3F5HA

Crystal structure of fused docking domains from pikaiii and pikaiv of the pikromycin polyketide synthase
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
54
structure length
54
Chain Sequence
SIDDLDAEALIRMALGPRNTMTSSNEQLVDALRASLKENEELRKESRRRADRRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for binding specificity between subclasses of modular polyketide synthase docking domains.
pubmed doi rcsb
source organism Streptomyces venezuelae
molecule tags Protein binding
molecule keywords Type I polyketide synthase PikAIII, Type I polyketide syntha
total genus 24
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature ec 2.3.1.239: 10-deoxymethynolide syntase.
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18605 PikAIV_N Narbonolide/10-deoxymethynolide synthase PikA4 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 3f5hA00
2Q6QA 3WUTA 4BRYB 3F5HA 3E1RA 2ZXXA 3WUVA 2WVRA 4BRYA 3WUUA 1UIIA
chains in the Genus database with same CATH superfamily
5CCGA 1L0NE 1KILE 2KS1A 1SLQA 1FS0E 2K9YA 1CI6A 3PJSK 4EOTA 1PPJE 3CLQA 1KYOI 3NFQA 1EXIA 2E43A 2B9BA 5EFWB 2KOGA 2Y9YA 3U1AA 4YPCA 2D2CD 2KS1B 1JY3O 2N9BA 4QMAA 3M91A 1USDA 2WSSH 1BE3J 3RK3B 3Q2YA 3VMXA 1T3UA 1EDLA 1VQNP 5KLVK 3CCRP 1IK9A 3BASA 1J1DB 3BRVB 3HE4A 1LTJC 2O01H 3Q3DA 3F5HA 5KLVG 3I56P 1HH0A 2Z5IA 4WB4A 1X22A 2OGUA 1KQGB 4TLFA 3CXHH 2WT7A 1YJNP 3GHGC 3WMM0 3L75E 3CCJP 1ZV8A 4U3FG 5AW6B 3P32A 4KT0J 1FBMA 2OARA 3P7KA 1LTAC 3L35A 3A0BE 1EZVD 2FY8A 3L75D 5GTIE 2LKMA 1DEEG 1IFDA 1NO4A 3MZWB 3P8CE 3S4RA 1BCCE 1H89A 2BASA 2OTKE 4NPDA 3A7OA 4B86A 4I6MC 4UB8H 3U1CA 2GM4A 3SSUA 1PPJD 2ZVOB 4KJMA 3U59A 1NGMB 3BCCE 2FYUJ 1BGYG 3CL3D 1OXZA 5B5EH 1FJKA 3R4YA 2C9NY 1IFMA 1JB0J 1WRGA 3TGUJ 3HRNA 3CC7P 2E5YA 2QSIA 3C9IA 2P2UA 4OGQC 1FOSE 1SQVG 2QE7H 2ZT9D 1USEA 2E76C 2WSEJ 4U3FJ 1VF5B 2IZ0A 2XNDH 3B71A 4LLHA 2OYHC 1LT1A 4PV1D 3AEGC 4L74A 5KJ7C 3BATA 1HGZA 1OZHA 2QJYB 3H1JG 2W90A 4H0LC 2M5AB 4IOIH 1JTHB 1PGQA 1Z56A 2KZIA 3R2PA 3D71A 3CCMP 3RK3E 3Q5RA 3AE5C 1NJIQ 3V4QA 3H1IJ 3H1KG 3BCCJ 1M56D 2FXPA 2IYPA 2POHA 3CXHE 3HTKB 1BGYD 1CSBA 1FE6A 1BE3E 3A5TA 1L0LD 4RO0A 4YXWH 1PP9E 3WUVA 4PV1B 1URQA 1W2BO 2KZJA 2O01J 1IFNA 2GA1A 3CXHD 3HTKA 4O9BA 3TGUG 3OAKA 1BGYE 4JF7A 1DEBA 4DCKA 2QA4P 3B5ND 5CBNA 1SQVJ 5CJ4A 1LT9A 1Y47A 1GL2B 1EZVI 1AV1A 1ZOYC 2WITA 3PH0A 2HR3A 4GIFA 4XFJA 5AVXB 1OX3A 3RL0C 2WT7B 1OW6A 2L5GB 3L75J 3H1JD 3M0DA 2FFDB 3M9QA 2DW3A 2W6BA 3G71P 2WZ7A 1MKMA 2FYUE 4D6TD 1NWQA 3S1KA 3M06A 3C8VA 5APXA 4DT0A 3TGUD 3B5NB 4TT3H 1M1JC 3E1RA 1JY2O 1KFMA 1AVYA 1RE4A 2Q3EA 1FC2C 1N7SB 2IFMA 2QM7A 5E79H 4C7RA 1URQD 2OYIA 1PP9J 5CHXA 4H13C 1BGYJ 1GW3A 1WT6A 1L0LJ 3BCCD 3T97A 2LXCB 3AE4C 1M90Q 1L4AD 1RF0C 3O6QA 1FJPA 1KB9E 3G4SP 1KORA 3HUSB 3RGUA 2AEFA 