4HYTB

Na,k-atpase in the e2p state with bound ouabain and mg2+ in the cation-binding site
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
289
structure length
289
Chain Sequence
b'FIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRFRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
publication title Crystal structure of the high-affinity Na+,K+-ATPase-ouabain complex with Mg2+ bound in the cation binding site.
pubmed doi rcsb
molecule tags Hydrolase/membrane protein
total genus 46
structure length 289
sequence length 289
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4hytB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 4hytB02
5APTA 5AVZB 2XZRA 1SP4A 3M0AA 3WGVB 2W27A 2BASA 3A7OA 3M91A 1T2KC 1G2CB 1MUUA 1GU5A 3A3YB 1MFZA 5AVTB 3V4WA 2P67A 3LIDA 2Q7CA 2R3CA 1HBWA 2WTYA 3TYYA 3V5BA 4AUWA 4KHXA 5APSA 1J2JB 1FAVA 2Z5IA 3IR9A 1CZQA 1NWQA 5APWA 2C9NY 2XV5A 5AW0B 2QM7A 1A02F 1GK4A 4JYBA 1JUNA 1GZLA 3P32A 5AVYB 4LC1A 5AW9B 3WGUB 2Z5HA 4C7NA 3NMDA 3L36A 1S9KD 3L37A 5AW1B 2WPQA 2VRSA 4DZOA 2IPPA 1GK6A 3HE4B 4JYCA 5AW5B 4AQRD 1CI6B 5AW7B 3TNUB 2YNYA 5AVQB 3M0DA 2R5DA 1GTWA 1KQLA 5AW4B 2KP8A 4RETB 3P7KA 2Q5UA 3M9BA 2ZFCA 1HWTC 5APUA 3VMZA 3SWFA 2ZXEB 1YYCA 1FOSE 5AVSB 5CMZA 2E42A 1A02J 3M9HA 2YO2A 1X8YA 1CSBA 1GD2E 2JJLA 3UIAA 5AVUB 5AVXB 1NAFA 5AVWB 1DH3A 1OWAA 3HTKA 3L35A 1H8AA 3NFQA 2QM8A 5APXA 3MGNA 5AVVB 1HJBA 2E43A 2WPRA 3I5CA 1SLQA 2WPSA 3A2AA 3VMYA 3KQGA 3LIEA 2YO3A 2C9LY 2R32A 1H89A 2H7HA 3V4QA 3M06A 4GKGA 4GT1A 4I2LC 5APQA 3HE5B 3KDPB 1JNMA 3HE4A 3VYIA 2WT7B 4EOTA 5AW6B 1CI6A 1MV8A 3VN0A 3TNUA 3VTPC 4B86A 2N9BA 3NTNA 4I6MC 1IO4A 5AW3B 4RESB 5AVRB 4M3LA 1GU4A 3OAKA 1OXZA 3O8ZA 2P7JA 5AW8B 3A5TA 2P2UA 3HE5A 5APYA 1S9KE 1HUCA 2Q3IA 3TK1A 1H88A 4XE5B 4C7NB 2WT7A 5APVA 4AYCA 2W6AA 2XU6A 3NXSA 3P8MC 4HYTB 1T2KD 4C46A 5AW2B 3T97A 2R5BA 1FOSF 3MD0A 2WWWA 3B8EB 3VMXA
chains in the Genus database with same CATH superfamily
1IRAY 1RIHL 2ZUUA 3II3A 2A3TA 1OAUH 2CKNA 2VERN 1DJHA 1A8JH 2IMMA 1SOKA 4NO0D 2P5EA 2OR9H 3SPHA 3C9IA 4JPKL 2FT8A 3SOBH 1LTSC 5HHVH 3NGBC 4LPCA 4DPCX 4R96B 1WFTA 1MJJB 4X6DA 4EBQL 4X50A 3H42H 1B6UA 1MCDA 4XVUD 4BD4A 4AG4L 1DLFL 2ITCB 2MQGA 3QYCA 5LGJB 3AT9A 1BF2A 2KHAA 3IFLL 2CKBL 2F5BH 3CMOH 4WFGD 1R5VB 3UBFA 5B8CB 1EXHA 2A9DA 5HHQA 2VDKL 4ZW3A 4HAKA 1IARB 1OV8A 4RRPG 3FU8A 5C97A 1CZQA 1ASOA 1NC4D 4GIOA 4RLDA 3VW3H 1LEIB 4ZYKA 3KYOB 3PL6B 4YHZL 4YSAA 2IGTA 1AVYA 1HKFA 1T1YA 4GXFA 4NWTL 3STLA 3QEGH 3VYPA 2VJ8A 4O51A 3P3RA 3K5BA 3VGFA 1J1OL 1KG0B 4LPYA 3V4VA 4YXHH 2D3VA 1UWEL 1NTMG 2X3CA 3QDMB 3G6EP 4OTXH 1F3JB 5B1BB 1EAQA 5BZDA 1BD2B 3BVVA 5GS0D 2VRSA 2R1WB 2VXUL 1F13A 3C6LB 4X9GA 1QGKB 1U8NA 5F7YC 3BWAB 5GS2H 4HJEA 4GAJL 4D0BB 5ICXB 4XRCA 1P69B 2VDQB 3EYQC 1NU1E 5GS1B 4QRSB 2R3SA 4E36A 1E4KA 4PV8A 5E8NB 5AAMC 1AP2A 1Z9SB 2BVOA 2VDRH 4NZRH 2YMOA 5DD3H 4KJQD 2PYEA 3L3OC 3T3PF 4JY6A 4KV5F 2PCXA 2YKLH 3TIDA 1O9WA 2H3KA 4PLJD 4TLTA 1K9MQ 3MNZA 5CILL 5E4AA 3VG9C 5GRJH 4JE0A 4M4RB 3PE9A 5LBSH 3LXAA 2KYIA 4J5VA 3ZQWA 4F8QA 4RFNC 3MYJA 1U8QB 1KFMA 5CZVH 5CCHE 5DMKB 1PP9J 4DP1X 3O6FC 1BV8A 1T7XA 1YTZI 3KHUA 4GQZA 3A6CL 2RQEA 3EHBD 4FQHA 3ERXA 3ULSA 2P28B 3VMOA 4ZMPA 5J13C 4Z7UA 3DHUA 2AXFB 1L0LD 1KNOB 1SQQD 3DO3A 5IM7B 4U1SB 3C2AL 5D2NE 1JZ8A 4K7PL 4N6RB 4PRBB 5E1QA 2BS71 2E9WA 5I1KL 2AXCA 2BDNL 4YBQD 3BKMH 3DWTA 1R5IA 4PSRA 1KV4A 5DD5H 2VLRD 5CR8A 1WRGA 1D6VL 1U8HB 2EC9U 3RTQC 4PJCB 1JZHA 3H7LA 1RE4A 4NM8L 5HYSB 5F71A 3PJSA 1VFMA 3EGDA 3HRZC 4IIZA 3BAEH 2HUHA 1Z32X 2KZBA 5CCHC 3P2BA 3QCUL 4HG4J 3T97A 1RQ5A 1NGMB 2FYNC 4UTCA 2FXPA 4Y2DA 4APXA 1EGJH 1SLVA 2VR5A 5DVLA 2GI0A 1ZHKA 3VWKD 5KBPA 1U8OB 3OAYH 3BN9C 4F7PB 1KZYA 3RL2A 4NFBA 4LL4A 5LAPA 3RL1A 1PIXA 2AI0H 2FJHA 4LOUC 1YMHA 5D2NC 1XGQB 4JO1L 2OZ4A 5K1JA 4Y16B 1QR4A 4FYTA 1SPDA 4YLQT 5JYLA 5IMMA 1FZKB 2D3NA 4AIZB 4KKQA 3V5BA 4TQEH 1ZTXE 2HFTA 2YPKB 4L9LA 4I77L 4KHXA 4CILA 4LSUH 4PRHA 1I9IL 1YNTB 3OJVC 2EE0A 5D7JC 4PY8I 2MCMA 2YEZB 1LT9B 4OFPA 5KJRH 2HJLB 3FONA 4AUYA 1JPSH 2BNRE 4QRQB 3WUTA 3B2XA 3QUMA 5GTHH 1X3DA 5FC9A 4D3CL 5FECA 3WGUB 2HRLA 4G1MA 4K5MA 3WNJA 3V0IA 4BEIA 4RCAA 4Z0BH 1EDIA 4JFDB 4JHVA 4XMZA 2EDEA 5E5MA 3LS5H 3EAKA 4BZ2L 2NY7H 2W0FA 2LAGB 1HX0A 1T89A 2WZAA 3VP8A 4WKXA 1QBLL 1MG2C 4RGND 5DFVD 1W15A 2ENPA 3C5SA 3V52L 5F7EH 2GT9A 5BJTA 4LPUA 3JTSB 2BH0A 3ML9A 4W9KC 3D0LB 1TTFA 4JANA 2Z4QA 1KTJA 4PJ7A 1N4XL 4X6DE 4XPFL 3V0EA 2QVMA 3NQKA 1JS4A 2HKHL 5HDRA 2Y0CA 2IADB 3BIAX 1UA6L 1HZHH 4QF1A 4DN4H 4U05A 3H32A 2X42A 3ARWA 5E2TH 1J1DC 2VCOA 3OLIA 4KUZH 3ZE0F 5ESQB 1UD3A 5F8RC 1H6EA 4OZ4A 3HI6L 1O6TA 4XH2B 1HKLH 4ZFZA 5TQ2H 4AIOA 2WO4A 1KJMA 1A4AA 1MFUA 4DSYA 2UXFA 4B9ZA 4MTMA 4LAQL 2SEBB 3GMMB 4ODUB 5I15H 1F11A 3SCMD 1ZLLA 2BVQA 2XI9A 1HK6A 1LQSR 2WOBA 4PM1A 5LDSA 1QI5A 2Z34A 4CL7A 3BEWA 1KENL 1D6EB 5D1XA 1GYVA 3Q06A 5KLVG 2OTKE 3ISYA 1H9DA 2K70A 2P42B 3OD3A 3T2LA 4Y19B 1RUMH 4IOIB 5L9DH 1YNKH 2BY0A 3CV5A 4UDTB 3IFPA 1OAJA 5FF6B 4QLRA 4YBLB 2PYEE 1UZGA 3TWCH 4BZ1L 1T0PB 4X8JB 3KYMA 5CINL 4PJIA 2J88H 4JBZA 4K9EL 3HUJB 3ARGC 4R90H 1GC1C 3QQDB 4EN3D 5HPOA 