4HYTB

Na,k-atpase in the e2p state with bound ouabain and mg2+ in the cation-binding site
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
289
structure length
289
Chain Sequence
FIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRFRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
publication title Crystal structure of the high-affinity Na+,K+-ATPase-ouabain complex with Mg2+ bound in the cation binding site.
pubmed doi rcsb
molecule tags Hydrolase/membrane protein
total genus 46
structure length 289
sequence length 289
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4hytB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 4hytB02
4RESB 5APTA 4AQRD 5AVXB 1S9KE 1T2KD 1DH3A 2Q3IA 4JYBA 2IPPA 3OAKA 3VYIA 1S9KD 4XE5B 3A3YB 4EOTA 1SLQA 3O8ZA 3B8EB 5AVUB 4M3LA 1GTWA 1GK6A 1FOSF 4I2LC 5AW2B 2P7JA 1JUNA 3KQGA 3HTKA 2WPSA 4AYCA 1HUCA 2XV5A 2R32A 3UIAA 3HE4A 5APWA 2E43A 5CMZA 2WPQA 4B86A 5AVVB 5AVSB 2WWWA 3TK1A 1A02F 5AVZB 3M06A 1GD2E 3V5BA 2XZRA 3I5CA 2JJLA 2R3CA 2YO3A 1H89A 1HJBA 2WT7B 3HE4B 5APYA 3L37A 1YYCA 1IO4A 5APUA 1A02J 2E42A 4LC1A 3A7OA 5AW7B 1H88A 3HE5A 3NMDA 2C9NY 2VRSA 1JNMA 5AVRB 3LIEA 1CI6B 4KHXA 5AW8B 1MUUA 2XU6A 4RETB 5APSA 2WT7A 2QM7A 2H7HA 3VN0A 2QM8A 3HE5B 2Q5UA 3KDPB 3V4QA 3V4WA 1NAFA 1FOSE 2P67A 3A2AA 2WPRA 1G2CB 2KP8A 3TNUB 5AW3B 3TYYA 1GZLA 2ZFCA 3WGVB 1X8YA 3M0AA 3L35A 2C9LY 1CI6A 1MFZA 3M9HA 2Q7CA 1T2KC 4AUWA 3IR9A 3LIDA 4GKGA 1H8AA 2YO2A 3P7KA 5AW0B 1OXZA 5AVTB 3L36A 2R5DA 1SP4A 1GU5A 5AVYB 5AVQB 2W6AA 3VMYA 2R5BA 3TNUA 1GU4A 1GK4A 4GT1A 4JYCA 4C7NB 5AW1B 1NWQA 5AVWB 3M9BA 1J2JB 5AW4B 1CZQA 3VMZA 5APXA 4I6MC 1KQLA 2N9BA 2ZXEB 5APQA 3VMXA 3MD0A 5AW6B 3MGNA 5AW5B 2W27A 2WTYA 3T97A 1HBWA 4HYTB 5APVA 4C7NA 1MV8A 2BASA 3P32A 3NTNA 3P8MC 2YNYA 1FAVA 2Z5HA 1HWTC 2Z5IA 5AW9B 3SWFA 2P2UA 3NFQA 3M0DA 3VTPC 1OWAA 3WGUB 3A5TA 3M91A 4C46A 3NXSA 1CSBA 4DZOA
chains in the Genus database with same CATH superfamily
5L2KD 2WKLA 4KZ0A 2EAEA 3T0EB 2C1OA 1IAIL 2WINA 3VE0B 3RNKA 4M9PA 2HLFC 3AE4C 1T4WA 4PG9B 3A24A 4L4VB 1G9NC 2AQTA 3N1MC 4J8RB 4M56A 1PG7W 2IBZY 4L4TD 5HYJA 4ODTL 5FYJE 4Z8FL 1U3HC 3Q5YA 4DPAX 4M6NL 3TO4A 2OYIC 2OJEA 4WJKB 4BK5A 3HBQA 3BKJL 2VN5A 3IDNB 1C5BL 1KCUH 5I16B 3A6CL 4GH7B 2W60A 3ARXA 1OIOA 3QRGH 2YIHA 2VT0A 3V4UH 4QRSA 4DP7X 3IFNL 3GLDA 1M1JB 3OV6A 4C47A 4D9QD 2FYYA 5FUCE 1JNHB 1AZZC 2K7PA 3LKNA 3QUZC 2XG5B 2XQBH 4GUPA 3T4AA 4OIIH 3FT3A 1G9NH 5D93B 5AWNH 4RGND 4U3XA 1URIA 2B14A 3GFUA 3SE3A 4AYSA 3QEUA 2BHYA 1OEZW 2CHZA 2ZYGA 4IGBD 5D7SL 2HMIC 1FAIL 1KCBA 4P2OC 4AV4A 2WSEH 5DJ6A 2Z0BA 3FTVA 1PZ5A 4HFUH 3VRLF 2QKIC 4PLKC 3BPLC 3BDBA 3RFZC 4XAKE 4DP5X 4U3SA 4AGQA 5KVGH 3CLFH 3FQYA 1IGIH 2VSCA 1OPGH 3RWGB 2VMCA 3HA0A 1G7QB 3EYVA 5CLXA 4RAVB 2BY2A 3WFDH 1X8YA 3ARYA 2WWMC 3QWQB 3LQMA 4CU8A 4HPHA 1HSAB 4BBWA 5TISE 2ZT9D 2Q76A 4NCC2 5LXVA 4I4WA 3VM5A 2YD6A 5KAIE 4JFYB 4BINA 5BRZB 2LXCB 3BCCG 2XSKA 3VFWA 3QCUL 1X9UA 2IPKB 3MNWB 3QPXL 2KKQA 4UQ9A 4GOSA 4Y88A 3F00A 1FZOA 5IHUH 3ELQA 4N3TA 5C2BL 4NQTA 4O5LH 2YD0A 3WFZA 1W8EA 3B5GA 1NCDL 2R0ZL 3GPSA 2IDBA 4GRWB 1HHJB 2Y07H 1QAWA 3VU2A 3FWNA 2NMSA 5T5FH 4HMEA 4D6TE 4ERSL 1XFPA 4HJ0C 1NPUA 1ZLWK 4AVIA 2H32H 5HY9B 1PLGH 1XF3A 3BIAX 2MRYA 3L5HA 5LAPA 1IUZA 1AGFB 5SWSD 5DJ8A 2Y24A 2VYRE 3DX2A 4P5MB 5C2UB 1VFUA 2E4TA 4J3OC 2J5UA 5T5NG 4U1HA 2Z5IA 5F0JB 1ZVHA 1A9VA 4GG6E 1Q72H 2P42B 3IMRA 5FKPB 2R4RH 4ZUSB 3W0WE 1T2JA 4HIHA 1OM3H 1WK0A 2FFDB 2I60H 4TQ8A 4HWEL 2IG2L 1Z3RA 4NCDA 1FWXA 1N64H 3PH0A 4RQQB 3Q1SH 5AYUL 3T3PF 5CLWA 3LKRB 3FFDA 3N40P 3V7MA 3VSUA 4QHPA 2B1HH 2A77L 2CHXA 3KG5A 3T4YA 1U8QB 2DLIA 5C0CE 1KBGH 5IB1A 3I6KB 3BH4A 1GTWA 3PHAA 4HUXA 2W0FB 2ZXGA 1CK0L 4ODXA 3KLHC 1JUNA 5T3ZL 1B0IA 1HZHL 3KQGA 3K46A 1I31A 4JFVA 3RPBA 1MRFL 3S34L 1MAMH 1SVZA 1IAOB 4LT7A 2AK4D 4J3OH 4OI7A 1EAQA 2EIBA 4W7YA 4MSWB 5D1XB 1N7SB 2R2CA 3BLBA 4BFBD 1GL2A 3L75E 3QO0B 5EZOH 2BCCJ 1XGYL 3H42L 2R3CA 5AYTA 5GISL 5GHWH 3VCLA 4KXDA 1S9VB 4KRPB 1OY3B 5TH2A 1T0MA 4X9GA 1UFUA 4NB7A 1XSKA 3IRCA 3MNDA 3S0PA 3HRZC 4YHZL 4R0LC 2LLNA 3VP8A 1JPST 5SWZA 1IV8A 1IZJA 4WI0A 4MS8D 2C9NY 5DHMC 1ACYH 5GJSL 3RVXC 3IDMB 3U9UB 1RVFH 5C0RL 4M1GL 1OSYA 3CHOA 4KO9A 4NUGL 3FU9A 2K45A 3GGWB 2D8KA 5FYJD 1RK0A 2J8OA 1UJ3A 3VX0A 1TITA 2B20A 4JAMB 3HB3C 4JQIH 2EH7L 3QFJA 3S98A 1J5IA 3KLKA 1BPVA 1RF1B 4E68A 1MELA 2IAMC 3MJGX 3Q5TA 4RMTA 1K5NB 3IMSA 1T1YA 4UANA 4JM0A 1KBVA 3PGCA 4Y16B 4A37A 2WGNB 1KPUA 4FXKC 3M0AA 1FFTB 1TSRA 4MYWB 2YBRB 4FHKA 3RJOA 2BNQA 3OX8B 4ZNCD 1UB6B 1L0LG 3LRHA 5I1KH 4OJEH 3CFDA 1R3KA 4TNWF 4LHQB 5H2FE 1HSBA 1I7RB 2CJ3A 3KPSB 1E50A 2FWOB 3IFPB 3FUJA 4JY6A 2Q7NA 1SEQL 3QJFB 4F2EA 1J5HA 3FU8A 3ROLA 5EU5A 4I18B 5IQ9A 1FRGH 1UM6L 2O5XH 3QCVH 5E6IB 3WIHL 1U92A 4UTAH 4KKCD 4XAKD 1Z5LB 4XMKL 4NRZA 4PJIF 3IDIB 4L23A 3WE6A 3EBHA 4AW4A 1O7SA 2ZXEB 2D7MA 4NJAL 1SLXA 1VPOH 2ZJSL 4AT6B 1URQB 4G7YL 2VQ1A 1EJOL 1XGQA 3M86A 1SF5A 1C1EH 4E0RA 3D0LA 5CN3A 1P53A 1DQML 2BEZF 1S7XA 1S72P 3TN0D 4N2EA 3ZXAC 4GUQA 1BXVA 1A7RL 2XETA 3L3GB 1YEIL 4QOKB 4PS3A 4QWWD 3UYRH 3B43A 4W4OC 5DRWB 3ZE0E 5JXAL 2YMTA 2JH2A 2ENSA 2BZCA 