4HYTB

Na,k-atpase in the e2p state with bound ouabain and mg2+ in the cation-binding site
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
289
structure length
289
Chain Sequence
FIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRFRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
publication title Crystal structure of the high-affinity Na+,K+-ATPase-ouabain complex with Mg2+ bound in the cation binding site.
pubmed doi rcsb
molecule tags Hydrolase/membrane protein
total genus 46
structure length 289
sequence length 289
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4hytB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 4hytB02
2YNYA 3I5CA 5AW1B 3TYYA 1FAVA 3M9BA 5AVWB 1J2JB 3WGVB 5AW9B 3M06A 3LIEA 1H89A 5AW3B 3L36A 3LIDA 3TNUB 3M91A 3O8ZA 3VMZA 2WWWA 2C9NY 3P32A 2WT7B 1A02J 5APTA 2XU6A 2ZFCA 1MV8A 1HWTC 5AW0B 2R32A 3HE5B 5AW6B 1SP4A 1T2KD 4AYCA 2BASA 1G2CB 2P7JA 2W6AA 4M3LA 5AVTB 3HE4B 1OXZA 1YYCA 5APQA 1NAFA 1CZQA 2Q3IA 2WPQA 1A02F 2H7HA 1S9KD 3T97A 4XE5B 3A5TA 3M9HA 3VTPC 2YO3A 1H88A 3NXSA 5AW4B 2R3CA 4DZOA 2Q5UA 3VMYA 2XZRA 2WT7A 3A2AA 3M0DA 1MUUA 1X8YA 2QM7A 3V4WA 2VRSA 1CI6B 4LC1A 2W27A 3HE5A 1GZLA 5AW5B 1MFZA 2WTYA 2QM8A 3A7OA 3VN0A 1NWQA 3P7KA 3MD0A 5AVYB 1HJBA 2IPPA 3B8EB 5AVQB 1JNMA 5AVZB 1FOSE 3NFQA 4JYCA 1T2KC 1DH3A 3VMXA 3TK1A 1S9KE 4KHXA 5APWA 5AVSB 1GD2E 2XV5A 3MGNA 2P67A 4RETB 1OWAA 1HUCA 3VYIA 3TNUA 3A3YB 2Q7CA 2KP8A 1CSBA 4EOTA 1GK6A 2ZXEB 4I2LC 5CMZA 2C9LY 3IR9A 4HYTB 4RESB 2R5DA 1IO4A 4I6MC 1GU4A 2WPSA 4C7NB 3NTNA 3P8MC 5APVA 4AQRD 5AW2B 3KQGA 3L37A 4JYBA 2Z5IA 3V5BA 1GTWA 3V4QA 3WGUB 3L35A 2E42A 4AUWA 1HBWA 1FOSF 2N9BA 3HE4A 3UIAA 3HTKA 3M0AA 2E43A 4B86A 1GK4A 3OAKA 5APYA 1KQLA 4C46A 1SLQA 2Z5HA 5AVVB 5AVXB 1JUNA 5APXA 2JJLA 3KDPB 5AVUB 5AVRB 4GT1A 1CI6A 3NMDA 5APUA 1H8AA 4C7NA 2P2UA 2WPRA 2R5BA 2YO2A 5AW7B 1GU5A 5APSA 5AW8B 4GKGA 3SWFA
chains in the Genus database with same CATH superfamily
5HI4D 3FRPA 3U79A 3AUWB 2DH3A 2FX7L 1YI2P 4PRBA 5IVXA 3MOAL 4MX7B 4Z1PA 4Q56A 2QQKH 4XMLL 4FFTA 1DLFH 1DBKL 2VKWA 4N6QA 4JN2B 4XCFL 2Y2TA 3EH5B 1N8OE 4NI6A 4QRUB 5H37H 4BELD 4X5WA 1V3KA 3T2PA 1TLMA 2V37A 5D72H 1T22A 4NZUL 2IO5A 5A16B 2AJZA 3PWPA 4AYGA 4N78D 1K6QH 4PD4J 3UTOA 4OJAA 5KYUA 4GKLA 4NRZB 4WO0A 4WENB 2AV7B 4I0KA 4M3LA 3ZDYB 2E4FA 4MAZA 3I02B 3G3ZA 4ZMAT 2ZAHA 5IB1A 1H0TB 4YXHL 4NPYB 3QQNA 1KMIZ 3T97A 2OSXA 1LYQA 1DEEA 5DQJB 2OMZA 4F1ZA 3QIUC 1ZGLA 1JPGA 5IESL 3GTVA 4O9HH 5JIKA 4AZ8A 4BV1A 2OJ1A 5EOCL 5HHMB 4YBLB 3QJZA 3MRBA 1DJWA 1FO0B 4QHKI 1ZLUK 1QKZH 4GSUA 4FKKA 2CO7A 1S7QB 3EJZC 4GMTL 2NY2D 2UY7B 3QWQB 2Y1YA 1I7ZB 4LQFL 1ZPLA 4HWUA 4Y99C 3MACH 4O5LH 3C6LA 1PZBA 3C12A 3SDCD 3OMNB 3KGUA 3M17B 3CSYB 3NJKA 4KJPC 4A6YB 1OAJA 4Z8FH 4X7SH 5I8OH 1UZ8B 3II2A 3DX9A 3SDAD 1SQXJ 3TM6A 4IGBB 4FTDA 4JL2A 4XBEH 4WI4A 1NCGA 4YDZA 2IFMA 2CIKA 2DJMA 1LTIC 3QG7L 3UIZA 4JREC 5KVFH 1JZ3A 1THCA 4ANKA 3SPJA 1TJMA 1YN6A 2BIMA 3EO0B 5HYJE 1BZ7A 1RUPH 4DN4H 2X88A 4HIHB 4KBPA 4I4WB 4LAQL 3VXME 1UD6A 5L2KD 2JR8A 2AV1A 1Y7VA 5HHOE 3EYUL 5KAIH 3HC3L 5GIRB 4ZSOB 1VZHA 1Z5LA 2A7BA 2VXTL 4X7TB 1S7WA 3ARTA 4M93B 4P3WA 5FYJL 4H26B 1O7DE 5ITFB 2X4OB 1WS8A 1IRAY 1UXMA 3F84A 1M56D 3WD5H 3RPIB 4A55A 4AQ1C 3TA3B 1DZ0A 1TJGL 3NRPA 4IRJB 3ZRSA 5I73C 2KZBA 3D2UB 1AE6H 2MTAA 5J11B 3SN6N 2PW1B 1EA9C 1DL7H 5JQHC 2NUTA 1IGML 3EJYD 4NUQA 1TYJA 2P8MA 3WG7B 3L3DB 4F2FA 4YIQB 2X9ZA 2MSPA 3CCEP 4JUTA 2XYBA 3UAFA 3HG1B 1GRWA 3QZWA 4IOFD 4LARH 2ZCLL 3VXRB 3TN0A 4O2CB 5GRVK 1WAAA 1MFTA 2VJ0A 2PR9A 4JHWL 1NJ9B 2HWZH 3IETA 4IBSA 1NAYA 1GGYA 3EH1A 4TUKL 2AJSL 3UTTA 4N9OB 3RWGA 3WY1A 1M8OB 4IK6A 2L8AA 2ITDB 3PU7A 2BIQA 2A99A 1K2DB 1OD7A 1ES0B 4G7VH 3ARXA 2YK1H 3OQ3B 1EEYB 4YWGH 2EADA 2XQBH 1VFAA 4G1MA 4ZI8A 2XBTA 2VXVL 5IW1B 3BUPA 4KZ0A 5T5NF 3CBRA 3SBQA 1T3FB 1PY4A 3QRLA 4POYA 1OTTD 1LTAC 3D30A 5E2WL 4QF1A 4W9EC 4UIMB 5H37A 1GZHC 4M1GL 4N0FB 1EBPA 4XCCL 1FA4A 1BD2B 2HH0H 4OLWL 2O6EA 4ZX6A 1MOEA 4K9EC 3OKYA 4NQEB 5SWZB 4WJKB 5IT2L 1A6AB 2BEQD 3KGRA 4YGVA 2F7QA 2Z92A 3D5OF 3ZTEA 3W37A 1CL7I 4ZOBA 3GO1H 5I8KH 4ADGA 3B2PA 1A3RH 3A7OA 1N10A 4H8UA 5GGQL 4ODTL 2FWUA 1FFNA 3PABB 1MZYA 1FZCB 5FOJA 1EO7A 3QIUB 4TLFA 2CCVA 2IFFL 1X9QA 2Q20A 4QTIH 3EDEA 5L88L 2GEEA 2L7UA 1FBIH 3SSUA 1E6JL 3O3UN 5GGRB 5F7AA 4G8GD 4EOTA 2BY1A 4WW2C 1XF3A 5GPRA 3Q43A 3VG0L 3L3JB 1FCGA 3OF6A 4FP8L 4BH8B 2OTWA 4R3SA 3MV8D 4XH2B 1KN4L 3CQFA 2D03L 1ORSB 2YUVA 4RZKA 2NT1A 1BOGB 2FFDB 4JDVA 5IJVA 1HZLA 4MLSA 1D6EA 4EF3A 1FFOB 3QH9A 3N1PC 2N9BA 3MA9H 1QLED 2DBJA 4GFTB 1KBWA 1NTZD 3LKNB 3ZTDC 4MJ5A 1YYLH 3FWNA 1S7TB 2M2DA 5D1QE 3QDJB 1OE1A 3L5IA 4RMQA 5CF3A 3G04A 2NPSB 1GL2C 1JWMA 4N8CH 5LNEA 5KTBA 3C5SB 5A2BA 5FXCH 4ANXA 4I9XA 3M86A 5F1KC 3FTVA 3P9LA 5DMIL 3MLVH 1E3XA 1O6VA 3FQNA 5F1NA 3WXWL 4FD0A 2VZTA 1T0NB 1S72P 4W9IC 4Y16D 5DUML 1AYOA 1P9MC 2PWDA 3FQTB 4OD1L 2CBMA 2GITA 2AQ2A 3KS0H 1QQDA 1N7LA 4NKMA 4NJAL 4KK9D 2MKWA 5KN5A 3BO8A 4G3YL 5H94A 1I8IB 3V2QA 4TRPL 3G08B 3PGDA 4FFYH 4PRNA 2MQ0A 1CE1H 4DEUA 1TZGL 3L3HA 4WWNA 5DUPL 4LPXA 4PY7A 4AC2A 4AXWA 2JK5A 2YFNA 5HI5C 2DKUA 2WT7B 1FL5A 5GS1A 