2ZYAA 4WWIA 1YQ3C 1QEXA 4HB1A 3TDKA 3HD7C 1VF5D 3L74J 2AXTE 2HODB 1NKNA 2P58A 2HG5D 1LT9C 4W7ZA 5GTIH 2FFDC 2YXRB 2ZJSE 1OMIA 2A06E 1BSNA 2QJKB 1WMKA 4HYTB 3RL0B 1L4AB 2E75B 2R5BA 2W83C 4ZKUA 4ZNCA 1FZFA 1YI2P 1QX8A 5AVUB 1GW4A 5APYA 2KUBA 2JWDA 2IBZG 1VQ8P 1T2KC 2IFNA 3HUSA 1HBWA 1ZLLA 1KZUB 1BCCD 1L4AA 1S3JA 1W5CE 3FWLA 1OVUA 2WWWA 3HE4B 1K9MQ 3AECC 2JWAA 1HWTC 1KTMA 1FAVA 1NTMK 5KJ7A 1VQKP 2NPSC 1EDIA 1L0ND 2I1JA 3FXEA 4H44C 4JYCA 3S9OA 1QGKB 1OVRA 1YTZI 2FYZA 2YKQA 1YIJP 3F89A 3H32B 5KKZC 1NHLA 2W27A 1RF1C 1GK4A 4UB6E 1FZCA 1N73A 1Q82Q 1FDMA 2P1JA 1SQPE 2YMKA 2YXQB 4PD4I 3CX5E 1KD1Q 2IBZD 1VQ4P 3TYYA 1Q7YQ 2OYIC 1NTKD 2M0BA 2E76B 1KB9D 3AE1C 1LWUA 2E74C 1GDTA 1SQXK 1FU1A 2HYNA 3L37A 4PJ0E 4BXLA 3GG2A 2PAJA 1IFIA 2BCCD 3G3ZA 1JCDA 3JC22 4H0LB 1IO4A 4GOEA 1G2CA 5AW3B 3B5NA 3TF5A 1NU1D 3IN6A 1PP9G 3H1ID 5H2FE 4EIJA 2IX7C 2QJPB 1VF5C 1H8AA 3M0DC 5KAIH 1R5SA 2XKMA 5APVA 3VP9A 2QM8A 3L74D 3WUTA 1NTZG 3JSVC 2FFDA 2K3RA 3HE5A 3II6A 2WPQA 2ZVNB 3OA7A 1PGJA 1GZLA 1UIIA 2I1KA 1VQ9P 4PD4E 3L74E 2BCCG 2XV5A 3KZIH 1ZRTD 2BEZF 1YQ4C 2M3BA 3AEDC 1NKZB 5AW2B 3CCQP 2OYHB 2H7HA 2O01N 4D6TJ 3H1IG 3H1KJ 3Q5SA 2A06D 3FXDA 5AW8B 1S72P 4RESB 2PGDA 3Q5PA 1RY3A 1LTIC 3AE8C 1L0LE 4HJGH 1UIXA 4EI2A 2K9JB 3D6YA 4JYBA 2Z4EA 2B88A 1SP4A 2XZRA 3VN0A 1Q81Q 2M5AA 4GKGA 3V4WA 1X8YA 4I2LC 5DJTB 2SPZA 2FBWC 1IJDB 4BRYB 3CC2P 5CCHD 4ASVA 1RQUA 2AXTH 2QJPC 4WVZA 2V7QH 1U57A 1NU1J 2E5TA 2KB7P 2KXPB 4U7JA 4WY4C 1K04A 3MGNA 4N78D 2B87A 2BCCJ 1NAYA 3VMYA 5B66H 3CI9A 1PGOA 2LXBA 2NPSD 3AE6C 3H1HG 4IFFA 2JP3A 1JMMA 1H0TB 2FYUD 1BE3G 1HGVA 3QH9A 4I7ZB 1LP1A 3IAOA 3QWOC 3NTNA 1X79B 3SFDC 2N1TC 1NTKG 1YYCA 3CCUP 5KLVD 2RH0A 2QRXA 1L0LG 1LWUC 2A45I 3E7KA 3H32A 3L73G 5KJ7D 5AW0B 3H1KD 4H44B 1S4XA 3KZIE 2G3AA 3H1IE 3V2QA 5CCHA 3H1HE 2H8PD 3KDPB 4OGQD 1FZAA 4U3FD 1VL2A 5AVRB 3GHGA 4UB6H 4LGDE 1GTWA 1J1EC 3FWNA 4WY4D 1GK6A 3HD7D 2QIWA 3AEFC 3MIWA 4L76A 2WMMA 1MUUA 3H1HJ 5AW5B 1JY2N 1JY3P 2J5UA 2NRGA 3MP7B 1SQBJ 1ZR4A 1Q2NA 3LW5H 5AW7B 2KLVA 1A02J 1L4AC 3RK2C 4RJTA 4D6TG 3O6QB 5AVTB 2Y9ZA 1LP1B 2C0XA 2VRSA 3RL0g 2Q9IA 3H1LJ 3FGAD 1ZXGA 2KNCB 1D7MA 3CMAP 4EDFA 1CI6B 4N78E 1VQLP 3HD7B 3AE2C 2G8YA 3L72G 3A0HH 2AEMA 1M8OB 1SQQJ 1SQVD 2BCCE 2PRRA 2OTJP 2D2CC 1SQPG 4WY4A 5CBOA 2J59M 3CCEP 2ITAA 4BRYA 3SWKA 1JEKA 1P84H 3Q1MA 3H1JJ 3CX5D 1RQVA 5CJ0A 1KYOH 3B5NC 2IYOA 2C9LY 1LTTC 2M3EA 1VQPP 1QVGO 1Q90D 2JDIH 2WVRA 3L72D 4ASWA 3KPEA 1IFPA 2QG4A 2P67A 3N4XA 3FX0A 1OVVA 4PD4D 1BE3D 2RN0A 2N1TB 2IBZI 3GLMA 1SQBD 4MN4C 1SQQE 3CX5H 1P84I 1ZN5A 2MKVA 2Q3IA 1KB9I 5KLIC 1FZCC 1OIPA 1K73Q 1L2PA 2PP6A 3KYQA 4H0LD 5TJHA 1SQPJ 2ZXXA 3TNUA 1SQQD 2NPSA 1ZP0C 5KAIE 3VOPA 1W2EA 4PV1C 4C46A 3WU2H 1NTMJ 1RE3A 3HE5B 2E76D 4L73A 5AVVB 1NAFA 3SFEC 3G9RA 2IDBA 4I7ZC 4JPZB 4K35A 3OJAB 