5A2KH 1DVXA 3I6KA 2IFGA 3FC8A 2VXQA 4HWEL 1RJLB 3IF4A 1OCWL 4BKTC 1RZKH 3QA3A 4Q0XL 2NCMA 4PRIA 1QSED 2B87B 3W0WA 1F8TL 3ARBD 4RA0C 2G9HB 1SQBE 4JZOA 4ANKA 3Q5PA 3PWLB 3IGAB 1ORSA 4HKZA 1M53A 3MRCA 4NQSA 4CSPA 1AIZA 1F6LL 1CB4A 1S9WB 4QT5A 3ARFA 1J0ZA 1OQXA 3F7RA 4Z7UE 3DIDA 4D6TJ 3TYYA 1E4KC 2JE8A 4QHNA 4TM9A 1MFCL 3MBED 4TLUA 3C08H 1S4IA 5F6IC 3A0OA 3SKJH 3LNIA 4F7EA 1P1ZB 4ZFFA 4JBSA 2QKIB 4AI7A 3MKKA 4LLUA 4GW5B 3VAEA 1NOFA 3RX8A 3ZTNH 5I76A 3CCQP 4AOFA 5KJ7E 5K59F 3CWBJ 4PGEB 4DTGH 2ZSWB 3F5WA 5ALBL 1XIWC 3QI9B 1I3RA 1LP1B 1JK9B 5I6KA 2CCWA 3PXJA 1XH1A 4G7QB 1B3IA 1FNSH 2YFNA 2X38A 4QHMA 1JRHI 2E7CA 2XNDH 5GZOA 4WI8A 3PABB 4HFWA 4S1DD 2CNYA 2YBRB 4XP5L 1U8LA 1HH6B 1YN7A 4B5EA 3H1JJ 5K93A 4LO9A 4JY5H 2HJFB 4UQ2B 4ZS6D 5FYJL 1Q0YL 4NZUH 1ZS8A 5D1QA 1XTCC 3RUGB 1UD2A 4NDMB 3RAJL 1DYZA 3QORB 2QHLA 3W2DL 1RE4C 5KJ7C 2X1PA 4PRHE 5E9AA 2FJFA 4UINH 4L3CA 3CFDA 3U25A 2W9LA 1T6VN 2E86A 3JWDL 4Z8FL 1B0GB 3VFSA 2CDEA 3N4XA 2K0RA 1FZMB 1K6QH 2VB5A 4JFYA 3MXVH 4QYOB 3MRGB 3JTBA 3K8MA 1Y6MR 3TA4D 3HBGA 3QG7H 3X3GL 3BZEB 3GSRA 3BZDA 1NU1K 3JQOB 4S2SB 5EEUA 3INUH 4GUPB 4PHXA 4ENZA 4PD4I 5JO5A 1R3HB 4X9IA 3ZKSD 5EZOL 5IVNA 1JERA 2CJ3A 3D6ZA 5DZPA 1HCYA 3OSKA 4L9LC 4ODVH 5KG9A 3TBTB 5L2JA 4FULA 4U1NB 3GI8L 5I6OA 3M1BB 4ZFOB 4XWGL 5KWYC 3H1KD 2D7NA 2NX5A 2R9HC 4GRWE 5EDXA 3SSGA 4A66A 5DJAA 1OSZA 4NJ9L 4WDIA 4XNXL 3W68A 1MREH 4UUJB 5FUCE 4EO5A 4J3OH 4JM0A 2PW1B 3T5WA 3OMNB 3H1LE 3KJ4C 4ACTA 4YSSA 4HUMB 3T1FB 2W27A 3WFEH 2OK0L 3CL3D 2GHWB 2YBGA 2FFDB 1UM4H 2HSIA 2EP6A 3I6SA 4JFFA 3M45A 3P9MA 1TVBA 3BAIA 1YQ4C 3A0HE 3DX8B 4KVNH 4ZO6A 4PJXF 1F6AB 1F41A 4UZSA 2VMFA 3WLBB 4CGTA 2DN7A 2ERJB 1N67A 4XO5A 1RZJL 2BOLA 4KK9D 3FT4B 1EJFA 3TZVB 4Z7VF 3RVTD 2B1OA 1ZOYC 5D1XE 1M9SA 1TZIA 2HRPH 3FT0A 1PGJA 3NG5A 3IDGB 2FHCA 3L5WB 2MWCA 3NTCL 2J8UB 4G9FD 4X7CC 3OLDA 3OC8A 5I19H 3LX9A 4ONGL 5F9JA 5FUCC 4D8OA 2Y7QB 4WKZB 1RP9A 3QHZH 1EMTH 2D03H 3TBBA 3GMRB 4PJIE 2AJUL 4LSRH 2CRIA 3MUGB 1MJ8H 5IJCC 1G5GA 1DZ0A 3KLKA 1TEGA 3STZB 3AEBC 4L4TA 4AEHL 2KI7B 3QDJE 2NXZC 1FCCA 2QKSA 1NPNA 4L8SB 1BWWA 1RPQA 1NTMJ 2ZPKL 5D7KD 4JYCA 1OP5H 2NW2A 4U1GC 4N68A 4HPHA 4IIQA 1U36A 3GRGA 3O4OC 4BQ9A 2QV4A 3MOBL 4PRIE 1FFOA 3W0WE 2FEEL 5FUZH 1XR8A 3FN0L 3KL3A 3QPQD 4G80A 5D1XC 3RURA 3RK2D 4BCYA 1R3JA 5C0AD 3CCHB 2ZONA 1FG9C 4PG2C 4CVZA 4WWPA 3VD9A 1LTGC 2C9VA 1IKFH 5L8JB 5HD8D 5CF3A 5L2KA 1WP6A 1XF1A 4HIJA 1X7QB 5GGTA 4LLAA 4I48A 4ZSOA 1M7IA 3VI4B 4OCWL 2XQBL 4WUUD 2EADA 4WO4B 5EO0B 3B2VL 1EHXA 1DP0A 1H8AA 3I75B 1I3UA 2W94A 3QZWA 4I9XA 3CBJB 1KT2B 2ICWJ 5DT1L 2NPSD 3A2AA 1WAAA 3MLRH 2HFEA 3US0A 1P84I 4MSWA 4LMQE 1QFPA 4M6ML 2PXYB 4GFTB 1E28A 2YXFA 4RAVB 1IGFH 2WLLA 4X4YB 2E76B 4C56B 4IBVA 1FIEA 2V4LA 1OQOA 2DPKA 3ARFC 3P4NB 1E4XH 1T1XA 2JWDA 1BFTA 4OFYD 4ZOBA 3U4EA 3JWNH 3OKEB 4UWQB 2X2UA 4OV6F 5JIPA 5B5EH 2BWIA 1IFGA 1JTTA 2IDCA 1JF1A 4E9VA 6TAAA 3K6NA 5I17A 1AKJD 2W38A 5D71L 4MNGB 1T66D 4GO6B 4OLXH 3KWTA 2JXMA 1KGJA 2QFPA 4LF3A 4Z7NF 2FBOJ 1HIMH 4KOCA 1U9KA 3GBML 3OR6B 2B1AH 4IOFD 4B9JA 4XZUB 5IWLA 4FI7A 3C5ZA 4NN6C 4H5SB 4XNUH 3BRDA 3B4NA 3A7OA 1JNHB 4NO0B 5EIIB 4GDOA 5J57B 3CDZA 1ONQA 1J0KA 4MAZA 1EV2E 1M3IA 3FOLB 3B5NA 2YXVA 4YDVB 4L29A 5GZOC 1ADQA 5I0WA 4G8GE 4YBHA 1M7DA 3GHBL 4PW3A 4TNEA 1XCQB 2YD4A 4X99A 1DJXA 4XO4A 2QE7H 3DA0A 1G9EA 3UTTA 2OYHA 3TU6A 4HS6B 3V9EA 3FK3A 4DGIL 3CFNA 4FQ1L 2WHVA 5A2JH 3U36B 4ERSH 5LNEA 4QTFA 5CKGA 1Y9BA 3PDGA 3CCUP 1P6AB 4XMPL 4UTBH 1ADWA 2WGNB 5ADOL 1RFDL 2BCKB 4TS6A 3NPSB 1WA0X 5JOPE 3FCGA 5IIEA 1U8KB 4MB5A 4OLYL 1SUHA 4NO5A 4C83A 5G4OA 1SQBK 1Z9PA 3ZMEA 5IY5B 2VH5H 3HCVB 4KUCF 3FUNA 2JMRA 32C2B 4NO3A 2FGWH 1E4WL 1NAKH 3JWOC 1UM5H 5EN2B 5IQ7H 3LW5H 5IMOB 4C54A 5E7BA 1HWTC 3OAUL 3FJTA 4N2OA 3LEYH 5CLYA 3MXWH 1YYCA 1FOSE 1JPST 4BSJA 4KRPD 4AQ1A 5INCB 1HJCA 5CZXC 4D6TD 2W60A 4HH9A 3GLAA 1QRNA 1KLUB 4PYHA 1EX0A 2OTPA 3VD1A 5IQOA 4PJDF 4V33A 4Z78A 5EZIH 1JHLL 3ILPB 3NIGB 2TAAA 2J6EL 1INEL 4TNWK 2F19H 1IGTA 4LEXH 4V2BA 3QWRD 2EZ0C 5ALCH 3I5CA 3EO0A 4ZPVB 5LAXA 3CFQA 1ZIAA 5HVHB 3IGLA 3KQGA 2VGLM 3BC9A 3CWBD 3EHBB 4KY1H 3N41B 4L4TE 3F8UB 1IGCH 5D8JH 2XA8L 1W8NA 3U0WL 3EUUA 4KDTC 4JQXC 4KZCA 2P1JA 4EOTA 1TJIL 2E27H 5H2BB 4MDIA 2N59A 4NNXB 5JOFB 1MHEA 1NBZA 3LEXA 4BYHA 1RZFL 2VLRB 5LBSA 1GU4A 1KCLA 3CCEP 4WJ5A 5DURD 3H1JD 5JHBA 1QW8A 1P5UB 3V4PH 3KPLB 4UILL 4JFPA 1BSIA 4YDMA 3P8MC 3D12B 3NABH 4FLHA 3FCTA 1KPUA 4N1CA 2AEQL 4UQIM 4CGUB 2I69A 1UCTA 3DUUA 3GXPA 3EDEA 5FV1L 2V3DA 2HJKA 4ZJ9A 3KVDD 1HHKB 3ITKA 4MN4C 4HBCL 1KY6A 2LW3A 3UBXA 1LD9A 4Z18A 3VWKB 4M7LL 4YFEA 2Y23A 3IXTA 3MA7B 2X4PB 3GMQB 2N1TE 3GJFB 3KW8A 3MRHB 5IBUG 4FNLH 3L9EA 1OCOB 1ZANL 1WAAE 2MPAL 3EBGA 3V9FA 4D7BA 1AQMA 1N3NA 3C9NB 2X9YA 2YIUC 1GMIA 4NZFA 3WTYA 1SQXG 3BWZA 3V0VB 1W72B 3P73B 4FQIL 4XMTA 1N26A 1S9XB 4BKSC 1R5LA 1XCTA 4N85A 4PJ5A 1FAVA 1RZIB 1XQ4A 1RUQL 3GXFA 5ABAA 5FDWB 3UTZA 4RFEA 1JDAA 2QHRL 5I6NA 3ZGHA 3ULUH 1ZJAA 4AV4A 4YHYC 2HPCA 5BV7L 3PGCB 1QPKA 3RGVB 4YGAB 1IQWL 1H15A 2FX7L 3W5MA 3WBDA 1LO5A 1JBJA 3IE4A 2R27A 3ARYA 3QEUB 5JIMA 2DQJH 3MA9H 4I9WE 1SMAA 1TQCC 1CGUA 3G5XA 3EBAA 4LCYA 4PREA 