4HYTB

Na,k-atpase in the e2p state with bound ouabain and mg2+ in the cation-binding site
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
289
structure length
289
Chain Sequence
FIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRFRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the high-affinity Na+,K+-ATPase-ouabain complex with Mg2+ bound in the cation binding site.
pubmed doi rcsb
molecule tags Hydrolase/membrane protein
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
total genus 46
structure length 289
sequence length 289
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4hytB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 4hytB02
4XE5B 2P2UA 3HE5A 1NWQA 4JYCA 3KQGA 1CI6B 1OXZA 5CMZA 5AVXB 1H88A 5APQA 3VTPC 4I6MC 4LC1A 2WTYA 3M0AA 5APTA 2XZRA 5AW1B 1T2KC 1SLQA 5AVQB 2YO2A 1S9KD 1NAFA 2ZXEB 5AW3B 2Q3IA 5AW5B 3V4WA 3VMYA 3I5CA 3O8ZA 4I2LC 2BASA 3LIEA 1FOSF 3KDPB 1CSBA 3L36A 3A2AA 2XV5A 4DZOA 1X8YA 4C7NA 1CI6A 3UIAA 4HYTB 4C7NB 1GZLA 2WPQA 1OWAA 3HE5B 3A5TA 2W27A 2Z5IA 2XU6A 5AVVB 1FAVA 3VYIA 4M3LA 3V4QA 2VRSA 1GTWA 5AW6B 2E42A 3NFQA 4RESB 2H7HA 3P7KA 1HUCA 3OAKA 5AW4B 5AW8B 5AVRB 2C9LY 3WGUB 3M9BA 2IPPA 2QM8A 3NTNA 2KP8A 3TYYA 5AVYB 5APUA 5AW7B 5AVWB 3VMXA 4AQRD 4KHXA 4B86A 3SWFA 1SP4A 1JNMA 3TNUB 2YNYA 3WGVB 1A02F 2WPRA 3L35A 5APYA 3MGNA 1KQLA 1YYCA 2YO3A 3LIDA 2C9NY 4RETB 1GD2E 1GU5A 5AW0B 2WT7A 3V5BA 3M9HA 2WPSA 5AW9B 3NMDA 2ZFCA 2QM7A 4GKGA 3IR9A 5APVA 1GK6A 2Q7CA 1HJBA 3L37A 2R3CA 4JYBA 2R5DA 4AYCA 1T2KD 2R32A 2P7JA 2P67A 5APWA 1H89A 4AUWA 1HWTC 3M0DA 2Q5UA 3MD0A 3TNUA 3P8MC 5AW2B 3A3YB 5AVTB 1GK4A 2JJLA 3HE4A 3NXSA 1JUNA 4C46A 3B8EB 1G2CB 3A7OA 3M06A 5AVUB 2R5BA 1MFZA 3M91A 5APSA 3HE4B 1HBWA 1CZQA 1MUUA 1S9KE 3TK1A 2E43A 2WT7B 2N9BA 5APXA 5AVSB 1GU4A 1A02J 2Z5HA 1J2JB 4EOTA 3VN0A 3HTKA 4GT1A 3VMZA 1H8AA 1FOSE 5AVZB 2WWWA 3T97A 1IO4A 3P32A 1DH3A 1MV8A 2W6AA
chains in the Genus database with same CATH superfamily
2P2UA 5E8DL 5F97E 5A2AA 1CW5A 2Y0DA 1NTZK 2XBDA 1S9KC 2Z9TA 2O1JA 3MRRB 5EU7E 2EH8H 5M7QA 1YEJH 1PPIA 2BZCA 1RZGB 5DDHB 5I1HH 1WWBX 3BW9A 1H0TA 4HPYL 2XFXB 3FUFA 2ESVA 3WIHL 2JMRA 5L2JB 4HKZA 3C5SB 3MBWB 43CAA 2AV1A 1GVIA 5HHNB 3O8ZA 2JB5H 3BZFB 4YPGA 3NPZB 5ESQB 4BBWA 1KT2B 3VQLA 1QBLL 1IGCH 5I73B 4YDMA 5FA4B 2V6HA 1KYFA 3MAWA 4M6OH 5CSBA 3REVB 5CCHC 1HJCA 4AV5A 3UXFA 4QHLA 1NDTA 1ZSDA 4KZCA 1NEPA 4J3BA 2X4TA 5IJKA 5TQ2H 3K6FA 3TBCA 2L04A 4UUJB 5AKRA 3FB6B 4LPVA 3G6DL 4XBEL 4O51B 4QTFA 2PPDA 4PB9L 2H4EA 1A5FH 3ZO9A 1OANA 3B5ND 3D08A 1Z9PA 4F37K 1ML0A 3FT4A 4MJ2A 2ICEB 5DQDH 3QORB 1EZVE 2EEAA 2XIBA 5DJDA 43C9A 2YR3A 4JFPA 2E74D 3MYZA 4HCRA 1PYWB 2BSTB 4X9BA 2AQ2A 5ILTH 4HK0B 3Q5RA 5FO2A 1XIWC 1YYCA 2PUQT 5C6TL 1E9QB 4PJ5E 3LHAA 5FGBA 4KK9C 4O02L 4O2FA 5FAAA 1KQGB 3RPIB 1AQKH 2PR9A 3LRKA 1BVNP 2QPUA 2XCMC 4XNDA 4E68A 4JQVA 1GGTA 5JORA 3G5XB 3KLAA 1E2ZA 1HHGA 3I3EA 5JOPD 2BRRH 3VD4A 3UPRA 1WFUA 3OAYK 4ZFZA 4AJVA 5LO7A 15C8H 3N9GL 4KDTA 2O5XL 3AE7C 1Y07A 2X4UB 2PNDA 5I73C 3WSQL 2IAND 1NCIA 5DWUH 3EGSB 3FQWB 5KVEH 5HGAB 2VZTA 1GGIH 3OMNB 1MI5D 2JJTA 4PREB 3QIUA 3IDIA 1UZ6E 3NPSC 3RK2B 1JXKA 5J3HC 1TFHA 3FU6A 1VF5D 2B7DT 2K1AA 1Z3GH 4H0LD 1Q9KB 5H2BA 4X80H 4TNWK 1Z9SA 2JCCB 5A2KH 3P4MB 1E7VA 3PDOA 3MLXH 3T77B 1LQBC 1YEIH 4NYLA 4R7NB 5GS0C 3GGWB 1QI4A 1WFJA 4PJBF 4M5YH 1A02J 4KUCF 5AYUL 4K8RL 4DHLA 1XTGB 1T0NA 3VN0A 1A9VA 4NQEE 4XHJC 1HE8A 2AEQL 1U42A 1BZ7A 3RL2B 2EXSA 1DH3A 4N1EA 3VRIB 1BE3D 2YPLE 2QIWA 3NYKA 3I50L 4QF1A 3GUFA 1UM6H 4B9PA 1KWGA 1TTBA 3GS7A 5E9DD 2WQUA 2ZPKH 2W0LA 3LQAH 1VEPA 2ZG3A 2H3XC 3SCMA 4GKSB 5E70A 2G0KA 3Q2VA 2XNDH 2R59A 2ZPKL 1TENA 4JHWH 4U6XA 1NGWA 5EZJB 5IKCB 3D48R 3VFOA 3SN6N 4MD5A 3MRLA 2GG1A 1JF1B 3TL5A 1XTMA 2XKSA 4LCYB 2BY1A 2E76C 3EF7A 1MNUH 1T89A 2NPLX 4JPQA 4MMXB 2EDLA 2K4AA 4YHMH 4DP2X 1P2CA 1T1XA 3ZPDA 1UWGL 3KS0J 4LU5L 3ZHNA 2G5RA 1DDHA 5EB9A 5CEYB 2OTLP 2H5UA 2QKIC 5C07B 3IRZA 2WLIA 1PW3A 1S5HA 2VDOB 4YVUA 3S36X 4O2EA 4X99B 4HCRH 4DKFH 5B3JF 4K71C 2ZWZA 3QA3A 4N8UA 2OR9L 1FL3B 1OAYH 4UWQB 4E2OA 3BFOA 4ENZA 3HA0A 4OD1L 3WFEH 1OSEA 1QL1A 1G0XA 1F4YH 1QZ1A 2VIRA 3CFUA 4RWYH 1VL2A 1K3IA 2HX8A 4Z78B 1PPJD 1U30A 4Z76B 2KZBA 1KWKA 1PNCA 1M7IB 5ICZB 3MBXL 3E9TA 3WD5L 3QHTC 4LCCC 1ZA6B 5J1AB 2WYHA 3BGFC 5DD3H 3H32B 2FYUJ 4KK8D 2WZ0A 1GAFL 1CBVH 5D1QD 1OAXL 3DTXA 4YNYB 5DD6B 2VB5A 3P40A 5I1DB 3AC0A 3S48A 3VB8A 2N0KA 1KY7A 1I3RB 2VLLA 4KJYB 4LFHD 5IROA 3L9EA 3OKNB 1OP3H 4EN3B 3WBDA 3ZDXE 4LF3A 5J89A 1UT9A 2XU9A 1RULL 4NQXB 1N7LA 2X9WA 1NGQH 3GSQB 1A0QH 1OLZA 1B0IA 2V7NA 1N6VA 3EOAB 5HHMB 1IUZA 5A3IC 2WCGA 3VGBA 3JTTA 3WIIH 5DJXA 4AIZB 4NIYE 2A73A 2AEFA 2NY1D 3AS3A 4TRPH 4WNQB 4G9FE 2YN3A 2CLVA 3WIHA 2BY3A 4W9LC 4BUHA 5L9DL 1SQQJ 4I3GA 4QNPF 1JUFA 5FUCC 5CD5D 1H89A 2OTUB 1B0WA 2BDNH 4ZMWA 3Q2CA 1SF5A 4XPAH 3MUJA 3IDXH 2R0ZH 3RWCB 3BRTB 3SE4C 2ADJA 2WLZA 3UPCA 1SFCB 4H25A 2ZXQA 3CCRP 5F88A 2ZF9A 3DV6B 4QDGA 4HBCL 4HJGA 3PTZA 2R7EB 4GI9A 4MDRA 3HMXH 1KF9B 4J27A 4X5RA 3L5JA 2JQAA 1NTZE 1G7PB 2Q8BL 2YK1L 4PU2A 4OJEH 1A7NL 3VP9A 4U6YA 3CVBA 1UD6A 4KDVA 5DZ9A 2WB7A 4KDTC 4MZ2A 4XNMB 