPA 3RK3E 1IO4A 1LNQA 2O01N 3L74D 2IX7C 2KSJA 4RKUJ 1N7LA 1SQXG 3TNUA 2AXCA 4BXLA 2A45H 2K1AA 3M06A 1PPJD 4RESB 3ABVC 1VPCA 5CJ0A 1PGOA 1KILC 2O01J 2H43A 1MUUA 4LC1A 3HD7A 3N7NA 1RQVA 5AW6B 1SVFA 2QA4P 3KZIE 1DD3A 5CCHC 3WU2E 3S4RA 2KZJA 1VQPP 2FYUK 4U3FD 3RGUA 2LR2A 2YO3A 1SFCD 1VQKP 1DX7A 5KAFH 4N78E 1J1EC 1FOSE 1NTZJ 3B5NB 4TT3H 1L0NK 1N73B 3VMZA 1MKMA 1JY3N 2O1JA 5B5EH 1ZW0A 1SQPJ 5AVTB 3GHGB 1NU1D 1CW5A 1SQBK 2QJPB 3W68A 3HD7C 3IF4A 3A2AA 1DEEG 5AVWB 3L75J 3L71E 4PD4I 2AEMA 2JKVA 2E74B 4AQRD 1EZVI 4NPFX 3PHLA 3VP9A 3CCEP 2K9JB 3EFFK 1L0LE 2WSSH 1KTMA 3EQ2A 3R4YA 2Q9IA 2IPPA 3L4FA 4H0LC 1AFOA 3U1CA 2CPSA 1VQOP 1NKZB 1EC5A 3CC2P 2R5DA 3L71G 4L73A 5APVA 2L91A 5AVYB 4WY4B 3O6QB 4PV1D 5KKZB 2P58A 1JCCA 2OTLP 3MHVA 1CSBA 1YYCA 1N8RQ 4JBZA 4RO0A 1BE3D 4JYCA 1OVUA 2OARA 3SSUA 1FOSF 3KDPB 4I2LC 3CWBD 3L36A 2HPCB 1GZLA 2OYHB 3AE3C 3BCCE 3H1IJ 1SQPE 4WBAA 1USEA 4PD4H 4H44B 4OGQD 3M9BA 1KB9D 2MKVA 1JMMA 1J1DB 3H1JD 4Y99B 3AEFC 3JCUH 1GL2D 2C9LY 5CCGD 4UB8H 2YXQB 2ZXEB 1IK7A 2JO1A 1PIXA 2AXTE 1NTZG 2E75B 2BEQD 4Z1MH 2KI7B 1SQPG 3L73J 2FYUJ 1LTGC 2ZVNB 5BVZA 3S9OA 1WT6A 4R4MA 1L0NJ 4DZOA 2W27A 3M0AA 4W7YA 3L75G 2QJKB 2KS1B 1H0TA 1HTLC 3H1KD 4IOIH 2WT7B 3PRJA 1G2CA 1N7SD 2RH0A 3JSVC 2FYZA 5GTIE 2Q7CA 1HUCA 3CWBE 1DD4A 1IFJA 1GU5A 3H1HD 3AE7C 1NTKE 1HGVA 5AW3B 3H1LJ 1QLED 1TU3F 2YMKA 1BCCD 3AE2C 3AE9C 3L72D 4WWIA 4YTPC 2H88C 1QGKB 1KILB 3PH0A 2HODB 3Q5RA 1VQ5P 1NTMK 4UB6H 2HG5D 5CBNA 1KQGB 1AQ5A 3V2QA 2IBZD 1URQC 1JY3P 1G1IA 2ZT9D 4XE5B 5KJ7D 2B9BA 1J2JB 2R44A 3H1IG 3WUUA 3SFDC 2KUBA 3L73E 1J1EB 2KIKA 3AE6C 1Q81Q 1LT1A 3T97A 3L70D 2QG4A 3H32A 1SQVD 5E79E 1VQ9P 1EXJA 3HD7B 2QEXP 1OW6A 3CPWO 3MUDA 3NXSA 4W7ZA 1BGYJ 1M56D 2A06G 1KYOD 3B4SA 2GM4A 3H1HE 4I7ZC 5AVXB 3TSIA 3CX5E 4N3YB 4N6JA 5KLVD 3L73G 2FYUG 4OH8B 1WMKA 5CMZA 4ZNCA 1H88A 3Q5SA 3H1LE 3HUSA 2P2UA 4AYCA 3NMDA 4H0LB 1SQXD 1KV4A 2IBZE 3M91A 1FZCA 2ZYAA 5APUA 1PP9J 5AW4B 2B87A 4XFJA 1VDFA 2W6JH 3U59A 3BATA 2VRSA 2FFDA 3H1LG 1NU1K 4W80A 1SQVE 2WWWA 1JMBA 2J59M 1K73Q 1GK4A 3HUSC 1VF5D 3R2PA 2A45G 2Y9YA 4OVNF 3SWKA 2N1TA 3A0BH 2WMMA 5TISE 1KYOE 1FU1A 2D2CD 1FDOA 2Z5HA 1FZCC 1LTTC 2XZRA 1S1CX 1M57D 1KILE 1PGJA 1NWQA 1BGYE 1IK9A 5B66H 2E76D 1SQQJ 2FFDC 1P84I 4IL6E 1YJ9P 1KN7A 2OYIA 1K05A 2YIUC 1GW4A 2HFED 4N78D 4YXDC 3USSA 3GF3A 1ZR2A 2PAJA 1L4AD 1SQXE 2ZYGA 5KAIH 3PTZA 3QH9A 1NH4A 2N1TC 4I1LA 1EDIA 1MV8A 3L35A 3GMAA 1BGYG 1LGHB 2ZYDA 2V7QH 4LGDE 3P7KA 3RK2D 2GUSA 5AVVB 1PP9E 2WTYA 1D7MA 3FX0A 1JUNA 2NPSA 3FWLA 3UIAA 2Z5IA 3CD6P 3A0HH 3L71D 1NAFA 3VN0A 2AEJA 4ZKPA 1PGPA 1HH0A 2OYIC 2J58A 2QJYC 2R3SA 3QWOC 3K5BA 5AW5B 3TGUE 1YTZI 3V6IA 4AUWA 2IZ1A 4ASWA 2W8ZA 1L0LD 4NPDA 2M0BA 3FXDA 1S5LH 2CPBA 3V4WA 1FZBA 1P84H 3MP7B 1EDLA 2C9NY 1PP9G 3HE5A 4WVZA 2KK7A 1FZGA 2OTJP 1H0TB 