4P9ML 4QHMB 5I73B 4N78E 3VXOA 1Q9OB 2XY2A 4RDQG 1IC0A 5CCKL 3VRIB 1MFEL 1NIDA 2XZAH 3FO9A 1L0LJ 4M6OL 5C6WH 2V9TA 1HHKA 3NEXA 5DTFA 4N8VG 1A64A 3PREA 3FS9A 2C9AA 2CUAA 2YMTA 4TLUA 5CEYA 1EVTC 2LLGA 4GOEA 3DYMA 4H1LA 3TBYA 2LGNA 1OXYA 2M5AB 2OTJP 1IC5H 3NEOA 4IFMA 4HS3B 5AOJA 1QSFD 3VM5A 2H7HA 4R7XA 2R0WL 1T20B 1JGVL 1NICA 2NY1D 3L3GB 3NTCL 4LOUD 4QXTB 1KFNA 4JKLA 4H8VA 1KIPB 4I85A 4MJ2A 1NUNB 3JV5A 4UQIM 1N73A 4PAZA 4N2FA 3ESOA 3MRKB 3P0GB 1GMJA 5B7FA 4J3OC 3GK8H 3VFSB 1ZT7B 4LP4A 1GZLA 5D72L 2X4UA 2AXFB 1ZWIA 1OP9A 5HYJA 5CSGA 1H5BC 5JOEA 3BQUC 1K6QL 2F5BH 5IJKC 4LKCA 1PJ9A 2IFNA 5A1AA 4YNYB 3P0YL 5HHOA 1KTLB 5G4OA 3KL0A 1VGKA 1I9RH 5CILH 2P67A 5A6LA 1QI4A 1Z3RA 1XD1A 2P44B 4DPBX 5JHAA 5EC1A 1R34A 2ZX8A 4NLAA 1JK9B 4HCIA 3I9IA 2DY2A 1QMUA 4O9HL 1PSKH 1SEBA 4GRWF 2WLIA 5L2KE 2GJZB 1B88A 4W81A 1P5UA 1X4ZA 4Z78A 1MCDA 5IEKB 2N1TC 5J12C 4FQIL 3EFFB 3H1ID 1B4RA 3QHTC 4HFUL 3G9VA 3MZGB 4TQIA 4TUOB 4ZFOB 4EDXA 1HESA 3GEWB 3WCYA 1YNKL 4NQSB 2VLKB 1AMXA 4OIFA 4O5LL 3MACL 1E28A 4WW2B 3IFNH 4BSVA 2Z5HA 3DA0A 2QHRH 4PCKA 3H9SA 3F01A 1D5BA 3FT4B 3MNVB 5D2LF 2O1KA 5DZJA 2K0RA 4HJ0C 5CJOL 4ZMVA 2QVFB 4IL6E 2VJXA 2BNQA 2DZEA 3TVMA 5J1AB 5D6CA 3LH2H 4PJFB 5I8OL 1OMIA 4C7NA 4UQ2A 3KH3A 2NSQA 4XBEL 1VZIA 4CJ1A 3RL1A 5AW8B 4I1LA 1VPCA 1SOQA 5KVFL 3V6BR 4C4KO 4L4VE 5JHDE 4JUSA 3MHZA 3RX5A 4AEIH 3TF5A 1FAVA 2FL5A 1RUPL 1MFUA 4DN4L 5LO7A 4ABUA 3H0TA 5DD0H 4KJYB 3RIAK 1PW3A 1H89A 3ULVC 1PLGH 4WI2A 5E2JA 3V0AC 3O8XC 4EUPG 1T8ZA 4QWWC 1DSFL 5DK2B 4PJAB 3RFZC 4HUVA 3AQZA 5CJBA 5E03A 5EO9A 2UXTA 2QVIA 1DVFA 3M1BA 4IOIB 4OTXH 3WLBB 3QPQD 2DWXA 3X11A 3U9UA 3D71A 2WXNA 3QEQB 4XPTH 5LBGA 1IFPA 5IG7B 3VU1A 1ZDSA 1JY3O 1F4YH 3WD5L 1JZJA 1JF5A 5DVNA 4HOXA 1V7NH 4OIIH 2R8SH 4AL8H 3MLZH 4HLJA 4JEGB 2P10A 2GTZB 3N40F 3X3GH 1KJVB 1H8LA 2DWSA 1DL7L 3NMEA 4FFYA 5C0IA 1PD0A 1S7UB 3GMMA 4HH9B 4IRSD 2V2TB 3TGUJ 3E6HA 5DJXA 1OAQH 3TO2B 3MLRH 1N0LB 1E6OH 1AFOA 1X8YA 2CJ3A 2NR6A 1E27A 1U8MA 4Q9CA 3CXHD 1F0LA 1MY5A 3OR7A 4ORZC 4GRWE 3OZ9H 3T4AB 3VGFA 4ES9A 4WEMB 2KI7B 1A3LH 5JPMB 2XWXA 2OBGA 2HWZL 5IP4A 3DETD 4UTAL 2XZQL 3PE9A 4OZFB 5JYLA 2A9DA 1RPUA 1PGOA 2D3NA 3D9AH 3QDGD 4NWTH 2EDBA 3NH7H 3RFRA 3U1CA 5B4MC 2EE3A 4YWGL 2YK1L 2XQBL 1QTYT 4KTEH 1A22B 4K35A 2IYOA 5D2LE 2P28B 1WVZA 3BHBA 3PNWA 3RE0A 1BBJA 4L3EA 4LKXB 3MV8E 1H6TA 2WYIA 3U6RB 1KILC 3KYQA 4ZQTA 5JQIB 5SWQB 4NZJA 1K8DB 1TZIB 4HAFA 5GISH 1E2ZA 4PR5B 2HH0L 4UB6E 1WAPA 1GOFA 1H5BB 3TLRA 2HG5B 5PCYA 2K6ZA 3QISA 1CGYA 2WINB 4NYLA 1C1EL 2FQGA 3L3OC 3AM8A 1E50A 5F3HB 3UDWC 3CZSA 4F8OA 3GO1L 5I8KL 3LKSB 1HSBB 1A3RL 4FJYA 2J8UA 4HMDA 4Q89A 4UIKH 4U1HA 1JY3N 2B14A 5FKAB 1C8QA 3NZHH 5K1VA 5AVVB 3FX0A 1JOIA 1JZGA 4P4RA 4LB8A 4YHZL 5DD6A 4Z7WB 1CICD 3HG0A 4BRYB 4QTIL 3JUZA 1URLA 1FBIL 1A7NH 2NQDA 1JV2B 3D08A 5DHYB 2BCCE 2LKMA 1TJIH 2HP4A 2WCSA 5ICZB 3KYMA 2AK4D 4KX8A 4EMZA 5F21B 5AW1B 1NC4B 3BLBA 3LOWA 4S2SB 1VEPA 4GRLB 3X17A 6FABL 3PAYA 5INCB 1ND0B 4HULB 5AAPA 1IFGA 1FRGH 4G7YL 4CVXA 5KSBB 1M2VB 1FU1A 1X4YA 3MA9L 5KBKA 4XPAH 3OWRA 3VW3H 1LO3H 4E9YA 4WDIA 1YYLL 1TQSA 2X70A 3CCRP 3VE0B 2I85A 1ETZB 3P9MA 2GG1A 1KGYE 1KACB 1V3LA 4AVJA 1AY1H 2CHZA 2IBZI 1U2YA 3UZEA 2ZAEB 3E8VA 1SQXG 3Q2CA 2EDRA 4U7SA 2L91A 2OS7A 4AQAA 2IPUG 2DWEA 3HPLA 1SQQK 2QVKA 2UV3A 3QQ9D 3MLVL 3OMZA 4JQVA 3SDCA 4DP9X 4HKJA 1QLEH 2GABA 3GF3A 1JDAA 1G7PA 2IX7C 2JI1A 1H6FA 1OGAD 3AEBC 4FLQA 4Q0XH 3MRPA 1AXSA 1CFSA 1A65A 3O8XB 2EDEA 2EDDA 4XBGB 1T83C 3RFZB 4XX1G 3SDAA 3LB6D 4OVUA 4ASWA 2VDKL 4JCWA 2K88A 1LT9C 5B5EE 3BSGA 4RMSA 5I2IB 1S46A 4FG6C 1VHPA 2CIIB 2Q76B 3S35H 3JCUH 3BYTA 5EFIB 2WZ6A 4FFYL 1CE1L 2OMNA 1AD9B 4R2GC 1SVCP 1VACA 3EOBB 3M45A 2BNRD 5A2CA 5AW5B 1MLCB 3QORD 4JY4B 3KBHE 4ASVA 2Y3NA 4PP1D 4U6YB 3WJLC 5ADOH 2OSLB 5L2KA 5EUKA 3C2AH 5JIMA 2BW4A 2XZAL 1XGYH 4DK6A 1QR4A 3BWAA 2HFFA 5C07B 5CZRA 4G71B 3WUUA 1TU3F 4V1DB 3V0WH 3MGNA 5IB2A 4W70A 1KGCE 3DPBA 5IB3B 2Q7CA 2EXWD 2NY4C 2NYYD 4JKWA 1JWSB 1KCRL 4BXLA 1CFTB 3HZKA 1A7RL 5DJ8B 1AANA 2FD6H 2NYKA 1LDPH 2RFXA 5C8JB 1PS3A 3CCVP 5JYMA 4HIEA 5MI0C 4MVBD 1E8YA 2LU3A 3JWNC 5TK4A 3CXDH 3FUFA 2APXA 2HODB 5DJ6A 4XZUB 3VGGA 4G6FB 4DP6X 1JTHA 3GK8L 3O3DB 2YLHA 1OPGH 1KC5H 1U8OB 2NNCA 5IWLA 2MPAH 4CPGA 4JLRB 5AWNH 5BV7H 4H7VA 5TGBB 3QXDA 1SBSH 4JE4B 4AIZA 1DJGA 2XTJE 1G84A 2YBRA 5DMKA 2OYHC 1KILB 1OVUA 1RZ8B 2F5BL 3AROA 1GPOL 1AGFB 1WFUA 5F9DC 4EO5A 1K8IA 5B5EH 1TG8A 2RQ8A 1I9RL 4AITA 2F15A 3VD9A 2K6WA 2DOCA 3CDFA 4TULH 3L3OB 3DJ9A 3BP4A 5L0QB 4GBXD 1SN5A 4PS8A 5E8EA 3VFMA 4JO3H 2Z4QA 3OKNB 2ZICA 4F37F 1VQOP 1PSKL 5DT1H 1VADA 1UXLA 3S4SA 5DI8A 1J2JB 2PWGA 2IANB 3D1MC 2EZ0C 4GXVH 3H1KJ 4M5SA 4LLVA 4F58H 3KPSE 1AGCB 4OFYD 5EUOB 3HZVA 3LRSB 4FKEA 3ZKMC 1NHLA 2E7CA 3L4UA 4S11A 3NJLA 1ZLVK 3WDIA 4F92B 3L72J 1T6BX 5F9JA 1XV8A 5APTA 1Q0EA 3AADB 3IFNL 4E9RA 2QHRL 4Q9QH 3GQFA 3NSXA 2XBDA 2X4PA 4WHDA 5T1JA 3KPEA 4X6CA 1RF0A 3HE5B 1RK7A 4XAKD 5T3XD 2CAKA 2COQA 3EYVA 2OMUB 1UH2A 1EJ8A 1M1JC 1U92A 2VQTA 4LPYA 3LH2L 4MMYA 2ICCA 4U6HA 3D07A 3LPOA 1TSRA 3E38A 4PVNA 5F2FA 2WAHA 3GKWH 4O02B 5J9PB 2V9QA 2AXTE 5EOQH 2NLJB 4G8GA 5TE6L 4AEIL 3FJTA 