2YAQA 5IVXB 3JWNG 3ERXA 1J48A 4EIBA 3A23A 4OCYL 4QRPA 4UMSA 1I3VA 5GSRA 4TT3H 1IBBA 4P46B 3RPIB 3U4BL 3L3IB 4Z1MH 4YE0A 3L4YA 4ZS7L 1PCSA 1A3RL 2EO7A 1JMZA 1IEBA 1VHPA 4AK2A 3ESVF 1TMQA 4GAYA 5DT1H 2XX1A 4MRCA 5G55A 5FGRA 2BO0A 2B0SL 2L7UA 5EF1A 1BBJB 1P2CB 1U8IB 2XVGA 1LTJA 1FCGA 1CIDA 2Y7QA 3P0GB 4LVHC 3RHWF 4APXA 5F3BA 1HYSD 3QAQA 1REIA 4HC1L 2E3VA 4HU2A 3K2UH 2DKSA 1E90A 1BYPA 1BSHA 1U8CB 1MW1A 2OYHC 2WNWA 1FGNH 1OSEA 5JW5B 3BMWA 4IHOA 1XGRB 4ZFFB 1NH4A 1Q9LB 4NCC1 2BJML 1FG9C 3RL0B 2HJLB 4PGCA 2DBJA 2C9SA 2GTQA 4AQEA 1OW0C 2R0LL 3KPOB 2Y1YA 4UDTB 4ALAH 4OWFA 1XIWD 1AFOA 1HHKB 1J86A 2NTFA 2VN4A 4TVSa 2YQ2A 5CCKL 2F1AA 4APQC 1N3NA 3MYJB 3CDFA 3F64A 3WS3B 5C0CD 4I77L 1U8PB 1P5UB 2JK5A 1DUZA 1WAAE 5HGAB 2OQJB 3IDXL 1CFVL 4P3DB 5KG9A 3DO4A 2HN7A 3WLWC 3I6LD 1T2XA 3QE5A 2ZCLH 4DCQA 3Q2VA 4OV5B 4Y4HB 4G43B 1IFHH 3QC5X 4L9LC 3HHSB 1NC4B 3V4PB 3L75D 4MQ7B 1T7YA 3NCFB 2F5BH 2A0LD 4MMZA 2VL5B 4RSYA 3FCBA 3UTTA 5E4AA 1U57A 2WV3A 1TQBB 1NGPL 4HJGB 1NGQH 4MNHA 4CSSA 4PJ8A 3HNVH 4W4NA 2E4FA 5B1KA 5DVLA 32C2B 2F53E 4NM8L 4JFXB 3L7EA 3PL6C 5CD5D 1QPKA 1SQBE 2CCVA 2NW3B 3SDDD 3ESPA 4IFMA 4PJXA 2P5EA 3JTSB 1FLRH 4K3JH 4HC1A 1S5LH 2V2TB 2FATH 4JDEB 3RGVB 3U4EA 7TAAA 1RZPA 1MXGA 5TTRA 1FPTH 1MCLA 1A7PH 3E1ZA 4JQXC 3WUZA 5D2NA 2AERT 3AECC 4KDTA 2LAGB 3ULVF 2L3BA 3NZHL 1D6EA 1RH5B 2WB1A 2WWOA 1SS1A 4FQXB 1NBCA 4MDRA 4KI5C 2OL3L 2HA1A 3PIQA 2QHLA 3DI2B 1CN4A 3HI5L 4G8IB 3JVGC 5DFVC 1HINL 1FAVA 2ZAHA 2NSXA 5L4MA 1MCDA 4OM0H 4UQAA 3ZT6A 4WO4D 2OYMA 4S1QH 4YR6B 1UURA 1PGPA 4FFYH 3U7WH 5I18H 1FUNA 3TXAA 2JFCA 1ZS2A 1LL1A 5IB4B 5CP7B 4OFYA 3HW7A 3BE1L 4LRIC 2CIIA 4K07A 3QJQB 4PRDB 1AXTH 2Z65C 4RAUA 1RKRA 4M6MH 3HZMA 1PDKB 1WGVA 1O75A 3DXAB 4UV4L 2TRHA 1LE9B 4ENED 1BZ8A 3EH1A 3BD3A 1KFNA 4HFUL 3NH7H 2Z7ZA 1D5XA 1NU1K 2EDXA 3G08A 3WNMA 1WWAX 4RLDA 3OM3B 4OGAC 5AAMC 3HUJE 2WYIA 3D07A 4JPIB 3WXWH 2EIEA 3LKSA 3VRIA 3LKPB 4FXGC 5KVGL 1XVSA 3DV4B 1TKWA 5I1EH 2Y7NA 3JC22 3S37H 4XAWH 5E4OA 3TK1A 5KYUA 3VD3A 3RYMA 3HLAB 2ICWI 2DKUA 3QR2A 3VXUA 1A4AA 4AJYV 3TBCA 1LP9B 3QDGB 2VERA 3NJFA 4FTVE 2OTUA 2I07B 2AQSA 4YSUA 2QPDB 1JEKA 4GUOA 4FE9A 5AZ2H 5CEXA 2NYYD 4ZO7A 4A7UA 3FXDA 4M8QA 2CBPA 4JDTL 1U8HA 1G0DA 1OHZA 2XQ0A 3CU7A 2FIRT 4O02H 4F7KA 4ZXBA 1AD0A 1RQVA 3OD3A 2MOVA 4N2BA 4HKXA 4XN7A 5AOZA 3VNYA 2VE6B 3Q05A 4MB4A 2GTWA 2X3CA 2QJKC 2FK9A 4DVBB 2VUYA 1KY7A 1KXHA 4WWKB 2OL3A 3M0DC 4KK6D 2Y07L 1GW6A 1NTMG 1XAKA 2JIXB 1NC2A 5A2BA 1EBPA 1HDMA 3WXVL 2GTZA 3SKJH 2WC7A 2NTSP 3EH4B 4P05A 5BOPA 2AXWA 5T1KB 3NAAH 2AAVA 4JY5L 2E8YA 3S96B 2VN6A 1IBGL 4XNUH 3EDDA 1XB3A 1NAMH 4O2EB 2B7DT 3BZ4A 5HJGA 1ZPUA 1YG9A 1FVEA 2QELA 3CBKB 3IXTA 1RHHB 3TF4A 1U3HA 1FFPA 1I9RL 1JPFB 4NZTH 2OYIA 2KPWA 2I9LB 3CI9A 3QFDA 1N64L 4AQAA 4NGHL 4BV1A 4UQBA 3CX5E 4Y19A 1E27A 1MWAA 4YDVB 2B1HL 5J11C 2OJZL 2DICA 2YJQA 5FO7B 1KBGL 2VR5A 2GSMB 4CGUB 4AENA 1QFPA 3QIUA 3RK3C 3DO7B 2A99A 1GYVA 3DKHA 3OGCA 4NAMA 3KJ4B 3T8XB 3EZJB 4NQDA 1H6FA 4OGQC 1JDAA 4Y5YB 1ZLSH 4TS6A 4DVRL 5AW5B 2W27A 1AGBA 1GY2A 2DTSA 1JE6A 1T03L 1I8UA 3L4FA 2D7NA 2Z9TA 2JWAA 4OLVH 3VXNA 1RJZB 4BCXA 4XB7A 4XCYA 4KOCA 1VKXB 5GHWL 1V55B 2NY1D 4IYKA 3CHRA 1JNLH 1HL5A 1L4IA 1FH2A 4MAYB 1E4WH 4TLUA 5A2LH 4LL1A 3MBXH 4CADB 1LM8V 3L73G 1USZA 3CZJA 2IH8A 3ZE1B 3GSVB 3UGXA 3RFZA 4NAQA 4Q6IB 2NXYC 3NJJA 4DZOA 5C3TA 3ILDA 3TA3C 1HYRC 4LCWA 1ACYL 1UKTA 2OX5B 1XGTA 4BRYA 2X9XA 4GRLD 4UB8H 4X6DF 1D7CA 1M2VB 3QXWA 3BUYA 3JTBA 5DJ2B 1QWHA 3M7OA 2XZCH 1E79H 3UGUA 4JQIL 4A6YB 1T3JA 3REWA 4ZUUB 5D1QD 1JGEA 2EDYA 1JZ6A 3HI6H 3SEPA 3DMMB 3IDGA 1K73Q 1WEJL 3K7UA 4IJ3C 5BJTA 5GGSY 2JO1A 3UYOD 3QI9B 5H35A 3FFCA 3O9WC 1G7IB 4NENB 3W11D 2BIQA 4NDMA 5I1KL 2OTJP 4PJFB 3ZRFC 1TUPA 3GPEA 2D03H 5KVEE 2OXGB 4DGUA 5APYA 1TQWA 3DC0A 3NN8B 3G5WA 3C60C 2LTQB 2VXUH 3PV6B 4LLYB 4XNQB 5HYJD 5J13C 2VN7A 3SDCC 4PY7B 1FNHA 5MENB 1MQKL 1XB6A 3QFJE 4QR7A 5C7XH 4ANUA 2GSIB 1JPTH 2OJ1A 1FRGL 3AMKA 3QCVL 4QKTA 4UTAL 3ZHFA 1QHPA 5KUMA 4MLIA 2IWEA 3KGSA 2FGZA 4TSAH 3D5OF 3DRTB 3WU1A 2XWTB 5GGSB 3CCMP 1H8OA 4EDXB 3S9DB 2YQ3A 3TT1H 1DN0B 1U95A 5DU7A 3WY2A 5B3JE 4ASVA 3X11A 1JZ8A 3S3CB 5C0JB 3FMGH 5KS9F 3TONA 4KTEH 2BHFA 3KCPB 4JJ5A 4NO2A 3B7RL 5FX3A 4HCFA 5I6NA 3NPSB 4P07A 2AJZB 2Y9RT 4G7VH 5IEHA 2GQHA 2HPTA 1QLEB 4N8CL 4PJCF 5DQ9B 5T3ZE 1SP4A 2DLTA 3MRLB 2GM4A 3K71B 4UWQB 4H44D 4U1KB 1GU4A 1M7DA 3AAZA 3AITA 1XCTB 2YD4A 1RE4C 5TE6H 2YKPA 2N56A 4X6EA 3T2LA 1UGNA 2B15A 4TL5A 2I9TA 1L9SA 2GUYA 4PWFA 4UM9A 4ZMZA 1TJHH 1PZCA 2ATPA 4KY2A 1HXKA 1QBMH 2JQMA 3ARFC 1JI2A 2Q8BH 1OVVA 5MP6L 1GW3A 2NDFA 1R34A 1ZHKB 3HRZA 3MJ9L 3CCVP 4JM2D 3GXIA 1CO1A 1TTBA 1PFCA 3FSVA 2BOBA 2H45A 1AJ7L 3DARA 3EG9B 4NC1E 4QDGA 4QRPE 1H3XA 5HI5D 1N0LB 3FNKA 1K04A 1A6UH 5I1HH 1JZEA 1KQGB 5FGBA 4R9HA 5KTBA 5GRJH 5KTEH 4DP0X 5EIQA 2DQUH 1DVFD 3G3ZA 1NIBA 1RZQA 3H9YA 2DM2A 3TCXA 2HODA 1ZHNB 5BZXA 1JRHI 3RIKA 1V7NL 1JYXA 5FDYA 5DK3A 4YQXH 2YGOA 4P23A 3MUDC 4LCIL 3KYKH 1AQ5A 2ZNXA 4M3LA 3WI9A 1IARB 3ZTCC 4WK0B 4ZYKB 2Y06H 1ZV2A 2L5GB 3BSZL 5HYFA 4ODSH 1OT1A 2FSDA 3UAEA 2XV5A 3ASWA 4EF3A 2F5BL 4XTRD 1IIKA 4S1RH 5AVSB 3V52L 1MG2C 3N55A 