3IF4A 1SQBG 4XE5B 3GW6A 1KMIZ 4UB8E 4EYYQ 5BU5A 1SFCB 2WTYA 1M57D 3CWBJ 2E74D 3EFFK 3MD0A 1HVVA 2WSFJ 1SQXG 2YKPA 3RK2D 1JM0A 1EC5A 2YO2A 1NTKE 1N7LA 1KILB 4WY4B 5B5EE 3D6ZA 1YITP 1KC8Q 1KFNA 3H1LG 3A2AA 2YMYA 1QL1A 2H88C 4PD4H 3PTZA 1P84E 5APWA 2WPRA 1NTZE 2MJZA 2WSEH 2KK7A 3V6IA 4OGQB 1XTGB 1DIPA 1OFCX 1G2CB 1AQTA 2OQQA 2V4HA 5CMZA 1FDIA 1QLED 1SQQG 3HD7A 4H44D 3L72E 1QVFO 1AFOA 2KYVA 1EDJA 1NU1G 3L74G 4GT1A 5APTA 1NTZD 1VPCA 1AQ5A 1NTMG 1KQLA 1JNMA 2XNXA 3VMAA 4Z1MH 1DD3A 1T2KD 3CCLP 1JMBA 4JBZA 3KQGA 3EWKA 3LIDA 4C7NB 3B8EB 3H6PA 1IZNB 1RE4C 1SQXD 1VDFA 3KXDA 2JO1A 2FXOA 2BEQD 1NTKJ 3K5BA 1JY2P 1M7LA 5BU8B 1YJWP 1J1DC 2L91A 3L73J 2WQYC 2JEEA 2ZFCA 1LTBC 2YO3A 2PFXA 3GHGB 3M9BA 1SQPK 2LR2A 3MUDC 3WU2E 4GOFA 1MFTA 3JCUH 1NTMD 3L73E 3M9HA 3H1JE 3SWFA 1HTLC 1GU5A 3CMEP 1OWAA 3VYIA 3L70G 5KAFE 2IPPA 2QVAA 1RF1B 2K1AA 1LJ2A 4H13D 3L4FA 4D6TE 1URQC 5K5GB 1SQVE 1H88A 1FOSF 2Y0DA 3D70A 1FZCB 2OYIB 1A02F 2HODA 1MZ9A 2W6AA 3C1LA 2B87B 1JO5A 3PHLA 3CWBG 3AEBC 3LIEA 1T8ZA 2WSFH 1BDCA 1SQXJ 1OW8A 2CPSA 4HKZH 5KKZB 1H0TA 3VMZA 4BWNA 1G1IA 1VQMP 3L72J 1S9KD 3CC4P 2WPVB 3T97B 4ZMDA 3G6EP 1N73C 3L70D 3V2PA 2KIKA 2GUSA 2QJKC 1NTZJ 3AE9C 1RF1A 2FXMA 1NTZK 5DJUB 4AUWA 2UWJE 1S9KE 2WSCH 1GMJA 2Y0CA 3L71J 1SFCA 2K9JA 2FYNB 1HJ0A 4OH8B 1PV3A 1XTCC 4U3FE 4Y99C 2KP8A 1ZR2A 1T6AA 2M8RA 3A0HE 1N8RQ 1N7SD 3HUSC 1FZEA 2A06G 3LW5J 5CCGC 2YIUB 2E42A 1KYOD 1HUCA 3ITKA 2K37A 4IFMA 5AW9B 1N2DC 1AVOA 1LT9B 4H13B 1SQXE 2D2CB 2YNYA 2ZT9B 3ABVC 2YIUC 4R4LA 4YXDC 1KV4A 3BRTB 4N6JA 1X0TA 4NPFX 2J58A 4DJGA 1M1JB 3ZDMA 1KYOE 3H25A 1T3JA 1PFIA 1EZVE 1SS1A 2YKOA 4N3YB 4RKUJ 1KQSO 1LGHB 2H43A 1KQFB 2GUVA 3CPWO 2ZT9C 5L8RJ 3MHVA 1L0NJ 3P8CD 2B89A 1LNQA 3N7NA 1LTSC 1R8EA 1PL5A 1IK7A 1P84D 1GL2D 1S1CX 1RF0A 5AVZB 3VP8A 1VQ5P 1KN7A 1CW5A 2XU6A 2IZ1A 5AVSB 1PPJG 1R5LA 2FYUG 5E79E 2E75D 4GDOA 3L70E 3I55P 1LWUB 2FYUK 4AQRD 1CZQA 1M1JA 1E79H 2W6JH 5M1BA 3AEEC 2ZYDA 3V2NA 1EDKA 4HH2A 4GODA 1GL2C 1N73B 1GD2E 1IC2A 3VTPC 2CPBA 1URQB 4YTPC 1JCCA 1LTGC 3H1KE 4JQ0D 4OVNF 3TSIA 2N9YB 4DOJA 1DH3A 2WSCJ 5AVWB 1AA0A 1ZW0A 1K05A 2QJYC 1TU3F 2JKVA 2R5DA 2CK3H 2JR8A 2V7QJ 3B4SA 3BCCG 3UIAA 3W68A 1PZQA 2JJLA 1YJ9P 3L71G 3RBZA 2RMZA 4I1LA 2HPCB 3TK1A 5KTBA 1RHZB 3L71E 1EXJA 3NXSA 1BDDA 4K3AA 3IR9A 4AYCA 1KILD 1Y8AA 1YHQP 1M1KQ 1LTJA 1S2EA 2W8ZA 1NYHA 3I5CA 4KHXA 3OW2O 2H89C 3V5BA 3KHUA 2WPSA 3M0AA 5C39A 1EZVG 1L0NK 2O1JA 3L75G 3CD6P 1S5LE 3RL0D 1SFCD 4C7NA 1SQBK 1MV8A 1QL2A 1SQPD 1NTME 3L73D 3NMDA 2AXCA 2IBZE 5TISH 1N7SA 3PLNA 4ZKPA 2R44A 1FDOA 4WBAA 4IL6H 5GTHH 1Q86Q 1MFZA 1VQ7P 1YBKA 3CXHI 4PJ0H 2KNCA 2HLOA 3W67A 1NU1E 2Y0EA 1KILC 3JCUE 4IL6X 5H2FH 1YTZT 2P7JA 1GU4A 4W7YA 2FKWB 5KLVE 1RE3C 1J2JB 4OWFA 1SFCC 2C0WA 1FZBA 5KAFH 2KI7B 2KSJA 1SQBE 2ZYGA 3PP5A 3BVHA 3A3YB 