4S1DD 5IHHA 3CXHE 2EE9A 1DO6A 1U3YA 2LR2A 4WNQA 4UDTB 3UEQA 3MV8A 3QIWB 3V6OE 2VRSA 1CI6B 3FTXA 1PLGL 2YWYA 4FTVE 3V0VB 4YVUA 5J5EA 1F6LL 1P4UA 1QRND 1T04B 2CLVA 4BJLA 5C9KA 4DW2H 3IFPA 4CNIA 2BPBA 3QDGE 3NN8B 4C4KT 4X5XA 1XF4B 1EZVX 3MRGA 3A4AA 4YLCA 3ZT5A 1G7LA 4ISVB 4POZC 4LDOB 4GODA 2R8SL 1QUNB 4GLRI 2DIAA 4NQCD 4WKXA 4AL8L 3MLZL 4PV8A 1J1DC 2ZT9B 2FBJH 5HDQH 2Z91B 2JO1A 1FHGA 3QG6A 1PG7X 1NA8A 2X0WA 4JDEB 1IAIM 3QJUB 1OCCB 2IV8A 2X2UA 4KXAA 5FIEA 4Y16A 1E40A 1OAQL 3L4TA 4TNFA 3MLRL 3WEAA 1E6OL 3UGXA 2NNAA 1Z9PA 1H3TA 4DGIH 2JE8A 4RRPG 3WDHA 7PAZA 2CR3A 3EOAA 3OZ9L 4NQTA 1ZS2A 2HKFH 1BYOA 3ZKXC 5HPMA 1L0LG 3BP6B 5M7QA 1FYTB 1OAUH 4KI5D 4KKCC 2NY4B 5E5MB 5SX5H 3THMH 3VGBA 4XVSH 3D9AL 5F8RC 4HPOH 4KKPA 2E6QA 5FX3A 3G6JB 2AXTH 3ML8A 3HMXH 4MBRA 3UYPA 3ZYOA 1JUNA 2BVPB 2MOVA 2HRLA 3BRVB 1DQVA 3AWGA 4X5PA 5MI0B 3SKNA 4KTEL 3CXHH 1UOWA 4JM4H 3TV3H 2WPRA 2HFED 1ZIBA 1ANUA 3ZO0A 4F1SA 5CMAB 2RKLA 5APSA 1TVDA 3IAPA 3UZVB 4A37A 5GISL 3NIGF 5B1JA 4AV5A 2R59A 1Q1PA 3MO1A 3TPUA 3EF7A 1RERA 4I3SL 2FT7A 1QSFA 3KYNA 3LNGA 2EYTA 5DZAA 1NCHA 1AD0A 1CU4L 4XN9A 3S8WA 3S4RA 5FUCE 3SPHA 43CAB 3K72A 5IQ9B 3BW9B 2Z93A 1UB6B 2N7AA 1AZUA 2X1XR 3B5HA 1ZRUA 1CT8B 1L7TH 1MH5B 2E9IA 3FYEB 4HBQA 3ZK0A 4RZCA 3VGDA 5DHVH 3P1VA 3VH8B 2ZFCA 3L74J 4IIZA 3NZHL 4MD4B 5HY9B 2RJMA 1HTYA 3CHQA 3FQRA 2FECI 4XNXH 3U0PB 3CFJB 2VZVA 4U1SB 4ZFGH 2MQCA 3SPGA 4DPRA 2HCZX 4PJEB 4ZJ9A 3D25A 4APQC 2I26N 3TP4A 1TJIL 5LLIC 2GI0A 2F8IA 3R7QA 3TBSA 1SFCD 3H1JJ 5DRWB 1HE7A 1BF8A 1TCMA 3DBXB 1GZPA 3V0JA 2YO3A 2X12A 4IEFA 2DQTH 4LFHD 3FRUA 1ML0A 3NDYE 5I24A 2QSCH 1U8HB 5D7HA 1AIFA 1FZGA 5F88B 4XOCA 4AK2A 4XPAL 3DX6A 2BS9A 1JNLH 1LO3L 3VW3L 3N1MC 3JT2A 3HKFA 5C92A 5DHEA 5GS2D 1K72A 3LCYA 2WXPA 3GDCA 5DYOB 5GTHH 3GB7A 1HJBA 2JTYA 4F7PB 1AY1L 3IBEA 4Y1AE 5DRZA 3HBGA 5DA0B 1J5CA 2R9HC 5EF2A 4GSQA 3V6FA 1FVCA 1CIDA 2ESVE 4AK1A 2NZ2A 5I0YA 4ETYA 3JWOH 1U4EA 1HK6A 4ZT1A 1XSKA 5PAZA 3UL4A 3CD4A 3W9DB 3L75D 4XX5A 5CM1A 1Y6KR 3P02A 5CUSH 4NN6B 3ABLB 4YSEA 3ULUC 4L8BA 3BCCD 4NOBA 1PP9G 1MVUA 1OL0A 3NIGE 2EO9A 1PZSA 4RGNC 3LRLA 3VXMB 4B9FA 1DQLH 4K94C 5CEZE 4KROD 3HZ3A 3VD2A 5ADOL 1MCSA 3C87A 5DR5H 2HT4D 3C2AL 4UT9H 3GUTB 1XGYL 4TMPA 5E8PB 4ZW6A 2F8XC 3PFUA 1V55B 1R1CA 3ZOAA 3MFFA 2AZUA 2EIEA 4QRSB 4ALAC 2OPCA 1DVZA 1FAKT 4NKQB 3BI9X 3GJEA 3TGUG 3APMA 1KJ3L 1L0YA 4FCHA 1K73Q 3QDMD 4NUPA 1MFNA 4QRPB 3ZKXB 1RQ5A 4UUJA 2FD6L 1YEJH 1FFPB 1KIRA 1RCYA 3SQBB 2I1JA 3CXDL 4IRSA 1CFVH 1CK0H 3DX3A 3MV9E 2KZKA 3L36A 3HMXA 1OPGL 2PR4H 2MPAL 3HLAA 4FYRA 4YSDA 5AWNL 5BV7L 2ERJB 1HEHC 4K7FA 1NKGA 1KXVA 1SBSL 3ABKB 3AG1B 3GW6A 3V6OA 2B88A 3Q2NA 3S3JA 4F15C 3RUGF 4ODWA 3CCHB 2P80D 1XD0A 5D2NC 4NN5B 3FN0H 3IDGA 4BYHA 5GTIE 5DURD 1BX2B 4QJ5B 3QDGA 1UENA 3VFWA 2DKMA 3IJEA 5ITBH 3RYMA 1BEYH 1DD3A 4LE8A 4TULL 4EZLA 3BZ4B 3WY3A 1ZRTD 1RF1C 1F3JA 3M9HA 4V33A 2ZUSA 1RUKL 2ZUYA 5DT1L 2KZ1B 2YGQA 3I2CH 4Y4FD 4WUUD 3L73D 2WVVA 5DHVA 4F58L 2OYIB 3IKCA 1I9IL 2G5BB 1QRNE 3DHMA 5DJCB 1S7VA 4JFHE 5GGUB 3IM1A 4WY4D 4UQ9A 1DLHB 1DUZB 2NTFA 4HGWA 1U3HB 5F9WC 1A7OH 3ZHLA 2H8PB 1VCAA 5GGSY 4HS8H 5B1BB 3DUUA 3ZHKA 4Q9QL 2VDKB 5TQ0H 3REWB 4ANVA 1RZGA 2EAEA 1IGCH 3MA7A 3ARFB 2XC8A 4NQCE 1MIEH 3RY4A 1GCFA 3EHBB 2RTTA 4XCEB 4IOSD 2ZUQB 2Z7YA 4I48B 3GKWL 1CICA 3KNBB 5AFAA 3BAXA 2DQIH 5EU5A 1NBYA 1Q0YH 1UWXH 3SE3C 3KPPB 5EOQL 1GU4A 3QRGH 1DQJA 4PRDB 5T3XH 5CD3A 1GYCA 4JYBA 4DIXA 4PN6A 2AK4A 3V4QA 2VCOA 2AJXH 2J4WH 5GTIH 4JVPA 5F6HI 4N3YB 4PV1C 5B39B 4DW2L 1EFXB 2W81C 4ICXA 3W5NA 1RE3A 5LQBH 3Q8CA 1NU1J 4Q6IC 2I8DA 3WNOA 3MJ7B 1HSAB 3HB3D 3NFNB 3QA3A 2ICWI 5TH2A 3RK2B 1XGRA 5KS9F 1A02N 4X4YA 2MKLC 1W80A 1L4AC 5DJ0B 5FDYA 3PHLA 3CSPA 1OARH 1WWCA 4OZFG 2Q87A 4DQOH 1YG9A 4TQPA 1OZUA 4XXWC 4LOVA 1J10A 2FBJL 5HDQL 4DKFL 4O51A 4YDVB 2QL1A 3ARGC 4J12A 2WSFJ 4KK8D 5E79E 1P6AB 4WAFA 4U31A 1OGAA 1PBYA 3WKMH 3WSQH 3NJVA 9PCYA 3DVNA 4LK4A 4UT9A 4DGIL 4J3OG 3BGMB 4WV1B 4NFBA 4KJMA 1KGXA 4KNQA 3Q2WA 1YO4A 2GT9B 3FDWA 2A0LD 2Q86B 3TU6A 1R8EA 4L8CB 3RY5A 2YLKA 3THML 6PAZA 1T89C 1WBYA 3N0PB 4XVSL 2BNRA 4HPOL 3GSQB 5DEFA 3QORA 5KBDA 3HMXL 1DFBH 1CQKA 1BWWA 3JV6A 2NRDA 1HH6B 4L37B 1PLCA 4YO0B 4MDJB 5HXMA 4JM4L 3TV3L 5F1IB 4HLEA 3QUZB 4AQ8C 3O2DH 4XNQB 2I60H 4LLUA 1NPNA 3DTXA 1USQA 2HYMA 5HYFA 4HT1H 4F15B 4BSJA 2QJPB 3OXSA 2P49B 3RVXD 3L8QA 1INQA 1PGPA 5BQ7A 5KLIC 2Y07H 1L7TL 2J1YA 1MRCH 4K0OA 3SE8H 1IAOB 1I3VA 3GZOA 3IXAB 1BVOA 2BP8B 4PJ0E 1K5NA 4YFLI 2NY6D 1RJZB 2WW8A 2Q2EB 3MZTA 4XNXL 3PQYE 2FT6A 3MRJA 5IEHB 5E79H 4ZFGL 3ESMA 4PGCA 1RULH 1C12A 1SMOA 3FFOA 1RZKH 5JIDA 2G2NA 1LK3H 4N6JA 1XVSA 4ZQKA 1VQ7P 1NDMA 3MXWH 4JDTL 2F2HA 2W0KA 3L75E 4LCCC 4IL6X 4LCWD 3P4NB 5KS9E 3QO1A 2KP8A 3FYIB 2RMZA 3VRLE 1IKOP 1I4FA 1U8KA 3IBOA 4KJWC 1AFVH 3H1KG 3BCCE 1D5MB 2APTA 2DQTL 4HHWA 3HN5A 4CU6A 1KV3A 1UUSA 5DU7A 2QSCL 2CPUA 5C7ZA 4EN3B 1GGBH 4GBXA 1S9VB 2WQSA 3KLKA 3L72G 3WS6A 3DO7A 1IZNB 4QD2E 2E7LC 1JNLL 2YA0A 5AAWC 4OFYA 3MU3A 4NSKA 3VWKD 3ARWA 5JIQA 4PGEB 1EHKB 2IAMD 1SLQA 2YBGA 3V6ZA 4NUGL 5DRNA 3L9RA 2FNWA 2RHEA 2M83A 3CDCA 4YSAA 4Z0BH 2FQFA 1HHHA 3UAJD 3RJOA 3KDPB 4HDIA 3DRTA 