3F5HA

Crystal structure of fused docking domains from pikaiii and pikaiv of the pikromycin polyketide synthase
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
54
structure length
54
Chain Sequence
SIDDLDAEALIRMALGPRNTMTSSNEQLVDALRASLKENEELRKESRRRADRRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Type I polyketide synthase PikAIII, Type I polyketide syntha
publication title Structural basis for binding specificity between subclasses of modular polyketide synthase docking domains.
pubmed doi rcsb
source organism Streptomyces venezuelae
total genus 24
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature ec 2.3.1.239: 10-deoxymethynolide syntase.
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18605 PikAIV_N Narbonolide/10-deoxymethynolide synthase PikA4 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 3f5hA00
3F5HA 2WVRA 3WUUA 2ZXXA 1UIIA 4BRYB 3WUVA 3WUTA 3E1RA 2Q6QA 4BRYA
chains in the Genus database with same CATH superfamily
1Q7YQ 5KLIB 3B71A 3FXEA 3HUSA 5AVSB 1NYHA 2YKPA 2ZJSE 3CWBD 3II6A 3V5BA 5KKZC 3JSVC 1X0TA 3H1KD 3B8EB 2R32A 1SQXE 3AE3C 3H32B 3U1CA 3OW2O 2YIUB 3L70G 1OWAA 1CI6A 4NPFX 3U1AA 2ZVNB 1LP1B 2ZYAA 3S4RA 1FZCC 2OYIB 1T8ZA 1M1JA 4U3FJ 2L5GB 3B5NA 1E5WA 2WSFJ 5AW8B 5CJ4A 2HODB 1GW4A 1LTJB 1MUUA 1GD2E 1NWQA 4B86A 2KLUA 1BCCD 4GIFA 2IYPA 3CX5H 4NPEA 1P84D 1KV4A 3TGUD 1SQVK 4L73A 1K04A 3R2PA 4H13C 1AFOA 2L91A 2ZFCA 4I7ZC 1FJPA 3BCCG 2DW3A 2I8DA 4PD4I 3AEAC 2OYHC 3L37A 4C7NA 1JUNA 1N7SC 2Z5IA 3ABVC 2O01J 2I1KA 3GHGB 3L70J 1SQVG 3C1LA 1EC5A 3A0BH 5CCGA 3L73D 3H1HE 1GW3A 3AE8C 1A02J 2AXTE 3HD7A 4LLHA 3CL3D 3GLMA 3HTKB 2YKOA 1PFIA 3CD6P 2G8YA 4AUWA 1A02F 1KN7A 1Q82Q 1IFNA 4ASWA 4QMAA 3VMAA 4ZKUA 3D6ZA 3O8ZA 2C0WA 4IL6E 1KILA 2QJKB 5AW6B 1SFCD 1KQLA 2ZT9B 3P8CE 3KZIE 1FDMA 2N1TC 3SFEC 3V2NA 2KOGA 4WB4A 1MV8A 2AXCA 2FBWC 3CCLP 2W6AA 1LTGC 3CCEP 1H8AA 1RF1A 4ASVA 1ZV8A 3BCCJ 3QH9A 4N78E 4W7ZA 2KIKA 4JPZB 1AQ5A 1RE3A 2K88A 5APYA 4WY4D 1OVUA 3M9BA 4HB1A 2GM4A 1SQVJ 3IAOA 4OH8B 1NTMK 2XKMA 1YQ3C 5BU5A 1VPCA 1D7MA 1NU1K 1PPJD 3T97A 2LKMA 1KQSO 4AYCA 4XE5B 1YTZT 2O3JA 3L74E 1NTKD 5APTA 4IFMA 1YJNP 1YQ4C 2JWAA 2A45G 1KB9E 4UB6E 1GDTA 2NPSC 1NTMG 1OW6A 3L72D 2E74B 5B5EE 1NU1G 1ZRTD 2Y9YA 3UIAA 2QIWA 1ZXGA 3HE4B 2JDIH 1J1EB 2HPCA 1J1EC 1CZQA 2IBZI 1T2KD 4UB8E 2E76C 3WU2E 1BE3G 1VQ7P 3TDKA 3HUSC 2RMZA 1SQBD 1ZMEC 2H43A 2Y0CA 3RL0g 5CHXA 3L70E 1RQVA 1EDKA 1VL2A 2YO2A 3M06A 1KYOH 3JCUH 4Z1MH 3F89A 1SQPE 4XFJA 5KLVD 2RKLA 3OJAB 2XNDH 1NTZK 1LGHB 3LW5H 2I1JA 2ZT9D 3E7KA 2BASA 3PP5A 2WVRA 1JY3O 1H88A 1BDCA 1NTMJ 3FWNA 3MTUE 3TYYA 1M1JC 1NTZG 1NU1J 1AVYA 1KC8Q 2UWJE 3CX5D 1VQKP 1X9VA 2QM8A 1FU1A 3AEEC 3B5NC 1FOSE 1PGJA 2WMMA 1QGKB 2HR3A 5BU8B 2JKVA 2Q7CA 3H32A 3CX5I 1ZLLA 1FZFA 5E79E 