1M42A 3T3MB 3O41A 1NDTA 1NGQL 1LO3H 1QEWB 5HVHB 2ZT9B 1XGPB 1OGAB 4WI9A 2X4RB 4JRYB 1MFDH 3CFEA 3L3JB 3FPYA 1T5XA 4PJAE 1BFTA 2ZJSE 5A43C 1INDH 4MQXC 3C09C 5DI8B 4PV9B 2X1XR 5KYWA 1FGVH 5DRNA 1M57B 3T08A 4KV5E 4YL4A 4JN2A 1KYOJ 2XWBA 1FN4A 5JIPA 2EIJB 5DFTA 3C6LA 3LD8C 4PLJC 1FPTL 2ZICA 1WVZA 1H8NA 2A73B 1OAYL 2GBUA 3MJ9A 4MKTA 3R1GH 2NUPA 2Z8SA 2HFFA 1CFNB 4HSAC 3CFKB 4OT1H 2ROXA 2ZX9A 2FRGP 2ZXAA 3UTTE 1F97A 3ZSTA 1MNUH 2R3SA 4FP8H 2FEDD 3WIFA 1RF0C 3F7KA 4ATWA 3TESA 3EO1B 1MCEA 5SWZD 4ELMB 5BVJB 1D9KC 4WSGA 3MMEB 4PUBH 4ODHL 2O01N 2VLJA 3OKKA 3BAYA 3JTTA 1SYSB 2IMMA 2P5EE 3GW6A 4L3EA 4P06A 4PJXE 3D30A 5J6GA 2VISA 4J3UA 4KQ4H 5MEQA 1V3JA 2VXQL 2C5DC 3SCMD 4Z7NB 4BWTA 1ZT4B 5D2NE 5DZNA 1CGSH 4DUWA 2CO6B 2MCPH 5CIPH 3MAWA 4LL4A 3CXHI 1LE5A 2HR3A 2OYHA 2VIRA 3BWZA 3TWYA 2PTUA 3BSZA 4LLUA 1E4KC 3R06A 1JY2P 3B7UX 3NRQA 4ZAKB 4E9TA 1NCWH 2AEQH 3I9IA 3QQ3A 2YLKA 4I6MC 2BNQD 3CFQA 3WXWL 1EEQA 2RFXA 3GXPA 4IKIA 1Q9KB 3FSAA 1E7UA 1KJ3H 2JJTA 2PKDA 3TZVD 4APQA 5I1EL 4XAWL 1KCRL 3NSXA 1CW5A 4L8DB 2V8MA 2GY7B 2WUCH 3AU1B 5T3ZD 3FQRA 3GHBL 5F7WC 3V6IA 3BWSA 7FABH 2QGDA 4AYEC 3RRQA 4U2ZA 3G5YB 5FIEA 1GAFL 5AZ2L 2BVOA 4QRQA 3ECBB 2XQYG 3UPRA 2VDQH 4NSKB 1E9PB 1USQA 5EA0L 4PR5B 5I6XB 1D3CA 3AB0B 4YHLL 2ZKXA 5CFAA 1I7ZB 1H9VA 1SJXA 2DDQL 5I9QB 4N87A 1BIIB 3UTQB 4W9LC 1PIGA 1S9WB 3O6FC 3BATA 4LKCA 4QRPD 2ZD0A 2PW2A 2HLAB 3D8MA 5I73B 1B0GB 5ESQB 2VXQA 4WWOA 1H6TA 3U46B 2XZRA 1A3ZA 2MQGA 4YDJB 1NAML 4JQXA 2DV6A 1HZKA 3U4KA 1TTCA 3NT0A 3ZO9A 1J18A 1BM7A 2P48B 1YNTB 2XWJA 3CXFA 4E9QA 1AGDA 1EERB 3JVFC 1NTZK 4TF4A 4LC1A 4HKJB 1IVTA 4F7PB 3KM1A 3QNZA 1CLVA 3V0VB 1EGJH 4WI6A 4AY0A 1DYZA 1NJ9B 3CUPB 4A63A 2XXCB 3O6LL 5CSBA 1MHPH 4D0DA 3P9LB 3KYNA 1AS8A 2VJ8A 5EN3A 4WJ5A 3IGAA 4KHXH 2V7NB 2K9YA 2G2NA 3FX0A 5G2NA 1H3WM 5HI3C 4F7TA 1D2OA 3N04A 5CKAA 3S2AA 2EVJA 5LBSA 3L4UA 5E8OA 1IC4H 2HPCB 4KO5A 3VXQB 5ETUB 3FK3A 2V7HB 1ZANH 1WC7A 1JNLL 1I3GH 3RJDA 4GDOA 1HHGA 5AAWC 4Y19E 5FGCE 2AANA 5FYJU 5AAMA 1UC6A 4YDKL 1OO2A 1L6PA 3KJ6H 3WO4B 4GSDH 4X6CA 1H3PL 1CYWA 4HIJB 5DA4A 5E5RB 5CJ0A 3ESUF 1COBA 4JFQB 4NKDA 4NQDE 4W6XB 5F7MC 3UTTD 1FL3A 4R26H 5H8DA 1DBMH 2IFNA 1EX0A 4AZ8B 5HDOA 3SYAA 1S3KH 5D1ZA 1VQ8P 4DW2H 3EH2A 5ABDE 4PJ8D 3L72J 4P04A 3G9VA 4QHLA 4Y9FA 3MV7A 4WEEA 3KNBA 5I6PA 4GG6B 4K8RC 5INCA 3BAEH 4WQOA 4OZFB 3BT0A 3W0WB 3EFOB 2V3EA 4PV1D 4B60A 1UB5B 3ULUE 3I50L 2D03L 3OKEB 4HPOH 1XMWA 1N67A 1T21A 1F56A 3MTXA 4LCWE 4MHHI 5IVZA 1XIWB 3VRJB 3M0DA 1PX4A 4XCCH 3QXDA 3CE1A 2YUZA 4JZOB 3L1OL 2C0WA 3QEHB 3I55P 5C7XL 4IOIA 1L6ZA 1N68A 3BPCB 3ARVA 3UACA 5JDSB 1KN4H 3NCWA 4UUJA 2QQLL 1C5DA 5IZ7A 5IESL 2LVCA 1ZXKA 3SDXB 3ME0B 3HTLX 2OLDA 3B5TA 3FFCE 5I74C 4BH7B 4NHUB 4M5TA 2F1EA 4ZPTB 3HN3A 4NN5C 3TT1L 4PREB 3H8NA 1LLAA 3FJTA 4LEXL 1W2BO 4WFFD 2QJPB 1UCBH 4KTEL 1IZNB 1R19A 4OFYD 3TBTB 2L8AA 4LBEA 2PTTA 2E75C 5B1CA 2CLZA 4ODVL 1U8KB 4WHDA 2IANA 3JXAA 1ILUA 3OR6A 5KSAC 3Q6GH 4M5YL 5L88H 4OUUA 5C0GB 4K3EL 1FYTD 1MFUA 1WFNA 2UZIH 2FAUA 5TE6L 1UXWA 3L2LA 1FV1B 5E03A 5GSVB 4FLQA 1XSJA 3AG4B 4M6OH 1KB5B 4J3XA 1RLBA 4NI6A 5KVDH 4MGXA 3VXUD 2YZ8A 5EMYA 4PHXA 4B3EA 5ID0B 1F4YH 3QUYA 4M3KB 2VR8A 3L3OB 1SLVA 2CALA 4DN3H 1R3JB 3ARSA 1THAA 4BH8B 3LKQA 4PP2B 1AGEA 1AC6A 2DQHH 4U7KA 5I0WA 4ZXBD 5EC1B 5C1MB 4I3SH 4RDQG 1JV5B 1OF2A 1XR8A 1BVLB 1OTUD 2IPTH 4WO4B 2F19L 1SFCB 4W9DC 4HIEA 1PX8A 5EZLA 3SODB 3UYPB 4WDIB 4LPCA 4ZQKA 5GRJL 4I1LA 3VI4F 2K8QA 3MLPA 1GU5A 3FF8A 4E2OA 5AUMA 2BP0B 2K3HA 3UBXG 1NC2D 1DQQA 4JYCA 3ILQD 1L9QA 3B9KB 4PRAB 3EBAA 3LN9A 4YQXL 1OZUA 1P84J 3CCHB 5GPRA 4G6KH 2RD0A 3GMQA 5FOJA 1MHCB 2RALA 1OQOA 3HCVB 3QCTL 4MD4A 43CAA 4F9LA 1N70A 1DEDA 3AW5A 3C60A 3SGEI 2YSSB 3CVHA 1L2PA 4ONHB 3SPHA 5LJYH 5BZWB 2DLEA 2JXMA 4E5XB 1LO4H 3KXFA 4AQ1A 4DO4A 4M93C 1LO3L 4XVUD 2VDMB 2RMZA 4I7ZC 1WRFA 1MRDL 4BXVA 4G6ML 1MZZA 2WCSA 1QATA 3QIUD 4HS3B 4C46A 4A2MA 1KN7A 1CI3M 1JZDC 3LW5H 2UZYA 2UY7B 2YD5A 2CBTA 4DUVA 5J12C 4ZFOL 2DM7A 5CHXA 1I7TB 3V5HB 1AOZA 2WQVA 2NY3B 3MJWA 5GGTH 4B9IA 1KYOI 3K4ZA 4JRXA 5B8CA 5I26A 5BUGA 4OT1L 3WNOA 1IGCH 2GITB 1FL6A 3CZGA 1DDHB 1AA0A 5DJUB 1BJMA 3WJJA 4DGWC 5JOEA 3IETB 3DX8A 5E1HB 4FP8L 4WFHE 1J5DA 1EEUA 4KKAD 5HDBB 3T0AA 2PTVA 2R69A 1FZEA 1R5WA 2WOBA 5ICYB 1HKLH 3ULUD 1DVQA 4LCWD 2CU9A 4YC2C 3MGAA 2VLMD 4KUCF 3ZYOA 1DLFL 3GB7B 1SGKA 3CDZA 1IAKA 3ARFA 5HHXH 2NXZD 1CFSA 4BFNA 3TTSA 2H3NA 1CGSL 1PZ3A 1IGFL 4GS7B 2YQBA 1VRSA 2J6EH 4B53A 2ZP0T 3EHBB 3VD0A 4YUEL 1N73B 4NC2B 2BWDA 1NCWL 4K2UL 5JORA 4H1LB 4LO9A 1G1YA 5E56A 4HIXL 4PD4J 5EEUA 1N4XH 3FFCD 1JFQH 4OAWB 4Z77A 2HX7A 1T6BX 3OBAA 4FZEL 5J3HD 1OGSA 1SHSA 3Q1MA 1DLHB 1FOSE 1M2OA 1OZTG 4OJFL 1O6SB 5C0ND 5E2UH 1KJ3L 1YYLL 3G6AB 4L3EE 3AXIA 3I02B 4OLWL 4KZDH 5EC2A 3ZHKA 4Z78B 5E2VL 1OWRM 5LDSA 3ATBA 3C5JA 2WUCL 1BZ9B 2JI2A 2F53B 3FOMB 3H0TA 5CMAB 1DJXA 2E76C 2W95A 2GJJA 3Q2CA 5DS2A 5DJZA 1RK7A 1KLUA 4M62H 2H47C 3KPEA 5JR1L 2H6PB 3JWOH 3GSUA 3N1FC 5IMOA 4JNXA 3AS1A 5DJ0B 1LP1B 3MUJA 1GGIH 1H3TA 3BZFA 3QR0A 1XF2A 1TVHB 3C5SB 2AVGA 1DBKL 1EFQA 1JN6A 1HE8A 3IDYB 4D0CB 4D8PB 3KGTA 4JLRB 3QNXB 3ULVC 2AP2A 2OTLP 1NFKA 1VF5B 