2Z4EA 3NFQA 3D70A 1RHZB 1EZVE 1X0TA 2NPSC 1UIIA 1G2CB 4EIJA 1T6AA 4EOTA 2KOGA 3CXHD 2MJZA 3D6YA 1SQQE 1URQB 3RL0g 3TGUG 3GG2A 1GK6A 3G71P 1UIXA 2BCCJ 2N9BA 1U7JA 3V2PA 2ZVOB 5AW7B 3VTPC 2R3CA 1NU1J 3BCCD 1E79H 1SQPD 3I5CA 1ZXGA 3RL0D 1EXIA 1EZVG 1ZMEC 1VL2A 4H13C 1M90Q 2NRGA 3RBXA 2UWJE 1SQQG 1ZP0C 3RK3C 2KNCA 3L75D 3PJSK 4I7ZB 3MTUE 2WPQA 5APSA 3G9RA 2FXPA 2XDJA 1RY3A 3T97B 4K35A 2D2CC 3KPEA 4C7RA 3H32B 3O8ZA 3HE4A 2W90A 2Y0CA 3M9QA 1IFNA 3CXHE 4IFFA 2E76C 1G1JA 2PGDA 1ZLLA 3CCJP 5APXA 1AA0A 3II6A 2ZXXA 1CI6A 2H7HA 5M1BA 1PFIA 3A5TA 3AEEC 1NTZE 1ZR4A 2BCCE 1YHQP 2C0XA 2AEFA 1SQVK 1LJ2A 3CI9A 2OGUA 1OW8A 1AVOA 3CMAP 1NTKD 1FDMA 1KQFB 3VYIA 1R5SA 1FZFA 2LKMA 1YI2P 3H1ID 1S3JA 4C46A 3H1JJ 1FAVA 2IDBA 5BU5A 3L75E 3WUVA 3WU2H 5KLVK 2DW3A 1SFCA 1FZCB 1JY2N 2J5UA 1FC2C 2B87B 2KP8A 2JP3A 2BCCG 1KD1Q 1GU4A 1Y47A 2FXOA 1JNMA 2FFDB 5L8RJ 3LIEA 2A06D 4DT0A 3V4QA 2C0WA 2KB7P 2YIUB 2H8PD 1YJWP 1SQXK 3L73D 4M3LA 2FYUD 3C8VA 1K9MQ 4GT1A 2N1TB 3Q1MA 1SQBJ 4K3AA 1LWUA 4H44D 1SFCC 1KQSO 3VMAA 3FWNA 4HB1A 1SLQA 2V7QJ 1NGMB 5APWA 1OZHA 3E1IA 3W67A 2O3JA 3GLMA 2WPSA 1MFTA 3IFMA 3CX5D 1QL1A 4C7NA 2OYIB 4L76A 2QJYB 1YQ4C 2WSFH 3H1IE 1S4XA 3RL0C 2E75D 1BCCJ 4WB4A 1JY2O 1EDJA 3F5HA 5EFWB 2O01H 3H1LD 3GHGA 1RF1A 2KSEA 4LLHA 1GD2E 3N4XA 1LWUC 3HTKA 3D71A 3VOPA 5AVZB 2YXRB 2QM7A 2Y0DA 1X9VA 4YXWH 1RQUA 1SP4A 1JEKA 1RH5B 3Q5PA 1S5LX 2A06E 1VQNP 4EDFA 3E7KA 2NPSB 3OA7A 3ITKA 1NYHA 2JEEA 2HYNA 2BASA 2FYUE 2IYOA 2W83C 3TNUB 1Q82Q 1JOCA 2WZ7A 3L70J 1L0NE 3AE5C 1FJPA 1GL2A 2Q1KA 3V2NA 3H1JG 2K9YA 5CCGA 1RF1C 1H89A 4PV1C 1Y8AA 1GMJA 5CHXA 4CPGA 3AEDC 2GA1A 4O9BA 1KC8Q 1KB9I 1SQBE 1LT9A 3LW5H 3OW2O 4H13B 2YKPA 1LTJA 1M7LA 3V5BA 1K8AQ 1KILD 2AXTH 1BSHA 3RK3B 4D6TJ 1BGYD 2IYPA 1NAYA 3CCUP 1KMIZ 1QVFO 1L0LK 5DJTB 4BWNA 4OGQC 4ASVA 1JM0A 1RE4A 2ITAA 1L0NG 1YIJP 2M3BA 5CCHD 3AECC 1OW7A 2XNDH 2R32A 1Y9BA 4OWFA 2ZAEB 3AE1C 1GL2C 4GOFA 3CCSP 5CCGC 3WUTA 3TF5A 1SQBG 3WMM0 2D2CB 1N7SA 1YQ3C 3MUDC 3B8EB 3PP5A 3A3YB 2KZIA 1LT9C 2RMZA 1YBKA 1OVVA 1IZNB 4Y28J 2IFNA 1ZRTD 1LTJC 2N9YB 5GTIH 2E76B 2B89A 3BRVB 3M0DA 3Q2YA 1PP9D 3HD7D 5KKZC 2KNCB 2M5AA 2OQQA 1U7MA 4NPEA 1NVOA 3NTNA 2R5BA 3AE8C 1KB9H 1T3JA 2JJLA 5KAFE 1SQPK 3TGUD 3KHUA 1EDKA 3TDKA 3CX5I 1FZAA 3TK1A 1GDTA 1X8YA 5B5EE 1N7SC 2PFXA 3FGAD 3HE4B 2WPRA 1XTGB 1IFIA 3C9IA 5KJ7A 1NTMJ 2YMYA 3C1LA 4PD4D 4DOJA 3M0DC 4QMAA 1Q90D 2WT7A 1OXZA 1X22A 1EZVD 3CC7P 2I1KA 1GTWA 4D6TE 1CI6B 2IBZI 2ZFCA 1W2EA 2Q3EA 5APTA 2JWDA 3AE4C 1BDDA 1SQQD 3TYYA 3P8CE 2JWAA 1FE6A 1IFMA 3JC22 5E79H 4MN4C 3U1AA 2G8YA 1ZRTE 2H89C 3G4SP 2QE7H 1M1KQ 2ZJSE 5H2FH 2ZT9C 5KJ7C 2FKWB 2HODA 5DJUB 3I55P 4D6TG 1SFCB 3G6EP 3CX5H 1HVVA 1NHLA 3EFGA 3L74J 1KYOI 5CCHA 3OAKA 1PZQA 1NTKK 4HYTB 1KFMA 3AEAC 2XU6A 2IZ0A 1Q86Q 2O1KA 2QVAA 1L0LJ 3SWYA 4TLFA 