1BE3J 4YPCA 3GG2A 4KT0J 5AW3B 1S3JA 1SLQA 1M7LA 1LP1A 4CPGA 3L4FA 1L0LD 2PAJA 4R4MA 1SQVE 3TF5A 4OGQC 2OYIA 1IFJA 2IYOA 2O1KA 4WY4A 2E74D 1KTMA 2P58A 5GTIH 1ZW0A 2HODA 1LTJA 1WRGA 2B88A 1L0LK 3H1JG 5CCGC 3CPWO 1URQB 3H25A 2JR8A 3FXDA 5L8RJ 1S9KE 3AE2C 3H1LE 2P7JA 1NTZJ 4H0LB 2WSCH 3M0AA 1L0LG 2POHA 3I55P 2BEZF 2ZYDA 3HRNA 1W2EA 2D2CB 5APWA 4N6JA 1EZVG 2A06G 3MGNA 1XTCC 3GHGA 4W7YA 4PD4H 2IZ1A 3L75E 2W27A 4TT3H 1FDIA 3CCRP 4HYTB 1OFCX 1LTTC 1T6AA 2YNYA 4ZKPA 1IFPA 1YBKA 2N9YB 2H8PD 4H44D 2AEJA 2LXBA 3HTKA 1RF1C 1Q2NA 1VF5D 3AE1C 2XU6A 3VMXA 1RE3C 2PP6A 4OVNF 1FZAA 1OXZA 3CCSP 3KXDA 5KAFH 2LXCB 3H1JJ 1IO4A 1NTME 1EXIA 1NU1E 1QVGO 1VQ9P 1G2CB 1KQGB 3M9HA 1M57D 2CPBA 5APXA 2QM7A 1HUCA 2HYNA 1R5SA 1L0LJ 3VP8A 2E5TA 1GU4A 1BE3E 4TLFA 3V6IA 1NVOA 1YJWP 5H2FE 1GMJA 1YI2P 3L74D 3D6YA 1G1IA 1YITP 1URQD 2QJPB 2QJYB 2QJYC 3H1ID 2WZ7A 2KXPB 1PP9D 3LIEA 4AQRD 1LNQA 3NTNA 3HE4A 4DT0A 2Z5HA 2D2CD 2WT7B 1NTZE 1Q81Q 2KZJA 1K05A 5KLIC 2IFNA 2NZ2A 3ITKA 3IFMA 1IFDA 5EFWB 1Y8AA 2FYUE 5CMZA 3W68A 2BCCG 3D70A 2MKVA 1JY3N 3K5BA 3CC2P 1SFCB 1W5CE 2QVAA 2WQYC 3MP7B 4EI2A 1L0ND 5AVUB 1FS0E 2R5BA 3O6QB 1SQQE 2Q6QA 3AE4C 2YIUC 3Q2YA 2PGDA 1OW7A 3AE9C 1EDJA 5KTBA 1T3JA 1RF0A 4RKUJ 3GF3A 2M3EA 1L0NK 2OYIC 4D6TE 4IOIH 4JF7A 1S4XA 4WY4B 1JB0J 4WY4C 3WUUA 3AECC 2WSEH 3KYQA 3CWBG 2IFMA 1CSBA 3H1KG 1LTJC 2C0XA 1L0NG 2XZRA 3PH0A 1RE4A 2M3BA 1N8RQ 5KAIE 5AVTB 2N9BA 2KZIA 3MZWB 3GF7A 3RK3E 1NKZB 2P10A 1VQMP 4PD4D 1EZVE 2A06E 1KQFB 1FZEA 1X79B 1K8AQ 3Q5SA 2BCCJ 4WVZA 2W6BA 3LW5J 1OVVA 1MZ9A 2M5AB 1T2KC 3P8MC 1HVVA 2AEMA 2AEFA 3RL0D 3GHGC 5TISE 1JOCA 1KORA 1WMKA 4BRYA 1URQA 3H1LD 1NH4A 2YO3A 1PGQA 1QEXA 1BCCG 3VMZA 2Q3IA 3JC22 3CMAP 2WSSH 2V7QJ 1M90Q 1BSNA 3TGUG 2OTLP 2FYZA 3L71E 3A0HE 3CWBJ 3RGUA 4L74A 1VQ4P 3S9OA 3H1KJ 1L0NJ 2QJKC 2ZT9C 2JWDA 4WBAA 4IFFA 4EIJA 1JCDA 1DIPA 1VQOP 2HG5D 2NRGA 1AJYA 3D71A 3L73G 1ZN5A 1KZUB 3G9RA 1YJ9P 4K3AA 1BGYD 2JO1A 2AXTH 4I6MC 4Y99B 4Y99C 4DZOA 1N73B 2WSCJ 1N73C 4JYCA 1BCCJ 2M0BA 4IL6H 4U3FE 1G2CA 1DEBA 1RQUA 2W83C 1SS1A 3CXHD 3TGUJ 3FWLA 5AW4B 3BVHA 5CBNA 4EDFA 1UIIA 2IBZD 2E74C 2W90A 3G71P 1BGYG 3JCUE 3CXHI 1DH3A 3C9IA 3L35A 1NTKK 2RH0A 2ZYGA 1PIXA 1WT6A 2BCCE 4H13D 1GK4A 1IK7A 4K35A 1PPJG 2O1JA 3L73J 1BSHA 1FZBA 1NTKG 4JBZA 1GU5A 1N7SD 1KILE 5DJTB 5DJUB 3L72G 4C46A 2IBZG 1LTBC 1JY2O 5AVWB 2KNCB 1KB9H 4UB6H 1JNMA 5B5EH 1SQBK 2Q1KA 4YXDC 2WT7A 1BDDA 3GW6A 2WPVB 1RF0C 2FYUD 1GL2B 3Q5RA 4H44B 1ZR4A 4H44C 3CWBE 5B66E 1VF5B 1HH0A 3VYIA 3WU2H 3CMEP 1PV3A 1SQXD 3R4YA 3KDPB 5KLVK 1SQBG 1L4AB 4I2LC 1X22A 3LIDA 1S5LE 2K3RA 1BGYJ 1VQPP 1SQQD 1SFCA 2N1TD 3Q5PA 1HTLC 1KFNA 3O6QA 1M8OB 4I1LA 1RE4C 3V4WA 2XV5A 5KLVG 1SQXK 1UIXA 3BCCE 1Q86Q 3AEBC 4D6TD 1JO5A 1VQNP 2QE7H 2P2UA 1NTKJ 2ITAA 2R44A 1RH5B 3FX0A 1LT9B 1LT9C 