4HYTB

Na,k-atpase in the e2p state with bound ouabain and mg2+ in the cation-binding site
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
289
structure length
289
Chain Sequence
FIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRFRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/membrane protein
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
publication title Crystal structure of the high-affinity Na+,K+-ATPase-ouabain complex with Mg2+ bound in the cation binding site.
pubmed doi rcsb
total genus 46
structure length 289
sequence length 289
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4hytB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 4hytB02
4AQRD 1OXZA 3NTNA 3M91A 1KQLA 5APYA 3M0DA 4AUWA 2WPRA 5AVTB 5AW7B 2QM7A 3T97A 1GD2E 5APTA 2P2UA 4AYCA 5AVUB 5CMZA 3P8MC 4RESB 4GKGA 2XU6A 1H89A 5AW0B 2QM8A 3NFQA 3SWFA 3NXSA 1SLQA 3NMDA 1H8AA 1MFZA 1A02J 3VMXA 3V4QA 1HWTC 3P7KA 5AW4B 1YYCA 4KHXA 4XE5B 2Q7CA 2XV5A 5APXA 1HBWA 3B8EB 2VRSA 4C7NB 1GU5A 1NWQA 1GK6A 2XZRA 3M0AA 3HE4B 3LIEA 1G2CB 4EOTA 5AVYB 4C7NA 1GZLA 3V5BA 1GTWA 1GK4A 5AW5B 2R5DA 1CZQA 3HE4A 3L36A 3UIAA 3M9BA 3MGNA 1J2JB 2R32A 1JUNA 1FOSF 4LC1A 2YO2A 4C46A 2Q3IA 2C9LY 3MD0A 5AVVB 4I6MC 4JYCA 5APWA 2WTYA 2R5BA 2W6AA 2WWWA 2IPPA 1S9KE 3KQGA 1FOSE 1T2KD 4M3LA 2Q5UA 2YO3A 1JNMA 2BASA 2ZXEB 5AVQB 5APUA 3P32A 3VN0A 3A3YB 3IR9A 1MV8A 1OWAA 5AVWB 3I5CA 3WGUB 1HJBA 2WT7B 1T2KC 2Z5HA 2ZFCA 5APVA 3L35A 3HTKA 1GU4A 3OAKA 1FAVA 1HUCA 5AW3B 2WT7A 2E42A 1MUUA 3O8ZA 5AW1B 3VMZA 4I2LC 1SP4A 5AVXB 2WPSA 3A5TA 1CSBA 5AW2B 3A7OA 3VYIA 3TNUB 3TYYA 1S9KD 2JJLA 4B86A 3KDPB 3V4WA 4HYTB 2R3CA 3TK1A 1CI6B 2KP8A 3HE5B 5AVZB 2P7JA 5APSA 5AW8B 3TNUA 4JYBA 4GT1A 1CI6A 3HE5A 4DZOA 5AVRB 2YNYA 3VTPC 3L37A 3VMYA 1X8YA 5AW6B 1H88A 2C9NY 1NAFA 3LIDA 2E43A 1A02F 1IO4A 3A2AA 3WGVB 2N9BA 2W27A 2Z5IA 2WPQA 5AW9B 1DH3A 3M06A 2H7HA 4RETB 2P67A 5APQA 3M9HA 5AVSB
chains in the Genus database with same CATH superfamily
2HXAA 4DK6A 3CCRP 4ZQKA 4QRQA 1VQPP 4PG2A 3WJMA 5I5MA 3NRPA 4IKIA 3LKSA 4NYLB 3RPIB 1HF9A 3C12A 1QUNA 2AAAA 3BKYL 4JO8A 3QHTC 2WBJC 2MHAB 4NRXA 1KYOH 1UENA 4FOMA 4NO2A 3TBVB 3ULUE 1E28B 3OKEA 2R27A 3U83A 1LTAC 1NM9A 1DQQA 1HE8A 3O6LH 1P7HL 5F9OL 2GJZA 3TH3T 2JR8A 4OLVH 5IBTH 5ISZB 5JO5B 1KXTB 2VWEC 5KTEL 4IU2A 2Z31B 3KVDD 5FA4A 2BOBB 4NQCE 1CDCA 4QHUA 5CIPB 1LMIA 1U3HD 4ZFGH 3O6FD 3TNMB 3CXHD 3C60C 2BPBA 3UYRH 3QQ3B 4Z7VE 4ZDHA 2TSAA 4LEXH 1CGTA 1S7UA 3PE9A 3FHEA 3MRPA 1QSZA 2GUOB 4FA8A 1NA8A 2NW2A 5HGDB 3T65B 2GJ6B 3GZOA 4MVBC 1Z9LA 2YD7A 1RHFA 4XMXA 4LVHC 2WQRA 1KV4A 1IE4A 3MLXH 4MMYA 4K8RH 1JFHA 4JVUA 4P2QA 4QRPA 4DQOL 4XNZB 1II4E 1TZGH 4ABUA 4IU3B 4LPYA 3S3BB 2GTQA 3WSQH 4QTIL 5C0AA 2QVMA 3D25A 4AJVA 4QHLA 4GIOA 1QBMH 1MREH 3U1CA 3M6DA 3MRMB 4JFUA 1WV7T 2KLSA 4UIMB 1VJSA 4OV5B 1M7DA 5DUJA 1X0TA 3CFKA 2CDFA 4DEPC 2ZG3A 5E4EC 1NCCL 2BNRD 3BGFB 4YDMA 4KK5D 2F8IA 3P0GB 1DSWA 3DUUB 1GGTA 1A1OB 2R44A 1KTDB 1A6ZA 2MWCA 2PAJA 3JCUH 5FYJD 1AY1H 1DO6A 4PLJC 5E6ZA 1H3PL 2J55A 1I7TA 4PRPD 2GBUA 4PJXA 3SYOA 4DIXA 3CN4A 1AXSA 2O5YL 2HCZX 5CCGA 4UQDA 2K6YA 1SHWA 4JFQB 2CBQA 1S7TB 1W0VA 4RLDA 5JXAL 1QTPA 4G42B 3K7UA 1QW8A 1A2YB 1T89A 1D5XB 3VYIA 1EAQA 3SCMD 4OQTL 4KNTA 1M7LA 1CFNB 3GLDA 4BKLB 4BZ1H 5JPNA 1HSAA 4GXFA 1MI5D 5CCHC 3IFPB 1MAMH 3AM8A 4ONOA 4ZBJA 1JI1A 1N2DC 3CCMP 1CDBA 2VQ1B 1DIPA 3BKML 4XPHH 2OI9B 3C6EA 5FCSH 3MRHA 2LE9A 1XGUB 3OWEA 5E2JA 3IJEB 1SFCA 5AYQA 3ITKA 3CH8A 3WY4A 2J43A 1N73B 1KY7A 1JRHL 1XEDA 1OT4A 4JR9H 4M61B 1FI8C 5JOEA 5B38B 1EO8H 2R9HD 1D6EB 2X2HA 3ZTJH 4I18B 4BQ9A 4KOBA 1S9YB 4WY4A 5HVHB 2F54E 2K9JA 2IWGA 4I0PB 3RGVA 3KPRD 1XTCC 4BZ2H 1UB6B 3HZMB 5D71H 4ETQB 4EVNA 5TISE 2N4IA 4K3EL 2C0WA 4KZEH 5CCGC 4J3SA 3MR9A 1BMGA 4R97C 2QM7A 4EIBA 4NPKA 2NY3B 1T89C 2AK4A 4OCRL 3V4UL 5D96B 2E9WA 1CW5A 2J8UA 3RL0D 4PPTA 2KUBA 3RDTD 1JD7A 3JZ7A 1IBBA 3KYNB 2X0WA 2OX5A 3AM8C 1AYRA 3VI3B 2GPZA 2VDQH 1M8OB 1NJIQ 4G9FA 3V4LA 4PJ0E 4FQPA 2ATKA 3MLZH 3AEAC 1NDMA 3QDHA 4OCYL 5DC2A 3TNNA 2DBJA 3TS8A 4WDIA 3QUYC 2GBAA 1GC1L 1M42A 4NFDA 3IDGA 4YE4H 3NIFF 1SJVA 2R4SL 1CICA 1EHXA 4M1DL 1SOQA 4U7JA 1G6RL 4NUJB 1DD3A 5FO8B 4WY4C 4R96B 3UACA 1J1OL 2DIAA 1JPSH 2LAAA 5FHAH 3V4VA 3RGVC 5JA8B 1LO2H 4RMRA 2GTZB 4NKIL 1RF0A 5BV7C 4R90H 1FQ9C 2D03H 5CJXC 3KXFD 4UTBA 1E5UI 3CQQA 4JN1L 3NCEB 4DVRH 1X3DA 3ARFA 2PTUA 4QUOA 4JRFA 1NFDB 1NPUA 2HJLB 4XHJD 5EZLB 1OB0A 3L72E 3U30B 3BWZA 4CU6A 4KI1A 2W9DH 5KVEE 3LAFA 3HIZA 2NRDA 1UUSA 3I02B 3WMM0 3HEIB 3GIVA 2H5UA 5I18H 4WUUE 1MFDH 2IPKA 4HS8H 5GS2D 1AIFB 5L88L 2PYFB 3BCCE 5IEKB 2M3BA 2Y9RT 2VABA 4I4WA 2NYYC 2AQRA 5BXFB 4ODTL 1BMWA 3I2CH 3QEUA 2GABA 3GMMB 1TZHB 1EDIA 1HL5A 1QBLH 1ZTXE 2H1PH 1TETH 4XNXL 4FABH 5HGBA 2DQ6A 4LSPH 2AQSA 3INOA 2DQCH 3CBJB 4KFZC 5HHXH 4IL6H 1RF0C 3T0EE 1OE2A 3MRKA 2J6EA 2JSFA 2VJXA 4HEPG 1F3RB 4ZAKD 5KBMA 4Z7UF 2Q7NA 2ERJC 4RMVA 5C0RH 2JDIH 32C2B 2FK9A 4DEUA 2QKSA 3QUMA 3ZOAA 3MLYL 3VJ6A 3ISYA 2M5AA 4P59H 5DJAA 3H1LE 2FDBP 3NT0A 2EXWD 5T3XE 3GNMH 4WF7A 4DGYH 1SVZA 3B9AA 5K1VA 3U82B 3RWEA 3IXAA 4JN2B 3E3QE 3ZRCC 1DH3A 4XP4L 4OGXL 3BPNC 