4I48B 3OF6D 5BQ7A 4XZUB 1CYXA 3PABB 1C5CL 1EEZA 1WFUA 2C9AA 2PF6A 2W38A 4UV7L 4KJMA 4ELDA 1S5LE 1KTRL 3C2AH 2C1OB 3UEZA 1WBYA 3OSVA 4TNWK 1AXSB 1LO5A 3E6HB 5H2BA 5AENA 5FYLL 3OG4B 2QEXP 3CBJB 3JWDC 3V0HA 3T71A 1NBZB 3ZGIA 5C92A 1X44A 3L1GA 3DX0A 3TO4B 3DUSA 2OJEB 3CK0H 3VWKC 5I1DA 3BKMH 3ULVH 1RF0A 1EGJL 3FDWA 1Z9OA 3W81A 1CDUA 2WQSA 3WEAA 3WL9B 3QRFM 3UH8A 4YXDC 1MHPL 1ZVNA 3HUJB 3STLB 1EQWA 4WY7H 5D7JB 5E1IA 3U1PA 5JOFA 4PJGF 1M7IA 4QRSB 4UILH 1JTHB 2Q0ZX 3CJJA 1KXVC 1CC3A 3S8GB 1B88A 1E9OB 5KWYC 1T89A 2OV0A 3GI8L 3MLXH 1HF9A 4GUPB 5ITFB 1HUCA 4NXSA 4WW2B 3S5LB 4XXWC 3FCSA 3HE4A 2HFGL 4N2NA 3GF7A 3RWFA 3MREB 2DWEB 4FTVB 1OP5H 1KCVH 3QEUB 3JWDH 3KR3H 2ICEA 3WBDA 4V11A 4NC0B 3I3BA 3D50A 4LAJH 1DX7A 1YEHH 4P23D 3MU3A 3BPOC 3UAJD 1T0PB 3K4DA 4KI5E 1E28A 2XPGA 3HG1D 4N1HB 1JXDA 3U25A 4UMGA 4AVKA 4F8QA 1N5YH 1ZV5A 3NK4A 5DD3H 3KJ6L 3QIWD 2BY3A 4GSDL 3RHWK 1MKFA 4NPDA 1YIJP 1I1AC 5DEGB 3K5BA 1OB1A 2JQZA 1E2VA 3D69B 4KQ3L 3OAYK 4XMVA 3S6CA 2DQCH 1DBML 1WS8A 2OXHB 3E8UL 4EBQH 4DW2L 3PAUA 3VD2A 1INEH 1G7JA 4I4WB 3V4WA 2ALAA 4Y4FC 4ES9A 1HILB 1MNNA 1UKQA 1G2CB 3QZPA 4I1NB 3VFPA 3SY6A 3FO0L 3BAEL 2J25A 1RMFH 4X6BA 1X5MA 1J0HA 3C6LD 2Q7CA 1FZOB 3FGAD 1IEAA 2QADD 4IRJC 4XCCL 2H4EA 5AVTB 1NSNL 1RZIA 2WTPA 3O0RL 5I6MA 3BAWA 3LKOB 3NCEB 3IJHB 3O6FA 3IXAB 4A2EA 2HLOA 1I1CA 1GGUA 1XF3B 4IOSD 1KXTB 5DJ8B 1KTCA 1CZQA 4ONGH 2BPBA 3IFOA 3MV7E 4WWNA 4U1HB 5DYOB 3ZL2A 4BIKA 4D6TG 2A1WH 2VLJD 2ZCKL 1S7QA 3IE4A 4L3ED 4UNTA 2D2OA 4K8RL 4YDNA 3TDKA 5ECGA 3RB5A 3UBGA 4HIHB 4B9CA 1OPOA 1WFJA 3PWNA 5JHDE 1DVZA 3MXWH 3DBXB 5EO0A 3QWOA 1NGMB 2IPUG 2O6EA 3PWVA 4DP6X 1UCBL 3Q44A 1RUAH 3EGXA 1OARL 1SQXK 5K9KB 4FABL 3DVNA 2FR4B 5IB1B 1HNGA 4QGYA 4G6FD 4HUXB 3Q6GL 5TF0A 2A9BA 3FTUA 4GODA 1BW8A 3GMAA 2C26A 2G2RB 3B9DA 1KTJA 4RGMB 3T6QC 4LF3B 3IDJA 1TYJA 1WZAA 4JKWA 4M6OL 3ZKNC 5F3FA 5H4ZA 1GL2B 3GMRB 5I1IH 1JYVA 3DYOA 3LQZB 3H1HJ 4LHUB 2NY2B 1TQCB 3T2PA 5AAWA 2OS7A 1HYSC 1PJWA 5TH2B 2BWIA 5I17B 1OTTC 5FECA 3L75G 2X2UA 1DJGA 1F5WA 1YN7A 2IANE 5KANI 4NPJA 2P24B 4WW1B 3EJCA 4WI0B 3OWRA 3RZCB 3SQRA 4HPYL 4P5TA 3DOSA 1RK0B 1MCCA 5ICZA 1PLAA 1OVUA 3DO3A 2GK0A 3OHXC 3QFJB 4GKOA 2E7LC 3Q8BA 5LCVH 3H6JA 3H1IJ 4G8EA 1OCWL 3WUUA 3EDFA 4AI7A 1AHKA 5DK2A 4GT0A 4RA3A 1WWCA 1T1YB 3PGCB 1L0NE 1IJ9A 1SBBA 3BHBA 4QJ5B 1J8HB 2HRPH 3OPZH 2RJMA 2R7EA 4G6KL 3CQFA 2ADFL 2KH2B 2W59A 4GMSH 3L7FB 4JO8A 2CO7A 1FBIL 1ML0A 1TEFA 2QM8A 2C9VA 1NGZB 1WYJA 1CBVH 1R3KB 3S3DB 4WCYH 3BIKA 4PJ9D 5E1QA 4PWIA 4KY1H 4J27A 2MKLC 1LO4L 3G4SP 2Z4TA 4XP1H 3MODH 4S10A 3L9YA 5K39A 4G6JH 4JB9H 2XNDH 4H13B 1JTOA 1GPOL 1MCKA 5EU5B 4NFDA 2X4PB 3C5ZC 4HLZG 3KYAA 3U2SA 2IF7A 2YPKA 3AGWA 4JANB 4BFKA 4Y5VB 1JMXA 2XKNB 3DUUB 1X79B 2GW5A 5DHVB 2BSBA 3ALXA 3QZNA 4TTDC 2O93L 2VQ1B 3HG0A 4CVZA 3VD7A 4AIZB 3OR7B 4JFUA 3B1TA 4PGEA 5D96C 5CD3A 1Q82Q 1S7XB 4N8PA 4EMZA 2FGWH 5FO8A 3P9MB 2MCAA 4YHOH 1S2EA 3RL1A 3VFOA 4IS6A 3M17A 3JV4B 1YNKL 5KSAA 3QUXA 5DJYA 2MPAH 2WN2A 1HE7A 4TRPH 2IWKA 3C6SB 4ZTPH 2ZCHH 1IKNC 5A2IH 5C70A 1LTTC 1M1SA 1IEBB 2VWEC 3KLSA 4UTBH 2Q6WB 3RK2D 1ZJBA 2OMWA 4GAYB 5B5EH 4HK0A 2AEMA 2JKVA 4LBAA 4APXB 5IB2A 3LH9A 5HHXL 1S5LX 2FYUD 3LPWA 5F88B 2CRYA 1XCQA 2ICCA 3QZMA 3FB6A 1EHLH 1IQWL 2ITCA 5D1ZD 1FE6A 2IH3A 3N85L 2K9JA 4TULL 4JRXE 4YBHA 5BS0A 2ORBL 2ZSWB 2O1JA 2J6EL 3RWJA 1QLFA 2ENPA 3MV7D 5CEZL 3TBYB 1GYWA 1WZLA 4KO7A 1LD9A 4GW4B 1EFXA 4ZJ9A 1NMCB 4IDJH 2WIIA 5I15H 4PGCB 1GGBH 3FYIB 4GRMA 4L2YA 4WVRA 1MCRA 1QSFA 4U3FJ 2XXGA 3MXVH 4P4KC 4E42A 3QO1B 5K5YA 5EULV 3M7FB 3G71P 4MASA 1JHKL 3ALPA 4Z3JA 5A3ID 1DUZB 3B5NC 5F6IC 4PJAB 2MHAA 2UX7A 1AYOA 3CZLA 3QXAA 4J2QA 4PJIA 4WFGE 3MRDA 4NO5A 5JHMA 4C83A 1DDTA 5FA4A 1OAKH 4E9XA 3QIBB 3QPKA 5MERA 4M62L 1RIVH 3GBDA 3U30C 3ZHNA 4LDCA 1R75A 2JI1A 4YXLH 3VX1A 3F7RA 3FQ1A 2I85A 4Y1AD 1GGIL 1FE8L 2VUKA 3GBMH 4S1DC 4YOKA 1G43A 4LLMA 2D7OA 5DJDA 1JRHH 4H0HB 3G5VB 4F92B 3PU7A 4XB3A 1YPZF 5FO9A 1NTZE 3TO2A 5BV7H 4YFLI 1GY1A 2IAND 2NYZA 2AV7B 5CUSH 5IJBC 1F8TH 1F41A 3IN0A 1BAFL 3BT2L 2X4QA 4MA8L 2NQDA 2IYPA 2P5EB 4PJXB 4YDMA 3ABZA 3VXTB 2NT1A 3ZMEA 4QTIH 4W7ZA 5L9DH 3QXUA 3DJTA 1JF5A 3N50A 2WQYC 3KYMA 4QPEA 2HUHA 1A6VH 4JKPH 2ZOLA 3TGUE 1Z7JA 4YBQD 1OAXH 3CK0L 1D6EB 3LNFA 3MO1B 3ULVL 1ASPA 3MRKB 2HT2C 3QUYD 2FJSA 3LMJL 4X8JB 1KB3A 3Q5SA 3PIQB 4M7LL 4QMAA 4UILL 2NNAB 1G7HA 3TP4A 2UWEB 2X6VA 4AKOA 1NEUA 5CJ4A 3BGFC 1KBWA 4NWTL 4JR9L 1Z32X 3MLXL 3P11H 4YK4B 5T1DL 4TSBH 4HJJH 4L8SA 4M7JH 3FT0A 3OKNA 1F3JB 4U6HA 2KSEA 4OZIA 3WNKA 1MVUA 3JWDL 2ZUVA 3KR3L 4DAGH 2N0KA 1ZY9A 4FQ2L 4RAUB 1BFVH 3HZMB 3MROA 1AC0A 4JO4H 4P4RA 2XN1A 1YEHL 3AG3B 1CMOA 4DFIA 2KSJA 1D5XB 2V2WA 2ITEA 2DI9A 3L74E 2ZSVA 4WI4A 5DD3L 3LKSB 4U6YA 4XODA 2FEEL 5CWSA 3UX9B 5CZRA 3SWYA 1AHWC 3VWJA 1EMTL 3Q2LA 4AZUA 5EBWA 5KYUB 4LASL 3KXFD 2CK0H 1DFBH 2NY6D 2DQCL 2AABL 2A45I 3ZRCC 3CXHH 3KYOB 1ORSA 2OMVB 5AL0A 5JHAA 5EU3A 1XH3A 3L4ZA 1INEL 2CDGA 4QMEA 5JOPE 1KJ2A 5KLVK 3VA2C 5DK0B 5IBUB 4M8QB 4D3CH 1JD9A 3LXBA 3AE3C 1HXMA 3TOPA 4G42A 4PJ0H 3RTQD 4IU3A 1AD0B 3MLRL 5IMLA 3ECWA 3I9GL 2GTWB 1MFMA 4JRXD 3NG5A 3HAEA 2PP8A 5I5IA 5AKTA 4ODBD 