1Y9BA 3L72J 3OAKA 1SQXG 4BXLA 4L75A 4BWNA 1G1JA 5GTHE 3KPEA 1P84E 3CCJP 2HFED 3RK3D 4BRYB 3TGUE 5CCHD 3PJSK 1URQC 2H89C 1L2PA 2JEEA 1AVOA 5E79H 2WPSA 5APUA 1SQBJ 4H0LC 4IL6X 1USEA 2E5YA 5AW0B 4GDOA 3G6EP 2M5AA 2D2CC 3L73E 2FFDB 2WPQA 3H1HD 5KLVJ 5KAFE 2P67A 2C9LY 1IFMA 3F5HA 2WSEJ 2E43A 1NO4A 5AVZB 1R8EA 1FE6A 5KJ7D 1GL2D 4WWIA 3CCUP 1Q90D 2KSEA 1SQXJ 3V4QA 5AW1B 1L4AD 3EFFK 3P8CD 3AEFC 3RK2B 2ZAEB 1NJIQ 3MHVA 3QWOC 1EXJA 3P32A 3V2RA 2KS1B 4PV1D 3H6PA 1HJBA 3SWFA 4N78D 4DJGA 2ZXXA 3CCVP 4C7RA 4PJ0E 3E1RA 3BRTB 3B4SA 2Y0EA 2Q5UA 1PZQA 2RN0A 1PGOA 1NTKE 2E75D 4U3FD 1N73A 2GA1A 3A2AA 4OGQD 1KB9D 2QJPC 1IJDB 3G4SP 1VQ6P 1ZRTE 3FGAD 3CCQP 1JY3P 1SVFA 5C39A 2FYNB 1KB9I 2FYNC 3MUDA 2YXQB 1VQLP 1AV1A 4LGDE 1JMMA 5CCGD 5APQA 1ZR2A 3RL0B 5AVYB 3TSIA 3HD7D 1ZOYC 1HBWA 5CCHA 3KQGA 4JQ0D 3CXHH 1AQTA 5H2FH 1JY2N 1IFIA 3L74G 3L70D 1TU3F 4M3LA 1KILD 1N2DC 1YIJP 1OZHA 3CC7P 2K1AA 4W80A 1QLED 1SQPD 5TJHA 1RY3A 5KLVE 3H1IG 1LJ2A 1PP9G 3Q3DA 4L76A 2IPPA 1SFCC 1VQ5P 3A5TA 4GODA 1PGPA 2KNCA 2OGUA 3PHLA 3RK2D 5KKZB 3PRJA 2WTYA 3TK1A 4RESB 1SQPK 3CC4P 1EDLA 5KJ7A 3CX5E 1GL2A 1HJ0A 1JTHB 3TNUB 3N4XA 2Q3EA 3G3ZA 3H1JE 2M8RA 1K73Q 3HE5B 1H0TB 1L4AA 5AVRB 1S1CX 1SQPG 2FXPA 1K9MQ 1FZCB 3KHUA 3N7NA 3BCCD 2YKQA 1JEKA 1L0LE 1YYCA 3L74J 3A0BE 3BATA 3PLNA 1SQVD 1Y47A 4MN4C 2XDJA 2Y0DA 3VTPC 4R4LA 5APVA 2IDBA 2VRSA 1KMIZ 2J5UA 2V4HA 3H1IJ 4DCKA 2K9YA 1PP9J 1LT9A 3BRVB 2P1JA 3NXSA 2YMKA 1NAYA 2OTJP 4H13B 1MFTA 4YTPC 1OMIA 4I7ZB 1S9KD 1P84I 1KD1Q 1USDA 3CLQA 3NFQA 1OW8A 2OYHB 1EDIA 2CK3H 1U7JA 2ZXEB 1N7SB 3RBXA 2KLVA 2K9JB 5KAIH 1SQPJ 4GOEA 2OARA 2Y9ZA 3NMDA 3L75D 2KK7A 2FFDA 4GOFA 4DOJA 1JM0A 1T3UA 5CBOA 3CI9A 4U7JA 1M1KQ 1NKNA 1GK6A 1YHQP 3H1LG 2B89A 5TISH 1OVRA 1GTWA 4Y28J 3IF4A 2J59M 3AE5C 5BVZA 4HJGH 5AW2B 2KB7P 2N1TB 4LC1A 1W2BO 3ZDMA 1NTMD 1LWUB 1LWUC 1FOSF 3AEDC 1NU1D 2B87B 3A0HH 3L75G 3CCMP 2A45I 2KP8A 4ZNCA 2KS1A 3EQ2A 3AEGC 3M0DA 4OWFA 1BE3D 5APSA 3MUDC 3KZIH 3V2QA 4A7PA 2OTKE 5AVVB 2R5DA 1KYOE 1FJKA 3OA7A 3RK3B 3RK3C 2NPSB 5CCHC 2KUBA 2QRXA 3IR9A 1FAVA 3H1IE 1PP9E 1HWTC 3H1LJ 3BASA 1SP4A 2E76B 2PRRA 2GUVA 1FZGA 3SWKA 1LTSC 1FC2C 4EOTA 1HF9A 2GUSA 2WSFH 3HUSB 1NTZD 3L75J 1VDFA 1DEEG 1N7LA 3MD0A 1YTZI 3L36A 5KJ7C 3I56P 3WUTA 2ZVOB 1GL2C 1VF5C 1R5LA 2R3CA 3USSA 3H1KE 4UB8H 2OYOA 5CJ0A 1L0NE 2CPSA 3IN6A 1CI6B 2JJLA 1L4AC 2FKWB 2WWWA 3WUVA 2FYUK 4XA4A 5GTIE 4O9BA 1ZP0C 1M1JB 2O01H 2Q9IA 1OIPA 2SPZA 3EFGA 1DD4A 4PV1B 4PV1C 3B5NB 2W8ZA 1QL1A 1CW5A 3MIWA 1XTGB 3A7OA 1SQQK 3H1JD 1JTHA 2FYUG 3TNUA 3EWKA 2V7QH 3PTZA 2KSJA 1U7MA 2JP3A 1J1DB 2Z4EA 1IK9A 1J1DC 3HE5A 5B66H 1H0TA 2QSIA 1BCCE 1N86A 1DX7A 1LTAC 2E75B 2E75C 3VP9A 1SQQG 4RJTA 5M1BA 1FZCA 1NHLA 1IZNB 4OGQB 1S5LH 2NPSD 4PD4E 1NGMB 1EZVD 2A06D 1VQ8P 4C7NB 3VMYA 4KJMA 1IC2A 2B9BA 4JYBA 