1M1JA 1FJKA 2FY8A 3RL0B 1HGZA 2WSFJ 3AEGC 1PGQA 4PD4E 1HF9A 1Q2NA 4BRYA 1LWUB 2K88A 3JCUE 1NTME 4GODA 4JF7A 4U3FJ 1W2BO 4UB8E 3BASA 3IAOA 1JTHA 1LTAC 2RKLA 2PP6A 1QX8A 3GW6A 1BDCA 4C7NB 1QL2A 1T3UA 1NTZD 1QEXA 1LTIC 2BCCD 3BRTB 4GIFA 4B86A 1R5LA 3PLNA 1M1JC 1OWAA 2XV5A 3BCCJ 1VQ8P 5AW2B 2V4HA 5TISH 1KYOH 1S72P 1RF1B 4PV1B 2WVRA 1NTMG 4JQ0D 3HTKB 3CCQP 2M8RA 1VQ7P 2K3RA 3MD0A 1NJIQ 2FYNC 3LW5J 2W6AA 4IL6H 4EI2A 5GTHH 2P10A 1YJNP 2QIWA 1SS1A 1S2EA 3L74E 1L4AA 1VF5C 2K37A 2CK3H 4GDOA 1OMIA 2E43A 2KLVA 2PRRA 2HR3A 3G3ZA 4OGQB 1Z56A 2E5TA 4HH2A 1URQD 4GKGA 2W6BA 3IR9A 3B5ND 1PPJE 3I56P 3KQGA 2YKQA 1GL2B 4EYYQ 4PJ0H 1AVYA 3MIWA 4YPCA 1FDIA 2G3AA 1NO4A 1ZV8A 5KLIC 2IFMA 4IFMA 4KT0J 1N86A 1LT9B 2WSCH 5AVUB 3SFEC 4UB6E 3L74G 1LTJB 1A02J 4U3FE 3CC4P 4R4LA 1BE3J 1L4AC 2YNYA 1JY3O 3CWBJ 3CCMP 3SWFA 1VQMP 2E74D 2HLOA 1PPJG 1L0LG 2E42A 2Q6QA 1IFPA 1RF0A 2XKMA 1IJDB 1NTKJ 1WRGA 3HUSB 1PV3A 1NU1E 1LP1A 3RK2C 3IN6A 1QVGO 3CCRP 1FZEA 3KZIH 1N7SB 4DJGA 1NKNA 2WSEH 4U3FG 3FXEA 4ZMDA 2OTKE 1H8AA 5BU8B 1U57A 4WY4D 2B88A 2M5AB 3CL3D 4KJMA 1T2KD 1KFNA 3CXHI 1S9KD 1NU1G 1RF0C 2RN0A 3BCCG 2WITA 2BEZF 1VQLP 1L0ND 5C39A 4I6MC 5TJHA 3H1KJ 3E1RA 2ZT9B 1SQBD 2OYOA 1USDA 1CZQA 3H1HJ 1BE3E 1FBMA 5CBOA 5AW9B 3EWKA 1URQA 3S1KA 1HJ0A 3BVHA 3B5NA 1N73A 1LTBC 3L72J 3KYQA 2KYVA 2FXMA 1KB9E 1KORA 3D6ZA 4DCKA 3VMXA 3H1JE 2LXBA 3VP8A 3CXHH 3A0BE 1HBWA 2LXCB 1YITP 1IC2A 1AQTA 1OIPA 1BE3G 5AVRB 3HRNA 1SQQK 2NZ2A 2N1TD 1S9KE 1X79B 1P84D 3CWBG 1YTZT 4RJTA 4ZKUA 4L75A 5B66E
chains in the Genus database with same CATH topology
4WWIA 4HB1A 1DEEG 4EYYQ 1U7JA 1Q2NA 3PH0A 1MFTA 5C39A 5CBNA 5DJTB 1EDIA 4GODA 4NPFX 4ASVA 1JM0A 1ZXGA 2B87A 2JWDA 1BDDA 4BXLA 2QRXA 2KI7B 2RKLA 1S3JA 2SPZA 1EDJA 2ZAEB 5EFWB 4GOFA 2UWJE 4HJGH 2R44A 1BDCA 4GOEA 2KUBA 2KIKA 4MN4C 5CBOA 5K5GB 1LT1A 1FC2C 2B87B 3S1KA 2I8DA 1EC5A 2KZIA 1JMBA 3QWOC 1OVVA 1LP1A 1Y47A 2KZJA 2KS1B 1H0TA 4ASWA 4NPDA 2B89A 2M0BA 5DJUB 4IOIH 3FXDA 3RGUA 2LR2A 2M5AA 2P58A 2WMMA 1U7MA 4NPEA 2LXBA 4K35A 3MHVA 1NVOA 3FXEA 1EDLA 4JBZA 2K3RA 4ZMDA 1OVUA 1LP1B 4HKZH 1ZW0A 2OTKE 2LXCB 1H0TB 1OVRA 1SS1A 2Q1KA 1EDKA 2B88A 1X0TA 2M5AB 2HR3A 4KJMA 4K3AA 2QVAA 4CPGA 3ZDMA 3MZWB 4ZNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WWI A;  4HB1 A;  1DEE G;  4EYY Q;  1U7J A;  1Q2N A;  3PH0 A;  1MFT A;  5C39 A;  5CBN A;  5DJT B;  1EDI A;  4GOD A;  4NPF X;  4ASV A;  1JM0 A;  1ZXG A;  2B87 A;  2JWD A;  1BDD A;  4BXL A;  2QRX A;  2KI7 B;  2RKL A;  1S3J A;  2SPZ A;  1EDJ A;  2ZAE B;  5EFW B;  4GOF A;  2UWJ E;  4HJG H;  2R44 A;  1BDC A;  4GOE A;  2KUB A;  2KIK A;  4MN4 C;  5CBO A;  5K5G B;  1LT1 A;  1FC2 C;  2B87 B;  3S1K A;  2I8D A;  1EC5 A;  2KZI A;  1JMB A;  3QWO C;  1OVV A;  1LP1 A;  1Y47 A;  2KZJ A;  2KS1 B;  1H0T A;  4ASW