5IUCA 2JI3A 3MRQB 4YGVA 3K8LA 1HDMB 4HX1B 2QQNL 1FZGA 2VRSA 5EOQL 2QMJA 5I1LA 4R90H 4CDGC 4HBCL 3AM8A 1KULA 5FYLE 1GC1C 2XNAA 3ZE1F 3MPCA 4QRUA 4HK3J 2XA3A 2A1WL 3KPQB 1JWMA 1ZRTE 1U41A 1FVEB 4ZW3A 3NFNA 1U3HB 3LPFA 1AQKL 3MXWL 2OYIB 4BFIB 3QFDB 1NM9A 4AKPA 5GRUH 3VWKA 4DEWA 3CN2A 2HVJB 4DO5A 2A6IB 4JFFA 4R7NA 3MHVA 1RUAL 3Q2NA 2BSDA 4JZJC 1E27B 4Y19B 1GXEA 2OTWA 2VDPH 4D2NA 1PZUB 3S4RA 3GMOB 1KXVA 4AENB 1E4JA 3BN3B 1IBYA 4Y2LA 4IBUA 3QUZB 3QYCA 4NQDB 3F8UB 1MFBL 3V8OA 4DSYA 2WSCJ 1AGBB 3AUVA 3QAZC 2YD8A 2YGVA 1X5ZA 1NTKK 1HCZA 1HCYA 5IF0A 1AVAA 5I1IL 2DW3A 4X42A 5BUAA 1QFOA 4P2OB 5BVZA 3CN3A 1NL0H 1VQOP 3DECA 4Y9BA 2CBMA 2FHBA 4RX4A 1NHLA 1HWHB 1O5PA 5E24E 2CPSA 2QKIB 5E0QA 3BPLB 4XNXL 4YDIL 3VRLE 4TQIA 3RFZB 2WZPD 4OZHF 1NWOA 3WDHA 4CILA 5JMRA 1SJHB 4ZMXA 2XZAH 1NZRA 1XGTB 3BUTA 3PGFL 3U0WH 4QKXB 2E7MA 1BX2A 3OAUH 3NVQA 3GT6A 3TGUD 5L0QC 1VIWA 3VB8A 2YXRB 1HVVA 3T97B 3REWB 2DQJH 3PGDA 2C3VA 4Y4FA 2YK1L 1GIGH 4RO0A 1OHQA 1QBBA 1FNLA 1XF4B 3TIDB 2DQEL 3IDGB 3EO0B 5B1JA 4NUJA 1GMIA 3VSVA 4OGXH 1KILA 3OMZA 3JT0A 3RX8A 1NMBH 2HRPL 3CFMA 2VR7A 3OPZL 2SEBA 2H8PB 4PQXA 4HB1A 5BJTB 2JJSC 2N7BA 2FX7L 3MRGB 1KEMH 2TRYA 4GMSL 2QJYC 2GBTA 1IQDB 5DZ9A 5H35B 4PLJD 4OTXL 1IFMA 5D5MF 4AYBA 3K6SB 3ABMB 3CXHK 4MNGE 2CO1A 3MUGB 2GABA 3CPWO 3EYOB 2XBDA 3SGDI 1JK8A 2PCPA 2R32A 3MNMA 4U1MA 4XP1L 3MODL 3W82A 4G6JL 3H32B 4JB9L 3WNJA 1YMMB 2F7PA 2UZPA 5A16A 2KIKA 4LDEB 5EBMB 5IMKA 3RWHA 1DUYB 1JCVA 4PVBA 3L74D 2AI0H 1F4WH 5IQ7L 5KVFH 3N0PB 3UC2A 3A0BH 2VB5A 5TJHA 1FNSL 4FQ1H 4J28A 1YDPB 1CLYH 2H26B 5T1LB 1GKOA 4FRWA 1CICC 5K69A 4YZFF 2XN9A 2Z6FA 4RVBA 2EICA 4YEEA 3N3EA 4O51A 5FW7A 1RP8A 4HETA 2DJMA 2GG1A 3X11B 3T3PE 3VGGA 3P4NB 4JJ5B 5JOPD 3VMAA 4X4YA 2GPZA 5A6LA 1OIPA 1QPXA 4Z95H 5MHSE 4NP4L 2R59A 4S1SL 4AVJA 3R7RA 2X3AA 4X6DA 4G7QB 4M8RA 5FXCH 2KNCB 2Y5TA 1SQQD 2HG5D 5FDWA 5I66A 3CPLA 3AAZB 3AEFC 1QFWM 5DR5H 5SV4A 2Z8WC 4X6EB 3VMPA 5F1NB 1KY6A 4LMQI 1X7SA 2I9TB 3BLPX 3HI1A 4UM9B 2VKWA 2WXOA 4U1GC 3KHQA 5C0DA 3D85A 2A9ML 5GGVH 4AEHH 4YPCA 2EXYC 2ZOWA 3HRZB 5FYLD 2OSLB 4R0LB 3JCUH 2EC9U 2JB5L 3GD1C 4F7MA 4ZMNA 4KH2A 2XPZA 1ZRTD 3ZZLA 3BCCJ 2FB4L 1Y6KR 4U6XA 1GGBL 1LK3H 4R7LA 1U8MB 3HB3B 3FB8B 4QF1B 2E7LA 3LVEA 3RL2B 1VGKA 4CBZA 3RDTC 1X5FA 2IAMB 3IDUA 4OLEA 5CP3H 4XNMA 4DETA 2QV2A 2WYHA 3DA0A 1WTLA 3A6BL 4LCCC 2IC2A 1GRWA 1TLKA 3K6OA 4FN0A 2V4HA 2Y3NA 4FXKB 3DSFH 1Y0LA 1M05B 4I0CC 5HVGB 2BIMA 1KC5H 3IU4L 4HAKA 4UB0H 5TPWL 3FTWA 4PJBA 4YLBA 1Y7VA 4A55A 2I5YH 3ZL4L 1MREL 1HOEA 1NH6A 1MFCH 4UZSA 3ABKB 5KS9A 3O81A 3UP1A 2C7UB 3L4CA 3GBML 3EJZC 3F58H 2JSFA 3L81A 2BHZA 1FDLL 4G9DA 3DUHA 4XP4H 5J6SA 4X2UA 1QSFE 4PJCA 1I9JH 2F61A 3US0A 1WISA 3T6WA 4PVMA 3GSQA 1T4KA 2HVKB 4L1HA 2RA1A 3NCYS 4JFPA 4PJIE 3LS5L 5HYQA 2VXTH 1SQBJ 1CE6B 4D8OA 3U1QA 5JYLA 5DRNB 3SGEH 1U8LA 5F6HJ 1C9SA 4JN2B 2ARJB 4DGYH 1R8EA 4JFHE 5KZCD 2YPLE 1ZV8A 3TV3H 1DBAH 3UOAB 2WLHA 1IBDA 1ZDQA 2HFFB 1DQTA 2FH8A 4IRSC 4JKPL 3X1EA 2R2BB 1QLRA 2CD0A 4M4RB 3MV9B 5AG8A 1OAXL 3BWAB 1WO2A 1MLBA 3I2CL 4M4PA 4V33A 1IKNA 1MLCB 3FT1A 4HALA 3RKDC 4KGJA 4N8UA 3A67H 4BGLA 3INUH 1M3IA 2E74D 3H1JE 2ALWA 2VZTA 5J89A 5EIIA 3OKKB 4P5TD 3PDDA 2WQ8A 1NUDA 1VZGA 4LVHB 2XIBA 1ZWIA 5MEQB 1A1NA 3LS4H 2C4XA 1X9LA 5AFAA 3LZNA 2HXAA 4I5BA 2WPRA 1BGXL 2HP4A 5FHAH 4YSAA 4B9YA 5CEZE 1EK3A 4ZKUA 4DAGL 5CXPA 2OYHB 1DEEB 2VIRB 1BZDA 4Z5RB 5KYXA 2Z3FA 2BLFA 3F3HA 4QXWA 1E6OH 2DWDA 4PBWD 4Z7QB 2NPSD 5T3XE 3MCG1 4ONFL 4K71C 3G7TA 4UQ2A 3ZDMA 3MNZA 4N0YH 1X6LA 4TVPH 4XC1L 1EEYB 2H43A 5D7EA 3LH2L 2FKWB 2KUTA 2PYEA 1CDJA 5EZJA 4GT1A 2IH1B 4APQB 5DVKA 1CFQB 4TUUA 3IPBA 1DQLH 2DB8A 1BF8A 4Q9RL 3B5NA 3T2NH 4CVWA 5MHSD 3GBLA 3CMAP 2WZAA 1N59A 1TZHA 4OZIE 3CU1A 3FU5A 4XI5D 4XO5A 1OSZA 4H7VA 2JJVA 2QLYA 4QRQB 4FYTA 4Y1TA 4L9LB 3S36H 1WLHA 3A47A 2GHZA 3UPRB 3ECVA 3L4XA 2MWCA 1FIEA 1LVEA 2ESVA 3AEGC 2VLKB 1UD5A 5C39A 3LQAC 1FFOB 3HUSA 1E6JH 3WTVA 5EZPA 5AALA 4BFJA 5FUZH 4X8GA 2E7HA 1TQUA 3ZO0A 2YXWA 3LDBC 1EZLA 4W6WB 2UWJE 2F8VA 1RU9H 2H2SD 1W16A 5KSAD 1T1XA 1MJ8H 3PL6B 3QUXD 5HI4C 4LGRB 3REVB 3WKNA 4H2AA 5APTA 2IIJA 3OKMA 3HIZA 3PHSA 3F7LA 4GQRA 4LKCB 3X13A 4XCNB 2A2QT 3A6OA 5JLZA 3VW3H 4R90L 4YZWA 4PJ7B 3MCLL 1YQVL 2Y23A 1YJ9P 1QRKA 4P2CG 4NNPL 3RUGA 3D9AL 4HMCA 4I2LC 1MJUL 1HESA 4M00A 1OCOB 1XTMA 4L0ZA 5B66H 3SBQA 1K72A 1AGDB 3PRZA 4WY4C 3KL5A 3BQUD 4GIOA 1JYWA 1NGWB 4C4KO 2J8UF 3G5XB 3PWPA 4ISVB 5ALCH 4CC4C 5BS0D 2C3WA 2VDPL 1SQPJ 5TE7H 3ZL1A 3EOAA 4ZZKA 4R4FL 1KMIZ 1HCVA 4YNYB 2CKBH 2X70B 2DYPA 1OW6A 2BVTA 1EFXD 4TUJB 5C09B 1JBJA 4NHCH 2ZNWA 3S1KA 3KBPA 4ECNA 5JHBA 3DOHA 3FRUA 4F7CA 4Z3EA 4F7TB 3CQQA 1GC1L 3UABA 4BQCA 4OD1H 5K9OA 2HCZX 1QSFD 1Q86Q 3QPQD 1B3IA 3U0PA 1EVTC 1JUFA 4XHJD 4POZC 1RJLA 3WTWA 1OAQL 4PBDA 1KENH 2E6QA 2ITDB 2NX5E 4FNPA 1FLTX 1NL0L 3EH5B 4O02B 2L4OA 4XCEB 5C0IA 4JFFE 3ZT7A 3Q6FB 4BUQA 2EILB 1D7BA 3Q3GA 5IFAL 5KUKA 1JNNH 4LCYB 3ZE2E 1CF8L 3PS6A 1KYOK 4FXGB 4OFKA 4Z3FA 1MIEH 4FDWA 4D0BA 4ZD3H 4U1NA 1QSVA 3GMPA 3RVTD 3TFKC 4HT1H 5HHOB 3AGVA 3HZVA 5C0FA 4MB5A 3ECQA 2HTLD 3BC9A 3OAUL 3MOBH 3OSKA 3E80A 5LGYA 2DQJL 2UY6A 2ZWKA 3BYTA 