3D71A 3QP3A 4MNQA 2V9UA 5EFIB 4AQRD 1XWVA 2HR3A 1ED3A 1RZPA 1ZLSH 1AKPA 4WI7A 4BUHA 4IOSD 4LZKA 5IW1A 1AR2A 3HS0A 1R3KB 2EYTA 3NJIA 1AI1H 1IBYA 2JCWA 1YO4A 3QI9A 4UINH 4XXWC 4C4BA 5IHUL 5BNXD 3MBXH 1BD2B 1JXFA 1QD0A 2NXYB 2PCXA 4JPWL 3QSKB 4OF8A 3QUXD 1L5GB 2LLNA 5EUKA 3ZE0B 4WU5B 2WXKA 3IGFA 1DSFH 5AENA 3RX8A 2H2SC 1H9VA 1L9OA 4P46B 3LKNA 3M17B 2GJPA 3RTLA 4QYOB 1R5IB 5CBEA 4CDHA 2YKOA 2ORBL 5APXA 3NVQA 1NAYA 1FFQA 2VXQA 2VZSA 4WWKA 4FNLH 3GK8H 3JV6B 4TQEH 5F0PB 4DKDC 3C6LA 1CLZH 3PQYD 4HIIA 4HIHA 5ABDE 1NFKA 3MBEA 1D7DA 2IAMB 2IH1A 1MSPA 1BCCE 2SPZA 3JSVC 1KCLA 4PJAF 4FD0A 1XL6A 2DF3A 4YC2B 4AYMC 3RG1C 4BUQA 5GZOC 5JHDA 4I9WD 4M8QB 2Q2EB 5K9OA 1R46A 2IWFA 1PIFA 3FF7A 1AGFA 4PJ5E 3HS0C 3GRBA 5EWIL 1PKQE 3QI9C 2VSKB 1URIA 4YHLL 3BWAB 4HCRH 2LFGA 2A38A 3ENEA 3QYMA 5I71B 3FT2B 4XHQA 5TF1L 2YO3A 1JNMA 1ZMYA 2MTPA 1HFUA 3GINA 2I9TA 2ED9A 3EOBB 2WXMA 3RWFB 2KH2B 1E5BA 3O8XA 1CO1A 2ARWA 2VUKA 5I6XC 5IMKA 4Z8FH 1AFVH 1XIWA 1I85C 2IV8A 3MRNA 1CFBA 3HMXL 1CLYL 2X28A 4ZUTA 4DP8X 3ILEA 5AD0A 3L2LA 3C6LC 3D1MC 1ZS8A 2FH8A 4JKLA 4OUUB 4G5ZL 2ZWKA 4FHBD 3V9CA 4BQ6A 5KYUB 2DLFH 2E7BA 3MRIB 2ADYA 4R7NB 3KYOB 3KDPB 2DQEH 2NNXA 1BVLA 4UQAA 5CP7B 5DRWB 1E8XA 1U58B 1BFOB 1U95B 3DVGA 4ZUUB 3CCHB 3KWTA 1FYTD 2Z35B 4X6DF 5INCB 3S97C 2IOIA 3FCTB 3VUAA 4ZNEA 4D6TG 1Z9MA 4XC1H 3UP1A 3AS2A 2CU9A 3VXSE 3FPXA 3WN5C 2DLIA 3K4ZA 3NJVA 1R3IH 5E8EB 1WAEA 3ULSA 3BKCL 5D1QD 5LXVA 1IZNB 2I25N 2NY5L 2GT9A 1ZV2A 2WIIB 4FQCH 4FZEL 1TXKA 3LCYA 4NQCB 5J6GB 1LT9B 2OYOA 3UYPB 3MLTA 3KGRA 2HPOA 3W68A 1OGPA 4EPSA 2WCPA 1Q72H 2FXOA 4PWHA 3RP1A 5J6HA 4BGLA 3WNIA 1NGPH 4YE0A 1EJ6A 3AY4A 5AFAA 3RZWA 1XIWC 4DGVH 4ANWA 4NPYB 5AKSA 4WFFE 1MHCB 3WMPA 3KH3A 4K4KA 4XNAA 4UDUB 3RJDA 4C7RA 4OFIA 3RWGB 4AMXA 5IJKA 1A8ZA 4PSRA 2CK2A 1FL5A 4K23H 4N78D 4D94A 3GDCA 4W68A 3L71E 1SDDA 4L9LC 1MFAL 4DPRA 1TUPA 2CHNA 4LL9A 3P4OA 2Y4SA 4TSAL 3W81A 2PR4H 3F6JA 1QNZH 2X6UA 3RK2C 2A74B 2QM8A 2PTTB 3NMDA 4KKZA 4BFEA 5KYWB 2VUOA 2XIDA 4K2UH 4ZXBD 3GIZH 1FDLH 4QJ3B 3DETD 3ULVE 1T20A 1ZA3A 3A0HH 5F88A 4AM0A 1HI6B 2XN0A 1V3KA 2OL3B 4JY6A 3BUQA 5LCVL 2IX7C 2AXGB 5FUCC 3TVMA 5EEWA 2HKFL 3UTTB 3AY4C 4GSRA 2P5ED 3MLRH 4U7MA 4XC3H 1IM9B 4Q2ZB 3H1IJ 1UOWA 4FQIH 1IE5A 3HI6L 5EIQA 1FIGH 1JMZA 4QXWA 1IC1A 3DKHA 4TUOB 1DVFD 1T04A 4B97A 1U3HA 5DFWH 3P77A 4NQSA 3PU7A 2Q9IA 2VLKD 4FHJA 2JIXD 4JFPB 2WXIA 1ZLUK 3RY4A 1FG9C 2JCCA 5KYXB 1NSNH 3E0GA 1SVFA 2DDQH 3HE7B 2HJFB 5HHVH 3ZX1A 2NY1C 1RU9H 4YXHL 4YUEL 4LU5L 2D2CB 4PRDA 2UWEA 3FGAD 1N8OE 4JRXA 1HXMB 4EAEA 4L3EE 1XH2A 3SE4A 2IALB 3GSWB 4WKXA 1RUAL 8FABB 2FYUJ 4MA1B 3S3PA 4M6OL 1NWPA 5J1AA 3SEPA 3CNKA 4Q6KA 4HUVB 2F53D 3AS1A 3I50L 2F54B 4NRZA 3WL9B 2E42A 5DVNA 1MIEH 2ICEB 4G6AD 4NQVB 3TIEA 4KRPD 1L4AB 2BSCA 4WEBH 2WLIB 3P11L 1K04A 1UC6A 4LHUA 4OZHE 3DIDA 1IKFL 4FLSA 2FFDC 1CGWA 3MDJA 5C71A 3F5WB 3RVTD 4ZPVB 4GFXA 3T6WA 5DDHA 3GRGA 2CLVA 5IR1B 1MLBA 2M0BA 3CDFA 3G5XA 3GMQB 3SDCB 5IWLC 2P8PA 3RTQD 4AC4A 3B9KB 4GP8B 3ARWA 2FWLB 4AK1A 2E6QA 2QLVB 1ROCA 5GPRA 1VGEH 1DFBL 4LCIL 4RQQA 2AJ3A 2N7AA 2Z4QA 3GMNA 2FT7A 3G08A 5J9PA 2V8LA 4KO5A 3SCMA 2VITA 1BVOA 2B2XL 1QG3A 2FD6H 3BPLB 3TWCH 5KJ7A 1DN0B 4MTMA 1KYOD 1EFXA 5EMYA 3SYPA 2YEZA 5D55A 2WWKO 3WFDH 1NTKJ 1B9ZA 2JNZA 35C8L 4YFLF 3O4OB 3O3AB 1BQLH 1UXWA 1P84J 2YKLH 4LP5A 3GMLA 1WBYB 4PVNA 2A0LC 1KTJA 2BRRL 3MQIA 4N0CD 5ABAA 3I74A 4XPFH 1OAZL 4EI5A 3O2WL 5F9JB 5HTSA 5DHYB 4YWGH 1SQPG 3QDGE 3B9EA 5KLIB 1IGCL 2W5PA 3K5BA 1SZNA 1XEUA 2PCPA 4KO6A 4WUUB 4DZBB 1WCBB 4K8RD 3KPSD 4GW1A 2QEXP 4XN1A 3HHSB 1RE4A 3RL1B 3VG9C 3PNWA 3VMAA 5F8RC 1OAXH 4PTTA 4ODUA 4OH8B 2DI9A 3GSNA 3QRGL 4JG1H 1AHWC 4P4RA 5KJ7C 3GDBA 1X5AA 5DEFA 1E4WL 4PY8I 2Q3IA 3F7KA 4HUCA 5L0QB 5CN2A 5C0DA 2ITCA 2IZ0A 4OIIL 1E3FA 5AOIA 3S36L 2BP5M 1KYAA 1L9QA 3PLYA 3SOBH 1JYWA 5L6YH 1I9JH 3RNKA 5F1IA 4YHYB 1T2KD 1IIIA 3QWNA 2XZQL 2LAGB 3L4VA 5SV3A 1NGZA 5ECGA 3VGDA 4A2GA 4EI5C 1F3DJ 4WFED 1FH2A 1HILA 4MXWH 4QHMA 1KYOK 3US1A 4QGYA 4HJSA 2Z3FA 1HC1A 1Q7YQ 1JDAA 3CPUA 2VSDA 4TUKH 5DQDL 2DIBA 2LKMA 2A6JB 3ET9F 2DY2A 2E75B 3DSFL 4LSRH 4A38A 3ZW3A 3ROOB 2AEIT 4JFDE 1RURH 2P1YA 2RBLA 3NTCL 1SQBG 1KIUB 2WAQA 3IWUA 3OX8A 1SQVG 1MELA 1U42A 3KD4A 3RWJA 3LPGA 4S1RL 1U8CA 4WGKA 5DLMH 1KJMA 3TNUB 3O45B 2HT3C 3UBGA 3H2WA 4BINA 2PW1A 1L7IH 2IBGA 5D6CB 2YBGA 5JW3H 4GT1A 4XCYB 2O5XL 4APQC 1BECA 3VRLF 1ND0A 3AFLA 5AVRB 3R18A 4JDEB 1IAII 1DJZA 3KCPB 5I74B 4Z5RA 6FABL 1RH8A 2UY6B 3VFWA 3ZL1A 3U59A 3VGAB 5I24A 3PGCB 1R3HA 3D08A 3SY0B 3RZCD 1A4BA 1KIPB 2DD8L 1TKWA 4X5WA 1KMGA 4A7TA 5FGBA 2X3AA 3WNOA 2KHAA 1RZIB 4B3EA 4X6CE 2EDQA 3H4FA 5DD5H 5IQOA 1G9EA 3Q3DA 3JQOB 1YEJL 4TULL 3SPJA 3VH8A 4TNVK 5CXPA 5AL8A 2R56H 3M8OL 4YR6B 4ODWB 1YEWA 5CZRA 2HA1A 1X79B 2C4XA 4L4TD 4Y2NA 2EC9T 4HKJA 1A7OH 4GPVA 4W93A 1A3QA 5DQJA 3FT0A 1LM8V 3PAYA 1A7NH 1M2OA 3EJZD 3MRLB 3MJ8A 2EIJB 3QWRA 2VDOH 4PJ5B 2FB4H 5C0EB 4LSQL 4TVUA 1NCGA 1KBGL 1RIUL 3OR7A 1PKQB 1BDYA 1R5VA 4H44B 1FO0A 1V10A 4RWYL 1CBVH 3GSUB 3QEGL 4JPKH 3LY6A 1FLRL 3D3VB 1BIIB 5KLVD 2IH3B 4ZO7A 4AC2A 3MO1B 3L5XH 4KHXL 4N0UA 5IVZB 4PQXA 3BGMA 5H4YA 2NMSA 4NNPH 3LMJL 4Z0XA 