A;  4NPD A;  2B89 A;  2M0B A;  5DJU B;  4IOI H;  3FXD A;  3RGU A;  2LR2 A;  2M5A A;  2P58 A;  2WMM A;  1U7M A;  4NPE A;  2LXB A;  4K35 A;  3MHV A;  1NVO A;  3FXE A;  1EDL A;  4JBZ A;  2K3R A;  4ZMD A;  1OVU A;  1LP1 B;  4HKZ H;  1ZW0 A;  2OTK E;  2LXC B;  1H0T B;  1OVR A;  1SS1 A;  2Q1K A;  1EDK A;  2B88 A;  1X0T A;  2M5A B;  2HR3 A;  4KJM A;  4K3A A;  2QVA A;  4CPG A;  3ZDM A;  3MZW B;  4ZNC A; 
#chains in the Genus database with same CATH topology
 3CCL P;  1KZU B;  3B5N C;  1NTK G;  2K9J A;  1N73 C;  1N2D C;  2E5Y A;  2GUV A;  1L2P A;  2JDI H;  4XA4 A;  3GF7 A;  3GHG C;  1SQV J;  2KXP B;  2Y9Z A;  1Q7Y Q;  5APQ A;  3Q3D A;  1M1J B;  3AEB C;  2QJP C;  1GW3 A;  3CCV P;  5KAI E;  1RE3 A;  3HE5 B;  3VMY A;  3H1K E;  2QM8 A;  4BRY B;  1AJY A;  1JB0 J;  4WY4 A;  4HJG H;  5AW8 B;  3O6Q A;  4GOE A;  5H2F E;  5KLV J;  1MFZ A;  1A02 F;  2E74 C;  1AV1 A;  5K5G B;  1JTH B;  2FYN B;  3F89 A;  1DEB A;  3A0H E;  4D6T D;  1VF5 B;  3MGN A;  1T8Z A;  2NPS D;  2HPC A;  4L74 A;  5AVS B;  3P8C D;  2OYH A;  1BCC E;  1OFC X;  1OX3 A;  3L72 E;  4IFD K;  4IL6 X;  1W5C E;  3H1K G;  4A7P A;  1SQX J;  3B71 A;  1RE3 C;  4U7J A;  1S5L E;  2YKO A;  1OVR A;  3L37 A;  1P84 E;  2Q5U A;  1IFD A;  3LID A;  4WY4 C;  5KLI B;  1T2K C;  3RBZ A;  3H1H G;  1K04 A;  3P32 A;  1HWT C;  1NTZ K;  1RE4 C;  4KHX A;  2WSC J;  2XNX A;  1HJB A;  4H13 D;  4JPZ B;  1JO5 A;  1BCC G;  1L4A B;  4JYB A;  5AW1 B;  3L72 G;  3RK3 D;  2OYH C;  3L70 E;  2M3E A;  1JY2 P;  3TGU J;  3H6P A;  4H44 C;  3CLQ A;  1XTC C;  1ZOY C;  2POH A;  2JR8 A;  3RK2 B;  1J1D C;  2WPV B;  2QRX A;  3A7O A;  5CJ4 A;  4Y99 C;  2SPZ A;  1M8O B;  1ZN5 A;  2IBZ G;  2KS1 A;  2P1J A;  3V2R A;  4H0L D;  2KLU A;  1VQ4 P;  2WQY C;  2WSE J;  1E5W A;  2I8D A;  2A45 I;  5KLV E;  2P67 A;  1NTM D;  2E75 C;  3M9H A;  3L70 G;  1PL5 A;  3KXD A;  2QSI A;  1JCD A;  1SQV G;  3OJA B;  2Y0E A;  2I1J A;  5GTH E;  1KQL A;  1NOH A;  3H25 A;  2YO2 A;  5KTB A;  1R8E A;  1DH3 A;  1LTS C;  1LP1 B;  3P8M C;  4HKZ H;  3CME P;  2QJK C;  1KIL A;  5APY A;  2Q3I A;  1BSN A;  1FS0 E;  1MZ9 A;  5KLV G;  1EQ7 A;  2P7J A;  4PJ0 E;  3ZDM A;  2FBW C;  3MZW B;  5AW0 B;  1VQ6 P;  3L71 J;  5AVQ B;  2L5G B;  1DIP A;  3RK3 E;  1IO4 A;  1LNQ A;  2O01 N;  3L74 D;  2IX7 C;  2KSJ A;  4RKU J;  1N7L A;  1SQX G;  3TNU A;  2AXC A;  4BXL A;  2A45 H;  2K1A A;  3M06 A;  1PPJ D;  4RES B;  3ABV C;  1VPC A;  5CJ0 A;  1PGO A;  1KIL C;  2O01 J;  2H43 A;  1MUU A;  4LC1 A;  3HD7 A;  3N7N A;  1RQV A;  5AW6 B;  1SVF A;  2QA4 P;  3KZI E;  1DD3 A;  5CCH C;  3WU2 E;  3S4R A;  2KZJ A;  1VQP P;  2FYU K;  4U3F D;  3RGU A;  2LR2 A;  2YO3 A;  1SFC D;  1VQK P;  1DX7 A;  5KAF H;  4N78 E;  1J1E C;  1FOS E;  1NTZ J;  3B5N B;  4TT3 H;  1L0N K;  1N73 B;  3VMZ A;  1MKM