2RKLA 2HFED 3RK3C 1SVFA 3L36A 1GL2A 1JY3N 2OYOA 2O1KA 3EQ2A 1BSHA 1LTJB 3PRJA 3V2RA 3CWBE 1AJYA 5AVQB 1PP9D 2Z5HA 1JOCA 1NH4A 1G1JA 2E74B 2NPSB 1NU1K 4A7PA 2QEXP 1HF9A 3E1IA 3GF3A 1JTHA 1NVOA 3H1LD 1PGPA 2XDJA 3USSA 4CPGA 2Q1KA 3L71D 1K8AQ 2HPCA 1N86A 1VQOP 5GTHE 4IL6E 5AW4B 2KSEA 2R3CA 2K88A 3GF7A 5APUA 5KLIB 3O8ZA 2OYHA 1SQQK 3MUDA 4R4MA 2R3SA 3TGUE 1DD4A 1L0NG 4NPEA 2NZ2A 5B66E 3RK3D 2O3JA 2A45H 2KLUA 1L0LK 2AEJA 3CCSP 2OTLP 1KILA 2ZAEB 2E75C 3AE3C 2N1TD 2Q7CA 3CCVP 2A45G 5KLVJ 1BCCJ 1U7MA 4IFDK 5AW1B 2P10A 2ZXEB 3SWYA 2Q6QA 5CCGD 3P8MC 4XA4A 3GMAA 1U7JA 3IFMA 1NOHA 1VQ6P 1DX7A 5BVZA 1N7SC 4M3LA 1PIXA 5AVYB 3H1HD 3RK2B 1NTKK 3AEAC 2R32A 4W80A 3MTUE 4Y99B 1S5LH 3TNUB 1JUNA 1ZRTE 5APSA 2Q5UA 3H1LE 5CCHC 1HJBA 1SQVK 1Y9BA 5TISE 1J1EB 3CX5I 1X9VA 1KB9H 4LC1A 3RBXA 3EFGA 1IFJA 1S5LX 3AE7C 5APQA 1FZGA 1ZMEC 1RH5B 2N1TA 3L70J 1OW7A 1E5WA 3CWBD 4Y28J 1EQ7A 2FYNC 1BCCG 4L75A 3A0BH 3WUUA 4DZOA 2I8DA
chains in the Genus database with same CATH topology
2Q6QA 3WUTA 4BRYB 3F5HA 3E1RA 2ZXXA 3WUVA 2WVRA 4BRYA 3WUUA 1UIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q6Q A;  3WUT A;  4BRY B;  3F5H A;  3E1R A;  2ZXX A;  3WUV A;  2WVR A;  4BRY A;  3WUU A;  1UII A; 
#chains in the Genus database with same CATH topology
 5CCG A;  1L0N E;  1KIL E;  2KS1 A;  1SLQ A;  1FS0 E;  2K9Y A;  1CI6 A;  3PJS K;  4EOT A;  1PPJ E;  3CLQ A;  1KYO I;  3NFQ A;  1EXI A;  2E43 A;  2B9B A;  5EFW B;  2KOG A;  2Y9Y A;  3U1A A;  4YPC A;  2D2C D;  2KS1 B;  1JY3 O;  2N9B A;  4QMA A;  3M91 A;  1USD A;  2WSS H;  1BE3 J;  3RK3 B;  3Q2Y A;  3VMX A;  1T3U A;  1EDL A;  1VQN P;  5KLV K;  3CCR P;  1IK9 A;  3BAS A;  1J1D B;  3BRV B;  3HE4 A;  1LTJ C;  2O01 H;  3Q3D A;  3F5H A;  5KLV G;  3I56 P;  1HH0 A;  2Z5I A;  4WB4 A;  1X22 A;  2OGU A;  1KQG B;  4TLF A;  3CXH H;  2WT7 A;  1YJN P;  3GHG C;  3WMM 0;  3L75 E;  3CCJ P;  1ZV8 A;  4U3F G;  5AW6 B;  3P32 A;  4KT0 J;  1FBM A;  2OAR A;  3P7K A;  1LTA C;  3L35 A;  3A0B E;  1EZV D;  2FY8 A;  3L75 D;  5GTI E;  2LKM A;  1DEE G;  1IFD A;  1NO4 A;  3MZW B;  3P8C E;  3S4R A;  1BCC E;  1H89 A;  2BAS A;  2OTK E;  4NPD A;  3A7O A;  4B86 A;  4I6M C;  4UB8 H;  3U1C A;  2GM4 A;  3SSU A;  1PPJ D;  2ZVO B;  4KJM A;  3U59 A;  1NGM B;  3BCC E;  2FYU J;  1BGY G;  3CL3 D;  1OXZ A;  5B5E H;  1FJK A;  3R4Y A;  2C9N Y;  1IFM A;  1JB0 J;  1WRG A;  3TGU J;  3HRN A;  3CC7 P;  2E5Y A;  2QSI A;  3C9I A;  2P2U A;  4OGQ C;  1FOS E;  1SQV G;  2QE7 H;  2ZT9 D;  1USE A;  2E76 C;  2WSE J;  4U3F J;  1VF5 B;  2IZ0 A;  2XND H;  3B71 A;  4LLH A;  2OYH C;  1LT1 A;  4PV1 D;  3AEG C;  4L74 A;  5KJ7 C;  3BAT A;  1HGZ A;  1OZH A;  2QJY B;  3H1J G;  2W90 A;  4H0L C;  2M5A B;  4IOI H;  1JTH B;  1PGQ A;  1Z56 A;  2KZI A;  3R2P A;  3D71 A;  3CCM