1DN0A 2N1TC 2P80D 3O2DL 1MCJA 4GAFB 1LP9F 5LUMA 3MV7D 3GS0A 4RGNB 4DH2A 4TV3A 5I26A 5T1KD 4XP6H 4Z1PA 4YQXL 3V0WL 4PLKD 5CLXA 3QZOA 4PJBE 1C5CH 4NSKB 4P4KD 5D2LB 3HNTH 1F3DH 4AGQA 4R26L 5L4FA 3MV11 4N0FA 4Y9EA 4YHLL 1KEML 4OLWH 3F5HA 2Z31D 4JKKA 3MMEA 3D3VA 1OL0A 3W9EB 1BA9A 2P8LA 4AM0B 3IDJB 1NSNH 2VL5A 1UJ3A 3T4AA 4B9KC 1TEFA 3X11B 4F92B 3FT9A 1I1FA 3L3GA 4Y1TA 4IRSC 1ODAA 3D18B 4HIEB 4DO4A 2ADFL 2XACC 4G6MH 5EOTB 3S36H 4W68A 4QO1B 3C5ZC 3FHAA 1EPFA 3DMMB 3QAQA 2XWCA 3DIFB 3SCMB 1BDCA 2V2TA 4L8DB 4G3YH 4ABVA 3DK2A 1ROWA 1DQDH 4P48A 4TF4A 3L5XL 3B5NC 3WELA 1NFIB 4M5YH 1OP3K 2C7UA 1NTMD 2UVEA 3AM8A 2VUYA 3VWJD 4J39A 1P5VB 4HS3B 5BUGA 3DJ9A 1EBAA 3WHE1 2BVTA 2E7BA 3CSFA 5IQNA 3S96B 2AVGA 4WGWB 3L1EA 2OYHC 1R75A 5EPMA 1H88A 4BKLB 3BQUC 4UNTA 3OJ2C 4C7NB 4KI5D 1P7HL 1UH3A 3ISWA 4LL9A 3Q3DA 1FYTA 2W9EH 2WVSA 3OQ3B 5C0RL 1Q7YQ 1RUKH 2IFFL 1QRNE 2BRRH 3LKNB 4TUKL 3ZKNC 1ITCA 2PP7A 4EN3B 4J3UA 1RE3A 3UAEA 4F1SA 4IS6A 1Q1PA 2FEDD 2EYTA 3VXOB 2QLYA 4NIYE 2LR4A 5DZJA 3RZCC 2GJJA 1K72A 3FUDA 4GIPD 1U42A 1UXMA 1QSEB 3FFDA 4U7MA 5D1ZA 3SE4C 3MROA 1DQML 4AW4A 1TZGL 2ZKWA 5B39B 1KB9E 1M8OB 1QA9A 1GJWA 2IH3A 1IFMA 2EIMB 4KKAC 4OCXL 5E95B 2W8CA 4GRLA 3U2IA 3AXIA 4L9DA 5I6MA 3MBEB 4IKNA 1KILE 4NN7C 3EQ2A 5I16B 2JQAA 3OW2O 1JY3O 4H0HB 4AQ1C 2NNAA 2Y69B 4KRLB 3TIEA 5MEOA 3QIUA 1EJ6A 1W6LA 1XSJA 2JLPA 5F1IB 3CVHH 3ZL2A 3FO9B 2FNBA 1AQDA 1J7VR 1FNEB 5BVZA 2DZEA 2GAZB 3BN3B 3WY1A 3MFGB 3SDAD 2IPUK 1UB5A 2V5MA 4R6UA 4LVOB 1T4KA 3ALXA 2EH8H 3D52A 1U8MB 5FUOH 4TSBH 4M6NH 1SY6L 5C9JA 1S7TB 3ZR5A 1UD5A 5HPMB 3KWWA 3OJDA 5E24E 3O2WH 4ODXB 4NOFA 5AW4B 4X7TB 1N5AB 1QBMH 1KILC 3DXAA 3QDGD 5CLWA 1A2YB 3B8SA 1VCBC 2FWSA 2R2HA 1CF1A 3LJ3A 4LLDA 1BE3J 2A83B 1FH2A 2WUCH 3QUYA 1QG3A 2N4IA 1U7JA 2XYCA 4JDVA 4NYLB 2MNUA 4KWUA 1E6OH 2G2NA 4PJ5E 2FQFA 1J05A 1LWRA 2ED8A 2JCCF 2FSDA 1T3JA 1SLXA 1PQZB 2E56A 1RF1B 2C0XA 2WITA 3V6ZB 3X1BA 5B3JE 2Y0EA 4XXDB 1R24A 4OCSH 4OIBA 3NIFF 2A1WL 1KELH 1NFDB 3DBSA 1NPJA 2ZUQC 3Q5TA 4FOMA 4N6QA 2CHNA 5JDSA 1M57D 3PP3K 1WBXB 4JREB 2KZWA 1ANUA 3O6MH 1AIFB 2PO6D 4GQ9H 3FB6A 1KYFA 5E08H 5CD5C 3RK3D 4YDKL 2VE6B 4MJIA 4TXVB 5AYUL 4BFBD 1CCZA 3OL2A 3HR5A 4FE9A 43C9B 2KZJA 1Z9MA 3Q1MA 1ZR2A 3UO1L 2RMNA 3FHEA 4JB9L 2R4SH 2IPKA 1VGEH 1PGRB 5KSAD 3GI9L 3TBSA 3P4OA 3VI3A 4AKQA 4AEFA 1FORL 1I1AC 1XMWA 4FYSA 4N0UB 1XGPB 2BC4B 3ARPA 3BKCH 4HIIB 1QZ1A 2GK0A 1CDIA 1UGNA 2X4NA 2XU9A 2OYIA 2R1YA 3L72G 3D3VE 3FZUD 3MRBB 4QY8A 3ZT5A 1WZLA 1ILSA 4TSCH 3TVMD 5IB3A 4JEGB 2AKRA 1JP5A 2PYFA 4CMHB 1QFHA 3FUMA 3P2TA 1ZTXL 5J8OA 5D72H 3U2SB 3LNFA 1V7MH 4XNBA 3PGFH 1MNUL 4ZRGA 3UROR 4N2HA 1HQ4B 2EIDA 5A2CA 1YEEH 4HOMA 4QMAA 2CRMA 3H2QA 5D5MA 2ZCKL 4MXWL 2V9TA 3FFCD 5JIKA 5GGVL 5K5YA 4P3DA 2OTUB 3OHXB 2AK4D 3MGOB 4NJAL 4U2ZA 5HXMA 2XKNB 3HZYB 4HA1A 4L48A 4MDJA 1PDKA 4G9FB 2Y4SA 4ZX6A 3RVUD 4M1DL 1FDLH 4AJ0A 4LP5A 1KB5L 1UJ3C 4XP9H 3VFVB 4BK8A 2X4QB 2UXVA 3DC0A 5E8PA 3LKOB 1L9PA 3MFFA 2VDMH 4PV1D 4LHUA 4PSPA 3ZUNC 1FYTE 1TJHH 3MZGB 4BWNA 2VISA 4OZFH 3Q9PA 4XVTH 1K5NA 2I07A 4Z9KB 5AFAA 4NPDA 4G7YH 4KVCH 5MI0C 3MLYL 2F8XC 2EEBA 3MLTA 3WUZA 5GZNC 1JPTL 4DPRA 3WJMB 1A6PA 3EJRA 4J8RB 5GGSA 5KZCD 2J8OA 4L18A 2ZXEB 3SQBA 1N0LA 1IAIH 3RK2B 5LNGA 5FYLL 2Q76B 1GC1L 2E9GA 5KVFH 4OGAD 3S3CB 2A06D 3D25B 4GKSA 1HDMB 2CUAA 3SE8H 3M17B 3VSVA 2EDMA 2X3AA 3W38A 1G5AA 2P52A 4WUUB 3WYRA 3IF1B 5T5NG 1P7BA 3AC0A 4H1LG 3ZRSA 5HI3D 1SQMA 3L74E 3QUZA 1NGQH 4NKIH 1A7RL 1CJYA 2NOYA 4M6AA 2VN3A 4Z3GA 3F01A 3H2WA 5CBOA 1DQQA 1WA2X 1NTZG 3CMGA 1L4AA 4AWJC 4MJ5B 1LL1A 1VF5C 4XCCL 2IIJA 1KIUB 3I50L 3IKKA 4Z7NE 4WFFE 1KB3A 1MRFH 2WVTA 1VFAB 5G5DB 3D34A 1K8IA 4ZUSB 4XHJD 4MX7A 3DHMA 4GRLC 1ULVA 5AOKA 3VM7A 4XZ4A 5DMIH 4A2HA 2J7LA 4KKCC 3EO9H 4X6CE 3IN6A 3K71A 3MLUH 1KLGA 5AAWA 1XGUB 2A45G 5AW2B 1SYSB 1DHKA 1L9MA 4K3GA 1KYUA 1BM7A 1AKJB 4M1GL 1WH0A 2BP0B 5ERWB 2CHWA 1JZDC 4YFLF 2DIBA 2CO3A 1T7YA 4QOKD 3B56A 4OD1L 2XPZA 1L3WA 4P5MB 2YRPA 1ZDQA 3CXDH 5AKVA 5DYOA 2FYYA 3QK0A 4NC0B 4TQ8A 3RWHB 5I8KL 1XD0A 3MNMA 4PHZA 5EZJB 3UL4A 2IGFH 4PS4L 2DH2A 4EI6A 1T8ZA 4FNTA 4PY7B 5HY9A 1X9QA 3CFKA 3R1GL 3BUTA 1ZVNA 2HLAB 4MJIE 3L3KB 4AMXA 1U3JA 3EWKA 3SJVE 2OMXB 2CNZA 4J7RA 2ZX7A 3U7YH 2GY5A 4W81A 1T03L 4PR5B 1E27A 5CHXA 1SQXJ 3FUIA 4IDJL 4XNAA 5DEGA 3K2IA 2WXOA 3VXQB 1A1MA 2JLLA 3IGKA 3QUYC 3EH1A 4Y8DC 3FQNA 3CGTA 5D7LE 2R0ZH 2IBBA 3N5AA 3QW9A 2G0LA 1IVTA 5KAQG 3VI3E 3BDXA 1F1GA 2ZX6A 3VOPA 2XJKA 3OB0K 2D2CD 3MUJA 5MP6H 5KJ4A 1A6UL 1IC5L 2QDVA 2NUTB 2BSED 3QQNA 4HJTA 4U3FE 3T6VA 1ED3B 3JC22 3GSXA 3R18A 2BFVH 2F54E 5JW4R 3GMOB 3FRPG 5C39A 1S7SA 4BUGA 1KB9K 4H88L 5EEXA 2KERA 4WV1C 1I8IB 4HUVB 4EUPH 1G6RB 4BQCA 1AZZC 4HJGB 4KXDA 4RETB 1XSKA 5C0CA 5APUA 4OFQA 5I5JA 4U1KB 2O5XL 1QEWA 3MLZH 3US9A 5H94B 2OM5A 2VLMD 2W6JH 2V7HB 5D9SA 3M7OA 4OH8B 3B8YA 4MMZC 3S9DB 5D5ME 4KRPB 1O5PA 4UTBA 1WBYA 1F90H 4MAYA 1X5XA 3GRBA 5DI8A 3TBWA 5HHOB 3N3EA 1HJBC 2W59A 3BPOC 3L35A 5JHDA 5DXWA 3TURA 4LGDE 1MLCB 1V7NL 4MCYA 4NN5C 5I2IA 3B9KA 4OLVL 1HXMB 4NAQA 3A6BL 5TTRA 3KPQA 3US1A 3B9DA 1JHKL 1NCCL 1JGLH 1AHWA 1FZFA 1KCSL 1UWXK 3QZWG 3HZ3A 3QUKA 4OM1H 