1UM5L 1JHLH 3EFFA 4FQJH 3SZ6A 1XV8A 2NT0A 5DHXB 1NAMB 3TNMA 3H1JD 3KNBB 1NMBL 4ZMYA 3ARUA 1W2EA 3IGLA 1WIPA 5INCB 3T5WA 2XFGB 1MY7A 4GEIA 4OIFA 3DETD 5JHDB 1MCOL 2JP3A 2GEEA 2AJSH 2QJKB 3B83A 3KPPA 2X6CA 1EDJA 1GL4B 2TSBA 3GHGA 4PN6A 3QXDB 2VXVL 5IB5A 1QTYT 4HF5H 1FVCA 1WBXA 3N4XA 4F57H 5T3XD 2OMZA 2BASA 3ASOB 4FA6A 4P2QA 1UH2A 1WCBB 1E8YA 4DT2A 3NTNA 2QHRH 5KVFL 2YFOA 4BQ9A 3BRFA 3H1LD 2BNRA 1CLYL 1YMHA 2YKLL 3CFNA 4PJDF 2G9KA 5EEYA 4Q8BA 5DTFB 2PXYA 4IBZA 5E0FA 3UIYA 3X1GA 3CZFA 4MN4C 1T2KD 2X42A 3OWEA 1B2YA 2UVFA 5J11B 1U30A 1HQRA 2PR4L 3QDJA 4LBEB 3X17A 4L3FA 5HDLA 1PBYA 2F54B 1HHIA 2IFFH 4OCSH 4A68A 3RK3B 2P7JA 1KTLB 5DFWH 4A7SA 1ZJAA 2ZWSA 4FF9A 4JGNA 2PYFA 2MCMA 4OGQB 2JKRM 2CDFA 3BVHA 2AXFB 1X0TA 3FN9A 3MGOB 3K0YA 4H25B 4HCRL 2EXSA 4XOEA 2Z7UA 5IHZA 1WBZA 1MH5A 3VWJD 5JNYB 5A7BA 3K2IA 1LTIC 2XN9E 3MZWB 1H6UA 1A6WL 5CEYA 3MLZL 5B39A 2FNWA 3THML 1PZQA 2ZQKA 3QZOA 4HWBA 3IBEA 2BW5A 1M71A 2NXYB 3H56A 3HJ0A 4FFVC 3TA3B 3VGAC 4NJ9H 4U1IB 4D9RD 4ADJA 4LE8A 3KL3A 3DTXA 4A7GF 4X6DE 4V1DB 1WZKA 1KB9I 2KS1A 1BAWA 1LK3L 4CKQA 4JUTA 3DDFA 5EZLB 1V05A 4M7LT 4Q58C 5DLLA 4GJTB 2BCCE 3N0AA 1Q0YH 1TJGH 4KKBC 1KBBA 1F00I 5DDHA 3Q1EA 1BVKA 4NKIH 5ISZA 1DQQB 1U0QA 4HWUA 4IJ3B 2OMNA 4IMKC 2D31A 4IBWA 2VMDA 4DZ8A 1GZHC 4UB0L 1KC5L 1CI6A 4G8GB 3O9WB 5DWUH 5E9AA 1T7ZA 3GMQB 4TNGA 2IV8A 2E86A 4MD4B 5CR8A 4ZOAA 43CAB 3WTTA 5F9JA 2CUAA 3BASA 2XJLA 4JE0A 3C60B 2O61B 1CB4A 1CR9H 5J13B 1SF3A 3SDCB 3L70D 3F58L 4OLUL 2JXMB 5CJQH 1BOGA 3VWKD 1B2WH 1UJTA 2P8MA 4XP4L 4JFFD 2W07A 1M53A 1YEGH 3HPLA 3WY4A 4K94C 1ZAGA 1J8RA 3VXMD 4HCRA 4XO9A 3BJLA 3ZTDC 2OCCB 4FFZH 2N9BA 3MV8E 3RFRA 4U1JA 2VXTL 1UA6H 2VMJA 3FCGA 5IKCA 2UZYB 1AG0A 1FFQA 2WZ5A 4HYTB 4DGYL 4HXBL 4NPYB 3PDOB 3C8KB 3TBBA 4XPAH 3MRCA 3VXSA 4H88H 3SOBL 5KBMA 5F6HI 2DD8H 2EDKA 1JY3O 5D6CB 5KS9E 5ALBL 3BDYH 3SWFA 3VXPA 3E3QC 1I8MA 3VD5A 2QIWA 1FL6B 1VZHA 4PRID 4M6AA 4N1EA 2QPSA 3KWTA 1H5BC 2BFVH 4RX4D 4HZLA 3DX3A 4PJCE 3DX8B 4BZ1H 3CCSP 4WIQA 4BWUA 4K94H 4UIKH 2EE6A 1TQSA 1M1KQ 1VQLP 1RIHH 4YL9A 1EXUA 4KVCL 1HX0A 1X4XA 4NRYA 2FIKA 3VI4A 5DC2A 5HJ3A 43C9B 2ATKA 3IEAA 1NCCH 3CDZB 3ARFB 1YLBB 3LS4L 1I8IA 1UA3A 3K2KA 2ADGB 3R0MA 1CFSB 4KK8C 4NXKA 2OZ4H 4R4NC 2DBLH 4CC0A 4W6YB 2H3NB 3T8VA 4B95C 2MIZA 5A40E 1H3GA 3RVWC 1KILD 5HHPB 1NUFA 5A1AA 1E6OL 1MFNA 3QZBA 2JJLA 4EQ3A 1P1ZB 5HGHA 2LU5A 5HHMB 4F2MA 1ET7A 4Z77B 3QJXA 3RDJA 3BP6A 1NKGA 2WHVA 4I9WD 2VWEE 4N0YL 4TVPL 4KZEH 4C56D 2IGFH 3RDTA 4EI6A 5JHLL 4Q4EA 1JGIA 1JZJA 3JZ7A 2O5ZL 2W81C 3J2PA 2AZAA 3HE6C 5TDOA 3T2NL 3LV3A 2WXPA 3H0TB 3IJEA 1SJEB 4A39A 3FYEB 3LRLA 2R0WH 4CU6A 2ZP8A 5LQBH 2ZX7A 1GS7A 4ZFOB 5DJZB 1OGTB 4FQQB 2GCYA 5DD5H 2WO3B 3T77A 1I85C 3MJ8B 1OFCX 2KPNA 4NRXA 4HJSA 2NY4D 1HVXA 1MI5D 2DH2A 2XN9D 1ZSDB 3MUUA 2A4EA 1P7QA 2YPVA 4HU8A 1DEEG 1E6JL 4C58B 2ZKHL 1UXMA 4PY8J 5IW1B 2PYEE 5HHVL 3WJMB 4WW2F 4WHYH 1OXZA 1AQ8A 4AL8H 1L9OA 1RU9L 2WLZA 4EN3C 2YEZA 4UOW0 5I1CH 3QDHA 5C08A 3C09B 1UOLA 1WAEA 1X9QA 1EEZB 2CRMA 1CF1A 5CGBA 3MI6A 5AW1B 1HEZA 3HE7D 5I24A 2EIMB 2H1PL 5AVWB 4F3FA 1WBYB 1KELL 3LD8B 2WPVB 3U1SH 2MCG1 2WXQA 1Q90A 5CIPB 1S6NA 1OF0A 1NGYA 3FUKA 4IKJA 2BCCD 3D6ZA 4G71B 2ESVE 2V5RA 4NZRH 5EO9A 4PIRF 3UZEA 3S35H 4XCFH 1UWFA 5C0BA 2CJSA 3VMXA 4PMEA 3LQAL 4CBPA 3DUSB 3X14B 3CZNA 2WYZA 4WWKC 3T1FB 5I1DB 3TF7C 9PCYA 1E4XL 4QRTA 3GMNA 1X7TA 5H37A 3QUGA 1CXHA 1KFAH 3SDAC 2Y1AA 5IJKA 5JHLA 1D9KB 2CKBL 3P8MC 2JMRA 5JPNC 2EVIA 3VE0A 1M7IB 4NHCL 1V3LA 2NY0D 3CHXA 4L4VA 2OQQA 1F1DA 1Z0MA 2COQA 4OLYL 2ZVNB 4PWHA 5C0EB 4P49A 4OD1L 4J8RA 2RQ8A 1NOAA 4AQRD 1L4AC 5KAFH 5DJTB 4ZX6A 2E27H 2MOGA 2EVGA 2W6JH 1B4JH 2WSEJ 2QQQA 1T3FB 1KENL 5E5LA 2CGYA 2IZ1A 2DL9A 3MJ7A 3V9CA 3NJMA 3QG6B 1WDAA 5I16A 3PWPE 2F6AA 4OCRL 5I6KA 3BKCH 1WZ1L 3WFBL 3PAZA 1E28B 3VYPA 1BM3L 5DHYA 2WOYA 1F6AB 1XEDA 1M1JA 2OKMA 3ZIMA 3NJLA 4HT1L 1EC5A 5JW3H 4UM8A 3PAYA 3M1CA 1OB1B 1OP3H 3BP4A 1X5HA 3JSVC 4O2FA 1V7MH 3CLEH 3CC7P 4QXTB 1VENA 3RWEB 1JHLL 4TXVB 2K9FB 4JHWH 3EJPA 4X83A 4JPQA 5GTHE 2ZOKA 2EUVA 5J1TC 4I87A 2J8HA 3APMA 3LRKA 1F1AA 4IRZH 1GOHA 5CO1A 5CCJA 3HN8A 5F1IB 3LIEA 5C71A 1AS6A 5LDUA 2H5UA 4HZAA 1WF5A 1UG9A 2D7TL 2Y2WA 3MLYH 4RAVA 3F2LA 2A45H 3FKUS 1INQB 3N40F 3H6PA 3O6FB 3DVIA 3HNTL 2WBJC 4PJGA 5LNEA 4HUNB 3SPVB 5CCGC 3CVCA 2IPKA 2LR2A 2FCBA 1OW8A 1NFIB 2P1YA 4FMVA 2FYUG 3ZKMD 2OK0L 3MRHB 1S7QB 1SBSH 2M26A 4F8PA 1SQVK 2CZNA 4KVNH 4UQCA 2ADJA 3PWNB 3WTXA 2FHFA 3LRGA 4JFZH 1A7QH 4XHQA 5I0YA 3PWVB 2ZUXA 2WY3B 2DQDH 3EGXB 2UXTA 1D5MA 5LGHH 3G5ZB 2EECA 2EEXA 1RCYA 4H8PA 4OM1H 4MJIA 1NO4A 5KAQF 1AGFA 4RFEB 4P5MA 4P2QE 4W81A 5M7QA 2BFGA 1IO4C 2CM6A 2WXNA 4JQVC 1TIUA 2DH3A 3WEMA 1JVOA 1MJ7H 2RBLA 4U6VH 4ZUSA 4WUUB 2WVVA 3U1AA 1TENA 2NQ3A 2P80A 3IDJB 5H94B 2FFDA 1XH2A 3F5WB 2BNRE 1AKJA 4YSSA 4I8DA 4W9FC 3LKRA 1LWUC 1LGHB 1QRNB 3RJQB 4Z7VF 1U8QA 2ZUYA 3ETSA 4Y2DC 3ZDXE 3QDJE 3GM0A 4P8QA 4L3CB 4JMNA 2J1YA 2PWHA 2FJHA 2W0FA 4FERA 5DD0H 4NPKA 4PP1C 1HJBC 2ZF8A 2PP7A 4MNGB 2ESVD 3X1BA 4N68A 1N18A 5AL8A 4RNRB 5HDQL 2RH0A 1ZT1B 1RUML 3VI3F 5AYQA 5E79E 3QDMA 3MRBA 1Q0YL 1TJGL 2XBZA 3US1A 2MPVA 1S9VA 2IBGA 1AD9B 3C08H 3WFCL 2K4WA 1OTSC 2Q2LA 2M3BA 2J3SA 2Z4EA 4Z3HA 1CZ8H 3BHBB 3ZBMA 2DAVA 2J57A 3POHA 4EKXA 2R7EB 3EUDA 2Z91B 1U3YA 2G30A 3IDMA 3IGFA 3UJTH 3EYSH 2YGPA 1YYCA 1CR9L 1L0NG 4PJ6A 4F80A 4P5RA 3A0HH 3T3PB 1KCWA 3W9EB 2N1KA 3N6YA 4JAMA 4MX7A 2R1WB 4LOFA 1QBLL 1MHHA 1YO4A 1ZHBB 3LZQA 4HGKC 1PP9D 2NNRA 4ZS6C 1RF1A 4N22A 5LAXB 5K39B 3PFUA 1K5NA 3FO9A 5G4OA 3TTYA 3FTGB 5KVFE 3B2XA 5ISZE 2DYPD 4YJZL 1H0DA 2YBRA 5GXBB 4UAHA 1UA6L 5E51A 5SX5H 2OPCA 3KLLA 1UB6A 5I74B 1CGWA 5KBLA 2KLVA 3SGDH 4NN5B 4CVZB 3L2NA 3W2DH 1I7RA 4PGEB 2XRAH 4FCHA 2DD8L 2ZYAA 3KPSA 4WHTA 2FWOA 4L18A 4AUWA 1EIBA 1G9MC 2E75B 4JVPA 2LV4A 2VQ4A 3M17B 2YQGA 5E1AB 2VNCA 3MCYA 5KSAB 3KPRA 1D2PA 4FX5A 1U21A 3MRJB 1RQUA 1UZ6F 5AVYB 1MG3C 4XOBA 3VVWA 4QHUB 3T0DA 4WTZA 4FI6A 4K94L 1VACB 2NR6A 3IDIA 4IK7A 1RIHL 4K23H 1A5FL 1IU1A 1N0XH 1NU1J 1J2JB 1R24B 2D73A 1URQA 4M5ZH 2OMWB 4UI2A 4HEMA 3W67A 4N2IA 4ACTA 4L1LA 4KQ0A 2DIJA 3P73B 2VAJA 1A2YB 5JXEC 1I1FB 1BFSA 1E3ZA 2F68X 4MXVF 2DBLL 3L3GA 3TVMC 3VXSE 5J1SC 1ACZA 3V4PL 5DRWA 3VO0A 5F0LB 3I9AA 1G9MH 4GQ9L 3LPPA 4H0GA 3OGOE 1QLFB 1I8LA 5KJ4A 4GMTH 4ZUTB 3UZVB 3TYFA 2QMKA 4O9HH 4EPSA 1M6UA 1LD9B 4P46A 3RPIA 5I6OA 5M95B 3W39B 3EJJX 4ZO9A 5JZ7D 2C1PA 4L29A 5D6DA 3RZWA 1K4DB 3NFQA 1WT5C 2EE9A 1BBJA 1BCIA 1OK0A 1P2CA 1U8IA 2IGFL 2A6JB 2VCOA 4HMDA 1QSFB 1NIDA 4QHKI 3VI4E 3CL3D 4WB4A 5CBNA 4KTDH 1U3JA 3ARDC 1GZHA 3M8OH 2MHAB 4PJIB 4O58H 35C8H 1U8CA 3MRDB 1KGXA 5FA4B 5GRYA 5MERB 5HVFB 1Q9LA 3HTKA 3UTZB 4PEEA 2YPLB 3UIAA 5IR1A 2DI7A 4PVLA 3FHAA 1YCSA 2TAAA 2PXYD 4F2ME 3KPOA 1B9KA 1IJNA 3BAJA 1UWYA 3NACH 2IH9A 1HHKA 4X80H 3SPCA 1ZIAA 4M93B 1O9WA 3MYJA 4I7ZB 2OW7A 1U8PA 3WS6A 1FL5B 3TO2B 2VW7A 3MZGB 4KX7A 1MCFA 4PY8I 2ED8A 1TNMA 4P3DA 3VAEA 1IB5A 4AQZA 1FAKT 2YMXH 3JYBA 3N9GH 1H88A 5JMOC 2DLFL 5DF0A 2EDTA 4OV5A 1FIGH 4Y4HA 1OANA 3MA7B 5J12B 2AEJA 1NTZG 1YY9D 2YS4A 4FG0A 1KNOB 1NC4A 3D6GA 4K0OA 3V4PA 4MQ7A 3JZYA 3GKWL 5APSA 1ZOXA 5ITBL 4HD5A 3S35L 4KJYB 3UC0L 2VL5A 4XCFL 3HS0C 5AG9A 2ZOLB 4XPGL 4HJGA 4MJ4A 1RZ7L 4TOYH 2YLHA 1MCQA 32C2A 3CSTA 4UQIM 4JFXA 5DCCA 4PGBA 5AZEH 1DN2A 4YC2B 4ABQA 5LGJA 2GAZB 5HJDA 4P59L 5C08E 3TGUG 2NW3A 3ARGC 3JTSA 1NEZA 1G7HB 1AKPA 4NQXA 3G6DH 5IW6A 1S9KC 1KYOE 4JDEA 4RISH 5DJXA 3FUNA 3NCJH 3RGVA 4RMBA 4CA4A 4XPTL 3LRMA 1WMKA 4ICWA 3OKNB 2E27L 4GBXD 4ZW8A 1B4JL 1WHOA 5E9DA 3SE8H 5ISZD 5KJRH 3CVIL 1DJHA 3T65A 2O1KA 1XDTT 4FQXA 3KW8A 5A6MA 4P4RB 4KROD 1CU4H 3BKCL 4N0CC 4NS0A 2V2WB 4G8IA 4TVPE 3WG7B 2AJVH 3TFBA 4A7PA 4U6YB 1DO6A 4PS4L 3DOIA 3HE6A 4MNQA 1K8AQ 1NBVL 1GJWA 4L4VE 3L74G 5IB4A 2YNYA 1HWTC 5CP7A 1V7ML 3CLEL 3I84A 2E76B 1R5VB 3VQLA 5EU3B 2CDGB 1PDKA 4CUCA 4J4PA 1I85A 4WTWA 2QL1A 3QUMH 3L4WA 1T20B 3SE4C 4BRVA 1OT2A 2K4AA 3QRLA 4G42B 3J27A 1SDAB 3LKPA 1F58L 1SNRA 3NIFF 1GHFL 3K1KC 3VXSD 4GKNB 3HLAA 3HAEB 2K1AA 3GXNA 5EFIB 4EN3A 4PV8B 1LP9A 3QDGA 1GVIA 4QY8A 4NT6B 4YGVB 5D8JL 1G1CA 1LO2H 1ZVYA 1JWSB 1ZTMA 4AYDC 1BF5A 3D4YA 1FJ1A 3MNVA 1M3JA 3IAGC 3WEOA 3FZUD 2DLHA 4OZGF 4JRLA 2XC8A 2KQMA 2OMUB 2QQKL 1RUKL 1ZIBA 2VE6A 2X89A 4KVNL 1LEGB 2GY5A 3AMLA 3L13A 4TUOB 4JFZL 2NX5B 2BMKA 4PW3A 4WWKA 5TQ2H 5EUOF 3VWKB 4J8QA 4R7NB 3OQ3B 4PWKA 4J7RA 2DQDL 2OTWB 1FF5A 2W9LA 1S7UB 5AW8B 2XHNA 4YSEA 2BCMA 4OM1L 3PWUB 5JPNA 3SFDC 4P2RB 3VFUA 2HFEA 3NSFA 5T1KA 4PJGE 1OOWA 1T83A 1ZDSA 2EH8L 4K5OA 3B2UC 3S96A 4FQCL 4J3SA 1AO7D 3HC4L 4O2EA 1ERNA 2XKSA 4XNAA 1JPFA 4JVWA 4UZGA 2I9LA 4GAAA 3KS0H 3VD9A 3OB0K 1HIMH 3RU8H 1XXDC 1L0QA 4EUPA 1PGOA 1FQ9C 4YDVA 5AEAA 1F18A 1VDGA 3BPOB 4WWPA 4GRWE 1JNJA 4P0DA 1M1XB 2XT1B 3Q43A 3SGKC 1FG2A 4FJYA 4IMLA 3DO7A 4MJIE 2ICWB 2WXGA 5AOKA 4DFHA 1HJ0A 2FNBA 4X5XA 2I1KA 1DBBL 1AE6H 1I1AB 3SB3A 2R8SH 1BX2B 4HH9B 4LSUH 1KGJA 1P7QD 4TSCL 2JKSA 3SY0B 3L9EA 3GRWH 4PHZA 1A4JA 3SYQA 2PWDA 2Q1KA 2C3VB 3BVNA 4NZ8A 4Y4FB 1IT9L 5FB8B 3C08L 4QXUL 2RKLA 4MAYA 4JGMA 3HMWL 5SWQA 4CADA 1A4CA 1KLFB 1HN1A 2SEBB 3A21A 2K1MA 3FRPA 3E2HC 4Q6IA 4F20A 3GK8L 1OOAA 2F8OA 4NQSB 1BCCJ 2E9IA 2XCMC 4IRJB 1JK9B 1SJMA 2HKHH 3EYSL 1DJZA 5IQLA 2HT4C 4PRBB 1ZV9A 5DJ2A 1T5KA 4N1CA 3U7YH 4A6YA 5C0BD 3HZ3A 1ADQA 4CVUA 4O9BA 2WIMA 3D39D 2X6BA 4ZUUA 4DN4H 3LNEA 1UIIA 4XE5B 3L72E 5CCGA 3QDME 4BFEA 3IJ8A 2DQMA 5A16B 2C8NA 2J59M 2YRBA 2WUBH 4TQEH 4LLWA 2Y7MA 2Z31C 5AOMA 1W15A 3B3BA 3T0ED 1CD0A 5IY5B 3ELAT 4JCWA 3QI9A 5HGBB 5ELIA 1WWWX 1QWNA 2KS0A 4L4VD 1U4EA 2OXGA 4MMXC 4OF0A 3VXOA 3IGKA 5CMZA 2I27N 3NN8A 1BZQK 2VAAA 1NOFA 3W2DL 5A6IA 3PV6A 4LLYA 4O4YH 4R83A 3EAKA 3FCTB 2PETA 4DO6A 1CURA 4X9YA 1QSEB 3RGUA 4Q2ZA 3GSNH 4XH2B 1NFDF 4X4YB 2DQTH 3HC3L 3HD7C 1EJ8A 3QHFH 3MLUL 25C8H 2YAOA 3MLSH 4KDVA 4PTTA 3TWCL 3HG4A 1IO4A 3ILPA 2C7FA 3K6IA 4N0RA 4UT6L 4JQVA 1AXIB 2Y5TB 1PW3A 5I66B 2A9CA 4MQSB 2WLIB 4Y5XC 4HUWA 2XWTA 1H0TB 5GGSA 4EDXA 1DN0A 2AQPA 1Y47A 3HI1B 4W9JC 3VN0A 1SHMA 2J43A 5C0JA 4KUZH 3E0GA 3KCPA 3R0NA 1PNCA 2AQ3A 4KGLA 2BSSB 3D85B 3KPSE 1W5CE 2BP8B 1ZT7B 5DS8B 4CMHC 4E9VA 4YDZA 1Q0XL 2IBZD 1G9ML 2YRLA 2O6CA 4TUKH 5DQ9A 3WKQA 4GMTL 3MRLA 3KPRE 4O9HL 2KBGA 1W0YT 1X7QB 5CZXC 4J3TA 4U1KA 3PLNA 2BSCA 2SODB 3PHOB 2CQVA 5F71A 4F2FA 4U6XB 1P7KA 4PTUB 5EU4A 1YUHA 