P;  3RK3 E;  3Q5R A;  3AE5 C;  1NJI Q;  3V4Q A;  3H1I J;  3H1K G;  3BCC J;  1M56 D;  2FXP A;  2IYP A;  2POH A;  3CXH E;  3HTK B;  1BGY D;  1CSB A;  1FE6 A;  1BE3 E;  3A5T A;  1L0L D;  4RO0 A;  4YXW H;  1PP9 E;  3WUV A;  4PV1 B;  1URQ A;  1W2B O;  2KZJ A;  2O01 J;  1IFN A;  2GA1 A;  3CXH D;  3HTK A;  4O9B A;  3TGU G;  3OAK A;  1BGY E;  4JF7 A;  1DEB A;  4DCK A;  2QA4 P;  3B5N D;  5CBN A;  1SQV J;  5CJ4 A;  1LT9 A;  1Y47 A;  1GL2 B;  1EZV I;  1AV1 A;  1ZOY C;  2WIT A;  3PH0 A;  2HR3 A;  4GIF A;  4XFJ A;  5AVX B;  1OX3 A;  3RL0 C;  2WT7 B;  1OW6 A;  2L5G B;  3L75 J;  3H1J D;  3M0D A;  2FFD B;  3M9Q A;  2DW3 A;  2W6B A;  3G71 P;  2WZ7 A;  1MKM A;  2FYU E;  4D6T D;  1NWQ A;  3S1K A;  3M06 A;  3C8V A;  5APX A;  4DT0 A;  3TGU D;  3B5N B;  4TT3 H;  1M1J C;  3E1R A;  1JY2 O;  1KFM A;  1AVY A;  1RE4 A;  2Q3E A;  1FC2 C;  1N7S B;  2IFM A;  2QM7 A;  5E79 H;  4C7R A;  1URQ D;  2OYI A;  1PP9 J;  5CHX A;  4H13 C;  1BGY J;  1GW3 A;  1WT6 A;  1L0L J;  3BCC D;  3T97 A;  2LXC B;  3AE4 C;  1M90 Q;  1L4A D;  1RF0 C;  3O6Q A;  1FJP A;  1KB9 E;  3G4S P;  1KOR A;  3HUS B;  3RGU A;  2AEF A;  2ZYA A;  4WWI A;  1YQ3 C;  1QEX A;  4HB1 A;  3TDK A;  3HD7 C;  1VF5 D;  3L74 J;  2AXT E;  2HOD B;  1NKN A;  2P58 A;  2HG5 D;  1LT9 C;  4W7Z A;  5GTI H;  2FFD C;  2YXR B;  2ZJS E;  1OMI A;  2A06 E;  1BSN A;  2QJK B;  1WMK A;  4HYT B;  3RL0 B;  1L4A B;  2E75 B;  2R5B A;  2W83 C;  4ZKU A;  4ZNC A;  1FZF A;  1YI2 P;  1QX8 A;  5AVU B;  1GW4 A;  5APY A;  2KUB A;  2JWD A;  2IBZ G;  1VQ8 P;  1T2K C;  2IFN A;  3HUS A;  1HBW A;  1ZLL A;  1KZU B;  1BCC D;  1L4A A;  1S3J A;  1W5C E;  3FWL A;  1OVU A;  2WWW A;  3HE4 B;  1K9M Q;  3AEC C;  2JWA A;  1HWT C;  1KTM A;  1FAV A;  1NTM K;  5KJ7 A;  1VQK P;  2NPS C;  1EDI A;  1L0N D;  2I1J A;  3FXE A;  4H44 C;  4JYC A;  3S9O A;  1QGK B;  1OVR A;  1YTZ I;  2FYZ A;  2YKQ A;  1YIJ P;  3F89 A;  3H32 B;  5KKZ C;  1NHL A;  2W27 A;  1RF1 C;  1GK4 A;  4UB6 E;  1FZC A;  1N73 A;  1Q82 Q;  1FDM A;  2P1J A;  1SQP E;  2YMK A;  2YXQ B;  4PD4 I;  3CX5 E;  1KD1 Q;  2IBZ D;  1VQ4 P;  3TYY A;  1Q7Y Q;  2OYI C;  1NTK D;  2M0B A;  2E76 B;  1KB9 D;  3AE1 C;  1LWU A;  2E74 C;  1GDT A;  1SQX K;  1FU1 A;  2HYN A;  3L37 A;  4PJ0 E;  4BXL A;  3GG2 A;  2PAJ A;  1IFI A;  2BCC D;  3G3Z A;  1JCD A;  3JC2 2;  4H0L B;  1IO4 A;  4GOE A;  1G2C A;  5AW3 B;  3B5N A;  3TF5 A;  1NU1 D;  3IN6 A;  1PP9 G;  3H1I D;  5H2F E;  4EIJ A;  2IX7 C;  2QJP B;  1VF5 C;  1H8A A;  3M0D C;  5KAI H;  1R5S A;  2XKM A;  5APV A;  3VP9 A;  2QM8 A;  3L74 D;  3WUT A;  1NTZ G;  3JSV C;  2FFD A;  2K3R A;  3HE5 A;  3II6 A;  2WPQ A;  2ZVN B;  3OA7 A;  1PGJ A;  1GZL A;  1UII A;  2I1K A;  1VQ9 P;  4PD4 E;  3L74 E;  2BCC G;  2XV5 A;  3KZI H;  1ZRT D;  2BEZ F;  1YQ4 C;  2M3B A;  