4J1UA 5DJUB 2AXGA 4XI5C 3V9FA 5FYKU 1EDHA 3U1AA 3JWOL 1QX8A 1IC2A 2I9TB 1CDBA 2WWKO 3VRLF 2J20A 4N86A 2K7QA 1X44A 3IEAA 5CUSL 3G71P 1CG9B 1ZV9A 2H1XA 4L4VB 5JHDB 4Q4IA 5IMKA 1AVYA 4PJ0H 3M88A 4HFWA 2V5SA 2VDLB 3TV8A 5AVWB 5F9AC 1OSZA 2DQGH 1G1JA 2C9RA 2VN7A 1G6RB 3VD3A 5I15H 2D7NA 2NY3C 4NT6B 3T2OA 3TONA 5K59F 4G1EB 4PGBB 1DQLL 5B66E 1MEXH 1U93A 2X4NB 4I77H 4UT9L 3SY0B 3MR9A 5AZ2H 1QRNA 4MASA 3QUKB 1SBBA 3T08A 1SHMA 2XV2A 3CSTA 4HUUA 4K3EH 1G7QA 4J7RA 1ACZA 1YEKH 4LBEB 1WEJH 1ZRTE 1HKFA 2ALWA 2HRGA 35C8L 3RWEB 1CZQA 1VQPP 1ADQH 4QHNA 5T3ZD 2BVEA 3RDTC 3A5VA 3F64A 4NQCA 4U4IA 1YEJL 3L73E 2GI7A 3P40A 1UCBH 4NC1E 4M7JH 3MREA 2DW3A 43C9B 1CK0L 2ZCHH 2GIYA 3GJFB 1U33A 2N7BA 3DX8A 1HOCB 4PRPD 2CDEB 2PR4L 4R4FL 4GQQA 3VCLB 1QEWB 1IK9A 2LFGA 2V4LA 2BVQA 2NUPA 5L2JB 5LAXA 4EBQH 1JVKA 2JKTM 4K3DH 2X4TB 3SKOB 2FSDA 2NDFA 1JTPA 1U58B 3FN0L 2DMGA 3MV11 4RQQB 3O2DA 3S3BB 3TEXA 2WLZA 3OKOB 4HHAA 1FPTL 3FQUB 3K4AA 5BVPH 2J1KA 1JDCA 1D5XA 5E7BA 5ITBL 1BEYL 1HVXA 5BO0D 5HYQB 4K8RC 3A3YB 5ESAA 3U9WA 4IHOB 3SKJL 3SJVB 1IFJA 1NTMJ 4EJ1C 5B66H 5BOJA 4FXKA 5KVMC 4GKSB 5BVZA 4QRTA 5F9OL 5B38B 1GH7A 2APWA 3N42B 3Q3DA 5IOPA 2HFEA 1CFBA 1P0SE 2J6WA 3AGWA 4P3CH 4GRMB 5EU7E 4X0NA 3RUGA 3I2CL 4BUQA 3SDXB 4AJ0A 2IQ9H 4Z7NF 1WPCA 1X5IA 3DI2B 1WCBA 1I31A 3L74G 1INEH 4Z76B 2WQXA 3FQYA 2KKQA 4QYOA 5CIPH 4UQEA 1A7OL 1AQDB 1NGXA 1YNTF 4H8QA 5ENWA 4NZRL 1AV1A 4HS8L 4LCCB 2A83A 5ELIA 5K59E 3LNFA 5TQ0L 3HD7B 1F2XK 1UEYA 1YEDA 1IGCL 2VDOL 3B5NB 5I0WA 5I5IA 1MIEL 4OZHB 4HD9A 1DJXA 5FO9A 3NIDB 3DROB 3ASWA 4UM9D 1JXJA 3SYOA 2VAAA 3HUSA 1BXVA 1Q94B 2DQIL 1Q0YL 2EIZB 3AB0C 3HE7C 2Q6WA 4GQRA 4U1KB 5IBLC 2DRUA 3L2MA 4CAGA 4XRCB 5KJRH 1U7JA 1A6WH 3CMEP 4KRPB 1CI3M 1SFCA 2AVFA 1U91B 1KBPA 1UOLA 3FT3B 3ZIMA 3LHPH 5I1DA 3GSWA 5I66B 2AJXL 2J4WL 3MROA 4JG5A 3I75A 5FB8B 1MJJB 2AKRB 3L6FA 5DRXA 1DN0B 5LQBL 1Z2KA 5DVKA 4ZDHA 5K9JH 4L3CB 3WTSA 3SO3B 4D0BB 4BBWA 2YD2A 4NKOB 1R24A 4U3SA 3Q6FB 5E2TH 1T5XB 1ZANH 5CS7A 3KM2A 1BM3H 1J1XH 2VUOA 1EZVG 3MX0B 1OARL 4ODBD 4LIQE 4DQOL 1QZ1A 5GS0D 5FUZL 2FDBP 2A38A 1F3DH 2NY3B 4R7DB 2OMYA 1CPUA 3D85D 2PTTB 3VA2C 3W39B 3ZN6A 3G9AB 2YSSA 3PWLB 3FOMB 1S9WA 2YD7A 4OV6F 5FGBA 3JWNG 4HS6A 4FQPA 4NNPH 5J7CC 3WKML 2Q5UA 3RU8H 4XXDB 2XZRA 1XH3B 1WK0A 4GAYB 3WSQL 4EQ3A 3IU3B 3K6OA 2F08A 2YQ3A 2QR0B 1X3DA 3NJXA 5C0ND 2WWMD 3BVNA 5FC9A 4HKXB 4Z7NE 4CSTA 3STZA 2DWYA 1QLFA 3CHPA 3FB8A 1JZHA 3FHQA 3NRQA 4EAEA 2GYSA 2WLNA 2EVJA 1G1IA 4AJYV 3RDTB 3GSVA 3MRHA 1DFBL 1ADQA 3SDDD 5EU3A 4YHNB 5HVGB 1SQBJ 1XIWC 1CDJA 1HQRA 2BIIA 3KPMB 4OQTL 4JFQB 1BQHA 1MXDA 4X7EC 4X98B 2QQNL 1TF4A 4ZO7A 3UYRH 3WENA 3O2DL 2JJTC 2OR9L 3AS2A 3SOTA 3QI9C 2I60L 3ULSB 2VXQL 1K3ZA 4S1QH 1HH9B 2C4XA 1IFIA 3RWFB 3QDMA 3QC6X 1UD5A 4TOYH 4HT1L 3S2AA 1AI1H 2C1PA 4ZTOH 4N5ED 2AQSA 4Z77B 5I1IH 4MDIA 3O6MH 2Y07L 1ZHKA 3FSWA 3HVNA 5DJDA 3SCMC 3FN9A 1J5HA 4LIQH 3UMNA 5I16A 2BCCJ 1MRCL 2OGUA 1ONQB 1WTLA 1QSEB 2G3AA 4I89A 4JFDD 4K5PA 4CVUA 2XTJB 3RAJL 4CRPA 4NENA 2Y6SC 3F5HA 3VYNA 1N0XH 2ICEA 5EZPA 3UTSD 1RZKL 4JFXA 1LK3L 4ZS6D 3MXWL 3CH1A 1MPAH 3IGAB 3NMDA 2P80A 4NO3B 2B8OT 2JFCA 1CD8A 4W4OC 1T6AA 3ATDA 3F65A 3PP3K 1AHWA 1YSOA 1WRFA 4JO1L 1AFVL 3PS6A 2EDWA 3GSOB 5CLTA 4H0IA 5CIPA 3OKLA 5HYSB 4CMMA 4L18A 2LFEA 3ARBB 4JZJB 1EWHA 1I1FA 2IBZE 1UA6H 3WE6B 3KPSB 4YHOH 3WN5C 5C0EB 5AL8A 4TVPD 5D1ZI 2YKPA 4WUUA 4Y4FA 5CJXC 4PRHB 4J23A 3V9CA 3OX8B 4YLQT 3QEGH 3FBQA 2RA1A 2FE0A 5AB0A 4WY4A 4L1LA 4Z9KB 3AB0B 3HE7B 4N2HA 2WKOF 5KSAC 1CL7L 4Z0BL 4P06A 3EGXA 4XZ4A 3QT2A 4I5BA 4AVIA 1A6ZB 1Z3GH 1KT2A 4FFZA 4YAQB 3UPAA 3ZE0F 1NGYA 2R0ZL 2I7SA 3BC9A 4A2HA 4AIEA 3ARZA 2VKXA 1WH0A 4NQXA 1ZXGA 3C9NB 4N28A 1TFPA 2W60A 3NZUA 3KPQA 4IOSA 4TTDD 4C56D 3DUSB 3JTBA 3VXUE 1BYPA 3O3EB 3NOIA 2ATKA 4MFHA 3W81A 1E4KC 3A2AA 3M0DA 4WUKH 2DQGL 1L9SA 5I15L 4PGDB 5D7JB 1NU1G 2WXLA 1LP1B 3N40P 4Y5XB 1ZLUH 1GR7A 3RZCB 3TGXA 2WWKT 4DK3A 5I30H 1Y0LB 3LZNA 2CGRH 3H9HA 5EO1B 3KL5A 2XVGA 3OJ2C 1JL8A 3BVVA 3BYYA 4MB3A 5IJBC 4DGVH 3G5YB 4MJHA 3HLKA 4LU5H 2JB5H 2BWIA 4W6XB 1M1KQ 2Q8AH 1DDHB 2R29A 4U1IB 1REIA 1CD0A 5EU4B 3PJSK 1MHEA 3FNKA 1HQ4A 3AABA 4NO2B 1M90Q 1YEKL 1WEJL 1L0LK 1NBZA 4LPUA 1OP3K 3O45A 2CZNA 1NFIA 3U0TA 3L4FA 3H55A 1JXDA 4QHUB 1ADQL 1KTDA 1HILA 3CWBJ 1ZA6A 2CKBH 3BUIA 4YPGB 1T7WA 3ZO9A 4MJIB 1S3KH 4JHVA 3LRKA 5B3JF 3ATAA 3B34A 4XMXA 1UCBL 3VXSB 4M7JL 2K37A 3RNKB 3MLYH 2ZD0A 2BZ7A 2JP3A 3GHEH 3P73A 2ZCHL 4BSWB 2ZVOB 3LS5L 2BSTA 1OF2B 4Q58C 1X5FA 4P2RD 5C09E 4XWOD 2R69L 2VMCA 4AM0A 3FQWA 4KPHH 5T3ZH 1HL4A 5HGDB 3GF7A 3HNTH 2J2ZB 1PGRB 4K3DL 4XCNA 2QDWA 5IK3A 1U95B 4LSUH 2N59A 2DQDH 2APSA 3SPVB 2J58A 1UM6H 3R4RA 1YECH 2CDFA 2OQQA 4G5ZH 5BVPL 1TO4A 4ERSH 2H2SD 4AQOA 1KB9J 1I3RB 1YN7B 5FA4A 3Q8FA 1XDTT 1JGLH 4Y19E 1VJSA 5D9SB 3WS3A 4R8WL 2KOGA 2IPKA 3ZE0E 5EO0B 1MHCA 1GDTA 1KLUB 1NH6A 3BAJA 4P3CL 4WLCA 5SX4H 1DEDA 1PFCA 1T1WA 1DQIA 2I32A 2ADGB 2IQ9L 4IU2B 1GTNA 4JNXA 2X3CA 5CNHA 3SGJC 5G5DA 3HN8A 2JNZA 4L9LC 2YJQA 1INEL 1UFGA 3TFKC 1BJ1H 2Y5TB 2YD1A 3QXTA 5DFTA 1B0RA 1IE4A 1RHHA 3RL2A 5C0CD 1RU9H 4N5UA 1E4JA 4GG8B 1XGUB 1NMCB 1SY6H 3DC0A 4K7PY 1RIVH 