A;  1JY3 N;  2O1J A;  5B5E H;  1ZW0 A;  1SQP J;  5AVT B;  3GHG B;  1NU1 D;  1CW5 A;  1SQB K;  2QJP B;  3W68 A;  3HD7 C;  3IF4 A;  3A2A A;  1DEE G;  5AVW B;  3L75 J;  3L71 E;  4PD4 I;  2AEM A;  2JKV A;  2E74 B;  4AQR D;  1EZV I;  4NPF X;  3PHL A;  3VP9 A;  3CCE P;  2K9J B;  3EFF K;  1L0L E;  2WSS H;  1KTM A;  3EQ2 A;  3R4Y A;  2Q9I A;  2IPP A;  3L4F A;  4H0L C;  1AFO A;  3U1C A;  2CPS A;  1VQO P;  1NKZ B;  1EC5 A;  3CC2 P;  2R5D A;  3L71 G;  4L73 A;  5APV A;  2L91 A;  5AVY B;  4WY4 B;  3O6Q B;  4PV1 D;  5KKZ B;  2P58 A;  1JCC A;  2OTL P;  3MHV A;  1CSB A;  1YYC A;  1N8R Q;  4JBZ A;  4RO0 A;  1BE3 D;  4JYC A;  1OVU A;  2OAR A;  3SSU A;  1FOS F;  3KDP B;  4I2L C;  3CWB D;  3L36 A;  2HPC B;  1GZL A;  2OYH B;  3AE3 C;  3BCC E;  3H1I J;  1SQP E;  4WBA A;  1USE A;  4PD4 H;  4H44 B;  4OGQ D;  3M9B A;  1KB9 D;  2MKV A;  1JMM A;  1J1D B;  3H1J D;  4Y99 B;  3AEF C;  3JCU H;  1GL2 D;  2C9L Y;  5CCG D;  4UB8 H;  2YXQ B;  2ZXE B;  1IK7 A;  2JO1 A;  1PIX A;  2AXT E;  1NTZ G;  2E75 B;  2BEQ D;  4Z1M H;  2KI7 B;  1SQP G;  3L73 J;  2FYU J;  1LTG C;  2ZVN B;  5BVZ A;  3S9O A;  1WT6 A;  4R4M A;  1L0N J;  4DZO A;  2W27 A;  3M0A A;  4W7Y A;  3L75 G;  2QJK B;  2KS1 B;  1H0T A;  1HTL C;  3H1K D;  4IOI H;  2WT7 B;  3PRJ A;  1G2C A;  1N7S D;  2RH0 A;  3JSV C;  2FYZ A;  5GTI E;  2Q7C A;  1HUC A;  3CWB E;  1DD4 A;  1IFJ A;  1GU5 A;  3H1H D;  3AE7 C;  1NTK E;  1HGV A;  5AW3 B;  3H1L J;  1QLE D;  1TU3 F;  2YMK A;  1BCC D;  3AE2 C;  3AE9 C;  3L72 D;  4WWI A;  4YTP C;  2H88 C;  1QGK B;  1KIL B;  3PH0 A;  2HOD B;  3Q5R A;  1VQ5 P;  1NTM K;  4UB6 H;  2HG5 D;  5CBN A;  1KQG B;  1AQ5 A;  3V2Q A;  2IBZ D;  1URQ C;  1JY3 P;  1G1I A;  2ZT9 D;  4XE5 B;  5KJ7 D;  2B9B A;  1J2J B;  2R44 A;  3H1I G;  3WUU A;  3SFD C;  2KUB A;  3L73 E;  1J1E B;  2KIK A;  3AE6 C;  1Q81 Q;  1LT1 A;  3T97 A;  3L70 D;  2QG4 A;  3H32 A;  1SQV D;  5E79 E;  1VQ9 P;  1EXJ A;  3HD7 B;  2QEX P;  1OW6 A;  3CPW O;  3MUD A;  3NXS A;  4W7Z A;  1BGY J;  1M56 D;  2A06 G;  1KYO D;  3B4S A;  2GM4 A;  3H1H E;  4I7Z C;  5AVX B;  3TSI A;  3CX5 E;  4N3Y B;  4N6J A;  5KLV D;  3L73 G;  2FYU G;  4OH8 B;  1WMK A;  5CMZ A;  4ZNC A;  1H88 A;  3Q5S A;  3H1L E;  3HUS A;  2P2U A;  4AYC A;  3NMD A;  4H0L B;  1SQX D;  1KV4 A;  2IBZ E;  3M91 A;  1FZC A;  2ZYA A;  5APU A;  1PP9 J;  5AW4 B;  2B87 A;  4XFJ A;  1VDF A;  2W6J H;  3U59 A;  3BAT A;  2VRS A;  2FFD A;  3H1L G;  1NU1 K;  4W80 A;  1SQV E;  2WWW A;  1JMB A;  2J59 M;  1K73 Q;  1GK4 A;  3HUS C;  1VF5 D;  3R2P A;  2A45 G;  2Y9Y A;  4OVN F;  3SWK A;  2N1T A;  3A0B H;  2WMM A;  5TIS E;  1KYO E;  1FU1 A;  2D2C D;  1FDO A;  2Z5H A;  1FZC C;  1LTT C;  2XZR A;  1S1C X;  1M57 D;  1KIL E;  1PGJ A;  1NWQ A;  1BGY E;  1IK9 A;  5B66 H;  2E76 D;  1SQQ J;  2FFD