3A3YB 4D6TG 1EZVI 1LT1A 1S2EA 3I5CA 2QG4A 2E76D 2XNXA 2R3SA 2BEQD 3HD7B 3HD7C 1MFZA 3M91A 2FFDC 1MKMA 1GZLA 2H7HA 1QVFO 3U59A 2K37A 4HKZH 3W67A 1M56D 1KILB 1X8YA 1KILC 2OYHA 2FYUJ 5GTHH 2J58A 1RHZB 3L71D 4HH2A 1P84H 2QA4P 3SSUA 1N7SA 4EYYQ 2H88C 2KYVA 1U57A 2K9JA 1HGZA 1OX3A 5AVXB 3M9QA 2OQQA 1E79H 1SQQJ 3SFDC 3RK2C 2FXOA 1RF1B 3E1IA 4NPDA 1LTIC 3AE6C 1Z56A 1HGVA 3H1HG 4KHXA 2C9NY 4N3YB 1S72P 1BGYE 3B5ND 3Q1MA 3M0DC 4GKGA 3WMM0 4D6TJ 3RBZA 1J2JB 1JMBA 2E42A 3SWYA 3L71G 3T97B 5K5GB 2WITA 2WPRA 2LR2A 1DD3A 2N1TA 2FY8A 1PPJE 1H89A 5AW5B 1LWUA 3P7KA 3C8VA 1JY2P 1PL5A 3GMAA 2HLOA 2FXMA 2B87A 1QL2A 2PFXA 3CXHE 3L72E 2IBZE 2HPCB 4IFDK 2A45H 3VOPA 2YXRB 1FBMA 1KYOD 2IZ0A 1JCCA 3RL0C 4ZMDA 1KFMA 2BCCD 2IX7C 1KYOI 3AE7C 2NPSA 4PJ0H 5AVQB 1NAFA 3H1HJ 1SQBE 2W6JH 2QEXP 1QX8A 5AW7B 4H0LD 1AA0A 5AW9B 4U3FG 4GT1A 1EQ7A 3V2PA 1S5LX 4RO0A 3S1KA 2G3AA 4YXWH 3VN0A 1FDOA 3L71J 2MJZA 2O01N 2KI7B 2YMYA 1NOHA
chains in the Genus database with same CATH topology
3F5HA 2WVRA 3WUUA 2ZXXA 1UIIA 4BRYB 3WUVA 3WUTA 3E1RA 2Q6QA 4BRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F5H A;  2WVR A;  3WUU A;  2ZXX A;  1UII A;  4BRY B;  3WUV A;  3WUT A;  3E1R A;  2Q6Q A;  4BRY A; 
#chains in the Genus database with same CATH topology
 1Q7Y Q;  5KLI B;  3B71 A;  3FXE A;  3HUS A;  5AVS B;  1NYH A;  2YKP A;  2ZJS E;  3CWB D;  3II6 A;  3V5B A;  5KKZ C;  3JSV C;  1X0T A;  3H1K D;  3B8E B;  2R32 A;  1SQX E;  3AE3 C;  3H32 B;  3U1C A;  3OW2 O;  2YIU B;  3L70 G;  1OWA A;  1CI6 A;  4NPF X;  3U1A A;  2ZVN B;  1LP1 B;  2ZYA A;  3S4R A;  1FZC C;  2OYI B;  1T8Z A;  1M1J A;  4U3F J;  2L5G B;  3B5N A;  1E5W A;  2WSF J;  5AW8 B;  5CJ4 A;  2HOD B;  1GW4 A;  1LTJ B;  1MUU A;  1GD2 E;  1NWQ A;  4B86 A;  2KLU A;  1BCC D;  4GIF A;  2IYP A;  3CX5 H;  4NPE A;  1P84 D;  1KV4 A;  3TGU D;  1SQV K;  4L73 A;  1K04 A;  3R2P A;  4H13 C;  1AFO A;  2L91 A;  2ZFC A;  4I7Z C;  1FJP A;  3BCC G;  2DW3 A;  2I8D A;  4PD4 I;  3AEA C;  2OYH C;  3L37 A;  4C7N A;  1JUN A;  1N7S C;  2Z5I A;  3ABV C;  2O01 J;  2I1K A;  3GHG B;  3L70 J;  1SQV G;  3C1L A;  1EC5 A;  3A0B H;  5CCG A;  3L73 D;  3H1H E;  1GW3 A;  3AE8 C;  1A02 J;  2AXT E;  3HD7 A;  4LLH A;  3CL3 D;  3GLM A;  3HTK B;  2YKO A;  1PFI A;  3CD6 P;  2G8Y A;  4AUW A;  1A02 F;  1KN7 A;  1Q82 Q;  1IFN A;  4ASW A;  4QMA A;  3VMA A;  4ZKU A;  3D6Z A;  3O8Z A;  2C0W A;  4IL6 E;  1KIL A;  2QJK B;  5AW6 B;  1SFC D;  1KQL A;  2ZT9 B;  3P8C E;  3KZI E;  1FDM A;  2N1T C;  3SFE C;  3V2N A;  2KOG A;  4WB4 A;  1MV8 A;  2AXC A;  2FBW C;  3CCL P;  2W6A A;  1LTG C;  3CCE P;  1H8A A;  1RF1 A;  4ASV A;  1ZV8 A;  3BCC J;  3QH9 A;  4N78 E;  4W7Z A;  2KIK A;  4JPZ B;  1AQ5 A;  1RE3 A;  2K88 A;  5APY A;  4WY4 D;  1OVU A;  3M9B A;  4HB1 A;  2GM4 