4FX5A 5E8NA 2BMKB 3HUSC 1HAUA 3FW6A 2YS4A 5E9DD 2D7OA 5HJDA 3W5MA 1S78C 4U1MB 3T0XA 5FGBC 2GITB 2DMGA 3RWHA 2KPNA 4JHVA 3OMAB 4AITA 1C16B 1GZLA 2HG5D 3FTGA 4YDIH 5JA9A 3EWKA 1TMCB 3GMOA 4HBCL 1P5VA 3JWDC 1NCOA 3AMLA 2CR0A 5T5NF 3ECQA 1ASQA 3CHOA 4O02A 3PLNA 1SXBA 4IDLA 4C56D 5CD5D 1JF6A 1OFCX 3GGWB 1X4YA 1CDGA 2JKVA 1WBXB 3N1GC 5F96L 1UZ6F 4WSKA 1HS6A 1NGMB 1M53A 2P24B 4PS4L 4CSPA 4DW2L 1CGXA 4DGIL 2BHYA 1E40A 1HNGA 3FFCD 1YEKH 2BASA 1AQDB 2WOBA 2WSKA 3PL6B 3Q6GH 4HWEH 3VN0A 3OXRA 1EA9C 1KACB 3E1RA 1NTDA 4XP5L 3HCVB 1G7IB 2ZCKL 3MODH 5D9SB 1LNQA 4S11A 5CD3A 3B9DA 3OG4B 1B0GB 1HHGA 3HG3A 5TQ0H 2VZTA 4HHAB 3TBWA 5AW3B 4Q6IA 3CD4A 3OHXB 1CL7I 4Q0XH 3CX5I 1OARL 2EH8L 2JK5A 3DXAD 4X9FA 4Y5VB 4KJPC 1VCAA 5DYOA 4QIRA 5KSBE 1SY6L 4RZCB 4GOFA 5KLVK 1D5RA 2CJTA 3H32B 3EYUL 1KB9I 4I48B 4K5OA 3TO4B 4ZNCD 3KPPA 4YEFA 3EUDA 2XWJB 3RKDC 2O6EA 3DNKA 2AK1L 1KSRA 1LD9A 5T3ZH 2MQGA 3OPZL 4RGNC 5MERB 1XT5A 4PWGA 4PV1B 3ESMA 3LPPA 2FJFA 5J4MA 2QPFA 1QLEL 1IGTB 1JUFA 3WHE1 2KYVA 2LR4A 4XBGA 4NXSA 1PCXA 1J05B 3FHQA 3PWPD 1FJ1A 4G8GE 4LOUC 4YSPA 5EC1A 3RU8H 1KC5L 4OD2B 3VXRA 2HMID 3FSZA 3F65A 5AOMA 1F2XK 1I31A 3IF1A 4Q6IC 2FHFA 4OZGE 5LXGH 5CWSB 4FZ8H 4XMLH 3BE1H 3MZWB 3S5LG 5IHHA 1ONQB 1KGUA 1KG0A 4ZW5A 2WZ5A 3C5ZA 1CGSH 4UUJA 4OGQB 2BHFA 2VXSL 4OJYA 3PDOA 3FHAA 5E7FA 3V5KB 2QR0B 2YFOA 1AZNA 3BDYL 3QQNA 4UNVA 2HTKC 1E2WA 3QFDA 3BQUC 4M6MH 3UAEA 2Q3AA 2J3SA 2V2WA 4QGTA 5D7IA 2FX9H 2ZWSA 3FB8A 1ZOYC 3R19A 2OXGB 3EFFK 3ECVA 3NK3A 1IC2A 4MQ7B 3MRQA 1PPJG 1KIRB 4J3VA 3W9DB 4O00A 3RPKA 4AQEB 1EUTA 4WCYH 5CGYC 2CDEB 1TZOA 2IDTA 2HRHA 4TSBL 3X1EA 1EXJA 3PV6A 3VU2A 3HD7D 3CGTA 4LLMA 2IBZI 3GBMH 3VWJB 3WDHA 3V0JA 1WIPA 1OOWA 1UVQB 3FSVA 5JR1L 4H1LG 1K2DB 3C5ZC 4Z7NF 3QWOA 3FQ4A 2XG5A 1QAWA 5AEAA 4Y9FA 5CHNB 4X4ZA 1FOSE 4JKKA 5D1ZA 1BJMA 5LUMA 3QPQD 1EDYA 1X5FA 2R2HA 2WW8A 5LAXB 4X0KA 2EIEA 3H9SD 2E7HA 1YEIH 5EO9A 3KPMA 1R33A 1OCWH 3D30A 5SX4I 2G3ZA 1JTHB 1MRCL 3PWVB 2WPVB 4BXLA 2ZQKA 4QTHA 1H5BA 5DF0A 2NNCA 2ZSWB 4U1JA 1J9RA 2VR4A 1OCOB 2IFFH 3WXVH 3JV4B 4DGWC 4G8IB 1FAVA 2PXYC 4FQXC 3CLQA 2KMWA 4WWPA 3L13A 1TQTA 4Z1MH 2YAOA 3F04A 3KCWA 4NKOA 3V4PL 1W0YT 4F91B 4HHWA 3IFNH 5DD6A 5CINL 5T5FL 1B9KA 1T21B 4PI2A 1A9EA 4KXDA 4YMPA 4ZO9A 3PWUB 4HZAA 3D2UA 4P9HL 1BDDA 3QWOC 2QTEA 3HG1B 1I4FB 5J12C 3MV7E 3TOPA 2F53A 1MCNA 2YRPA 3CXHJ 3F7VB 3FN3A 3UIYA 5C07B 4XNMB 1M6UA 4H26A 4HGWA 1PGRB 4BEIA 5TE4L 4N2CA 5FCUL 1CN4A 1INDH 3P73B 1UB5B 4O51B 5DZJA 3KGSA 3MUZ1 4H40A 4HXBL 5AW9B 2IGTA 3VFVB 3KS0J 4XOEA 3M9HA 4IKLA 4JMNA 2RMZA 3QRLA 4O4YL 5KTBA 4D9RD 4TQ8A 2ZUXA 3RRQA 5J3HC 2HFED 3KWWA 2ZXXA 2YRZA 4M6NH 2V3DA 1P69B 4JFEA 3QIBB 1H15B 3H1ZA 2VMCA 2IAAC 3ZO9A 4ELKB 3OTTA 3PIQA 4AK2A 5I73C 1S4IA 1NWOA 2F61A 2NY7H 4GG8B 4TM9A 4R2GB 2BFVL 4WAFA 4E9TA 2FEDC 4YZFF 5G5DB 2J88H 3AITA 4NUGH 4LRNH 4M8VA 2BNQB 1AMYA 1OAQL 1TF4A 2VDKH 5KS9E 4F58L 2X5PA 3GLAA 1A02N 1KPRB 4K5NA 4RRPG 2XKNB 4OJFL 1XCQB 4EBQH 4N8CH 4KKCC 1NAMB 1G7QA 4U1LA 4U1GB 3B8YA 2Q0ZX 2ZOLB 4NWTL 4HJEA 4MA8L 1G7MB 2DH3A 4BK5A 1OLLA 1QSFD 4PJ8D 3HAEA 2X9ZA 1X9LA 4H25A 1NKRA 5HPOA 2R8SL 4KNUA 2XY1A 1B4RA 1RP8A 1MCWW 1BXUA 4JFDB 5SWSE 3TN0A 2QDWA 1ORSA 1X6NA 3NSFA 2VB5A 3CDZB 4GI8A 4KPHH 3TA3B 4B96A 4DKFL 3U6XS 4X4ME 2VLJE 4WKZB 1RI8A 4LMQE 2XWDA 4FMKA 1PZ2A 3LH9A 4LEEA 4X99A 2J12B 4C83A 5B8CC 3EHBC 2UX6A 3FZUD 4PCTA 1AE6H 4I1RA 3BXNA 2M2DA 3HZKB 1RY3A 3D12B 4FADA 1SNRA 1J8HE 1HNYA 3SWKA 4KXCA 3CCUP 4MCNA 4P2CG 1UD3A 4XVSL 5F0MB 1X5HA 1H0DA 5CLZA 1A6UH 2V7NA 3T08A 1Z3GL 4M6AA 3V5HB 4KWUA 3N85H 1HCZA 2VAAB 4TOYL 3VU1A 4JGJA 1BF8A 4F7EA 2FRGP 4YJZL 4X6CB 1CK0L 3SDXF 4PJDA 4DETA 4LARL 3B2PA 4LOFA 1Z1WA 1XGTA 5GS3A 3IF4A 1MVYA 1SFDA 3ZDYE 4HW6A 2WO2B 1G9NL 2OQJB 3FU7A 3LHAA 3TJHD 1EZVX 1B4JL 2ENPA 3TN0C 3KWUA 4TTGA 1AMXA 2ZWZA 3R4RA 3LQAL 4MAYA 3WKYA 5APSA 2OMNA 5KBDA 3G5YB 1RSYA 5FOBB 3VG0H 5IF0B 3B5ND 4EQ2A 3GC3A 3F05A 3U2JA 2E4TA 1QFUL 4GLRI 5DI8A 5HYIA 5JTWA 2EECA 3LSOB 1N7SA 4ZMTA 3BH8B 4PJHA 4UIKH 4BZ1A 1J5HA 1F4YH 4Y5YB 4XXDA 5A6IA 1PBYA 1A47A 4QRSB 3WUWA 3MC0A 3CN2A 3SDAD 5DK2A 3O3DA 3S98A 3D06A 4MN4C 4YXDC 1MWAB 2BHZA 3PP3H 2BCMA 3D39D 4GBXC 4DEWA 1HOCB 2RR3A 3ERXA 3EFOB 3SIKA 3UJJL 4MMZC 5BVPH 1MEXL 5AVUB 3IDNB 3TASA 3U0WH 4TNEA 4DP6X 4N2MA 2R0LL 4S1QH 4TNVF 3S34H 4LLYB 2X4RA 4MAYC 4O2FA 4BK8A 1SJEB 1ZJAA 1YYLH 1VPCA 1NDGA 3CI9A 4G8AC 2EDJA 3DTDA 4GUCA 4BWTA 1PGPA 1RAMA 4KNQA 5F3BB 1T1WA 1FP5A 2XFXB 2ZOUA 1EAJA 2VDNB 4PRIE 2OTUA 3T6VA 1YNTF 3MLUH 1QFWI 3A0OA 3EGXB 3HUJA 4MAZA 4CU7A 3QUHA 2DQTL 1N7SC 3H1IE 1CLVA 1E4XH 1F3JA 1UA3A 2H32A 2WD0A 4GXVH 5E6SB 2VZOA 4U6XA 3W56A 3IAOA 3CC7P 2F8XC 4EJ1C 1JXJA 3NA9L 1RIVL 1BSNA 1HHHB 4HLJA 1KILA 3QUZA 4Z9KB 1BLIA 5FW6A 4OFQA 1BBDH 1GGYA 4WI9A 5EBLA 4GO6B 2NW3A 2AJXH 3N42B 2C9RA 3L3HB 3PXHA 4JRYA 1KJVB 3MNDA 2K88A 1EVTC 4MB1A 4X9YA 3WKQA 2R5BA 2HFFA 2EDEA 3FO1B 1NTZK 2GQHA 4AYDC 2OR7A 3A67H 3VFRB 4PY7A 1OZUA 2FYUE 2NXZD 4NO3A 3U4BL 3VFTA 2GJRA 1DBKL 4N8VG 3L1EA 2J7LA 3G6JA 1OAUH 3U46A 3LNGA 3G9AB 2FBJH 4FG4A 5DRZA 5I1HL 2P7TA 3I84A 4EUPA 4NHUB 5E5MA 5JIKA 1IBFA 2WT7B 4FXKA 5EBMB 3N0PB 4Y5XB 1GC1C 