4EDWH 2JNZA 4QWWD 4ZUVB 4LSQL 3WE1A 2AC0A 4ORGA 5IG7B 5DJ6A 5DGQA 2KNCB 3IFOB 5E9DD 2AZUA 4GXVH 4KJPC 1JCDA 1PG7X 5GISH 4LCIH 1XF4A 4NQDD 1EZSA 1AJYA 2D3JA 2IANE 2IWKA 2E6JA 4E42A 5JORB 1OANA 2MQ0A 4NQTA 4HF5L 2MMXA 4HUWA 2XYBA 5DURB 2AJVL 1TPXB 2CQVA 3KBFA 4J3OC 2R0KL 5ESAB 1BE3D 1JNNL 1MXDA 4K9JA 2XKMA 2GJRA 4YXWH 3GO1H 3T65B 1BYNA 4GW1B 1KSRA 5A2FA 3OAYK 1B90A 1GS8A 1JY2N 1J5DA 1OXYA 4MDRA 3DX9B 4WEBL 3RNKA 3L7EB 1J8HE 2APTA 1VEMA 2HG5D 2DDQL 4QRFA 5GGQH 5C6WH 1MFZA 4PB9H 1LM8V 4D9QE 3C5JB 4OY9A 1CD1B 3E6FA 3O2VH 4MB3A 4AL8C 1ECYA 4O02B 1UZ8B 3GEWB 3BIKA 5DFTA 3V4PA 1SQVK 2ZCHH 3OKYA 5GGUB 2CPSA 2YKOA 3D70A 4NERA 5HYIA 1FA4A 1LTJA 3BVHA 3D4YA 2BEZF 1BJ1H 1F2QA 3CH1A 5ACZB 3O6LL 4A7PA 3FTXA 1M7XA 3EYQD 1CLYL 4Q6YA 2HFFA 4LOFA 2HFGL 4OW6A 4PPTA 1OF2A 5F7DA 1A66A 5I5MA 1KCRH 5E5RB 1HWGB 3EJUA 3GS4A 4QEGA 5IFHH 1QUPA 3QUZC 4YR6B 4L4JA 2L7JA 2V7QH 4U7KA 4IBSA 2O30A 1USDA 4EEEA 3E3QE 4G6FD 4FABL 1UXSB 2QFRA 3ABZA 2HODB 1GS7A 1U92B 2CLVA 1FVEA 3MV7B 2HYMA 3ZDWA 3M9QA 1AXTH 1AI1L 4GQQA 3WNLA 5FYKU 4MS6A 1YG9A 3L6FB 3D6GA 2FWLB 4MZ2A 3E8UH 3O6FD 3TTSA 4GO8A 2NTFA 2Y06H 5B5EE 1GD2E 2V7NA 1Q9KB 2Z31B 4PJ7F 4QAWA 3T0AA 3W11C 1D7FA 4FTDA 4JLRA 4ZFGL 1TQBC 1NU1D 3F89A 3MREB 1X7SA 2MTPA 3BX7C 1MHCA 3MRLA 3SKNB 1NOAA 4U3SB 1C8QA 1J9CT 3CZUB 4URKA 2XQYG 2FJGA 4XAKE 1P7QD 4BINA 5T3XH 2PWHA 5GRZA 4IOIH 3L1OH 4FJ6A 2IF7A 2LLLA 1LNUB 3VX0A 2H47C 3FQTB 4M93B 3E3QC 3H1LJ 3FB8B 5LGYA 1FNHA 1UQSB 3RTQD 2B3IA 4K2UL 3I02B 2NZ9C 2NUPB 3ELAT 3G9VA 1QX8A 5CCHD 3SFDC 3DURA 4Y2OA 2JWAA 1NDTA 3LXBA 2H3XC 5F3BA 1LTBC 1IO4A 1XGTB 5L6YH 1IEHA 5EU4A 1NO4A 3D1MC 1EDYA 3JV6B 4O5LL 4TRPH 3VWJB 2AF2A 3MBXH 5KVDH 3QIWA 2WSDA 1R3KB 5HI5C 3BN9D 5HJ3B 3QUGA 3QFDB 4MQXC 2PR9A 4X0KB 3NT0A 4HZ1A 4NAJA 5CFHA 4IBWA 4YL9A 4LOUD 3CX5E 1EXUB 3QXUA 1XBRA 1AFVL 3K5SA 4H20H 1TKWA 1SEQH 1DUZB 3F85A 4U1IB 5IV2A 3L72J 3OWEA 4L75A 4NRYA 4H0LC 5JHDE 2WQUA 5FKPB 1A3LL 4HFUH 4R3SA 5D7JD 1X6NA 2R2EA 3VFMA 4IRJC 3ISRA 1BX2A 1X5JA 5D93C 5IB1A 2W65A 2NY5L 4ZMNA 2AJSL 4TSAH 4ZMTA 1QWUA 3P30H 4X6FB 5DEFB 5F7BA 3OWRA 4KAQH 4M8QA 4JFOA 3D7PA 2ICWB 3OKLB 5FHBH 3HC0A 3ZT6A 3GQFA 4KRMB 3ULVH 3CUPB 4Y5XA 2AK1L 3GS7A 2P48B 3GPSA 3IDYB 4U7SA 2DQFA 4KFMA 4OZHA 3AE9C 1D7BA 3CFCH 1A02F 1MCWM 2B20A 2Y6SC 2C3HA 4MAYC 4CU6A 4I1RA 1A6VL 2FNWA 4FQCL 2B59B 2IVFC 4WB4A 3NQIA 1L6ZA 3X2QB 2F1BA 1R3IH 3B9KC 1EFQA 1WC7A 4S1SH 1RURH 3GSWB 5IR1B 1IGJA 3RWIA 4YGVB 2BNRD 1E2ZA 2JCCE 3GJEB 5HI4C 3HB3C 1DL7H 3PCYA 4N8VB 4PV9A 5ILTL 2I9TA 1EBPA 1DUYB 1OO2A 4O2CA 1YEJL 4HH8A 3FUKA 3LAFA 5CJQL 3NMEA 4ONHA 4X5WB 8FABB 1R0AL 3H0TB 3WMM0 1OP4A 4X7DC 1JMBA 4K94C 3CVHA 3EDJA 4JPIB 3FMGL 4X6BA 5B38A 3SQOH 2C0WA 3G5ZB 4J1UA 2J3SA 4NRZA 1KYDA 1J0HA 2VDOH 4HPOH 4NUJB 3ZDZE 4DKFH 2OMZB 3S35L 4I5BA 1ES0A 4F24A 5BVJA 5HDQH 4IBZA 5T5NF 1EIBA 4AY0A 4G6AC 2ZT9D 1NIFA 3LIEA 4L74A 1LVEA 1M57B 1XEDA 2HT2C 3LHPL 3DRTB 4RGMB 2J71A 2N0MA 3CI9A 2AEPL 2PO6B 3KWXA 3TCXA 5EBMB 4MJ6A 3RK3B 3HE4A 3TT1L 3WKPA 4B5ZA 1QVOB 5I0ZA 3R4RA 4F7MB 3VN0A 3ARGD 1UYWL 5FM5O 3B5HA 2SODB 1VB9A 3TASA 3Q5RA 1MIEL 5A2BA 4M3LA 1IFHL 1T83A 2JH2A 3AEAC 3HMWH 3E1ZA 3IMSA 3IEAA 3EYVA 4Z3HA 1VAHA 4Y2LA 2Y7NA 1LTJC 4Y5VA 3B37A 4WAFA 3BP6A 5J6GA 1BIHA 1BBDH 2X5PA 1AQTA 1OAQH 1Z2KA 5DWPA 3PV7A 2X4RB 3TVMB 1RZGA 4R8WL 1NBYA 4JX0A 2PYED 1CE6A 1X5ZA 1GSMA 3C6SA 1MQKH 1K9TA 2OLDA 2VDPH 5E1HB 4K23L 1CZ8H 3DDGA 5B3NA 3SSUA 1T0OA 1WGOA 2HX8A 1BCCG 2D7OA 2WTRB 3QS2A 4G6KL 5J1SC 2ORBL 3NAAH 4D94A 5KS9A 3N1GC 4CJ1A 5F1NA 5M95B 3RL0g 4QRUA 1XIWD 3ESPA 3FFCB 4OWFA 2PCPB 3HLAB 4A7TA 2CXKA 1RHHB 1VQOP 2AK4B 3PHSA 5IT2L 1SQBD 2EIZB 1DEDA 1L9TA 2CCLA 1PKQA 2WCGA 2EIBA 4YSTA 4B3EA 5I0VA 3IJHB 3HBPA 3JYCA 4WSKA 4FQXA 1S3JA 1FL5B 1QLFA 2XKSA 2O01H 1I4FB 3S5YA 3JT0A 3MJ8A 2WZ7A 4PV1B 3LZFH 3QXDB 1OP5K 3ZKXB 3T2NH 1PSKL 1MFEH 3GZQA 1PD6A 3RNQB 3UAAA 2ZP9A 3GMNA 1IK9A 1LK2A 3LXCA 1VDFA 1AD9A 5FYKH 3BWUC 3UX9B 5KJ7D 4D9LL 4JK0D 1EDQA 3UAJC 1PIGA 3R0NA 2GUVA 1CGSL 3TEUA 2ODHA 2FL5A 4GLRI 4ELMA 4O4YH 4CBZA 3MJ7A 3W56A 3WE6A 1N73A 5E56A 5KZCB 3U1SH 4P46A 1JHTA 3EZJB 1H19A 3D87B 2VAJA 3F7YA 5CS7A 2DWDA 5T5FH 2L4OA 1KV3A 5DUPH 5CEYA 3QIWC 5IMLA 5MEPA 4LIQL 5JPMB 3TYFB 2ENSA 1K8DB 4OJFH 4IQHA 1MF2L 3DROA 2FHBA 4OZFA 2NY3C 4LBEA 3FPXA 2AJYL 4GINA 3KXFA 1KOAA 1S7XA 4XCEA 1JMZA 4MRBA 4BFJA 1JFQL 4U6YA 3CQQA 3Q5SA 4PRHD 3LPOA 2G5BA 2ADJB 3CHXA 3CFIC 4KH9A 1JWSB 1LWUA 2R9HD 1SYVA 5CN3A 4LGRB 5H2FE 2ZYSA 4K3DL 3FTZA 3KPOB 4Q4IA 3V6IA 4AJYV 2PRRA 3BP7A 3PWNA 2MNJB 3WTXA 2AERT 2BZCA 4Q2ZA 3QNXA 4FN0A 3BLPX 3CLEH 4N3UA 3FYEB 4GG8B 3AADB 4XO9A 2CDFA 1ZV8A 4XO3A 4Y5XC 4QHLA 4RMVA 2AGJH 1FVCB 3OBAA 3QXAB 4MA3A 2NSXA 1CVRA 1KN2L 2FXOA 3N1FC 3SO3B 1NBQA 1EJOH 3VMXA 2X89A 3UZQB 2VQTA 1LE5A 4ANUA 2BNQA 4N8CL 5TF1L 2H88C 3NRPA 1OW0A 3SGKC 1L7TH 2AEOA 3CFTA 4QOKB 4TUOB 1JZEA 4ZPTA 4YXLH 2VRKA 4R0LB 1SJHB 4ABQA 4FFWC 5ADPL 1U3HA 2OL3L 2YKKA 1J9SA 1E67A 3TEWA 3MN8A 1CGWA 2N7AA 4UOW1 5HYJA 4FKEA 1F4HA 4PBDA 4DGWC 2QQQA 4UT9A 2FLBT 3H1LD 3UXFA 1MHHA 4XMUA 4EDFA 4RVBA 3RPKA 1W0VB 1JZ2A 4XPHH 3TJPA 3KS0H 4PTTA 1MEXL 4AEIH 3RL0C 2OP4L 5GS0H 