A;  1SQV J;  3IAO A;  4OH8 B;  1NTM K;  2XKM A;  1YQ3 C;  5BU5 A;  1VPC A;  1D7M A;  1NU1 K;  1PPJ D;  3T97 A;  2LKM A;  1KQS O;  4AYC A;  4XE5 B;  1YTZ T;  2O3J A;  3L74 E;  1NTK D;  5APT A;  4IFM A;  1YJN P;  1YQ4 C;  2JWA A;  2A45 G;  1KB9 E;  4UB6 E;  1GDT A;  2NPS C;  1NTM G;  1OW6 A;  3L72 D;  2E74 B;  5B5E E;  1NU1 G;  1ZRT D;  2Y9Y A;  3UIA A;  2QIW A;  1ZXG A;  3HE4 B;  2JDI H;  1J1E B;  2HPC A;  1J1E C;  1CZQ A;  2IBZ I;  1T2K D;  4UB8 E;  2E76 C;  3WU2 E;  1BE3 G;  1VQ7 P;  3TDK A;  3HUS C;  2RMZ A;  1SQB D;  1ZME C;  2H43 A;  2Y0C A;  3RL0 g;  5CHX A;  3L70 E;  1RQV A;  1EDK A;  1VL2 A;  2YO2 A;  3M06 A;  1KYO H;  3JCU H;  4Z1M H;  3F89 A;  1SQP E;  4XFJ A;  5KLV D;  2RKL A;  3OJA B;  2XND H;  1NTZ K;  1LGH B;  3LW5 H;  2I1J A;  2ZT9 D;  3E7K A;  2BAS A;  3PP5 A;  2WVR A;  1JY3 O;  1H88 A;  1BDC A;  1NTM J;  3FWN A;  3MTU E;  3TYY A;  1M1J C;  1NTZ G;  1NU1 J;  1AVY A;  1KC8 Q;  2UWJ E;  3CX5 D;  1VQK P;  1X9V A;  2QM8 A;  1FU1 A;  3AEE C;  3B5N C;  1FOS E;  1PGJ A;  2WMM A;  1QGK B;  2HR3 A;  5BU8 B;  2JKV A;  2Q7C A;  3H32 A;  3CX5 I;  1ZLL A;  1FZF A;  5E79 E;  1BE3 J;  4YPC A;  3GG2 A;  4KT0 J;  5AW3 B;  1S3J A;  1SLQ A;  1M7L A;  1LP1 A;  4CPG A;  3L4F A;  1L0L D;  2PAJ A;  4R4M A;  1SQV E;  3TF5 A;  4OGQ C;  2OYI A;  1IFJ A;  2IYO A;  2O1K A;  4WY4 A;  2E74 D;  1KTM A;  2P58 A;  5GTI H;  1ZW0 A;  2HOD A;  1LTJ A;  1WRG A;  2B88 A;  1L0L K;  3H1J G;  5CCG C;  3CPW O;  1URQ B;  3H25 A;  2JR8 A;  3FXD A;  5L8R J;  1S9K E;  3AE2 C;  3H1L E;  2P7J A;  1NTZ J;  4H0L B;  2WSC H;  3M0A A;  1L0L G;  2POH A;  3I55 P;  2BEZ F;  2ZYD A;  3HRN A;  1W2E A;  2D2C B;  5APW A;  4N6J A;  1EZV G;  2A06 G;  3MGN A;  1XTC C;  3GHG A;  4W7Y A;  4PD4 H;  2IZ1 A;  3L75 E;  2W27 A;  4TT3 H;  1FDI A;  3CCR P;  4HYT B;  1OFC X;  1LTT C;  1T6A A;  2YNY A;  4ZKP A;  1IFP A;  1YBK A;  2N9Y B;  2H8P D;  4H44 D;  2AEJ A;  2LXB A;  3HTK A;  1RF1 C;  1Q2N A;  1VF5 D;  3AE1 C;  2XU6 A;  3VMX A;  1RE3 C;  2PP6 A;  4OVN F;  1FZA A;  1OXZ A;  3CCS P;  3KXD A;  5KAF H;  2LXC B;  3H1J J;  1IO4 A;  1NTM E;  1EXI A;  1NU1 E;  1QVG O;  1VQ9 P;  1G2C B;  1KQG B;  3M9H A;  1M57 D;  2CPB A;  5APX A;  2QM7 A;  1HUC A;  2HYN A;  1R5S A;  1L0L J;  3VP8 A;  2E5T A;  1GU4 A;  1BE3 E;  4TLF A;  3V6I A;  1NVO A;  1YJW P;  5H2F E;  1GMJ A;  1YI2 P;  3L74 D;  3D6Y A;  1G1I A;  1YIT P;  1URQ D;  2QJP B;  2QJY B;  2QJY C;  3H1I D;  2WZ7 A;  2KXP B;  1PP9 D;  3LIE A;  4AQR D;  1LNQ A;  3NTN A;  3HE4 A;  4DT0 A;  2Z5H A;  2D2C D;  2WT7 B;  1NTZ E;  1Q81 Q;  2KZJ A;  1K05 A;  5KLI C;  2IFN A;  2NZ2 A;  3ITK A;  3IFM A;  1IFD A;  5EFW B;  1Y8A A;  2FYU E;  5CMZ A;  3W68 A;  2BCC G;  3D70 A;  2MKV A;  1JY3 N;  3K5B A;  3CC2 P;  1SFC B;  1W5C