4R0LC 5D7LE 2BPBA 1ASOA 5TK4A 1JPFA 3IJ9A 4Z0XB 1N5YL 1PIFA 1MUJA 5JHLH 4TQEL 1C16A 4B9ZA 5EF0A 3FFCA 3C60D 1UD2A 3IETA 4MS8D 2Z35A 2IANB 3A4EA 5K33A 3D4GA 1C7TA 2Y25A 4GT7A 4L4VA 5I8EA 2FY8A 3ILPA 1TJHH 3KVPA 1ZPUA 4WWID 5DSCB 1U8HA 2DWSA 2FO4B 2UZIL 4HSAC 2EE3A 3ARGA 2NXYB 3W0WD 4AM0B 4LOUD 1PZ3A 2K6WA 2ZP8A 2BVTA 4OLUL 3QQ4B 5INDA 4YGVA 1SHSA 1FVCB 2DQIL 3W1ZA 2YMTA 1TSRA 1MFDH 3LQZA 5KBDA 4G80A 1JZ7A 1DQMH 1A9EB 2CMRL 2PR4L 3NFPB 3RK3C 3CZUB 5SX4I 4YBLC 4ZYKA 5I17A 4WGVB 5CGYC 1NOFA 3MRBB 4HJ0D 5SWSE 1MCLA 1MXDA 5GISL 4K9EL 4ELMA 2KDYA 3GI8L 3MLSL 3E2HC 1PPJG 4KTDH 4QMAA 2NYYD 3TLRA 1SXCA 1MWAL 3CX5J 4Y8AA 5AEAA 3HRPA 2V7QH 2DL2A 4OSUH 4RMBA 4JDZB 2VQ1A 2OMZB 3PAZA 2ZKHH 3OW2O 4TSBL 4ZS7H 3VMXA 1F4AA 2VDQB 3CX5K 4LSSH 1P6AB 1GHFH 4L0ZA 4OCYL 3TV8A 4AQRD 3L5WB 3JWNE 2AK4E 2I1JA 3L35A 4POZD 1QLRA 4A2MA 1JY3O 1QBMH 3C5JB 3IFNH 5C0GB 4BKLA 1AG6A 3W57A 4K3AA 3LNFA 3L6FA 3DI2B 4JRXB 4TRPL 3RX8A 4ZQKA 3HRZB 3IR9A 5JQ6L 3H0TB 3B6SB 2UVEA 3O6KH 4QXUH 5EEXA 2HT3D 3C6SA 2HSIA 3NZHL 3O3DB 5AB1A 1UM4H 3AU1B 3UTSB 1FYTB 3TNMB 2WXMA 3TYFB 5K9QG 3RILA 2H6OA 4Y99C 3JWDL 3T3PE 3BZEB 5IFHL 1BGYG 3U7YH 1MFMA 3D09A 1NTMG 3OXSA 4KC3B 5C2BL 3UZQA 2XPZA 2RMZA 2VAAA 1WO2A 1E6JL 3GLAA 4JFQB 5HYIA 2VABB 2N9BA 4KK5D 1UD8A 3TEZA 1CDCA 3SDAB 3EYUH 4CVXB 2BSED 4KVNH 1EFXA 3HUJA 4FZ8L 3NRQA 3B3IB 4YZFF 2D9QB 5IMMA 2W0FB 4X8GA 3MLRH 2QADC 4LHUD 4PD4E 4NS0A 1HC1A 3EJZD 3B4SA 4O4YL 4BD4A 3E8UH 3FTGA 4H2CA 2I27N 5CJXC 4AJWA 1JPST 4BFGA 2VNCA 5FCUH 2NY6C 2ZX9A 3ARBB 3QVAA 4B9FA 3CMGA 2UZYA 3I9PA 3T0AA 2AHIA 4N6RB 4I6MC 4X5QA 4HKJB 2K6ZA 5KOVC 1SEQH 4ZMYA 1AKJB 4Y7OC 1PEWA 1FN4B 1MAKA 3WKQA 3PH0A 1BMGA 1I9EA 3KWWB 4IHOB 4BRVA 1PNDA 3VXQB 3P8CD 3SWKA 4LARL 5FLVA 1F3JB 4JO2H 4ECNA 3ZKQD 1KD1Q 4TQHA 3HE7C 1CN4A 4I7ZB 1LP9F 4YDZA 2UWEF 3QEUB 5HHOB 4YHIB 2WWMD 4BGLA 2OAAA 3JZ7A 3QJUB 1BIHA 4ONGH 5IFAL 5ISZE 4XMVA 1RIVH 4NQDB 5DK3A 5B66H 1M1SA 1QQDA 3FQUA 5D7SL 1NGXA 3NIGB 3H1LG 1F4XL 3VXRB 3C8DA 1AHKA 2Y3NA 3AW5A 3ZMRA 1L0NK 1N7SB 5GGRB 1U6AH 4X8JB 5CINH 3K5BA 4ABWA 3L4FA 5LWYL 3AMLA 3QCVL 3ARGC 1OCWH 1BCIA 2AMUA 5AKSA 3UTTE 2FYUK 3R1GH 4TKWA 4HAGA 4PJGA 2FB4H 3CH1B 1JV2A 4WI3A 1DBBH 2NT0A 3GMOB 3HVDA 4FDWA 3AUWB 4DKFL 2BNQE 5D7IA 5HHVL 3GBML 1FZMB 3IFOA 4YXKL 1RHHA 2BSSB 1IBGL 1XGQB 1GKOA 4XPBL 3UPRB 3L7EA 2UZXB 1BMZA 1DBML 4PD4K 4ZJ9A 4L18A 3GIVB 2B3RA 2Y7MA 4NRXB 4EI0A 4KI5F 1GK6A 2X4OB 3EF4A 4LKXA 2LR2A 4JO3L 2NUPA 1CR9H 2GSIA 5TDNA 2ENPA 1EXUB 1YBKA 1G7QB 1EXIA 3OR7A 3WJJA 5ACZB 1AD0A 1ESOA 3HN8A 3MFFB 3VSUA 3S96A 1OL0A 4P3CH 3IRPX 3C12A 4TQ8A 1F11B 2ZUVA 3G5VB 3BKJH 1GPOH 3OJAB 3MNMA 1G1IA 4ANUA 1FG2B 4Z95L 4AJ0A 3HUSB 4PJ7A 4PJXB 1HHKB 5GGUB 1DSFL 4AEHL 4F1ZA 3HJ0A 1E65A 1QSEB 2VOTA 3CV5A 4WSJA 5DQJA 3PJSK 3QDJE 4Z3GA 1NU1G 4PBWD 1JRHL 1EO5A 2ZCKH 4FRWA 4ZNEE 2MQCA 3CCHA 1FFPB 4G59C 4GKNB 2FHFA 1A3LH 3EHBB 1K8IB 4FYTA 3EXLA 1R3HA 1VDFA 2ARWA 4MBRA 1GGIL 2PYEA 1B4LA 3RHWK 5KG9B 2N01B 5TQ0H 4GKOA 5JW3H 4LASH 1N4XL 5F8QC 3T0EC 3IFPB 3FCSA 1MSPA 2Q3XA 3H9SA 3DV4B 5GXBB 4ANKA 3R2PA 1KJ2L 3P3UA 3Q8FA 3CJJA 2Z1KA 3GSVB 1ZGLM 2BASA 3UYOD 1NEZA 4P2QA 3O3BA 2ZE0A 2DQEH 1ZLDA 1G1OA 2FAUA 1JGVH 3SDXB 3UO8B 3W9DA 3GEFA 1YDPA 3F89A 3RL1A 5LDSA 2FXPA 1L0ND 1MF2H 2F53D 3VI4B 2JKJA 2YSSA 5GGVL 5CJXA 1VACA 2G2NA 2QSTA 1RUPL 5KAFH 5LB1A 3L9RA 1MJJB 3HB3B 4R83A 1AS8A 2BOCA 2QGEA 3ZTCC 4HJJL 4K73A 4AEIH 5EF1A 5AW6B 4KTDL 2E42A 5E8PB 5EWIL 3SDAA 2FWOB 5DO2D 1JYNA 2W07A 1URQD 3W2DL 1M2OA 1BVKB 1CDYA 3JWNC 3HG1B 1HCFX 2BO0A 4N2BA 3C2AL 1J8HB 1U3HA 4P07A 4RWHA 4RX4A 2J59M 3VU2A 4YHPA 1SM3H 2DQUL 4MMZB 1GZPA 2EUZA 5I23A 4LLVB 4C4KO 4GAJH 1YMHB 2DWEA 1OKEA 3KPSE 4F2FA 1RZFL 4GRLB 4JO5A 5M95B 5CKGA 1L3NA 1OM9A 3KDMA 1TNMA 5SWZB 2YQGA 2IG2L 4EN2A 1NM9A 2WIMA 1BOGA 1T83C 2VN7A 2GHWB 2XICA 3FO2A 4JCWA 4XCYB 3MRNB 5F9WC 2YKOA 4PCYA 2FQGA 1SVFA 3EFGA 3RK3E 2KLSA 5J11B 5FCSH 1UWEL 3L6FB 1CL7L 4BEIA 2XY2A 1CLZH 4FXLA 2VL4A 2N3JA 3PWPE 5I18L 1A1NA 3OAZH 4NQVB 2W91A 1N73C 2KI7B 1TVHB 3I2CL 1N5YH 1CLZL 1TVHA 3JWOL 5B39A 2XFGB 1WITA 3QWRD 4EQ3A 3L72G 2XNAA 1REIA 2BMKB 2X6AA 3LKQA 4WBAA 1HVVA 3OXRA 4JCLA 4YDKL 3B2VH 1FFQA 1PP9J 4AE0A 4U3FD 2GYSA 1M1JB 1I7UB 5AYTA 4OF6A 4WFEE 2EZ0D 4UTCA 4OV6F 1E4WL 2WSCJ 3GXDA 4HHGA 4U1IB 5IMKB 3GRGA 4FD0A 2VR5A 1NTKD 3ELAT 3F62A 2NZ9D 1NEZG 1HQRB 3BAKA 2N1TA 1JNHA 2WOBA 1YEIL 4OCNC 5DWUL 5TFSH 3S98A 4FQ1L 2MNJB 3KYAA 1GZPB 2D7TH 4Y88A 4XNXL 2W6AA 3AG3B 3H9ZA 1CXLA 1BF8A 2HLOA 3DO3A 1X79B 4OUUB 4JYCA 1U8IA 5DJYA 5C0BE 3X3GH 2DIBA 1XR8A 4ELME 3PHQA 4ZTPH 4PI2A 4ZUWA 2CPBA 1WBYA 5ID1A 1MCSA 3FWNA 2FWOA 2BC4A 3QRFM 1IAIM 2NNCA 1FIGL 2YD7A 5CILH 2NY6D 4ODUA 3D06A 4EDXB 3AXLB 2F8OA 3A6BL 4RGNB 2RAMA 3I5CA 2XG4B 3CXHJ 2PO6B 1K6QH 5DO2C 4KVPA 1G6RH 2F1BA 2RBLA 2A2QT 3CSFA 4BWUA 1KTJA 1ES0B 3ZQ9A 4C7NA 4JFYA 4XNZC 2XG5A 5IHLB 3WMQA 3OHXB 3OX8A 3ZRSA 3N1FC 4NO2A 1LO2H 1FZAA 1IC5L 4UIMA 3MOQA 4OKDA 4XB3A 5EZPA 4FHBD 4HLZH 1MJ7H 1UHVA 3SE9L 4FQ2H 2VC2L 4N6JA 3QEQB 2DWDA 2D0FA 2DWYA 2ZCHH 3IF1A 4AY0A 1X44A 4JEGB 1N3NB 1UGKA 4MJIE 4DUVA 1VQPP 1R47A 1SHXA 4XBEH 1YZZA 4IW4C 1F4WH 3QO0B 4PWJA 