4PGBB 2NXZD 3L70E 4HCRH 1IAOB 4K71B 1M90Q 5ID1B 3CX5K 4JGUA 3CVIH 3RGBA 1VFBB 4LLVB 5AENA 4Y7OC 1WLHA 3DVFA 2DRUA 4J3OG 1E8WA 3FL7A 2CO7A 3RU8H 1HJ0A 2D2CB 3LZPA 3KH4A 4KTGA 5D1XD 4O2EA 4PG9B 3PL6A 4QTHA 5BXFB 3N1PC 4IM8A 4MS8C 4A7VA 2CO4A 4LHUG 5IBTL 1TTUA 3MODL 2FB4L 2YUWA 2P7TA 4JZNB 5D7IE 3FHQA 1OT4A 3OLGA 4K73A 3OX8A 1CFTB 2WCPA 1NLBH 2QJDA 1R5WB 4L8CA 2OXGB 2ZFCA 2R1WA 3HI5L 3C6LA 1FP5A 3D6YA 4DUWA 4OUOA 4V2CB 5CMZA 3QDJD 4D0BA 4KZEH 3Q43A 1DX7A 1I9EA 1SDAB 5EWIL 1JZ6A 5KS9E 1ZLVK 2EH7H 4JN2B 3FCBA 2AFNA 2GBAA 4U49A 2ITFA 2PWGA 3FBKA 3L45A 3GHEH 3Q44A 2WWOA 1JK8B 5DC9B 4PRID 5I9QB 3W0WD 1Q1JH 4Y5VC 3NCWA 3BKJL 5HYFA 1FG2A 2NZIA 4LLMA 3C1LA 4WVRA 3ARFD 4NZDA 3LMJL 4N2MA 2ARJB 1JGIA 1TNMA 4M4RA 3VACA 1EZVE 3CC1A 4GKLA 3WXWH 4EUPA 1YEDB 5EZLB 4HALA 3ARDC 1E9OB 1CDGA 1OALA 3FO2A 1U8QA 1QFWI 5DMKA 2UZYB 4GSDL 3B2PA 4LCUB 1BG9A 4BFOA 3J27A 1VHPA 3NIDE 2Y25A 4DEPC 3PJNA 3RA7L 3DDFA 2J58A 2A6IB 1I1RA 2Z93B 3QEQA 1KB9J 5E9DB 5KVEE 2AXFA 4ONOA 4DO5A 2A9NL 4UIMB 4X4XA 1MCKA 4NQDB 4ELME 4Q9QL 1L9OA 3HMXH 3QZPA 4PRBA 2J5LC 1KEGH 3S8WA 2VDLB 2J4WH 5IEHB 5IJKA 1ZVSB 2JVUA 4PVBA 3GJFH 2VC2L 3UJIH 2AEWA 3NGBB 5CAYB 5GZOD 1N5YH 3M0AA 1B0WA 1I85C 3VP9A 5I75C 2WK2A 2WXQA 3KZIH 5GSVB 3VFWA 1JVKA 3U30C 2UY6A 1QVFO 1G9NH 2DAVA 1MUJB 3B5TA 5J6HB 4OZIF 2A38A 1MI5A 5TJWK 5BU5A 1F4YH 1G0XA 3KXFE 5HGDA 4ZNCA 3ZRCC 4R7LA 4QXGH 3LPFA 3PWPD 4PCKA 4KKLC 5F93C 1XTMA 1KCUL 2JTDA 4MMYA 3WCYA 1EEYB 5D70L 5IVXA 2Z5IA 5EU5A 4KZ0A 3PHLA 3JWNG 2HTKC 4K3JH 1XGQA 1N73C 3IJ7A 3BATA 2OCJA 1X5LA 4JR9H 3I3EA 4P46C 3CSTA 1FZKA 3BI9X 4KNTA 1GHFH 3EGXB 1BFSA 4G8GD 1L4IA 2EACA 3V4UL 3AS3A 1OGTB 1YNTA 1CL7H 1D5BB 4PJEE 4DCQB 4HEPA 2QLVB 1AH1A 1LT9A 1GS6X 2JF1A 1YSOA 3SPIA 4M48H 4FFYH 4XOEA 2CBOA 3L3OB 4J3VA 4AQZA 3O6QA 4P23A 2BNQE 2JK5A 1PPIA 3K0WA 3WFHA 1SJMA 4Z3TA 1TEYA 2N3JA 1RPKA 4PJFA 2IOIA 4P3CH 3T77B 2DY2A 1IAIM 3NK4A 5CZXD 3VG9B 2A4CA 4G6FB 1V55B 4PMEA 5K9JH 4JRYB 4OFIA 1HWHB 2E0PA 3O4LA 4S1QH 3AE6C 3D0VA 5JOPD 5HYJE 3MHZA 4MCZB 1DVFA 1CXLA 4RFNB 5E6UB 2O61B 1QSFB 2EZ0D 2G5RA 2HG0A 4AKPA 2M8XA 1KXTB 2W07A 3FN9A 3U6XS 4PWHA 25C8L 3JV4B 5I8EA 3O6FB 3NDZE 3JTSA 1EAPB 2PUQT 2IQAB 4TNVK 5HJBA 2HTLC 1DSYA 5AVWB 1YPZF 2WYTA 5J13B 1GYCA 2IBGA 3KLHC 2JKNA 1BQLL 1XT5A 5SWQB 1VPOL 4L76A 2ATKB 2RAMA 1KJ2L 1TJGH 4Y4FC 2ZWSA 4KDVA 4P9MH 3NN8B 1OW0C 5JW4Q 2CJUH 2YO3A 2KIKA 3MNDA 2GUOB 1MCIA 3LPGA 2JJSC 4DK5A 4GAAA 3ARRA 4GAGH 4NOBA 4XH2A 1WCQA 3RTQB 5KOMC 4ECNA 5C8JB 4W9LC 4UT7L 4EIUA 1CI6A 5FGSA 3VX1A 3HRZB 4IHOA 4O9HL 4QRBA 4R97C 5A3IC 4UB6H 3O11A 3FQYA 2OAAA 2F15A 5MERB 4YXKH 2A77L 4EIJA 2FYNB 2I5YL 2X7LB 4ZMAT 1YUHA 1NMBH 3BVUA 5D4QA 4L4TD 2AAAA 1KJ3L 1KC5L 4MD0A 1LE9B 3NXSA 1S8DA 2FD6L 2BK8A 4IOIA 5ISZA 5F3HA 3B8EB 5D2NB 3TP4A 1I3GH 2APSA 4MZIA 3WFDH 4W80A 2VABB 4HDIB 4NZTL 3SPVB 5HHME 2BSTB 3KDMB 5DEZA 4X83A 4Z95L 1QPPA 2VLLB 4X8JA 3EGSB 4GP5B 3HNVH 3N85H 3V6FB 4DO6A 4XB7A 1M1JA 4WW2F 1ZA6A 5D7JB 3GM8A 5CIPB 5C07E 3SDYH 2EXWC 2OI9C 3N9GH 3HRNA 3NSYA 5IB5B 1MVUB 1PY4A 4FFTA 4A6YH 2F7IA 4HWBL 4DW2L 4JRWA 2M5AB 3MRRB 3VRIB 1LMIA 4YIQB 3N06B 1GXEA 3PWLA 3AQDA 2FO1A 3L9YA 4M61A 3L5JA 4AGOA 3QEQE 5KYWB 1NBVH 1CG9B 2N1TD 1UWFA 3U4BL 4U6HA 1CFBA 3AB0C 3D50A 1PZCA 4NLHA 2ZXDA 5KTEL 3V79C 3EYUL 3WIHH 3LN5B 5F97E 1U58B 2ADGB 2HAZA 5E9NA 2YA1A 3GC3A 3DOIA 4GW5A 4LARL 5E0QA 5J12C 2FYVA 5GJSH 3OTTA 3MLPA 3U7WH 4HB1A 4PGEA 3KGUA 1LO4H 2ZSWA 1B4RA 4V1DA 1E5UI 3WDJA 5KKZC 2BNRB 3MLXL 2R5DA 1EHNA 3CXHK 3FYIB 1NCTA 3QI9A 2ICWI 5D6CA 5F7MC 1J1DB 1LP1A 1JK9A 3RY6A 1MI5E 4IRSD 4TPRL 3H1HE 3O8XA 3GTTA 1QWHA 1E9PB 4UU9B 2IALB 4FG2A 5IVXE 2WN2A 5CEZE 2XIBA 5FIEA 5I6XC 1IIIA 2JKSA 3AE4C 2HH0L 1NAFA 5E6IA 3APMA 3KL5A 4AX3A 1NGZA 1RZ7L 2FT6A 5IJKC 4UQ2A 4TOYL 3BFQG 1QHQA 3MNVA 2GY7B 3B5ND 4NDMA 4X6DB 4XCNA 4B60A 1E3XA 3D09A 3BUQA 2ENYA 4MQTB 2ITAA 1FPTH 1NEZA 4KX9A 1CXFA 4CVWA 4YX2H 3AMLA 2Y3AA 3BRVB 1BZEA 4AL8L 5HHQB 2Y7SA 3S3PA 4I2LC 1JF6A 1WPCA 1B0GA 4LOEA 4AV5A 1RMFH 3BQUD 4YFDB 5E99L 1FZMA 4MD5A 1BEYH 3MRGA 4PJFE 1EHAA 2WN3A 2QSCH 1XGYH 5E2WH 2OJEB 3LIUA 1XBDA 3FAXA 3STLB 3ARGB 3ZKND 4NNPL 5BMFL 1WBZA 4UMGA 1Q0EA 1RJZA 3K72B 1FZOA 2WNWA 3O4LE 1WK0A 4GUPA 3V4VB 2Q20A 2VQ1A 2FBJH 1SXNA 5CLTA 4XNMA 5B1KA 1R3HA 3RZCD 2BCCG 4HX1A 4FLQA 3KXDA 4DFIA 1TQVA 3D05A 5AVZB 2AEMA 4LK4A 4X80H 3TBTA 1T2QH 1Y0LB 4XRCB 5CEXB 4ZFOA 4KKAD 4ONFL 1NCDH 5F7FA 1DBMH 2BWDA 4PV8B 4GSXA 1URLA 4XP1L 2CLZA 2BVOB 4P2CG 4U3FJ 1CQKA 2PYEB 5F6IB 4UUJA 4DGVL 2A6KB 4P23C 1NGWB 3N40P 4J2XA 2YGQA 1N8ZA 3MNZB 4JUSA 2FEJA 2IWGA 2ZIDA 1QRND 4YEFA 4JJOA 4BUQA 1RIHH 4BE6A 2FFDA 3HAEG 3NYKA 2FK9A 2P4AB 3JUYA 3VE0A 3DO4A 3Q3GA 2NYKA 1URQA 1DVFC 1USQA 4X5LA 3ARQA 3MYJB 4JPKH 3DJZA 4UI2A 4PJHF 3V0HA 4EBQH 2FXMA 5IEKB 5E4EC 2OTLP 4Q7DA 4AG4H 3MUHL 1DLFH 1KB9D 1GZLA 3IFLH 4A55A 3Q01A 3FSZA 4FQHB 3ULSB 3NZUA 1X4YA 4Z7UB 4JY4A 2G30A 4OGXL 1E0OB 1Q82Q 2IPPA 2J8UA 1KILD 2WQAA 4PN6A 4E5XG 2WQYC 5IP4A 3G71P 4GB9A 3WMSA 5ISZE 5INDA 2I24N 3F05A 2Y7QA 2HMIC 3NDYE 4HVBA 1JUFA 4AMKH 4YHZH 3Q8CA 4DP7X 3RWJB 1R5IB 3GMRA 2WZ0A 2FQGA 4NWTH 4FQ2H 1YEIL 5DUML 3TH3T 3KW7A 