1SXBA 5B39G 4XTRD 4Z7OB 1KQGB 1NIBA 5JHLH 4JM2D 4ZUVA 4ZUTA 5AVTB 3WN5B 4U3FE 1JPEA 1HL5A 2D2CD 5BXFB 3MLPA 5IM7B 1HWGB 1E5CA 5AAMC 3CZGA 2WGXA 1HX0A 1UXWA 3WXVH 2QKIC 3NSJA 2AEFA 1QHPA 1IUZA 5KJRL 2UZYA 1A6WL 3FH5A 2GW5A 2JXMA 4LCWA 3VFTA 2A1WL 4AE1A 1IGJA 1IM3B 4Y0GA 1L2PA 5FOBA 3L5XL 3LQMA 4MQSB 3LHPL 4W93A 5E94B 5AB1A 5B3JE 5ID1B 5KSAB 1FG9C 3FQ1A 2Q5BA 1BGYE 4NRXA 3D39D 3G6AA 3X3FH 2X44D 1GC1H 4K5OA 5BS0D 5MHSD 2Y2YA 5JUEL 4QOKD 3SY6A 1KXHA 2ADFH 3HN3A 3M07A 3U36A 2K70A 3Q3GB 4B5ZA 1G87A 1MFDH 4Y1AB 2NY5H 1NKOA 3KLLA 4NI3A 3KYOA 1KPVA 5E2TL 3VWKA 3TZVD 5CCHD 2IAMA 1BM3L 1J1XL 5FM5M 3FL7A 4XPGH 2ESVB 4O2FA 4QRQB 4JRYE 2IBGA 3DX7B 1AJ7L 2DBLH 3UAJA 3KL3A 1SLXA 4ZOAA 4ABWA 3G9RA 3D2TA 2B1AH 2VLJD 2BY3A 3BH8B 1R47A 3ES6B 3VMOA 3CLFH 3C09B 3UTPD 1Q2NA 4PY8J 3JTTB 1JGUH 4JY6A 3RU8L 5F96H 3W11C 4OH2A 4V11A 3L37A 4ONFH 4I1PA 3S1KA 3NIGB 1B6DA 1U21A 5IVZA 2WQWA 5GJSH 5GS0H 3NG5A 2QMKA 4YH6A 4MD0B 4OLEA 1SQQD 1JIBA 3S34H 3SYPA 4JFDE 4B86A 4IBWA 2NQ3A 1R9FA 1L0NK 2B2XH 3EADA 3GDBA 2DJ4A 3UGUA 5JLZA 3IWUA 4Z3IA 2DLFH 3WDJA 5JXAH 1NCDH 3QUXB 5DFAA 5KYYA 3QFDA 5D5MB 3MP7B 2CE6A 1PQZA 5IF0A 4JVUA 1PG7W 2ENPA 4G6ML 4ZS7H 4G9FB 2IC2A 1FZJB 1MNUL 1I8MA 1LO2H 1S7RA 1IBZA 1T5WB 1TCRB 1G7HA 4WU7B 4I0PD 1JZFA 2VDOB 2WLHA 4S1QL 3QZOA 3CFBB 1PNDA 3EAKA 1O6SB 3L3KA 2P45B 1AKPA 2C3VA 2YIUC 3LZOA 4TOYL 1AI1L 4AVHA 4ZTOL 3HFFA 5I1IL 2K78A 4NZTH 2ATPB 3O6ML 4M1CD 5AW3B 3MV9B 4EXKA 2VR6A 3GKZA 3TNUB 4LIQL 2CDGB 5FGCB 3LZQA 2E9JA 5F7YC 3TJEL 2PCFA 5HPOA 3CHSA 4PRPA 1YJDC 2OI9B 2FIKB 4OD3L 2BLFA 3HI6L 4U1LB 1KIUB 1UQSB 3LRGA 3IDIB 3LN9A 1N0XL 2GEQA 1CCZA 4HGKC 5A40E 4PD4I 3OAYH 1NTMG 4TNEA 1NDTA 4F33B 1LQBC 4HKBB 2FRGP 4OVNF 2E75D 2RR3A 5IQOA 1EXIA 1VQ9P 1JXFA 3WNLA 4C56E 2C0WA 2XN9D 2Z3FA 2Y4SA 3AITA 4I3RH 4WWID 4MZRA 4HJIA 5D96C 1ESOA 4HF5H 3V9EA 4FNUA 3AEGC 4K5NA 5MERA 3GLMA 2ZCKL 4YHOL 1RFDL 1R3HB 1SY6A 1IARB 4N6RB 1JK8A 2FH6A 2WTRB 4BKLB 1A9EA 4H5SB 4KVPA 1HI6B 1IILE 2MNWA 3QEGL 4PJDF 4JM2F 5JHLA 1KTMA 1HVVA 4P4KD 1G9MC 1RY3A 1FQ9C 1O5DT 2GJPA 4IJTA 4R6UA 4R83A 2PPDA 2BOLA 1ZJAA 5H2FE 3ZL2A 5C08B 3OKDB 3O6QB 2XXFA 3UBGA 2X4QA 4GKZB 4WK4B 4LF3B 1AO7D 5K9OB 3CPUA 5K69A 1Z3GL 3QFJD 4TVPH 2HZHA 2M8RA 1G7IA 3MRDA 4ZW8A 2P5EE 3N2JA 3WMQA 2FK9A 1OSPL 4IRZL 4Y1SA 3L48A 3X12A 5FM4A 1U8CB 5E6YA 4HYTB 2ZKXA 4UM9A 4A66A 5FYJU 4LSVH 4PG2A 5JQ6H 2WKOA 4WK2B 4WUKL 5I71B 3D12B 4M7LH 5GGRY 3ULAB 4OV5A 4XNUH 2F1BA 4GIPD 2ZX9A 5I30L 2CGRL 2UX6A 1B9KA 1BIIA 1UJ3C 2RB8A 3B2MA 3LKQA 3NPZB 4HMCA 4UZUA 4DGVL 5ESVB 1KQLA 3KPNA 4LU5L 4JPIA 1VKXB 2EVHA 2X89D 1A1MA 4HUWB 1MKMA 1LWRA 1MCOH 4PJ9D 4R26L 2Q8AL 1XSIA 1SJEB 3QYCA 2YZ1A 2UXFA 5F1SA 3HPJA 3ALPA 5FA3B 2RGSA 2J59M 4JPWL 4IBYA 1WO2A 3HZMA 1VFUA 3IJYB 3BE1H 4NKIH 4A39A 2CKBL 3GTNA 4FNTA 1PLBA 1P7KA 1S3KL 3IE4A 4NUJB 5ILTL 4MAYD 3QYNA 3D85A 4GAJH 2WQVA 4GW1A 3LMJH 3MLYL 1N3NB 1FVDA 3PWNA 3C6LC 1RJLA 2JF1A 2Z4EA 1HCYA 3GHEL 4U0RC 2I07B 3RWCA 5B38G 4M48H 2XWBA 5C0CE 4TSAH 4BFIA 2X9YA 2AQPA 4Z7VB 4KPHL 5EFWB 1FH5H 3AU1A 5T3ZL 3TNMA 1SQBG 3HNTL 4HZLA 2XBZA 4MNQE 4PB0L 1M3JA 2D0FA 1H3XA 3EFOA 2DQDL 2ZWSA 3LW5J 1D5ZA 3QR0A 4FJZA 4PJDE 4CC4C 3MRRA 4ZFFA 3O3BB 1UM6L 4FFWD 2EVGA 3LNIA 4NZFA 2YIUB 2GJ6B 2EIMB 4G5ZL 2CJSA 4ERSL 4EEEA 3PNRB 4F7TA 1ZT1B 2OARA 1OWWA 5L8JB 1IZKA 1AS8A 1UD2A 3SDDA 3C08H 4CILA 5JW5A 2R4SL 4C47A 2F1EA 1JGLL 3B7UX 2CLZB 1JERA 1GAFH 4B9JA 5EIIA 3T0ED 1MFBH 2R4RH 4PG9A 4DZOA 5KOMC 1SXAA 1T66D 1NTDA 2BCCG 4N25A 3W0WB 3HC2A 5MHSE 1J9SA 1BFTA 4FFVD 1OTUD 2ZOWA 5F89A 5KYWA 1LE9A 5C0RH 4S1SH 5IB4B 2Z31B 5GRVL 3C5ZD 1RU9L 3GHGB 4RKUJ 1PKQA 3CC1A 4OZIB 5CCHE 5TDNA 4YK4C 3U83A 1RIVL 3PQYB 2IDQA 1BHGA 1JYNA 2XKNB 5D96B 3QULB 3IYLW 3IAOA 1YEGH 3BESR 4DOHE 2AS5M 4JFDA 2E76B 5CXPA 4P59H 2KERA 4P2QD 3N06B 5J1SC 4KKBC 3AREB 2XDHA 1B4JL 4FEMA 3UTSA 1OP4A 1A5FH 4GW5B 2MMXA 4N0YH 5KS9B 3UTPE 1JFQH 2ADYA 1VQKP 3WXVL 3R06B 4YFLF 1L5GA 2FJGB 4MA3B 3T3PB 3TN0C 2WB7A 1DVUA 4JFED 3MNMA 2ALAA 3ETBJ 3S5LB 5AW2B 2OYPA 1U2HA 1LEGA 1S78D 3KG5A 3KXDA 2QADD 5F7LB 5DC2A 1G2CA 3X3FL 5EN3A 1GC1L 1NCBH 5DVPA 2EVIA 4AVKA 2ADFL 1GK4A 1KPRB 4QTFA 3B9VA 2NY5L 2CRIA 5JDSA 1BVNP 5J3HD 1S8DA 1AGDB 4PPTA 4K3JL 2ED8A 1RIUL 4XPGL 5IB5B 3BPOB 3SE4A 3UTZB 4IM8A 4JKKA 4EIJA 1J0HA 1MHPL 3LDBC 2AJZB 3R8QA 4JAMB 1ZOYC 2B1AL 2OP4H 1G5AA 2HT3D 3KPOA 5D1XB 4R7NA 1UG9A 2IDFA 3CLFL 1UJ3B 3MTRA 1VF5D 1KIQA 2BMKB 1B2WH 3KPRA 4ONFL 4DAGH 2DM7A 2B20A 2WSEH 1N5AB 3T77A 1FORH 4XP4H 4C56A 2KS1A 3T97B 5GJSL 3U4KA 2JIXD 3TC9A 3L71E 3K2UL 3J2PA 1TJHH 4NUMA 4OBRA 1OHZA 4M62H 2B2XL 4FHKA 2GCYA 2AQ1A 2P47B 3MRBB 1J1EB 2DLFL 4R7VA 5I76A 2FB4H 5JXAL 2WSCJ 1NCDL 2CO7B 1J8SA 1M7DA 4PLJD 5LG1A 2AFNA 2O5YH 5E6ID 3CWBG 1BAGA 2APBA 3V7AG 3QNYA 2GC4C 3C6LB 4ZS7L 3VXPA 1WUZA 1KB5H 1MHHB 2WBXA 4QRAA 4OGQD 4X2UA 4J5VA 3H2PA 4BRJA 1LO2L 1ZTXE 1RY7B 2GB2A 3EYQC 3KVQA 5CCGD 3OJDB 3TXAA 3VFNB 1SFHA 3O3AB 3V95A 4QHPA 4B5EA 4IBQA 4KFMA 5D7LB 2FYUK 4NZTL 4HIPA 3NSFA 3VD5A 1PJWA 3RWDA 1JZ4A 3EYSL 4OCYH 4UWQB 2H26B 5D7SH 3RLSA 2MQ3A 4Z7AA 2BNUA 1INDH 2ZYGA 3SGEI 4Z5RA 2WIIB 4NRYA 5CP7A 1YBKA 4HAKA 4P2RA 3FFDA 