4JJ5B 1JY3O 4P2QE 4MQXC 4C56A 4QXTB 1A7BA 5DZ9A 5MENB 2FX8L 3L54A 1KILC 4JKNA 4LEBA 3PWNA 5C0AE 3NP3A 4JFHE 3NJLA 3Q8FA 3VTMA 2OARA 4OZGB 1HKLH 5E1GA 2ZYHA 4N87A 5ALBH 5IHZA 1VFUA 5FYKL 3VI4F 3DRQB 3QEHA 5AYUL 3OB8A 3UX9B 2EUWA 5F7KC 2P43B 1G7JB 4HKBB 4AW7A 5AKVA 2AEWA 3GBDA 2XI9A 4Z0BH 2I27N 2RH0A 3WEXB 3NSDA 2I9LB 4WW1A 5GSVA 3MHVA 4PJXE 5CIPH 4YHIB 3P2DA 3PHQA 4V1DB 1A25A 1TEGA 2UYLB 1NTKE 3H3PL 1XR8B 1ZE3C 3HW7A 4PJBA 1P84E 3SZKC 3QQ4B 2P8LA 3L3JA 4WWID 2FH6A 3KL0A 4FXKC 1F1GA 5IK3A 2CO7A 3QE5A 1CDIA 2PCFA 4N0YH 1LL1A 3ZUNC 5GJSH 4MNHA 2HPCA 1FGVH 2IPUG 2YPKB 2IQAB 3SJVA 4H0LC 4BHUA 4FLHA 2AEMA 1VDGA 1TR7A 2WITA 3GB7A 1RVFL 5GS0L 1MRFL 2ZUUA 3F7QA 3V7MA 4Z3JA 4AIZA 4ZK8A 1FZKB 1PTZA 3E1ZA 3K1KC 3QXUA 1CFSB 1EZVE 2VXTH 3PWPA 3MRGA 3V5DA 4WB4A 1L0LD 5CCJA 2DQUH 4Q74A 4JDTL 1S3JA 3K8KA 5MP6H 3VGEA 4U1KB 4HJJH 5GRUL 3AEEC 5GRVK 2WSDA 5DK0A 3IEAA 5ITBH 4Y16C 3EIFA 4XPAH 3IPEA 3GMPA 5F6HI 4PJEA 4FFYH 3MNVA 2X2YA 2EDMA 3IU3A 2AK4E 7TAAA 3IVKA 1AZZC 4UAOC 4P23D 5TGBA 5FUZL 2J8UE 3ARGD 3ELAT 4W7ZA 3FMGL 4OLUH 4RISL 4W9CC 1OVUA 1XF4A 5GSRA 5IOPB 2ZUSA 3MNWB 1DD4A 1IGIL 1KLFA 4AGLA 3LTVA 2H89C 4JYCA 3IFLL 2KZBA 3QDMB 4IBYA 1QEWA 4HISA 4N22A 4O58H 3UBXI 5ALCL 5ERWB 1A7PH 1MJ8L 3FPYA 3TVMD 3RK3B 3ZK0A 1VHPA 5GGVY 3D7PA 3OMZA 5TTRA 1T5WA 1TJMA 4P4KA 1OAYH 1VQNP 3KZIE 4YAQA 4YVNA 2ZXEB 1VA9A 2C1OB 3MV7B 4JHAL 5HI5C 3CX5K 1PIGA 1AQ5A 1KDJA 3DX1A 2XWTA 4PGCA 3BHBA 4OVVA 1HHKA 1AZRA 1DUZB 1PKOA 3K2IA 4NJAL 5CUSL 4GKNA 4NHCH 1IFJA 2Y1AA 4I89A 4Z7UE 1XCTB 2Y0DA 3HMXA 3IMWA 3X3GH 2K6ZA 4R83A 2BX5A 3EDJA 3KE0A 4J8RA 5T3ZD 5AW2B 3CVHH 4BFJA 1L0LK 4M7ZB 2EE0A 3MIWA 1UFUA 4CPGA 1NCHA 2YR3A 5DS2A 5IW6B 3CBKB 2V7HA 4L76A 3L4FA 2HLAB 1PGJA 5I1GH 3GSRA 3VXOA 4LSVL 4M3JA 4MYPA 4JYBA 1UUNA 1XF1A 3FU5A 2CLRB 3GHPA 3QWQB 3TJPA 4AT6B 5F7YC 3EJPA 5HPMA 3DSNA 1KWGA 5LWYL 4P4KC 4ADIA 2EEXA 1NC4D 3BZ4B 5CN1A 2GSMB 5C7XL 2B87B 2I07B 4GG6A 1OTSC 1EXUB 5KS9B 3MUGB 3DMMD 4I0CC 1MCOH 4ABVA 4IKJA 2QMJA 2P1JA 5D6DC 4BWUA 3LH8A 3AREC 4K71C 2OW7A 1KN7A 5LGYA 3TFKC 1Z7JA 1YHQP 2ED8A 4L37B 3CSBA 3VXUA 1ETZA 3CZUB 3RUGA 5I8CB 4ZQTA 3EJCA 2BXZA 2D9CA 1MLCB 3VW3H 5SWSB 4RJTA 4HXAH 3GHBL 1NEUA 2GIYA 2JQMA 4J3UA 4BDVB 3D18A 1OHZA 2HX9A 2MNWA 5DD3L 5GGSA 2O01H 2D7TL 3AT0A 4HF5L 5DMIL 3HS8A 1G4MA 2VLME 2E7LC 4Z77A 1FNSL 3PS6A 3ZXAC 2YC1A 4TLSA 2FT6A 1R5WA 1P7QB 1ZRTE 1TFPA 3QISA 3QH3A 1J8HB 1FWXA 3LN9A 4H88H 4ZRGA 1NPJA 4XWGH 3HR6A 3EOYG 3MRJA 3JZYA 1N12A 1SQ2N 4MNQE 3GHGA 1MW2A 2CGRH 4LCUB 3CFBA 4NBZB 4PJ9C 1JV2A 5IEHB 2NY5C 4JZJB 1CDJA 2NZ9D 2A83A 5C8JB 2Q8BL 5LCVA 1OGTA 1OQOA 3BH9B 1T66D 3DJRA 3NFSL 1SQPD 4IEFA 4E41B 4EXKA 5C0CA 2YN5A 2FO1A 1SYSA 2OM5A 5DGQA 4YX2L 4M43L 5D7KE 3ZDYB 1LE5B 5C2BH 3B37A 3NAAH 3UCRA 2OMVA 4FFVD 2O5ZH 2WTYA 1WRGA 5EZPA 3UH8A 4TVPE 3UO8B 43C9B 5C3TA 2Q76B 1F6AB 3KYMA 5HJ3A 5DQ9B 1X5ZA 3DDGA 4PS7A 1OL0A 2IADB 3L9YA 3EJYD 2WLJA 1U3ZA 5HJGA 4ZUWB 3CWBD 4PWFA 1KFGA 1RJYA 3HRPA 3A3YB 3HPJA 1ZK5A 4MSWA 5HI4D 1OTTD 3QB7C 3BPCA 4HHGA 3HE6C 4ONHA 4DK3A 1BZ7A 3GM0A 3U7WH 1KB5L 3CMEP 1FLTX 1MCBA 3GHGC 3IJSA 4IRJA 5JHDE 1PP9G 4J23A 2GB2A 5HD8D 2F7OA 1JK8B 4QKTA 2JWYA 4R7XA 1KCWA 2CWRA 1Z0NA 5FO7B 2WWMD 2WBJB 1FDOA 4G7YH 4D8PB 4OB5H 3H3BC 2X6CA 3L2MA 5I0WA 2OYIC 1U2HA 3USSA 2CRIA 2I7OA 4Q58C 4W9EC 2XVBA 3CZFA 3FTZA 1SQBD 1EXHA 4HKZH 4U1SA 1SQVD 1YMHA 3GJFA 5TDOB 4OZIF 4Q4IA 2P9RA 1E9PB 4KMQA 2B16A 4AQAB 1QP1A 3DHMA 1CZ8L 3PDGA 4M1CC 4PRIB 2MSPA 5CZXC 5D7LD 3DOHA 3NH7H 2OYHA 3CCJP 2PP6A 1BEXA 1RUML 1S5HA 1WK0A 1ZJBA 3C2SA 2XPYA 3J27A 3AG3B 3HG0A 3F7LA 3OAYH 4D0BB 4ZQKB 1F97A 2XBDA 4QRQB 4TPRH 3JV0A 4X6DE 1XB8A 3WJMB 4IRJC 2HT2C 3LKSB 4IGBD 4NZFA 1PGQA 1QUNB 3V7AG 3GLEA 2PYEA 4G3YH 4LHQB 5ECJE 1YEHL 2WLLA 4NRXB 4NO2B 3OKEB 2N9YB 5TFSL 1JZ7A 2K7PA 3NCMA 1DQQB 1QBML 5C09E 4HEPA 1WUZA 2GJZB 4ZTPL 5F70A 3AABA 4IU2B 3NXSA 4QHUB 5FA4B 2VERA 1ZHNA 2FHBA 3G6AA 3NZHH 1NCNA 4V2CB 4ZDHB 1AY1L 1S7UB 5FB8A 1QRND 3D39A 4JO4H 3MRPB 2G60H 1DLFH 1ULVA 2HJKA 3L3DA 2NW2B 3ARZA 4IRSD 4IFFA 3S35L 3BLBA 4KK8C 4PRAA 4JKWA 3VX1A 4HG4K 1WEJL 4MMYB 3FKUS 2P26A 1X22A 2XHNA 4P2QB 4M7LL 3FXDA 3SFDC 1E9QA 1MHPH 2J1KA 4M4RA 2P8MA 4QRPB 4UI2A 2JKLA 1BVNT 3AGWA 3O4LD 4KTEH 5C0AB 2H0FA 3D25B 1GW6A 4QHLB 1DVUA 2ZXBA 3LEXA 1NIFA 4LK4A 3EOTH 3HNVH 4XP6L 2Y1ZA 4Z7WA 3RY5A 5IMLA 4GRWE 1M7DB 3NCJH 1J1DC 3APDA 4YDNA 3CFKB 2CDFB 5FXCH 3J7HA 2K7QA 3R1GH 4P9MH 4BCYA 1XV8A 1A6ZB 2P5WD 4KQ4L 1YRKA 2CGYA 2UZIH 4FHKA 3DGDA 3SYAA 3X1GA 4AG4H 1I7TB 4PJXB 1MAJA 1L0NG 1D5BA 2VZUA 1D5MA 4AQ1A 3GPSA 1AXSB 4POYA 3QAZC 3RE0A 1RLWA 4R97B 1W0VB 3GI8L 4XVJH 4LPVA 2JWAA 3U1QA 4KZEL 3BEVA 3GXDA 5E8PB 5JPNB 1CSBA 1HSAB 3AXLA 3CXHE 3H7LA 2BVEA 3K2KA 1HXYA 4X50A 3L9BA 2ADIA 4MASA 3VYOA 4U1HA 2P7JA 2JCCE 1VF5D 3QS2A 3MRHB 3ZU8A 2LU3A 1TO4A 1SFCB 5I82A 1DBBL 4UTAL 1CXFA 1EZVY 4GSUA 3WFHA 1PSKH 3IKCA 2BW5A 2XWEA 4UM9A 4NZTH 4WY4B 1CC3A 1T1ZA 3ZZSA 2DL2A 3TH4T 3RGVB 3T77A 3T6QC 3JTTA 1JMMA 5EU5A 2OL3H 1KLGA 4EVNB 4PJGF 4AQ1C 1PZ5A 1J18A 2P67A 3KVQA 3MR9B 4N90E 5ACLA 15C8L 5ESAA 5LO7A 4HJGA 5K5YA 1WMKA 2CK0L 2AK4B 3ZMNA 2GCYA 3QJQB 2J8UB 1JF5A 