5ABDE 1J1OH 4RMSA 4DPBX 5A40E 3PJSB 1BAWA 1UWEH 1ETA1 2WMPA 1AC0A 4LFHG 4FQLL 5AOLA 1F2XK 4B0MM 2R69L 2VXUH 1TMQA 3FCSB 1XXDC 3FUEA 3T97B 5E5LA 5HDWA 4GAJH 5JQ6L 2WUBL 5KVDE 1H3TA 3CCVP 1NCUA 4JCWA 3F7QA 4Y2DB 1A3RL 5I1DA 1ZHKB 5CD5D 2CAKA 2OJ1A 1TZAA 3WKYA 2O6DA 5B7FA 4OF7A 3RL2B 2BJML 3CN3A 3RL1B 2JKIS 2FJHB 5ICYA 1YMHB 3L73E 3BZ5A 5CILH 3E9UA 5IMMB 1OIOA 4W7YA 3TEXA 1X7TA 2IH9A 4WO0A 1X5YA 3OMAB 4PJ5D 1XEUA 5B3SB 3D48R 1I1AD 4L9LB 4F8NA 5EOCL 3SY6A 2BCMA 4PRHB 4L1LA 1M1JC 5I5IA 3L3HB 3O3UN 2E5TA 2QMJA 2QPUA 4V1DE 1AOHA 5T5FA 2FBWC 3ZQXA 3FQ1A 3QUMB 2ZWLT 3K2UL 4MWFA 3A6CH 5FECB 4G1MB 4UU9A 3T3ME 4RAVA 3KJ4B 4PJ8A 4DK6A 1AVOA 1PFOA 2BY2A 2OCCB 2IG2L 2GTZA 2C9PA 5E5MB 2R4RL 3CFBA 4YOKA 1KFNA 3C2AH 2P3YA 3NZ8B 2ZJSE 2W0FB 4K7PH 4XN4A 1HCFX 3O3DA 4YSDA 4FA7B 2BDNH 2YN3A 4EZKA 2GBTA 5I1KH 1EZVX 3C5SB 4JFTA 2LU4A 1D6VH 2GT9B 3A6OA 5BJTB 1GAFL 4C4BA 4Y4KC 4NM8H 2OSLA 2Z4QB 4JANB 2CCVA 2IH8A 4OJAA 1V8HA 2IDQA 6PAZA 1S6NA 4GRWB 5BW7A 4PWIA 1CTMA 3UBHA 4K94L 1CBVL 3D3VD 3QCUH 2YS4A 5TE6L 3KL0A 3LRSB 2VMDA 4QF1B 1WFJA 3H32B 2R2BA 1CXHA 2VR6A 1B0IA 1HZKA 3TL5A 4WTXA 4ZTEA 1JNHA 2GC7C 4BM7A 2DQTL 1KTBA 2CPCA 3O8XC 2JTYA 3PHOA 4HIXL 4QDGA 3S1KA 1PX8A 4YAQA 4ZFZB 1PLAA 2YD8A 3CCMP 4JO1H 1KJMB 2NXZB 1FZGA 4JF7A 1KTMA 4HOXA 1RUAL 2A6JB 1ZXGA 2NDFA 4J3SA 5E6IC 3BT2L 5HVGB 3EYSL 2BVQB 5GZND 4U1GB 3BUDA 3H6JA 4HS6A 1I9IH 1NC4A 3BEWB 5I6PA 4DKEL 4AT6B 3U1AA 3GSNL 5D1XB 1EZVG 2VT0A 3VXMA 2WKOA 2YZ1A 4MA8L 3MX0B 4FYRA 3L75E 1NL0L 2O6FA 2L7QA 2BCKA 3IFPB 4D3CH 1XF2A 1R19A 4WU7A 1N8RQ 3PDDA 5DGRA 3DUHA 5BRZE 1FYTD 2OJZL 4PJIB 4OH2A 4HCRA 1INQB 3IVKB 1OARL 4KT0J 4BZ2H 4YSEA 2DLIA 3LZNA 1IAKB 2HLFC 2VR3A 3LNHA 3QDJB 1QBLH 2ZUVA 3V6BR 1DVUA 3I6KB 3V52H 3ABGA 5I1JH 2VM4A 1EA9C 1KGIA 4XPFH 1N4XH 3WEBA 4PRIB 3QG6A 3W0WB 5BO1L 3S4SA 4JZOB 1VF5D 5FAAA 2HKHH 4JKPL 2D73A 1ORSB 4HKZB 4NQSB 1UA6H 1QUNA 4QT5B 3FFOA 1KLUA 3ARFB 4J12A 4XB3A 5TK2A 1Y6NR 1IJ9A 5I24A 3DECA 4MMXA 4QHNB 2M8RA 4XAWL 2WLMA 4NIKB 2GJ6E 1N6VA 4KKCD 4Q9CA 3OKOA 2X0UA 1KBBA 1SMOA 4IRZL 2ZXCA 3POHA 2BOCB 3HI6H 4QJ3B 3CIQA 4GIAA 1NKRA 5GS3A 3ZTEA 3H9SA 1G7IA 4LLUB 3L74D 5AW3B 1ICTA 4X5QA 3IDXL 2WVUA 2YXMA 3PRZA 4LAQH 5I76B 4G8FA 3LW5J 3EH2A 2DLGA 1LILA 2Y5TB 5ESVA 1URQC 3MNWA 3F5WB 1V10A 5KSVB 4UB8E 2L8AA 2WIMA 3BJ91 4YNYA 4NN6B 2JR8A 1TTCA 1CBJA 1I3RB 1KENH 4OUUB 1UCBL 5JOFA 5KVMC 4Y9FA 4WFFD 5E1GA 4WI7A 4QHMB 2EINB 1RIUL 4U6TA 4HFWB 5LCVL 4M62L 1J8KA 4Y88A 3UG3A 1Q9LA 1U8LB 3V0AC 1YN7B 3JV0A 1MZ9A 5DHYB 4AIXA 4BZ1H 2CG9X 4EQ3A 1ACYL 5CINH 3ZHLA 1V54B 4ZUTA 3QUYD 4LPXA 4K9EH 2IX7C 2IJ0C 5CO1A 2X10A 1MJ7H 4PVLA 4AEEA 5JPNC 1HF9A 1AG0A 2FJFB 3HMXA 3P3UA 4HWEH 3KPEA 3LNEA 4CUCA 1FSKC 1OCWH 2W0PA 2G9KA 2PWDA 2ZKMX 3GMQA 3GJFA 3L48A 3MRHA 1I9RL 1F8TH 2MOGA 2CDEB 1SN2A 2P26A 5F70A 2DEYX 5CN1A 4JFYB 3G5YA 1VSCA 3P73A 3KJ6L 4DP8X 4MJID 2QTVA 4G8GB 1DLHB 1MFCH 3GSRB 3BUIA 3IJSA 4XBPA 3SJVD 1QBBA 2LLGA 4LGPB 5I71C 1J5IA 4Z7OE 2RD0A 4TLKA 3PGCA 5JO5B 5T3ZE 1HU8A 1KYAA 5IOPA 4EQ2A 5D7LD 3RVXC 1QATA 4WI6A 1YPZE 1K4DA 3Q0HA 35C8L 1J12A 1GOHA 2ENJA 5DHEA 2EE3A 3FH7A 2MKLC 5BO0D 3AWEA 1O9ZA 1T7WA 5ALBH 2NW3A 3ETSA 4U3FD 2NZ1A 5DJAB 1N10A 2EDDA 1ZAGA 2KI6A 4CC4C 2EDLA 2F54D 5KBKA 4FCAA 2WY3B 1E79H 1ZT7A 1SQPE 4TT3H 4KQ3L 4PJ8C 2EKSA 2YD6A 3ULUF 2DWSA 3TYGL 4FP8L 4XP5H 4CSSA 4FFYA 5KYXB 4QGTA 3P9MB 1FF5A 3RBSA 4RISL 1TVBB 4G70B 1UB6B 1WD8A 3N04A 4PJAA 3LZLA 2A9CA 1Q0YH 4LVHC 5I73C 4I2XE 4MFHA 1Q81Q 4KJPD 2WXPA 3KE0A 3S37L 3RAJH 3KLSA 2DF3A 1IC1A 3IT8D 1MY5A 3OPUA 5SWSA 4ANVA 5BW7C 3JWDH 4EUPG 4Z8FH 3VXME 3IGFA 4J3OD 3WXVL 1MAML 2F74A 1FBIL 4W70A 3D8MA 4FXLA 3GD1C 3V5HA 4MCMA 5DQDH 4I6MC 7TAAA 2F58L 5F9JB 1G7JA 2Y7OA 4RESB 2KKQA 4JM2F 3DIFA 3SCMA 4DFHA 5FM5M 1QLEL 3X3GH 4CKVX 5JQIB 4M7JL 1F3DJ 1E5AA 1VFOA 4YVNA 4L4TB 4PUBH 5ANMA 1KYOH 3KZ8A 1P5VA 4M3HA 1ZJBA 3T9WA 5EZOH 3MOQA 5JQHC 1G7LA 4J3TA 4I88A 2BCCJ 1CFVL 1YY9C 2NW2B 3S96A 4L3AA 5KLIC 2Z1KA 2YIUB 1EEUA 4IIQB 4BKLA 3AMKA 1K2DA 3TM6A 3GI8H 2IAND 3HHMA 3B34A 4XWGH 3ZDXF 3BRFA 4G80B 4A04A 4MYPA 1XSOA 2DIJA 3DIVA 3B43A 2WVRA 4IBLT 4YHYB 2R2CA 5DCCA 3TWYA 3VFUB 5I1HL 4RX4D 4NBYB 3FU0A 3PXLA 4I48B 3H1HG 1JXGA 1M7IB 2WWMC 3OXRA 4M03A 3X12A 1A5FL 3Q7JA 4Y89A 3ARBA 4RSYA 5B39A 3H9SE 3WJLC 1HL5A 1J8HD 1E3FA 3LEVL 3QUZD 1TQCB 2B2XL 3QZWB 4OF8A 5T33L 3NJHA 1GVIA 2N1TB 1SFDA 4D9QD 2WINA 5DJDA 1WAPA 2LGNA 3U6RB 1RZJH 1GJIA 3MBEA 1DVZA 2XY1A 4MSWB 5I1IL 2E7LA 3O3BA 5CMAA 5T1MB 1E28B 1S7RA 2EQDA 3P9LA 3QAZC 2WLLB 2IV8A 1NWPA 4NZJA 4A6YA 3FO9A 4ONGH 3EBHA 5AVQB 2D0GA 5L8LB 4MXVF 4QRPE 3U4EB 2A74A 3W11D 1N59B 1A6WL 1SFHA 4N24A 5GJTL 4AQOA 3BH9A 1LEGA 1BZ7A 3AEDC 1W8OA 2AJUH 3KBHE 2W5PA 5DRXA 4WEEA 1JDCA 1U8MA 3HG1E 4IRSB 5CU9A 4AEHH 5I17B 2XRAL 3KCWA 4OQTL 1XHHA 3G6AB 1N86A 1S7TA 2FQEA 2ZPKH 4JHUA 1G6VK 2OMUA 3QZMA 2JXMB 2AQPA 4LF3B 5TISH 4ODXA 5K9KB 2C9RA 4B9IA 3QRGL 2Z8RA 3MOBH 3C5ZB 1I7ZB 2PWFA 3F62A 3FN0H 4I3GA 4EIZC 2XZQL 3TJEL 2A83A 3BGFC 3GF8A 2EE2A 2NZ9D 3CDZB 4DK3A 4HZLA 3HG5A 4IJ3C 4PJBB 3G6JF 1MRDL 2XIDA 2MKWA 2X9WA 4NC2B 3B5NB 3KZIE 4L29B 2KDYA 4OIIL 5KVEL 3AQZA 1M7DB 1O7VA 