C;  1P84 I;  4IL6 E;  1YJ9 P;  1KN7 A;  2OYI A;  1K05 A;  2YIU C;  1GW4 A;  2HFE D;  4N78 D;  4YXD C;  3USS A;  3GF3 A;  1ZR2 A;  2PAJ A;  1L4A D;  1SQX E;  2ZYG A;  5KAI H;  3PTZ A;  3QH9 A;  1NH4 A;  2N1T C;  4I1L A;  1EDI A;  1MV8 A;  3L35 A;  3GMA A;  1BGY G;  1LGH B;  2ZYD A;  2V7Q H;  4LGD E;  3P7K A;  3RK2 D;  2GUS A;  5AVV B;  1PP9 E;  2WTY A;  1D7M A;  3FX0 A;  1JUN A;  2NPS A;  3FWL A;  3UIA A;  2Z5I A;  3CD6 P;  3A0H H;  3L71 D;  1NAF A;  3VN0 A;  2AEJ A;  4ZKP A;  1PGP A;  1HH0 A;  2OYI C;  2J58 A;  2QJY C;  2R3S A;  3QWO C;  3K5B A;  5AW5 B;  3TGU E;  1YTZ I;  3V6I A;  4AUW A;  2IZ1 A;  4ASW A;  2W8Z A;  1L0L D;  4NPD A;  2M0B A;  3FXD A;  1S5L H;  2CPB A;  3V4W A;  1FZB A;  1P84 H;  3MP7 B;  1EDL A;  2C9N Y;  1PP9 G;  3HE5 A;  4WVZ A;  2KK7 A;  1FZG A;  2OTJ P;  1H0T B;  2Z4E A;  3NFQ A;  3D70 A;  1RHZ B;  1EZV E;  1X0T A;  2NPS C;  1UII A;  1G2C B;  4EIJ A;  1T6A A;  4EOT A;  2KOG A;  3CXH D;  2MJZ A;  3D6Y A;  1SQQ E;  1URQ B;  3RL0 g;  3TGU G;  3GG2 A;  1GK6 A;  3G71 P;  1UIX A;  2BCC J;  2N9B A;  1U7J A;  3V2P A;  2ZVO B;  5AW7 B;  3VTP C;  2R3C A;  1NU1 J;  3BCC D;  1E79 H;  1SQP D;  3I5C A;  1ZXG A;  3RL0 D;  1EXI A;  1EZV G;  1ZME C;  1VL2 A;  4H13 C;  1M90 Q;  2NRG A;  3RBX A;  2UWJ E;  1SQQ G;  1ZP0 C;  3RK3 C;  2KNC A;  3L75 D;  3PJS K;  4I7Z B;  3MTU E;  2WPQ A;  5APS A;  3G9R A;  2FXP A;  2XDJ A;  1RY3 A;  3T97 B;  4K35 A;  2D2C C;  3KPE A;  4C7R A;  3H32 B;  3O8Z A;  3HE4 A;  2W90 A;  2Y0C A;  3M9Q A;  1IFN A;  3CXH E;  4IFF A;  2E76 C;  1G1J A;  2PGD A;  1ZLL A;  3CCJ P;  5APX A;  1AA0 A;  3II6 A;  2ZXX A;  1CI6 A;  2H7H A;  5M1B A;  1PFI A;  3A5T A;  3AEE C;  1NTZ E;  1ZR4 A;  2BCC E;  1YHQ P;  2C0X A;  2AEF A;  1SQV K;  1LJ2 A;  3CI9 A;  2OGU A;  1OW8 A;  1AVO A;  3CMA P;  1NTK D;  1FDM A;  1KQF B;  3VYI A;  1R5S A;  1FZF A;  2LKM A;  1YI2 P;  3H1I D;  1S3J A;  4C46 A;  3H1J J;  1FAV A;  2IDB A;  5BU5 A;  3L75 E;  3WUV A;  3WU2 H;  5KLV K;  2DW3 A;  1SFC A;  1FZC B;  1JY2 N;  2J5U A;  1FC2 C;  2B87 B;  2KP8 A;  2JP3 A;  2BCC G;  1KD1 Q;  1GU4 A;  1Y47 A;  2FXO A;  1JNM A;  2FFD B;  5L8R J;  3LIE A;  2A06 D;  4DT0 A;  3V4Q A;  2C0W A;  2KB7 P;  2YIU B;  2H8P D;  1YJW P;  1SQX K;  3L73 D;  4M3L A;  2FYU D;  3C8V A;  1K9M Q;  4GT1 A;  2N1T B;  3Q1M A;  1SQB J;  4K3A A;  1LWU A;  4H44 D;  1SFC C;  1KQS O;  3VMA A;  3FWN A;  4HB1 A;  1SLQ A;  2V7Q J;  1NGM B;  5APW A;  1OZH A;  3E1I A;  3W67 A;  2O3J A;  3GLM A;  2WPS A;  1MFT A;  3IFM A;  3CX5 D;  1QL1 A;  4C7N A;  2OYI B;  4L76 A;  2QJY B;  1YQ4 C;  2WSF H;  3H1I E;  1S4X A;  3RL0 C;  2E75 D;  1BCC J;  4WB4 A;  1JY2 O;  1EDJ A;  3F5H A;  5EFW B;  2O01 H;  3H1L D;  3GHG A;  1RF1 A;  2KSE A;  4LLH A;  1GD2 E;  3N4X A;  1LWU C;  3HTK