E;  2QVA A;  2WQY C;  3MP7 B;  4EI2 A;  1L0N D;  5AVU B;  1FS0 E;  2R5B A;  3O6Q B;  1SQQ E;  2Q6Q A;  3AE4 C;  2YIU C;  3Q2Y A;  2PGD A;  1OW7 A;  3AE9 C;  1EDJ A;  5KTB A;  1T3J A;  1RF0 A;  4RKU J;  3GF3 A;  2M3E A;  1L0N K;  2OYI C;  4D6T E;  4IOI H;  4JF7 A;  1S4X A;  4WY4 B;  1JB0 J;  4WY4 C;  3WUU A;  3AEC C;  2WSE H;  3KYQ A;  3CWB G;  2IFM A;  1CSB A;  3H1K G;  1LTJ C;  2C0X A;  1L0N G;  2XZR A;  3PH0 A;  1RE4 A;  2M3B A;  1N8R Q;  5KAI E;  5AVT B;  2N9B A;  2KZI A;  3MZW B;  3GF7 A;  3RK3 E;  1NKZ B;  2P10 A;  1VQM P;  4PD4 D;  1EZV E;  2A06 E;  1KQF B;  1FZE A;  1X79 B;  1K8A Q;  3Q5S A;  2BCC J;  4WVZ A;  2W6B A;  3LW5 J;  1OVV A;  1MZ9 A;  2M5A B;  1T2K C;  3P8M C;  1HVV A;  2AEM A;  2AEF A;  3RL0 D;  3GHG C;  5TIS E;  1JOC A;  1KOR A;  1WMK A;  4BRY A;  1URQ A;  3H1L D;  1NH4 A;  2YO3 A;  1PGQ A;  1QEX A;  1BCC G;  3VMZ A;  2Q3I A;  3JC2 2;  3CMA P;  2WSS H;  2V7Q J;  1M90 Q;  1BSN A;  3TGU G;  2OTL P;  2FYZ A;  3L71 E;  3A0H E;  3CWB J;  3RGU A;  4L74 A;  1VQ4 P;  3S9O A;  3H1K J;  1L0N J;  2QJK C;  2ZT9 C;  2JWD A;  4WBA A;  4IFF A;  4EIJ A;  1JCD A;  1DIP A;  1VQO P;  2HG5 D;  2NRG A;  1AJY A;  3D71 A;  3L73 G;  1ZN5 A;  1KZU B;  3G9R A;  1YJ9 P;  4K3A A;  1BGY D;  2JO1 A;  2AXT H;  4I6M C;  4Y99 B;  4Y99 C;  4DZO A;  1N73 B;  2WSC J;  1N73 C;  4JYC A;  1BCC J;  2M0B A;  4IL6 H;  4U3F E;  1G2C A;  1DEB A;  1RQU A;  2W83 C;  1SS1 A;  3CXH D;  3TGU J;  3FWL A;  5AW4 B;  3BVH A;  5CBN A;  4EDF A;  1UII A;  2IBZ D;  2E74 C;  2W90 A;  3G71 P;  1BGY G;  3JCU E;  3CXH I;  1DH3 A;  3C9I A;  3L35 A;  1NTK K;  2RH0 A;  2ZYG A;  1PIX A;  1WT6 A;  2BCC E;  4H13 D;  1GK4 A;  1IK7 A;  4K35 A;  1PPJ G;  2O1J A;  3L73 J;  1BSH A;  1FZB A;  1NTK G;  4JBZ A;  1GU5 A;  1N7S D;  1KIL E;  5DJT B;  5DJU B;  3L72 G;  4C46 A;  2IBZ G;  1LTB C;  1JY2 O;  5AVW B;  2KNC B;  1KB9 H;  4UB6 H;  1JNM A;  5B5E H;  1SQB K;  2Q1K A;  4YXD C;  2WT7 A;  1BDD A;  3GW6 A;  2WPV B;  1RF0 C;  2FYU D;  1GL2 B;  3Q5R A;  4H44 B;  1ZR4 A;  4H44 C;  3CWB E;  5B66 E;  1VF5 B;  1HH0 A;  3VYI A;  3WU2 H;  3CME P;  1PV3 A;  1SQX D;  3R4Y A;  3KDP B;  5KLV K;  1SQB G;  1L4A B;  4I2L C;  1X22 A;  3LID A;  1S5L E;  2K3R A;  1BGY J;  1VQP P;  1SQQ D;  1SFC A;  2N1T D;  3Q5P A;  1HTL C;  1KFN A;  3O6Q A;  1M8O B;  4I1L A;  1RE4 C;  3V4W A;  2XV5 A;  5KLV G;  1SQX K;  1UIX A;  3BCC E;  1Q86 Q;  3AEB C;  4D6T D;  1JO5 A;  1VQN P;  2QE7 H;  2P2U A;  1NTK J;  2ITA A;  2R44 A;  1RH5 B;  3FX0 A;  1LT9 B;  1LT9 C;  1Y9B A;  3L72 J;  3OAK A;  1SQX G;  4BXL A;  4L75 A;  4BWN A;  1G1J A;  5GTH E;  3KPE A;  1P84 E;  3CCJ P;  2HFE D;  3RK3 D;  4BRY B;  3TGU E;  5CCH D;  3PJS K;  1URQ C;  2H89 C;  1L2P A;  2JEE A;  1AVO A;  5E79 H;  2WPS A;  5APU A;  