1KZQA 1T03H 5B21A 1KN2H 2EDFA 3Q7JA 5ABAA 1U57A 2W0FA 4GI8A 3TF7C 3QQ4A 2F68X 4JKNA 1CDHA 4MNGE 5CBAA 4FQQB 4WVRA 1Z5LB 2OYMA 3LZFH 1YMMD 2B9AA 3F04A 3LZLA 4X80H 2I5YH 4PJ5D 3KCPB 4IBTA 4I3RL 4HUCA 1S7XA 3CMOH 3U7AA 2X6VA 1SQVE 4EIUA 4JFFB 1WWBX 3HTLX 1WFNA 5FUOH 5KYNA 5GS1C 1OLLA 6CGTA 4JHZA 1FNEA 4PJ7F 5GRUH 3HA0A 2EUWA 4YR6B 3JTSB 4HIJB 3U6XA 2ISDA 1IIIA 2PXYD 3RPBA 5EEXA 1ZVSA 2YAOA 4MCMA 1CDIA 1RD6A 1RLBA 4J8QA 4RIRA 4D9LL 1RK1B 2IDUA 4WTWA 2B0SH 4WI8A 1PFIA 5FK9A 1KYFA 2RMNA 1NCAL 2A2QT 1NWPA 1G4MA 5C0CA 4WU5B 3UCQA 3GTTA 1J9CT 4TVPL 3FCTB 4ATTA 1NOAA 2FECL 4B50A 5E9DB 2AAVA 1TTAA 1N73C 4NP4H 4DGYH 1PGJA 4P5RA 1M1XB 2G8YA 2HB0A 2NXZD 2CRMA 3D48R 3EYOA 1KPUB 1AC6A 1AGEA 3P8CD 2D2OA 2IDCA 5A2KH 4LSVL 2D4DA 2XQYG 4JHAH 4M5YH 1VFAB 5JQ6L 3H2WA 3VMPA 1NAMH 3D69A 1FLTX 5I6PA 3RK3E 4GS7C 3M9BA 2JELH 3O0RH 2DJUA 4M7LL 2DKSA 3IGUA 4B9YA 5DEGA 4XNUL 3AQYA 4QLRA 2RAMA 5TDOA 2W07A 1H9VA 1ZLVH 1JZ5A 4WEBH 4FADA 4UNUA 1I8KA 3D39A 3S48A 5BS0A 3FF7A 4YE4H 2FYNC 3BN9C 4QOKA 1Z1WA 4KY2A 1G7JB 4IJ3B 4J3BA 5G2NA 5CN3A 5BZXA 5K9KB 4UTCA 4H13C 1OAKH 1ZKAA 2KPWA 2R27A 1EDIA 4X6BB 1VESA 4TF4A 3TZVA 5CCHA 1P5UC 3C6SA 4J28A 4NHUB 4CSSA 4NKIL 1NDGB 1JUFB 1A02F 2B87A 3MRFA 2IGFH 4NPEA 3DRQB 2K1AA 4FQXD 4GAJL 4KHTH 1JFHA 2VLJA 3VMYA 1MLBA 1TO5A 4U2ZA 1G9EA 2VDQH 1XF3B 4U4BA 4XHJD 4UQCA 1U6AH 1R5LA 1HXMB 1VGEL 5JNYA 4M48L 4HPYH 2OTWB 2GM4A 4ODXB 5I74B 4PJ7E 4X7DC 4HC1H 1IVTA 3CU7A 5AYQA 3ZDXF 2KIKA 1FH5L 3IF4A 1QWUA 4HAGA 4M7LT 3TVMC 3BLPX 4AT6B 4BE6A 2M3EA 3KGTA 3A4EA 1KB5A 2LU5A 3KYKH 2ICWA 1GOGA 3UO8B 1BDCA 2W91A 4P2QE 4HV8A 2OMWA 2UZXA 4U1MA 4AENA 2OMBA 2WLLB 4W7YA 2JQZA 2YPKB 5CZXD 1BFOA 5I26A 1TZHB 3X14B 3EBHA 1JWMB 3C08L 1LTJA 4FXGB 3O6FD 3ZRCC 3BIKB 3T6WA 3LQZA 1O9VA 1GAFL 5J06A 1D7CA 4JFEE 3CVBA 3FTSA 1P1ZA 1MFBL 4Q2ZA 3WTYA 1A9VA 1N7MH 2R4RL 3S96A 3DV6A 1OB0A 2NQCA 3K6FA 1HNFA 4I0PA 4ZMQA 4X0KA 4FQ1H 3S2CA 1YEHH 2P46B 1BJ8A 2GITB 5FDWA 2IBZX 2HX9A 2IADA 3CD6P 3KZ8A 5APYA 1DQKA 2MH4A 3BO8B 1O7VA 5D7IA 1QNIA 5ICXA 3SPIA 2KT6A 2FAUA 5TISE 1GHFL 2CBOA 1W6LA 3QNZA 5FFGA 3CUPB 1EFQA 1YEGL 4PY7B 5JZ7C 5INDA 2YAMA 1A3ZA 3FO2A 4M7KL 2VZ3A 3ZZLA 1W0WB 5A3ID 4G7SB 1E9OB 2IIJA 1CZ8L 1A5FL 4LHUB 4N0YL 1PIFA 1IJNA 2R0KL 1JFQL 2Z7UA 2NR6C 5AW7B 2AXWA 4EI5D 4AYFB 5DTFB 2V7NA 3R19A 5I5MA 1K4CA 1GYWA 1T0MA 2A74B 2ARJB 1NM4A 1HIMH 2W65B 1QVGO 3FFCE 5CEYB 2XN9A 4WWIA 4Z7QB 4H1LB 4CDGC 3H32A 1PVHA 2CPSA 2NZ9C 4RSVA 3M06A 4MKTA 1UH4A 1NCBL 4A63A 4LSDA 2JKXA 2OYKA 4NAMA 3HUJE 1O6TA 2ED7A 3ZLQC 3I55P 1W0YT 2CUIA 5CLYA 5LG6A 1BLNA 3AE1C 4M02A 5B1CA 3ZDXE 5JOPD 2TRYA 3WIHL 3JQOB 3U46A 4I87A 5CGYC 5AOMA 5I6XB 2VE6B 4P4KA 4OR1A 5LGKA 4HCRH 4KTGA 4X9YA 4GT7A 3BAIA 3BKCL 5B8CA 1NAMA 1Z6JT 1I7TB 1A66A 1HZKA 2OP4L 3DURA 1J0JA 3VJ6A 5IKCB 4M7ZB 1KORA 1AO7A 2WYZA 4NN7C 5IMOA 5IR1B 1J5IA 1WFTA 2VRKA 2PPAA 3AM8C 1GY1A 3GMOB 3QFJA 5HI4C 1QBML 3AE7C 4KOBA 4EZKA 5C70A 3DMMD 4TM9A 3VXUB 25C8H 4DAGL 3JSVC 2YJLA 4GH7B 3V7MA 5TISH 4OQ1A 4E9QA 1FORL 4XP4L 4XO3A 3B9EA 3PV6A 3BJLA 1TJHL 4H13B 1WG3A 3ILPA 4LLWB 1B2YA 4M62L 5BMFH 3WTWA 1RH8A 3FH8A 3NBNA 3OW2O 5FV2A 4XFJA 1BZ8A 2JWDA 2XKMA 1HXYA 1Q9WB 2O5YL 3O11B 4G8FA 4QHLA 2N4IA 5LGHH 4EDXB 1OD9A 4FLOA 5APWA 1QR1A 1YMME 3EGDA 4KGLA 3SODB 1QNZL 2X89A 4PJ5E 4PJ9A 4Y4KB 3TYFB 4D94A 1ZXKA 1KB5L 4MJ4A 4Y9CA 1OZHA 3H9SB 3AEDC 4TNWF 4PJCF 3GMLA 4Z7UA 4J8RA 2R2BA 4DT2A 4HC1A 5GSVA 3TVMB 3QEHB 4C7NB 5J89A 3EZ8A 5BRZB 2OL3A 3C5JA 5DJAB 3S36L 5I1AA 2O6FA 4JM0A 4Y2DB 4OCYL 4MAYA 1WZAA 1S1CX 4RDQF 4MA7H 5D7SL 5C09B 4X4XA 1MCWM 1INDL 3IDNB 3PDOA 5H8DA 4XP6H 4LCIH 3ECBA 3MJWA 5K5GB 4JQVC 4UV4H 3SDCC 5KKZC 2YXMA 1T03L 3HAEB 1KN2L 3CU1A 1I1AB 5GGSA 1C16A 1TVBB 1JGEA 4JFVA 3B9KD 3QS2A 3SDAC 1BV8A 3TIEA 1F86A 1BVKB 1MQ8A 1EZVY 2DWDA 2XQ0A 3LZFL 4NO0D 4PBDA 4X80L 2I5YL 1EAJA 2PWHA 1ZPUA 3V52H 4X9FA 1QBAA 1FZFA 3CMOL 4BZ2H 4Y19B 3FT0A 5KYXA 4HWEL 4R97C 1P1VA 1F4XH 4DPAX 5FUOL 4HOMA 4YDKH 5EN2B 5KUMA 3ZTJG 2P5WE 2BOBA 5GRUL 3K71A 4JG0H 4G80A 2AJ3B 2AXCA 1JB0J 4AL8C 3L7EA 3BOVA 3T0EA 3CDZB 3K4DA 4MWFB 4E42B 4PLNC 4HISA 1QYGL 4ZX5A 3WKYA 1R5IA 3GMPB 5DJXB 3GXPA 3NSCA 1DDTA 1UVQA 2R3SA 1ZTXL 1BAFH 4WW1B 5J6GA 3MRMA 1MRDH 4LSSH 3QSKB 4Y9BA 1NC2D 2XJLA 2YGVA 3C5ZA 3SD5A 3STBA 2XX1A 4GP5B 3CQQA 3WHE1 3TPKA 3P30L 1URQB 1KBGH 3NJHA 3OZLA 5DVLA 2YAEA 3U2JA 5H35B 5LJYH 4XGZB 2NZIA 4K4KA 4DGYL 4B3VA 2K9JA 1PCXA 2E46A 2DJSA 3EJYC 4DO4A 4P2QA 2KNCB 5CBNA 2VLRD 4ZUUA 4JHAL 5DZVA 5IWLC 1PZ5B 4M5YL 1PAMA 5IW6A 2W92A 1NAML 1VZGA 1CI5A 2BOCB 4JFUA 4PJCE 1GY2A 2WZ7A 2B4CH 2G0KA 3CCJP 4IOFC 1BBJB 3RGVB 1R5WB 2UWEF 4CN6A 5ISZB 4JHBA 4FC3E 2XVBA 5IQLA 4R4MA 4JFEA 4I18A 3K6IA 4M61B 4QO1B 2C4FU 4F20A 2V5TA 3H7BA 3B3IA 4P49A 8CGTA 4HCRA 4YXKH 1AGBA 4WEBL 1ILSA 3OM3B 2ZSVB 1W16A 4PJGB 1PV3A 3K2KA 4QXGH 3PHQA 5F0PB 5M95B 5ICYA 3UZQA 4Z6AT 5K9QG 4JVWA 1SQXD 2UZIH 4DO6A 1P6FA 2P42B 4JRYB 1FNFA 1OTTC 1E8WA 3D09A 2XNDH 3G5ZA 3MGTB 2K4WA 3QUYB 4P4RB 4EQ2A 4NXKA 2HXAA 3DVGA 3SQOH 3CC7P 4U1JA 2IGFL 3HS0A 4YBQD 2JCWA 4KHTL 4HW6A 4HUNB 4N2CA 5EC2A 2VDQL 5D6DC 4TLKA 3UJTH 4N3UA 4HPYL 3LJ3A 2W5PA 4HC1L 1RF0C 