5FX3A 3Q1SH 4TUOB 3SE6A 2NY2B 3L74E 5G2NA 1SQBK 1FFPA 5TQ2L 1L9SA 1MVUB 3MA7B 4QNPE 4UTBL 2EP6A 3B5NA 1SP4A 4UI2A 2D4FA 4GIPD 3EFDH 2YEZB 3WHE1 5ADOH 5I16A 1USDA 4XC1H 3AM8C 4XNYL 3STZB 4K94C 3EFOA 5I0DA 3ZHDA 1QVFO 3BCCD 3EOYG 5DS1A 1K5WA 3L1OH 4X6CB 2YPVH 4OM0L 5DJXB 1FPTL 3IDGB 1KTRL 2KLVA 5D1XE 3QXTA 3UEZA 1H5BA 4GW1B 3K6NA 3T8MA 5T1KD 2GC4C 3B8SA 1A4AA 3MJ9L 2GEQA 4Z7NB 1IFMA 3WENA 3PP4L 3FQ4A 5DA4A 2V0AA 2W94A 4OBSA 4TSBH 2OYIB 2GSIB 3WS6A 4R2GC 1A6UH 1VADB 4PJDB 4EDWH 4QRPB 4KGJA 1NC4D 1CT8B 1XGPA 3FCUB 1G7IB 2B5IB 1DJZA 4NRXA 2WUBH 4F7PA 3D69B 5EC2A 3KM2A 4NDMA 1AXTL 4QRRB 4Z77A 1F02I 3T0VA 1MHEB 4K3JL 2EDQA 1OCCB 4FFTA 1UWYA 4G6AD 1T22B 5EH1A 2WSEJ 2A4CA 3UP6A 3F7KA 4FQLH 3U30B 4DEUA 1T2QL 4QAMB 1O0VA 5BS0D 1CLCA 4P5KA 2A45G 1QRND 3QPQD 3AEDC 4LLYB 4KPHH 1AXIB 1SJHA 2EDNA 4HUKB 3CG8A 5FWQA 3BEVA 3S8GB 2WXKA 3WL9B 1XIWA 2GA1A 3NFSH 1F4XH 1XGPB 1Y18A 1KV7A 2EC8A 2WCSA 1J8HD 1QFWI 3GK8L 3I6LE 5EBMB 1FNEB 1I53A 2R8SL 3ILQC 4Y1TA 3A22A 2WINA 2A1WH 3UEQA 3QG6B 1HHJB 1NPJA 4JUSA 1YA5A 4ADJA 5ESVB 5AAMA 4FERA 3KPPA 2CO7B 5TF1H 4S1SH 1ZMYA 2OMUA 1WSST 1U8LB 3KWTA 1M2VB 1OM3L 3MRGB 2D31B 4QJ3B 3WXVL 4PRHA 2HMID 1QW9A 3O2VL 1Q1JH 1SHWA 4N26A 1X9RA 4TLKA 1YQVL 1NFDF 4EKXA 5BZWA 4MJIA 4P48A 4CL7A 2X38A 3VYIA 5HI5D 3V0VB 2X4RA 5CSZA 5DRXB 1FN4A 3HE7D 4GW4B 1Z9NA 4FLQA 4LCUA 3M07A 2BVPA 1AQTA 1S7SB 2QPEB 5ADPL 4RESB 2OYHC 3NN8B 3D7PA 3TN0A 1TYRA 1MXGA 2WY3B 3QPXL 5F0PB 1Z5YD 2ZKMX 1NLDH 3WNPA 1GZQA 5E5RB 5CD5C 3PWVA 3TYYA 1KCUH 3N44B 5APUA 2NRDA 4UU9A 5D5MF 1GRWA 4NB7A 3VRLF 3ZE2F 1OB1A 5MHSD 5EO1B 4HKZH 2QSVA 4PJXE 3O8XD 4ZD3L 3T2PA 4C57C 3OZ9L 4BFKA 2XZAH 2ZVNB 1CF8H 1B9ZA 2E8YA 2GABA 2C9NY 1SVBA 3FUHA 2ESVE 2VABA 2VDNB 4JFQA 4JY4A 1ZLWK 4PG9B 1P1VA 2R1XB 2V8MA 2CUMA 2FLRT 3OF6D 3ZE0B 4Y4KA 1HQ4A 3MV7B 1CDIA 2ADFH 3ME0A 1KEMH 1MRCL 4HXBL 1MFUA 4ODVH 1BSHA 2R0LH 4JG0L 3G5ZA 3HPJA 2VGLM 1QSFB 4AH2B 3QNYB 3NJJA 4O02B 4NKDA 5AW2B 4QYOA 3S35L 5CXPA 1QMUA 2BHYA 3SKUD 4WJKB 3WNNA 2GUVA 2B1AH 2V9RA 3HCVB 1I85C 5ENWA 4XWGL 1MPAL 5ELIA 3GRWH 3GHBH 5E23A 2E59A 3MGOA 4XZUB 2VDRB 1D5RA 3BVUA 3LKRB 4JQ0D 2GFBA 2VXQH 3DI3B 5IHUL 2AERT 1MAMH 1KY6A 3FTYA 2AEOA 3IJSA 3TA3C 4AUYA 4A7SA 3X17A 5I0ZA 1DUZB 2Z7WA 4OZFA 1T03H 1ZIAA 1SXAA 5DZOA 3CHQA 3ARXA 3MRKA 2DYRB 3FQXB 1KZQA 4JGJA 3ECWA 3QEGL 4LESA 1W0VA 2F2HA 4ZUTA 1ZTXH 1ZSDB 2WWOA 3GHGA 3U82B 1X4YA 3X3FL 4IDJL 3QRBA 4MA3A 1AE6L 3ZYOA 4K23L 3OKKA 2Y6SD 5FYJH 3V6OE 3B2VL 4OTXL 4WI0B 3CTTA 1FNLA 1KYOH 3LKQB 3LPFA 2HTLC 3OXRB 4MXWH 4UM9B 5BRZB 2AC0A 3SKNA 3FCTB 4YDVA 1UOLA 1QOKA 1NSNH 1TTAA 1L4AB 2P1YA 1QATA 2Z93B 5I26A 2XFXA 3UYPA 1LEGA 2ZSWA 4NQVA 2Q7YB 5JOFB 5IMLB 1Q1JL 5TH2A 2K88A 4YTPC 4NRYB 3LQZB 5AOZA 4KX9A 5KSBE 2NY5H 2IPUG 1K85A 3PHLA 4ZBJA 2H8PD 5IZ7A 2HT2D 2DQIH 4PCTA 3HUSC 3DX2A 4MLIA 1TJHL 1Z5HA 4NKDB 1ZRTE 6PCYA 1KXHA 3PGDB 4MNQD 4X9HA 3PWJA 1O7SA 4LEOA 2J6EL 3G9VA 2P5EA 3S8FB 3CSGA 4UQCA 1KTDB 2XRAH 4IRJB 3WE1A 1RUAL 4MMZA 4S1RL 2BJML 2IV8A 3DRQB 5TD4A 1D5XB 1J5OH 5T1MA 4PJIB 4CC1A 3BIKB 3J07A 2YKPA 2ZWKA 4HK3J 4X98B 3CCJP 1RVFH 4ANWA 3V4VL 3EH2A 4M93C 3TVMC 4TXVB 4KI5C 3T4YB 3CDZA 3N43F 4HZ1A 3SGDI 1UOWA 2GK2A 4DN4L 1KILB 3VVVA 2GUOA 2C9VA 1HSAB 3T08A 1S5LX 1Q1PA 2EDXA 4CKQA 3QUMB 5CINL 4OQTA 3WUWB 2CO2A 1S5LE 4HJJH 2HKFL 4EI5C 3HBQA 4EN3C 5KS9A 4HD5A 2Y0CA 1FZBA 5CEZD 1YAZA 1HJBA 2UX7A 5H37H 3ZGHA 5CFHA 4PJ8C 1XB6A 3IXTA 5ITBL 3AREB 1TVDA 3O3BB 1F4WL 2VXQL 1L7IH 4LRNH 3HG3A 1AV1A 1ITBB 3C8HA 4M7JL 4PJCF 2ODHA 2X4RB 5CSZB 4GG6A 3GHBL 4KKBD 4KITB 2Y7QB 2B3IA 4ILDA 3SDCA 3KZIE 4OT1H 4HCGA 1M9SA 1JFQH 5K93A 3L3KA 4NENA 5HY9B 3EH1A 1KELL 4I0KA 2NW2A 4HK3N 5LXGH 4CRPA 3K1DA 3DMMB 3QIBD 4OF8A 3L75G 5CCHD 2WJ7A 3ARDA 1E2VA 1NGMB 4OW6A 1R5WB 4YGAB 5IW3A 3W68A 1NL0L 3GJEA 4MA8H 4Z0BH 1QPPA 2L5GB 3P2BA 4QR7A 4XI5C 3MLRL 2CBTA 1FU1A 4TUJB 3BUYA 2OXGB 1UD4A 4GOSA 3SODB 3QCUH 3HE6D 1A6AA 3H53A 3OSVA 5HYSA 3WIHH 5AW1B 4OD1H 4GSUA 2OYPA 1ZHKB 5D1QE 3AROA 4DO6A 1GGUA 5E6UB 1FUNA 1NAFA 3FU8A 4XPTH 2HG5A 1DEBA 1H3WM 3OGCA 4XN5A 2VLRE 4IHBA 5D7KD 3RWGB 4AW7A 1KXVC 2MKVA 3OC8A 4L2YA 1XEUA 4KNQA 1A7OL 4XMLL 4DGVH 5DTFB 4LIQL 1U8NB 3SKMB 1J5OL 1LL1A 2JI3A 3V6FA 3QWOC 2XX0A 3F7YB 2LV4A 3GMRA 4HIIB 5DJAB 4JFFD 3ZR6A 4F37F 1JPGB 4QRQA 1SFCC 5H2FE 4JN1H 5LNGA 4YHOH 2YA2A 4R2GB 4UINH 1DX7A 4BK8A 2H3NA 1UURA 3RX9A 4BSJA 2HLAB 1JXGA 3FYEB 1E28B 3OAKA 1X5HA 1GS7A 3MU3A 2YGVA 4BRYA 3RTQC 2F19H 4M1DH 3SQBA 3LXCA 4WAFA 1VAHA 1JGUH 2Z8RA 4RRPG 5HDQH 4Y16C 1MCPL 3AU0A 1UA6H 1JPTH 3NZ8B 5BJTB 5FFOA 4HQQH 3FC8A 4JO4L 4ELMF 4KNSA 1NAMB 2R44A 4WY4C 4MQTB 2P5EE 2DI9A 2J21A 2PW1A 1L5GB 1JPTL 3FK3A 2CSPA 2N0MA 1KTCA 3MA7A 4ZSOE 2M1KA 1ZT1A 4M48L 2QQQA 4WI6A 5E9DB 4HF5H 4D0CB 4WWNA 5T1DH 5EOCJ 3LH9A 1NMBH 2IMMA 4J3OD 4JZNB 3T8XB 1T2QH 2Y1ZA 1NBYA 4X4MA 5E8EA 4DP8X 2V37A 4PRIE 4ETQA 4NRZB 4O2CA 1DFXA 4QOKA 2ITEA 3DXAB 2XQBH 4YSRA 1IAOA 3HUJE 5DJ8B 5HHME 1GOFA 2DDQH 1PLGL 4LDOB 3ZZSA 3BWSA 3QDGA 3QJZA 5DS8A 1WC7A 5E79H 2GITA 5KBNC 3OKLB 4PVNA 4HIXH 1CZ8H 5CM1A 3O9WC 1JGLL 2WJ5A 4Z7AA 5E0QA 3S5LG 4D6TJ 4GXVL 4OLYH 4JZOA 3F5HA 1Z6JT 2A6KA 1UKTA 2GIYA 