2IDUA 1PQZA 5D7EA 2RGSA 4GT1A 4GOFA 2V2XA 4LESA 4X99B 2C9UA 4M5TA 2XQBH 5HI5D 4IBTA 2OYHB 4MQXD 3B2VH 1S7WA 5BZZA 4UZGA 5F0JB 5K33A 1O6SA 4XAKD 2ED6A 3H4FA 1K3ZA 3K8LA 4RMTA 3UGXA 1U95B 4OV5B 1Z5LB 3BP5A 3FU9A 1CXKA 5DT1H 1EVTC 4TTGA 3OAKA 1OXZA 1UASA 3C8KA 5B7EA 2GK2A 4H0LD 1HAWA 3H3BC 3IXAA 3U1QA 1X5MA 4M6MH 43C9A 3LQMA 5IIEB 1ZT1A 4IRJD 2BIMA 4C83B 1NPUA 4NO5B 3NP4A 4PJGA 3RZCB 2OPCA 2M83A 3DI2B 2W91A 2B08A 1NEPA 4LKCB 4NO3B 5F2FA 1ZT4A 4HIIA 4OI8A 3MP7B 2H1PL 4PJAE 4UTAA 3IU3A 1TVHA 1NKGA 4NN7B 4XGZA 2P67A 1AQHA 5D71H 3CX5D 4AQ1B 3VG0L 1G1KA 2Y6SD 4MAYD 4TKWA 5DK2A 4RZKA 2W60B 4HH9B 1QRNB 3GBMH 5SWSE 2JSFA 4QHKJ 4Z78B 4PWKA 3B9KD 1IGTB 2KLRA 5MENA 3EO0B 5KSBF 5HI4D 3HB3D 2YLHA 2XPYA 4FHBD 3WNKA 2GTWA 1RV6X 1OVUA 1CLZL 5EHFA 1CDHA 3NUKA 4FZ8L 5ANME 4X4ME 1YNLL 4KMTH 4G9FA 2JIXA 1KILB 4MDIB 1YECL 3TA3C 4DGIH 4PGJA 3TLRA 5DVNA 4FQ1H 2A73A 1YEFL 1AAJA 1Z0NA 1MHEB 5DU7A 3S48A 3LEXB 3L7FB 4UZUA 2O1KA 3LZOA 4XMPH 4AUUA 2VXVL 4K35A 5ADOH 1RFDH 2ATPA 2N9YB 4WJ5B 3MRPA 3W82A 3B9EA 4OLYH 1QNIA 3KMDA 4LCWE 4YHML 2WANA 3FCTB 1KPUB 3TBCA 1I1YA 4TYUA 3LIZL 2CKBA 4LLQA 1MFAL 2ZUQB 2BSCA 3DUUB 4G6AD 5DC0A 2HT2D 2HJKB 5ITFB 3B7RL 3U46B 3ZE2B 3F6JA 4J8RA 1E4WH 3UBXB 1LJMA 2QQNL 2QM8A 3W81A 1XB6A 4EI5C 1YQVL 3OAUH 2Q76A 3IXTB 4U33A 5B21A 2FIKB 5C0AA 1F5WA 2OMYA 4ISVB 3SDDD 1DDTA 2F1AA 5LGKA 1HDMA 1ZRUA 3OHMB 4U3CA 3F3HA 2OMTA 2Y07L 3IF1A 1XCTB 1NEZG 3GXTA 4HCIA 4PJ5B 5DHMC 1I1AB 2O26U 3AITA 2APXA 3ATDA 3DBXA 3U59A 1JHLH 4RFEB 3OAWA 3UTZB 4L37B 2J6EH 1INEH 4R7DB 2FYZA 1Y7VA 5IK3A 1ZGLP 2G75A 2FCBA 5CSBA 3S3DB 2BNUB 2NPSA 1H15B 3RFRA 2DQHL 1SQPK 3UH8A 5T1JA 1BMWA 2XA8H 4K5LA 1KIUA 3U0WH 2XSKA 5FA3A 2WP3O 3G5XB 4HU8A 4LCYB 4PREB 1TJIH 3CD4A 1DN0B 4HQQL 1AGDB 2XZZA 1AKPA 2YD3A 2I26N 1RZFH 2WM0A 3W67A 4QCIA 1I8MA 1XGUA 4JHWL 4LQFL 1U6AL 1YVLA 2PCYA 3BD3A 4LU5L 4UILH 1AKJA 1KIQB 1FNLA 3BAKA 3G5VA 2WO3B 2YRLA 4L73A 4B3VA 3L5IA 1WZ1H 4IU2B 2AEQH 5IW1A 3MMEB 2A74C 3D3VB 1LO2L 2P8LB 1TU3F 2VL5B 2W95A 2DM2A 4P5MA 1NTKE 1UJ3B 3ARSA 4HBCH 4B50A 4H4NA 3APCA 3RWHA 2EKJA 3L3GB 2BMKA 3SDCC 4KJYA 4M7LH 2WGXA 4M9PA 1A7NL 1YMME 4XBEL 2NR6A 3IFNL 4ZS7L 2HLAA 1ZANH 2MPAH 2LU3A 5AUMA 1E9QA 4ODBD 5EORL 2XVLA 4S1DC 3L5HA 1R1CA 1F4WL 2OMXA 1UJTA 1S9KD 3WO4C 4FQIH 5MI0B 4JDTL 4HC1L 4Q4EA 2V2TB 3UAJD 3R0MA 3VXQA 4PJGE 1RUQH 2QPDB 3NRQA 1RF0A 2MCAA 4XPAL 3V0JA 2C1PA 1TZ8A 2C7UB 1AO7A 4H8PA 4KK5C 3SGEI 4MASA 5BV7H 2ATAA 4CDGC 4N2EA 5FO7A 1IQWH 4M7ZC 2FX7H 5CEZL 1URIA 4HJIA 3QIWD 1OGSA 5EPMB 4AYDC 4X4KA 2F7PA 4PBXA 4PWJA 1OK0A 3CHSA 2E42A 5DJZA 3ES6A 1FYTB 4JAMA 5E8DH 2NY3D 1ZLUK 1AHMA 1T3UA 4P4RB 5DC4B 2D7TL 3O2DH 2ROXA 3RFZA 1TQTA 2IPTL 2X4UB 3NFPA 2C8NA 2ZUXA 1SQ2N 2WD0A 4OLZL 3B7YA 4U1KA 3VXPA 4YQXH 3V0WH 1SVCP 1ZWIA 5H94A 5MENE 1GGCL 3RIKA 4R26H 3FFDB 2BW5A 3MROB 2Y5QA 1VF5B 1KEMH 4UQEA 4YHLH 5E6ZA 3VDAA 2Z8VC 1VZIA 2IH3B 1JOCA 2H7HA 1FE8L 4ALAC 4N2GA 1D7MA 4NUQA 5IMKA 3ZSSA 4GRLB 2VZOA 3KYAA 1MLCA 1VQPP 2Y22A 2I1JA 1HXMA 4BZ2A 1AR1C 2CSPA 3WO3B 2NNAB 2BY1A 4H25A 3TIEB 4U4IA 5MEOB 3V2PA 3QIUB 4WTWA 2DTML 2ADFH 4A68A 3CK0L 4GFXA 2CH8A 3J2PA 1AQDB 3GIVA 2VKXA 5DVPA 3TK1A 1HAUA 7PCYA 5IG7A 2R0LH 1ZLWH 1YDPA 2V5SA 4FFWD 3IFOA 3Q9QA 2DD8L 1UB5B 1A0QL 2WXHA 2EEAA 3EYOA 2JELL 3WS6A 1VGKB 1OT2A 1FAKT 1KJ2B 2PLTA 3GGWA 3BVDB 4N9OB 5GRWA 4F37K 1PNDA 2ADIB 3CN4A 1SNRA 3OJDB 4BQBA 1B0RA 1MW2A 3CSYA 5C0AE 3MACL 3K5RA 3DXAB 2QEJA 3Q8EA 1MCHA 3MZTA 3RL0D 3GKZA 3CDFA 2R2HB 4NS0A 4X6CB 4LLDB 4PJCF 3QUYB 5C0RH 1YIJP 3B2DC 2IFFH 4JDVB 5J06A 3CCRP 4TUKH 1TVDA 3DX9A 1XXFC 1ZSHA 3L7EA 1J05B 4BSVA 4E9XA 3PWJA 1ROCA 1DBJL 4R7NB 1NMCC 5APWA 2XBZA 3O6KL 3GBEA 1H8NA 5IUSA 3ZDYE 3H1HJ 1R24B 1NCIA 1BYOA 3C5JA 1GK4A 2ZOUA 5ICZA 4MS8D 1DQMH 5JDSB 1TZGH 4DKTA 4NQCA 4A2EA 4NHUA 5EA0L 3ASNB 5GRVK 4F7TA 3FB6B 4OCXH 2H89C 4RGOL 2WPQA 4MJIB 5GGUA 3IBEA 4BZ1A 1AXSA 3LS4L 5C3TA 4JKWA 1JYVA 1MFMA 3HR5B 5E4OA 3HPJA 3Q48A 5SV3A 4F15C 5KTBA 1T6BX 4X9YA 5ACZA 3L70D 4F33A 2WXRA 1YNTF 1V3MA 1F6FB 3CC5A 4XXWC 3TBSB 4MMZB 4XE0A 2GKIA 3VI3B 1QMUA 4KO7A 3H1IE 3QQXA 3WFCL 1SJVA 1AQKL 2E5YA 4BFNA 4FNPA 3SWKA 2JKWA 2Q9IA 2PN5A 5JXEA 2X4NB 4W9EC 2I25N 1RZ8A 1U4EA 3BPOB 4KTDL 3F2LA 2R1YB 1SF3A 1LK3L 3GHPA 2OR7A 4QY8B 4Z5RA 2NPSC 4Z7WA 4NN5B 1E2VA 2F54B 1OCZB 5IB3B 4CDHA 1SY6H 4LQ1A 5T1KA 2AKRB 2PYFB 3ARDD 1IU1A 1OWAA 3PG2A 4ICWA 4JHZA 4F9PA 1MOEA 4P4KA 1EDHA 4FERA 3VQ2C 1Y1UA 1BJ1J 3EXJA 2W1NA 4DETA 2OYOA 1GSKA 3L4ZA 4J6RH 3EOBA 1LNQA 1MRCL 4MA7L 5D5MB 1YC7A 3SKNA 4FQJL 3H7BA 1S3KL 4J3XA 4P3DB 5H4YA 2ZP0T 4FLRA 2A7BA 2V7QJ 1AO7E 4YN3A 1BF8A 2ZJSL 5C0GA 1PDKB 2Z7WA 4WVZA 3FQTA 3FB8A 1U7MA 1EZVD 5EU3A 1KTLA 2J55A 4YDKH 5E8PB 2WBKA 3BE1L 2XXFA 3I3BA 2VDNL 3P40A 5AYUH 3EFFK 1JY3N 2FSEB 4HJSA 5CIPH 1L0LG 2NR6C 1TCRA 1SQQG 1XGTA 3UO1H 3JV6A 3QXWA 3BW9A 1T5XB 2R0WL 4JB9H 1K5NB 1UACL 5ECJE 1NUFA 5EMYA 4KKLD 4FLOA 2X2IA 3GI9H 2RACA 3MLTB 2ILLA 2ZX9A 3ILEA 3NSCA 5HJ3A 3VXSE 1FORH 2KC0A 1OF0A 4X0KA 5DZVA 2WBJC 1RF0C 2HTKD 2IANB 3A3YB 4BRYA 5GGSB 5AOZA 2GUSA 4P46D 2OQJA 3SQBB 3GSUA 3V9CA 5I1AA 1DUZA 4U1IA 2FJSA 2UWEA 5C6TL 2NYYC 5IJVB 2WSEH 3WG7B 