1J05A 1K3IA 2VZ1A 2P1JA 3MNZA 3HTKA 2DS4A 4RMWA 1MJ7H 2LU7A 1JNNH 3EJPA 2JIXA 5FW8A 2ADIB 3KYKL 2FEDD 2DMBA 1JGDA 3B3BA 7TAAA 5HD8D 4CVXB 4M00A 15C8H 3OJAB 2CXGA 5AVXB 1NGQH 3QJFB 3F8UB 4U3CA 1NKRA 3X1NA 1SQ2N 2SPZA 1XF1A 4DZBA 3D4GA 5KLVJ 4JO8A 2E6PA 5E6IA 2RBLA 2X1WL 2Z8VC 1DP0A 3RBZA 1N7ML 3P3UA 2WBWB 1KEGH 1FNGB 5CCGA 3Q2VA 2LAAA 2QLYA 1Z66A 3F5WB 3WFEL 1EDJA 3WGVB 4I9WD 1YEHL 4QYAA 1BWMA 9CGTA 3S6CA 4JO4L 1TENA 3S5LG 4PS3A 1L6PA 2XIDA 5JOPE 4XN1A 4GKOA 5EEVA 2X6AA 2I27N 5HHMD 3FO1B 1EHXA 1XH1A 2AI0H 3F7YA 4M8VA 5LCVL 5JXED 3KHOA 3CFEB 2Q3AA 1PL3A 4KDTA 3Q1EA 4LCYB 4Y16C 1BF2A 1WBZB 3BUYA 4QAWA 1N2RB 3KW7A 1DD4A 1EHLH 2BP3A 3GXFA 3NCXA 3DIFB 2HFFB 4NERA 1IM9D 2PPEA 1S9KD 4KK9C 1YMMA 1HIML 1PDKB 4GG6F 2CO6A 4PJ5A 2EO1A 2EDLA 3M46A 4GKNB 2O1JA 3APCA 1NIAA 4LSRL 5DJYA 4ZBJA 4RFEB 2R44A 1CDYA 3I9AA 2EDYA 4IGBD 4JF7A 1JP5A 2L04A 2ZPKH 3HZKB 3IDYC 5DZ9A 2RCSH 4DCKA 4WI0A 3S88H 2W27A 4L74A 4QTHB 4WTZA 3EYFA 4I8DA 1DANT 3RNQA 4G8EB 2W8ZA 2XYCA 3IT8D 2PXYA 4EVNA 5AVZB 3QCUH 4MA1B 4Q4EA 1JZ8A 3HI1A 4F7CB 2WLKA 3HR5B 4RFNB 3T8XA 4I0CC 2WTOA 5E6UB 4HCRL 4U3HA 2HRPH 5B1JC 5L6YH 3B4NA 4JFOB 1ERNA 1UH3A 4C83A 1ZHLB 4L2YA 5BV7C 2GHWB 4UB0L 2P5EB 2WP3O 4LOUC 5FF6A 2NY1C 1KJ2B 4N9GA 3TNNB 2A5UA 5T33L 2R0LH 5BZWB 1F4WH 3FWLA 1EZVI 3CVDA 2P58A 25C8L 2N01B 3NTNA 3TA3D 5E1AA 4IRJD 4S0HA 3V5BA 1JCCA 2R1WB 3D2UD 1TVHB 2IH3A 3FTZA 3WGUB 4LASH 1HYSD 3U7YH 1MY7A 4N26A 1P4IH 3GMRA 5BMFL 5JORB 1P2CB 1UFUA 2F53E 2NPLX 2AEPH 4LXFA 1IAMA 5B3SB 2OQJA 2H7WA 3HE6D 5HYIA 4W9KC 4FX5A 4Y9FA 3HG1D 3R4YA 1EAPB 1T21A 1FVEA 2DIBA 3MCG1 1A6UH 5BRPA 5LGHL 3VXRD 4YHYB 1Q82Q 1TJXA 2OKMA 1HDMA 2B3IA 4N1HB 4PVMA 5DCCA 2L0DA 1UHVA 2ZE0A 3NTCH 3PP4H 5E8NA 1L9OA 4UMSA 3FB5A 1SJMA 2CM5A 4X6CB 4EUPH 1AOZA 1F1DA 2CO3A 5HVFB 3G5XA 1KYOJ 4MMYB 5DZLA 1J86A 4UQ3B 1R3KA 4MCZA 4LLYB 1HE8A 1HJBC 4GG6E 3GI8H 4FQXA 3F83A 4DCQA 4TT3H 1S7SA 1TQCB 2ADJA 3OJVC 4MA7L 4L8SA 3U0WL 4PD4E 3AXLA 4G8GB 2LXCB 1KOAA 4LCIL 4XP6L 1F56A 1BQLH 1L0LD 3DK0A 1BD2D 4WNQB 3IFOA 2ZZUT 4HOZA 4MNQB 4NQED 4L3FA 5SWZD 5J6HA 2FO1A 2X6CA 4PJDB 1A6TB 4XWGH 4BH7B 1T1YA 5TFSH 4KQ3H 5DHMC 4X5XB 2YRBA 5K93A 4QRRB 1IBDA 2VLRE 3V52L 4D0CA 3BPNB 2GY7B 4BZ2L 5IY5B 5DGRA 2ZJSE 2IH8A 2J56A 1F4XL 4UNTA 3O41B 3O6FA 4YDKL 4MNHB 4OUUA 5IHWA 1MFVA 2QSVA 2FYYA 1VAHA 4JG0L 4H20H 3KPLB 3QR2A 1WIUA 3T0WA 5DEZA 1U8JA 3ESVF 3OXRA 5JW4N 1AZBA 3O2WH 3QPQC 5E51A 3QE5A 2OXHB 3VP9A 2PW2B 1JYWA 2JV6A 1LE5B 1MRDL 2PCPA 4LSSL 1SQXE 4GO9A 4TL5A 1FZOB 1HCZA 1KBKA 3KPTA 4ZAKB 1Y18B 2KBGA 1J0IA 3S36X 4HH8A 4DOHB 3MUDA 2CO4A 1KBGL 5GXBB 1YC7A 1URIA 1M71A 1QFWI 4YBHA 3K6SA 3NGBC 3AT0A 5MENB 3QDJD 4FLSA 4KTDH 1N59B 2NPSD 3CFDA 4IRSC 3VRJA 4B96A 4BHUA 2Y7NA 5TDPA 4AKQA 1C08B 3MRLB 4I2LC 4D0DA 4AC4A 5AG8A 4XX1E 3JSSA 1G9NH 3V4VH 4OCRH 4W9FC 4DTGH 5L9DH 3TJHD 3QH3A 2B4CL 2BSED 3CGTA 1JHKL 4EI5A 1KXVC 4MKMA 2EO7A 2EDKA 4YHMH 3NYKA 1S5LH 3BVHA 3VXTA 3FK3A 2D3VA 4YHIA 3DETC 5GHWH 1BSIA 2FO4B 4E0RA 2J1WA 4YHPA 2NNRA 4U7JA 2OW7A 3EUDA 3K8KA 3PXHA 4JANA 2KQMA 4HK0A 3BGFB 4JRWA 4YXKL 2V2WA 2ZJSH 3SBWA 2XTLA 4Y5VB 4C7RA 2VLMD 2UWEA 2XIIA 2UZIL 1L3WA 3ETTA 3HG4A 1SDDA 3MV7D 4JG1L 3OB0K 4HX1B 4ONGL 4UZGA 1ORQB 3FQRB 4KRLB 4OWFA 1OX3A 3CDGA 3SQOL 4G8IB 1W8OA 3I9PA 4R96B 4ZTPH 5AUMA 3VNYA 1FZKA 8PAZA 1VPOL 2QPSA 2IH1A 4S1RL 3D25B 3MV01 1N7SC 5AD0A 2L7EA 4I9WE 2PFXA 3A67H 4XC3L 3UJTL 4BFKA 3VI3B 2J57A 5JHMA 2CK3H 1PP9D 1LMIA 3DMMA 3J07A 5E95B 2EDHA 5F7MC 4IEFB 4EI6B 1QATA 2BERA 5HHME 1MJ7L 1JNNL 5DFWH 3H2QA 1QBBA 1B4TA 4JR9H 4YDLB 1MDAA 15C8L 1CICC 4EUPA 1EEZB 1PF3A 3AG2B 3H4HA 2DWTA 2QJYB 3MIWA 4ZKUA 3O6LL 1RHZB 4L1SA 4B6ZA 2ZOOA 3TASA 3TSIA 3HE4B 3RKDD 2XG4A 5IOKA 1E7UA 2ICES 3TGUD 2VN6A 4OCNC 2WXMA 4P9HH 1B0GB 4K7PH 2R1XA 4L29A 4PI0A 4LHUG 1RE3C 3MKKA 3WE1A 1KEGL 5C0FA 3BFQG 2CK2A 1YHQP 2YD4A 3JWOC 1KUMA 4P05A 5DD5L 1JO5A 4YJZL 2CHDA 3LZRA 1LEKB 2X4RB 1RMFH 2JMRA 5EZOH 1U8LA 4H1LG 4ZPTA 1LGVA 2JKRM 2IBZG 4F80A 2L5GB 1XXFC 2EE6A 4KKRA 5E8OA 3TCLB 2WD0A 1LWUB 3IFLH 3QQ9C 5SX5K 3L5JA 3QBTB 4ZSOE 4MNGB 2JJUA 4UT6H 1ZDQA 2VLKD 5T1DH 4TVSa 3F7QA 1UJTA 2H47C 4H0LB 3CE1A 3CXHK 3B9KA 1Z56A 4FNRA 5CMZA 3GXUB 3LB6C 2DYSB 4CW1A 4NO0A 3MFFB 1FO0H 4ZMOA 3FZUD 1E9QB 2JJVA 2Y2WA 3F6JA 1TTRA 3TBWA 1E8ZA 3MCLL 4G7QB 5KJ7D 2YKKA 1QOKA 2ZPKL 3IAQA 2N1KA 3QORC 5LUMA 4UUJB 1UXSA 2GBTA 2RCSL 4HK3J 2DEWX 3S88L 2LVCA 3SWKA 1CD9B 3JV0A 3NGBB 5DO8A 1GZQB 3HG1E 2WQYC 4HPHA 4IRSB 3VSVA 1P84J 1CXKA 2C9UA 2XQYK 3T4YA 1DSYA 4BCYA 1O5PA 1WSST 1YMHB 4A6YH 1WIPA 2WZ5A 3PIQA 3CMGA 1WISA 2HRPL 3PGCA 1GVIA 4EPSA 2EXWC 3V4VA 4K7FB 5L6YL 3QXAB 2NYYC 4WNJA 1NC2A 2B08A 1BBDH 1NFKA 3JVGA 1X9VA 4NPFX 2G3ZA 3LKRB 5DHDA 1D9KB 3K46A 2P24B 3IDJA 3P2TA 4I13B 4WHYG 4Y2LA 2YC1A 5A7EA 2J3SA 3IDGB 3QEQD 5B7MA 1F4WL 3F7VB 2Y9RT 4MVBC 4F37K 1E5BA 3EZJB 1DBBL 4FG2A 1XQ4A 3CIAA 3RK3B 2VLRA 2VR7A 1CYXA 4NDMA 4PREA 3RL0D 1Q1JL 1ZA3B 2DM3A 3KXFD 4UM8A 3H1IJ 3A47A 1P4IL 3BVUA 4PIRF 1L6XA 1BD2E 2WP3T 4HBCH 5HHXH 1AXIB 5FO7B 4ZUSA 3CN1A 3J27A 1LTGC 3HRZB 3PLNA 4LVOB 1MW3A 1XL4A 3IKCB 3GHBH 2W9LA 2FXPA 3PWJA 1A6UL 4K23H 4HGWB 1N7SB 5FKPA 5I23A 