5BOZG 3QUZB 1J8KA 5GJTH 3MV9A 5CP3H 3RWIA 4AYMC 5C70A 1XF2A 5GGQL 1HIML 3O41A 1XXFC 4N2IA 4PJ9D 1LTJB 4L3AA 2BSTA 4XO8A 3O4OB 1KQFB 4NHCL 4ODWA 3BCDA 4MX7B 1X7QA 4QAWA 3S35X 3CFEB 3QIBA 5IG7A 1HH6B 3ULVC 1M53A 1I9RL 1MFVA 3HG1E 4YHLL 3P77B 3EO9L 5E00B 2G60L 3WMSA 5IBTL 3VGHA 1FHGA 1S78D 3N0PB 4Y5VB 2G75A 3H25A 2OARA 3AEFC 2XWJA 4N2HA 2JVUA 4A6YL 1F6FB 4JPVL 5DHVH 5DMIL 2DQFB 5IEKA 3QUYD 2LU5A 2GVYA 4FQ1H 4PEEA 3VMOA 3TNMA 1L2PA 1HESA 1UWGH 4LOVA 4NO0B 2KB7P 3KW7A 4H13B 2MOGA 4Z7VA 2QJKB 2M8XA 2UXVA 4Q6IC 3AJ7A 4Y1SA 3U48A 2ADIA 2APVA 5AAWA 4OCMC 4UYQA 4LLDB 1K73Q 4M1CD 3BVHA 5HHXH 4QRTB 4N0CC 2QZ5A 1JJUA 1LO2L 1NU1J 2ITCA 1H3UA 1TZOA 2ESVB 2V8LA 2NCEA 1H0TB 3Q8BA 3WDJA 4I1LA 5HVHC 2AJXH 1USQA 2YD5A 2BXYA 4PB0H 1PP9G 3QQXA 2XN9E 1GL4B 2CDFB 5D1ZC 4N68A 1HCYA 3DBXA 2M83A 4PJAA 5GS1B 3O4LE 4F8LA 4N2CA 2FGWL 4Y2DD 2ICWB 2DJUA 3CX2A 3ERXA 2H1LM 5DD0H 1VGEL 2F5BH 3AWEA 2BP3A 2VTFA 4FQXD 5EU6D 1G6RA 1L9MA 1F3RB 3P9WB 2DTMH 4U7MA 3RWFA 5MEQB 5CLYA 1MEXH 4A37A 4LSVH 1PJ9A 4E9TA 3CDZB 1ZJBA 4M5ZL 4JFHD 3CDGB 4I0PB 2EUWA 1CFMA 4HUCA 1RL1A 4AV0A 3BESR 4P46A 4ZW3A 2VE6B 4L8CB 3FFCD 4Z7QF 1JERA 2WVSA 5F1IA 2BNRD 2G3XA 4P2RB 2NYKA 1ECZA 2XRAL 4IRSA 4NM8L 3L75D 3ISYA 1HI6A 4DUWA 4NFBA 5FUOH 3H42L 5C0EA 3E1ZA 1R5VA 2PN5A 3D87B 2G4EA 4PWIA 4CW1B 2QGBA 3MA9L 2CXGA 2XWEA 5L7XL 2VR4A 1HEZB 3F5WB 4JM2B 1KGIA 5CR8A 4QHUA 1PU0A 4J4PA 3MV8A 3IETB 3K72A 4PCSA 1NIAA 3RNQA 1RE3A 1HAUA 3VH8G 3WIFB 4B9CA 3PUCA 5FDWB 2FHCA 3STLA 3DO7B 2OQJB 3KH4A 3AEEC 2C5DC 3MJ9H 3BDYL 4H8WH 4I87A 1EV2E 2ZYRA 2R4SH 1EX0A 3DJTA 1JK9B 3VDCA 1E40A 3P0VH 4U1JB 5DYOB 2JIXA 3WNMA 2XWXA 3QCUL 2CA4A 4W9CC 2FYUG 1IRAY 2WW8A 4PFEA 3DV6A 3OB0K 1FZGA 3DXAD 1SXBA 3H6PA 1QNZH 1E27A 1OAUH 2ZNWA 1DUYA 3SBPA 4J3UA 4Q9CA 3RWEA 2XUWA 1QI5A 3G6AA 1T83A 1LTGC 1F1DA 4EQ2A 32C2A 4OZFB 5IEKB 1KEGL 2HRLA 4OLWL 1OGPA 2PWFA 2HR3A 2VR8A 4APQC 4UZSA 4PLKD 1QSEA 5FIEA 4M6NL 5HHOE 4ODXB 1L7TH 5CF3A 5KVEE 4TV3A 3LKOB 2HN7B 2IDBA 1TJMA 4AT6B 2FO1A 1OTUC 2WPQA 3ZZLA 4GQQA 1OGAA 2ZONA 3OQRA 2X3CA 1T0OA 3WY1A 1P4UA 1X7QB 3BO8B 2BSBA 3H1ZA 5IG7B 3KJ4C 4BSVA 4E41D 4ZFFA 5BVJB 2NMSA 5A43C 1L0LD 5FO9A 5KW9H 1Z9LA 4GAGL 3FUIA 1NTDA 1QRNB 4IK6A 3P30L 3S5LB 3HTKB 5SWSA 1E9OB 3QFDA 3ZTJG 4Z8FH 1R24A 3VXME 1Z32X 2ZUQB 1U8PA 1G6RL 3RGVC 4Z7OE 5B5EE 3CFBB 3MNVA 3R8QA 4NQCD 2X4OA 4LKXB 2RCSH 2OK0L 3TF7C 3HHSA 4RX4D 3QJRB 1XL6A 1A25A 1P7KB 4R9HA 4U2ZA 3FONA 1QFWM 2FWUA 4ZUUB 4DP6X 5HYEA 1E8YA 2OFQA 4G42A 4ACTA 5DURD 1KC5H 2OMTB 4MRCA 4TVPH 4PJHB 3R4RA 1FVEB 3TTSA 1IIKA 5DA0B 1TETH 1OAYL 5CEZH 1P1ZB 1KN2L 5T1DL 1SY6H 2DB8A 2IOIA 5T3XL 2F68X 3X1GA 1TQCB 3P77A 1UWXK 5E00A 4UIKL 4L37A 4X4XB 4YSDA 2ZNXA 1OTSD 5DMKB 2HJFB 4AYFA 3WHXA 5J6HB 1N86A 5J06A 4P57A 5LGJA 3DX6B 1ZT1B 3GSNH 3HI6H 4L4TB 4PGBA 4ZS6D 5D7JB 2NY0D 1K2DB 5DRXA 1QQDB 3FQUB 3NIFB 3EG9B 1BFOA 2DM2A 3W39B 3WEXB 4IIQA 5LGKA 3QDGD 2CM6A 3LRMA 1PFOA 3PP4H 5E6IA 4B5EA 2YPKB 2KXPB 1A7RH 2D7MA 4BZ2H 4G6FD 1LTXA 4W9FC 3VXOA 3CC7P 5GS3A 1T20A 1ZHLA 4TNGA 1MZZA 4M43L 2UY7B 3AS0A 2OMUB 2Y36H 4LLQA 3UTSD 2CO7A 2K9YA 5AB0A 1WZ1H 1IAOB 5DJ8A 4OGQC 2CIIB 1LO4L 3EZ8A 3HI5L 4HA1A 1ZEAL 2WINB 1FOSE 3S35H 3O45A 5FC9A 1SQBD 1R6VA 2ZWLT 3M45A 4DVBA 1HEJC 5I75C 4OLZH 4N6RA 1RK7A 4YDLC 2Z3FA 1I7TA 4UTBA 4M6MH 2X42A 2JKVA 1U2HA 3ARFA 4PTUB 4X80L 4F7EA 3U6RB 5HDWA 1D3CA 3UJJH 3MRCB 4OQ1A 1AE6H 5CZVL 4QXGH 5FYKL 1ZDQA 2YD9A 4JQVC 3DX4A 2RH0A 3MUGA 1L9NA 1KYOD 4P2OA 3ZHFA 3CFCH 2NNAB 4E9RA 1RXLA 4I9WD 1YTZI 1IGIL 3ULVD 3TTYA 3WFZA 2R0KH 3P1VA 2E27H 3GMNB 3SQOH 1QTYT 3QZOA 5CKAA 2OMBA 3JTSA 1QUNB 5DMGC 3Q06A 4URKA 1URIA 2TRYA 2OXGA 4Y2OB 3MRQB 4NNXB 1YAIA 5B1CA 4EUPA 1ED3A 3TV3H 2EIMB 3GSNB 4YXWH 1CTNA 3GXFA 4UQBA 3QDMD 3NCJL 5C0DA 2JK5B 1MHPL 3CU1A 4BKSC 5CN3A 2OZNA 1GYAA 4G11A 4EIJA 1XCQB 4I2XB 4YX2H 2Q86A 1CK0H 4NAMA 1FZJB 1BVLB 1CDHA 1BCCJ 5IBUB 3WLBA 4NT6B 2F74A 4APQA 1EZUA 1GMEA 4OZIA 3H1KE 2WSKA 3GS4A 3N91A 1UACH 2AI0L 3O0RH 2XBTA 2DKUA 2YAMA 2WIIA 3C6LD 3NEOA 4K94H 4RZCB 3SDCB 4BFFA 1JIBA 3FRPB 3DSFH 1UH2A 3P0YL 5GZOA 3KCPA 3T1FA 5B7FA 1VQ9P 2HT4C 4XA4A 3EDDA 1TZGL 1S9YA 3ALWA 4TM9A 3VWKD 1P6FA 1MCWW 4AZ8B 3V4PL 2NUTB 5ITFB 1SPDA 3WCYA 5D2NE 1V3JA 4AQOA 4QHLB 4L75A 1QPKA 2XDHA 5E51A 2WSPA 1XDTT 2OLDA 4ZK8A 3N1MC 4DN4H 5E5MA 1SS1A 2AV1B 3IS0X 3OMAB 4P23C 4HKZB 1N2RA 4G6JH 2I69A 2ZX7A 3CFKB 3ULAB 5L4MA 3TEYA 3AE4C 3BKJL 5IB1A 3NXSA 1UA6L 5C1MB 2QJKC 2AGJL 1JHLL 3HFFA 4JDVB 4X7DC 3DOIA 5D7HA 3RGHA 2A7BA 4HT1L 4AEHH 5IUSA 2E7CA 1AP2A 2HFFB 4NBYB 2XG5B 1CFSA 3H7BA 4HP5A 3CZFB 4JN2A 3NA9L 3WAKA 3KVQA 1QFWL 3FT0A 2IGFL 3OLIA 5HI4D 5D70H 3RVWC 5IHWA 5IY5B 2QV2A 3CXDL 4X50A 1FIGH 2IQAA 3N40F 2IQAB 5CHNB 1J5DA 3TBTA 1GSKA 4U31A 1CGVA 2CPCA 2BIPA 2ADGB 4NN7C 1PF3A 2BSEA 5FS5A 3BSHA 4EJ1C 1A6ZA 3BPOC 3ILQD 3GS0A 3PGCB 4NWUL 1DVQA 1NTME 1F58H 1WD8A 3CE1A 5HDOA 5JHLL 3TJHD 1JPFB 4P46B 4UBDC 3FH7A 1JZEA 4MSWB 1A4KB 3RVVC 5CWSB 1FZEA 2IH1A 3QZLA 3WY2A 3OR6B 1TJGL 3NEXA 4L29A 2UY6B 2Z93A 35C8H 1OCWL 2VUKA 1MHCB 1AH1A 2VMEA 3S4SG 1JD7A 2DQHH 4HHAA 5SWZD 1G7PA 5E5MB 4A55A 3OGOE 4PJDF 3TESA 1RIHH 2WSSH 4UV7L 5HPOA 