3HUJF 3CMOL 1ZTXH 2GYSA 2P49B 4OR1A 3RPBA 3P3YA 4HOWA 1MNUH 5DRZA 2A4EA 1O9VA 3D06A 1J8HB 3QUZB 3KXFD 3RFZC 2BP8A 3VW3L 3MRJA 1BCIA 2AXWA 1DQQB 1CLOL 2QJKC 2EDWA 2ZCKH 1JTOA 4MXWH 3R8BB 1T5WB 3CUPA 2JKJA 1MY7A 5GGVH 2X05A 3H9YA 5DA0B 1FLTX 1AMYA 2DWYA 1NH6A 4NJAH 3AU1B 5DVOA 4OTXL 2Y24A 5AW7B 1U2CA 2G3MA 1SGKA 4F80A 4M1DH 4MX7B 4JPVL 1KB5H 3IDNA 2HTLD 1QFOA 3TF4A 1TQBB 1NTKK 1AC6A 3KLHD 1VADB 3VQMA 3K71B 4N20A 3M88A 1VQNP 4MJHA 3SDAA 2XZCL 5AKRA 3WV0A 1VDGA 5CP7B 2X89D 4LZKA 1TTRA 3GK8L 4Y4FD 3GHGC 2BNQD 5DD1L 5FOJA 3ULVF 1CLVA 2WYIA 1JPTH 4F2EA 8FABA 3QDGA 1P4BL 1L0NK 1ZDSA 2FYYB 3WS6C 5HYJD 1CT8B 1KBVA 4NQCE 3DX7A 5A3ID 3NZHL 1FGNL 4HD9A 2UZPA 5FYLH 4EI6B 1GC1H 5EUOE 5HY9B 3CFKB 4NUJA 2YD2A 3L3IA 2GIMA 4R4FL 3RUGF 5L88L 4GG6E 4OJEH 3VYIA 3IAOA 1LDSA 1PZ5A 1E27B 2KDGA 4HJJL 3U4KA 2QDWA 4R2GC 2XX1A 3FQNB 3KYNA 2DQUL 4GXUM 4JGMA 4X8GA 3UCRA 1YJWP 1CK0L 4H44C 2J57A 2CPBA 1A7RH 4XT1C 5AW8B 3IJYA 4ES9A 3Q1SL 1NIBA 4BFGA 1BQRA 2X1QA 2ZOTA 2DIEA 5HHXL 1BFVL 4H0LB 3OLEA 4X9FA 4AQEB 4F7MA 1IBYA 3WKML 4Z7WE 3GSXB 3NJGA 4XCCH 4IRJB 3I50H 2EXWD 3BGAA 5D93B 1BFOA 4ZQTA 1T4WA 1ZHNA 1S7SB 4U1JA 4KU1A 3CZGA 4K9EC 1EGJL 5C0CB 3HG2A 1P4LA 4DP5X 2IO5A 4HK3J 3VGAC 4DKAA 3PS6A 5DO8A 1QEWB 5BPPA 1T80A 4X0NA 3C09C 3ATBA 4M1GH 2DW3A 1WBYB 2QJYB 3DSNA 3L75J 4MAYB 3TBWB 5DI8B 2CM5A 5HHMD 4OCRL 3VD0A 4HV8B 1CDBA 1G9ML 4OD1H 5T1LD 1A9BA 3CFUA 5JXEC 3ZLQC 4LDEB 5JHDB 5KAIE 5H4ZA 1OT1A 4HOZA 4UAOB 5I8KH 4AE1A 3ASWA 3B9KB 4LOVA 5C07D 5T3ZL 5T1DL 3KPQB 5B39G 1OPGL 3L9RB 3WMPA 3R1GH 4A1RA 3HB3B 4P4KC 3QUKB 1DJWA 1SXZA 2PCPA 3BFOA 1T03H 5FYJE 2AK4A 4FEIA 4ORGB 2C4FU 4IDJH 5B4MC 5DJ6B 2J8HA 5AW5B 5HVFB 3QEQD 4UANA 2RFXA 2X12A 2KUBA 3HE6C 3IAPA 2YNYA 4TVPE 4NCC1 4KPHL 5K39B 3PRJA 3BH4A 4R4NC 4W4NA 2J8UF 5A6MA 1BHGA 2QVKA 1H5BA 3BD4A 2PF6A 4E42B 2IEPA 4HZAA 1A6UH 3B3BA 4M7LT 5GHWL 2Y1ZA 5A1AA 3HJ0A 4WHCA 1E30A 2OZ4H 2N56A 2UWEE 4OU3A 3RNQA 4NM4L 2XBDA 1CSBA 1FYHB 4YE4L 3RP1A 43CAA 3H3KA 3DJRA 4HXAL 3TV3L 2YMTA 4H88H 1VA9A 2J1WA 3FOMA 1KYOE 3FPYA 3RNKB 1FRGL 3PAVA 1MI5D 2O5XH 3BCCE 3OMZA 3H1HD 1AA0A 5E7FA 1M2OA 1S7UB 3V6OE 1CDJA 1HKLL 2O01J 2ZAHA 2IAMA 3EFOA 5DVKA 3E6FB 5CEZD 2JCWA 2VIRB 3JWDC 2YPVL 1AOZA 1ZGLA 3BIKB 3GMAA 2H9GA 4KTEL 4JMNA 2EDHA 3V4PB 5JW3L 3ZDZB 5CCGA 4DVRL 1LTJB 1OAYH 4N9GB 3VI4F 1IFRA 4OLVH 5F89A 1H8SA 2B9AA 3A6BH 3CH1B 2MOVA 5AVRB 3VRLF 3CU1A 2HPTA 2ADJA 4EIBA 1JHKH 1NCCH 1ZPLA 1J9RA 4WBAA 1YYLL 1KCSH 1RUML 1P9MA 2P45B 3KPSE 3SE3A 1OF2B 1KMGA 5F7DB 2ZOLB 3NH7L 4LSQH 1OD9A 1EFXA 2XV2A 3KPOA 2UZIL 1F86A 4GRWH 4P23D 4PP2A 1BZ9A 4E9QA 3CDGB 3NCYS 4QHUB 3AREA 3V6OC 1DBAL 3AWGA 3CVBA 2DS4A 1F97A 2OXHA 1NLDL 3QDGE 1FAIL 2CLVB 1FVCA 3LRKA 3O4LD 4TL4A 5EC2A 4M56A 1WS8A 1DVFD 1RD6A 2J6EA 4HF5H 1I31A 2AJVH 3UZQA 2X6MA 5G4NA 2R0KH 1G1IA 3H1KG 4GP4B 1JNNH 2EE9A 3IWUA 1TETL 1UKTA 4FXKA 1E5BA 2LFEA 2V7NB 3DYPA 4TUOA 2J5WA 2DIAA 1NDGA 4R0LA 1FV1A 2W9DL 2WWKO 1BWMA 2BPBA 1MHCB 3L4UA 3MRLB 3IDMA 4WEBH 4G43A 2D8KA 1UATA 2DJSA 2P1YA 4JW3A 2DDQH 2FJGB 2HMID 4UNIA 3ZZ1A 2EDBA 2DBLL 4PFEA 1WRFA 4P5RA 2ED7A 1SQPJ 1W0VA 5I66A 1JZ5A 2K78A 2WP3T 5BQ7A 3PAUA 1ZXKA 2VO5A 5GSRB 2JFCA 3Q13A 4B7LA 4F91B 3FQ4A 2Q1EA 4YE0A 4BGLA 3DURB 2LU7A 4YJZL 1MPAL 4Y2OB 4LASL 2EABA 1G0DA 4IKLA 5F3BB 4M5SA 1KCKA 3O6LH 3CFJA 5EU4B 5I1CL 4GBXC 1CLYH 2W83C 2HFGH 4M1CC 2BSEA 4A7GA 5DJTB 1QTSA 2OR8A 3QIWB 2V5YA 3MBWB 2V9RA 2A4ZA 1TYRA 3B5GA 3PWUA 5ISZD 3G9RA 2WQSA 1E2WA 1OP3H 4JY5L 2NY3B 1TKWB 1CFTA 1A4JB 2V37A 4HD5A 4PRNB 4WFHE 2O5NA 2OXGA 2VZVA 5IV2B 4NRYB 1AANA 4ZT1A 3UABA 3E6HA 2H0EA 2D4DA 2APWA 4R3SB 2R2EB 1BSNA 3KYKL 3VFMB 1AI1H 3RIFF 4UINL 1BX2B 2DQDL 4E9RA 4Z0XA 3CX2A 2X9XA 3MV8A 3ZIYA 2EO7A 2EDJA 4GKNA 3P0YL 4AK2A 3NEOA 1UT9A 3AY4A 1SHMA 5B1JA 4M8QB 4JFOB 4ZFGH 1T7VA 4GYBA 5KANG 3EJCA 4YK4B 3RDJA 2I8DA 5KSAB 3R19A 3X1GA 2ICEA 4Y5XB 2K4AA 3V7AG 4PD4K 2ARJA 1DE4A 2DQFB 4OZHB 3O2DA 1RLWA 3L73D 3NIGF 5GRVL 4Y4HA 4Q89A 3FNKA 1FDOA 5FGCB 4WI2A 1DQTA 3CMEP 1NCNA 5GGRA 4DEUA 4LCUA 5C2BL 4K7PX 4Y4KD 4D0CA 4XC1H 1TENA 3DPDA 1A6ZA 1G94A 1B2WL 1GY1A 1WC7B 2MHAA 1AHKA 3N41F 5E9DA 2MCG1 5D1ZI 1IGJB 1P4UA 4V1DD 5E6SB 1P0SE 3IBOA 1ORQA 2C3XA 1L0LJ 4NQDA 4O5LH 4O2CB 3AG4B 3N43B 3M07A 3T2PA 3PHQB 1RSYA 4XNDA 3M7FB 1ZLSL 4ZTPL 4ONHB 3O8XD 1T0NB 4I1LA 3QNFA 1QSZA 3RL0B 1BQHB 5CGYC 3PLYA 1UZ6E 1AFVH 2ZOKA 5C0DB 4X6BB 5B38B 2XHNA 5E6ID 2ESVE 5G55A 4NRZB 4P5SA 5J6HA 1QI3A 5CCGE 3QJZA 1A3LH 1MWOA 5BS0A 2J1XA 4WK2B 2HG5A 3RWFA 4I5BB 5DJYA 1ES0B 1BGYE 5JMRA 2NY5H 3IMUA 1UUSA 2AJSH 2KSEA 3NJVA 2Q6QA 2RTTA 4XA4A 3WDIA 5AALA 1RLBA 2JO1A 4YHOL 4BUHA 1P2CB 3TGUE 4CVXA 2X1WL 2CR3A 3HC2A 4MJ6B 3QYNA 3N42B 3HE4B 2R29L 3E2HC 2BY3A 3EGXA 1ZGLM 4J4PA 2IAMC 3GLEA 4JQ0D 2TRYA 2HLFD 3D9AL 1AZRA 1OGTA 3PP3H 4NENB 4RWHA 5BZWB 2GQHA 1D5BA 1MZZA 4IJTA 4OLUL 4DAGL 2O5ZL 1A6VH 3BUBA 3FW6A 4O58L 3QWOC 2ZE0A 3JZYA 4KO9A 1NM9A 4FQCH 3OGCA 5CCGC 4W9ZA 5TPWL 3L3OA 4F9LC 1ZK5A 4Y5VB 3WN6A 2IH1A 2YKQA 1LO0L 5J6GB 5K9OA 3CZSA 5J1AA 3F64A 3FQRA 1GTNA 1S3RA 5AVXB 3SE3C 2EE6A 4CVUA 5ILTH 3L75D 1JL8A 1A4CA 4M00A 5DD6B 1Q0XL 1RZGB 4LBAA 1YEJH 5D7IB 3VH8A 1NBY