4RNRA 1NMBH 4MDRA 1CFNA 4JPVL 5KG9B 3FONA 3PP4L 4O9BA 3HAEG 3LSOB 4MSWB 4L1TA 4OLXL 4OJCA 2WNGA 2OTUB 4GBXC 3CFKA 4NCC1 3V2RA 4WFGD 3WS6C 1H6EA 4UCFA 2TRHA 3FU7B 1YVLA 1ACCA 1WHPA 3VTMA 3EJSA 2B15A 3IK2A 1AQHA 1HZHH 2Q8BH 5DJTB 2DEYX 5ANME 2QSQA 1RL1A 3TT3H 5ABZA 5JO5B 3T65A 3WEXB 3BH9A 3RWHA 3GI8L 1NBYB 4D8PB 5CEXA 4J3OD 4D9RE 2R2CA 5EB9A 1JPFB 4PJ7B 2FX8H 3B83A 2ZKHH 3B2XA 3D6YA 2X2YA 2R15A 4WTQA 4X8JB 3UPRA 4C57C 4YDJB 2QJKC 2HG5D 1L3NA 4GSDH 3ZR6A 1A4KA 2W9EH 4Y2OA 4JYCA 2WO3B 1M05B 2QGEA 4LDCA 1LD9B 3GD1C 4JGMA 3QDJE 1H8NA 4XWGL 1MI5B 4UQAA 4LGRB 2OR7A 1K9TA 4MX7A 2B1OA 4KQ3L 1DBML 3ARDB 4HKZH 2XG5B 2KI6A 4JN2A 3QP3A 4JZNA 3HR6A 2NDGA 4QRUA 2B59B 4AW7A 4KO7A 1MW0A 1CMOA 2NCMA 4S1DC 4F7EB 3HI5L 5A16A 2E9BA 3POCA 2R5DA 1WE5A 2Y06H 1AIZA 3IVKA 3TBCA 1KFAH 1XR8B 2OLDA 4AMXA 3AXIA 2PWFA 4CKQA 4HWZA 4PRID 3A0HE 3RVWD 4NRZA 2AV7A 3KLDA 1AQTA 1DFXA 1VRSA 4XN2A 2WSDA 1H0TA 4LDLB 1NC4D 2WXHA 4UT6A 1ZHNB 3MFGB 4WWKB 4GRLD 4WW2F 1MG2C 4A7VA 4D7BA 5DQJA 1KWKA 1EV2E 3B43A 4JFPB 1KDIA 1J1PL 4LEOB 4AMWA 1TOXA 2XWEA 4XMPH 4KO5A 1FO0A 3L4ZA 2KZWA 4PCYA 1X9UA 1S7QA 5JXEA 3GXIA 3PRZA 3DJSA 4GIAA 2UY7A 4M3HA 4MXQD 3VACA 1XF2B 3B1UA 1I7ZA 3QORB 5E9NA 6TAAA 5I17A 3APDA 1T7XA 3JV6B 2NW2B 1QVOB 3PL6B 1QLRB 1G9NL 3V4VL 2NW3B 3H1KD 1YYMH 2D31B 4MRBA 3FFCB 1IM9A 3OV6A 4PTUB 4QT5B 2OV0A 4HG4J 1BMGA 4JB9H 4YHML 1ETA1 3M17A 3CSYA 3O8XD 3L72D 5GHWL 1CYGA 2CUMA 4KI5C 1XXDC 3CLWA 4A6YA 2DB8A 5EIVA 4PW4A 1UZ8A 1ZK9A 2X2HA 3HUJB 1W72B 4IGBA 3UTQB 3ZZSA 4PJAF 4XAWH 4B9GA 2IXQA 1JHTA 2FUQA 2WOYA 2ZJSL 3W38A 3H1LJ 3OLDA 4LSTH 4FXKC 3EJTA 3KW8A 3W67A 1T2KD 1BSNA 4UQBA 4I4WA 5BO1H 2C7UB 1EDQA 4BCXA 3ERXA 4PTTB 1SLVA 1N64L 3HC4H 3KR3L 4ZTPL 5C07D 1OW7A 4D6TD 2BS71 5GIRA 2QVMA 3APFA 4ZSOA 1VFBA 4X7TA 4V1DD 1OB1B 1UWXK 5ITFA 2CPCA 3A67L 4H26A 3BRFA 2X4OA 3MBEB 1RQUA 1LL1A 4ENED 2AMUA 3RPIA 1UADC 4OGYH 3FPXA 3S0PA 3TA3A 3U25A 4IRJA 2WC7A 3D2UA 2EYSB 2VXSH 1JPST 4N24A 2PW1A 3L95B 3Q1SH 4JR9L 1JNMA 7PCYA 4G6FD 1OCOB 3HUSC 5KVEE 2UVEA 1DBAH 2YUXA 3RB7A 4BQ6A 2VLKE 3L3DA 3HE6A 4YIQA 1FDLH 1LWHA 3W3BA 5F6IC 4WJG3 2BZCA 3HG1A 1LVEA 2J43A 1SFCC 5F0MB 4UU9B 3L9RB 2VDNB 3VXRA 5BZDB 2A06D 4O2CA 1KILD 1JZIA 4J3OF 1NJ9A 3IR9A 4FMKA 4P9HL 4F2MB 2AXGB 3TBVB 1TTFA 2XFXB 2ITDA 2VNCA 2P8LB 3MLSL 1K2DA 1M2OA 1ES0A 4EOWH 3SHSA 5FO2A 1EEYA 3B5GA 5ES4B 3OG6B 1RMFL 5FO8B 1DQQB 5EZOL 4MMXC 1NKZB 5IW1A 2CO2A 1KCBA 1T3FA 3F7RA 4U7MA 1IBYA 1GW0A 3PWVB 4RRPA 4X4KA 2IAND 4MXVF 4HKZA 2ZX7A 3V8CA 3IFLL 4UIMA 3WFDH 4N0FA 3SBRA 1JM0A 3MYZA 3RTQB 3FSZA 1BD2A 3EO9L 4K9EH 1OCWH 4PJAE 5FGBC 3NP4A 4Z7WF 1BZOA 4NQEA 4UT6L 5SWZA 1A6AA 4A7QA 2WMPB 3OJMB 3QEQE 4N68A 2R1YB 5GZND 4JN1L 2QQQA 4MAYB 3WFCH 3E2HC 4GT0A 3N91A 5D1ZB 5L8RJ 4HCGA 4Y7OC 2FX9H 2X10A 3PABA 4GFXA 4YDMA 1FZCA 1BPLB 3GSRB 4TN9A 2P5WB 1FBMA 3GINA 4XP1L 4BZ1H 1R3JB 4JZOB 3CN3A 4QHNB 4KROC 3OGOE 4QXUH 1U4FA 3TYGH 1OWRM 5KSBF 1V27A 3L74D 2HT4C 2IZ1A 5GGRA 3BFWA 1BFSA 3BZFB 3L3JA 3I50H 5EBLB 4BH8A 1LO5B 3FQXA 3QIWD 3DX8B 4A6YL 1LM8V 1ORSA 2F5AH 4B9CA 5B1AB 3AZUA 2H9GB 1BOGA 2FFDA 4WFGE 2RALA 1EANA 2UXGA 4DF9A 4P5TD 1FFOA 1P69B 1PZUB 2IALB 2Y9YA 5D7KD 3LKNA 5EPMA 3UG5A 1S7TA 2K9UA 3FTUA 3II1A 4MXWL 5H2BB 3QDJA 2E3VA 3U4EB 5C0DB 2NPSA 3C5SA 2PKDA 4ANWA 1CF8H 1PLAA 2ZT9D 1A2YB 1E42A 4Y9EA 4ZMTA 3OLEA 5F71A 1K8AQ 4H8WH 1NSNH 2BSEA 2ICEC 3MJ8B 1T1XA 4IOIH 3QO0B 4HBCL 5CJ8A 5HHXL 4PJHA 1T0NA 1EDYA 4NNYB 1OAZH 4M3JA 4DP2X 1HEJC 1AHWC 2YKQA 2WPGA 4K23L 4QYOB 4N8VB 1YEWA 1PX3A 2V3EA 4MXVE 1NMBL 1CB4A 4G8AC 4U7KA 5ENWB 5AKSA 1I8IA 1OGPA 5DS1A 2FLMA 1FYTD 3G08A 1EZVD 4XNMB 5D93C 2A9MH 4BGLA 3I3BA 1X7TA 3BATA 3A6CL 4Z7WE 1OOWA 3MV7A 2VXUH 4P99A 1M57B 4QHMA 3H54A 1HZHL 3TWYA 3LPWA 4ZFZB 3ROLB 1Q9OA 1GMEA 2WXKA 4Y4FC 5FO9B 5E08L 2X7LB 2N1TE 3VRIA 4Y88A 3LVEA 3DI3B 2VAAB 2Z5IA 3HUSB 3PHOB 5DMGC 5ALCH 4OZFH 2FX8L 3V0EA 2ZKHL 5AB9A 4XB8A 1WWAX 5EOCH 2M5AA 4HS3A 4P2AA 1PD1A 5KSBE 4GMTH 3MROB 1X4XA 2W9EL 3DVIA 4QXTA 3GZPA 1E43A 2KL6A 3WIIH 1TXKA 5F3FA 3D0VB 2DQFB 1NMAL 4XCYB 3LKPB 1KIPA 1JS4A 1CGUA 3IRCA 5HJBA 4YFDB 4J3OH 2PWEA 4E9TA 2R2HA 4UYPA 1PZCA 1D2PA 2VSDA 3M0DC 3K7UA 5AQ0A 3VXNB 1KB9I 3VFSA 1R24B 4G9DB 3H1KE 4MMXB 5L4JA 2VR9A 1K85A 2XN0A 1YA5A 5F1OB 2Y06L 2APFA 5EU7C 2GSIA 3TA4D 5C3TA 3V4LA 3ULVE 3DGDA 1U8IB 2W80C 1FNSH 4YNYA 5EZJB 1GOHA 1KTLA 5AW9B 2YSSB 3GBNH 5EEUA 3QG7H 5EUOF 4EDWH 1OW6A 2SEBA 2MCPL 5ETUB 3A24A 2VL5B 1G43A 3HB3C 3OKKB 2E9GA 3HNSH 3PF2A 3QPKA 1JK9A 5AW0B 4K07A 1MDTA 2MKVA 3H9ZA 3IWVA 4XNZC 1Q9LB 1SXSA 2GJZA 4UBDD 2FEJA 3STZB 1SQPJ 3OR6A 2Z35B 2NNFA 3EO1B 2VXTH 4RAVB 4KK8C 3CZFB 3FUMA 5C07E 4N20A 4TUOA 3T6VA 4ZFOA 4JK0D 4B53A 5C0JB 4NQSA 3FUJA 3MLTA 2VLKA 4V1DE 4LVNB 3ZIYA 4PM1A 1HQRB 2O30A 4WW2A 1DJIA 1TJGH 3UBXA 3PRJA 2R3CA 1BQHB 1QACA 3FT4A 2BWQA 5F3BB 5CBEB 4JB9L 3V5DB 2A6JB 2A0LC 3NCCB 4ZMLA 3D4CA 1H3PH 2CXKA 5J1AA 4PJFA 3ZW3A 3WJMB 3R1GH 3QDMB 1IZJA 5KJ7A 4L5FE 3W1ZA 4Z3GA 3MKGA 3WTTA 1PZ2A 4FG4A 1CLVA 2A9BA 1I3UA 4JO2H 5DJDB 3VXMD 1NBCA 4LSTL 1HAWA 4JHWH 4J4PD 1UKSA 3UERA 3CXFA 4K5LA 4KJYA 1KILE 4P23B 3VFOA 5T1LB 3MUGA 2QGDA 3HC4L 4U1GC 2ICEB