4FNRA 4EKJA 4L29A 1NCDL 3WFCH 2DI7A 1ECZA 2OX5B 4LCYA 2QTVA 4MS8D 5IROA 1QKZH 2ATKB 4RDQG 1NDMB 4M5ZL 3TNNB 3MA9H 4WDIB 4WWIA 2QSQA 4JK0D 3IDGB 1MFDL 2H0PA 2Z8SA 1SVCP 1MCQA 4KHXA 4XA4A 1CICB 4KI5E 3H42L 1RF1A 2GAZA 2XXFA 3I2CL 4M62L 3TIDA 4BSJA 2OULB 3V4VB 4Y2LA 1V8HA 3R8BB 4KVCL 1NCUA 3TCXA 3T2PA 1CXHA 3GMRA 4JPVH 1PG7X 1U6AL 4JG0L 1GOGA 4N8PA 5IJVA 4A39A 4A7GF 8CGTA 3HC4H 1TJIH 2VERN 5DXWA 2F58H 3MOBL 2ATAA 3RKPA 2QQLH 3FCBA 3ARFB 1AS8A 2YWZA 3UZVA 6TAAA 3KPRE 3PP3K 3B2UC 4KAQL 3BAWA 1SUJA 2VW6A 3GIVB 5BQ7A 2IPKB 4N2AA 4WUKL 1AZVA 5IROC 5EU7E 4I4WB 4JFFA 1DP0A 4TYUA 2XQBH 3QEUB 2JP3A 2ZG1A 3GXNA 3FUNA 3LEYH 5HGBB 1RF1C 5HGGS 5E5UB 5FGRA 5JUEL 1KFAL 5DGRA 1ZT4A 3WKPA 3MRKB 3NEEA 2IQ9L 3QCTH 3QXVA 1TENA 4N2DA 4KJQD 2FR4B 3TYYA 3SDDA 3DDFA 1A7QH 1KJ2L 1N59A 3PP4L 5IHBA 1ZVYA 4KDVA 3RB5A 5ISZD 4XMKH 4RGMB 2NDFA 3QUMB 2FO4A 3VJ6B 1FHNA 1JNNH 2X42A 3PWLA 1EUUA 1HH9A 3VDAA 2M5AB 4IBLT 4WNQA 2ICCA 5DJAB 1OP3H 2YJLA 5FDYA 1TIUA 3KXFE 3O6MH 3QDJA 1G43A 2GJ6D 3RWEB 3IXAB 5LGHH 1J0ZA 4XMWA 2CBTA 1NTMK 4MNQB 4JFWA 3MV11 3V6BR 4OJAA 1ED3B 1DBJL 3I3DA 2OTLP 5IW1B 4IBTA 3HS0B 3VXMA 4TNFA 5D72L 4GUOA 2EYTB 2BIQA 4HOZA 3K6SA 4N6JA 3QI9B 5K9JL 4MDIA 3QCVL 1LWUA 4AYCA 1ZMEC 1CTMA 2XZCL 3TONA 2AEQL 1GVIA 1FVDA 3HRZA 5EUKB 2QT6A 4JQXA 3LKNB 4AVKA 3DMMA 2AW2A 1ZVHA 1FJPA 4DJGA 4OWFA 2XNXA 3STLA 4R84A 5I6XB 5CBEB 3L73D 4IJTA 2YAPA 2N0MA 5IBUB 4WWKB 2DM2A 2K45A 2UXTA 3ZIYA 5JQ6L 1Z6JT 5FEBA 3C6LB 3HMWH 5BU8B 4HIIB 4HIHB 4I13B 3MBEB 4L1HA 3FUDA 5T3XH 1VKXA 4HJ0C 2IH1B 1Q9LA 4PRHA 1TTRA 3X11A 1JMBA 1YZZA 5JHDB 1H3TA 4ZJ9A 1P7BA 1LLAA 5K9OB 5K5GB 2Z1KA 3UEZA 1MFTA 1AGFB 3QNFA 4KKNA 3QORC 2YQ2A 1WZLA 2DQEL 3AE4C 1B0RA 3UMNA 2X38A 4HMDA 2A5UA 2ZXCA 3AU0A 2IPPA 4NKMA 3HRZC 5LQBL 3KBFA 2I9TB 2YZ1A 4JQXC 5CJ5A 1BQRA 1OEZW 4LGPB 1JHLL 1F6LL 3O8XB 2YXRB 3FWLA 3N0AA 4N1CA 4J3OG 1E7UA 5IMKB 2IZ1A 2OAAA 1XIWB 2DLGA 3MRNB 3T4YA 4ZUTB 1IM3A 3C5JA 2HVKA 3OXSA 5AD0B 3S5ZA 3VGFA 1ZS8B 1GU4A 3HTKA 2CPUA 2Y5EA 2NY3D 5F7EH 2AV7B 2E56A 1KWKA 1MIMH 5DUBA 1JE6A 2XPZA 5IUSA 1DVXA 4PG9A 3BD3A 2CDGA 1BVLB 3LN5A 2IEPA 1NCJA 2HTLD 3DVGB 4WQOA 2KZKA 3RK2B 3V4PA 4J27A 2PWFA 1I9IL 1CUOA 5LVEA 1SN5A 2ZUYA 1OD9A 3BUYA 3P02A 4B27A 5EPMA 5TQ2H 4KHTH 1J10A 2JVUA 2V0AA 3NIGE 2BSSA 4KC3B 5T5FA 2WLKA 5HDWA 1IEBA 2CH8A 4BSVA 3BP7A 2BP3A 1FVCA 1UGKA 4HA1A 3ULSB 2GT9B 3KVPA 4I9WE 1QRKA 1QFOA 3OD3A 3MLTB 1FE6A 3VMYA 1UD6A 5J6HB 3FS9A 3WBDA 3WLBA 5I23A 2HLFC 4EN3A 3HVDA 3QG7L 3T1WA 5DD1L 1EGJL 1WC7A 4ZD3H 3WGVB 2EABA 4UB6E 2D3JA 4AL8H 3FB6A 1KELH 2EUZA 5EU3A 4JFVA 4I2XA 1U0QA 1SLXA 1FCCA 3SKOA 3A24A 1FL5B 1P0SE 1SVBA 1UH4A 2YBRA 3QJSB 4AUWA 4LXFA 5AWNH 4BWWA 5AVTB 1SDDB 2RQ8A 3VD2A 3U7YH 5APTA 5I1IH 1Z32X 4U3FG 1LGHB 1JNLH 4PMFA 1V3MA 3KJ6L 3B8SA 2V37A 5EU6A 2HB0A 4IKNA 1IGMH 2VYRE 5D7LA 1TEYA 2IBZG 3H1HG 3D34A 1OP9A 3NYKA 4GRWB 4HUNB 4R3SA 4EE2A 2MCPH 2WXPA 1YEFH 2F19H 3Q1SH 3WELA 4QXVA 3HHRB 4P9HC 1T20B 4RAHA 1ZA3B 2XJLA 5F88B 4AM0B 2Z8WC 4Q9BA 2YWYA 3MRCA 4IGBA 4JY6B 1T2QH 3K8MA 3DK0A 4YDVA 2R69H 1YQ4C 3VXRE 3OF6A 1Q1PA 4KRNA 1FYTE 4N2IA 3IJ8A 5F21B 4EN3C 2W6JH 3C2AH 5HHOA 2X12A 4XO9A 3TGUD 2PF6A 2W0KA 2BDNH 2O6DA 3TF7C 5AOKA 3F7RA 4FYSA 1ZEAH 5D1QE 4B9KC 4U3CA 2AJUL 2ZPKH 4PIRF 3NJJA 2ZKMX 1T04B 5LKNA 1U3HB 3P77B 4H2AA 4HKXA 2IGFH 4NQSB 1FZOA 5JIHA 3FQNA 3SPGA 3SSGA 4E9LA 4DO4A 5IQMA 1GY2A 3WUZA 4NS0A 1QRNA 1FZGA 4FQ2H 4ENZA 4BE5A 2JCCB 3QW9A 5D7IE 6PAZA 3QUGA 1E6JL 3TM6A 4N5ED 2FHCA 4Q6YA 4PRDB 2UWEB 4ZX5A 2Q6WB 1FFNA 1QHOA 3P2BA 1VGEL 2ENJA 3QARA 4AJYV 3REWA 4NZRL 4C4KO 4F9LA 5KG9A 4XRCB 2EO7A 5J1AB 3E6HA 3CDYA 4FL4B 3ULVH 1K73Q 5IVNA 1CD0A 4NRZB 2V5RA 1V55B 1MOEA 2C3XA 2O6FA 2Y36H 3OKLA 5G55A 2UXVA 3L1OL 5AYTA 3WIIH 3TIEB 5CSBA 3ZT6A 3T0VA 1BD2D 1KPVA 2Z6FA 2NXYD 5D2NA 2B7DT 1FFOA 5HYJA 1ASPA 5EUOA 5DDHB 4E9RA 1RZJH 2CLVB 2CO2A 1WLHA 1MLBB 3N1FC 4IBSA 1SRDA 3G5XB 4P46D 5DVMA 2P8PB 5K9QG 1I9RH 1IC5H 3UAFA 3DV6A 4XPFL 5F7AA 3EG9A 4WHTA 2L0DA 2M8XA 2Q7YA 4RQQB 2AJ3B 1I7RA 5T1KA 2F8OA 2Z4QB 5EOQH 3GMNB 1JZ2A 5E08H 3G08B 4OFKA 5J9PB 5L7XL 2JB5L 3KR3H 5E24E 2IAMD 3QXDB 2X1PA 4LDLB 1LTBC 2VITB 3SCMB 5M94B 1LYQA 2GSGA 3EUUA 3SKMA 1AXIB 2VLKE 3IJYA 1SM3H 1EFXB 1FG2A 2K9YA 2YEZB 2WZAA 4YZFE 4L2YA 2X7LA 4NWUL 4ATWA 3WXWL 2NDGA 2I5YH 2R9HC 4UMSA 2J5WA 1U8JB 1UXWB 3I85A 1O5PA 3JWNE 1ZLDA 1QNIA 3GMLB 5D2NC 3O0RL 2CKBL 3S3JA 1CQYA 2OZNA 4EI5B 1DUYA 1XGRA 2F53E 1VENA 3LQAC 1Y8AA 1DVZA 1RULH 1YCSA 3KPRB 4F2EA 5ICZA 3N44F 1M05A 3GXUB 3C8HA 3UO1H 2VZ1A 2PCPB 3VWKA 5E6RB 3HG5A 4ES9A 1B88A 3RDTC 4GW1B 4XNUH 2YA0A 2Q7CA 4HAKA 4MKTA 3OGCA 2E74D 3ZDXF 2VRSA 3ZE2F 3ABZA 3ZRFC 1HVVA 1MF2H 3RL0B 3CUPA 4EIUA 1UOLA 4PD4J 4F57L 2V5SA 3PNWB 4QCIA 4PTTB 1MKFA 4ODUB 1I1AD 3GSNB 4P4RB 4M48H 4D3CH 4DP2X 4UQCA 4JFEE 4J3BA 4DKEL 1WUNT 3N9GL 5DLML 3ULUD 1XVSA 1JUNA 2CRMA 3S5LA 5C0DB 2ITCB 3CQFA 3EJQA 3QHFH 1M4KA 1CLOH 3L4ZA 3I6SA 5I8EA 1UM5H 4I6MC 1F4XH 1WQVT 4JHBA 5F1IB 3RNKB 4D7PA 2PWHA 5HDLA 2WWWA 2IGLA 3R7RA 1PZAA 1Q4NX 1NGZB 2VDPB 5LAPA 1FNLA 1NIDA 4X8XA 4NQCD 2X4PA 1HILB 3LRGA 4QHMB 1G1KA 2WSFH 4U2ZA 4HC1L 3V6FA 4FKKA 1IT9H 2AI0H 4W9KC 