1SQB J;  4H0L C;  4IL6 X;  1USE A;  2E5Y A;  5AW0 B;  4GDO A;  3G6E P;  2M5A A;  2D2C C;  3L73 E;  2FFD B;  2WPQ A;  3H1H D;  5KLV J;  5KAF E;  2P67 A;  2C9L Y;  1IFM A;  3F5H A;  2WSE J;  2E43 A;  1NO4 A;  5AVZ B;  1R8E A;  1FE6 A;  5KJ7 D;  1GL2 D;  4WWI A;  3CCU P;  1Q90 D;  2KSE A;  1SQX J;  3V4Q A;  5AW1 B;  1L4A D;  3EFF K;  3P8C D;  3AEF C;  3RK2 B;  2ZAE B;  1NJI Q;  3MHV A;  3QWO C;  1EXJ A;  3P32 A;  3V2R A;  2KS1 B;  4PV1 D;  3H6P A;  1HJB A;  3SWF A;  4N78 D;  4DJG A;  2ZXX A;  3CCV P;  4C7R A;  4PJ0 E;  3E1R A;  3BRT B;  3B4S A;  2Y0E A;  2Q5U A;  1PZQ A;  2RN0 A;  1PGO A;  1NTK E;  2E75 D;  4U3F D;  1N73 A;  2GA1 A;  3A2A A;  4OGQ D;  1KB9 D;  2QJP C;  1IJD B;  3G4S P;  1VQ6 P;  1ZRT E;  3FGA D;  3CCQ P;  1JY3 P;  1SVF A;  5C39 A;  2FYN B;  1KB9 I;  2FYN C;  3MUD A;  2YXQ B;  1VQL P;  1AV1 A;  4LGD E;  1JMM A;  5CCG D;  5APQ A;  1ZR2 A;  3RL0 B;  5AVY B;  3TSI A;  3HD7 D;  1ZOY C;  1HBW A;  5CCH A;  3KQG A;  4JQ0 D;  3CXH H;  1AQT A;  5H2F H;  1JY2 N;  1IFI A;  3L74 G;  3L70 D;  1TU3 F;  4M3L A;  1KIL D;  1N2D C;  1YIJ P;  1OZH A;  3CC7 P;  2K1A A;  4W80 A;  1QLE D;  1SQP D;  5TJH A;  1RY3 A;  5KLV E;  3H1I G;  1LJ2 A;  1PP9 G;  3Q3D A;  4L76 A;  2IPP A;  1SFC C;  1VQ5 P;  3A5T A;  4GOD A;  1PGP A;  2KNC A;  2OGU A;  3PHL A;  3RK2 D;  5KKZ B;  3PRJ A;  2WTY A;  3TK1 A;  4RES B;  1SQP K;  3CC4 P;  1EDL A;  5KJ7 A;  3CX5 E;  1GL2 A;  1HJ0 A;  1JTH B;  3TNU B;  3N4X A;  2Q3E A;  3G3Z A;  3H1J E;  2M8R A;  1K73 Q;  3HE5 B;  1H0T B;  1L4A A;  5AVR B;  1S1C X;  1SQP G;  2FXP A;  1K9M Q;  1FZC B;  3KHU A;  3N7N A;  3BCC D;  2YKQ A;  1JEK A;  1L0L E;  1YYC A;  3L74 J;  3A0B E;  3BAT A;  3PLN A;  1SQV D;  1Y47 A;  4MN4 C;  2XDJ A;  2Y0D A;  3VTP C;  4R4L A;  5APV A;  2IDB A;  2VRS A;  1KMI Z;  2J5U A;  2V4H A;  3H1I J;  4DCK A;  2K9Y A;  1PP9 J;  1LT9 A;  3BRV B;  2P1J A;  3NXS A;  2YMK A;  1NAY A;  2OTJ P;  4H13 B;  1MFT A;  4YTP C;  1OMI A;  4I7Z B;  1S9K D;  1P84 I;  1KD1 Q;  1USD A;  3CLQ A;  3NFQ A;  1OW8 A;  2OYH B;  1EDI A;  2CK3 H;  1U7J A;  2ZXE B;  1N7S B;  3RBX A;  2KLV A;  2K9J B;  5KAI H;  1SQP J;  4GOE A;  2OAR A;  2Y9Z A;  3NMD A;  3L75 D;  2KK7 A;  2FFD A;  4GOF A;  4DOJ A;  1JM0 A;  1T3U A;  5CBO A;  3CI9 A;  4U7J A;  1M1K Q;  1NKN A;  1GK6 A;  1YHQ P;  3H1L G;  2B89 A;  5TIS H;  1OVR A;  1GTW A;  4Y28 J;  3IF4 A;  2J59 M;  3AE5 C;  5BVZ A;  4HJG H;  5AW2 B;  2KB7 P;  2N1T B;  4LC1 A;  1W2B O;  3ZDM A;  1NTM D;  1LWU B;  1LWU C;  1FOS F;  3AED C;  1NU1 D;  2B87 B;  3A0H H;  3L75 G;  3CCM P;  2A45 I;  2KP8 A;  4ZNC A;  2KS1 A;  3EQ2 A;  3AEG C;  3M0D A;  4OWF A;  1BE3 D;  5APS A;  3MUD C;  3KZI H;  3V2Q A;  4A7P A;  2OTK E;  5AVV B;  2R5D A;  1KYO E;  1FJK A;  3OA7 A;  3RK3 B;  3RK3 