3AED C;  1NKZ B;  5AW2 B;  3CCQ P;  2OYH B;  2H7H A;  2O01 N;  4D6T J;  3H1I G;  3H1K J;  3Q5S A;  2A06 D;  3FXD A;  5AW8 B;  1S72 P;  4RES B;  2PGD A;  3Q5P A;  1RY3 A;  1LTI C;  3AE8 C;  1L0L E;  4HJG H;  1UIX A;  4EI2 A;  2K9J B;  3D6Y A;  4JYB A;  2Z4E A;  2B88 A;  1SP4 A;  2XZR A;  3VN0 A;  1Q81 Q;  2M5A A;  4GKG A;  3V4W A;  1X8Y A;  4I2L C;  5DJT B;  2SPZ A;  2FBW C;  1IJD B;  4BRY B;  3CC2 P;  5CCH D;  4ASV A;  1RQU A;  2AXT H;  2QJP C;  4WVZ A;  2V7Q H;  1U57 A;  1NU1 J;  2E5T A;  2KB7 P;  2KXP B;  4U7J A;  4WY4 C;  1K04 A;  3MGN A;  4N78 D;  2B87 A;  2BCC J;  1NAY A;  3VMY A;  5B66 H;  3CI9 A;  1PGO A;  2LXB A;  2NPS D;  3AE6 C;  3H1H G;  4IFF A;  2JP3 A;  1JMM A;  1H0T B;  2FYU D;  1BE3 G;  1HGV A;  3QH9 A;  4I7Z B;  1LP1 A;  3IAO A;  3QWO C;  3NTN A;  1X79 B;  3SFD C;  2N1T C;  1NTK G;  1YYC A;  3CCU P;  5KLV D;  2RH0 A;  2QRX A;  1L0L G;  1LWU C;  2A45 I;  3E7K A;  3H32 A;  3L73 G;  5KJ7 D;  5AW0 B;  3H1K D;  4H44 B;  1S4X A;  3KZI E;  2G3A A;  3H1I E;  3V2Q A;  5CCH A;  3H1H E;  2H8P D;  3KDP B;  4OGQ D;  1FZA A;  4U3F D;  1VL2 A;  5AVR B;  3GHG A;  4UB6 H;  4LGD E;  1GTW A;  1J1E C;  3FWN A;  4WY4 D;  1GK6 A;  3HD7 D;  2QIW A;  3AEF C;  3MIW A;  4L76 A;  2WMM A;  1MUU A;  3H1H J;  5AW5 B;  1JY2 N;  1JY3 P;  2J5U A;  2NRG A;  3MP7 B;  1SQB J;  1ZR4 A;  1Q2N A;  3LW5 H;  5AW7 B;  2KLV A;  1A02 J;  1L4A C;  3RK2 C;  4RJT A;  4D6T G;  3O6Q B;  5AVT B;  2Y9Z A;  1LP1 B;  2C0X A;  2VRS A;  3RL0 g;  2Q9I A;  3H1L J;  3FGA D;  1ZXG A;  2KNC B;  1D7M A;  3CMA P;  4EDF A;  1CI6 B;  4N78 E;  1VQL P;  3HD7 B;  3AE2 C;  2G8Y A;  3L72 G;  3A0H H;  2AEM A;  1M8O B;  1SQQ J;  1SQV D;  2BCC E;  2PRR A;  2OTJ P;  2D2C C;  1SQP G;  4WY4 A;  5CBO A;  2J59 M;  3CCE P;  2ITA A;  4BRY A;  3SWK A;  1JEK A;  1P84 H;  3Q1M A;  3H1J J;  3CX5 D;  1RQV A;  5CJ0 A;  1KYO H;  3B5N C;  2IYO A;  2C9L Y;  1LTT C;  2M3E A;  1VQP P;  1QVG O;  1Q90 D;  2JDI H;  2WVR A;  3L72 D;  4ASW A;  3KPE A;  1IFP A;  2QG4 A;  2P67 A;  3N4X A;  3FX0 A;  1OVV A;  4PD4 D;  1BE3 D;  2RN0 A;  2N1T B;  2IBZ I;  3GLM A;  1SQB D;  4MN4 C;  1SQQ E;  3CX5 H;  1P84 I;  1ZN5 A;  2MKV A;  2Q3I A;  1KB9 I;  5KLI C;  1FZC C;  1OIP A;  1K73 Q;  1L2P A;  2PP6 A;  3KYQ A;  4H0L D;  5TJH A;  1SQP J;  2ZXX A;  3TNU A;  1SQQ D;  2NPS A;  1ZP0 C;  5KAI E;  3VOP A;  1W2E A;  4PV1 C;  4C46 A;  3WU2 H;  1NTM J;  1RE3 A;  3HE5 B;  2E76 D;  4L73 A;  5AVV B;  1NAF A;  3SFE C;  3G9R A;  2IDB A;  4I7Z C;  4JPZ B;  4K35 A;  3OJA B;  3IF4 A;  1SQB G;  4XE5 B;  3GW6 A;  1KMI Z;  4UB8 E;  4EYY Q;  5BU5 A;  1SFC B;  2WTY A;  1M57 D;  3CWB J;  2E74 D;  3EFF K;  3MD0 A;  1HVV A;  2WSF J;  1SQX G;  2YKP A;  3RK2 D;  1JM0 A;  1EC5 A;  2YO2 A;  1NTK E;  1N7L A;  1KIL B;  4WY4 