4WI8A 4D6TJ 5IG7A 3K74B 3VWKC 1MFEH 5KSVA 1RD6A 2N59A 2RCSH 5D1XA 1AD9A 1S7XA 2N7BA 3OKDA 3S48A 3N06B 3OX8B 5GIRA 2M83A 3RWJB 3V0WL 1U8CB 3VFGH 1KJMB 1TDQA 4YZWA 5EOCL 4FF9A 4AE0A 1RZFL 2PW1B 4MFHA 4KQ0A 2EIZA 1A7NL 1CL7L 2WVSA 3G6DL 3KLDA 2WLNA 3HBZA 3O6KH 3B7YA 4IW4C 4DP5X 4HFUL 5CSZA 2GI7A 4J3OH 4KX8A 2OMYA 2D7QA 3PPSA 1ND0B 4H1LA 5AZ2H 4Z5RB 2R4RH 3V9FA 7FABL 2AXJA 1L0LJ 2AVFA 1YUKB 3M7FB 3VFWB 1FZMA 1G1CA 1ZWIA 3E9TA 3KL3A 5M1BA 1R3HB 5IMOA 3TP4A 1TKWB 2Y3AA 4X5WB 3B1TA 3F3HA 1B4TA 1N6QH 3UTTD 3X1BA 3T0WA 4PJDE 1H88A 3GXFA 3FX0A 3QO0A 1IM9D 2WSCJ 3VH8B 1ZIAA 25C8H 1YI2P 2C3HA 3JCUE 3QEQA 2AJYH 1G87A 3DBXA 1YTZI 4XBEH 3RWDA 3HBQA 3JC22 4PB9L 5D1XC 4YS4A 3GI9H 1IC7H 1GY1A 4HKJB 3M91A 1M1JA 3GO1H 4WFEE 5DQJB 2JTDA 5FDWA 5EZIH 5A7BA 1PS3A 3MJ8B 1GD2E 1PJ9A 4YNYA 2YUZA 5EORH 3U0PA 3OR7B 1WGVA 4LSUH 4HIXL 1R5VB 1FO0B 4ZOEA 3HE7D 5HVWA 5I1KL 1K05A 1OWRM 2G0LA 2D2CD 5DFVD 3MRBA 4PJHE 2FCBA 4N0UB 1ROWA 4ZW7A 3BGMB 3Q6GL 4I5BA 4Z0XB 5E8NB 2W59A 2EDHA 5HYQA 1EDLA 2V17H 3M46A 4JDZA 1B2WL 1MJJA 5CFAA 5J1TC 1BZ8A 2F54D 3KLSA 3R06A 4OIFA 3RWHB 4AMKH 5FFOA 3QUXC 1A0QH 1HT6A 1F0LA 1OAKH 1QI4A 3FTGB 3KJ4C 3MCLH 4PUBL 5I17A 3GMOB 2BS8A 5DZNA 1FDIA 3S4SA 3SSUA 1TJXA 3BVTA 2ZCHL 1P5VB 1JOCA 1YC8A 4WVRA 3MRFA 2CJUH 1Q0YL 4ZFOL 1U33A 3ECBA 3ZTNL 4NP4L 4ERSH 2WWKT 4O02B 4UZSA 3SDCD 1M1JC 5HDQH 3B9KD 4WLCA 2ZYIA 3V8CA 5D70L 4RGNB 4XWOD 4BE6A 2FLMA 3A22A 1A64A 3VP9A 3NFNA 2NQCA 5GS0C 3BZFB 3HUJE 3NIGB 3OXRB 2UXFA 3IMUA 1MZ9A 2AABH 4BFFA 4YDKL 5CD3B 4YPCA 4ZW8A 4RRPA 5L2JA 1HHGB 1S9KC 1AVYA 4IIZA 3VI4E 2H0JA 2OS7A 4Q6IB 3L81A 3P69A 3WEBA 4AJWA 2AXFA 1U4EA 4H20L 2JK5B 5DYOB 3FTVA 2XXMB 5E6IC 1BYPA 1Y18A 2PPDA 4IRZH 1BQKA 4JRYE 2WQAA 2WANA 5EOTA 1MWAH 3V95A 1ACZA 1G0XA 3DUSA 2LOEA 5KW9H 5E9DE 3FOLA 3I9GH 2XFGB 4XOAA 3KPPB 3Q44A 2FATH 3WTWA 3L3KA 3NEOA 2X88A 1A3LL 1LD9B 1RZGA 2PCYA 3MFFA 4APXA 2D9QB 3GF3A 1QL1A 4H13B 3G6JE 2OMXA 2WLZA 3VQLA 1UT1A 4BBWA 3BCCD 3TDKA 1X5MA 3UAJA 2FJFB 2VR3A 4KOCA 4Y4KC 2VDNH 5DR5L 5IQNA 2ITDA 1N7LA 1JUFB 1GJIA 5I5JA 4K3DL 3U1SH 2YGOA 4XBGB 4OM0H 3AE1C 4C56E 1FJ1B 2VO8A 5EC1B 2CD0A 4K5PA 3WYRA 1SQPJ 4QAMB 5FX3A 2QQQA 3VXRB 2CQVA 3AAZA 3A47A 2PO6A 3IF1B 4RCAA 3W3BA 3FFCE 1PYWA 3RL2A 3VE0A 1KG0B 4MD0A 4WNSA 5CM1A 3C5ZB 4UUJB 3SQOL 5IVXA 3BSZA 2NR6A 3KW7A 3PDOB 3DHPA 1PLGL 2AERT 1FVEA 3ATFA 4IL6E 1G7PA 1G7HA 5DHDA 3QFDB 2W81C 4K94H 1PNCA 4ONGL 4UOW0 3OLGA 3H1LD 1PX4A 2V2WB 3DXAE 4R6UA 5D7IB 3VNYA 1FU1A 5ADPH 4GOEA 1RJLA 2RTTA 3FB8B 5T3XD 3UBXG 4BQ8A 1N5YL 3N40P 1OCWL 4PJBE 2E75D 1MCPL 4YHPA 4F20A 4I88A 4XN2A 4XTRD 4YLBA 3L6FA 1P9MA 5E99L 4NQTA 3FTYA 4OLZH 5EH1A 3SD5A 3MRQB 4PH8A 2IFFL 4BA8A 1J5OH 3BVXA 4MAUH 1OP3K 1E30A 3SJVE 5I1CL 4OTXH 5FK9A 1MCDA 2PO6C 3ECWA 1UYWH 1IZKA 3PV6B 3CCSP 4LLMB 2JEEA 4DPAX 3ZKNC 2KDYA 3V6OE 3OZ9H 3VI3F 2BVPA 4ODHH 5KSUA 4DNLA 4AYSA 4XNDA 5JPMA 1MJ7H 1EMTH 3VSQA 3MTXA 1AAJA 3QWOB 4PWEA 2XG5B 1SQBJ 2YEQA 3TO2A 5J12B 1SQVJ 3PWPE 5D1ZB 2D73A 2X53A 3ZN6A 2K3RA 2Y7OA 4BRVA 2R2HB 3NZUA 4KKRA 4O9BA 4U4IA 4X0KB 4FNTA 1KGCD 4JDVA 5EO9B 1K6QL 2V8MA 1IFHL 2Q5UA 1VFBA 2XWZA 1IFGA 3KPMB 3L4UA 4UCFA 3FUHA 4PJEE 4QTHB 4K5MA 1H5BB 3UTOA 1LO5A 4U1JB 1XF3A 1JY3N 2YD3A 1NU1G 1XGQA 3LOWA 4LQFH 5SWZA 2PPAA 3CXDH 3LH2L 1P9MC 1T5XA 1YAZA 4X83A 1JZJA 1KB5A 1ZGLA 2YXMA 1P4IH 5CF3A 1J5IA 5FS5A 3GXPA 4K55A 4NKOB 1NYHA 1GAFH 4KJYA 2WTOA 3MKKA 1NFDF 4PJ5D 2IV9A 1L0ND 2BEQD 1ACYH 1C7TA 1D5IL 1NGWA 2ZOTA 5DD6B 5JPMC 3D3VD 1A9EB 3ARBA 4LOVA 4NI6A 3REVB 3D2UB 2F18A 2ITAA 1GSMA 5E0QA 2B59A 3PABA 5CGMA 1FBIH 1OCCB 2KLTA 2NCEA 2WINA 4FQLL 3LB6D 4K9JA 2J88L 2F53B 4L4VA 5IHLB 4GODA 4H26B 4HGWB 4KXBA 3O9WA 5IZ7A 1X5KA 4N8VA 3N7NA 4HMCA 4ODVL 1DBAH 5CEZH 4CGTA 1I8UA 4HLEA 2X0VA 1GGBL 4JO3L 5E2VL 3J8F7 2Z1PA 4U3SA 2KLVA 1Q9WA 5DJXA 3RVVD 3MLSH 1AHMA 1U4FA 1DL7L 2B39A 4AW4A 1DQLL 4HAFA 5DJ0A 1OV8A 3H9SE 1YECH 1T1YA 2SODB 1AV1A 1KMIZ 3KWWB 2DZEA 2EDKA 4CSSA 2KZWA 2VC2L 4GMSH 4JFEB 3T9WA 1JGDA 3PIQB 4Z7OE 3V2RA 3PL6D 3P8MC 3U9PL 3ARBC 2OTKE 5J6SA 1OPGL 1Y6KR 4G9DA 3II2A 5AW0B 1IIKA 1KCVH 4YFDB 1AKJD 3A6OA 2FX7H 4GG6E 5EFWB 2BJML 1MRDH 4Y28J 1OVRA 4ZS6C 5GGVH 3NFPA 4F7TA 1G5AA 1EIBA 1G7QB 4U1LB 4EYYQ 1E3ZA 4KVNH 1GZQA 2CO3A 2BFGA 5E2VH 3A4FA 4D9QD 1XCXA 2NT0A 3HAEB 4FMVA 4UU9A 3U36A 4H25B 4N0CC 3UJTH 4YHZL 4HWUA 3VMPA 1Q9KA 1RUKH 1QFWL 1U8KA 1FNFA 3DVNA 4JM2A 2G30A 3NCXA 3QC5X 3W38A 4MQSB 2H43A 3MMEA 2EKSB 1ORSB 3TO4D 5D93C 4OSUH 1NGYA 4MWFA 3ZMEA 4DJMA 3L71D 3ZE0F 4OF7A 3R4DA 4C83B 4X99B 4X6EA 4XVTL 3EBGA 4HEMA 3LD8C 3TJEH 1MY7A 2IH8A 3GWJA 3BXNB 3K2MC 4ZZKA 5LJYH 4G7VH 3HR5B 4N6RA 3EGDA 2VR7A 5I28A 1ITBB 1EDQA 5A1AA 4D9RE 3AC0A 1DQMH 3U6XA 3ULVD 1LE9A 3ETSA 4W4OA 4F3FA 1FPTH 1S9WA 1H0DB 3ABKB 3EDFA 1I1AA 2V7NB 5C0BA 5EV7A 4FTVA 1SJXA 1FGNL 2OBGA 1SQXG 1JF1A 1JYNA 2JKRM 3CVBA 4JGMA 4NN6C 4F7EB 5I8OL 1JTTA 4PJDB 5C0CE 3WO3B 1T2KC 1LO0L 1XGTB 1OIOA 4XH2A 4FFWD 4TNWK 1S72P 2CXGA 3WS3A 2CM6A 3A0HE 4JM2C 2HFGH 4OGQD 4HALA 4UT7L 3TV3H 3FU7B 4HH9A 2OZ4H 3HS9A 4F7CA 3CZKA 4OZIE 2OV0A 5B22A 5K1JA 3ESVF 4MAYB 2UUDH 2H6PA 3HBPA 4XN8A 3HG2A 3GUTA 3IN6A 1GJWA 5LNDA 1U57A 