2OYOA 3O6MH 4JFXB 1K8DB 4GP8B 4G8GB 3O9WB 1VQ7P 3EBIA 1WWAX 3TBVB 3RVTC 2ADGA 3T3MB 1HGVA 4H8WC 3BVXA 4G3YL 1XB8A 2PR4H 2WPGA 4GBXA 4WKZA 1VGKB 5AW8B 5AVRB 4K5LA 3H7BB 3VD3A 2CRYA 5F7EL 3GPSA 2GUYA 5TDOA 3CXHI 5D2LB 3T6QC 5EN2B 4LARH 3F8UB 4KZDL 4R4NC 2VW4A 2LXCB 3MTRA 4J39A 3WLBB 2AXHA 3R19A 4R0LA 5JOFA 5KYYB 2XQ0A 3TXAA 1Q72L 4GEIA 4JZJB 3INUH 3L48A 1JFHA 2OP4H 3RLSA 2XN9A 3CFKA 2EABA 4B0MB 3SGKC 5I76B 1AQKL 3CMEP 4MQ7A 4A7PA 2FHBA 2VLLB 4KJYA 1UJ3C 3E3QC 2FT8A 2HAZA 2EIJB 1KACB 4A67A 1CG9A 4P4RA 2ZTBA 3A6OA 4KXZI 3AXHA 2PCPB 1BX2A 5FOBA 3TBYB 5B1KA 5ES4B 2N1KA 2CHZA 3TBWA 2HKFH 3RIAK 4GDOA 3EH5B 1THCA 4OM1H 5ICZA 5KVMC 3BWAB 5AL0A 5KVEL 1XAUA 2Y4SA 1S7TB 4KRNA 4WFHD 3GXUB 4GRLD 5CMAB 2AABH 3LDBC 3VD5A 2VXSL 5FB8B 3C5ZD 3WN6A 4POUB 4JKMA 4YFEA 4BFRA 3T97B 5IW1A 1AKPA 1INDH 2FX8H 4I4WA 3O41B 2AABL 1E4XL 3GRWA 1XO8A 1MJJA 5HVHB 1G2CB 1D5ZB 1U8KA 2NY2D 2P43B 3JWDH 4GINA 5GZOC 2K3HA 1KB5H 4Z7UA 4CDHA 3U1SH 2R0ZL 3MRCA 2PWDA 5ENWB 1BVLA 1DQKA 1RSYA 5J6SA 4HSCX 2DF3A 4L0PB 2FDBP 1G94A 1S7SA 1EZVG 3I9GH 4WVRA 2YMXL 4KUZL 1CDUA 3HUJF 4LMQI 2WV3A 4MD5B 5E1IA 1E4JA 4RMRA 4U0RB 4IBWA 2Q6WB 5I8CB 4PLKC 4NC1C 1I9IH 3D6GA 5KG9A 5E4IA 5KLVK 1BG9A 3N55A 5LVEA 1IM3B 4I5BA 5HGHB 25C8L 3VTMA 1Z9MA 2C7FA 1X4ZA 2FCBA 4GQ9L 2A1WL 4X4ZA 1O6TA 5DI8A 2QJYB 5ANMB 1GGYA 1KFGA 4OFPA 3SDCD 2QQKH 4EI5A 3BAYA 4WWPA 1DVZA 3EO0B 1EK3A 3QJSB 1IGJA 2P7TB 2EILB 2P58A 2V4LA 3TF4A 3NZ8A 5BJTA 2XXFA 3ARSA 2ED6A 3S37L 3WL9A 5FEBA 4WTXA 4E36A 3M1BB 5H2BB 1JY2O 4O00A 1OWAA 3MPCA 2IBZG 4NO3A 4RWYL 3B9KC 3U4EB 1BF2A 3HC2A 3TN0D 2QE7H 2XKMA 3LD8C 3EGSA 1RJZB 3FQWA 1ID5I 4LKCA 3LZRA 5E6RB 5C09D 2L7EA 3OZLA 3NJNA 4X6CE 3LSOA 5CZXC 3PLNA 3L72D 3UPAA 3FONB 1QP1A 4LSTH 2C3XA 4YDJA 2BS9A 3T2OA 4XAWL 2Z7UA 3CZJA 4R4MA 3FOMB 3TP4A 3GIZL 1KFNA 2KMWA 3L45A 1HF9A 3CMAP 5MI0B 3ATFA 4MS8C 3RAJL 1Q90D 4HU8A 1SQVE 1JGIA 3IGAB 5HYJE 1DL7L 2WVVA 2Q10A 4UOJA 2ZOLA 2IDTA 1FNEA 1HH9A 5C39A 1EXJA 1QRNA 1EERB 2WP3O 1W72L 4KXAA 2VLKD 4YDLB 1JCDA 2W83C 2EVFA 2EIKB 5LGJB 1NWOA 2ZX8A 4GW1A 4RFEB 1XIWD 2WQAA 4RDBA 4XHQA 5I19H 2FB4L 1K9TA 4JO1H 5BPPA 1PQZB 1WWWX 1GGCL 1Q38A 5AUMA 4X6EA 4LDEB 3KYQA 1HE7A 1WDAA 2EIZA 2VM4A 1OXYA 3WLWC 4B9JA 4ZNCD 5E4OA 3CLEL 1RK0B 5D1ZD 3G6AB 3SGKA 1WHPA 2W60A 4PW9A 2WUBL 4ELKA 3QEGH 4IOIA 4N90D 5KTBA 1ZVHA 4XP4L 3DWTA 1N64L 3VFVA 3ESPA 1IVLA 2YKLL 2YC1A 2I7OA 5APSA 2I24N 3SY6A 4MJ4A 1U8PB 3GZOA 3M1OA 3FO9A 2Y2YA 3SEPA 4OLYL 4PJFA 2VJ8A 3FXIC 5HHNA 1DJXA 4FQIL 3MBWA 1OP9A 5F6IC 2YKQA 3FMGL 3AE3C 4IHOA 4J8QA 4ZFFB 4J3XA 3VI3B 3DJSA 4F8TA 4WEEA 3V0HA 1AFVH 1YMMD 4I0CC 3FULA 5IJBC 4C8XA 4JDEA 3E80A 1LNQA 2X87A 4HBQA 3JWNG 1A3LL 1KILC 3BP4A 3EFOB 2J1WA 3MV9E 4PY7B 4TNFA 2CA3A 3VFSB 1SOSA 4HJSA 1SUJA 5ERWA 1NCBH 3IMWA 5F0LB 2VDPB 3AXLA 4GO6B 1WGVA 3DROB 4ZT1A 5BS0B 4FJZA 4OZGE 4AXWA 3D2UA 1CCZA 2JKWA 4R96B 4IBQA 1GYUA 4OKVB 3PJNA 4IRSB 2YOAA 4YHLH 3NCBB 4X98A 4QOKE 1QA9B 3CGTA 2JE8A 5DD3L 1UYWH 4AQEA 1K05A 1NKNA 4FCAA 1FAIH 4OUUA 4QTHA 3MRFB 3SDYL 3BYTA 5LG6A 4KK5C 1T1ZA 4KPHL 3QEQA 3P73A 4Z6AT 1YYLL 3WN5C 4HH9A 1HTLC 3V4LA 2HPCA 2X6CA 3NRFA 4S1RH 3RWFB 3CHRA 5JYMA 5DHVB 1FG9C 5KYUB 1XD0A 5CN1A 4N0UA 4NBZB 3UAFA 4AEEA 4JF7A 1K5NA 1LO3L 2Y6TE 2ZWSA 4QXTB 2QSQA 3BKMH 3H0TA 1YY8B 1I3VA 1RFDH 2NLJB 2YOCA 3F5WA 4JM2A 5C9KA 1WIPA 2X2JA 3UC0H 3WGVB 2YRZA 5IMLA 3QXAA 3E9UA 2H2SD 1J0HA 2I9LB 5D72L 3UJTH 1JHKL 4M02A 4LHQB 1TUPA 3OPZL 4PY8J 2APWA 4M7ZC 4QRTA 5K39A 3Q7JA 3T0EA 1F42A 3MOAH 3SBWC 4B5ZA 4Z7QB 4RMWA 1JF6A 4I18A 2KBGA 4ZW8A 3M86A 3V4PA 5C7ZA 1Y1DA 3IJ8A 5AOLA 1BXXA 4ZMVA 1KFMA 3F3HA 3LRHA 2OTJP 3KLLA 5BVPL 2Q5BA 2YAPA 3RTQD 4U1SA 1YMHA 3BAIA 2DLFL 2YWZA 4LLVA 3SDXE 4GSRA 1ETZA 3RP1A 3HR5B 4LMQE 3LKRA 2WVTA 2X0VA 1TF4A 5D1QA 3EZJB 5C6PB 5EU4A 3WN5B 1M6OA 1EEYA 3D39D 4WI2A 4XGZA 3SDAC 1KELH 3SGJA 3WNLA 3JTBA 5BCAA 1MCHA 1T4KA 2GCYA 5K39B 1MAML 4GRWH 4MB3A 4L8DB 3GUTA 2GSGA 2WMMA 3VSVA 1AVAA 1D7CA 3EIFA 1IKNA 3NK3A 4RSVA 5F1SA 4A2GA 4ISVB 4ZUVB 1ZLEA 2VAJA 4DAGL 4GAYB 4C7RA 3KEHA 3O8XA 3CFJB 5IIEA 1T6VN 5DRNA 2FUTA 3NT0A 5C08B 1FC2C 3NTCL 5KVDH 1BVNT 15C8L 3N9GH 3Q13A 1HZLA 4OLUH 4G6KH 3CZKA 3HE5A 1IQWH 1CPUA 3KBFA 3QUYC 1OVRA 4NUPA 1IQWL 1S7QB 3QFJA 1PS3A 2GJ6B 3NJIA 1ZCRA 3GBLA 1T2KC 5DVOA 1BQKA 3UBXG 1IZKA 1ZDSA 3VG0H 5J12C 3H9SB 4I7ZC 5CILL 1T0MA 1F2QA 4DGYH 5D55A 1URQC 5CUSL 1PAMA 4LSPL 1EJFA 4A63A 4M8QB 4HWEL 2LFEA 2EXTA 3TCTA 4XPHH 2K37A 4N2DA 2WQXA 2VO5A 1BGYE 2G4GA 1L7TL 3CFEA 1NBQA 3D05A 3DMMD 2UUDH 3QIBB 4JE0A 4O5LL 4ODWB 4OZHA 4QXGL 4WI8A 1P7QB 5J1SC 4Q6IB 3CMOH 3D25A 1JN6A 5TISE 2BOCB 5IGXH 4QXWA 1OCRB 1IGMH 3HIZA 5GSVA 2X2HA 4OD3H 5JIKA 5B8CA 2PKDA 3UAAA 2GJZB 2N1TC 3D3VA 3NQKA 2IWFA 5C0CB 2Q76B 1MN4A 1T1YB 2DQEL 2YZ1A 3QIWC 4WNQA 4PJXA 4WW2A 5GGUA 5IJCC 3K71B 1I1YB 3QI9C 4GAFB 1N2DC 4AYGA 1ACXA 3ROLA 3BKCL 4NPYA 2QMJA 1KNOA 3N42F 1NEZB 3MRGA 5HYSG 2WTPA 1KV4A 2IH3B 1PZBA 4LHJB 4NKOB 4S1SL 4D9RE 1X5IA 4NQXA 3SWFA 4X7FC 2I9TB 3WXVH 2E75C 4YXDC 2CKBB 3F6JA 2Z91A 4JFEB 1AI1H 4UT9H 2GY7B 4RZKA 1A1MB 1IM9B 1B0RA 1VFUA 4K7FA 1CK0L 4GSDL 2EIBA 3ESVF 1E4KC 1YEKL 5EBMA 4E5XG 2DLGA 