3OHXB 4XPFH 5LXGH 4DKEH 3D34A 4FQIH 1VGKB 1SVBA 4JPSA 2WKOF 2W6AA 4HEME 5HSFA 3ETTA 4PW9A 1K3ZA 4N78E 3QQNA 5C7ZA 4J6RL 3M8OL 3MV8B 4LHJB 3CHPA 1Y0LB 5BRZD 1UWXH 4ZX3A 5DUPH 3SQBA 3EG9A 4FNLL 2DN7A 2AEPH 4NYLB 3M46A 1KB9H 4N5ED 3ZTEA 3U4AA 4MAZA 1T7XA 5KS9B 5GS3A 1A64A 4KKLC 4N90E 3CPUA 3NACL 4IM8A 3P3SA 2FSEA 5BU5A 4ACPA 5HVWA 5IFHL 2PN5A 2X4SB 5E2WH 2JKLA 2K6WA 1QOKA 4G9DB 4K9EH 4JN1L 4UT6A 3D2TA 5HYEA 1NQBA 1ZHNA 3BFQG 3C5ZB 5A7EA 4GIPD 3WEXB 4FC3E 3GSQB 1T4KB 4Y4KC 1A3LH 1MHEA 4JFPB 4B97A 1P84E 2YMXL 5EOCH 1OAUL 2RCSH 4U1LB 5HYQB 4J6IA 3KBFA 3P4OA 3L71J 1U8LB 2ZUUA 5CJOL 5JTWA 4ZK8A 3B2DC 3L73D 5I8OH 2V2XA 5D96B 4EOTA 2YFNA 3VD1A 1N5AA 1KJMB 1R3HB 2DWXA 1T80A 4JL1A 3TYGH 4WI2A 2K3RA 4IL6H 1QLRB 1QEWA 4GSXA 1XGPA 1OGAA 5KSBF 1RZ8A 1MLBB 2R29H 3AADB 2X1OA 2Y7OA 4TOYL 3UPCA 3L3JA 2X05A 4JY4A 1KIUA 1Q2NA 4WO0A 5AZEL 5DI8A 1J9QA 4PV9A 5BUPA 3KZIH 4R4BA 3EYFB 2DWSA 3HKZA 1H89A 2EDNA 1P4IH 3G6DL 2NZ9D 3ZDYF 1TZ8A 2C3HA 2CGZA 1LEIB 4Y2OA 2A73A 2EZ0C 5D1XD 3QZWA 1N7SD 4FKKA 3TVMA 3L72D 3QDMD 3H1JG 1MFVA 2XN2A 3E3QE 1BV8A 2EYSB 2M2DA 2FBWC 4KRPD 5I82A 1HZLA 3NCBB 1JVKA 3P0YH 3W5MA 5KYXB 3EXLA 4LRNL 2YXVA 4TQHA 4ZFZA 4HKZH 1CU4L 3CMOH 3HFFA 3NFPB 4PRNA 5BVJA 1A6AA 1URLA 5LO7A 4BE6A 5IT2L 5GIRA 1MW0A 4R84A 3UBXI 3MNZB 1SYSA 4FS0A 4P4KB 4BFRA 2PYEB 5EZJB 3PFQA 2HTKC 1RK1A 1I82A 3ARDA 1XCXA 1UYWH 2XY2A 1ZT4A 3B5NB 5F6IB 1K8DA 2CO6A 5F9OH 3U82B 4X0KB 3KD4A 4Y16D 3MRPB 1N59B 5E9DE 3L08A 3PP5A 5ADPL 3U30B 2H0EA 3CN4A 1QFUL 4PD4E 3ESNA 4EYYQ 1I1YA 4J5VA 1I9IL 4LSSH 4LLDA 4IK6A 1ROCA 4CN4A 1Q9KA 3Q9PA 1P4LA 4X7SH 1P7HL 3X3FH 3KPSD 3UGEA 1IJDB 1T04B 1UWXK 4MNQE 4XVJL 1KGYE 1YPZE 3OQRA 4ZDHA 1LNUB 3LPOA 3O8XC 2EVHA 1KB9K 3V6OA 1T1XB 3KPRD 5E6ID 4LSPL 3OKMB 3G5YA 3ARBC 3IT8D 2NR6D 3CDGB 3ECBA 3DURA 1QBAA 3WOVA 4NSKA 4Z1PA 4Z0BH 2V7QH 3B56A 1URQD 4OIAA 1TOXA 1UVQB 5D7IF 1I7ZA 3VTPC 2JCCF 4N5UA 2DTML 3VH8A 2X2YA 4RH4A 1FO0H 5AB1A 4I3GA 3GI9H 3UTQA 4OFQA 4QOKD 3U79A 4AMXA 4F8LA 3PWPB 1S9WA 1LP9E 1AQMA 1E5ZA 2HLAA 4P46D 3U46A 4KKRA 3BGFB 4EZJA 1PAMA 2OR7A 3HAEG 4N90D 3JWNH 2EABA 2F58L 4OF5A 3TH2T 4AMKL 3FRUB 3VFMA 3GBNH 3P2TA 3AREC 4F37F 4XMLL 4KKBD 2HYNA 4FFWD 2BDNH 2N59A 3BWUF 4B50A 3WNPA 2YZ1A 3DHPA 4HKJA 3FT2B 1JPEA 4F7PA 2FYNC 1H8LA 1P84D 1FZCC 4ODWA 1UACH 2BS8A 5DD6A 3GKZA 5C0IB 1G6RH 4LSVH 3ZTJG 4NP9A 4J1UA 1GCYA 3QQDA 2W9DH 2WPGA 4HLJA 3RL0D 1FJKA 1UENA 4HWZA 1AE6L 3GMPB 1AHWB 4YTPC 1JNMA 3GHEL 1WIUA 4DK6A 5L4JA 1XTLA 1A47A 1KPRB 2R39A 3GRWL 5L4IA 3IPEA 3LB6D 3OZ9L 5ETUA 3PRJA 2V7HA 5BVPH 1Z3GH 4QRRB 1HOCA 4DKFL 4K73A 3SE4A 5EBGA 3TNMB 5FR3A 5GS0D 4HUKB 3TJEL 1TTUA 2AJYL 1DBJL 4Z7WF 5CINH 1QNIA 1G7LA 4Y4HD 1RD6A 2JVUA 2HH0H 3O4OC 1WH0A 3ZZSA 1NC4D 1UT9A 1JOIA 2EXWD 5IBTL 3KPPB 4HIJA 2VDPB 4LSQH 1SLWA 4PGZA 3PJLA 3U7YL 2SPZA 4OFDA 1EAPA 2IDUA 2B1AH 2QPFA 4AZ8A 1WBXB 1Z5HA 1R0AH 4WHCA 5IBLC 1QVGO 3I56P 2GYSA 2V5SA 3O6QA 2DQGH 4P2QB 5EDXA 2GEQA 1ULVA 1V54B 3K6NA 4H0LC 1QG3A 1SM3L 2Q7YB 2BIPA 4OZFA 3CMEP 3ZE1E 1PG7L 3EFOA 2V3DA 1UB5A 2B9AA 2BNRB 1AVOA 1L0LK 3RGVD 3CFIC 2WK2A 4LSTL 2VDNH 3QJHA 3CVBA 3PNRB 4RMWA 5FOBA 1Q4NX 2GK2A 1HQ4B 3Q0HA 3PAVA 4JZJB 2XI9A 3SE6A 1D7MA 4L0YA 1EAOA 3GSNL 1HQRB 3II3A 2DQTL 3ALWA 3QDJB 4P48A 4ZTOH 3ZUCA 5DHEA 4Z76A 4FQXD 4PD4D 3BPCA 3MUZ1 5GZNC 2VSDA 5CCGE 5F89A 2QT6A 2PYFB 3KWUA 2CDFB 5AVXB 1FSKC 4XR8C 3QAZB 3SDXA 3TH3T 5IJCC 1DVTA 3PP3H 4BH7A 5IHZB 5T1MA 4QD2E 3VQMA 5D70H 4PREA 1ZLVK 5LWYL 2YMOA 4KUZL 5ESAA 2NUTB 2R56L 4AOFA 3CDYA 5CEYB 4WEBH 2F8XC 4EE2A 2Z8RA 1U8KA 3DXAD 3AXHA 4J4PD 1M71B 1NIFA 4X9BA 4YHYC 1ZLUH 4E41D 3C12A 5DO2D 2NCEA 5F44A 4OZHE 3CDCA 2YIUC 1W0VB 3NJHA 2OSXA 3NZ8A 4MVBD 4LNVA 4OQTH 2MJWA 4QHNA 5F7DB 3WU2H 5L0QB 1FV1A 5D7KE 1N7MH 2FYVA 2VLRE 4DKEL 3NTCH 4L1DA 4FQIL 5F7HA 4HAGA 5F8RC 3H1KJ 4TLKA 1OZHA 3O6KH 1TVBA 5I5JA 1QVOB 2PO6C 3H1HE 1QMUA 5D71H 2C34A 1TZGH 5DDHB 4JVUA 1BVKB 3QDGD 1UFGA 5B38A 3P8CD 2D31B 2OMYB 3BN9C 3QULA 5AAPA 3KH4A 2F15A 5DMGD 3L3OA 5EU6A 1CI6B 2QJYB 2CGRH 1IZKA 1A14H 2BCCG 5HDRA 2APBA 2EDBA 2AEPL 1BE3J 1EHKB 1AQDB 2DJUA 1YY8B 3HE5B 3EIFA 1TJIH 4UT9L 5E70A 3SJVB 4BH8A 4F8NA 2WD0A 3L9BA 1G94A 3UEQA 5EC1A 2BSRB 1B4LA 4E36A 3P1VA 1J88A 1AIFB 2X89D 1J10A 4G1EA 1EZVE 1Y18B 3UYPA 1S5IL 2O6PA 4WDIA 4XN2A 2E46A 4WWKD 1BOGB 3FW6A 1T1WB 3IB4A 3H1IE 4KBPA 3RVVD 2VDKH 3DVGA 3FH5A 2JIXD 2X9ZA 3VFRB 4M61A 5FLVA 2Z31A 1BWWA 1U93B 4PB9H 3P7KA 4PRAA 4ZMQA 2NLJB 2HFED 3MV11 3LW5J 5T1KD 5EOCL 3R4DA 3AE9C 1EA9C 3HCVA 4IDLA 1CICB 4MMXA 2CLVB 3WN5C 2H0PA 4EZMA 2YSSA 4HV8B 4YZFE 5I8OL 3DHMA 1BMGA 3QEGH 4LXFA 3UO1H 2C9XA 4PCYA 4E5XA 1MZYA 3TYGL 2YJLA 2LLGA 1JIBA 3S3SA 3CFCH 3SO5A 1I7UB 2P44B 3Q7JA 4HZLB 4A7GA 3O2VL 2ZYHA 3V2QA 3TGXA 4OGZA 1KV4A 4HS3A 2NCMA 3LIZH 2FQEA 3I85A 1ECZA 4Y5XA 2C0XA 2XKUA 2UY7A 4I0PC 1T6WA 1GOGA 3KW7A 2LE9A 5JO5B 1BQ5A 4NUMA 3MBEC 5HJ3B 4DEPC 3Q2YA 2ATKB 1I7TA 2Q3EA 3KM2A 1YEJL 4U1GB 3WUWA 4BHUA 1LO0H 4GG8B 2Y9ZA 4NX0A 5DMIL 5BXFA 2GITA 2Y6SC 3V4VL 3Q8FA 1PGRB 1R17A 3S35X 4MAYD 3IETA 1F45A 1NCTA 1QNZH 5FF6B 4KRMB 1OGAE 1BJ1H 1QFWL 1Y1UA 4K7FA 2XFXB 5ICYA 3PP3K 2KZ1B 5EUKB 4LMQE 3ZZ1A