4QT5A 3X17A 4OT1H 1RJZA 1Z9OA 5DI8B 5KVFH 2MPAH 4FP8H 5A3IC 1KENL 4IMKC 1TJHH 2JKIS 1N7SB 2BSED 4UTAA 5GHWL 1KEGH 4PJHB 2EDOA 1OWWA 4PB0L 3WDJA 2YHGA 3L08A 4XXDB 3L75G 5CJQH 2B14A 4W4OC 5GZND 3OM3B 4R26H 3WUWB 4S0HA 3D87B 4P2OA 5DK2B 5HI3D 3O3DB 1CFVL 1Z2KA 4CN6A 2DWEA 4YO0A 3VWJD 4OJDH 4QRRA 5KUKA 3L3OC 1PW3A 1KCSL 1S9VA 3ULUF 1NQBA 2MOQA 5E4OA 1MHEA 3M0DA 1QSVA 1QVGO 2X4OA 3V2AR 1HEJC 2DV6A 4QDGA 3MGTA 3BP4A 4P3CH 2AXTE 1N7MH 2X4RB 4O2FB 4KGLA 1TYRA 2C1PA 4CMHB 3AXHA 1OKEA 4DFHA 5DS8A 5KYWA 1NDGB 4RSYA 5FKPA 4DTGH 3IETA 3UYOD 2EXSA 3POCA 4NFBA 4HT1H 1IFDA 2QG4A 1T1WB 3GS0A 3PG2A 2OTUB 3NABH 3TBSA 3HUJB 2YARA 1F3JB 1MPAL 12E8L 2H32B 2WQSA 4U6XB 1ACCA 2BRQA 3US9A 3TX4A 1KUMA 4BFIA 2V9TA 2VDQB 2JLLA 4OLWH 5KYNA 1AG6A 1KILB 3VP8A 3QUZB 4B95C 4B9FA 1R5LA 5M95B 2PYEE 3LIEA 4FEIA 4OCWL 4YK4C 3TESA 5EBLB 3EDKA 3IFMA 2NW3B 4JREB 2R5DA 4I9XA 4JRYB 1E8YA 2YIHA 2K0RA 2HFFB 2VN5A 3HG1D 1TMQA 2NNFA 3QUKA 2X1QA 4GQPH 4PY7B 1FH5H 1UKQA 3RX7A 5C07D 3VFTB 2DQJL 3EH4B 1EHLL 1AR1C 4UV7L 1AGBA 3CIAA 3G6JB 4L3AA 1HWWA 3U46B 2B08A 2FBOJ 4J4PA 3D39E 3PJSA 5DRZB 3WEAA 2P7TB 2J1XA 4EUPB 5E5MB 3E9UA 4FXKB 1W8EA 5BO1H 1PVHA 3LYRA 4C56B 1YEGH 2MRYA 3CLEL 2WVUA 4H0LB 4DZ8A 3PWNB 1VCBC 3QIBD 5F93C 1KXHA 1N26A 4HPYL 1L3WA 4J3OD 1Q0EA 4J6RH 3FFCB 5IHZB 4P5TD 2Z7UA 3QEHB 4ZFZA 4R2GD 3MNZA 1RQVA 2JJLA 2DWTA 5DMJB 2QELA 4DN3L 1E50A 4Y1TA 2A4CA 2BNQD 1P53A 1BQHG 1BZEA 1CXLA 1URLA 3TEZA 3H3KA 5LHDA 2ZOWA 3WNPA 4DOHE 3ORJA 3P54A 3L73J 1JWUA 4WW1B 5GSVB 2C4FT 3BVUA 3NGBC 3PHQB 4K3JH 4J4PC 1KN4H 2WKOF 4LSTH 5ITBL 4PJBB 5JHLH 2P8LB 3L3JB 3QG6A 4OZFA 4JFDD 2CO7B 5IK3B 4UAOB 4PP1D 2PCFB 2B0SL 4MNHB 3TA3D 3WTUA 2HPCB 3AWEA 4G71B 3SJVB 4JBSA 4PM1A 1CE1H 2YIUB 3K80A 4WWNA 3CLFL 4AIEA 4XPBL 3GB7B 5E00A 4B53A 1Z9SA 4LGDE 1SXSA 2Q1EA 4AIZB 3QR1A 2V9RA 4KZDL 1VB9A 1MW3A 1W72L 3B71A 2VKXA 4HS6B 1EEUA 3PWPB 3MRGB 3FN0L 3V5DB 4RAUA 3NCFB 2WYZA 4LFHD 4F7PA 4PD4E 3N41B 1LJ2A 3FF8A 1MFZA 4U3FD 2UZYA 4DKTA 5DK0B 4YTPC 2BY1A 1VQ9P 2Y3NA 2Y7QA 5I1LA 1DVSA 4UT6L 3GMPB 4PJEB 1ZA6A 2ZKYA 3H1HD 4JO1H 1SDAB 1IKOP 3MNVB 5BW7A 2EVGA 4DAGH 4QD2E 3IU3B 3DGGA 1NWQA 3WTXA 2XRAL 3IVKB 5CJOL 5TGBB 1EHAA 2AQ2A 4IBWA 3MZTA 3GLMA 4FNPA 1NLDH 1XF4B 3EYSH 5GSRB 1CZQA 1KLFB 2KOGA 1G0YR 4S1DD 1H6TA 2EDFA 1QEWB 1EZLA 1SOSA 2C5DC 2YAMA 1MH5A 3AXIA 5HHME 4D6TE 3ZYJA 1ZV5A 4J3WA 1I1RA 4ES8A 1T5WB 4F24A 4P4KB 4G83A 2PPEA 4YQXL 4YAQB 3RBXA 4FNUA 1Q94A 3KLHD 3MOAH 1P6AB 5IM7A 3C6SA 4PCYA 4K9EL 3U48A 1FHGA 2E7CA 5AB2A 5L2KA 2XWTB 4PGCB 2NT1A 3BHBB 1HHKB 1V7NL 2RKLA 1D7BA 4GKNB 1UT2A 4XN9A 4LNVA 4G6JH 4ZMYA 2BS9A 2XXCB 3QPQC 2ICWA 5KAQF 4KO9A 4TTDC 1AS6A 2O01J 3F12A 4KY1H 1M9SA 2OJEA 3GSVA 1L0LE 2X89D 4J8RB 4WGVB 2WB1A 4N2EA 1RIHH 2J4WH 4A6YH 2V7HB 5EO0A 2VSCA 1NHLA 1JZ5A 2DBLH 3GSRB 3VXOB 2ZNXA 2PWEA 1DCEA 1INQA 3FCGA 4JKPL 5C08A 4Z7OB 1E9OB 4DSYA 5HPMB 3TT1L 3DSNB 1DQKA 2NTSP 3O3BA 4JFFE 2EE2A 2PLTA 3MV01 3VGGA 4F9PA 2ZONA 4GG6B 2ZJSH 4XWGL 4MXVE 5DHXB 2J20A 4DHLA 4Z76A 5DT1H 2RA1A 3VTPC 1WWWX 1P84I 3NN8A 3QAQA 4NC1C 4MQTB 2CGRL 3DROA 3V8OA 3WY2A 1E43A 1ZVSA 2AQ1A 4NN7C 1MFBL 4JCWA 5E2UH 3V4VH 1PF3A 2F9BT 1EGJA 3VXUB 1I82A 1ETZB 2HPTA 3RUGB 1ZGLP 5LG6A 1KCRH 2CO6A 4DF9A 4WO4A 5GGSY 4FFZH 2Y06H 4LCWA 4TRPL 1MJUH 4UTBH 1L9PA 3D18B 5KSAD 5I1JL 3HN3A 5C2BL 5GGSB 2XV3A 4OCSH 3NAAL 5CS7A 4WEMB 4AE1A 4Z77B 2ZNWA 3FJTA 3EFGA 3PXLA 2YC1B 4LHUG 3X13A 1R5WB 4EDWL 3RA7H 2VUYA 2YZ8A 2EH7L 3QH3B 3VXTA 2AJSH 5DTFA 4XPGL 2DB8A 4GO9A 2JKJA 1QI3A 3T6XA 3MRJB 2HUHA 3GHGB 3CH1A 2XA3A 3CFBB 4AM0Q 1JV2B 3WJJC 1ODUA 4ZUVA 5MEND 2VN4A 4HJTA 1OGTB 1PQZA 4IEFB 4JCLA 1LNUA 3WLWC 1IQWH 1RFDL 5I1EH 2OMUA 3W11D 5C0CB 1QR1A 2XA8H 4AEHL 4NBXB 5AVYB 5K39A 1SYSB 1V54B 2CNZA 5IGXL 4G7YL 3IU4H 4OB5L 1A5FH 2J6EH 1AKJA 2ZYDA 1XGYL 1YNKH 2OMVB 4WI3A 2K8QA 5BUAA 1E27A 1MQKL 1NKZB 1AC0A 2UV3A 4GQRA 4Y7MA 1IARB 1M56B 4NZUL 2L5GB 3KYMB 1JVOA 5HJ3B 5INDB 5EEVA 2VL4A 1BVKA 3NACH 2J44A 4V1DD 5A2LH 2OTJP 1W8OA 1RJYB 4MSWB 3BGAA 5GS1A 5AOJA 2GYSA 4LRIC 4HLZG 5B1AB 1BM3H 4U6VL 2N1KA 3PV7A 3BPCB 4ONHB 3D51A 5KANI 1BZ7B 3BPOB 2XQYG 4PRHE 5CEYA 4Y4FA 2N1TA 1Y07A 3B56A 3IJSB 4BRJA 4M7KL 3H1KG 4LLDA 2EICA 1FNAA 3FZUC 3VFMA 2XUWA 3IDJA 3WD5L 2RAMA 3M9QA 2DQIH 5IV2A 1M90Q 4GI9A 1R0AL 5F7UA 5FUOH 5LNGA 4U3XA 5T1DL 5D8JH 3C09B 2DKMA 1EFQA 3BAJA 1NCIA 2H1XA 4KMTH 4NJ9H 1WZ1L 2FNWA 5EA0H 1OM3H 2OR9L 1AJ7H 3T2QA 3BUPA 3CZFB 3VNZA 4TNWF 5E2TH 1BWMA 5I5RA 1SQQG 3LHPH 3MCYA 4NO5A 4KMLB 3K5RA 1YMHB 4ODXA 4U1SB 4ANUA 3GJFB 1KGXA 5GGQL 4JS7A 1SQPE 1N64H 4RFOL 5CEZD 4NPDA 1IUZA 3FU3A 4MD5A 1HTYA 1N6VA 3LXBA 5JHAA 2XN1A 5GS1C 3HFMH 1EDKA 2OYHB 1S5HB 3NRFA 2QFRA 2VXQH 4RH4A 3INUH 5IB4A 5L8KB 2DTML 2JQAA 2G60L 3GJEA 4MDJA 1MXGA 5ACMA 4I77L 5F3FA 4RDQF 3W2DL 4Y4FC 4IFDK 2ZYAA 2N1TC 1EJOL 1JN6A 1UWFA 2QLYA 4ZUSA 5IQ7L 3CFCL 3NP4A 1SLWA 3JSSA 3AE6C 5BQDA 5L9DH 3ASNB 1MHPL 1U8OA 1BQSA 4XP1H 1Q1JH 2PYEB 4DUXA 3QDMD 1A3RL 2WLLB 3D52A 4FQHA 3VFUA 3RK3D 1F2QA 4WY7L 1J1DB 1BEYH 3DYPA 1SS1A 2BSEA 4K7PH 4J6IA 5E5LA 3DWTA 3I56P 4YBQD 3KZ8A 4U1NA 3SDAC 3F84A 1E2VA 4JFYA 1UIXA 3MV7D 3AECC 3ULUL 4Y19A 1ZHNB 3R1GL 