3WI9A 3ZUNC 2FQEA 2G9HB 1F1GA 1TZIA 1ZP0C 1G7JA 2H6UA 4K8RH 2XVKA 2YEQA 3H32A 3GF8A 3CCHB 2QJYC 3DURA 5L6YH 3HD7B 1TQWA 5A40E 1JTTA 2O01J 4EAEA 1VQ8P 1FZMA 2K9FB 3ML9A 4Z7NE 2XX1A 3QT2A 4F7TB 1BFVH 1HGZA 4IEFA 2FSEB 1DANT 4KAQL 1E9PB 1X9VA 1FZKA 1KN2H 1IGTA 1MW2A 4XP5H 3SCMC 1NCWL 4QWWC 5E2VH 2XC8A 4KAQH 3TWYA 3D12B 3MRDA 3DIFB 4A38A 4BRYB 2B16A 4YO0A 1CS6A 2RALA 1CQKA 2ZUXA 1C08B 1G0YR 5ANHA 1CT8A 3WNJA 1OOWA 4YHML 2P5WD 3CZGA 4FXGC 4K3JH 5JHBA 3IVKB 4MMXA 3E6HA 3RU8H 3QI9B 2X4QA 3HD7A 2HFED 1BM3L 1J18A 4JFTA 3RIFK 4HOMA 1KG0A 4JE4B 4EZMA 4NBXB 4Y9FA 4KQ3L 4LAJH 3F7YA 4TTDD 4FA7B 2YUWA 1KB5A 4KJPC 2BOBB 3V6ZA 4IYKA 3D3VE 3H1HE 4N8PA 2MTAA 3L4UA 5JW4M 3BUTA 3T1WA 1U3YA 3U0PA 3F7VA 5C0BA 1CYWA 3ARGD 4OI8A 2ILLA 3L3OA 4PD4I 3N6YA 3U46A 3CFNA 4GS7B 5KVGE 5C0IA 2OBGA 2XXCB 5JR1L 3U7AA 5EF3A 1VQMP 2W6JH 1GL2D 2TAAA 3P3RA 2UZYB 4P9MH 5DHEA 4M1GH 1PKQB 2XQYK 4JFHE 3GNMH 1AQDB 4XVJH 1ZK9A 2FR4B 5IROC 5IGXL 1N59A 2XIIA 4IL6E 2J43A 2VZOA 3KD4A 4FXKB 5I1JH 4PGCA 3ZSTA 3BVWA 4IIZA 1PIGA 4ZFGH 1ODAA 2V7HB 4JK0D 1X7SA 2AF2A 3D25B 1OAQH 3K6SA 3QFJE 4LSRH 4ODBD 1EFQA 4ZODA 5C8JB 1JWMB 4JO1L 1LT9B 3M9BA 3AMKA 1KMGA 3MROA 4FXGB 4J3OF 4Z7OF 3IMVA 1ZN5A 5IOKA 4XBMA 4G5ZL 5K59E 1IL1A 4GRLC 4X7EC 2J56A 4JFVA 2KZIA 5MP6H 1R0AL 4KKPA 5EPMA 2BP8A 1G6VK 5E1QA 2WBJC 2WPRA 1DQJA 5ESAB 3RQ3A 2HZHA 4V1DE 1S7QA 3BKYH 2FEJA 4Z3IA 1KZUB 2EDMA 5KWYC 2QM7A 3QAZC 4WK2B 4O02H 3ZK0A 5IWLC 2IWKA 1GW6A 1L6PA 4ZUWB 1COBA 3DVGB 3JVGA 1XR8B 2OL3B 1SYSB 4FNRA 1RUKH 4ZQKB 4N78D 3A4DA 4AQ8A 5HI3D 1LJMA 3KZ8A 2RGSA 2J2ZB 1AJ7H 1I8LA 4H2AA 4LSTL 1MFBH 4NZRL 3ZKSD 2Q3ZA 5DU7A 3PFUA 4HULB 5K9OA 2C7UA 4HWBH 2GUOB 1J0YA 1NCWH 2Q5UA 1UB6A 3INOA 4ZXBB 5IESL 3P8MC 2XTLA 1DBKL 4I3SL 3VE0A 1BFTA 3HC0B 1MG2C 1R3IL 5DZJA 1JUNA 1J88A 1MDTA 2GB2A 2NY4C 4KXDA 4R7VA 4WFFD 3USSA 1HKFA 3QHZL 5I6XB 1KB9H 3TH2T 4Z5RB 5DF0A 3KGTA 3TN0C 1PSKH 1QBBA 1YEGL 3RE0A 5BV7H 4DP4X 3PAVA 4PSRA 1MNNA 1QTPA 4HUWB 1V7NH 4TSCH 2X1XR 5EU5B 4DFHA 2B8OT 2G3NA 4W68A 3EYSH 3SO3C 2VDQH 4Q58C 4J3VA 2YMKA 5FYLH 2AQPA 4P3WA 4RFNB 2DLIA 5KKZB 2BNUA 1HKLL 4R0LB 3NCYS 1Z0NA 1SN5A 1YNLL 2PTTB 5I30H 2PTTA 4HLZG 1PG7H 3J8F7 3KL0A 1AIZA 3L16A 3IJYB 1LK3L 5CO1A 2VLKA 4K8RD 5I0VA 2IZ0A 2XWTA 4PS7A 2PWHA 4RBPH 1NBZA 3QUXC 2ZXXA 1ACZA 2JB6A 1TQCC 1S9KD 4XN2A 4HUVA 3D30A 3GK8H 3ILPB 4GY4A 2NOYA 4X0KA 4HUWA 5D71H 1XD1A 4WSKA 1RFDL 2WGNB 4XVTH 1QL2A 3HPLA 1CYGA 4U7JA 5T1KA 1C1EL 1E5UI 3IU4L 4NEHB 4HYTB 3PWUB 1O6SA 5FW6A 1RIHL 3FHEA 4UV7H 1YEHH 4GMSH 4J1UA 1HL4A 1W0VB 4ZUTB 2FJGB 3SPIA 4EBQL 4DCQA 4IS6A 3NCMA 4G6AC 5D1XA 2GBTA 2WLKA 2HFEB 1TJGH 2G60H 4GRWE 1KC5L 3DYPA 1HDMA 1G9NC 3ISWA 3CVHL 1Z1WA 3K6SB 1A4KA 4AWJC 3DYMA 1FFOB 1BXVA 1VFBB 1J8RA 3DVIA 3MGOB 3QDGE 1M8OB 2CLZA 4RMUA 2DMCA 4W6XB 2DEYX 5F9OL 2X9YA 1JZFA 3BRFA 2UWEA 1NLBL 1EDHA 2DTML 3HKFA 1DN2A 1N0LB 1ADQH 4QO1B 4IMKA 3G9AB 4UT9L 1DJYA 5ACLA 1PGOA 1Q94B 3DUUA 5I5IA 5SWQB 2QEJA 4PJFE 1DQJB 4FI8A 5ESAA 1W8NA 2R1YA 2RQEA 1YEKH 4NAJA 5JHLA 4PWGA 3IFPA 2NXYD 4N2MA 4YFDB 3W0WB 4YHYC 4A04A 4R5VA 4DP1X 5D6CA 4F2EA 3CPWO 1U95B 3UO1L 3GHEL 3NP3A 4G7QB 1NGQL 2H41A 2IBGA 3VYNA 4PJ6A 5FV2A 4RAHA 3GSQA 4W1TA 2EJ1A 3RA7H 3H1JJ 3BLKA 2Q86B 3RWJA 3N04A 1LO0L 3ECVA 1EHLL 5DRWB 3BKCH 4S1QH 4XH2B 4JHBA 3G4SP 1OAZL 5EMYA 4ENED 4LRNL 1RZ7H 2KLRA 4TTDC 2Z64C 4WUUA 1PKOA 3ZMEA 3VXUB 2AQSA 5DVLA 2NX5D 5F88B 1NC2A 4DP9X 2Z4EA 1E4XH 1NDGA 2VW6A 4GBXC 3L73D 1WGOA 1AC0A 2VN3A 4IKIA 1H3PH 4M7KH 2J55A 4MAYC 4FG6C 4YK4B 5DLMH 4Y2NA 1GGCH 5KVFH 5T1LD 5C6WH 2K8MA 2BNQB 1SMAA 3QEHA 1CFQB 1UB5A 1W5CE 2VC2B 1WG3A 4GW4A 4KTYA 2BEZF 1H8AA 4PJCA 4WDIA 5AUMB 2HH0H 2CGRH 1X5MA 2FX7L 2K3RA 3RK2D 3WFHA 2P24B 4ZO6A 3QIWB 2JFCA 1B2WL 3RHWF 3G6JB 3D9AH 3WJJC 3H1LD 2ICCA 1AQ8A 5CZVH 4HOXA 2AQQA 1FE6A 2NSMA 4L4TD 1YPZF 4PJ7E 4ZMDA 1BEYH 4HMDA 4KI5D 1QBAA 3MBED 4F58L 3FQTA 4EKJA 3OBAA 4XPGL 4M3KB 3OKNA 1L9PA 2X4QB 4KUCD 2XOTA 5E95B 2IPKA 4X4YA 4X4YB 5F7HA 1JF1A 1HJBC 3GQFA 1LGHB 4OFYD 4YNYA 3V4UL 3X1EA 5ISZB 2ID5A 5CZXD 5J7CC 4Z23A 3PNWA 4MXVE 1OW8A 2UY7A 1AGCA 5IOPA 3S36L 5FOJA 1YI2P 5IEHB 4G8AC 3RVWD 2E75D 2V2XB 2AJUL 2WNXA 3ARQA 3A0OA 3QARA 3O81A 4P5KB 3VRIA 5G4OA 1NMAH 4JFUA 2GJZA 3D3VB 1G9HA 1RJZA 2BP0A 4GBXD 1U4EA 4C58B 1W2EA 1UH3A 3SDAD 4EMZA 1TQBC 3RUGA 4UQAA 4LHUG 4ZMPA 4HPOL 7CGTA 2NNRA 4R4LA 2JF1A 1GJUA 5HYJB 4KFZC 1F3DJ 2DM4A 3RZCD 4HCIA 5F0MB 3FUNA 2F18A 1GGBH 4HUMB 4PG2C 3SOBH 1EC5A 4XCNA 4RGOL 4DGUA 1MH5B 2IV9A 3KYKH 3QO0A 4LCWB 1SQXD 3RA7L 1I8IA 4HWEH 3LPGA 1B0RB 4HGKC 1JGVL 4X42A 1WVZA 4XPFH 4BFEA 5BQ7B 4G1EA 1LWJA 4I77H 4RETB 4G70B 5GRYA 5HHXL 3CC4P 1H5BB 2Z6FA 3CXFA 2WK2A 3QXVA 3VA6A 2HODB 5IVOA 2BIMA 4DPBX 1W0WB 1RY3A 3Q2LA 4OCXL 3ZHKA 5LQBH 2XZZA 1HHIA 3KYOA 2VQTA 2MCG1 4OB5L 3RL2A 1KXQE 3WEXA 5F7LB 3EJYD 4U2YA 4XRCB 1EUUA 1QFWH 4TQIA 4ORZC 5ETUB 4H0LC 3D2TA 5DEFA 4XCEB 2QGDA 3B3IA 2O6PA 2MH4A 1SMDA 3BP7B 2YGOA 3N1QC 4JQIA 3AXIA 1U8CB 3LN9A 2OW6A 2K1MA 4AOFA 3CLEH 3QQ3B 5J13C 4YDNA 1DJGA 1BOYA 4ZTOH 4LEXH 1FC2D 3PHQB 5DMKA 3C5ZC 1T4KB 3SPVA 3GUTB 4L37B 5AVUB 5H8DA 2RFXB 3FT4B 5CEZL 1IFPA 4LPCA 3VD7A 4YSQA 3MV8D 5CBAB 