A;  3D71 A;  3VOP A;  5AVZ B;  2YXR B;  2QM7 A;  2Y0D A;  1X9V A;  4YXW H;  1RQU A;  1SP4 A;  1JEK A;  1RH5 B;  3Q5P A;  1S5L X;  2A06 E;  1VQN P;  4EDF A;  3E7K A;  2NPS B;  3OA7 A;  3ITK A;  1NYH A;  2JEE A;  2HYN A;  2BAS A;  2FYU E;  2IYO A;  2W83 C;  3TNU B;  1Q82 Q;  1JOC A;  2WZ7 A;  3L70 J;  1L0N E;  3AE5 C;  1FJP A;  1GL2 A;  2Q1K A;  3V2N A;  3H1J G;  2K9Y A;  5CCG A;  1RF1 C;  1H89 A;  4PV1 C;  1Y8A A;  1GMJ A;  5CHX A;  4CPG A;  3AED C;  2GA1 A;  4O9B A;  1KC8 Q;  1KB9 I;  1SQB E;  1LT9 A;  3LW5 H;  3OW2 O;  4H13 B;  2YKP A;  1LTJ A;  1M7L A;  3V5B A;  1K8A Q;  1KIL D;  2AXT H;  1BSH A;  3RK3 B;  4D6T J;  1BGY D;  2IYP A;  1NAY A;  3CCU P;  1KMI Z;  1QVF O;  1L0L K;  5DJT B;  4BWN A;  4OGQ C;  4ASV A;  1JM0 A;  1RE4 A;  2ITA A;  1L0N G;  1YIJ P;  2M3B A;  5CCH D;  3AEC C;  1OW7 A;  2XND H;  2R32 A;  1Y9B A;  4OWF A;  2ZAE B;  3AE1 C;  1GL2 C;  4GOF A;  3CCS P;  5CCG C;  3WUT A;  3TF5 A;  1SQB G;  3WMM 0;  2D2C B;  1N7S A;  1YQ3 C;  3MUD C;  3B8E B;  3PP5 A;  3A3Y B;  2KZI A;  1LT9 C;  2RMZ A;  1YBK A;  1OVV A;  1IZN B;  4Y28 J;  2IFN A;  1ZRT D;  1LTJ C;  2N9Y B;  5GTI H;  2E76 B;  2B89 A;  3BRV B;  3M0D A;  3Q2Y A;  1PP9 D;  3HD7 D;  5KKZ C;  2KNC B;  2M5A A;  2OQQ A;  1U7M A;  4NPE A;  1NVO A;  3NTN A;  2R5B A;  3AE8 C;  1KB9 H;  1T3J A;  2JJL A;  5KAF E;  1SQP K;  3TGU D;  3KHU A;  1EDK A;  3TDK A;  3CX5 I;  1FZA A;  3TK1 A;  1GDT A;  1X8Y A;  5B5E E;  1N7S C;  2PFX A;  3FGA D;  3HE4 B;  2WPR A;  1XTG B;  1IFI A;  3C9I A;  5KJ7 A;  1NTM J;  2YMY A;  3C1L A;  4PD4 D;  4DOJ A;  3M0D C;  4QMA A;  1Q90 D;  2WT7 A;  1OXZ A;  1X22 A;  1EZV D;  3CC7 P;  2I1K A;  1GTW A;  4D6T E;  1CI6 B;  2IBZ I;  2ZFC A;  1W2E A;  2Q3E A;  5APT A;  2JWD A;  3AE4 C;  1BDD A;  1SQQ D;  3TYY A;  3P8C E;  2JWA A;  1FE6 A;  1IFM A;  3JC2 2;  5E79 H;  4MN4 C;  3U1A A;  2G8Y A;  1ZRT E;  2H89 C;  3G4S P;  2QE7 H;  1M1K Q;  2ZJS E;  5H2F H;  2ZT9 C;  5KJ7 C;  2FKW B;  2HOD A;  5DJU B;  3I55 P;  4D6T G;  1SFC B;  3G6E P;  3CX5 H;  1HVV A;  1NHL A;  3EFG A;  3L74 J;  1KYO I;  5CCH A;  3OAK A;  1PZQ A;  1NTK K;  4HYT B;  1KFM A;  3AEA C;  2XU6 A;  2IZ0 A;  1Q86 Q;  2O1K A;  2QVA A;  1L0L J;  3SWY A;  4TLF A;  1M1J A;  1FJK A;  2FY8 A;  3RL0 B;  1HGZ A;  2WSF J;  3AEG C;  1PGQ A;  4PD4 E;  1HF9 A;  1Q2N A;  4BRY A;  1LWU B;  2K88 A;  3JCU E;  1NTM E;  4GOD A;  4JF7 A;  4U3F J;  1W2B O;  4UB8 E;  3BAS A;  3IAO A;  1JTH A;  1LTA C;  2RKL A;  2PP6 A;  1QX8 A;  3GW6 A;  1BDC A;  4C7N B;  1QL2 A;  1T3U A;  1NTZ D;  1QEX A;  1LTI C;  2BCC D;  3BRT B;  4GIF A;  4B86 A;  1R5L A;  3PLN A;  1M1J C;  1OWA A;  2XV5 A;  3BCC J;  1VQ8 P;  5AW2 B;  2V4H A;  5TIS H;  1KYO H;  1S72 P;  1RF1 B;  4PV1 B;  2WVR A;  1NTM G;  4JQ0 D;  3HTK B;  3CCQ P;  2M8R A;  1VQ7 P;  2K3R A;  3MD0 A;  1NJI Q;  2FYN C;  3LW5 J;  2W6A A;  4IL6 H;  4EI2 A;  5GTH H;  2P10 A;  1YJN P;  2QIW A;  1SS1 A;  1S2E A;  3L74 E;  1L4A A;  1VF5 C;  2K37 A;  2CK3 H;  4GDO A;  1OMI A;  2E43 A;  2KLV A;  2PRR A;  2HR3 A;  3G3Z A;  4OGQ B;  1Z56 A;  2E5T A;  4HH2 A;  1URQ D;  4GKG A;  2W6B A;  3IR9 A;  3B5N D;  1PPJ E;  3I56 P;  3KQG A;  2YKQ A;  1GL2 B;  4EYY Q;  4PJ0 H;  1AVY A;  3MIW A;  4YPC A;  1FDI A;  2G3A A;  1NO4 A;  1ZV8 A;  5KLI C;  2IFM A;  4IFM A;  4KT0 J;  1N86 A;  1LT9 B;  2WSC H;  5AVU B;  3SFE C;  4UB6 E;  3L74 G;  1LTJ B;  1A02 J;  4U3F E;  3CC4 P;  4R4L A;  1BE3 J;  1L4A C;  2YNY A;  1JY3 O;  3CWB J;  3CCM P;  3SWF A;  1VQM P;  2E74 D;  2HLO A;  1PPJ G;  1L0L G;  2E42 A;  2Q6Q A;  1IFP A;  1RF0 A;  2XKM A;  1IJD B;  1NTK J;  1WRG A;  3HUS B;  1PV3 A;  1NU1 E;  1LP1 A;  3RK2 C;  3IN6 A;  1QVG O;  3CCR P;  1FZE A;  3KZI H;  1N7S B;  4DJG A;  1NKN A;  2WSE H;  4U3F G;  3FXE A;  4ZMD A;  2OTK E;  1H8A A;  5BU8 B;  1U57 A;  4WY4 D;  2B88 A;  2M5A B;  3CL3 D;  4KJM A;  1T2K D;  1KFN A;  3CXH I;  1S9K D;  1NU1 G;  1RF0 C;  2RN0 A;  3BCC G;  2WIT A;  2BEZ F;  1VQL P;  1L0N D;  5C39 A;  4I6M C;  5TJH A;  3H1K J;  3E1R A;  2ZT9 B;  1SQB D;  2OYO A;  1USD A;  1CZQ A;  3H1H J;  1BE3 E;  1FBM A;  5CBO A;  5AW9 B;  3EWK A;  1URQ A;  3S1K A;  1HJ0 A;  3BVH A;  3B5N A;  1N73 A;  1LTB C;  3L72 J;  3KYQ A;  2KYV A;  2FXM A;  1KB9 E;  1KOR A;  3D6Z A;  4DCK A;  3VMX A;  3H1J E;  2LXB A;  3VP8 A;  3CXH H;  3A0B E;  1HBW A;  2LXC B;  1YIT P;  1IC2 A;  1AQT A;  1OIP A;  1BE3 G;  5AVR B;  3HRN A;  1SQQ K;  2NZ2 A;  2N1T D;  1S9K E;  1X79 B;  1P84 D;  3CWB G;  1YTZ T;  4RJT A;  4ZKU A;  4L75 A;  5B66 E; 
#chains in the Genus database with same CATH homology
 4WWI A;  4HB1 A;  1DEE G;  4EYY Q;  1U7J A;  1Q2N A;  3PH0 A;  1MFT A;  5C39 A;  5CBN A;  5DJT B;  1EDI A;  4GOD A;  4NPF X;  4ASV A;  1JM0 A;  1ZXG A;  2B87 A;  2JWD A;  1BDD A;  4BXL A;  2QRX A;  2KI7 B;  2RKL A;  1S3J A;  2SPZ A;  1EDJ A;  2ZAE B;  5EFW B;  4GOF A;  2UWJ E;  4HJG H;  2R44 A;  1BDC A;  4GOE A;  2KUB A;  2KIK A;  4MN4 C;  5CBO A;  5K5G B;  1LT1 A;  1FC2 C;  2B87 B;  3S1K A;  2I8D A;  1EC5 A;  2KZI A;  1JMB A;  3QWO C;  1OVV A;  1LP1 A;  1Y47 A;  2KZJ A;  2KS1 B;  1H0T A;  4ASW A;  4NPD A;  2B89 A;  2M0B A;  5DJU B;  4IOI H;  3FXD A;  3RGU A;  2LR2 A;  2M5A A;  2P58 A;  2WMM A;  1U7M A;  4NPE A;  2LXB A;  4K35 A;  3MHV A;  1NVO A;  3FXE A;  1EDL A;  4JBZ A;  2K3R A;  4ZMD A;  1OVU A;  1LP1 B;  4HKZ H;  1ZW0 A;  2OTK E;  2LXC B;  1H0T B;  1OVR A;  1SS1 A;  2Q1K A;  1EDK A;  2B88 A;  1X0T A;  2M5A B;  2HR3 A;  4KJM A;  4K3A A;  2QVA A;  4CPG A;  3ZDM A;  3MZW B;  4ZNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...