1NMBH 5EC2A 3G6AB 3ULVF 1EHKB 1GHFH 1O7VA 5MI0C 5E79H 1QPXA 3OBAA 1GKOA 3SODB 1A6PA 3UIZA 1N8RQ 5EF1A 5FB8B 3D39B 3QAZB 4OKVA 4Z95L 2HJKB 3L3DB 3CD6P 1IGFH 1ZCRA 5DJ6A 4FAAB 1XFPA 4HX1A 1HIML 5ESVA 4PRAB 5GISH 4WENB 3VVVA 1SQBE 1CXIA 1KV7A 2DW5A 4A2DA 1SQVE 1E9QB 1KB3A 4U1IA 4D8OA 1ZANL 2P8MB 3QQDA 3II3A 2B5IC 5JOFA 3BAEL 4MJJA 1KY6A 3UERA 2FGZA 2ZUQB 3D8MA 2H1LM 5CILH 5EU6E 3LEXB 3QS3A 4K07A 5D7LE 4NUMA 2UZPA 3ATEA 4Z7WB 1FZCC 3LZFL 5IMLB 3C8VA 5KAIH 1JZ6A 3IBOA 2VQUA 2A9DA 1YJDL 2IFNA 2DTSA 1TTCA 3LRLA 2W9EL 3LNIA 4LGRB 1VQ5P 3ZQWA 4YHKH 4BFNA 1PSKL 2Y07H 3VXQA 4Z1PA 2ZX7A 1MCCA 4UB0H 4NZTL 1D5BB 1D5MB 4HC1A 4AQ1B 1HYSC 2NQDA 1BWWA 2H2PC 1C08A 5LDUA 3QZPA 1PZUB 2J72A 4NQDA 2OL3L 1HJBA 1UQSA 3UPCA 2BCKA 3O2DL 4RA3A 4OZHF 3BEVB 3TEUA 1C12A 2CPCA 4AENA 4XI5C 2O6CA 1GYAA 4XPTL 2Y22A 3AXLB 3THMH 4BSWA 3OKMA 1NL0L 3H7BA 3QFGA 1HXYB 3S88L 3PJLA 2ADIB 2HLOA 1QRNE 4U1HB 1PY4A 4JX0A 1EERB 1NIBA 1RCYA 2DJ4A 4LLAA 4B86A 5D7EA 3AWGA 1P7QD 3NJXA 1J8HD 3HNSL 3WFHB 1VERA 1QKZL 4GRWH 4AEIH 3IKCB 4KK9D 3WMSA 2ENQA 1EVUA 1H3GA 1NIEA 4UM9B 3MJ7A 4DN4L 2AF2A 4YXWH 4Q9QL 2GJJA 2QHRL 5LGJA 1T1ZB 2QA4P 3AUVA 2VRKA 5EULV 3K91A 3T77B 3JTTB 5EU5B 4E41D 1KLGB 1T80A 3LVTA 4M7LT 1PZ5B 4P5TA 2WCGA 2CBPA 4CNIA 1NOAA 2D0GA 5GTHH 2C8NA 1JBJA 5D2NE 3LKPA 5ESAB 5E4AA 4F27A 4HJGB 1TNNA 3PP5A 1YITP 5EUOE 2GCYB 3ZTCC 3RB7A 1XZ0A 2EDDA 5H37G 1TJIL 2WN3A 3QJXA 5ILTH 2F58L 4GMTH 4L29B 5FKAA 4LCYB 3F58H 1FS0E 2YAQA 3QIWA 5EEUA 2J5LC 5HHMB 3FU9A 4G11A 4YXLL 3P4MA 2V7QJ 4GKZA 3BT2L 3CFQA 5LGKA 2UUDK 5F1NA 5GGTL 1YYMH 3MX0A 4P2RA 1RF1B 2GAZB 2AGJH 3F5HA 3VDCA 5BMFL 2AJVL 3HKFA 4QO1A 3S37L 4ZTEA 1L9NA 3GMRB 3K4DA 2WBJD 5E1QA 4ABWA 5IJVB 5KVGH 5I8KL 5E2WH 2QFPA 3QIUA 4J3OF 3SDYL 2HN7A 2APXA 3V52H 1WVZA 2Q9OA 5BZWA 1JD9A 3DO3A 3RGUA 3SE8L 1SLUA 1G2CA 1ORQA 1ZHKA 3UZVB 2Q8AH 1FAKT 1SJHA 1QFWM 3C60D 3KGUA 3IAQA 4FKEA 1M7IA 3BRTB 3UBHA 1NOHA 2DQDL 1JY2O 2BM3A 2HWZL 3D07A 3QIWC 2G3XA 3L5WB 5BQ7B 1JGVL 1JNNL 5KJ4A 3FU0A 4PRID 2IG2L 2FJHA 4BIKA 1OP5H 4NNYA 4MVBD 4GRLA 1WHOA 4JFFB 5KVEL 3W0WA 3ZTEA 1QVOA 1A7RH 1BSHA 1UEYA 1R19A 2GSIA 1NMCB 3SPIA 1DJGA 4X4XA 2IOMA 2JTYA 2ZG2A 5IT2L 1H0TA 2EXYD 3L74G 2CSPA 1ZT4B 4JHUA 1ZTXL 1PX3A 4I7ZC 4G6KH 3CXHI 5FR3A 3DO7A 1QWUA 3MA7A 1NFAA 1MUUA 5BO0D 1DBMH 1NU1D 3SDDB 4LNRB 3D50A 1H3UA 5KJRL 3BN9C 1NFIA 4HLZH 5DVOA 3L8QA 2H3NA 2WBKA 4LLVA 4PLJD 2FO4B 4IDJH 3LRMA 3LEVL 5EEXA 3AEFC 3PWLB 1HH9B 5JHBA 4NRYA 4WNQB 2KBGA 3CK0L 4JGUA 1KTBA 1YQVH 3L16A 1KORA 3QDJB 3HC3H 4ZOBA 4CC4A 3PUUA 1DHKA 1ZHBA 4X6CF 4GRLC 2B1AH 2W1NA 1QLEB 5D1XE 2F0CA 2X89A 4IOIH 4HQQH 1E4JA 4LPXA 3RNQA 4QRPD 1PPJE 4XMZA 1UFGA 3S2CA 4F8TA 3GBNH 1IBGL 4O2EA 4PJ7A 3VXMB 5C0AD 3BP5A 5JXEA 3K6SB 3ILPA 3GSNH 1UM4H 4G1MA 4GQ9H 4MDIB 5DD0H 5GRWA 2ICWJ 1LWUB 3K0WA 4A66A 1ETJA 4N0FA 1EX0A 3T3ME 5G4NA 1SXNA 2W07A 3K6NA 3HRZB 1FVDB 2P2UA 4MXQC 1OGAA 4J5VA 1LXMA 4DERA 4RESB 5FWRA 5I19H 3DMMB 5E8OA 4ZOCA 4AUYA 1J1XH 3LQMA 2YXVA 4W81A 5DMYA 2VDPH 2DYRB 3STLB 4J8QA 5E51A 5DUPH 2QJPC 2ADFH 4R4MA 5J7CC 3RFZA 1SLQA 1PAMA 5CCGD 1NTKD 3CL3D 2BIIA 2EP6A 3O2VL 4PCKA 4XAWL 9PCYA 3UTSA 4CC4C 2GKIA 3VSUA 5DUML 4ECNA 4WW2A 1VKXB 4NM8H 2F08A 1Q9LB 4G80A 4PRHB 3X11B 5KSAA 5I6NA 2FYUK 1TYJA 1F02I 3QHZL 1HQ4B 3ZT5A 1L0NJ 1MIML 4M03A 3WFBL 4ICXA 4OD3L 3PHSA 4MMXA 1GA2A 5JXEC 1SLVA 1XF5A 3MV9A 2G3MA 1B0RB 1SFCD 3TYFA 1QO3A 1DVYA 1E6OH 1OPOA 2NZ9C 3NPSC 3DX3A 2OYKA 4NKMB 2B8OT 4KHTL 4UV4H 1EZVD 1WZKA 1BXVA 2CMRL 2YPVL 1NBVL 4WY4D 4X7SH 4AXWA 1S9KE 3DOSA 2CIIA 4Q9RH 3NJMA 3RGVD 4NQUA 4U6YA 1TU2A 3RFZC 1BYNA 1KDIA 3T4YB 3BW9A 3B7RL 4NC2B 1IM3B 3C5JB 3CVIL 2HVKB 3OXSB 4KK6C 2NOYA 5D2LA 3GHEL 2NNRA 3HTKB 5J11C 4AOFA 3N42F 4K15A 2AK4D 4O5LH 4UT9H 5DUBB 4PG9B 1LWHA 4UOW1 5MHSD 2CDGB 3LN5B 3NCWA 5AWNL 1SQXD 2IF7A 3QJZA 3L73E 1RZ8A 4PGDB 2H8PA 4G9FD 4M00A 5I1IL 3BUYB 4A1RA 1NTKK 3ARDA 5EPMB 2ZKWA 2BSSB 4HYTB 1FO0H 4P57A 1IEBB 1P84K 1QFHA 4BSVB 3BP7B 3U4KA 1FVCB 5CCKH 1FFPA 5I6LA 1CICD 1I75A 2MCPL 5IFHH 5L4IA 4CVUA 3DC0A 3K71A 2AQNA 2AJZA 4PJIA 3WLBB 5LBSL 2MNJB 4PY8J 4KTDL 3ZKQD 4EN3B 1WC7B 1T2QL 1WG3A 1E42A 2R69L 1WFIA 2I24N 4LOEA 4BA0A 3FB6B 5BJTA 3Q1EA 4OZGF 3DIVA 5EU3B 4I2XB 3QJTB 4RX4D 5I26A 3Q2LA 3ABGA 3SKOB 3L2NA 1A21A 3ARFD 2YBRB 8PAZA 1RUQL 1W6WA 2EINB 4OD1H 2HX8A 3JBG7 5EHFA 1TLMA 1Y7VA 2FECI 1RZKL 3EGSA 5EN3A 4ANXA 1AQ8A 4O02H 3CC2P 3SQBB 5EU6B 2WO3B 5JIPA 1AJYA 5D7LB 4EZMA 2NPLX 2E5YA 1TTGA 4R3SB 3UG4A 1J8SA 3S35X 1MG3C 5AG9A 2P58A 3D69A 1Q0XH 2GY7B 1QASA 1BGXH 1COBA 1THAA 2E27H 2G5RA 1QOKA 3MRCB 4IGBB 3EADA 4MJ6A 4YDVB 2AQ3A 4DUWA 2JV6A 3VD1A 5TF0A 3P7KA 4NCC2 2QJYB 1PU0A 2ATPA 3LKQA 2C0XA 5CU9A 4OV6F 1F42A 4FXGA 5HHOB 3GSOA 3MXVL 5T33L 3A0BH 2O30A 1F8TL 1PDKA 4OCXH 4TL4A 5IVXE 3RAJH 2XZRA 2R3SA 3ZO0A 1FORL 4R4FL 1JHKH 3WFEH 3UIAA 1T3FA 4HKXB 1UJ3A 4U33A 1FZOB 3FQNB 4GDOA 5GRJL 1CU4L 1FOSF 2VLMD 2YJQA 2W0LA 1QRNB 4X7TA 2VAJA 3BVWA 3E8VA 3AUWB 4FQQA 3FUFA 4X8JA 4BGDA 4Y99C 1GW0A 3C5XA 4OM1L 2MMXA 3IGLA 1ZRTD 4LKXA 4U7KA 1ADWA 2FZ3A 4FCHA 2Y2YA 1FFNB 2R1XA 1DEBA 1IILE 4MNQD 4OJCA 4MHHG 3REWB 2GHZA 2W83C 3K0YA 2FY8A 4N2LA 5G