5HSFA 3K6OA 3OXSB 2YWYA 4YUEL 3TH3T 5KAIE 3RTQA 4DFIA 3AFLA 4HZAA 3LH8A 5EO9A 2EUXA 4ZUUA 2F7OA 4HV8B 4XOCA 5LBGA 1ZA3B 3ZL1A 1BJ1J 4KK9D 2PYED 5AWNH 3SDXF 4X7TB 3U7YL 1MCFA 1WTLA 3FT9A 4LVHB 5FV1L 3ZDYE 4APQD 7FABL 3WXWH 2BNRA 1WV7T 4FFZH 5MENB 3WTVA 5JTWA 3BGMB 3CC5B 3P0GB 2JIXD 4EO5A 2NY1B 1NINA 4C4KT 4PV9A 3T0ED 1EZVD 2JQMA 4YPGB 4NJAH 1EHAA 3N43B 4M00A 4MQ7B 1PDKA 5SWSB 1WT5C 3UERA 1INQB 1JV5B 2NCMA 2VDNL 4Z3FA 1EXHA 3R18A 4ZUVA 3V4WA 1D9KC 5AW5B 2AXGA 2VLKB 1QNIA 4M9PA 1AFVL 5AB9A 4TPRH 1VESA 3LNHA 2DLTA 1ZMEC 2MJZA 3UIAA 1UXWA 2NSQA 3EYSL 5A2CA 2BFVL 2GBUA 2ED9A 3GMQA 3MJGX 4H0LB 2BVQB 5DJZA 5EU4B 3VGEA 4MD4A 2GJ6E 4IOSA 3CWBG 4RMVA 4F9LC 5D93C 5JPMA 1URLA 4Y16D 4ONHA 1KPRA 4EE2A 4XP1H 5LHDA 3K2UH 4IU3B 2WN3A 1UCBL 3LRSA 2IANE 3ZHLA 4U1KB 4JFDD 5CEXA 1HUCA 1MI5E 3PIQB 1N6QL 4FHJA 4HX1B 2ZVOB 3MLSH 5D7KE 4JFZL 4Q9QL 4HWBL 4MN4C 1IGIH 1H3XA 4ZTEA 1A4JB 1LP9A 4ZS6C 3PCYA 4A66A 1QR1B 4V2BA 1S9XA 4M1DL 1W72H 4YGVB 3ZDWA 2OMWA 4CA4A 5C7XH 1G7HA 4JN1L 1OZHA 1C9SA 5K9OB 2VH5L 2BHUA 2ZYHA 5CWSA 2VWEC 3Q8EA 1WP6A 1WYJA 3L9YA 1U8HB 5IREA 4TOYH 5D72H 3Q01A 3DJRA 3UABA 3UJTL 5KBKA 1Y6MR 2EIDA 4OIIL 1HWGB 4PH8A 3F12B 3V9FA 4MMYB 1I1AB 4KMLB 5LBVA 4CUCA 2DWXA 4P5RA 4ZW5A 2WBJD 4YIQB 2R0LL 1Y9BA 2X89A 4JG0H 4QUOA 2CDFA 5L8JB 2DRUA 4M62L 1AQHA 3EJCA 3OG6B 3QWRA 2B08A 1ZVYA 4MKMA 1YC8A 3AACA 2Z0UA 3VWJC 4CW1A 3CSPA 2DQJH 1LNUB 3HVNA 3MJWA 4P5MA 1PD1A 1WRGA 3TU6A 4MHHG 2AEIT 2CBPA 4JBZA 3B5NC 1HI6B 2IMNA 2J88L 3SZKC 1R0AH 2KZKA 2AJVL 1FZCC 3KNBB 3G08B 4QTHB 3MCG1 3KJ6L 4XC1L 1FO0A 1W80A 4JY5H 2I85A 4DQOL 1A7NH 3AWFA 4AGOA 3LPPA 3PJSA 2FFDC 4IJ3C 2N59A 4N0CD 1FNSH 1AO7E 2E43A 4UB8H 2EXWD 4XB8A 1BLIA 1XSKA 3LRSB 1OZUA 5IVXE 2WWMC 2OR7A 1A65A 5IQ9A 5L0QC 4NO5B 1VQ4P 2VQ4A 1ZXGA 3L5XH 2HVKA 1MQKH 1N67A 3RBZA 2ICWA 3VG9C 4NNYA 1A4BA 3ZQWA 2Y7NA 5KEZA 3HTLX 4LPWA 2V2TB 2ISDA 2AK1L 5EUKA 2YSTA 2OMXB 3IJHA 3MOBH 4P9HH 6FABH 4M6AA 3N85H 2XTSA 5IW6A 2KZJA 4ANXA 1M7DB 3L3OB 1SQVD 3GF3A 1SLQA 4GRWB 4GMTH 5BU8B 2FZ3A 4JR9L 1N4XH 4KJPD 3K8LA 1S7VA 1PDKB 3SBWA 3VCLA 2YUZA 4OJYA 4LL1A 3V6BR 3E1RA 4LXFA 1BGYJ 1C5DB 2NR6D 5C07E 2CG9X 3FTUA 3DX9B 4XMKH 5DD6A 4KZEL 4K2UL 1GZLA 4WW2F 3K5SA 4K71B 1VQKP 2OSLB 1MCOL 4QI3A 1F97A 2UZXA 1ZA3A 3HZVA 3O6LH 1OAXH 1I8KA 3BP6B 2PYFA 1M56D 4JJHA 3SPCA 5DMIH 2AANA 2GITB 3L73G 5GRUH 4ASWA 1MWAH 3FUJA 3K4DA 3UBHA 3RTQB 3DIDA 5IT2H 3IFMA 2QV4A 3LCYA 1BBDL 4QHKJ 3O9WD 5IBLC 4TLUA 3U9WA 1K3ZA 4QRPD 2H45A 1H8SA 1IKNC 2HA1A 3ABVC 1QUNA 2BIOA 1S5HB 3H1JD 1ZPLA 5C07A 1AS7A 3G5VA 4JQIH 2CO4A 3EJYC 1ZXKA 1E9PA 1FZKB 2DQTL 1L9RA 2YAOA 4AYSA 1RKRA 1X9QA 3RNKB 1U8JA 3S36H 4IRZL 5KSBF 4XOBA 3IRCA 4WHTA 4WO4B 1RF1B 4U4BA 3SPHA 4PJ0E 1ZR2A 3COOA 2ARJQ 1KENL 3RL0C 3HI1A 2VZVA 3VFOB 1YPZA 3WFDH 2JCCE 3CX5E 3C8VA 4KHTH 1MJ8L 1PZ2A 5D70L 2ZQKA 4W81A 1VCAA 2HUHA 2NT1A 4HH8A 1KGCD 1M1XB 3CHPA 4YEEA 4RJTA 3B3BA 4Y99B 2EYTB 3TNNA 3ETSA 3OWRA 4ZFOA 3IJ7A 2PTVA 2TRHA 3IYLW 4OZIE 3FZUC 1AI1L 1FORL 4JFDB 4IBUA 4TMPA 1MFEL 3FO1A 1FGVL 3REWA 4ZMZA 3NIFF 3FQNB 5LUMA 2E3VA 4MS6A 1IC7L 4PJGB 3BWUF 3SDDB 2XKNA 3OJVC 1LO5B 1XH2A 4NYLB 4AMKL 4KI1A 3N42B 1Q9KA 4DEWA 5D8JH 1ONQA 1GJWA 3FFCE 3N1GC 2AEPH 4YHZH 1ZW0A 5JIQA 4H1LA 3P9LB 4PGDB 1ZAGA 3H42H 1YEGH 4H8UA 3RWDA 5GS0D 4GUPB 2LOEA 3NIGF 3IDNA 1GS8A 3T97A 2VKWA 3FBQA 3JZYA 3TT1H 1MWAB 3VXPB 5KVGH 4X2UA 2Y3AA 2VXSH 4KWUA 1NU1E 1RMFH 2E56A 3V5HA 3EYVA 5FECB 3WEOA 4O58L 5TPWL 3LYRA 1ROCA 1GIGH 4GQ9H 1UYWL 5CD3A 3QUHA 4WO4C 4C56B 3VXMA 2ZP9A 4ZMLA 1FZCA 4FE9A 5KYNA 1SDYA 4R90H 2UZIH 3GRWL 4GRWF 4MDJA 4MJ6A 4DGYL 1QKZL 1YHQP 3HE6C 2CD0A 4U1LB 2VERN 1LWHA 5CR1A 2G5BA 1J1DC 3M46A 3QJHA 4F93B 1H8NA 4KK6C 5CCGE 1CSBA 3GMRB 3QJVB 5GSRA 4DIXA 4UT6H 1N19A 4M8VA 2OP4L 3N44F 4JFPB 2QSIA 4B41A 2MOVA 5DJDB 3UAEA 1SNRA 1DE4A 1NQBA 1OE3A 1B2WH 1X5AA 5HI4C 1DJHA 3AE6C 2I07A 1SQQE 4JKPL 3MRMA 2BCCD 3SGEH 4M3LA 1K9MQ 3T09A 3MKKA 2DQGL 4WY7H 3H4FA 2LFGA 2Y1YA 5D1ZB 2XTJC 5D1ZI 1QBML 1SXSA 3NPSB 4RDQF 5AYQA 1PLBA 3QQDA 3OJDB 3B83A 4LCVA 3KGUA 5CJ0A 3CVHH 4KRMB 1IU1A 4M6NH 1AGBB 2A9ML 3EJUA 1M6OB 3L5IA 3ZDZB 5DEZA 2P10A 2ZKHL 1UM5L 4W9HC 1BM7A 4H0IA 2VW7A 3H1HJ 3GO1H 4E41B 2WYZA 1XZ0A 3L70G 4KKZA 5BO1H 4WUUB 3HBZA 4B0MM 3WEBA 2WXNA 5IJVA 1FNHA 1F5WA 4NO5A 2G8YA 4Q9BA 2YMOA 4E41E 3WMPA 5BVPH 3DSFL 1U7MA 2YFNA 1BPVA 2BFGA 2FYUE 3JQOB 4B3EA 2DJSA 3L3JB 4EI5D 5JIPA 1QEWA 4FQCL 2HMIC 2IH1B 3NFPA 3I9IA 1ZE3C 3SE8L 4WY4D 5DEGA 5DK2A 5I74B 1LTIC 2EE2A 1QFOA 3FTSA 3U6XA 5I8OL 4RIRA 4TLSA 5EBWB 8FABB 4U6TA 3K91A 4JPZB 2QA4P 1J5HA 1OGTA 4XBPA 5F7EH 1VQLP 4MJ5A 4P3CL 3AQDA 2F1AA 2X88A 3O3AA 4H88L 1UM6L 2WXLA 4NQDD 3TBSB 4AUWA 4BSWB 4DPAX 4UTAL 4TL4A 3TIDA 4PJFF 2K6YA 3S5ZA 3GHGC 3UAJA 1CBVL 1JZ5A 2DD8H 3HE4A 1OSZA 1YSOA 3FSWA 3MNDA 5B5EH 4XP4H 1RZ8A 4G6KL 1R3LA 3V9CA 5IQMA 5TISH 4ALAH 4HIJB 3RK2C 1YVLA 3CZFA 4ZAKD 4NHUB 5B38A 2DWTA 1OW0A 4CN1A 1UZGA 3G3LA 4MCZB 1SLWA 4ZDHA 1SJEB 5KJ7E 1AJYA 4OIIH 2NY0B 1FFOA 2LLGA 2DJ4A 2AQTA 3S34L 3MLUH 3V9EA 3KL5A 4JREC 3ORJA 4JFWA 1U93B 4L9DA 5KBPA 1FO0H 1U93A 2D3VA 3GDBA 4HCRL 1OE1A 1NC2D 4JCMA 4IS6B 3K6IA 4NZTL 3GXNA 