B;  5B5E E;  3D6Z A;  1YIT P;  1KC8 Q;  1KFN A;  3H1L G;  3A2A A;  2YMY A;  1QL1 A;  2H88 C;  4PD4 H;  3PTZ A;  1P84 E;  5APW A;  2WPR A;  1NTZ E;  2MJZ A;  2WSE H;  2KK7 A;  3V6I A;  4OGQ B;  1XTG B;  1DIP A;  1OFC X;  1G2C B;  1AQT A;  2OQQ A;  2V4H A;  5CMZ A;  1FDI A;  1QLE D;  1SQQ G;  3HD7 A;  4H44 D;  3L72 E;  1QVF O;  1AFO A;  2KYV A;  1EDJ A;  1NU1 G;  3L74 G;  4GT1 A;  5APT A;  1NTZ D;  1VPC A;  1AQ5 A;  1NTM G;  1KQL A;  1JNM A;  2XNX A;  3VMA A;  4Z1M H;  1DD3 A;  1T2K D;  3CCL P;  1JMB A;  4JBZ A;  3KQG A;  3EWK A;  3LID A;  4C7N B;  3B8E B;  3H6P A;  1IZN B;  1RE4 C;  1SQX D;  1VDF A;  3KXD A;  2JO1 A;  2FXO A;  2BEQ D;  1NTK J;  3K5B A;  1JY2 P;  1M7L A;  5BU8 B;  1YJW P;  1J1D C;  2L91 A;  3L73 J;  2WQY C;  2JEE A;  2ZFC A;  1LTB C;  2YO3 A;  2PFX A;  3GHG B;  3M9B A;  1SQP K;  2LR2 A;  3MUD C;  3WU2 E;  4GOF A;  1MFT A;  3JCU H;  1NTM D;  3L73 E;  3M9H A;  3H1J E;  3SWF A;  1HTL C;  1GU5 A;  3CME P;  1OWA A;  3VYI A;  3L70 G;  5KAF E;  2IPP A;  2QVA A;  1RF1 B;  2K1A A;  1LJ2 A;  4H13 D;  3L4F A;  4D6T E;  1URQ C;  5K5G B;  1SQV E;  1H88 A;  1FOS F;  2Y0D A;  3D70 A;  1FZC B;  2OYI B;  1A02 F;  2HOD A;  1MZ9 A;  2W6A A;  3C1L A;  2B87 B;  1JO5 A;  3PHL A;  3CWB G;  3AEB C;  3LIE A;  1T8Z A;  2WSF H;  1BDC A;  1SQX J;  1OW8 A;  2CPS A;  4HKZ H;  5KKZ B;  1H0T A;  3VMZ A;  4BWN A;  1G1I A;  1VQM P;  3L72 J;  1S9K D;  3CC4 P;  2WPV B;  3T97 B;  4ZMD A;  3G6E P;  1N73 C;  3L70 D;  3V2P A;  2KIK A;  2GUS A;  2QJK C;  1NTZ J;  3AE9 C;  1RF1 A;  2FXM A;  1NTZ K;  5DJU B;  4AUW A;  2UWJ E;  1S9K E;  2WSC H;  1GMJ A;  2Y0C A;  3L71 J;  1SFC A;  2K9J A;  2FYN B;  1HJ0 A;  4OH8 B;  1PV3 A;  1XTC C;  4U3F E;  4Y99 C;  2KP8 A;  1ZR2 A;  1T6A A;  2M8R A;  3A0H E;  1N8R Q;  1N7S D;  3HUS C;  1FZE A;  2A06 G;  3LW5 J;  5CCG C;  2YIU B;  2E42 A;  1KYO D;  1HUC A;  3ITK A;  2K37 A;  4IFM A;  5AW9 B;  1N2D C;  1AVO A;  1LT9 B;  4H13 B;  1SQX E;  2D2C B;  2YNY A;  2ZT9 B;  3ABV C;  2YIU C;  4R4L A;  4YXD C;  1KV4 A;  3BRT B;  4N6J A;  1X0T A;  4NPF X;  2J58 A;  4DJG A;  1M1J B;  3ZDM A;  1KYO E;  3H25 A;  1T3J A;  1PFI A;  1EZV E;  1SS1 A;  2YKO A;  4N3Y B;  4RKU J;  1KQS O;  1LGH B;  2H43 A;  1KQF B;  2GUV A;  3CPW O;  2ZT9 C;  5L8R J;  3MHV A;  1L0N J;  3P8C D;  2B89 A;  1LNQ A;  3N7N A;  1LTS C;  1R8E A;  1PL5 A;  1IK7 A;  1P84 D;  1GL2 D;  1S1C X;  1RF0 A;  5AVZ B;  3VP8 A;  1VQ5 P;  1KN7 A;  1CW5 A;  2XU6 A;  2IZ1 A;  5AVS B;  1PPJ G;  1R5L A;  2FYU G;  5E79 E;  2E75 D;  4GDO A;  3L70 E;  3I55 P;  1LWU B;  2FYU K;  4AQR D;  1CZQ A;  1M1J A;  1E79 H;  2W6J H;  5M1B A;  3AEE C;  2ZYD A;  3V2N A;  1EDK A;  4HH2 A;  4GOD A;  1GL2 C;  1N73 B;  1GD2 E;  1IC2 A;  3VTP C;  2CPB A;  1URQ B;  4YTP C;  1JCC A;  