C;  2NPS B;  5CCH C;  2KUB A;  2QRX A;  3IR9 A;  1FAV A;  3H1I E;  1PP9 E;  1HWT C;  3H1L J;  3BAS A;  1SP4 A;  2E76 B;  2PRR A;  2GUV A;  1FZG A;  3SWK A;  1LTS C;  1FC2 C;  4EOT A;  1HF9 A;  2GUS A;  2WSF H;  3HUS B;  1NTZ D;  3L75 J;  1VDF A;  1DEE G;  1N7L A;  3MD0 A;  1YTZ I;  3L36 A;  5KJ7 C;  3I56 P;  3WUT A;  2ZVO B;  1GL2 C;  1VF5 C;  1R5L A;  2R3C A;  3USS A;  3H1K E;  4UB8 H;  2OYO A;  5CJ0 A;  1L0N E;  2CPS A;  3IN6 A;  1CI6 B;  2JJL A;  1L4A C;  2FKW B;  2WWW A;  3WUV A;  2FYU K;  4XA4 A;  5GTI E;  4O9B A;  1ZP0 C;  1M1J B;  2O01 H;  2Q9I A;  1OIP A;  2SPZ A;  3EFG A;  1DD4 A;  4PV1 B;  4PV1 C;  3B5N B;  2W8Z A;  1QL1 A;  1CW5 A;  3MIW A;  1XTG B;  3A7O A;  1SQQ K;  3H1J D;  1JTH A;  2FYU G;  3TNU A;  3EWK A;  2V7Q H;  3PTZ A;  2KSJ A;  1U7M A;  2JP3 A;  1J1D B;  2Z4E A;  1IK9 A;  1J1D C;  3HE5 A;  5B66 H;  1H0T A;  2QSI A;  1BCC E;  1N86 A;  1DX7 A;  1LTA C;  2E75 B;  2E75 C;  3VP9 A;  1SQQ G;  4RJT A;  5M1B A;  1FZC A;  1NHL A;  1IZN B;  4OGQ B;  1S5L H;  2NPS D;  4PD4 E;  1NGM B;  1EZV D;  2A06 D;  1VQ8 P;  4C7N B;  3VMY A;  4KJM A;  1IC2 A;  2B9B A;  4JYB A;  3A3Y B;  4D6T G;  1EZV I;  1LT1 A;  1S2E A;  3I5C A;  2QG4 A;  2E76 D;  2XNX A;  2R3S A;  2BEQ D;  3HD7 B;  3HD7 C;  1MFZ A;  3M91 A;  2FFD C;  1MKM A;  1GZL A;  2H7H A;  1QVF O;  3U59 A;  2K37 A;  4HKZ H;  3W67 A;  1M56 D;  1KIL B;  1X8Y A;  1KIL C;  2OYH A;  2FYU J;  5GTH H;  2J58 A;  1RHZ B;  3L71 D;  4HH2 A;  1P84 H;  2QA4 P;  3SSU A;  1N7S A;  4EYY Q;  2H88 C;  2KYV A;  1U57 A;  2K9J A;  1HGZ A;  1OX3 A;  5AVX B;  3M9Q A;  2OQQ A;  1E79 H;  1SQQ J;  3SFD C;  3RK2 C;  2FXO A;  1RF1 B;  3E1I A;  4NPD A;  1LTI C;  3AE6 C;  1Z56 A;  1HGV A;  3H1H G;  4KHX A;  2C9N Y;  4N3Y B;  1S72 P;  1BGY E;  3B5N D;  3Q1M A;  3M0D C;  4GKG A;  3WMM 0;  4D6T J;  3RBZ A;  1J2J B;  1JMB A;  2E42 A;  3SWY A;  3L71 G;  3T97 B;  5K5G B;  2WIT A;  2WPR A;  2LR2 A;  1DD3 A;  2N1T A;  2FY8 A;  1PPJ E;  1H89 A;  5AW5 B;  1LWU A;  3P7K A;  3C8V A;  1JY2 P;  1PL5 A;  3GMA A;  2HLO A;  2FXM A;  2B87 A;  1QL2 A;  2PFX A;  3CXH E;  3L72 E;  2IBZ E;  2HPC B;  4IFD K;  2A45 H;  3VOP A;  2YXR B;  1FBM A;  1KYO D;  2IZ0 A;  1JCC A;  3RL0 C;  4ZMD A;  1KFM A;  2BCC D;  2IX7 C;  1KYO I;  3AE7 C;  2NPS A;  4PJ0 H;  5AVQ B;  1NAF A;  3H1H J;  1SQB E;  2W6J H;  2QEX P;  1QX8 A;  5AW7 B;  4H0L D;  1AA0 A;  5AW9 B;  4U3F G;  4GT1 A;  1EQ7 A;  3V2P A;  1S5L X;  4RO0 A;  3S1K A;  2G3A A;  4YXW H;  3VN0 A;  1FDO A;  3L71 J;  2MJZ A;  2O01 N;  2KI7 B;  2YMY A;  1NOH A; 
#chains in the Genus database with same CATH homology
 3F5H A;  2WVR A;  3WUU A;  2ZXX A;  1UII A;  4BRY B;  3WUV A;  3WUT A;  3E1R A;  2Q6Q A;  4BRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...