3SYOA 5KYWA 4BHUA 5KAQG 4HW6A 1JY2N 3FGAD 2WUCL 1H8LA 2D7TL 5DHYA 1CXEA 4G7VL 4TYUA 3FB5A 3V10A 4I0PA 3MTUE 1RZKH 4LSQH 5C0CE 3MV7D 3QWNA 1JHTB 1ZVSA 5J9PA 1RIVL 3PWJB 1NA8A 3CXDH 1KILD 5IB3B 5DURB 3PLYA 5TE7H 1WBXB 4QHMA 3MX0A 4R97B 1FVDA 2OGUA 2H0EA 2C3GA 4LCIH 4FNTA 4LVNB 1G5GA 3ZO0A 2CLVB 1I8LC 4MD4B 3TA4D 1AQ5A 3C60A 1FP5A 1QRKA 2Y9YA 4LQFL 3LB6C 4TTGA 3AT9A 2F74B 4OZIB 1XF5A 1IC4L 1BJMA 2EDYA 5E99L 2NY7H 4QXVA 3UZEA 1INQA 4MXQD 1JGDB 4MAZA 4OWFA 4FHKA 4PJFB 3KHOA 1E6OH 4S2SB 2C4FT 4NGHH 4PJ5A 1U2YA 3BEWA 1LTAC 2DICA 3RBSA 5TDPA 3G6DH 2ADIB 3ZE0F 2NQ3A 2V17L 2IPPA 3D39B 1KTLA 3A47A 1D7DA 1I8AA 3ARWA 3ZKXC 1KXVA 2RACA 5DT1H 3H85A 1ZA6A 2F7RA 3HZMB 3MRKB 2C0XA 2DI7A 2NY1C 4PP1D 5K59F 3VE0B 1RK0A 4MNHA 5IHZB 3DRTA 1YEEH 1FCCA 2OTUA 1I3GL 4FQ2L 4J12A 1JUFB 1S5IH 4UM9D 1FAIL 4XWOD 5BRZD 1I82A 4F2MB 1B4JH 1HL8A 3TCLA 3BIBX 4PY8I 1A14H 3VXNB 1RUKL 3NJLA 3Q6GL 3KPRB 3IDJB 4NM4L 5FYLE 3WFCL 1TZHA 2FYYA 2MWCA 1YLBB 4PRHD 4RNRA 1CF1A 4BH8A 4RISL 4HKBB 2WD0A 2ZXAA 1Q0YH 1H0DB 3MLZL 3VGDA 3RFZC 2P7JA 4OF7A 3QNYA 3GIZH 4FG2A 3HMWL 1S7RB 4RFOH 5JPNC 3WNIA 5I1DA 3WIAA 4L8SC 4WHYG 3F05A 4MB4A 1RLBA 3EADA 3C09B 1E7UA 3HNSH 3KYNA 2VH5H 2V3FA 1J8SA 4GIFA 1PG7W 2Y36L 2YD3A 3QZNA 3ES6A 5IQ7H 5LQBL 3MROB 3IFNL 1J87A 3V8CA 3IAGC 1A3RL 4BA0A 5F3BA 2VXUL 3FRPG 2X1QA 3D85B 3GMNA 4MJJA 2CNZA 4Z76A 4L3EB 1BFOB 1R3KA 2Q2LA 3JT0A 1OTTD 3L4CA 4BZ1L 1JBJA 3VD2A 1CQYA 4CNIB 3VFTA 2IOMA 2NXZC 2VISA 3RWDB 1SOXA 2A9BA 2ZD0A 3U4EA 3AEAC 1KUMA 5AG8A 5DO8A 2OZ4H 3FCGA 2P9RA 4NNPL 4OCWL 4CU8A 4G7SB 5FYKH 4XBGB 2YA0A 4YOKA 4X7SH 5CEYA 4PTUA 2HJFA 5GISH 3GFUA 5I15H 2K9UA 2CALA 2R69L 2V2WB 1AO7B 3W37A 4EZLA 1ORSB 3QAZB 2VN4A 2FUQA 3RL0B 3K2KA 3H9HB 3N7NA 1UKQA 4MVBD 2OYLA 5IV2A 3NZUA 3ARPA 4LVOB 3SQBB 2V5TA 5IP4A 1MFCH 4YPJA 1SFCD 2XACC 4F7PB 4NWTH 4Z7WF 2YPKA 1MJUH 2QHRL 4J6RL 4UOW0 2EVHA 2JLLA 1KENH 1HSBB 4AIXA 4B50A 1JL8A 4QEGA 1DEEB 4YBLB 1P84E 1JTPA 4J6RH 1T0NB 1JI2A 4ZAKC 3S6CA 3MRIB 2NY2C 3BZ5A 2I5YL 2WZPA 5FO9B 1R46A 5GZOD 1Y18B 4GNKB 3ULUE 3RGVD 2OTKE 3UTZB 2GI0A 3RL0g 2QVAA 4RNRB 4D9QD 1A22B 3QWQB 1T7YA 2NX5B 4UIKH 2CJUL 3BPCB 1IKFH 2BSRB 2C9SA 1SJHB 2DQUH 3UYRH 2CK2A 1G2CA 1D5ZA 3IN2A 4R4BB 5SWSD 1M1KQ 3C60C 5G4MA 1DLFH 2X28A 3BT0A 3OPUA 4KROB 4BE6A 1VIWA 3BISA 3U0TA 2J1ZA 1NUGA 4DO5A 2XNXA 2R56H 2YBGA 1M9WA 4PWKA 1MHEA 4QPEA 1A6AB 3ZGIA 4KY1H 1KIPA 4KQ0A 4WHDA 1QASA 2GIMA 1HT6A 1ZHNA 3KLAB 3OKDA 4FTVD 4RQQA 3SJVD 5JIIA 3T6VA 3VXUA 3DYOA 4HZLB 4OJFL 3SKJL 1T04B 2QJDA 2XT1B 1J05A 2IGLA 1J11A 4S1QL 3O11A 2BSCA 1C5DA 3BEWB 3MR9A 2OZ4A 4Y89A 4JVUA 4AVKA 5DRWA 5LXVA 3VI3F 1NFKA 3DA0A 2J71A 2LTQC 1A8JH 1GK4A 5E94A 1JMMA 3T2NL 4Q0XL 2N1TD 5IW6B 3EJPA 2OQJA 4Y4HD 5DUBA 3F6IA 1R75A 1OT4A 1KCWA 3F01A 1EAPB 2Y7QA 1KYOK 4WW2B 3VAEA 2G2RA 1BZEA 5C0CA 3TFBA 5I0WA 1T21B 4IKNA 3CZLA 3V0FA 1R5LA 4PJEB 2YD4A 4Y9EA 4GBXB 3L74G 4AGLA 1A2YB 2PXYA 3EO1B 3BPOB 3N0AA 5MENE 1BQSA 2AJYH 4E0RB 3P11L 3RFZA 4Q6IA 3P3YA 1OF2B 3OVUB 3C5XA 4PRAB 4QWWD 2R69A 3ZDYB 3P4LA 3MRPA 4GI6A 2GAZB 3BQUD 1SQVJ 2OMYA 4IMLA 4G8GA 4TULH 5AVXB 5KJ7A 2ENJA 2CNYA 1C8PA 4NN5B 1IAIH 3M7FB 3L74D 4MDIA 2MRYA 1M42A 3CFCL 5E2VL 2DWDB 5EN3A 4KK8C 4W4OA 5INCA 5EZOL 3GTVA 1YNTA 3VGGA 1BQHG 4KJWD 3H55A 3VSQA 1NMCC 1TO4A 1LNUA 4P5MB 5AZEL 2DBJA 1LMIA 12E8L 3D18A 4UV4L 1D5MA 3LN5B 3IU4H 3OHXA 4BM7A 5HJ3A 4XMTA 1PLAA 3LNIA 4F9PA 3L3DB 4C7NB 2CJUH 2MNUA 3MLWL 4OF5A 3MKGA 3QIUC 3GTNA 1M1JA 4UDTA 3X2QB 4GXUM 2FYZA 5B21A 3TBTB 1U8QA 3PGDA 3QXDB 4LHUA 1DBMH 4XOEA 1LWUA 4U3CA 2XWBA 4Q2ZB 1MW3A 3CAFA 3RWHA 1AGEB 1AD9B 4CSPA 4L8DA 4YL4A 3NSDA 3HC4L 1N7SC 4MZ3A 2VDLL 5I18H 2J20A 2KK7A 1FL6A 5JXEC 4L0YA 3PV6B 2HRHA 4HS8H 1JZ4A 2NY0C 2J72A 4XPFL 1N6QH 2JWYA 1Q0XH 2ZSWB 4W9IC 3VFGH 3KPOB 4G2AA 4JFZH 3VFNA 3CHSA 4ZS7L 4UCFA 3STBA 3EYOB 4PMFA 1VB9A 3CX5H 2VR3A 2BVOB 3AQZA 2BWIA 2BVOA 4G6JL 1II4E 4N8CL 5AAPA 1QFUL 3LNEA 3V4PH 4YSCA 3VWKC 5IJVB 2P46B 3KWUA 4GSQA 3GMPA 5JNYB 2G75B 1A6VL 1I1FA 2CIKB 1IBHA 2CO1A 4U1IA 4Y5VA 4G83A 3RX5A 3VFRB 1QVGO 3NACL 1HXYA 3FQXA 4WEBH 3T0EB 5HDQL 1MCNA 1GZHA 2ITFA 1J10A 1SGKA 3T1FB 1S78C 3THMH 4AQZA 4MNQB 2BEQD 3C1LA 2Y1VA 1LTJA 2ZZUT 3WUTA 2I07B 1AR1C 2XTJB 3LEVL 4R3SB 3GSUB 5MERB 2BCKA 4A2DA 2W9DH 3A7OA 1VACB 2DW5A 3S3PA 4Y1AD 1QHQA 4UMGA 3DVGA 3QUMH 2ATAA 1S7XA 3A6CH 2A6KB 1NBCA 3EOTL 3JV6A 4X6CF 4OZGF 3V7MA 3C9NB 5DJCA 5TTRA 4ZOBA 5GSRB 2VT0A 3AUVA 3IJEA 3KDMB 3WFBL 3GB7B 3VD1A 5KYUA 3PHAA 3OAYH 4LLMA 1BCCE 4PGZA 3WFCH 4F15B 5T5FL 1JB0J 1EDQA 3U9UB 2KC0A 4YS4A 4MA1B 4FTVB 3L4WA 3EXJA 4Y4KB 3DXAA 5AOMA 2IX7C 1FYHB 4EUPB 5I24A 3P2TA 4C56A 4Y2OA 4TULL 3D0VB 1QEXA 2AV7B 3M17B 1FGNH 4JY4B 1OAQL 4O58H 5TPWH 3GBDA 1OVUA 1HH6A 5KOMC 3PNRB 4FTDA 3GMMB 3H2PA 3DJZA 1HIMH 4N0YL 4M3HA 1ACYL 2VZUA 2JCWA 3V5DB 1NTZD 4EEEA 4XCEA 3PDDA 2XXMB 3CXHE 4GUPA 3OKOA 5EZLB 1ZXQA 5LAXA 3SYQA 5D5ME 4MB1A 5L8RJ 5DZNA 3U2SA 3ZTDC 1YJNP 1TLKA 2Q1EA 1ZEAH 3MLYH 3LNGA 3VTTA 1IFHH 1E0OB 4I1NB 4Y1AA 4WGWB 1KCSH 1V8HA 4NZDA 2LU3A 2NZ9C 4AL8H 2ZKWA 1SQQG 3FQNA 5E8NB 2CUAA 3T6XA 5I30L 3F7VB 1GW3A 1TOXA 5A7BA 4MTMA 1KOAA 2IF7A 4LLQB 1HL9A 3C09C 4PUBH