1LTG C;  3H1K E;  4JQ0 D;  4OVN F;  3TSI A;  2N9Y B;  4DOJ A;  1DH3 A;  2WSC J;  5AVW B;  1AA0 A;  1ZW0 A;  1K05 A;  2QJY C;  1TU3 F;  2JKV A;  2R5D A;  2CK3 H;  2JR8 A;  2V7Q J;  3B4S A;  3BCC G;  3UIA A;  3W68 A;  1PZQ A;  2JJL A;  1YJ9 P;  3L71 G;  3RBZ A;  2RMZ A;  4I1L A;  2HPC B;  3TK1 A;  5KTB A;  1RHZ B;  3L71 E;  1EXJ A;  3NXS A;  1BDD A;  4K3A A;  3IR9 A;  4AYC A;  1KIL D;  1Y8A A;  1YHQ P;  1M1K Q;  1LTJ A;  1S2E A;  2W8Z A;  1NYH A;  3I5C A;  4KHX A;  3OW2 O;  2H89 C;  3V5B A;  3KHU A;  2WPS A;  3M0A A;  5C39 A;  1EZV G;  1L0N K;  2O1J A;  3L75 G;  3CD6 P;  1S5L E;  3RL0 D;  1SFC D;  4C7N A;  1SQB K;  1MV8 A;  1QL2 A;  1SQP D;  1NTM E;  3L73 D;  3NMD A;  2AXC A;  2IBZ E;  5TIS H;  1N7S A;  3PLN A;  4ZKP A;  2R44 A;  1FDO A;  4WBA A;  4IL6 H;  5GTH H;  1Q86 Q;  1MFZ A;  1VQ7 P;  1YBK A;  3CXH I;  4PJ0 H;  2KNC A;  2HLO A;  3W67 A;  1NU1 E;  2Y0E A;  1KIL C;  3JCU E;  4IL6 X;  5H2F H;  1YTZ T;  2P7J A;  1GU4 A;  4W7Y A;  2FKW B;  5KLV E;  1RE3 C;  1J2J B;  4OWF A;  1SFC C;  2C0W A;  1FZB A;  5KAF H;  2KI7 B;  2KSJ A;  1SQB E;  2ZYG A;  3PP5 A;  3BVH A;  3A3Y B;  2RKL A;  2HFE D;  3RK3 C;  1SVF A;  3L36 A;  1GL2 A;  1JY3 N;  2OYO A;  2O1K A;  3EQ2 A;  1BSH A;  1LTJ B;  3PRJ A;  3V2R A;  3CWB E;  1AJY A;  5AVQ B;  1PP9 D;  2Z5H A;  1JOC A;  1NH4 A;  1G1J A;  2E74 B;  2NPS B;  1NU1 K;  4A7P A;  2QEX P;  1HF9 A;  3E1I A;  3GF3 A;  1JTH A;  1NVO A;  3H1L D;  1PGP A;  2XDJ A;  3USS A;  4CPG A;  2Q1K A;  3L71 D;  1K8A Q;  2HPC A;  1N86 A;  1VQO P;  5GTH E;  4IL6 E;  5AW4 B;  2KSE A;  2R3C A;  2K88 A;  3GF7 A;  5APU A;  5KLI B;  3O8Z A;  2OYH A;  1SQQ K;  3MUD A;  4R4M A;  2R3S A;  3TGU E;  1DD4 A;  1L0N G;  4NPE A;  2NZ2 A;  5B66 E;  3RK3 D;  2O3J A;  2A45 H;  2KLU A;  1L0L K;  2AEJ A;  3CCS P;  2OTL P;  1KIL A;  2ZAE B;  2E75 C;  3AE3 C;  2N1T D;  2Q7C A;  3CCV P;  2A45 G;  5KLV J;  1BCC J;  1U7M A;  4IFD K;  5AW1 B;  2P10 A;  2ZXE B;  3SWY A;  2Q6Q A;  5CCG D;  3P8M C;  4XA4 A;  3GMA A;  1U7J A;  3IFM A;  1NOH A;  1VQ6 P;  1DX7 A;  5BVZ A;  1N7S C;  4M3L A;  1PIX A;  5AVY B;  3H1H D;  3RK2 B;  1NTK K;  3AEA C;  2R32 A;  4W80 A;  3MTU E;  4Y99 B;  1S5L H;  3TNU B;  1JUN A;  1ZRT E;  5APS A;  2Q5U A;  3H1L E;  5CCH C;  1HJB A;  1SQV K;  1Y9B A;  5TIS E;  1J1E B;  3CX5 I;  1X9V A;  1KB9 H;  4LC1 A;  3RBX A;  3EFG A;  1IFJ A;  1S5L X;  3AE7 C;  5APQ A;  1FZG A;  1ZME C;  1RH5 B;  2N1T A;  3L70 J;  1OW7 A;  1E5W A;  3CWB D;  4Y28 J;  1EQ7 A;  2FYN C;  1BCC G;  4L75 A;  3A0B H;  3WUU A;  4DZO A;  2I8D A; 
#chains in the Genus database with same CATH homology
 2Q6Q A;  3WUT A;  4BRY B;  3F5H A;  3E1R A;  2ZXX A;  3WUV A;  2WVR A;  4BRY A;  3WUU A;  1UII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...